data_4J1O
# 
_entry.id   4J1O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4J1O         
RCSB  RCSB077483   
WWPDB D_1000077483 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          NYSGRC-012907 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4J1O 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-01 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vetting, M.W.'                                             1  
'Toro, R.'                                                  2  
'Bhosle, R.'                                                3  
'Wasserman, S.R.'                                           4  
'Morisco, L.L.'                                             5  
'Sojitra, S.'                                               6  
'Chamala, S.'                                               7  
'Kar, A.'                                                   8  
'LaFleur, J.'                                               9  
'Villigas, G.'                                              10 
'Evans, B.'                                                 11 
'Hammonds, J.'                                              12 
'Gizzi, A.'                                                 13 
'Stead, M.'                                                 14 
'Hillerich, B.'                                             15 
'Love, J.'                                                  16 
'Seidel, R.D.'                                              17 
'Bonanno, J.B.'                                             18 
'Gerlt, J.A.'                                               19 
'Almo, S.C.'                                                20 
'New York Structural Genomics Research Consortium (NYSGRC)' 21 
# 
_citation.id                        primary 
_citation.title                     
'Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.' 
_citation.journal_abbrev            MBio 
_citation.journal_volume            5 
_citation.page_first                e00933 
_citation.page_last                 e00913 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2150-7511 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24520058 
_citation.pdbx_database_id_DOI      10.1128/mBio.00933-13 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kumar, R.'      1  
primary 'Zhao, S.'       2  
primary 'Vetting, M.W.'  3  
primary 'Wood, B.M.'     4  
primary 'Sakai, A.'      5  
primary 'Cho, K.'        6  
primary 'Solbiati, J.'   7  
primary 'Almo, S.C.'     8  
primary 'Sweedler, J.V.' 9  
primary 'Jacobson, M.P.' 10 
primary 'Gerlt, J.A.'    11 
primary 'Cronan, J.E.'   12 
# 
_cell.entry_id           4J1O 
_cell.length_a           117.297 
_cell.length_b           117.297 
_cell.length_c           110.528 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4J1O 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein' 41984.688 2   ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                                                             24.305    5   ? ? ? ? 
3 non-polymer syn 'IODIDE ION'                                                                126.904   11  ? ? ? ? 
4 non-polymer syn GLYCEROL                                                                    92.094    1   ? ? ? ? 
5 non-polymer syn 1,1-DIMETHYL-PROLINIUM                                                      144.192   2   ? ? ? ? 
6 water       nat water                                                                       18.015    689 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVGPTYAP
SHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYAT
GIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVL
EQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGG
DIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVGPTYAP
SHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYAT
GIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVL
EQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGG
DIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         NYSGRC-012907 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  LYS n 
1 25  ILE n 
1 26  ALA n 
1 27  GLU n 
1 28  ILE n 
1 29  HIS n 
1 30  VAL n 
1 31  TYR n 
1 32  ALA n 
1 33  HIS n 
1 34  ASP n 
1 35  LEU n 
1 36  PRO n 
1 37  VAL n 
1 38  LYS n 
1 39  ASP n 
1 40  GLY n 
1 41  PRO n 
1 42  TYR n 
1 43  THR n 
1 44  ILE n 
1 45  ALA n 
1 46  SER n 
1 47  SER n 
1 48  THR n 
1 49  VAL n 
1 50  TRP n 
1 51  SER n 
1 52  LEU n 
1 53  GLN n 
1 54  THR n 
1 55  THR n 
1 56  LEU n 
1 57  VAL n 
1 58  LYS n 
1 59  ILE n 
1 60  VAL n 
1 61  ALA n 
1 62  ASP n 
1 63  SER n 
1 64  GLY n 
1 65  LEU n 
1 66  ALA n 
1 67  GLY n 
1 68  TRP n 
1 69  GLY n 
1 70  GLU n 
1 71  THR n 
1 72  CYS n 
1 73  PRO n 
1 74  VAL n 
1 75  GLY n 
1 76  PRO n 
1 77  THR n 
1 78  TYR n 
1 79  ALA n 
1 80  PRO n 
1 81  SER n 
1 82  HIS n 
1 83  ALA n 
1 84  LEU n 
1 85  GLY n 
1 86  ALA n 
1 87  ARG n 
1 88  ALA n 
1 89  ALA n 
1 90  LEU n 
1 91  ALA n 
1 92  GLU n 
1 93  MET n 
1 94  ALA n 
1 95  PRO n 
1 96  GLY n 
1 97  LEU n 
1 98  ILE n 
1 99  GLY n 
1 100 ALA n 
1 101 ASN n 
1 102 PRO n 
1 103 LEU n 
1 104 GLN n 
1 105 PRO n 
1 106 LEU n 
1 107 VAL n 
1 108 LEU n 
1 109 ARG n 
1 110 ARG n 
1 111 ARG n 
1 112 MET n 
1 113 ASP n 
1 114 GLY n 
1 115 LEU n 
1 116 LEU n 
1 117 CYS n 
1 118 GLY n 
1 119 HIS n 
1 120 ASN n 
1 121 TYR n 
1 122 ALA n 
1 123 LYS n 
1 124 ALA n 
1 125 ALA n 
1 126 ILE n 
1 127 ASP n 
1 128 ILE n 
1 129 ALA n 
1 130 ALA n 
1 131 TYR n 
1 132 ASP n 
1 133 LEU n 
1 134 MET n 
1 135 GLY n 
1 136 LYS n 
1 137 HIS n 
1 138 TYR n 
1 139 GLY n 
1 140 VAL n 
1 141 ARG n 
1 142 VAL n 
1 143 ALA n 
1 144 ASP n 
1 145 LEU n 
1 146 LEU n 
1 147 GLY n 
1 148 GLY n 
1 149 VAL n 
1 150 ALA n 
1 151 ALA n 
1 152 GLU n 
1 153 ARG n 
1 154 VAL n 
1 155 PRO n 
1 156 SER n 
1 157 TYR n 
1 158 TYR n 
1 159 ALA n 
1 160 THR n 
1 161 GLY n 
1 162 ILE n 
1 163 GLY n 
1 164 GLN n 
1 165 PRO n 
1 166 ASP n 
1 167 GLU n 
1 168 ILE n 
1 169 ALA n 
1 170 ARG n 
1 171 ILE n 
1 172 ALA n 
1 173 ALA n 
1 174 GLU n 
1 175 LYS n 
1 176 VAL n 
1 177 ALA n 
1 178 GLU n 
1 179 GLY n 
1 180 PHE n 
1 181 PRO n 
1 182 ARG n 
1 183 LEU n 
1 184 GLN n 
1 185 ILE n 
1 186 LYS n 
1 187 ILE n 
1 188 GLY n 
1 189 GLY n 
1 190 ARG n 
1 191 PRO n 
1 192 VAL n 
1 193 GLU n 
1 194 ILE n 
1 195 ASP n 
1 196 ILE n 
1 197 GLU n 
1 198 THR n 
1 199 VAL n 
1 200 ARG n 
1 201 LYS n 
1 202 VAL n 
1 203 TRP n 
1 204 GLU n 
1 205 ARG n 
1 206 ILE n 
1 207 ARG n 
1 208 GLY n 
1 209 THR n 
1 210 GLY n 
1 211 THR n 
1 212 ARG n 
1 213 LEU n 
1 214 ALA n 
1 215 VAL n 
1 216 ASP n 
1 217 GLY n 
1 218 ASN n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PRO n 
1 223 SER n 
1 224 ARG n 
1 225 ASP n 
1 226 ALA n 
1 227 LEU n 
1 228 ARG n 
1 229 LEU n 
1 230 SER n 
1 231 ARG n 
1 232 GLU n 
1 233 CYS n 
1 234 PRO n 
1 235 GLU n 
1 236 ILE n 
1 237 PRO n 
1 238 PHE n 
1 239 VAL n 
1 240 LEU n 
1 241 GLU n 
1 242 GLN n 
1 243 PRO n 
1 244 CYS n 
1 245 ASN n 
1 246 THR n 
1 247 LEU n 
1 248 GLU n 
1 249 GLU n 
1 250 ILE n 
1 251 ALA n 
1 252 ALA n 
1 253 ILE n 
1 254 ARG n 
1 255 GLY n 
1 256 ARG n 
1 257 VAL n 
1 258 GLN n 
1 259 HIS n 
1 260 GLY n 
1 261 ILE n 
1 262 TYR n 
1 263 LEU n 
1 264 ASP n 
1 265 GLU n 
1 266 SER n 
1 267 GLY n 
1 268 GLU n 
1 269 ASP n 
1 270 LEU n 
1 271 SER n 
1 272 THR n 
1 273 VAL n 
1 274 ILE n 
1 275 ARG n 
1 276 ALA n 
1 277 ALA n 
1 278 GLY n 
1 279 GLN n 
1 280 GLY n 
1 281 LEU n 
1 282 CYS n 
1 283 ASP n 
1 284 GLY n 
1 285 PHE n 
1 286 GLY n 
1 287 MET n 
1 288 LYS n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 ILE n 
1 293 GLY n 
1 294 GLY n 
1 295 LEU n 
1 296 GLN n 
1 297 GLN n 
1 298 MET n 
1 299 ALA n 
1 300 ALA n 
1 301 PHE n 
1 302 ARG n 
1 303 ASP n 
1 304 ILE n 
1 305 CYS n 
1 306 GLU n 
1 307 ALA n 
1 308 ARG n 
1 309 ALA n 
1 310 LEU n 
1 311 PRO n 
1 312 HIS n 
1 313 SER n 
1 314 CYS n 
1 315 ASP n 
1 316 ASP n 
1 317 ALA n 
1 318 TRP n 
1 319 GLY n 
1 320 GLY n 
1 321 ASP n 
1 322 ILE n 
1 323 ILE n 
1 324 ALA n 
1 325 ALA n 
1 326 ALA n 
1 327 CYS n 
1 328 THR n 
1 329 HIS n 
1 330 ILE n 
1 331 GLY n 
1 332 ALA n 
1 333 THR n 
1 334 VAL n 
1 335 GLN n 
1 336 PRO n 
1 337 ARG n 
1 338 LEU n 
1 339 ASN n 
1 340 GLU n 
1 341 GLY n 
1 342 VAL n 
1 343 TRP n 
1 344 VAL n 
1 345 ALA n 
1 346 GLN n 
1 347 PRO n 
1 348 TYR n 
1 349 ILE n 
1 350 ALA n 
1 351 GLN n 
1 352 PRO n 
1 353 TYR n 
1 354 ASP n 
1 355 GLU n 
1 356 GLU n 
1 357 ASN n 
1 358 GLY n 
1 359 ILE n 
1 360 ARG n 
1 361 ILE n 
1 362 ALA n 
1 363 GLY n 
1 364 GLY n 
1 365 HIS n 
1 366 ILE n 
1 367 ASP n 
1 368 LEU n 
1 369 PRO n 
1 370 LYS n 
1 371 GLY n 
1 372 PRO n 
1 373 GLY n 
1 374 LEU n 
1 375 GLY n 
1 376 ILE n 
1 377 THR n 
1 378 PRO n 
1 379 ASP n 
1 380 GLU n 
1 381 SER n 
1 382 LEU n 
1 383 PHE n 
1 384 GLY n 
1 385 PRO n 
1 386 PRO n 
1 387 VAL n 
1 388 ALA n 
1 389 SER n 
1 390 PHE n 
1 391 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    PD1222 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Paracoccus denitrificans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     318586 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A1B198_PARDP 
_struct_ref.pdbx_db_accession          A1B198 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANP
LQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPR
LQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIY
LDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGV
WVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4J1O A 23 ? 391 ? A1B198 1 ? 369 ? 1 369 
2 1 4J1O B 23 ? 391 ? A1B198 1 ? 369 ? 1 369 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4J1O MET A 1  ? UNP A1B198 ? ? 'EXPRESSION TAG' -21 1  
1 4J1O HIS A 2  ? UNP A1B198 ? ? 'EXPRESSION TAG' -20 2  
1 4J1O HIS A 3  ? UNP A1B198 ? ? 'EXPRESSION TAG' -19 3  
1 4J1O HIS A 4  ? UNP A1B198 ? ? 'EXPRESSION TAG' -18 4  
1 4J1O HIS A 5  ? UNP A1B198 ? ? 'EXPRESSION TAG' -17 5  
1 4J1O HIS A 6  ? UNP A1B198 ? ? 'EXPRESSION TAG' -16 6  
1 4J1O HIS A 7  ? UNP A1B198 ? ? 'EXPRESSION TAG' -15 7  
1 4J1O SER A 8  ? UNP A1B198 ? ? 'EXPRESSION TAG' -14 8  
1 4J1O SER A 9  ? UNP A1B198 ? ? 'EXPRESSION TAG' -13 9  
1 4J1O GLY A 10 ? UNP A1B198 ? ? 'EXPRESSION TAG' -12 10 
1 4J1O VAL A 11 ? UNP A1B198 ? ? 'EXPRESSION TAG' -11 11 
1 4J1O ASP A 12 ? UNP A1B198 ? ? 'EXPRESSION TAG' -10 12 
1 4J1O LEU A 13 ? UNP A1B198 ? ? 'EXPRESSION TAG' -9  13 
1 4J1O GLY A 14 ? UNP A1B198 ? ? 'EXPRESSION TAG' -8  14 
1 4J1O THR A 15 ? UNP A1B198 ? ? 'EXPRESSION TAG' -7  15 
1 4J1O GLU A 16 ? UNP A1B198 ? ? 'EXPRESSION TAG' -6  16 
1 4J1O ASN A 17 ? UNP A1B198 ? ? 'EXPRESSION TAG' -5  17 
1 4J1O LEU A 18 ? UNP A1B198 ? ? 'EXPRESSION TAG' -4  18 
1 4J1O TYR A 19 ? UNP A1B198 ? ? 'EXPRESSION TAG' -3  19 
1 4J1O PHE A 20 ? UNP A1B198 ? ? 'EXPRESSION TAG' -2  20 
1 4J1O GLN A 21 ? UNP A1B198 ? ? 'EXPRESSION TAG' -1  21 
1 4J1O SER A 22 ? UNP A1B198 ? ? 'EXPRESSION TAG' 0   22 
2 4J1O MET B 1  ? UNP A1B198 ? ? 'EXPRESSION TAG' -21 23 
2 4J1O HIS B 2  ? UNP A1B198 ? ? 'EXPRESSION TAG' -20 24 
2 4J1O HIS B 3  ? UNP A1B198 ? ? 'EXPRESSION TAG' -19 25 
2 4J1O HIS B 4  ? UNP A1B198 ? ? 'EXPRESSION TAG' -18 26 
2 4J1O HIS B 5  ? UNP A1B198 ? ? 'EXPRESSION TAG' -17 27 
2 4J1O HIS B 6  ? UNP A1B198 ? ? 'EXPRESSION TAG' -16 28 
2 4J1O HIS B 7  ? UNP A1B198 ? ? 'EXPRESSION TAG' -15 29 
2 4J1O SER B 8  ? UNP A1B198 ? ? 'EXPRESSION TAG' -14 30 
2 4J1O SER B 9  ? UNP A1B198 ? ? 'EXPRESSION TAG' -13 31 
2 4J1O GLY B 10 ? UNP A1B198 ? ? 'EXPRESSION TAG' -12 32 
2 4J1O VAL B 11 ? UNP A1B198 ? ? 'EXPRESSION TAG' -11 33 
2 4J1O ASP B 12 ? UNP A1B198 ? ? 'EXPRESSION TAG' -10 34 
2 4J1O LEU B 13 ? UNP A1B198 ? ? 'EXPRESSION TAG' -9  35 
2 4J1O GLY B 14 ? UNP A1B198 ? ? 'EXPRESSION TAG' -8  36 
2 4J1O THR B 15 ? UNP A1B198 ? ? 'EXPRESSION TAG' -7  37 
2 4J1O GLU B 16 ? UNP A1B198 ? ? 'EXPRESSION TAG' -6  38 
2 4J1O ASN B 17 ? UNP A1B198 ? ? 'EXPRESSION TAG' -5  39 
2 4J1O LEU B 18 ? UNP A1B198 ? ? 'EXPRESSION TAG' -4  40 
2 4J1O TYR B 19 ? UNP A1B198 ? ? 'EXPRESSION TAG' -3  41 
2 4J1O PHE B 20 ? UNP A1B198 ? ? 'EXPRESSION TAG' -2  42 
2 4J1O GLN B 21 ? UNP A1B198 ? ? 'EXPRESSION TAG' -1  43 
2 4J1O SER B 22 ? UNP A1B198 ? ? 'EXPRESSION TAG' 0   44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL               'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE              ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?                               'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'           ?                               'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE                ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?                               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'        ?                               'Mg 2'           24.305  
PBE non-polymer         . 1,1-DIMETHYL-PROLINIUM 'PROLINE BETAINE'               'C7 H14 N O2 1'  144.192 
PHE 'L-peptide linking' y PHENYLALANINE          ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4J1O 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.26 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   45.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.7 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
;Protein (10 mM Hepes pH 7.8, 150 mM NaCl, 5% glycerol, 1 mM EDTA/DTT); Reservoir (20% Peg400, 200 mM MgCl2, 100 mM MES pH 6.7); Cryoprotection (Reservoir+200 mM L-Proline Betaine+ 20% glycerol, comes with approx equal molar of iodine during synthesis of L-Proline Betaine), sitting drop vapor diffusion, temperature 298K, VAPOR DIFFUSION, SITTING DROP
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.details                MIRRORS 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2012-04-14 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
# 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_k_max                  ? 
_reflns.d_resolution_high            1.600 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_netI_over_sigmaI        16.800 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_Rmerge_I_obs            0.107 
_reflns.limit_l_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.entry_id                     4J1O 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.percent_possible_obs         100.000 
_reflns.pdbx_Rsym_value              0.107 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.limit_l_min                  ? 
_reflns.limit_h_min                  ? 
_reflns.R_free_details               ? 
_reflns.number_all                   101674 
_reflns.d_resolution_low             110.528 
_reflns.pdbx_redundancy              13.000 
_reflns.number_obs                   101674 
_reflns.limit_h_max                  ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.600 1.690   ? 156913 ? 0.600 1.300  0.600 ? 10.700 ? 14636 100.000 1  1 
1.690 1.790   ? 162068 ? 0.441 1.700  0.441 ? 11.700 ? 13883 100.000 2  1 
1.790 1.910   ? 165571 ? 0.309 2.500  0.309 ? 12.600 ? 13092 100.000 3  1 
1.910 2.070   ? 164273 ? 0.212 3.500  0.212 ? 13.500 ? 12191 100.000 4  1 
2.070 2.260   ? 157978 ? 0.153 4.900  0.153 ? 14.000 ? 11256 100.000 5  1 
2.260 2.530   ? 145804 ? 0.119 6.200  0.119 ? 14.300 ? 10219 100.000 6  1 
2.530 2.920   ? 129604 ? 0.093 7.700  0.093 ? 14.300 ? 9065  100.000 7  1 
2.920 3.580   ? 108858 ? 0.069 10.000 0.069 ? 14.100 ? 7733  100.000 8  1 
3.580 5.060   ? 83690  ? 0.050 13.200 0.050 ? 13.800 ? 6072  100.000 9  1 
5.060 117.297 ? 47195  ? 0.041 15.300 0.041 ? 13.400 ? 3527  99.900  10 1 
# 
_refine.ls_percent_reflns_R_free                 4.9900 
_refine.overall_SU_B                             ? 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.entry_id                                 4J1O 
_refine.aniso_B[2][3]                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_ML                            0.1200 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.aniso_B[1][3]                            ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.aniso_B[3][3]                            ? 
_refine.occupancy_max                            1.000 
_refine.ls_number_restraints                     ? 
_refine.aniso_B[1][1]                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_R_factor_obs                          0.1586 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_starting_model                      ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.ls_number_reflns_R_free                  5074 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.ls_percent_reflns_obs                    99.9600 
_refine.ls_R_factor_R_work                       0.1575 
_refine.overall_SU_R_free                        ? 
_refine.ls_d_res_high                            1.6000 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.B_iso_min                                4.430 
_refine.occupancy_min                            0.250 
_refine.B_iso_mean                               15.2380 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.ls_R_factor_all                          0.1586 
_refine.aniso_B[2][2]                            ? 
_refine.B_iso_max                                67.410 
_refine.ls_d_res_low                             37.0930 
_refine.pdbx_overall_phase_error                 16.4800 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.aniso_B[1][2]                            ? 
_refine.ls_R_factor_R_free                       0.1809 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_number_reflns_obs                     101606 
_refine.overall_FOM_work_R_set                   0.9002 
_refine.ls_number_parameters                     ? 
_refine.details                                  ? 
_refine.ls_number_reflns_all                     101606 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.solvent_model_param_bsol                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5538 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             689 
_refine_hist.number_atoms_total               6269 
_refine_hist.d_res_high                       1.6000 
_refine_hist.d_res_low                        37.0930 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           5882 0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          8055 1.121  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     877  0.071  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      1069 0.006  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 2207 16.347 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.6000 1.6182  30 100.0000 3173 . 0.1978 0.2216 . 160 . 3333 . . 'X-RAY DIFFRACTION' 
1.6182 1.6372  30 100.0000 3165 . 0.1904 0.2194 . 154 . 3319 . . 'X-RAY DIFFRACTION' 
1.6372 1.6572  30 100.0000 3197 . 0.1765 0.2000 . 171 . 3368 . . 'X-RAY DIFFRACTION' 
1.6572 1.6782  30 100.0000 3142 . 0.1822 0.2231 . 183 . 3325 . . 'X-RAY DIFFRACTION' 
1.6782 1.7003  30 100.0000 3206 . 0.1753 0.2056 . 156 . 3362 . . 'X-RAY DIFFRACTION' 
1.7003 1.7235  30 100.0000 3168 . 0.1680 0.2139 . 159 . 3327 . . 'X-RAY DIFFRACTION' 
1.7235 1.7482  30 100.0000 3194 . 0.1696 0.2020 . 182 . 3376 . . 'X-RAY DIFFRACTION' 
1.7482 1.7743  30 100.0000 3165 . 0.1706 0.2136 . 160 . 3325 . . 'X-RAY DIFFRACTION' 
1.7743 1.8020  30 100.0000 3172 . 0.1687 0.1927 . 166 . 3338 . . 'X-RAY DIFFRACTION' 
1.8020 1.8315  30 100.0000 3191 . 0.1586 0.1838 . 178 . 3369 . . 'X-RAY DIFFRACTION' 
1.8315 1.8631  30 100.0000 3202 . 0.1558 0.1880 . 162 . 3364 . . 'X-RAY DIFFRACTION' 
1.8631 1.8970  30 100.0000 3192 . 0.1579 0.2005 . 166 . 3358 . . 'X-RAY DIFFRACTION' 
1.8970 1.9335  30 100.0000 3191 . 0.1539 0.1861 . 157 . 3348 . . 'X-RAY DIFFRACTION' 
1.9335 1.9729  30 100.0000 3202 . 0.1576 0.1926 . 157 . 3359 . . 'X-RAY DIFFRACTION' 
1.9729 2.0158  30 100.0000 3208 . 0.1581 0.1957 . 171 . 3379 . . 'X-RAY DIFFRACTION' 
2.0158 2.0627  30 100.0000 3177 . 0.1556 0.1857 . 170 . 3347 . . 'X-RAY DIFFRACTION' 
2.0627 2.1143  30 100.0000 3180 . 0.1511 0.1918 . 166 . 3346 . . 'X-RAY DIFFRACTION' 
2.1143 2.1715  30 100.0000 3240 . 0.1494 0.1586 . 164 . 3404 . . 'X-RAY DIFFRACTION' 
2.1715 2.2353  30 100.0000 3184 . 0.1500 0.1749 . 182 . 3366 . . 'X-RAY DIFFRACTION' 
2.2353 2.3075  30 100.0000 3221 . 0.1500 0.1710 . 160 . 3381 . . 'X-RAY DIFFRACTION' 
2.3075 2.3899  30 100.0000 3180 . 0.1482 0.1729 . 186 . 3366 . . 'X-RAY DIFFRACTION' 
2.3899 2.4856  30 100.0000 3210 . 0.1553 0.1723 . 185 . 3395 . . 'X-RAY DIFFRACTION' 
2.4856 2.5987  30 100.0000 3248 . 0.1539 0.1909 . 145 . 3393 . . 'X-RAY DIFFRACTION' 
2.5987 2.7357  30 100.0000 3208 . 0.1559 0.1777 . 198 . 3406 . . 'X-RAY DIFFRACTION' 
2.7357 2.9070  30 100.0000 3253 . 0.1612 0.1982 . 163 . 3416 . . 'X-RAY DIFFRACTION' 
2.9070 3.1314  30 100.0000 3250 . 0.1600 0.1934 . 174 . 3424 . . 'X-RAY DIFFRACTION' 
3.1314 3.4463  30 100.0000 3291 . 0.1529 0.1802 . 157 . 3448 . . 'X-RAY DIFFRACTION' 
3.4463 3.9445  30 100.0000 3288 . 0.1397 0.1702 . 185 . 3473 . . 'X-RAY DIFFRACTION' 
3.9445 4.9677  30 100.0000 3314 . 0.1398 0.1357 . 193 . 3507 . . 'X-RAY DIFFRACTION' 
4.9677 37.1025 30 100.0000 3520 . 0.1838 0.1828 . 164 . 3684 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4J1O 
_struct.title                     
;Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound l-proline betaine (substrate)
;
_struct.pdbx_descriptor           'Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4J1O 
_struct_keywords.text            
;Enolase, Betaine Racemase, Proline Betaine Racemease, NYSGRC, Structural Genomics, New York Structural Genomics Research Consortium, PSI-Biology, ISOMERASE
;
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 5 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 5 ? 
V N N 6 ? 
W N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'biological unit is an octamer' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 82  ? ALA A 94  ? HIS A 60  ALA A 72  1 ? 13 
HELX_P HELX_P2  2  PRO A 95  ? ILE A 98  ? PRO A 73  ILE A 76  5 ? 4  
HELX_P HELX_P3  3  GLN A 104 ? GLY A 114 ? GLN A 82  GLY A 92  1 ? 11 
HELX_P HELX_P4  4  HIS A 119 ? GLY A 139 ? HIS A 97  GLY A 117 1 ? 21 
HELX_P HELX_P5  5  ARG A 141 ? LEU A 146 ? ARG A 119 LEU A 124 5 ? 6  
HELX_P HELX_P6  6  GLN A 164 ? GLY A 179 ? GLN A 142 GLY A 157 1 ? 16 
HELX_P HELX_P7  7  PRO A 191 ? ARG A 207 ? PRO A 169 ARG A 185 1 ? 17 
HELX_P HELX_P8  8  PRO A 222 ? CYS A 233 ? PRO A 200 CYS A 211 1 ? 12 
HELX_P HELX_P9  9  THR A 246 ? ARG A 254 ? THR A 224 ARG A 232 1 ? 9  
HELX_P HELX_P10 10 GLY A 255 ? VAL A 257 ? GLY A 233 VAL A 235 5 ? 3  
HELX_P HELX_P11 11 ASP A 269 ? GLN A 279 ? ASP A 247 GLN A 257 1 ? 11 
HELX_P HELX_P12 12 LEU A 289 ? GLY A 293 ? LEU A 267 GLY A 271 1 ? 5  
HELX_P HELX_P13 13 GLY A 294 ? ARG A 308 ? GLY A 272 ARG A 286 1 ? 15 
HELX_P HELX_P14 14 GLY A 320 ? ALA A 332 ? GLY A 298 ALA A 310 1 ? 13 
HELX_P HELX_P15 15 THR A 333 ? VAL A 334 ? THR A 311 VAL A 312 5 ? 2  
HELX_P HELX_P16 16 GLN A 335 ? ARG A 337 ? GLN A 313 ARG A 315 5 ? 3  
HELX_P HELX_P17 17 ALA A 345 ? ILE A 349 ? ALA A 323 ILE A 327 5 ? 5  
HELX_P HELX_P18 18 ASP A 379 ? PHE A 383 ? ASP A 357 PHE A 361 5 ? 5  
HELX_P HELX_P19 19 HIS B 82  ? ALA B 94  ? HIS B 60  ALA B 72  1 ? 13 
HELX_P HELX_P20 20 PRO B 95  ? ILE B 98  ? PRO B 73  ILE B 76  5 ? 4  
HELX_P HELX_P21 21 GLN B 104 ? GLY B 114 ? GLN B 82  GLY B 92  1 ? 11 
HELX_P HELX_P22 22 HIS B 119 ? GLY B 139 ? HIS B 97  GLY B 117 1 ? 21 
HELX_P HELX_P23 23 ARG B 141 ? LEU B 146 ? ARG B 119 LEU B 124 1 ? 6  
HELX_P HELX_P24 24 GLN B 164 ? GLY B 179 ? GLN B 142 GLY B 157 1 ? 16 
HELX_P HELX_P25 25 PRO B 191 ? ARG B 207 ? PRO B 169 ARG B 185 1 ? 17 
HELX_P HELX_P26 26 PRO B 222 ? CYS B 233 ? PRO B 200 CYS B 211 1 ? 12 
HELX_P HELX_P27 27 THR B 246 ? ARG B 254 ? THR B 224 ARG B 232 1 ? 9  
HELX_P HELX_P28 28 GLY B 255 ? VAL B 257 ? GLY B 233 VAL B 235 5 ? 3  
HELX_P HELX_P29 29 ASP B 269 ? GLN B 279 ? ASP B 247 GLN B 257 1 ? 11 
HELX_P HELX_P30 30 LEU B 289 ? GLY B 293 ? LEU B 267 GLY B 271 1 ? 5  
HELX_P HELX_P31 31 GLY B 294 ? ARG B 308 ? GLY B 272 ARG B 286 1 ? 15 
HELX_P HELX_P32 32 GLY B 320 ? ALA B 332 ? GLY B 298 ALA B 310 1 ? 13 
HELX_P HELX_P33 33 THR B 333 ? VAL B 334 ? THR B 311 VAL B 312 5 ? 2  
HELX_P HELX_P34 34 GLN B 335 ? ARG B 337 ? GLN B 313 ARG B 315 5 ? 3  
HELX_P HELX_P35 35 ALA B 345 ? ILE B 349 ? ALA B 323 ILE B 327 5 ? 5  
HELX_P HELX_P36 36 ASP B 379 ? GLY B 384 ? ASP B 357 GLY B 362 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 264 OD2 ? ? ? 1_555 O MG  . MG  ? ? B ASP 242 B MG  401 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc2  metalc ? ? A ASP 264 OD2 ? ? ? 1_555 C MG  . MG  ? ? A ASP 242 A MG  401 1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc3  metalc ? ? P MG  .   MG  ? ? ? 1_555 W HOH . O   ? ? B MG  402 B HOH 588 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc4  metalc ? ? D MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  402 A HOH 600 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc5  metalc ? ? A SER 391 OG  ? ? ? 1_555 E MG  . MG  ? ? A SER 369 A MG  403 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc6  metalc ? ? O MG  .   MG  ? ? ? 1_555 W HOH . O   ? ? B MG  401 B HOH 509 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc7  metalc ? ? C MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  401 A HOH 503 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc8  metalc ? ? P MG  .   MG  ? ? ? 1_555 W HOH . O   ? ? B MG  402 B HOH 782 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc9  metalc ? ? E MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  403 A HOH 851 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc10 metalc ? ? D MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  402 A HOH 638 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc11 metalc ? ? D MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  402 A HOH 603 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc12 metalc ? ? D MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  402 A HOH 537 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc13 metalc ? ? A SER 391 O   ? ? ? 1_555 E MG  . MG  ? ? A SER 369 A MG  403 1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc14 metalc ? ? P MG  .   MG  ? ? ? 1_555 W HOH . O   ? ? B MG  402 B HOH 772 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc15 metalc ? ? P MG  .   MG  ? ? ? 1_555 W HOH . O   ? ? B MG  402 B HOH 709 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc16 metalc ? ? P MG  .   MG  ? ? ? 1_555 W HOH . O   ? ? B MG  402 B HOH 744 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc17 metalc ? ? B GLU 241 OE2 ? ? ? 1_555 O MG  . MG  ? ? B GLU 219 B MG  401 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc18 metalc ? ? D MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  402 A HOH 595 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc19 metalc ? ? A GLU 241 OE2 ? ? ? 1_555 C MG  . MG  ? ? A GLU 219 A MG  401 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc20 metalc ? ? P MG  .   MG  ? ? ? 1_555 W HOH . O   ? ? B MG  402 B HOH 645 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc21 metalc ? ? E MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  403 A HOH 784 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc22 metalc ? ? E MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  403 A HOH 551 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc23 metalc ? ? B ASP 216 OD2 ? ? ? 1_555 O MG  . MG  ? ? B ASP 194 B MG  401 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc24 metalc ? ? D MG  .   MG  ? ? ? 1_555 V HOH . O   ? ? A MG  402 A HOH 549 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc25 metalc ? ? A ASP 216 OD2 ? ? ? 1_555 C MG  . MG  ? ? A ASP 194 A MG  401 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc26 metalc ? ? O MG  .   MG  ? ? ? 1_555 U PBE . OXT ? ? B MG  401 B PBE 407 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc27 metalc ? ? C MG  .   MG  ? ? ? 1_555 N PBE . O   ? ? A MG  401 A PBE 412 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc28 metalc ? ? O MG  .   MG  ? ? ? 1_555 U PBE . O   ? ? B MG  401 B PBE 407 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc29 metalc ? ? C MG  .   MG  ? ? ? 1_555 N PBE . OXT ? ? A MG  401 A PBE 412 1_555 ? ? ? ? ? ? ? 2.250 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 40 A . ? GLY 18 A PRO 41 A ? PRO 19 A 1 1.40 
2 GLY 40 B . ? GLY 18 B PRO 41 B ? PRO 19 B 1 3.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 3 ? 
D ? 8 ? 
E ? 4 ? 
F ? 2 ? 
G ? 3 ? 
H ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
H 6 7 ? parallel      
H 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 66  ? THR A 71  ? ALA A 44  THR A 49  
A 2 SER A 51  ? ALA A 61  ? SER A 29  ALA A 39  
A 3 ILE A 25  ? PRO A 36  ? ILE A 3   PRO A 14  
A 4 ALA A 388 ? PHE A 390 ? ALA A 366 PHE A 368 
B 1 TYR A 42  ? ILE A 44  ? TYR A 20  ILE A 22  
B 2 SER A 47  ? VAL A 49  ? SER A 25  VAL A 27  
C 1 ARG A 153 ? PRO A 155 ? ARG A 131 PRO A 133 
C 2 HIS A 365 ? ASP A 367 ? HIS A 343 ASP A 345 
C 3 ILE A 361 ? ALA A 362 ? ILE A 339 ALA A 340 
D 1 TYR A 158 ? THR A 160 ? TYR A 136 THR A 138 
D 2 ARG A 182 ? LYS A 186 ? ARG A 160 LYS A 164 
D 3 ARG A 212 ? ASP A 216 ? ARG A 190 ASP A 194 
D 4 PHE A 238 ? GLU A 241 ? PHE A 216 GLU A 219 
D 5 ILE A 261 ? LEU A 263 ? ILE A 239 LEU A 241 
D 6 GLY A 284 ? LYS A 288 ? GLY A 262 LYS A 266 
D 7 HIS A 312 ? ASP A 315 ? HIS A 290 ASP A 293 
D 8 ASN A 339 ? GLY A 341 ? ASN A 317 GLY A 319 
E 1 ALA B 66  ? THR B 71  ? ALA B 44  THR B 49  
E 2 SER B 51  ? ALA B 61  ? SER B 29  ALA B 39  
E 3 ILE B 25  ? PRO B 36  ? ILE B 3   PRO B 14  
E 4 ALA B 388 ? PHE B 390 ? ALA B 366 PHE B 368 
F 1 TYR B 42  ? ILE B 44  ? TYR B 20  ILE B 22  
F 2 SER B 47  ? VAL B 49  ? SER B 25  VAL B 27  
G 1 ARG B 153 ? PRO B 155 ? ARG B 131 PRO B 133 
G 2 HIS B 365 ? ASP B 367 ? HIS B 343 ASP B 345 
G 3 ILE B 361 ? ALA B 362 ? ILE B 339 ALA B 340 
H 1 TYR B 158 ? THR B 160 ? TYR B 136 THR B 138 
H 2 ARG B 182 ? LYS B 186 ? ARG B 160 LYS B 164 
H 3 ARG B 212 ? ASP B 216 ? ARG B 190 ASP B 194 
H 4 PHE B 238 ? GLU B 241 ? PHE B 216 GLU B 219 
H 5 ILE B 261 ? LEU B 263 ? ILE B 239 LEU B 241 
H 6 GLY B 284 ? LYS B 288 ? GLY B 262 LYS B 266 
H 7 HIS B 312 ? ASP B 315 ? HIS B 290 ASP B 293 
H 8 ASN B 339 ? GLY B 341 ? ASN B 317 GLY B 319 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 67  ? O GLY A 45  N ILE A 59  ? N ILE A 37  
A 2 3 O LEU A 52  ? O LEU A 30  N LEU A 35  ? N LEU A 13  
A 3 4 N VAL A 30  ? N VAL A 8   O ALA A 388 ? O ALA A 366 
B 1 2 N ILE A 44  ? N ILE A 22  O SER A 47  ? O SER A 25  
C 1 2 N VAL A 154 ? N VAL A 132 O ILE A 366 ? O ILE A 344 
C 2 3 O HIS A 365 ? O HIS A 343 N ALA A 362 ? N ALA A 340 
D 1 2 N TYR A 158 ? N TYR A 136 O GLN A 184 ? O GLN A 162 
D 2 3 N ILE A 185 ? N ILE A 163 O ALA A 214 ? O ALA A 192 
D 3 4 N VAL A 215 ? N VAL A 193 O GLU A 241 ? O GLU A 219 
D 4 5 N LEU A 240 ? N LEU A 218 O TYR A 262 ? O TYR A 240 
D 5 6 N LEU A 263 ? N LEU A 241 O GLY A 286 ? O GLY A 264 
D 6 7 N MET A 287 ? N MET A 265 O ASP A 315 ? O ASP A 293 
D 7 8 N HIS A 312 ? N HIS A 290 O GLU A 340 ? O GLU A 318 
E 1 2 O GLY B 67  ? O GLY B 45  N ILE B 59  ? N ILE B 37  
E 2 3 O VAL B 60  ? O VAL B 38  N ALA B 26  ? N ALA B 4   
E 3 4 N VAL B 30  ? N VAL B 8   O ALA B 388 ? O ALA B 366 
F 1 2 N ILE B 44  ? N ILE B 22  O SER B 47  ? O SER B 25  
G 1 2 N VAL B 154 ? N VAL B 132 O ILE B 366 ? O ILE B 344 
G 2 3 O HIS B 365 ? O HIS B 343 N ALA B 362 ? N ALA B 340 
H 1 2 N TYR B 158 ? N TYR B 136 O GLN B 184 ? O GLN B 162 
H 2 3 N ILE B 185 ? N ILE B 163 O ALA B 214 ? O ALA B 192 
H 3 4 N VAL B 215 ? N VAL B 193 O GLU B 241 ? O GLU B 219 
H 4 5 N LEU B 240 ? N LEU B 218 O TYR B 262 ? O TYR B 240 
H 5 6 N LEU B 263 ? N LEU B 241 O GLY B 286 ? O GLY B 264 
H 6 7 N MET B 287 ? N MET B 265 O ASP B 315 ? O ASP B 293 
H 7 8 N HIS B 312 ? N HIS B 290 O GLU B 340 ? O GLU B 318 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 401'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 402'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 403'  
AC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD A 404' 
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD A 406' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IOD A 407' 
AC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD A 408' 
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IOD A 409' 
AC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 411' 
BC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PBE A 412' 
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 401'  
BC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 402'  
BC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD B 403' 
BC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IOD B 404' 
BC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IOD B 406' 
BC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PBE B 407' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP A 216 ? ASP A 194 . ? 1_555 ? 
2  AC1 5  GLU A 241 ? GLU A 219 . ? 1_555 ? 
3  AC1 5  ASP A 264 ? ASP A 242 . ? 1_555 ? 
4  AC1 5  PBE N .   ? PBE A 412 . ? 1_555 ? 
5  AC1 5  HOH V .   ? HOH A 503 . ? 1_555 ? 
6  AC2 6  HOH V .   ? HOH A 537 . ? 1_555 ? 
7  AC2 6  HOH V .   ? HOH A 549 . ? 1_555 ? 
8  AC2 6  HOH V .   ? HOH A 595 . ? 1_555 ? 
9  AC2 6  HOH V .   ? HOH A 600 . ? 1_555 ? 
10 AC2 6  HOH V .   ? HOH A 603 . ? 1_555 ? 
11 AC2 6  HOH V .   ? HOH A 638 . ? 1_555 ? 
12 AC3 5  SER A 391 ? SER A 369 . ? 1_555 ? 
13 AC3 5  HOH V .   ? HOH A 551 . ? 1_555 ? 
14 AC3 5  HOH V .   ? HOH A 784 . ? 1_555 ? 
15 AC3 5  HOH V .   ? HOH A 851 . ? 1_555 ? 
16 AC3 5  GLN B 164 ? GLN B 142 . ? 5_545 ? 
17 AC4 1  ARG A 337 ? ARG A 315 . ? 1_555 ? 
18 AC5 1  ALA A 66  ? ALA A 44  . ? 1_555 ? 
19 AC6 3  HOH V .   ? HOH A 570 . ? 1_555 ? 
20 AC6 3  HOH V .   ? HOH A 590 . ? 1_555 ? 
21 AC6 3  HOH V .   ? HOH A 698 . ? 1_555 ? 
22 AC7 1  TRP A 68  ? TRP A 46  . ? 1_555 ? 
23 AC8 2  GLN A 53  ? GLN A 31  . ? 1_555 ? 
24 AC8 2  ALA A 83  ? ALA A 61  . ? 1_555 ? 
25 AC9 9  ASN A 357 ? ASN A 335 . ? 1_555 ? 
26 AC9 9  GLY A 358 ? GLY A 336 . ? 1_555 ? 
27 AC9 9  ILE A 359 ? ILE A 337 . ? 1_555 ? 
28 AC9 9  ARG A 360 ? ARG A 338 . ? 1_555 ? 
29 AC9 9  ASP A 367 ? ASP A 345 . ? 1_555 ? 
30 AC9 9  LEU A 368 ? LEU A 346 . ? 1_555 ? 
31 AC9 9  PRO A 369 ? PRO A 347 . ? 1_555 ? 
32 AC9 9  HOH V .   ? HOH A 546 . ? 1_555 ? 
33 AC9 9  HOH V .   ? HOH A 633 . ? 1_555 ? 
34 BC1 12 TYR A 78  ? TYR A 56  . ? 1_555 ? 
35 BC1 12 TYR A 157 ? TYR A 135 . ? 1_555 ? 
36 BC1 12 ALA A 159 ? ALA A 137 . ? 1_555 ? 
37 BC1 12 GLN A 184 ? GLN A 162 . ? 1_555 ? 
38 BC1 12 LYS A 186 ? LYS A 164 . ? 1_555 ? 
39 BC1 12 ASP A 216 ? ASP A 194 . ? 1_555 ? 
40 BC1 12 ASN A 218 ? ASN A 196 . ? 1_555 ? 
41 BC1 12 GLU A 241 ? GLU A 219 . ? 1_555 ? 
42 BC1 12 ASP A 264 ? ASP A 242 . ? 1_555 ? 
43 BC1 12 LYS A 288 ? LYS A 266 . ? 1_555 ? 
44 BC1 12 MG  C .   ? MG  A 401 . ? 1_555 ? 
45 BC1 12 HOH V .   ? HOH A 676 . ? 1_555 ? 
46 BC2 5  ASP B 216 ? ASP B 194 . ? 1_555 ? 
47 BC2 5  GLU B 241 ? GLU B 219 . ? 1_555 ? 
48 BC2 5  ASP B 264 ? ASP B 242 . ? 1_555 ? 
49 BC2 5  PBE U .   ? PBE B 407 . ? 1_555 ? 
50 BC2 5  HOH W .   ? HOH B 509 . ? 1_555 ? 
51 BC3 6  HOH W .   ? HOH B 588 . ? 1_555 ? 
52 BC3 6  HOH W .   ? HOH B 645 . ? 1_555 ? 
53 BC3 6  HOH W .   ? HOH B 709 . ? 1_555 ? 
54 BC3 6  HOH W .   ? HOH B 744 . ? 1_555 ? 
55 BC3 6  HOH W .   ? HOH B 772 . ? 1_555 ? 
56 BC3 6  HOH W .   ? HOH B 782 . ? 1_555 ? 
57 BC4 1  ARG B 337 ? ARG B 315 . ? 1_555 ? 
58 BC5 1  ALA B 83  ? ALA B 61  . ? 1_555 ? 
59 BC6 2  HOH W .   ? HOH B 615 . ? 1_555 ? 
60 BC6 2  HOH W .   ? HOH B 643 . ? 1_555 ? 
61 BC7 12 TYR B 78  ? TYR B 56  . ? 1_555 ? 
62 BC7 12 TYR B 157 ? TYR B 135 . ? 1_555 ? 
63 BC7 12 GLN B 184 ? GLN B 162 . ? 1_555 ? 
64 BC7 12 LYS B 186 ? LYS B 164 . ? 1_555 ? 
65 BC7 12 ASP B 216 ? ASP B 194 . ? 1_555 ? 
66 BC7 12 ASN B 218 ? ASN B 196 . ? 1_555 ? 
67 BC7 12 GLU B 241 ? GLU B 219 . ? 1_555 ? 
68 BC7 12 ASP B 264 ? ASP B 242 . ? 1_555 ? 
69 BC7 12 LYS B 288 ? LYS B 266 . ? 1_555 ? 
70 BC7 12 ALA B 317 ? ALA B 295 . ? 1_555 ? 
71 BC7 12 MG  O .   ? MG  B 401 . ? 1_555 ? 
72 BC7 12 HOH W .   ? HOH B 680 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4J1O 
_atom_sites.fract_transf_matrix[1][1]   0.008525 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008525 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009047 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
I  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 23  ? 39.506  25.841 15.517  1.00 41.87 ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 23  ? 39.041  24.776 16.401  1.00 39.74 ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 23  ? 37.599  24.389 16.068  1.00 30.12 ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 23  ? 36.837  25.206 15.545  1.00 29.70 ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 23  ? 39.152  25.212 17.861  1.00 42.23 ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 23  ? 38.792  24.125 18.848  1.00 44.07 ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 23  ? 38.595  24.769 20.510  1.00 67.41 ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 23  ? 40.207  24.474 21.232  1.00 25.63 ? 1   MET A CE  1 
ATOM   9    N  N   . LYS A 1 24  ? 37.229  23.140 16.349  1.00 22.60 ? 2   LYS A N   1 
ATOM   10   C  CA  . LYS A 1 24  ? 35.899  22.654 15.992  1.00 18.18 ? 2   LYS A CA  1 
ATOM   11   C  C   . LYS A 1 24  ? 35.295  21.718 17.043  1.00 14.00 ? 2   LYS A C   1 
ATOM   12   O  O   . LYS A 1 24  ? 36.008  20.953 17.696  1.00 14.17 ? 2   LYS A O   1 
ATOM   13   C  CB  . LYS A 1 24  ? 35.933  21.939 14.638  1.00 22.19 ? 2   LYS A CB  1 
ATOM   14   C  CG  . LYS A 1 24  ? 36.606  22.712 13.508  1.00 33.05 ? 2   LYS A CG  1 
ATOM   15   C  CD  . LYS A 1 24  ? 36.350  22.049 12.169  1.00 39.44 ? 2   LYS A CD  1 
ATOM   16   C  CE  . LYS A 1 24  ? 36.663  20.563 12.223  1.00 44.66 ? 2   LYS A CE  1 
ATOM   17   N  NZ  . LYS A 1 24  ? 35.765  19.780 11.329  1.00 47.72 ? 2   LYS A NZ  1 
ATOM   18   N  N   . ILE A 1 25  ? 33.973  21.784 17.199  1.00 15.08 ? 3   ILE A N   1 
ATOM   19   C  CA  . ILE A 1 25  ? 33.252  20.827 18.035  1.00 13.43 ? 3   ILE A CA  1 
ATOM   20   C  C   . ILE A 1 25  ? 33.304  19.439 17.403  1.00 13.19 ? 3   ILE A C   1 
ATOM   21   O  O   . ILE A 1 25  ? 32.872  19.251 16.263  1.00 13.92 ? 3   ILE A O   1 
ATOM   22   C  CB  . ILE A 1 25  ? 31.771  21.237 18.220  1.00 11.38 ? 3   ILE A CB  1 
ATOM   23   C  CG1 . ILE A 1 25  ? 31.667  22.562 18.973  1.00 10.96 ? 3   ILE A CG1 1 
ATOM   24   C  CG2 . ILE A 1 25  ? 30.993  20.162 18.987  1.00 11.27 ? 3   ILE A CG2 1 
ATOM   25   C  CD1 . ILE A 1 25  ? 30.235  23.049 19.159  1.00 10.25 ? 3   ILE A CD1 1 
ATOM   26   N  N   . ALA A 1 26  ? 33.841  18.474 18.144  1.00 13.45 ? 4   ALA A N   1 
ATOM   27   C  CA  . ALA A 1 26  ? 33.895  17.089 17.683  1.00 14.34 ? 4   ALA A CA  1 
ATOM   28   C  C   . ALA A 1 26  ? 32.771  16.236 18.279  1.00 14.44 ? 4   ALA A C   1 
ATOM   29   O  O   . ALA A 1 26  ? 32.219  15.357 17.605  1.00 14.62 ? 4   ALA A O   1 
ATOM   30   C  CB  . ALA A 1 26  ? 35.250  16.491 18.011  1.00 15.27 ? 4   ALA A CB  1 
ATOM   31   N  N   . GLU A 1 27  ? 32.443  16.481 19.548  1.00 14.36 ? 5   GLU A N   1 
ATOM   32   C  CA  . GLU A 1 27  ? 31.440  15.681 20.259  1.00 12.54 ? 5   GLU A CA  1 
ATOM   33   C  C   . GLU A 1 27  ? 30.559  16.543 21.157  1.00 12.12 ? 5   GLU A C   1 
ATOM   34   O  O   . GLU A 1 27  ? 31.011  17.553 21.681  1.00 12.12 ? 5   GLU A O   1 
ATOM   35   C  CB  . GLU A 1 27  ? 32.124  14.630 21.140  1.00 16.25 ? 5   GLU A CB  1 
ATOM   36   C  CG  . GLU A 1 27  ? 33.055  13.678 20.414  1.00 16.79 ? 5   GLU A CG  1 
ATOM   37   C  CD  . GLU A 1 27  ? 33.818  12.768 21.362  1.00 23.79 ? 5   GLU A CD  1 
ATOM   38   O  OE1 . GLU A 1 27  ? 33.566  12.823 22.585  1.00 20.69 ? 5   GLU A OE1 1 
ATOM   39   O  OE2 . GLU A 1 27  ? 34.678  12.000 20.882  1.00 25.93 ? 5   GLU A OE2 1 
ATOM   40   N  N   . ILE A 1 28  ? 29.302  16.139 21.332  1.00 11.68 ? 6   ILE A N   1 
ATOM   41   C  CA  . ILE A 1 28  ? 28.434  16.760 22.330  1.00 10.99 ? 6   ILE A CA  1 
ATOM   42   C  C   . ILE A 1 28  ? 27.783  15.650 23.149  1.00 12.65 ? 6   ILE A C   1 
ATOM   43   O  O   . ILE A 1 28  ? 27.208  14.719 22.588  1.00 13.68 ? 6   ILE A O   1 
ATOM   44   C  CB  . ILE A 1 28  ? 27.350  17.658 21.688  1.00 10.34 ? 6   ILE A CB  1 
ATOM   45   C  CG1 . ILE A 1 28  ? 28.006  18.822 20.943  1.00 10.29 ? 6   ILE A CG1 1 
ATOM   46   C  CG2 . ILE A 1 28  ? 26.398  18.196 22.765  1.00 12.26 ? 6   ILE A CG2 1 
ATOM   47   C  CD1 . ILE A 1 28  ? 27.034  19.681 20.139  1.00 12.84 ? 6   ILE A CD1 1 
ATOM   48   N  N   . HIS A 1 29  ? 27.898  15.734 24.472  1.00 10.86 ? 7   HIS A N   1 
ATOM   49   C  CA  . HIS A 1 29  ? 27.322  14.718 25.353  1.00 10.75 ? 7   HIS A CA  1 
ATOM   50   C  C   . HIS A 1 29  ? 26.322  15.355 26.308  1.00 13.05 ? 7   HIS A C   1 
ATOM   51   O  O   . HIS A 1 29  ? 26.602  16.395 26.904  1.00 12.04 ? 7   HIS A O   1 
ATOM   52   C  CB  . HIS A 1 29  ? 28.421  13.987 26.132  1.00 11.30 ? 7   HIS A CB  1 
ATOM   53   C  CG  . HIS A 1 29  ? 29.446  13.351 25.252  1.00 11.92 ? 7   HIS A CG  1 
ATOM   54   N  ND1 . HIS A 1 29  ? 29.293  12.085 24.725  1.00 14.69 ? 7   HIS A ND1 1 
ATOM   55   C  CD2 . HIS A 1 29  ? 30.635  13.809 24.798  1.00 13.84 ? 7   HIS A CD2 1 
ATOM   56   C  CE1 . HIS A 1 29  ? 30.348  11.792 23.988  1.00 15.32 ? 7   HIS A CE1 1 
ATOM   57   N  NE2 . HIS A 1 29  ? 31.176  12.821 24.010  1.00 13.87 ? 7   HIS A NE2 1 
ATOM   58   N  N   . VAL A 1 30  ? 25.153  14.733 26.425  1.00 10.75 ? 8   VAL A N   1 
ATOM   59   C  CA  . VAL A 1 30  ? 24.075  15.245 27.268  1.00 11.11 ? 8   VAL A CA  1 
ATOM   60   C  C   . VAL A 1 30  ? 23.885  14.301 28.453  1.00 11.55 ? 8   VAL A C   1 
ATOM   61   O  O   . VAL A 1 30  ? 23.796  13.090 28.264  1.00 14.13 ? 8   VAL A O   1 
ATOM   62   C  CB  . VAL A 1 30  ? 22.751  15.363 26.474  1.00 11.32 ? 8   VAL A CB  1 
ATOM   63   C  CG1 . VAL A 1 30  ? 21.626  15.859 27.379  1.00 14.56 ? 8   VAL A CG1 1 
ATOM   64   C  CG2 . VAL A 1 30  ? 22.923  16.297 25.281  1.00 12.18 ? 8   VAL A CG2 1 
ATOM   65   N  N   . TYR A 1 31  ? 23.833  14.859 29.662  1.00 11.05 ? 9   TYR A N   1 
ATOM   66   C  CA  . TYR A 1 31  ? 23.715  14.062 30.889  1.00 12.86 ? 9   TYR A CA  1 
ATOM   67   C  C   . TYR A 1 31  ? 22.447  14.423 31.660  1.00 13.29 ? 9   TYR A C   1 
ATOM   68   O  O   . TYR A 1 31  ? 22.004  15.573 31.637  1.00 13.06 ? 9   TYR A O   1 
ATOM   69   C  CB  . TYR A 1 31  ? 24.921  14.291 31.803  1.00 11.93 ? 9   TYR A CB  1 
ATOM   70   C  CG  . TYR A 1 31  ? 26.272  13.975 31.191  1.00 12.19 ? 9   TYR A CG  1 
ATOM   71   C  CD1 . TYR A 1 31  ? 26.886  14.871 30.319  1.00 11.39 ? 9   TYR A CD1 1 
ATOM   72   C  CD2 . TYR A 1 31  ? 26.939  12.800 31.502  1.00 15.16 ? 9   TYR A CD2 1 
ATOM   73   C  CE1 . TYR A 1 31  ? 28.120  14.598 29.762  1.00 13.81 ? 9   TYR A CE1 1 
ATOM   74   C  CE2 . TYR A 1 31  ? 28.178  12.512 30.946  1.00 12.75 ? 9   TYR A CE2 1 
ATOM   75   C  CZ  . TYR A 1 31  ? 28.761  13.421 30.078  1.00 17.07 ? 9   TYR A CZ  1 
ATOM   76   O  OH  . TYR A 1 31  ? 29.996  13.142 29.530  1.00 19.43 ? 9   TYR A OH  1 
ATOM   77   N  N   . ALA A 1 32  ? 21.872  13.438 32.345  1.00 15.03 ? 10  ALA A N   1 
ATOM   78   C  CA  . ALA A 1 32  ? 20.725  13.666 33.228  1.00 15.41 ? 10  ALA A CA  1 
ATOM   79   C  C   . ALA A 1 32  ? 21.165  13.357 34.655  1.00 16.11 ? 10  ALA A C   1 
ATOM   80   O  O   . ALA A 1 32  ? 21.809  12.336 34.898  1.00 21.12 ? 10  ALA A O   1 
ATOM   81   C  CB  . ALA A 1 32  ? 19.565  12.787 32.829  1.00 17.94 ? 10  ALA A CB  1 
ATOM   82   N  N   . HIS A 1 33  ? 20.806  14.227 35.598  1.00 14.67 ? 11  HIS A N   1 
ATOM   83   C  CA  . HIS A 1 33  ? 21.285  14.103 36.976  1.00 15.54 ? 11  HIS A CA  1 
ATOM   84   C  C   . HIS A 1 33  ? 20.266  14.684 37.969  1.00 16.38 ? 11  HIS A C   1 
ATOM   85   O  O   . HIS A 1 33  ? 19.682  15.734 37.717  1.00 16.50 ? 11  HIS A O   1 
ATOM   86   C  CB  . HIS A 1 33  ? 22.644  14.810 37.068  1.00 15.05 ? 11  HIS A CB  1 
ATOM   87   C  CG  . HIS A 1 33  ? 23.265  14.801 38.427  1.00 17.05 ? 11  HIS A CG  1 
ATOM   88   N  ND1 . HIS A 1 33  ? 23.597  13.640 39.098  1.00 20.01 ? 11  HIS A ND1 1 
ATOM   89   C  CD2 . HIS A 1 33  ? 23.658  15.819 39.227  1.00 18.39 ? 11  HIS A CD2 1 
ATOM   90   C  CE1 . HIS A 1 33  ? 24.147  13.947 40.258  1.00 23.18 ? 11  HIS A CE1 1 
ATOM   91   N  NE2 . HIS A 1 33  ? 24.195  15.264 40.364  1.00 21.98 ? 11  HIS A NE2 1 
ATOM   92   N  N   . ASP A 1 34  ? 20.033  14.001 39.089  1.00 17.73 ? 12  ASP A N   1 
ATOM   93   C  CA  . ASP A 1 34  ? 19.030  14.464 40.054  1.00 18.82 ? 12  ASP A CA  1 
ATOM   94   C  C   . ASP A 1 34  ? 19.603  15.333 41.178  1.00 19.29 ? 12  ASP A C   1 
ATOM   95   O  O   . ASP A 1 34  ? 20.704  15.079 41.664  1.00 23.97 ? 12  ASP A O   1 
ATOM   96   C  CB  . ASP A 1 34  ? 18.289  13.274 40.670  1.00 25.50 ? 12  ASP A CB  1 
ATOM   97   C  CG  . ASP A 1 34  ? 17.331  12.615 39.699  1.00 35.24 ? 12  ASP A CG  1 
ATOM   98   O  OD1 . ASP A 1 34  ? 16.747  13.326 38.853  1.00 34.60 ? 12  ASP A OD1 1 
ATOM   99   O  OD2 . ASP A 1 34  ? 17.161  11.381 39.789  1.00 40.81 ? 12  ASP A OD2 1 
ATOM   100  N  N   . LEU A 1 35  ? 18.835  16.335 41.604  1.00 22.50 ? 13  LEU A N   1 
ATOM   101  C  CA  . LEU A 1 35  ? 19.244  17.206 42.711  1.00 21.34 ? 13  LEU A CA  1 
ATOM   102  C  C   . LEU A 1 35  ? 18.157  17.325 43.779  1.00 22.13 ? 13  LEU A C   1 
ATOM   103  O  O   . LEU A 1 35  ? 17.323  18.231 43.717  1.00 22.25 ? 13  LEU A O   1 
ATOM   104  C  CB  . LEU A 1 35  ? 19.574  18.608 42.187  1.00 19.20 ? 13  LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 35  ? 20.662  18.762 41.121  1.00 17.58 ? 13  LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 35  ? 20.683  20.192 40.582  1.00 16.66 ? 13  LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 35  ? 22.032  18.401 41.675  1.00 17.78 ? 13  LEU A CD2 1 
ATOM   108  N  N   . PRO A 1 36  ? 18.165  16.424 44.772  1.00 23.92 ? 14  PRO A N   1 
ATOM   109  C  CA  . PRO A 1 36  ? 17.177  16.511 45.857  1.00 25.61 ? 14  PRO A CA  1 
ATOM   110  C  C   . PRO A 1 36  ? 17.298  17.817 46.640  1.00 28.43 ? 14  PRO A C   1 
ATOM   111  O  O   . PRO A 1 36  ? 18.418  18.245 46.925  1.00 27.18 ? 14  PRO A O   1 
ATOM   112  C  CB  . PRO A 1 36  ? 17.546  15.331 46.762  1.00 30.26 ? 14  PRO A CB  1 
ATOM   113  C  CG  . PRO A 1 36  ? 18.271  14.378 45.868  1.00 25.82 ? 14  PRO A CG  1 
ATOM   114  C  CD  . PRO A 1 36  ? 19.031  15.238 44.903  1.00 24.74 ? 14  PRO A CD  1 
ATOM   115  N  N   . VAL A 1 37  ? 16.169  18.439 46.974  1.00 27.20 ? 15  VAL A N   1 
ATOM   116  C  CA  . VAL A 1 37  ? 16.181  19.686 47.741  1.00 28.54 ? 15  VAL A CA  1 
ATOM   117  C  C   . VAL A 1 37  ? 16.401  19.403 49.219  1.00 30.14 ? 15  VAL A C   1 
ATOM   118  O  O   . VAL A 1 37  ? 15.566  18.765 49.863  1.00 31.92 ? 15  VAL A O   1 
ATOM   119  C  CB  . VAL A 1 37  ? 14.859  20.471 47.593  1.00 28.57 ? 15  VAL A CB  1 
ATOM   120  C  CG1 . VAL A 1 37  ? 14.921  21.780 48.373  1.00 29.48 ? 15  VAL A CG1 1 
ATOM   121  C  CG2 . VAL A 1 37  ? 14.566  20.744 46.140  1.00 26.66 ? 15  VAL A CG2 1 
ATOM   122  N  N   . LYS A 1 38  ? 17.523  19.878 49.754  1.00 30.12 ? 16  LYS A N   1 
ATOM   123  C  CA  . LYS A 1 38  ? 17.803  19.721 51.177  1.00 32.29 ? 16  LYS A CA  1 
ATOM   124  C  C   . LYS A 1 38  ? 16.726  20.404 52.010  1.00 38.36 ? 16  LYS A C   1 
ATOM   125  O  O   . LYS A 1 38  ? 16.411  21.577 51.787  1.00 38.13 ? 16  LYS A O   1 
ATOM   126  C  CB  . LYS A 1 38  ? 19.194  20.262 51.524  1.00 33.68 ? 16  LYS A CB  1 
ATOM   127  C  CG  . LYS A 1 38  ? 20.318  19.272 51.240  1.00 34.63 ? 16  LYS A CG  1 
ATOM   128  C  CD  . LYS A 1 38  ? 21.685  19.942 51.210  1.00 35.94 ? 16  LYS A CD  1 
ATOM   129  C  CE  . LYS A 1 38  ? 22.066  20.528 52.557  1.00 41.82 ? 16  LYS A CE  1 
ATOM   130  N  NZ  . LYS A 1 38  ? 23.366  21.265 52.483  1.00 39.66 ? 16  LYS A NZ  1 
ATOM   131  N  N   . ASP A 1 39  ? 16.155  19.650 52.949  1.00 38.20 ? 17  ASP A N   1 
ATOM   132  C  CA  . ASP A 1 39  ? 15.065  20.124 53.801  1.00 42.74 ? 17  ASP A CA  1 
ATOM   133  C  C   . ASP A 1 39  ? 13.909  20.709 52.986  1.00 44.55 ? 17  ASP A C   1 
ATOM   134  O  O   . ASP A 1 39  ? 13.353  21.753 53.335  1.00 43.80 ? 17  ASP A O   1 
ATOM   135  C  CB  . ASP A 1 39  ? 15.576  21.145 54.822  1.00 48.77 ? 17  ASP A CB  1 
ATOM   136  C  CG  . ASP A 1 39  ? 16.573  20.545 55.801  1.00 55.75 ? 17  ASP A CG  1 
ATOM   137  O  OD1 . ASP A 1 39  ? 17.568  21.227 56.125  1.00 57.59 ? 17  ASP A OD1 1 
ATOM   138  O  OD2 . ASP A 1 39  ? 16.360  19.397 56.252  1.00 56.75 ? 17  ASP A OD2 1 
ATOM   139  N  N   . GLY A 1 40  ? 13.558  20.027 51.901  1.00 44.11 ? 18  GLY A N   1 
ATOM   140  C  CA  . GLY A 1 40  ? 12.517  20.492 51.001  1.00 43.29 ? 18  GLY A CA  1 
ATOM   141  C  C   . GLY A 1 40  ? 11.120  20.389 51.585  1.00 46.08 ? 18  GLY A C   1 
ATOM   142  O  O   . GLY A 1 40  ? 10.943  19.910 52.706  1.00 40.67 ? 18  GLY A O   1 
ATOM   143  N  N   . PRO A 1 41  ? 10.113  20.835 50.820  1.00 38.02 ? 19  PRO A N   1 
ATOM   144  C  CA  . PRO A 1 41  ? 10.303  21.374 49.469  1.00 37.96 ? 19  PRO A CA  1 
ATOM   145  C  C   . PRO A 1 41  ? 10.587  22.878 49.458  1.00 34.96 ? 19  PRO A C   1 
ATOM   146  O  O   . PRO A 1 41  ? 10.508  23.540 50.496  1.00 37.39 ? 19  PRO A O   1 
ATOM   147  C  CB  . PRO A 1 41  ? 8.948   21.104 48.816  1.00 36.38 ? 19  PRO A CB  1 
ATOM   148  C  CG  . PRO A 1 41  ? 7.980   21.254 49.939  1.00 39.90 ? 19  PRO A CG  1 
ATOM   149  C  CD  . PRO A 1 41  ? 8.685   20.737 51.176  1.00 40.78 ? 19  PRO A CD  1 
ATOM   150  N  N   . TYR A 1 42  ? 10.919  23.402 48.283  1.00 32.69 ? 20  TYR A N   1 
ATOM   151  C  CA  . TYR A 1 42  ? 11.036  24.842 48.088  1.00 34.87 ? 20  TYR A CA  1 
ATOM   152  C  C   . TYR A 1 42  ? 9.778   25.322 47.378  1.00 32.37 ? 20  TYR A C   1 
ATOM   153  O  O   . TYR A 1 42  ? 9.458   24.846 46.286  1.00 31.07 ? 20  TYR A O   1 
ATOM   154  C  CB  . TYR A 1 42  ? 12.278  25.181 47.266  1.00 32.98 ? 20  TYR A CB  1 
ATOM   155  C  CG  . TYR A 1 42  ? 12.578  26.664 47.182  1.00 35.04 ? 20  TYR A CG  1 
ATOM   156  C  CD1 . TYR A 1 42  ? 13.149  27.339 48.255  1.00 36.77 ? 20  TYR A CD1 1 
ATOM   157  C  CD2 . TYR A 1 42  ? 12.298  27.385 46.025  1.00 34.18 ? 20  TYR A CD2 1 
ATOM   158  C  CE1 . TYR A 1 42  ? 13.428  28.691 48.183  1.00 33.01 ? 20  TYR A CE1 1 
ATOM   159  C  CE2 . TYR A 1 42  ? 12.573  28.739 45.943  1.00 33.83 ? 20  TYR A CE2 1 
ATOM   160  C  CZ  . TYR A 1 42  ? 13.138  29.384 47.025  1.00 30.79 ? 20  TYR A CZ  1 
ATOM   161  O  OH  . TYR A 1 42  ? 13.412  30.729 46.945  1.00 32.59 ? 20  TYR A OH  1 
ATOM   162  N  N   . THR A 1 43  ? 9.070   26.260 48.001  1.00 34.11 ? 21  THR A N   1 
ATOM   163  C  CA  . THR A 1 43  ? 7.745   26.656 47.532  1.00 37.33 ? 21  THR A CA  1 
ATOM   164  C  C   . THR A 1 43  ? 7.710   28.046 46.906  1.00 35.55 ? 21  THR A C   1 
ATOM   165  O  O   . THR A 1 43  ? 7.834   29.060 47.596  1.00 35.09 ? 21  THR A O   1 
ATOM   166  C  CB  . THR A 1 43  ? 6.714   26.597 48.669  1.00 40.49 ? 21  THR A CB  1 
ATOM   167  O  OG1 . THR A 1 43  ? 6.760   25.305 49.286  1.00 40.89 ? 21  THR A OG1 1 
ATOM   168  C  CG2 . THR A 1 43  ? 5.312   26.848 48.133  1.00 39.13 ? 21  THR A CG2 1 
ATOM   169  N  N   . ILE A 1 44  ? 7.541   28.067 45.589  1.00 33.46 ? 22  ILE A N   1 
ATOM   170  C  CA  . ILE A 1 44  ? 7.331   29.289 44.829  1.00 31.55 ? 22  ILE A CA  1 
ATOM   171  C  C   . ILE A 1 44  ? 5.842   29.308 44.495  1.00 34.30 ? 22  ILE A C   1 
ATOM   172  O  O   . ILE A 1 44  ? 5.228   28.247 44.379  1.00 33.35 ? 22  ILE A O   1 
ATOM   173  C  CB  . ILE A 1 44  ? 8.170   29.261 43.536  1.00 28.82 ? 22  ILE A CB  1 
ATOM   174  C  CG1 . ILE A 1 44  ? 9.618   28.874 43.850  1.00 27.65 ? 22  ILE A CG1 1 
ATOM   175  C  CG2 . ILE A 1 44  ? 8.123   30.595 42.825  1.00 29.59 ? 22  ILE A CG2 1 
ATOM   176  C  CD1 . ILE A 1 44  ? 10.506  28.761 42.631  1.00 25.19 ? 22  ILE A CD1 1 
ATOM   177  N  N   . ALA A 1 45  ? 5.244   30.491 44.364  1.00 33.62 ? 23  ALA A N   1 
ATOM   178  C  CA  . ALA A 1 45  ? 3.809   30.577 44.091  1.00 35.13 ? 23  ALA A CA  1 
ATOM   179  C  C   . ALA A 1 45  ? 3.411   29.841 42.808  1.00 33.78 ? 23  ALA A C   1 
ATOM   180  O  O   . ALA A 1 45  ? 2.269   29.397 42.662  1.00 35.10 ? 23  ALA A O   1 
ATOM   181  C  CB  . ALA A 1 45  ? 3.352   32.033 44.045  1.00 35.99 ? 23  ALA A CB  1 
ATOM   182  N  N   . SER A 1 46  ? 4.365   29.702 41.895  1.00 31.30 ? 24  SER A N   1 
ATOM   183  C  CA  . SER A 1 46  ? 4.112   29.072 40.607  1.00 29.96 ? 24  SER A CA  1 
ATOM   184  C  C   . SER A 1 46  ? 4.684   27.652 40.511  1.00 33.32 ? 24  SER A C   1 
ATOM   185  O  O   . SER A 1 46  ? 4.422   26.941 39.535  1.00 31.79 ? 24  SER A O   1 
ATOM   186  C  CB  . SER A 1 46  ? 4.697   29.939 39.492  1.00 28.04 ? 24  SER A CB  1 
ATOM   187  O  OG  . SER A 1 46  ? 6.103   30.054 39.627  1.00 26.51 ? 24  SER A OG  1 
ATOM   188  N  N   . SER A 1 47  ? 5.465   27.243 41.512  1.00 29.21 ? 25  SER A N   1 
ATOM   189  C  CA  . SER A 1 47  ? 6.133   25.935 41.469  1.00 28.32 ? 25  SER A CA  1 
ATOM   190  C  C   . SER A 1 47  ? 6.626   25.476 42.843  1.00 35.04 ? 25  SER A C   1 
ATOM   191  O  O   . SER A 1 47  ? 7.404   26.174 43.493  1.00 29.41 ? 25  SER A O   1 
ATOM   192  C  CB  . SER A 1 47  ? 7.305   25.973 40.480  1.00 27.34 ? 25  SER A CB  1 
ATOM   193  O  OG  . SER A 1 47  ? 7.911   24.697 40.330  1.00 28.50 ? 25  SER A OG  1 
ATOM   194  N  N   . THR A 1 48  ? 6.166   24.304 43.283  1.00 32.42 ? 26  THR A N   1 
ATOM   195  C  CA  . THR A 1 48  ? 6.675   23.677 44.506  1.00 31.71 ? 26  THR A CA  1 
ATOM   196  C  C   . THR A 1 48  ? 7.553   22.487 44.120  1.00 31.80 ? 26  THR A C   1 
ATOM   197  O  O   . THR A 1 48  ? 7.101   21.592 43.407  1.00 32.11 ? 26  THR A O   1 
ATOM   198  C  CB  . THR A 1 48  ? 5.529   23.185 45.413  1.00 34.43 ? 26  THR A CB  1 
ATOM   199  O  OG1 . THR A 1 48  ? 4.683   24.286 45.775  1.00 35.97 ? 26  THR A OG1 1 
ATOM   200  C  CG2 . THR A 1 48  ? 6.082   22.536 46.679  1.00 35.69 ? 26  THR A CG2 1 
ATOM   201  N  N   . VAL A 1 49  ? 8.804   22.474 44.580  1.00 29.53 ? 27  VAL A N   1 
ATOM   202  C  CA  . VAL A 1 49  ? 9.748   21.428 44.168  1.00 28.15 ? 27  VAL A CA  1 
ATOM   203  C  C   . VAL A 1 49  ? 10.400  20.659 45.323  1.00 29.20 ? 27  VAL A C   1 
ATOM   204  O  O   . VAL A 1 49  ? 10.836  21.251 46.314  1.00 30.58 ? 27  VAL A O   1 
ATOM   205  C  CB  . VAL A 1 49  ? 10.842  21.977 43.225  1.00 31.49 ? 27  VAL A CB  1 
ATOM   206  C  CG1 . VAL A 1 49  ? 10.242  22.338 41.872  1.00 31.57 ? 27  VAL A CG1 1 
ATOM   207  C  CG2 . VAL A 1 49  ? 11.552  23.181 43.848  1.00 27.40 ? 27  VAL A CG2 1 
ATOM   208  N  N   . TRP A 1 50  ? 10.463  19.336 45.170  1.00 30.03 ? 28  TRP A N   1 
ATOM   209  C  CA  . TRP A 1 50  ? 11.077  18.447 46.154  1.00 30.26 ? 28  TRP A CA  1 
ATOM   210  C  C   . TRP A 1 50  ? 12.427  17.932 45.661  1.00 31.07 ? 28  TRP A C   1 
ATOM   211  O  O   . TRP A 1 50  ? 13.348  17.695 46.451  1.00 30.14 ? 28  TRP A O   1 
ATOM   212  C  CB  . TRP A 1 50  ? 10.157  17.262 46.448  1.00 33.86 ? 28  TRP A CB  1 
ATOM   213  C  CG  . TRP A 1 50  ? 9.032   17.584 47.380  1.00 40.86 ? 28  TRP A CG  1 
ATOM   214  C  CD1 . TRP A 1 50  ? 9.040   17.477 48.743  1.00 42.75 ? 28  TRP A CD1 1 
ATOM   215  C  CD2 . TRP A 1 50  ? 7.728   18.061 47.024  1.00 46.05 ? 28  TRP A CD2 1 
ATOM   216  N  NE1 . TRP A 1 50  ? 7.824   17.858 49.255  1.00 49.41 ? 28  TRP A NE1 1 
ATOM   217  C  CE2 . TRP A 1 50  ? 7.002   18.223 48.221  1.00 49.54 ? 28  TRP A CE2 1 
ATOM   218  C  CE3 . TRP A 1 50  ? 7.105   18.369 45.810  1.00 48.65 ? 28  TRP A CE3 1 
ATOM   219  C  CZ2 . TRP A 1 50  ? 5.684   18.678 48.239  1.00 55.79 ? 28  TRP A CZ2 1 
ATOM   220  C  CZ3 . TRP A 1 50  ? 5.794   18.821 45.832  1.00 52.84 ? 28  TRP A CZ3 1 
ATOM   221  C  CH2 . TRP A 1 50  ? 5.100   18.971 47.037  1.00 55.32 ? 28  TRP A CH2 1 
ATOM   222  N  N   . SER A 1 51  ? 12.530  17.745 44.351  1.00 28.46 ? 29  SER A N   1 
ATOM   223  C  CA  . SER A 1 51  ? 13.784  17.342 43.725  1.00 29.19 ? 29  SER A CA  1 
ATOM   224  C  C   . SER A 1 51  ? 13.853  17.921 42.319  1.00 27.77 ? 29  SER A C   1 
ATOM   225  O  O   . SER A 1 51  ? 12.820  18.145 41.682  1.00 25.74 ? 29  SER A O   1 
ATOM   226  C  CB  . SER A 1 51  ? 13.912  15.817 43.686  1.00 27.76 ? 29  SER A CB  1 
ATOM   227  O  OG  . SER A 1 51  ? 15.129  15.438 43.066  1.00 26.85 ? 29  SER A OG  1 
ATOM   228  N  N   . LEU A 1 52  ? 15.067  18.176 41.840  1.00 22.40 ? 30  LEU A N   1 
ATOM   229  C  CA  . LEU A 1 52  ? 15.239  18.804 40.533  1.00 20.48 ? 30  LEU A CA  1 
ATOM   230  C  C   . LEU A 1 52  ? 16.053  17.931 39.574  1.00 21.45 ? 30  LEU A C   1 
ATOM   231  O  O   . LEU A 1 52  ? 17.067  17.338 39.948  1.00 19.20 ? 30  LEU A O   1 
ATOM   232  C  CB  . LEU A 1 52  ? 15.882  20.196 40.671  1.00 21.01 ? 30  LEU A CB  1 
ATOM   233  C  CG  . LEU A 1 52  ? 15.089  21.384 41.249  1.00 20.08 ? 30  LEU A CG  1 
ATOM   234  C  CD1 . LEU A 1 52  ? 13.798  21.649 40.482  1.00 20.15 ? 30  LEU A CD1 1 
ATOM   235  C  CD2 . LEU A 1 52  ? 14.794  21.214 42.723  1.00 22.11 ? 30  LEU A CD2 1 
ATOM   236  N  N   A GLN A 1 53  ? 15.591  17.856 38.331  0.39 18.91 ? 31  GLN A N   1 
ATOM   237  N  N   B GLN A 1 53  ? 15.603  17.863 38.327  0.61 18.74 ? 31  GLN A N   1 
ATOM   238  C  CA  A GLN A 1 53  ? 16.301  17.124 37.290  0.39 18.03 ? 31  GLN A CA  1 
ATOM   239  C  CA  B GLN A 1 53  ? 16.312  17.113 37.296  0.61 17.86 ? 31  GLN A CA  1 
ATOM   240  C  C   A GLN A 1 53  ? 17.152  18.086 36.467  0.39 15.26 ? 31  GLN A C   1 
ATOM   241  C  C   B GLN A 1 53  ? 17.155  18.065 36.457  0.61 15.25 ? 31  GLN A C   1 
ATOM   242  O  O   A GLN A 1 53  ? 16.625  18.864 35.673  0.39 14.70 ? 31  GLN A O   1 
ATOM   243  O  O   B GLN A 1 53  ? 16.625  18.813 35.638  0.61 14.70 ? 31  GLN A O   1 
ATOM   244  C  CB  A GLN A 1 53  ? 15.305  16.407 36.378  0.39 19.00 ? 31  GLN A CB  1 
ATOM   245  C  CB  B GLN A 1 53  ? 15.310  16.399 36.392  0.61 18.81 ? 31  GLN A CB  1 
ATOM   246  C  CG  A GLN A 1 53  ? 15.516  14.905 36.278  0.39 22.56 ? 31  GLN A CG  1 
ATOM   247  C  CG  B GLN A 1 53  ? 14.176  15.719 37.146  0.61 18.48 ? 31  GLN A CG  1 
ATOM   248  C  CD  A GLN A 1 53  ? 16.847  14.536 35.652  0.39 21.37 ? 31  GLN A CD  1 
ATOM   249  C  CD  B GLN A 1 53  ? 12.859  15.761 36.387  0.61 31.16 ? 31  GLN A CD  1 
ATOM   250  O  OE1 A GLN A 1 53  ? 17.395  15.276 34.832  0.39 19.78 ? 31  GLN A OE1 1 
ATOM   251  O  OE1 B GLN A 1 53  ? 11.982  16.571 36.690  0.61 30.27 ? 31  GLN A OE1 1 
ATOM   252  N  NE2 A GLN A 1 53  ? 17.371  13.379 36.033  0.39 21.91 ? 31  GLN A NE2 1 
ATOM   253  N  NE2 B GLN A 1 53  ? 12.715  14.888 35.398  0.61 30.21 ? 31  GLN A NE2 1 
ATOM   254  N  N   . THR A 1 54  ? 18.467  18.040 36.655  1.00 14.77 ? 32  THR A N   1 
ATOM   255  C  CA  . THR A 1 54  ? 19.347  18.924 35.897  1.00 13.56 ? 32  THR A CA  1 
ATOM   256  C  C   . THR A 1 54  ? 19.855  18.234 34.633  1.00 12.74 ? 32  THR A C   1 
ATOM   257  O  O   . THR A 1 54  ? 19.874  17.000 34.542  1.00 13.12 ? 32  THR A O   1 
ATOM   258  C  CB  . THR A 1 54  ? 20.515  19.478 36.754  1.00 13.58 ? 32  THR A CB  1 
ATOM   259  O  OG1 . THR A 1 54  ? 21.133  20.576 36.069  1.00 12.59 ? 32  THR A OG1 1 
ATOM   260  C  CG2 . THR A 1 54  ? 21.542  18.399 37.035  1.00 13.79 ? 32  THR A CG2 1 
ATOM   261  N  N   . THR A 1 55  ? 20.229  19.046 33.649  1.00 11.77 ? 33  THR A N   1 
ATOM   262  C  CA  . THR A 1 55  ? 20.765  18.549 32.393  1.00 11.12 ? 33  THR A CA  1 
ATOM   263  C  C   . THR A 1 55  ? 22.138  19.175 32.187  1.00 10.48 ? 33  THR A C   1 
ATOM   264  O  O   . THR A 1 55  ? 22.277  20.406 32.185  1.00 10.09 ? 33  THR A O   1 
ATOM   265  C  CB  . THR A 1 55  ? 19.834  18.891 31.210  1.00 10.77 ? 33  THR A CB  1 
ATOM   266  O  OG1 . THR A 1 55  ? 18.564  18.258 31.400  1.00 11.52 ? 33  THR A OG1 1 
ATOM   267  C  CG2 . THR A 1 55  ? 20.430  18.408 29.897  1.00 12.90 ? 33  THR A CG2 1 
ATOM   268  N  N   . LEU A 1 56  ? 23.156  18.330 32.053  1.00 10.51 ? 34  LEU A N   1 
ATOM   269  C  CA  . LEU A 1 56  ? 24.510  18.818 31.810  1.00 10.60 ? 34  LEU A CA  1 
ATOM   270  C  C   . LEU A 1 56  ? 24.895  18.551 30.363  1.00 11.17 ? 34  LEU A C   1 
ATOM   271  O  O   . LEU A 1 56  ? 24.447  17.571 29.759  1.00 11.38 ? 34  LEU A O   1 
ATOM   272  C  CB  . LEU A 1 56  ? 25.532  18.160 32.748  1.00 13.04 ? 34  LEU A CB  1 
ATOM   273  C  CG  . LEU A 1 56  ? 25.344  18.184 34.275  1.00 11.72 ? 34  LEU A CG  1 
ATOM   274  C  CD1 . LEU A 1 56  ? 24.765  19.499 34.742  1.00 15.01 ? 34  LEU A CD1 1 
ATOM   275  C  CD2 . LEU A 1 56  ? 24.487  17.013 34.758  1.00 14.52 ? 34  LEU A CD2 1 
ATOM   276  N  N   . VAL A 1 57  ? 25.720  19.434 29.811  1.00 9.32  ? 35  VAL A N   1 
ATOM   277  C  CA  . VAL A 1 57  ? 26.230  19.266 28.455  1.00 10.47 ? 35  VAL A CA  1 
ATOM   278  C  C   . VAL A 1 57  ? 27.753  19.375 28.457  1.00 10.61 ? 35  VAL A C   1 
ATOM   279  O  O   . VAL A 1 57  ? 28.314  20.312 29.025  1.00 9.96  ? 35  VAL A O   1 
ATOM   280  C  CB  . VAL A 1 57  ? 25.662  20.343 27.514  1.00 15.20 ? 35  VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 57  ? 26.245  20.188 26.113  1.00 18.52 ? 35  VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 57  ? 24.153  20.252 27.459  1.00 17.33 ? 35  VAL A CG2 1 
ATOM   283  N  N   . LYS A 1 58  ? 28.416  18.411 27.826  1.00 10.35 ? 36  LYS A N   1 
ATOM   284  C  CA  . LYS A 1 58  ? 29.857  18.473 27.626  1.00 10.00 ? 36  LYS A CA  1 
ATOM   285  C  C   . LYS A 1 58  ? 30.123  18.612 26.132  1.00 10.39 ? 36  LYS A C   1 
ATOM   286  O  O   . LYS A 1 58  ? 29.680  17.774 25.334  1.00 12.92 ? 36  LYS A O   1 
ATOM   287  C  CB  . LYS A 1 58  ? 30.516  17.206 28.172  1.00 10.39 ? 36  LYS A CB  1 
ATOM   288  C  CG  . LYS A 1 58  ? 32.050  17.190 28.115  1.00 12.63 ? 36  LYS A CG  1 
ATOM   289  C  CD  . LYS A 1 58  ? 32.573  15.791 28.461  1.00 15.26 ? 36  LYS A CD  1 
ATOM   290  C  CE  . LYS A 1 58  ? 34.066  15.770 28.707  1.00 22.53 ? 36  LYS A CE  1 
ATOM   291  N  NZ  . LYS A 1 58  ? 34.525  14.369 28.962  1.00 24.86 ? 36  LYS A NZ  1 
ATOM   292  N  N   . ILE A 1 59  ? 30.816  19.682 25.752  1.00 9.54  ? 37  ILE A N   1 
ATOM   293  C  CA  . ILE A 1 59  ? 31.275  19.860 24.374  1.00 9.89  ? 37  ILE A CA  1 
ATOM   294  C  C   . ILE A 1 59  ? 32.761  19.500 24.333  1.00 11.51 ? 37  ILE A C   1 
ATOM   295  O  O   . ILE A 1 59  ? 33.546  19.967 25.158  1.00 12.98 ? 37  ILE A O   1 
ATOM   296  C  CB  . ILE A 1 59  ? 31.065  21.315 23.888  1.00 11.79 ? 37  ILE A CB  1 
ATOM   297  C  CG1 . ILE A 1 59  ? 29.578  21.678 23.851  1.00 10.77 ? 37  ILE A CG1 1 
ATOM   298  C  CG2 . ILE A 1 59  ? 31.695  21.518 22.508  1.00 18.92 ? 37  ILE A CG2 1 
ATOM   299  C  CD1 . ILE A 1 59  ? 29.328  23.131 23.426  1.00 17.68 ? 37  ILE A CD1 1 
ATOM   300  N  N   . VAL A 1 60  ? 33.144  18.628 23.402  1.00 11.07 ? 38  VAL A N   1 
ATOM   301  C  CA  . VAL A 1 60  ? 34.538  18.230 23.266  1.00 11.97 ? 38  VAL A CA  1 
ATOM   302  C  C   . VAL A 1 60  ? 35.048  18.715 21.922  1.00 14.24 ? 38  VAL A C   1 
ATOM   303  O  O   . VAL A 1 60  ? 34.440  18.429 20.884  1.00 13.52 ? 38  VAL A O   1 
ATOM   304  C  CB  . VAL A 1 60  ? 34.695  16.695 23.316  1.00 12.70 ? 38  VAL A CB  1 
ATOM   305  C  CG1 . VAL A 1 60  ? 36.174  16.277 23.188  1.00 13.82 ? 38  VAL A CG1 1 
ATOM   306  C  CG2 . VAL A 1 60  ? 34.065  16.108 24.591  1.00 13.94 ? 38  VAL A CG2 1 
ATOM   307  N  N   . ALA A 1 61  ? 36.162  19.445 21.937  1.00 12.87 ? 39  ALA A N   1 
ATOM   308  C  CA  . ALA A 1 61  ? 36.789  19.914 20.704  1.00 15.69 ? 39  ALA A CA  1 
ATOM   309  C  C   . ALA A 1 61  ? 37.582  18.799 20.028  1.00 14.86 ? 39  ALA A C   1 
ATOM   310  O  O   . ALA A 1 61  ? 37.861  17.761 20.635  1.00 16.06 ? 39  ALA A O   1 
ATOM   311  C  CB  . ALA A 1 61  ? 37.702  21.101 20.994  1.00 16.78 ? 39  ALA A CB  1 
ATOM   312  N  N   . ASP A 1 62  ? 37.948  19.024 18.767  1.00 15.01 ? 40  ASP A N   1 
ATOM   313  C  CA  . ASP A 1 62  ? 38.823  18.097 18.041  1.00 17.44 ? 40  ASP A CA  1 
ATOM   314  C  C   . ASP A 1 62  ? 40.086  17.782 18.834  1.00 20.11 ? 40  ASP A C   1 
ATOM   315  O  O   . ASP A 1 62  ? 40.601  16.663 18.786  1.00 20.52 ? 40  ASP A O   1 
ATOM   316  C  CB  . ASP A 1 62  ? 39.255  18.695 16.701  1.00 25.56 ? 40  ASP A CB  1 
ATOM   317  C  CG  . ASP A 1 62  ? 38.190  18.602 15.640  1.00 33.07 ? 40  ASP A CG  1 
ATOM   318  O  OD1 . ASP A 1 62  ? 37.313  17.717 15.737  1.00 32.60 ? 40  ASP A OD1 1 
ATOM   319  O  OD2 . ASP A 1 62  ? 38.248  19.411 14.689  1.00 38.13 ? 40  ASP A OD2 1 
ATOM   320  N  N   . SER A 1 63  ? 40.583  18.782 19.557  1.00 19.92 ? 41  SER A N   1 
ATOM   321  C  CA  . SER A 1 63  ? 41.823  18.650 20.314  1.00 23.57 ? 41  SER A CA  1 
ATOM   322  C  C   . SER A 1 63  ? 41.660  17.806 21.575  1.00 23.03 ? 41  SER A C   1 
ATOM   323  O  O   . SER A 1 63  ? 42.648  17.384 22.179  1.00 23.01 ? 41  SER A O   1 
ATOM   324  C  CB  . SER A 1 63  ? 42.346  20.035 20.691  1.00 21.16 ? 41  SER A CB  1 
ATOM   325  O  OG  . SER A 1 63  ? 41.388  20.746 21.462  1.00 24.57 ? 41  SER A OG  1 
ATOM   326  N  N   . GLY A 1 64  ? 40.416  17.566 21.981  1.00 19.07 ? 42  GLY A N   1 
ATOM   327  C  CA  . GLY A 1 64  ? 40.155  16.820 23.198  1.00 17.82 ? 42  GLY A CA  1 
ATOM   328  C  C   . GLY A 1 64  ? 39.763  17.719 24.359  1.00 17.68 ? 42  GLY A C   1 
ATOM   329  O  O   . GLY A 1 64  ? 39.254  17.246 25.379  1.00 18.15 ? 42  GLY A O   1 
ATOM   330  N  N   . LEU A 1 65  ? 39.999  19.018 24.204  1.00 13.65 ? 43  LEU A N   1 
ATOM   331  C  CA  . LEU A 1 65  ? 39.619  19.995 25.228  1.00 14.10 ? 43  LEU A CA  1 
ATOM   332  C  C   . LEU A 1 65  ? 38.100  20.032 25.386  1.00 13.94 ? 43  LEU A C   1 
ATOM   333  O  O   . LEU A 1 65  ? 37.367  19.977 24.396  1.00 13.99 ? 43  LEU A O   1 
ATOM   334  C  CB  . LEU A 1 65  ? 40.146  21.381 24.856  1.00 15.78 ? 43  LEU A CB  1 
ATOM   335  C  CG  . LEU A 1 65  ? 40.117  22.455 25.944  1.00 19.72 ? 43  LEU A CG  1 
ATOM   336  C  CD1 . LEU A 1 65  ? 41.054  22.076 27.072  1.00 21.61 ? 43  LEU A CD1 1 
ATOM   337  C  CD2 . LEU A 1 65  ? 40.481  23.815 25.356  1.00 15.97 ? 43  LEU A CD2 1 
ATOM   338  N  N   . ALA A 1 66  ? 37.626  20.133 26.626  1.00 11.26 ? 44  ALA A N   1 
ATOM   339  C  CA  . ALA A 1 66  ? 36.183  20.076 26.884  1.00 11.85 ? 44  ALA A CA  1 
ATOM   340  C  C   . ALA A 1 66  ? 35.652  21.301 27.619  1.00 11.16 ? 44  ALA A C   1 
ATOM   341  O  O   . ALA A 1 66  ? 36.343  21.878 28.455  1.00 14.27 ? 44  ALA A O   1 
ATOM   342  C  CB  . ALA A 1 66  ? 35.845  18.815 27.671  1.00 14.77 ? 44  ALA A CB  1 
ATOM   343  N  N   . GLY A 1 67  ? 34.415  21.682 27.309  1.00 12.13 ? 45  GLY A N   1 
ATOM   344  C  CA  . GLY A 1 67  ? 33.706  22.699 28.071  1.00 9.54  ? 45  GLY A CA  1 
ATOM   345  C  C   . GLY A 1 67  ? 32.373  22.165 28.577  1.00 9.57  ? 45  GLY A C   1 
ATOM   346  O  O   . GLY A 1 67  ? 31.763  21.284 27.952  1.00 10.37 ? 45  GLY A O   1 
ATOM   347  N  N   . TRP A 1 68  ? 31.916  22.692 29.712  1.00 9.71  ? 46  TRP A N   1 
ATOM   348  C  CA  . TRP A 1 68  ? 30.678  22.229 30.331  1.00 8.33  ? 46  TRP A CA  1 
ATOM   349  C  C   . TRP A 1 68  ? 29.605  23.305 30.455  1.00 8.22  ? 46  TRP A C   1 
ATOM   350  O  O   . TRP A 1 68  ? 29.896  24.460 30.795  1.00 8.53  ? 46  TRP A O   1 
ATOM   351  C  CB  . TRP A 1 68  ? 30.963  21.683 31.731  1.00 9.12  ? 46  TRP A CB  1 
ATOM   352  C  CG  . TRP A 1 68  ? 31.624  20.351 31.736  1.00 8.77  ? 46  TRP A CG  1 
ATOM   353  C  CD1 . TRP A 1 68  ? 32.966  20.103 31.742  1.00 11.57 ? 46  TRP A CD1 1 
ATOM   354  C  CD2 . TRP A 1 68  ? 30.977  19.070 31.774  1.00 9.10  ? 46  TRP A CD2 1 
ATOM   355  N  NE1 . TRP A 1 68  ? 33.193  18.748 31.766  1.00 11.79 ? 46  TRP A NE1 1 
ATOM   356  C  CE2 . TRP A 1 68  ? 31.992  18.095 31.784  1.00 11.44 ? 46  TRP A CE2 1 
ATOM   357  C  CE3 . TRP A 1 68  ? 29.642  18.657 31.792  1.00 9.08  ? 46  TRP A CE3 1 
ATOM   358  C  CZ2 . TRP A 1 68  ? 31.711  16.729 31.817  1.00 12.44 ? 46  TRP A CZ2 1 
ATOM   359  C  CZ3 . TRP A 1 68  ? 29.365  17.305 31.821  1.00 11.20 ? 46  TRP A CZ3 1 
ATOM   360  C  CH2 . TRP A 1 68  ? 30.397  16.355 31.833  1.00 11.39 ? 46  TRP A CH2 1 
ATOM   361  N  N   . GLY A 1 69  ? 28.359  22.896 30.209  1.00 7.65  ? 47  GLY A N   1 
ATOM   362  C  CA  . GLY A 1 69  ? 27.190  23.741 30.413  1.00 8.54  ? 47  GLY A CA  1 
ATOM   363  C  C   . GLY A 1 69  ? 26.115  23.020 31.219  1.00 8.66  ? 47  GLY A C   1 
ATOM   364  O  O   . GLY A 1 69  ? 26.207  21.806 31.460  1.00 9.28  ? 47  GLY A O   1 
ATOM   365  N  N   . GLU A 1 70  ? 25.100  23.764 31.659  1.00 7.90  ? 48  GLU A N   1 
ATOM   366  C  CA  . GLU A 1 70  ? 24.060  23.203 32.526  1.00 7.16  ? 48  GLU A CA  1 
ATOM   367  C  C   . GLU A 1 70  ? 22.770  24.001 32.388  1.00 7.05  ? 48  GLU A C   1 
ATOM   368  O  O   . GLU A 1 70  ? 22.807  25.223 32.234  1.00 8.27  ? 48  GLU A O   1 
ATOM   369  C  CB  . GLU A 1 70  ? 24.526  23.204 34.003  1.00 7.56  ? 48  GLU A CB  1 
ATOM   370  C  CG  . GLU A 1 70  ? 23.444  22.730 35.006  1.00 9.67  ? 48  GLU A CG  1 
ATOM   371  C  CD  . GLU A 1 70  ? 23.997  22.456 36.400  1.00 9.64  ? 48  GLU A CD  1 
ATOM   372  O  OE1 . GLU A 1 70  ? 25.094  22.964 36.730  1.00 8.48  ? 48  GLU A OE1 1 
ATOM   373  O  OE2 . GLU A 1 70  ? 23.335  21.730 37.184  1.00 10.22 ? 48  GLU A OE2 1 
ATOM   374  N  N   . THR A 1 71  ? 21.637  23.305 32.441  1.00 7.27  ? 49  THR A N   1 
ATOM   375  C  CA  . THR A 1 71  ? 20.331  23.962 32.534  1.00 7.34  ? 49  THR A CA  1 
ATOM   376  C  C   . THR A 1 71  ? 19.393  23.138 33.421  1.00 8.22  ? 49  THR A C   1 
ATOM   377  O  O   . THR A 1 71  ? 19.272  21.920 33.251  1.00 8.19  ? 49  THR A O   1 
ATOM   378  C  CB  . THR A 1 71  ? 19.741  24.239 31.124  1.00 7.39  ? 49  THR A CB  1 
ATOM   379  O  OG1 . THR A 1 71  ? 18.518  24.972 31.249  1.00 10.39 ? 49  THR A OG1 1 
ATOM   380  C  CG2 . THR A 1 71  ? 19.514  22.937 30.343  1.00 8.25  ? 49  THR A CG2 1 
ATOM   381  N  N   . CYS A 1 72  ? 18.764  23.792 34.396  1.00 8.26  ? 50  CYS A N   1 
ATOM   382  C  CA  . CYS A 1 72  ? 17.924  23.095 35.362  1.00 9.63  ? 50  CYS A CA  1 
ATOM   383  C  C   . CYS A 1 72  ? 16.675  23.904 35.704  1.00 9.00  ? 50  CYS A C   1 
ATOM   384  O  O   . CYS A 1 72  ? 16.684  24.700 36.638  1.00 11.09 ? 50  CYS A O   1 
ATOM   385  C  CB  . CYS A 1 72  ? 18.728  22.813 36.638  1.00 11.03 ? 50  CYS A CB  1 
ATOM   386  S  SG  . CYS A 1 72  ? 17.862  21.776 37.840  1.00 12.73 ? 50  CYS A SG  1 
ATOM   387  N  N   . PRO A 1 73  ? 15.589  23.708 34.940  1.00 11.63 ? 51  PRO A N   1 
ATOM   388  C  CA  . PRO A 1 73  ? 14.321  24.372 35.274  1.00 14.15 ? 51  PRO A CA  1 
ATOM   389  C  C   . PRO A 1 73  ? 13.884  24.045 36.697  1.00 12.94 ? 51  PRO A C   1 
ATOM   390  O  O   . PRO A 1 73  ? 14.141  22.943 37.186  1.00 14.64 ? 51  PRO A O   1 
ATOM   391  C  CB  . PRO A 1 73  ? 13.340  23.785 34.252  1.00 14.84 ? 51  PRO A CB  1 
ATOM   392  C  CG  . PRO A 1 73  ? 14.195  23.459 33.083  1.00 13.25 ? 51  PRO A CG  1 
ATOM   393  C  CD  . PRO A 1 73  ? 15.523  23.005 33.647  1.00 13.10 ? 51  PRO A CD  1 
ATOM   394  N  N   . VAL A 1 74  ? 13.256  25.004 37.366  1.00 12.37 ? 52  VAL A N   1 
ATOM   395  C  CA  . VAL A 1 74  ? 12.862  24.819 38.756  1.00 13.80 ? 52  VAL A CA  1 
ATOM   396  C  C   . VAL A 1 74  ? 11.423  24.292 38.829  1.00 17.14 ? 52  VAL A C   1 
ATOM   397  O  O   . VAL A 1 74  ? 10.486  24.985 39.234  1.00 17.76 ? 52  VAL A O   1 
ATOM   398  C  CB  . VAL A 1 74  ? 13.110  26.108 39.605  1.00 16.08 ? 52  VAL A CB  1 
ATOM   399  C  CG1 . VAL A 1 74  ? 12.317  27.315 39.088  1.00 17.14 ? 52  VAL A CG1 1 
ATOM   400  C  CG2 . VAL A 1 74  ? 12.855  25.849 41.085  1.00 15.78 ? 52  VAL A CG2 1 
ATOM   401  N  N   . GLY A 1 75  ? 11.264  23.039 38.418  1.00 17.12 ? 53  GLY A N   1 
ATOM   402  C  CA  . GLY A 1 75  ? 9.949   22.453 38.255  1.00 17.00 ? 53  GLY A CA  1 
ATOM   403  C  C   . GLY A 1 75  ? 9.419   22.826 36.885  1.00 16.73 ? 53  GLY A C   1 
ATOM   404  O  O   . GLY A 1 75  ? 9.881   23.798 36.285  1.00 16.24 ? 53  GLY A O   1 
ATOM   405  N  N   . PRO A 1 76  ? 8.451   22.055 36.378  1.00 12.83 ? 54  PRO A N   1 
ATOM   406  C  CA  . PRO A 1 76  ? 7.969   22.280 35.012  1.00 12.70 ? 54  PRO A CA  1 
ATOM   407  C  C   . PRO A 1 76  ? 6.909   23.374 34.903  1.00 13.41 ? 54  PRO A C   1 
ATOM   408  O  O   . PRO A 1 76  ? 6.475   23.656 33.785  1.00 12.83 ? 54  PRO A O   1 
ATOM   409  C  CB  . PRO A 1 76  ? 7.371   20.920 34.635  1.00 12.60 ? 54  PRO A CB  1 
ATOM   410  C  CG  . PRO A 1 76  ? 6.922   20.338 35.933  1.00 13.91 ? 54  PRO A CG  1 
ATOM   411  C  CD  . PRO A 1 76  ? 7.957   20.785 36.940  1.00 13.30 ? 54  PRO A CD  1 
ATOM   412  N  N   . THR A 1 77  ? 6.520   23.987 36.020  1.00 13.29 ? 55  THR A N   1 
ATOM   413  C  CA  . THR A 1 77  ? 5.471   25.013 35.988  1.00 13.84 ? 55  THR A CA  1 
ATOM   414  C  C   . THR A 1 77  ? 5.960   26.448 36.250  1.00 13.64 ? 55  THR A C   1 
ATOM   415  O  O   . THR A 1 77  ? 5.163   27.387 36.196  1.00 16.19 ? 55  THR A O   1 
ATOM   416  C  CB  . THR A 1 77  ? 4.299   24.685 36.947  1.00 17.37 ? 55  THR A CB  1 
ATOM   417  O  OG1 . THR A 1 77  ? 4.798   24.467 38.276  1.00 18.41 ? 55  THR A OG1 1 
ATOM   418  C  CG2 . THR A 1 77  ? 3.558   23.442 36.495  1.00 15.32 ? 55  THR A CG2 1 
ATOM   419  N  N   . TYR A 1 78  ? 7.245   26.627 36.541  1.00 13.17 ? 56  TYR A N   1 
ATOM   420  C  CA  . TYR A 1 78  ? 7.748   27.974 36.852  1.00 14.70 ? 56  TYR A CA  1 
ATOM   421  C  C   . TYR A 1 78  ? 7.821   28.829 35.591  1.00 16.98 ? 56  TYR A C   1 
ATOM   422  O  O   . TYR A 1 78  ? 7.465   30.014 35.599  1.00 17.85 ? 56  TYR A O   1 
ATOM   423  C  CB  . TYR A 1 78  ? 9.139   27.912 37.499  1.00 14.83 ? 56  TYR A CB  1 
ATOM   424  C  CG  . TYR A 1 78  ? 9.761   29.272 37.786  1.00 13.33 ? 56  TYR A CG  1 
ATOM   425  C  CD1 . TYR A 1 78  ? 9.496   29.943 38.976  1.00 14.05 ? 56  TYR A CD1 1 
ATOM   426  C  CD2 . TYR A 1 78  ? 10.627  29.873 36.874  1.00 15.86 ? 56  TYR A CD2 1 
ATOM   427  C  CE1 . TYR A 1 78  ? 10.075  31.187 39.252  1.00 13.74 ? 56  TYR A CE1 1 
ATOM   428  C  CE2 . TYR A 1 78  ? 11.207  31.117 37.137  1.00 20.29 ? 56  TYR A CE2 1 
ATOM   429  C  CZ  . TYR A 1 78  ? 10.919  31.765 38.323  1.00 17.59 ? 56  TYR A CZ  1 
ATOM   430  O  OH  . TYR A 1 78  ? 11.485  32.997 38.599  1.00 16.94 ? 56  TYR A OH  1 
ATOM   431  N  N   . ALA A 1 79  ? 8.288   28.205 34.514  1.00 15.48 ? 57  ALA A N   1 
ATOM   432  C  CA  . ALA A 1 79  ? 8.570   28.882 33.258  1.00 14.87 ? 57  ALA A CA  1 
ATOM   433  C  C   . ALA A 1 79  ? 8.303   27.882 32.152  1.00 15.29 ? 57  ALA A C   1 
ATOM   434  O  O   . ALA A 1 79  ? 8.160   26.689 32.425  1.00 13.28 ? 57  ALA A O   1 
ATOM   435  C  CB  . ALA A 1 79  ? 10.030  29.331 33.223  1.00 10.91 ? 57  ALA A CB  1 
ATOM   436  N  N   . PRO A 1 80  ? 8.223   28.354 30.898  1.00 14.59 ? 58  PRO A N   1 
ATOM   437  C  CA  . PRO A 1 80  ? 7.941   27.407 29.809  1.00 11.91 ? 58  PRO A CA  1 
ATOM   438  C  C   . PRO A 1 80  ? 9.177   26.593 29.452  1.00 10.60 ? 58  PRO A C   1 
ATOM   439  O  O   . PRO A 1 80  ? 9.784   26.760 28.387  1.00 13.81 ? 58  PRO A O   1 
ATOM   440  C  CB  . PRO A 1 80  ? 7.497   28.315 28.655  1.00 16.66 ? 58  PRO A CB  1 
ATOM   441  C  CG  . PRO A 1 80  ? 8.091   29.666 28.978  1.00 22.37 ? 58  PRO A CG  1 
ATOM   442  C  CD  . PRO A 1 80  ? 8.079   29.760 30.471  1.00 16.81 ? 58  PRO A CD  1 
ATOM   443  N  N   . SER A 1 81  ? 9.548   25.708 30.371  1.00 10.53 ? 59  SER A N   1 
ATOM   444  C  CA  . SER A 1 81  ? 10.763  24.926 30.263  1.00 10.84 ? 59  SER A CA  1 
ATOM   445  C  C   . SER A 1 81  ? 10.660  23.757 31.230  1.00 10.76 ? 59  SER A C   1 
ATOM   446  O  O   . SER A 1 81  ? 9.980   23.852 32.257  1.00 13.39 ? 59  SER A O   1 
ATOM   447  C  CB  . SER A 1 81  ? 11.969  25.787 30.634  1.00 14.73 ? 59  SER A CB  1 
ATOM   448  O  OG  . SER A 1 81  ? 11.805  26.350 31.927  1.00 20.33 ? 59  SER A OG  1 
ATOM   449  N  N   . HIS A 1 82  ? 11.312  22.649 30.888  1.00 10.90 ? 60  HIS A N   1 
ATOM   450  C  CA  . HIS A 1 82  ? 11.294  21.449 31.724  1.00 10.43 ? 60  HIS A CA  1 
ATOM   451  C  C   . HIS A 1 82  ? 12.446  20.520 31.348  1.00 9.68  ? 60  HIS A C   1 
ATOM   452  O  O   . HIS A 1 82  ? 12.986  20.632 30.260  1.00 9.52  ? 60  HIS A O   1 
ATOM   453  C  CB  . HIS A 1 82  ? 9.923   20.735 31.693  1.00 10.55 ? 60  HIS A CB  1 
ATOM   454  C  CG  . HIS A 1 82  ? 9.543   20.121 30.373  1.00 10.37 ? 60  HIS A CG  1 
ATOM   455  N  ND1 . HIS A 1 82  ? 9.492   20.826 29.189  1.00 15.46 ? 60  HIS A ND1 1 
ATOM   456  C  CD2 . HIS A 1 82  ? 9.115   18.869 30.082  1.00 10.70 ? 60  HIS A CD2 1 
ATOM   457  C  CE1 . HIS A 1 82  ? 9.082   20.024 28.218  1.00 10.09 ? 60  HIS A CE1 1 
ATOM   458  N  NE2 . HIS A 1 82  ? 8.845   18.832 28.734  1.00 12.86 ? 60  HIS A NE2 1 
ATOM   459  N  N   . ALA A 1 83  ? 12.834  19.622 32.249  1.00 11.04 ? 61  ALA A N   1 
ATOM   460  C  CA  . ALA A 1 83  ? 14.010  18.778 32.015  1.00 12.53 ? 61  ALA A CA  1 
ATOM   461  C  C   . ALA A 1 83  ? 13.918  17.936 30.736  1.00 10.86 ? 61  ALA A C   1 
ATOM   462  O  O   . ALA A 1 83  ? 14.869  17.891 29.948  1.00 10.12 ? 61  ALA A O   1 
ATOM   463  C  CB  . ALA A 1 83  ? 14.287  17.894 33.223  1.00 12.23 ? 61  ALA A CB  1 
ATOM   464  N  N   . LEU A 1 84  ? 12.783  17.269 30.530  1.00 10.07 ? 62  LEU A N   1 
ATOM   465  C  CA  . LEU A 1 84  ? 12.603  16.467 29.321  1.00 10.57 ? 62  LEU A CA  1 
ATOM   466  C  C   . LEU A 1 84  ? 12.672  17.365 28.093  1.00 11.27 ? 62  LEU A C   1 
ATOM   467  O  O   . LEU A 1 84  ? 13.169  16.957 27.038  1.00 9.47  ? 62  LEU A O   1 
ATOM   468  C  CB  . LEU A 1 84  ? 11.274  15.709 29.349  1.00 11.47 ? 62  LEU A CB  1 
ATOM   469  C  CG  . LEU A 1 84  ? 11.101  14.636 30.422  1.00 15.02 ? 62  LEU A CG  1 
ATOM   470  C  CD1 . LEU A 1 84  ? 9.727   13.997 30.322  1.00 15.79 ? 62  LEU A CD1 1 
ATOM   471  C  CD2 . LEU A 1 84  ? 12.189  13.574 30.297  1.00 18.05 ? 62  LEU A CD2 1 
ATOM   472  N  N   . GLY A 1 85  ? 12.194  18.598 28.240  1.00 9.27  ? 63  GLY A N   1 
ATOM   473  C  CA  . GLY A 1 85  ? 12.242  19.561 27.153  1.00 9.65  ? 63  GLY A CA  1 
ATOM   474  C  C   . GLY A 1 85  ? 13.646  20.048 26.849  1.00 8.36  ? 63  GLY A C   1 
ATOM   475  O  O   . GLY A 1 85  ? 13.995  20.268 25.690  1.00 8.11  ? 63  GLY A O   1 
ATOM   476  N  N   . ALA A 1 86  ? 14.452  20.244 27.885  1.00 8.25  ? 64  ALA A N   1 
ATOM   477  C  CA  . ALA A 1 86  ? 15.847  20.620 27.680  1.00 7.83  ? 64  ALA A CA  1 
ATOM   478  C  C   . ALA A 1 86  ? 16.563  19.550 26.870  1.00 7.82  ? 64  ALA A C   1 
ATOM   479  O  O   . ALA A 1 86  ? 17.276  19.850 25.912  1.00 9.28  ? 64  ALA A O   1 
ATOM   480  C  CB  . ALA A 1 86  ? 16.542  20.823 29.017  1.00 11.00 ? 64  ALA A CB  1 
ATOM   481  N  N   . ARG A 1 87  ? 16.364  18.296 27.247  1.00 8.20  ? 65  ARG A N   1 
ATOM   482  C  CA  . ARG A 1 87  ? 17.048  17.207 26.566  1.00 9.73  ? 65  ARG A CA  1 
ATOM   483  C  C   . ARG A 1 87  ? 16.556  17.019 25.138  1.00 10.36 ? 65  ARG A C   1 
ATOM   484  O  O   . ARG A 1 87  ? 17.342  16.684 24.250  1.00 9.49  ? 65  ARG A O   1 
ATOM   485  C  CB  . ARG A 1 87  ? 16.943  15.930 27.394  1.00 11.21 ? 65  ARG A CB  1 
ATOM   486  C  CG  . ARG A 1 87  ? 17.562  16.156 28.770  1.00 14.31 ? 65  ARG A CG  1 
ATOM   487  C  CD  . ARG A 1 87  ? 18.104  14.900 29.382  1.00 28.04 ? 65  ARG A CD  1 
ATOM   488  N  NE  . ARG A 1 87  ? 17.122  14.257 30.249  1.00 34.12 ? 65  ARG A NE  1 
ATOM   489  C  CZ  . ARG A 1 87  ? 16.875  14.633 31.500  1.00 30.63 ? 65  ARG A CZ  1 
ATOM   490  N  NH1 . ARG A 1 87  ? 15.973  13.984 32.226  1.00 23.12 ? 65  ARG A NH1 1 
ATOM   491  N  NH2 . ARG A 1 87  ? 17.524  15.664 32.024  1.00 24.39 ? 65  ARG A NH2 1 
ATOM   492  N  N   . ALA A 1 88  ? 15.265  17.252 24.907  1.00 8.47  ? 66  ALA A N   1 
ATOM   493  C  CA  . ALA A 1 88  ? 14.734  17.169 23.550  1.00 9.38  ? 66  ALA A CA  1 
ATOM   494  C  C   . ALA A 1 88  ? 15.288  18.280 22.669  1.00 8.16  ? 66  ALA A C   1 
ATOM   495  O  O   . ALA A 1 88  ? 15.624  18.054 21.498  1.00 9.67  ? 66  ALA A O   1 
ATOM   496  C  CB  . ALA A 1 88  ? 13.217  17.207 23.567  1.00 10.23 ? 66  ALA A CB  1 
ATOM   497  N  N   . ALA A 1 89  ? 15.393  19.482 23.225  1.00 7.87  ? 67  ALA A N   1 
ATOM   498  C  CA  . ALA A 1 89  ? 15.920  20.602 22.460  1.00 7.57  ? 67  ALA A CA  1 
ATOM   499  C  C   . ALA A 1 89  ? 17.390  20.392 22.111  1.00 7.41  ? 67  ALA A C   1 
ATOM   500  O  O   . ALA A 1 89  ? 17.803  20.669 20.984  1.00 8.34  ? 67  ALA A O   1 
ATOM   501  C  CB  . ALA A 1 89  ? 15.709  21.919 23.210  1.00 7.83  ? 67  ALA A CB  1 
ATOM   502  N  N   . LEU A 1 90  ? 18.167  19.894 23.069  1.00 7.71  ? 68  LEU A N   1 
ATOM   503  C  CA  . LEU A 1 90  ? 19.575  19.598 22.822  1.00 7.66  ? 68  LEU A CA  1 
ATOM   504  C  C   . LEU A 1 90  ? 19.733  18.490 21.793  1.00 10.52 ? 68  LEU A C   1 
ATOM   505  O  O   . LEU A 1 90  ? 20.638  18.556 20.962  1.00 10.58 ? 68  LEU A O   1 
ATOM   506  C  CB  . LEU A 1 90  ? 20.296  19.240 24.127  1.00 7.35  ? 68  LEU A CB  1 
ATOM   507  C  CG  . LEU A 1 90  ? 20.418  20.417 25.094  1.00 8.51  ? 68  LEU A CG  1 
ATOM   508  C  CD1 . LEU A 1 90  ? 20.736  19.923 26.491  1.00 10.54 ? 68  LEU A CD1 1 
ATOM   509  C  CD2 . LEU A 1 90  ? 21.490  21.374 24.615  1.00 11.32 ? 68  LEU A CD2 1 
ATOM   510  N  N   . ALA A 1 91  ? 18.871  17.468 21.850  1.00 9.07  ? 69  ALA A N   1 
ATOM   511  C  CA  . ALA A 1 91  ? 18.898  16.394 20.845  1.00 10.44 ? 69  ALA A CA  1 
ATOM   512  C  C   . ALA A 1 91  ? 18.608  16.921 19.442  1.00 11.86 ? 69  ALA A C   1 
ATOM   513  O  O   . ALA A 1 91  ? 19.198  16.453 18.460  1.00 12.51 ? 69  ALA A O   1 
ATOM   514  C  CB  . ALA A 1 91  ? 17.918  15.270 21.208  1.00 9.64  ? 69  ALA A CB  1 
ATOM   515  N  N   . GLU A 1 92  ? 17.688  17.875 19.342  1.00 10.11 ? 70  GLU A N   1 
ATOM   516  C  CA  . GLU A 1 92  ? 17.375  18.485 18.058  1.00 9.98  ? 70  GLU A CA  1 
ATOM   517  C  C   . GLU A 1 92  ? 18.559  19.270 17.492  1.00 11.18 ? 70  GLU A C   1 
ATOM   518  O  O   . GLU A 1 92  ? 18.873  19.157 16.303  1.00 11.99 ? 70  GLU A O   1 
ATOM   519  C  CB  . GLU A 1 92  ? 16.143  19.397 18.171  1.00 11.76 ? 70  GLU A CB  1 
ATOM   520  C  CG  . GLU A 1 92  ? 15.704  20.036 16.844  1.00 15.60 ? 70  GLU A CG  1 
ATOM   521  C  CD  . GLU A 1 92  ? 15.363  19.018 15.757  1.00 22.67 ? 70  GLU A CD  1 
ATOM   522  O  OE1 . GLU A 1 92  ? 14.853  17.922 16.079  1.00 27.06 ? 70  GLU A OE1 1 
ATOM   523  O  OE2 . GLU A 1 92  ? 15.610  19.316 14.567  1.00 18.97 ? 70  GLU A OE2 1 
ATOM   524  N  N   . MET A 1 93  ? 19.218  20.057 18.344  1.00 9.74  ? 71  MET A N   1 
ATOM   525  C  CA  . MET A 1 93  ? 20.288  20.944 17.887  1.00 7.83  ? 71  MET A CA  1 
ATOM   526  C  C   . MET A 1 93  ? 21.652  20.272 17.721  1.00 9.71  ? 71  MET A C   1 
ATOM   527  O  O   . MET A 1 93  ? 22.404  20.626 16.820  1.00 9.94  ? 71  MET A O   1 
ATOM   528  C  CB  . MET A 1 93  ? 20.450  22.127 18.846  1.00 8.17  ? 71  MET A CB  1 
ATOM   529  C  CG  . MET A 1 93  ? 19.265  23.079 18.850  1.00 9.34  ? 71  MET A CG  1 
ATOM   530  S  SD  . MET A 1 93  ? 19.563  24.532 19.873  1.00 8.60  ? 71  MET A SD  1 
ATOM   531  C  CE  . MET A 1 93  ? 19.656  23.824 21.521  1.00 9.75  ? 71  MET A CE  1 
ATOM   532  N  N   . ALA A 1 94  ? 21.981  19.327 18.593  1.00 8.87  ? 72  ALA A N   1 
ATOM   533  C  CA  . ALA A 1 94  ? 23.354  18.801 18.628  1.00 9.42  ? 72  ALA A CA  1 
ATOM   534  C  C   . ALA A 1 94  ? 23.952  18.316 17.289  1.00 11.11 ? 72  ALA A C   1 
ATOM   535  O  O   . ALA A 1 94  ? 25.090  18.670 16.971  1.00 11.25 ? 72  ALA A O   1 
ATOM   536  C  CB  . ALA A 1 94  ? 23.498  17.729 19.708  1.00 10.44 ? 72  ALA A CB  1 
ATOM   537  N  N   . PRO A 1 95  ? 23.210  17.509 16.505  1.00 10.27 ? 73  PRO A N   1 
ATOM   538  C  CA  . PRO A 1 95  ? 23.806  17.054 15.243  1.00 12.60 ? 73  PRO A CA  1 
ATOM   539  C  C   . PRO A 1 95  ? 24.221  18.213 14.338  1.00 11.66 ? 73  PRO A C   1 
ATOM   540  O  O   . PRO A 1 95  ? 25.227  18.109 13.621  1.00 11.67 ? 73  PRO A O   1 
ATOM   541  C  CB  . PRO A 1 95  ? 22.673  16.245 14.599  1.00 12.80 ? 73  PRO A CB  1 
ATOM   542  C  CG  . PRO A 1 95  ? 21.916  15.714 15.777  1.00 10.99 ? 73  PRO A CG  1 
ATOM   543  C  CD  . PRO A 1 95  ? 21.904  16.862 16.748  1.00 11.65 ? 73  PRO A CD  1 
ATOM   544  N  N   . GLY A 1 96  ? 23.459  19.303 14.380  1.00 11.15 ? 74  GLY A N   1 
ATOM   545  C  CA  . GLY A 1 96  ? 23.724  20.456 13.538  1.00 13.10 ? 74  GLY A CA  1 
ATOM   546  C  C   . GLY A 1 96  ? 24.837  21.348 14.057  1.00 12.75 ? 74  GLY A C   1 
ATOM   547  O  O   . GLY A 1 96  ? 25.190  22.333 13.407  1.00 13.01 ? 74  GLY A O   1 
ATOM   548  N  N   . LEU A 1 97  ? 25.388  21.009 15.219  1.00 9.64  ? 75  LEU A N   1 
ATOM   549  C  CA  . LEU A 1 97  ? 26.444  21.820 15.826  1.00 10.38 ? 75  LEU A CA  1 
ATOM   550  C  C   . LEU A 1 97  ? 27.814  21.157 15.710  1.00 10.98 ? 75  LEU A C   1 
ATOM   551  O  O   . LEU A 1 97  ? 28.842  21.796 15.951  1.00 11.61 ? 75  LEU A O   1 
ATOM   552  C  CB  . LEU A 1 97  ? 26.117  22.127 17.296  1.00 9.21  ? 75  LEU A CB  1 
ATOM   553  C  CG  . LEU A 1 97  ? 24.883  22.991 17.561  1.00 9.60  ? 75  LEU A CG  1 
ATOM   554  C  CD1 . LEU A 1 97  ? 24.642  23.107 19.068  1.00 10.76 ? 75  LEU A CD1 1 
ATOM   555  C  CD2 . LEU A 1 97  ? 25.059  24.377 16.944  1.00 11.91 ? 75  LEU A CD2 1 
ATOM   556  N  N   . ILE A 1 98  ? 27.835  19.875 15.355  1.00 10.21 ? 76  ILE A N   1 
ATOM   557  C  CA  . ILE A 1 98  ? 29.107  19.183 15.141  1.00 10.96 ? 76  ILE A CA  1 
ATOM   558  C  C   . ILE A 1 98  ? 29.869  19.884 14.012  1.00 12.24 ? 76  ILE A C   1 
ATOM   559  O  O   . ILE A 1 98  ? 29.317  20.125 12.930  1.00 14.86 ? 76  ILE A O   1 
ATOM   560  C  CB  . ILE A 1 98  ? 28.908  17.683 14.822  1.00 13.51 ? 76  ILE A CB  1 
ATOM   561  C  CG1 . ILE A 1 98  ? 28.112  16.984 15.937  1.00 12.05 ? 76  ILE A CG1 1 
ATOM   562  C  CG2 . ILE A 1 98  ? 30.254  17.001 14.615  1.00 13.41 ? 76  ILE A CG2 1 
ATOM   563  C  CD1 . ILE A 1 98  ? 28.755  17.087 17.337  1.00 12.24 ? 76  ILE A CD1 1 
ATOM   564  N  N   . GLY A 1 99  ? 31.116  20.262 14.289  1.00 12.37 ? 77  GLY A N   1 
ATOM   565  C  CA  . GLY A 1 99  ? 31.940  20.965 13.318  1.00 14.56 ? 77  GLY A CA  1 
ATOM   566  C  C   . GLY A 1 99  ? 31.971  22.479 13.474  1.00 15.49 ? 77  GLY A C   1 
ATOM   567  O  O   . GLY A 1 99  ? 32.779  23.153 12.828  1.00 17.52 ? 77  GLY A O   1 
ATOM   568  N  N   . ALA A 1 100 ? 31.092  23.018 14.317  1.00 13.51 ? 78  ALA A N   1 
ATOM   569  C  CA  . ALA A 1 100 ? 31.030  24.462 14.555  1.00 14.16 ? 78  ALA A CA  1 
ATOM   570  C  C   . ALA A 1 100 ? 32.236  24.962 15.344  1.00 15.12 ? 78  ALA A C   1 
ATOM   571  O  O   . ALA A 1 100 ? 32.865  24.205 16.077  1.00 13.50 ? 78  ALA A O   1 
ATOM   572  C  CB  . ALA A 1 100 ? 29.749  24.823 15.292  1.00 12.54 ? 78  ALA A CB  1 
ATOM   573  N  N   . ASN A 1 101 ? 32.548  26.244 15.194  1.00 12.49 ? 79  ASN A N   1 
ATOM   574  C  CA  . ASN A 1 101 ? 33.631  26.871 15.948  1.00 13.87 ? 79  ASN A CA  1 
ATOM   575  C  C   . ASN A 1 101 ? 33.131  27.344 17.315  1.00 11.32 ? 79  ASN A C   1 
ATOM   576  O  O   . ASN A 1 101 ? 32.357  28.301 17.406  1.00 13.14 ? 79  ASN A O   1 
ATOM   577  C  CB  . ASN A 1 101 ? 34.190  28.050 15.133  1.00 12.34 ? 79  ASN A CB  1 
ATOM   578  C  CG  . ASN A 1 101 ? 35.431  28.674 15.757  1.00 13.31 ? 79  ASN A CG  1 
ATOM   579  O  OD1 . ASN A 1 101 ? 35.725  28.467 16.931  1.00 11.74 ? 79  ASN A OD1 1 
ATOM   580  N  ND2 . ASN A 1 101 ? 36.168  29.450 14.962  1.00 14.33 ? 79  ASN A ND2 1 
ATOM   581  N  N   . PRO A 1 102 ? 33.582  26.686 18.404  1.00 12.43 ? 80  PRO A N   1 
ATOM   582  C  CA  . PRO A 1 102 ? 33.042  27.052 19.718  1.00 12.73 ? 80  PRO A CA  1 
ATOM   583  C  C   . PRO A 1 102 ? 33.651  28.331 20.292  1.00 13.19 ? 80  PRO A C   1 
ATOM   584  O  O   . PRO A 1 102 ? 33.293  28.742 21.397  1.00 14.69 ? 80  PRO A O   1 
ATOM   585  C  CB  . PRO A 1 102 ? 33.425  25.845 20.587  1.00 13.39 ? 80  PRO A CB  1 
ATOM   586  C  CG  . PRO A 1 102 ? 34.716  25.382 19.999  1.00 13.51 ? 80  PRO A CG  1 
ATOM   587  C  CD  . PRO A 1 102 ? 34.591  25.613 18.501  1.00 11.65 ? 80  PRO A CD  1 
ATOM   588  N  N   . LEU A 1 103 ? 34.558  28.961 19.549  1.00 10.86 ? 81  LEU A N   1 
ATOM   589  C  CA  . LEU A 1 103 ? 35.246  30.153 20.026  1.00 8.71  ? 81  LEU A CA  1 
ATOM   590  C  C   . LEU A 1 103 ? 34.555  31.428 19.554  1.00 12.01 ? 81  LEU A C   1 
ATOM   591  O  O   . LEU A 1 103 ? 35.100  32.523 19.711  1.00 11.18 ? 81  LEU A O   1 
ATOM   592  C  CB  . LEU A 1 103 ? 36.707  30.159 19.564  1.00 9.16  ? 81  LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 103 ? 37.567  28.941 19.905  1.00 10.42 ? 81  LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 103 ? 38.937  29.081 19.269  1.00 12.95 ? 81  LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 103 ? 37.696  28.773 21.429  1.00 12.43 ? 81  LEU A CD2 1 
ATOM   596  N  N   . GLN A 1 104 ? 33.366  31.276 18.967  1.00 10.46 ? 82  GLN A N   1 
ATOM   597  C  CA  . GLN A 1 104 ? 32.607  32.398 18.400  1.00 8.10  ? 82  GLN A CA  1 
ATOM   598  C  C   . GLN A 1 104 ? 31.181  32.368 18.938  1.00 7.62  ? 82  GLN A C   1 
ATOM   599  O  O   . GLN A 1 104 ? 30.279  31.866 18.273  1.00 7.99  ? 82  GLN A O   1 
ATOM   600  C  CB  . GLN A 1 104 ? 32.578  32.287 16.872  1.00 8.59  ? 82  GLN A CB  1 
ATOM   601  C  CG  . GLN A 1 104 ? 33.956  32.271 16.228  1.00 9.56  ? 82  GLN A CG  1 
ATOM   602  C  CD  . GLN A 1 104 ? 33.899  32.082 14.728  1.00 11.75 ? 82  GLN A CD  1 
ATOM   603  O  OE1 . GLN A 1 104 ? 33.102  31.285 14.224  1.00 14.06 ? 82  GLN A OE1 1 
ATOM   604  N  NE2 . GLN A 1 104 ? 34.759  32.800 14.002  1.00 10.42 ? 82  GLN A NE2 1 
ATOM   605  N  N   . PRO A 1 105 ? 30.970  32.910 20.141  1.00 9.59  ? 83  PRO A N   1 
ATOM   606  C  CA  . PRO A 1 105 ? 29.678  32.691 20.800  1.00 8.17  ? 83  PRO A CA  1 
ATOM   607  C  C   . PRO A 1 105 ? 28.479  33.283 20.076  1.00 8.94  ? 83  PRO A C   1 
ATOM   608  O  O   . PRO A 1 105 ? 27.389  32.711 20.165  1.00 9.13  ? 83  PRO A O   1 
ATOM   609  C  CB  . PRO A 1 105 ? 29.855  33.349 22.174  1.00 11.16 ? 83  PRO A CB  1 
ATOM   610  C  CG  . PRO A 1 105 ? 31.045  34.279 22.023  1.00 18.07 ? 83  PRO A CG  1 
ATOM   611  C  CD  . PRO A 1 105 ? 31.929  33.627 21.001  1.00 10.90 ? 83  PRO A CD  1 
ATOM   612  N  N   . LEU A 1 106 ? 28.657  34.400 19.378  1.00 7.80  ? 84  LEU A N   1 
ATOM   613  C  CA  . LEU A 1 106 ? 27.539  34.991 18.644  1.00 8.44  ? 84  LEU A CA  1 
ATOM   614  C  C   . LEU A 1 106 ? 27.228  34.207 17.360  1.00 8.66  ? 84  LEU A C   1 
ATOM   615  O  O   . LEU A 1 106 ? 26.064  33.962 17.024  1.00 7.60  ? 84  LEU A O   1 
ATOM   616  C  CB  . LEU A 1 106 ? 27.806  36.473 18.342  1.00 8.90  ? 84  LEU A CB  1 
ATOM   617  C  CG  . LEU A 1 106 ? 26.729  37.221 17.555  1.00 9.75  ? 84  LEU A CG  1 
ATOM   618  C  CD1 . LEU A 1 106 ? 25.359  36.996 18.168  1.00 9.96  ? 84  LEU A CD1 1 
ATOM   619  C  CD2 . LEU A 1 106 ? 27.023  38.722 17.457  1.00 10.78 ? 84  LEU A CD2 1 
ATOM   620  N  N   . VAL A 1 107 ? 28.268  33.820 16.634  1.00 7.92  ? 85  VAL A N   1 
ATOM   621  C  CA  . VAL A 1 107 ? 28.089  32.974 15.453  1.00 8.39  ? 85  VAL A CA  1 
ATOM   622  C  C   . VAL A 1 107 ? 27.442  31.647 15.868  1.00 8.92  ? 85  VAL A C   1 
ATOM   623  O  O   . VAL A 1 107 ? 26.552  31.124 15.182  1.00 9.94  ? 85  VAL A O   1 
ATOM   624  C  CB  . VAL A 1 107 ? 29.435  32.735 14.736  1.00 9.20  ? 85  VAL A CB  1 
ATOM   625  C  CG1 . VAL A 1 107 ? 29.277  31.750 13.591  1.00 9.81  ? 85  VAL A CG1 1 
ATOM   626  C  CG2 . VAL A 1 107 ? 29.997  34.059 14.205  1.00 9.70  ? 85  VAL A CG2 1 
ATOM   627  N  N   . LEU A 1 108 ? 27.872  31.115 17.006  1.00 9.50  ? 86  LEU A N   1 
ATOM   628  C  CA  . LEU A 1 108 ? 27.317  29.861 17.502  1.00 7.76  ? 86  LEU A CA  1 
ATOM   629  C  C   . LEU A 1 108 ? 25.833  30.009 17.857  1.00 9.92  ? 86  LEU A C   1 
ATOM   630  O  O   . LEU A 1 108 ? 25.032  29.109 17.578  1.00 9.42  ? 86  LEU A O   1 
ATOM   631  C  CB  . LEU A 1 108 ? 28.131  29.346 18.701  1.00 7.83  ? 86  LEU A CB  1 
ATOM   632  C  CG  . LEU A 1 108 ? 27.812  27.922 19.189  1.00 10.19 ? 86  LEU A CG  1 
ATOM   633  C  CD1 . LEU A 1 108 ? 28.149  26.890 18.122  1.00 11.99 ? 86  LEU A CD1 1 
ATOM   634  C  CD2 . LEU A 1 108 ? 28.585  27.625 20.469  1.00 12.50 ? 86  LEU A CD2 1 
ATOM   635  N  N   A ARG A 1 109 ? 25.470  31.136 18.464  0.59 6.92  ? 87  ARG A N   1 
ATOM   636  N  N   B ARG A 1 109 ? 25.465  31.130 18.479  0.41 8.69  ? 87  ARG A N   1 
ATOM   637  C  CA  A ARG A 1 109 ? 24.073  31.385 18.800  0.59 6.80  ? 87  ARG A CA  1 
ATOM   638  C  CA  B ARG A 1 109 ? 24.060  31.389 18.805  0.41 10.34 ? 87  ARG A CA  1 
ATOM   639  C  C   A ARG A 1 109 ? 23.199  31.444 17.549  0.59 9.90  ? 87  ARG A C   1 
ATOM   640  C  C   B ARG A 1 109 ? 23.189  31.457 17.553  0.41 9.93  ? 87  ARG A C   1 
ATOM   641  O  O   A ARG A 1 109 ? 22.110  30.872 17.515  0.59 9.99  ? 87  ARG A O   1 
ATOM   642  O  O   B ARG A 1 109 ? 22.091  30.900 17.522  0.41 9.97  ? 87  ARG A O   1 
ATOM   643  C  CB  A ARG A 1 109 ? 23.919  32.672 19.619  0.59 10.85 ? 87  ARG A CB  1 
ATOM   644  C  CB  B ARG A 1 109 ? 23.904  32.669 19.644  0.41 11.16 ? 87  ARG A CB  1 
ATOM   645  C  CG  A ARG A 1 109 ? 22.502  32.889 20.116  0.59 13.78 ? 87  ARG A CG  1 
ATOM   646  C  CG  B ARG A 1 109 ? 22.484  33.248 19.655  0.41 14.38 ? 87  ARG A CG  1 
ATOM   647  C  CD  A ARG A 1 109 ? 22.382  34.117 21.019  0.59 12.90 ? 87  ARG A CD  1 
ATOM   648  C  CD  B ARG A 1 109 ? 22.153  33.947 20.976  0.41 15.48 ? 87  ARG A CD  1 
ATOM   649  N  NE  A ARG A 1 109 ? 22.616  35.387 20.329  0.59 7.99  ? 87  ARG A NE  1 
ATOM   650  N  NE  B ARG A 1 109 ? 21.531  33.029 21.926  0.41 17.39 ? 87  ARG A NE  1 
ATOM   651  C  CZ  A ARG A 1 109 ? 21.763  35.943 19.472  0.59 12.34 ? 87  ARG A CZ  1 
ATOM   652  C  CZ  B ARG A 1 109 ? 20.234  33.014 22.223  0.41 10.15 ? 87  ARG A CZ  1 
ATOM   653  N  NH1 A ARG A 1 109 ? 20.621  35.332 19.162  0.59 14.94 ? 87  ARG A NH1 1 
ATOM   654  N  NH1 B ARG A 1 109 ? 19.397  33.881 21.661  0.41 13.00 ? 87  ARG A NH1 1 
ATOM   655  N  NH2 A ARG A 1 109 ? 22.057  37.104 18.905  0.59 13.63 ? 87  ARG A NH2 1 
ATOM   656  N  NH2 B ARG A 1 109 ? 19.775  32.126 23.087  0.41 6.74  ? 87  ARG A NH2 1 
ATOM   657  N  N   . ARG A 1 110 ? 23.674  32.135 16.516  1.00 9.45  ? 88  ARG A N   1 
ATOM   658  C  CA  . ARG A 1 110 ? 22.933  32.191 15.252  1.00 8.86  ? 88  ARG A CA  1 
ATOM   659  C  C   . ARG A 1 110 ? 22.780  30.807 14.628  1.00 9.15  ? 88  ARG A C   1 
ATOM   660  O  O   . ARG A 1 110 ? 21.744  30.496 14.025  1.00 9.59  ? 88  ARG A O   1 
ATOM   661  C  CB  . ARG A 1 110 ? 23.586  33.146 14.244  1.00 8.39  ? 88  ARG A CB  1 
ATOM   662  C  CG  . ARG A 1 110 ? 23.570  34.597 14.682  1.00 8.37  ? 88  ARG A CG  1 
ATOM   663  C  CD  . ARG A 1 110 ? 23.894  35.520 13.510  1.00 9.54  ? 88  ARG A CD  1 
ATOM   664  N  NE  . ARG A 1 110 ? 24.157  36.874 13.985  1.00 9.87  ? 88  ARG A NE  1 
ATOM   665  C  CZ  . ARG A 1 110 ? 25.358  37.450 13.977  1.00 10.31 ? 88  ARG A CZ  1 
ATOM   666  N  NH1 . ARG A 1 110 ? 26.406  36.801 13.469  1.00 12.50 ? 88  ARG A NH1 1 
ATOM   667  N  NH2 . ARG A 1 110 ? 25.510  38.674 14.458  1.00 9.36  ? 88  ARG A NH2 1 
ATOM   668  N  N   . ARG A 1 111 ? 23.808  29.976 14.766  1.00 8.77  ? 89  ARG A N   1 
ATOM   669  C  CA  . ARG A 1 111 ? 23.736  28.623 14.221  1.00 8.03  ? 89  ARG A CA  1 
ATOM   670  C  C   . ARG A 1 111 ? 22.650  27.849 14.958  1.00 10.27 ? 89  ARG A C   1 
ATOM   671  O  O   . ARG A 1 111 ? 21.865  27.145 14.333  1.00 10.12 ? 89  ARG A O   1 
ATOM   672  C  CB  . ARG A 1 111 ? 25.086  27.913 14.333  1.00 8.95  ? 89  ARG A CB  1 
ATOM   673  C  CG  . ARG A 1 111 ? 25.128  26.557 13.632  1.00 9.70  ? 89  ARG A CG  1 
ATOM   674  C  CD  . ARG A 1 111 ? 26.569  26.120 13.390  1.00 18.81 ? 89  ARG A CD  1 
ATOM   675  N  NE  . ARG A 1 111 ? 26.664  24.717 12.989  1.00 20.56 ? 89  ARG A NE  1 
ATOM   676  C  CZ  . ARG A 1 111 ? 27.667  24.218 12.274  1.00 24.62 ? 89  ARG A CZ  1 
ATOM   677  N  NH1 . ARG A 1 111 ? 27.683  22.926 11.953  1.00 19.97 ? 89  ARG A NH1 1 
ATOM   678  N  NH2 . ARG A 1 111 ? 28.653  25.015 11.875  1.00 22.70 ? 89  ARG A NH2 1 
ATOM   679  N  N   . MET A 1 112 ? 22.583  28.014 16.276  1.00 9.08  ? 90  MET A N   1 
ATOM   680  C  CA  . MET A 1 112 ? 21.525  27.370 17.058  1.00 9.57  ? 90  MET A CA  1 
ATOM   681  C  C   . MET A 1 112 ? 20.145  27.860 16.639  1.00 10.15 ? 90  MET A C   1 
ATOM   682  O  O   . MET A 1 112 ? 19.211  27.060 16.522  1.00 8.62  ? 90  MET A O   1 
ATOM   683  C  CB  . MET A 1 112 ? 21.733  27.579 18.563  1.00 8.07  ? 90  MET A CB  1 
ATOM   684  C  CG  . MET A 1 112 ? 22.857  26.735 19.126  1.00 8.22  ? 90  MET A CG  1 
ATOM   685  S  SD  . MET A 1 112 ? 22.919  26.732 20.924  1.00 8.74  ? 90  MET A SD  1 
ATOM   686  C  CE  . MET A 1 112 ? 23.636  28.345 21.248  1.00 9.74  ? 90  MET A CE  1 
ATOM   687  N  N   . ASP A 1 113 ? 20.019  29.164 16.397  1.00 7.98  ? 91  ASP A N   1 
ATOM   688  C  CA  . ASP A 1 113 ? 18.744  29.742 15.970  1.00 9.37  ? 91  ASP A CA  1 
ATOM   689  C  C   . ASP A 1 113 ? 18.324  29.152 14.632  1.00 9.72  ? 91  ASP A C   1 
ATOM   690  O  O   . ASP A 1 113 ? 17.131  29.051 14.327  1.00 13.44 ? 91  ASP A O   1 
ATOM   691  C  CB  . ASP A 1 113 ? 18.860  31.266 15.830  1.00 9.24  ? 91  ASP A CB  1 
ATOM   692  C  CG  . ASP A 1 113 ? 18.972  31.986 17.160  1.00 14.15 ? 91  ASP A CG  1 
ATOM   693  O  OD1 . ASP A 1 113 ? 18.699  31.396 18.228  1.00 12.77 ? 91  ASP A OD1 1 
ATOM   694  O  OD2 . ASP A 1 113 ? 19.327  33.186 17.128  1.00 14.57 ? 91  ASP A OD2 1 
ATOM   695  N  N   . GLY A 1 114 ? 19.312  28.757 13.830  1.00 8.20  ? 92  GLY A N   1 
ATOM   696  C  CA  . GLY A 1 114 ? 19.040  28.175 12.530  1.00 9.74  ? 92  GLY A CA  1 
ATOM   697  C  C   . GLY A 1 114 ? 18.594  26.724 12.603  1.00 11.88 ? 92  GLY A C   1 
ATOM   698  O  O   . GLY A 1 114 ? 18.186  26.147 11.591  1.00 13.70 ? 92  GLY A O   1 
ATOM   699  N  N   . LEU A 1 115 ? 18.673  26.141 13.800  1.00 9.96  ? 93  LEU A N   1 
ATOM   700  C  CA  . LEU A 1 115 ? 18.328  24.736 14.020  1.00 8.24  ? 93  LEU A CA  1 
ATOM   701  C  C   . LEU A 1 115 ? 17.061  24.567 14.858  1.00 9.68  ? 93  LEU A C   1 
ATOM   702  O  O   . LEU A 1 115 ? 16.365  23.550 14.746  1.00 10.15 ? 93  LEU A O   1 
ATOM   703  C  CB  . LEU A 1 115 ? 19.487  24.009 14.713  1.00 8.98  ? 93  LEU A CB  1 
ATOM   704  C  CG  . LEU A 1 115 ? 20.829  23.967 13.981  1.00 8.67  ? 93  LEU A CG  1 
ATOM   705  C  CD1 . LEU A 1 115 ? 21.935  23.475 14.905  1.00 10.92 ? 93  LEU A CD1 1 
ATOM   706  C  CD2 . LEU A 1 115 ? 20.732  23.085 12.750  1.00 11.46 ? 93  LEU A CD2 1 
ATOM   707  N  N   . LEU A 1 116 ? 16.772  25.557 15.699  1.00 8.34  ? 94  LEU A N   1 
ATOM   708  C  CA  . LEU A 1 116 ? 15.623  25.494 16.603  1.00 7.85  ? 94  LEU A CA  1 
ATOM   709  C  C   . LEU A 1 116 ? 15.204  26.896 17.027  1.00 8.61  ? 94  LEU A C   1 
ATOM   710  O  O   . LEU A 1 116 ? 16.033  27.682 17.497  1.00 8.12  ? 94  LEU A O   1 
ATOM   711  C  CB  . LEU A 1 116 ? 15.972  24.661 17.837  1.00 7.62  ? 94  LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 116 ? 14.897  24.487 18.917  1.00 9.29  ? 94  LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 116 ? 13.665  23.761 18.366  1.00 12.17 ? 94  LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 116 ? 15.478  23.748 20.116  1.00 8.68  ? 94  LEU A CD2 1 
ATOM   715  N  N   . CYS A 1 117 ? 13.920  27.208 16.858  1.00 8.65  ? 95  CYS A N   1 
ATOM   716  C  CA  . CYS A 1 117 ? 13.387  28.496 17.292  1.00 9.74  ? 95  CYS A CA  1 
ATOM   717  C  C   . CYS A 1 117 ? 13.110  28.460 18.791  1.00 9.43  ? 95  CYS A C   1 
ATOM   718  O  O   . CYS A 1 117 ? 12.588  27.468 19.312  1.00 9.09  ? 95  CYS A O   1 
ATOM   719  C  CB  . CYS A 1 117 ? 12.103  28.798 16.515  1.00 8.79  ? 95  CYS A CB  1 
ATOM   720  S  SG  . CYS A 1 117 ? 11.212  30.278 17.039  1.00 13.83 ? 95  CYS A SG  1 
ATOM   721  N  N   . GLY A 1 118 ? 13.484  29.530 19.485  1.00 9.25  ? 96  GLY A N   1 
ATOM   722  C  CA  . GLY A 1 118 ? 13.193  29.666 20.906  1.00 9.63  ? 96  GLY A CA  1 
ATOM   723  C  C   . GLY A 1 118 ? 14.055  28.735 21.730  1.00 7.91  ? 96  GLY A C   1 
ATOM   724  O  O   . GLY A 1 118 ? 15.211  28.495 21.390  1.00 9.41  ? 96  GLY A O   1 
ATOM   725  N  N   . HIS A 1 119 ? 13.486  28.213 22.812  1.00 7.61  ? 97  HIS A N   1 
ATOM   726  C  CA  . HIS A 1 119 ? 14.189  27.260 23.677  1.00 7.56  ? 97  HIS A CA  1 
ATOM   727  C  C   . HIS A 1 119 ? 15.518  27.810 24.199  1.00 8.53  ? 97  HIS A C   1 
ATOM   728  O  O   . HIS A 1 119 ? 16.521  27.097 24.241  1.00 7.48  ? 97  HIS A O   1 
ATOM   729  C  CB  . HIS A 1 119 ? 14.399  25.933 22.935  1.00 8.87  ? 97  HIS A CB  1 
ATOM   730  C  CG  . HIS A 1 119 ? 13.119  25.265 22.535  1.00 7.72  ? 97  HIS A CG  1 
ATOM   731  N  ND1 . HIS A 1 119 ? 12.394  25.643 21.422  1.00 8.10  ? 97  HIS A ND1 1 
ATOM   732  C  CD2 . HIS A 1 119 ? 12.428  24.252 23.108  1.00 7.96  ? 97  HIS A CD2 1 
ATOM   733  C  CE1 . HIS A 1 119 ? 11.315  24.886 21.327  1.00 8.37  ? 97  HIS A CE1 1 
ATOM   734  N  NE2 . HIS A 1 119 ? 11.310  24.032 22.336  1.00 9.80  ? 97  HIS A NE2 1 
ATOM   735  N  N   . ASN A 1 120 ? 15.511  29.080 24.600  1.00 8.14  ? 98  ASN A N   1 
ATOM   736  C  CA  . ASN A 1 120 ? 16.699  29.708 25.179  1.00 6.82  ? 98  ASN A CA  1 
ATOM   737  C  C   . ASN A 1 120 ? 17.332  28.901 26.308  1.00 6.69  ? 98  ASN A C   1 
ATOM   738  O  O   . ASN A 1 120 ? 18.557  28.852 26.421  1.00 7.24  ? 98  ASN A O   1 
ATOM   739  C  CB  . ASN A 1 120 ? 16.367  31.107 25.700  1.00 8.91  ? 98  ASN A CB  1 
ATOM   740  C  CG  . ASN A 1 120 ? 16.525  32.179 24.638  1.00 12.39 ? 98  ASN A CG  1 
ATOM   741  O  OD1 . ASN A 1 120 ? 17.121  31.937 23.581  1.00 11.90 ? 98  ASN A OD1 1 
ATOM   742  N  ND2 . ASN A 1 120 ? 15.999  33.376 24.913  1.00 10.29 ? 98  ASN A ND2 1 
ATOM   743  N  N   . TYR A 1 121 ? 16.502  28.274 27.147  1.00 6.93  ? 99  TYR A N   1 
ATOM   744  C  CA  . TYR A 1 121 ? 17.030  27.533 28.295  1.00 6.92  ? 99  TYR A CA  1 
ATOM   745  C  C   . TYR A 1 121 ? 17.922  26.362 27.896  1.00 8.53  ? 99  TYR A C   1 
ATOM   746  O  O   . TYR A 1 121 ? 18.821  25.993 28.645  1.00 9.73  ? 99  TYR A O   1 
ATOM   747  C  CB  . TYR A 1 121 ? 15.912  27.095 29.249  1.00 8.36  ? 99  TYR A CB  1 
ATOM   748  C  CG  . TYR A 1 121 ? 15.014  25.963 28.788  1.00 11.10 ? 99  TYR A CG  1 
ATOM   749  C  CD1 . TYR A 1 121 ? 14.022  26.167 27.834  1.00 10.25 ? 99  TYR A CD1 1 
ATOM   750  C  CD2 . TYR A 1 121 ? 15.106  24.704 29.377  1.00 14.24 ? 99  TYR A CD2 1 
ATOM   751  C  CE1 . TYR A 1 121 ? 13.187  25.115 27.437  1.00 17.22 ? 99  TYR A CE1 1 
ATOM   752  C  CE2 . TYR A 1 121 ? 14.271  23.668 29.004  1.00 15.47 ? 99  TYR A CE2 1 
ATOM   753  C  CZ  . TYR A 1 121 ? 13.314  23.875 28.042  1.00 16.18 ? 99  TYR A CZ  1 
ATOM   754  O  OH  . TYR A 1 121 ? 12.485  22.827 27.696  1.00 11.57 ? 99  TYR A OH  1 
ATOM   755  N  N   . ALA A 1 122 ? 17.699  25.804 26.711  1.00 7.63  ? 100 ALA A N   1 
ATOM   756  C  CA  . ALA A 1 122 ? 18.561  24.742 26.196  1.00 9.09  ? 100 ALA A CA  1 
ATOM   757  C  C   . ALA A 1 122 ? 19.770  25.326 25.466  1.00 6.38  ? 100 ALA A C   1 
ATOM   758  O  O   . ALA A 1 122 ? 20.898  24.863 25.659  1.00 8.29  ? 100 ALA A O   1 
ATOM   759  C  CB  . ALA A 1 122 ? 17.774  23.827 25.271  1.00 10.13 ? 100 ALA A CB  1 
ATOM   760  N  N   . LYS A 1 123 ? 19.529  26.331 24.623  1.00 6.51  ? 101 LYS A N   1 
ATOM   761  C  CA  . LYS A 1 123 ? 20.625  27.036 23.953  1.00 6.20  ? 101 LYS A CA  1 
ATOM   762  C  C   . LYS A 1 123 ? 21.656  27.544 24.956  1.00 7.17  ? 101 LYS A C   1 
ATOM   763  O  O   . LYS A 1 123 ? 22.853  27.542 24.676  1.00 7.08  ? 101 LYS A O   1 
ATOM   764  C  CB  . LYS A 1 123 ? 20.093  28.194 23.101  1.00 6.27  ? 101 LYS A CB  1 
ATOM   765  C  CG  . LYS A 1 123 ? 19.306  27.718 21.877  1.00 6.45  ? 101 LYS A CG  1 
ATOM   766  C  CD  . LYS A 1 123 ? 18.696  28.881 21.132  1.00 7.73  ? 101 LYS A CD  1 
ATOM   767  C  CE  . LYS A 1 123 ? 17.872  28.364 19.950  1.00 6.88  ? 101 LYS A CE  1 
ATOM   768  N  NZ  . LYS A 1 123 ? 17.049  29.450 19.318  1.00 9.87  ? 101 LYS A NZ  1 
ATOM   769  N  N   . ALA A 1 124 ? 21.190  27.988 26.122  1.00 7.60  ? 102 ALA A N   1 
ATOM   770  C  CA  . ALA A 1 124 ? 22.103  28.534 27.134  1.00 6.48  ? 102 ALA A CA  1 
ATOM   771  C  C   . ALA A 1 124 ? 23.165  27.537 27.583  1.00 8.06  ? 102 ALA A C   1 
ATOM   772  O  O   . ALA A 1 124 ? 24.296  27.924 27.855  1.00 6.65  ? 102 ALA A O   1 
ATOM   773  C  CB  . ALA A 1 124 ? 21.323  29.058 28.331  1.00 6.86  ? 102 ALA A CB  1 
ATOM   774  N  N   . ALA A 1 125 ? 22.800  26.259 27.659  1.00 7.88  ? 103 ALA A N   1 
ATOM   775  C  CA  . ALA A 1 125 ? 23.737  25.219 28.085  1.00 8.49  ? 103 ALA A CA  1 
ATOM   776  C  C   . ALA A 1 125 ? 24.871  25.054 27.080  1.00 8.97  ? 103 ALA A C   1 
ATOM   777  O  O   . ALA A 1 125 ? 26.019  24.820 27.457  1.00 9.30  ? 103 ALA A O   1 
ATOM   778  C  CB  . ALA A 1 125 ? 23.009  23.898 28.298  1.00 8.02  ? 103 ALA A CB  1 
ATOM   779  N  N   . ILE A 1 126 ? 24.549  25.171 25.796  1.00 6.69  ? 104 ILE A N   1 
ATOM   780  C  CA  . ILE A 1 126 ? 25.574  25.133 24.759  1.00 8.41  ? 104 ILE A CA  1 
ATOM   781  C  C   . ILE A 1 126 ? 26.454  26.389 24.820  1.00 7.13  ? 104 ILE A C   1 
ATOM   782  O  O   . ILE A 1 126 ? 27.684  26.291 24.761  1.00 8.26  ? 104 ILE A O   1 
ATOM   783  C  CB  . ILE A 1 126 ? 24.946  24.992 23.355  1.00 7.02  ? 104 ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 126 ? 24.251  23.624 23.197  1.00 9.80  ? 104 ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 126 ? 26.001  25.191 22.264  1.00 8.80  ? 104 ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 126 ? 25.184  22.426 23.205  1.00 12.36 ? 104 ILE A CD1 1 
ATOM   787  N  N   . ASP A 1 127 ? 25.818  27.556 24.935  1.00 6.01  ? 105 ASP A N   1 
ATOM   788  C  CA  . ASP A 1 127 ? 26.520  28.836 25.079  1.00 5.98  ? 105 ASP A CA  1 
ATOM   789  C  C   . ASP A 1 127 ? 27.536  28.769 26.233  1.00 8.57  ? 105 ASP A C   1 
ATOM   790  O  O   . ASP A 1 127 ? 28.708  29.164 26.079  1.00 6.19  ? 105 ASP A O   1 
ATOM   791  C  CB  . ASP A 1 127 ? 25.475  29.962 25.265  1.00 6.89  ? 105 ASP A CB  1 
ATOM   792  C  CG  . ASP A 1 127 ? 26.073  31.288 25.719  1.00 10.25 ? 105 ASP A CG  1 
ATOM   793  O  OD1 . ASP A 1 127 ? 26.564  31.352 26.861  1.00 8.93  ? 105 ASP A OD1 1 
ATOM   794  O  OD2 . ASP A 1 127 ? 25.995  32.286 24.957  1.00 9.76  ? 105 ASP A OD2 1 
ATOM   795  N  N   . ILE A 1 128 ? 27.098  28.246 27.378  1.00 6.27  ? 106 ILE A N   1 
ATOM   796  C  CA  . ILE A 1 128 ? 27.946  28.222 28.566  1.00 6.14  ? 106 ILE A CA  1 
ATOM   797  C  C   . ILE A 1 128 ? 29.134  27.282 28.375  1.00 6.87  ? 106 ILE A C   1 
ATOM   798  O  O   . ILE A 1 128 ? 30.276  27.624 28.723  1.00 6.96  ? 106 ILE A O   1 
ATOM   799  C  CB  . ILE A 1 128 ? 27.140  27.849 29.829  1.00 6.78  ? 106 ILE A CB  1 
ATOM   800  C  CG1 . ILE A 1 128 ? 26.200  29.007 30.201  1.00 8.88  ? 106 ILE A CG1 1 
ATOM   801  C  CG2 . ILE A 1 128 ? 28.078  27.516 30.991  1.00 9.08  ? 106 ILE A CG2 1 
ATOM   802  C  CD1 . ILE A 1 128 ? 25.066  28.606 31.145  1.00 8.52  ? 106 ILE A CD1 1 
ATOM   803  N  N   . ALA A 1 129 ? 28.869  26.110 27.801  1.00 7.07  ? 107 ALA A N   1 
ATOM   804  C  CA  . ALA A 1 129 ? 29.925  25.144 27.518  1.00 7.39  ? 107 ALA A CA  1 
ATOM   805  C  C   . ALA A 1 129 ? 30.960  25.725 26.560  1.00 9.05  ? 107 ALA A C   1 
ATOM   806  O  O   . ALA A 1 129 ? 32.158  25.492 26.726  1.00 9.57  ? 107 ALA A O   1 
ATOM   807  C  CB  . ALA A 1 129 ? 29.330  23.857 26.952  1.00 7.24  ? 107 ALA A CB  1 
ATOM   808  N  N   . ALA A 1 130 ? 30.505  26.484 25.565  1.00 6.63  ? 108 ALA A N   1 
ATOM   809  C  CA  . ALA A 1 130 ? 31.427  27.127 24.632  1.00 10.03 ? 108 ALA A CA  1 
ATOM   810  C  C   . ALA A 1 130 ? 32.298  28.201 25.294  1.00 8.68  ? 108 ALA A C   1 
ATOM   811  O  O   . ALA A 1 130 ? 33.496  28.245 25.051  1.00 10.27 ? 108 ALA A O   1 
ATOM   812  C  CB  . ALA A 1 130 ? 30.676  27.689 23.430  1.00 11.74 ? 108 ALA A CB  1 
ATOM   813  N  N   . TYR A 1 131 ? 31.717  29.051 26.139  1.00 6.57  ? 109 TYR A N   1 
ATOM   814  C  CA  . TYR A 1 131 ? 32.523  30.007 26.904  1.00 6.64  ? 109 TYR A CA  1 
ATOM   815  C  C   . TYR A 1 131 ? 33.547  29.320 27.812  1.00 6.89  ? 109 TYR A C   1 
ATOM   816  O  O   . TYR A 1 131 ? 34.683  29.790 27.947  1.00 7.13  ? 109 TYR A O   1 
ATOM   817  C  CB  . TYR A 1 131 ? 31.630  30.943 27.740  1.00 7.32  ? 109 TYR A CB  1 
ATOM   818  C  CG  . TYR A 1 131 ? 31.150  32.163 26.976  1.00 8.56  ? 109 TYR A CG  1 
ATOM   819  C  CD1 . TYR A 1 131 ? 31.964  33.282 26.841  1.00 8.93  ? 109 TYR A CD1 1 
ATOM   820  C  CD2 . TYR A 1 131 ? 29.883  32.196 26.402  1.00 9.07  ? 109 TYR A CD2 1 
ATOM   821  C  CE1 . TYR A 1 131 ? 31.533  34.405 26.145  1.00 11.46 ? 109 TYR A CE1 1 
ATOM   822  C  CE2 . TYR A 1 131 ? 29.442  33.314 25.705  1.00 8.77  ? 109 TYR A CE2 1 
ATOM   823  C  CZ  . TYR A 1 131 ? 30.274  34.408 25.580  1.00 11.06 ? 109 TYR A CZ  1 
ATOM   824  O  OH  . TYR A 1 131 ? 29.842  35.525 24.896  1.00 11.77 ? 109 TYR A OH  1 
ATOM   825  N  N   . ASP A 1 132 ? 33.150  28.212 28.442  1.00 7.91  ? 110 ASP A N   1 
ATOM   826  C  CA  . ASP A 1 132 ? 34.060  27.444 29.295  1.00 8.33  ? 110 ASP A CA  1 
ATOM   827  C  C   . ASP A 1 132 ? 35.243  26.982 28.457  1.00 7.87  ? 110 ASP A C   1 
ATOM   828  O  O   . ASP A 1 132 ? 36.408  27.171 28.829  1.00 10.64 ? 110 ASP A O   1 
ATOM   829  C  CB  . ASP A 1 132 ? 33.304  26.249 29.915  1.00 8.00  ? 110 ASP A CB  1 
ATOM   830  C  CG  . ASP A 1 132 ? 34.105  25.511 30.984  1.00 7.65  ? 110 ASP A CG  1 
ATOM   831  O  OD1 . ASP A 1 132 ? 34.937  26.123 31.696  1.00 8.74  ? 110 ASP A OD1 1 
ATOM   832  O  OD2 . ASP A 1 132 ? 33.883  24.291 31.135  1.00 10.25 ? 110 ASP A OD2 1 
ATOM   833  N  N   A LEU A 1 133 ? 34.939  26.398 27.303  0.43 7.64  ? 111 LEU A N   1 
ATOM   834  N  N   B LEU A 1 133 ? 34.932  26.373 27.316  0.57 7.64  ? 111 LEU A N   1 
ATOM   835  C  CA  A LEU A 1 133 ? 35.964  25.916 26.386  0.43 9.00  ? 111 LEU A CA  1 
ATOM   836  C  CA  B LEU A 1 133 ? 35.943  25.874 26.388  0.57 8.83  ? 111 LEU A CA  1 
ATOM   837  C  C   A LEU A 1 133 ? 36.886  27.050 25.913  0.43 11.15 ? 111 LEU A C   1 
ATOM   838  C  C   B LEU A 1 133 ? 36.875  26.995 25.915  0.57 11.14 ? 111 LEU A C   1 
ATOM   839  O  O   A LEU A 1 133 ? 38.113  26.895 25.896  0.43 11.11 ? 111 LEU A O   1 
ATOM   840  O  O   B LEU A 1 133 ? 38.101  26.835 25.897  0.57 11.18 ? 111 LEU A O   1 
ATOM   841  C  CB  A LEU A 1 133 ? 35.284  25.221 25.202  0.43 11.93 ? 111 LEU A CB  1 
ATOM   842  C  CB  B LEU A 1 133 ? 35.242  25.212 25.198  0.57 12.56 ? 111 LEU A CB  1 
ATOM   843  C  CG  A LEU A 1 133 ? 36.078  24.305 24.277  0.43 14.01 ? 111 LEU A CG  1 
ATOM   844  C  CG  B LEU A 1 133 ? 36.027  24.408 24.167  0.57 14.60 ? 111 LEU A CG  1 
ATOM   845  C  CD1 A LEU A 1 133 ? 35.130  23.375 23.523  0.43 13.96 ? 111 LEU A CD1 1 
ATOM   846  C  CD1 B LEU A 1 133 ? 36.948  23.445 24.855  0.57 14.44 ? 111 LEU A CD1 1 
ATOM   847  C  CD2 A LEU A 1 133 ? 36.857  25.135 23.304  0.43 9.77  ? 111 LEU A CD2 1 
ATOM   848  C  CD2 B LEU A 1 133 ? 35.046  23.640 23.287  0.57 15.43 ? 111 LEU A CD2 1 
ATOM   849  N  N   A MET A 1 134 ? 36.287  28.176 25.520  0.43 9.19  ? 112 MET A N   1 
ATOM   850  N  N   B MET A 1 134 ? 36.287  28.128 25.542  0.57 9.06  ? 112 MET A N   1 
ATOM   851  C  CA  A MET A 1 134 ? 37.036  29.358 25.094  0.43 10.14 ? 112 MET A CA  1 
ATOM   852  C  CA  B MET A 1 134 ? 37.039  29.293 25.085  0.57 9.96  ? 112 MET A CA  1 
ATOM   853  C  C   A MET A 1 134 ? 38.030  29.774 26.159  0.43 10.31 ? 112 MET A C   1 
ATOM   854  C  C   B MET A 1 134 ? 38.011  29.809 26.147  0.57 10.36 ? 112 MET A C   1 
ATOM   855  O  O   A MET A 1 134 ? 39.212  29.986 25.878  0.43 10.11 ? 112 MET A O   1 
ATOM   856  O  O   B MET A 1 134 ? 39.168  30.115 25.851  0.57 10.01 ? 112 MET A O   1 
ATOM   857  C  CB  A MET A 1 134 ? 36.097  30.541 24.844  0.43 11.20 ? 112 MET A CB  1 
ATOM   858  C  CB  B MET A 1 134 ? 36.074  30.401 24.656  0.57 11.61 ? 112 MET A CB  1 
ATOM   859  C  CG  A MET A 1 134 ? 35.187  30.413 23.644  0.43 13.47 ? 112 MET A CG  1 
ATOM   860  C  CG  B MET A 1 134 ? 36.741  31.689 24.239  0.57 9.39  ? 112 MET A CG  1 
ATOM   861  S  SD  A MET A 1 134 ? 34.134  31.869 23.508  0.43 21.39 ? 112 MET A SD  1 
ATOM   862  S  SD  B MET A 1 134 ? 35.657  32.649 23.167  0.57 27.58 ? 112 MET A SD  1 
ATOM   863  C  CE  A MET A 1 134 ? 35.375  33.139 23.295  0.43 25.48 ? 112 MET A CE  1 
ATOM   864  C  CE  B MET A 1 134 ? 34.092  32.446 23.997  0.57 14.91 ? 112 MET A CE  1 
ATOM   865  N  N   . GLY A 1 135 ? 37.536  29.900 27.386  1.00 9.54  ? 113 GLY A N   1 
ATOM   866  C  CA  . GLY A 1 135 ? 38.371  30.327 28.494  1.00 9.40  ? 113 GLY A CA  1 
ATOM   867  C  C   . GLY A 1 135 ? 39.535  29.380 28.722  1.00 9.36  ? 113 GLY A C   1 
ATOM   868  O  O   . GLY A 1 135 ? 40.667  29.817 28.945  1.00 9.75  ? 113 GLY A O   1 
ATOM   869  N  N   . LYS A 1 136 ? 39.271  28.077 28.663  1.00 9.75  ? 114 LYS A N   1 
ATOM   870  C  CA  . LYS A 1 136 ? 40.340  27.101 28.844  1.00 9.46  ? 114 LYS A CA  1 
ATOM   871  C  C   . LYS A 1 136 ? 41.368  27.197 27.719  1.00 11.43 ? 114 LYS A C   1 
ATOM   872  O  O   . LYS A 1 136 ? 42.569  27.087 27.951  1.00 14.74 ? 114 LYS A O   1 
ATOM   873  C  CB  . LYS A 1 136 ? 39.780  25.683 28.908  1.00 11.82 ? 114 LYS A CB  1 
ATOM   874  C  CG  . LYS A 1 136 ? 38.916  25.393 30.115  1.00 12.63 ? 114 LYS A CG  1 
ATOM   875  C  CD  . LYS A 1 136 ? 38.598  23.903 30.130  1.00 19.39 ? 114 LYS A CD  1 
ATOM   876  C  CE  . LYS A 1 136 ? 37.582  23.549 31.169  1.00 23.68 ? 114 LYS A CE  1 
ATOM   877  N  NZ  . LYS A 1 136 ? 37.305  22.084 31.111  1.00 22.19 ? 114 LYS A NZ  1 
ATOM   878  N  N   . HIS A 1 137 ? 40.885  27.411 26.500  1.00 10.56 ? 115 HIS A N   1 
ATOM   879  C  CA  . HIS A 1 137 ? 41.760  27.490 25.339  1.00 10.36 ? 115 HIS A CA  1 
ATOM   880  C  C   . HIS A 1 137 ? 42.688  28.699 25.397  1.00 11.67 ? 115 HIS A C   1 
ATOM   881  O  O   . HIS A 1 137 ? 43.889  28.580 25.120  1.00 15.00 ? 115 HIS A O   1 
ATOM   882  C  CB  . HIS A 1 137 ? 40.921  27.528 24.061  1.00 13.41 ? 115 HIS A CB  1 
ATOM   883  C  CG  . HIS A 1 137 ? 41.728  27.609 22.804  1.00 16.50 ? 115 HIS A CG  1 
ATOM   884  N  ND1 . HIS A 1 137 ? 42.651  26.649 22.448  1.00 21.11 ? 115 HIS A ND1 1 
ATOM   885  C  CD2 . HIS A 1 137 ? 41.738  28.529 21.812  1.00 19.28 ? 115 HIS A CD2 1 
ATOM   886  C  CE1 . HIS A 1 137 ? 43.199  26.978 21.292  1.00 22.40 ? 115 HIS A CE1 1 
ATOM   887  N  NE2 . HIS A 1 137 ? 42.662  28.113 20.883  1.00 19.90 ? 115 HIS A NE2 1 
ATOM   888  N  N   . TYR A 1 138 ? 42.141  29.859 25.763  1.00 10.40 ? 116 TYR A N   1 
ATOM   889  C  CA  . TYR A 1 138 ? 42.934  31.093 25.814  1.00 11.18 ? 116 TYR A CA  1 
ATOM   890  C  C   . TYR A 1 138 ? 43.665  31.294 27.143  1.00 13.53 ? 116 TYR A C   1 
ATOM   891  O  O   . TYR A 1 138 ? 44.576  32.130 27.241  1.00 17.67 ? 116 TYR A O   1 
ATOM   892  C  CB  . TYR A 1 138 ? 42.053  32.317 25.548  1.00 15.32 ? 116 TYR A CB  1 
ATOM   893  C  CG  . TYR A 1 138 ? 41.438  32.384 24.171  1.00 19.73 ? 116 TYR A CG  1 
ATOM   894  C  CD1 . TYR A 1 138 ? 42.147  31.995 23.044  1.00 25.94 ? 116 TYR A CD1 1 
ATOM   895  C  CD2 . TYR A 1 138 ? 40.138  32.844 24.003  1.00 22.46 ? 116 TYR A CD2 1 
ATOM   896  C  CE1 . TYR A 1 138 ? 41.573  32.059 21.784  1.00 28.24 ? 116 TYR A CE1 1 
ATOM   897  C  CE2 . TYR A 1 138 ? 39.562  32.919 22.753  1.00 23.06 ? 116 TYR A CE2 1 
ATOM   898  C  CZ  . TYR A 1 138 ? 40.279  32.525 21.649  1.00 25.85 ? 116 TYR A CZ  1 
ATOM   899  O  OH  . TYR A 1 138 ? 39.693  32.605 20.404  1.00 29.64 ? 116 TYR A OH  1 
ATOM   900  N  N   . GLY A 1 139 ? 43.272  30.532 28.161  1.00 11.15 ? 117 GLY A N   1 
ATOM   901  C  CA  . GLY A 1 139 ? 43.855  30.660 29.487  1.00 12.39 ? 117 GLY A CA  1 
ATOM   902  C  C   . GLY A 1 139 ? 43.307  31.866 30.230  1.00 16.02 ? 117 GLY A C   1 
ATOM   903  O  O   . GLY A 1 139 ? 44.045  32.567 30.925  1.00 21.11 ? 117 GLY A O   1 
ATOM   904  N  N   . VAL A 1 140 ? 42.004  32.095 30.094  1.00 10.97 ? 118 VAL A N   1 
ATOM   905  C  CA  . VAL A 1 140 ? 41.353  33.290 30.624  1.00 11.30 ? 118 VAL A CA  1 
ATOM   906  C  C   . VAL A 1 140 ? 40.059  32.898 31.353  1.00 10.95 ? 118 VAL A C   1 
ATOM   907  O  O   . VAL A 1 140 ? 39.365  31.972 30.935  1.00 12.22 ? 118 VAL A O   1 
ATOM   908  C  CB  . VAL A 1 140 ? 41.044  34.279 29.458  1.00 15.81 ? 118 VAL A CB  1 
ATOM   909  C  CG1 . VAL A 1 140 ? 40.245  33.598 28.382  1.00 24.15 ? 118 VAL A CG1 1 
ATOM   910  C  CG2 . VAL A 1 140 ? 40.327  35.528 29.931  1.00 19.10 ? 118 VAL A CG2 1 
ATOM   911  N  N   A ARG A 1 141 ? 39.750  33.588 32.447  0.34 11.48 ? 119 ARG A N   1 
ATOM   912  N  N   B ARG A 1 141 ? 39.755  33.588 32.451  0.66 12.00 ? 119 ARG A N   1 
ATOM   913  C  CA  A ARG A 1 141 ? 38.479  33.379 33.132  0.34 9.64  ? 119 ARG A CA  1 
ATOM   914  C  CA  B ARG A 1 141 ? 38.482  33.408 33.147  0.66 9.28  ? 119 ARG A CA  1 
ATOM   915  C  C   A ARG A 1 141 ? 37.339  33.912 32.279  0.34 9.26  ? 119 ARG A C   1 
ATOM   916  C  C   B ARG A 1 141 ? 37.340  33.912 32.273  0.66 9.28  ? 119 ARG A C   1 
ATOM   917  O  O   A ARG A 1 141 ? 37.498  34.914 31.581  0.34 9.92  ? 119 ARG A O   1 
ATOM   918  O  O   B ARG A 1 141 ? 37.494  34.901 31.558  0.66 10.18 ? 119 ARG A O   1 
ATOM   919  C  CB  A ARG A 1 141 ? 38.478  34.078 34.491  0.34 10.45 ? 119 ARG A CB  1 
ATOM   920  C  CB  B ARG A 1 141 ? 38.484  34.196 34.461  0.66 8.61  ? 119 ARG A CB  1 
ATOM   921  C  CG  A ARG A 1 141 ? 39.405  33.432 35.494  0.34 12.13 ? 119 ARG A CG  1 
ATOM   922  C  CG  B ARG A 1 141 ? 39.522  33.723 35.454  0.66 12.64 ? 119 ARG A CG  1 
ATOM   923  C  CD  A ARG A 1 141 ? 39.081  33.871 36.903  0.34 14.00 ? 119 ARG A CD  1 
ATOM   924  C  CD  B ARG A 1 141 ? 39.862  34.842 36.421  0.66 14.10 ? 119 ARG A CD  1 
ATOM   925  N  NE  A ARG A 1 141 ? 39.576  35.207 37.218  0.34 14.20 ? 119 ARG A NE  1 
ATOM   926  N  NE  B ARG A 1 141 ? 39.382  34.582 37.774  0.66 14.54 ? 119 ARG A NE  1 
ATOM   927  C  CZ  A ARG A 1 141 ? 39.543  35.725 38.441  0.34 13.92 ? 119 ARG A CZ  1 
ATOM   928  C  CZ  B ARG A 1 141 ? 39.450  35.477 38.753  0.66 14.38 ? 119 ARG A CZ  1 
ATOM   929  N  NH1 A ARG A 1 141 ? 40.010  36.944 38.677  0.34 13.40 ? 119 ARG A NH1 1 
ATOM   930  N  NH1 B ARG A 1 141 ? 39.968  36.671 38.502  0.66 12.13 ? 119 ARG A NH1 1 
ATOM   931  N  NH2 A ARG A 1 141 ? 39.039  35.007 39.434  0.34 14.35 ? 119 ARG A NH2 1 
ATOM   932  N  NH2 B ARG A 1 141 ? 39.011  35.185 39.971  0.66 15.86 ? 119 ARG A NH2 1 
ATOM   933  N  N   . VAL A 1 142 ? 36.190  33.242 32.337  1.00 7.95  ? 120 VAL A N   1 
ATOM   934  C  CA  . VAL A 1 142 ? 35.028  33.640 31.542  1.00 7.71  ? 120 VAL A CA  1 
ATOM   935  C  C   . VAL A 1 142 ? 34.630  35.102 31.769  1.00 8.46  ? 120 VAL A C   1 
ATOM   936  O  O   . VAL A 1 142 ? 34.323  35.804 30.816  1.00 8.78  ? 120 VAL A O   1 
ATOM   937  C  CB  . VAL A 1 142 ? 33.828  32.685 31.766  1.00 8.53  ? 120 VAL A CB  1 
ATOM   938  C  CG1 . VAL A 1 142 ? 32.520  33.302 31.269  1.00 9.48  ? 120 VAL A CG1 1 
ATOM   939  C  CG2 . VAL A 1 142 ? 34.085  31.357 31.059  1.00 9.58  ? 120 VAL A CG2 1 
ATOM   940  N  N   . ALA A 1 143 ? 34.683  35.573 33.014  1.00 8.45  ? 121 ALA A N   1 
ATOM   941  C  CA  . ALA A 1 143 ? 34.395  36.984 33.292  1.00 7.39  ? 121 ALA A CA  1 
ATOM   942  C  C   . ALA A 1 143 ? 35.278  37.940 32.466  1.00 9.58  ? 121 ALA A C   1 
ATOM   943  O  O   . ALA A 1 143 ? 34.828  39.010 32.046  1.00 10.23 ? 121 ALA A O   1 
ATOM   944  C  CB  . ALA A 1 143 ? 34.528  37.284 34.796  1.00 7.65  ? 121 ALA A CB  1 
ATOM   945  N  N   . ASP A 1 144 ? 36.531  37.549 32.238  1.00 10.06 ? 122 ASP A N   1 
ATOM   946  C  CA  . ASP A 1 144 ? 37.464  38.362 31.446  1.00 11.23 ? 122 ASP A CA  1 
ATOM   947  C  C   . ASP A 1 144 ? 37.266  38.225 29.930  1.00 12.78 ? 122 ASP A C   1 
ATOM   948  O  O   . ASP A 1 144 ? 37.960  38.871 29.143  1.00 16.39 ? 122 ASP A O   1 
ATOM   949  C  CB  . ASP A 1 144 ? 38.915  38.052 31.840  1.00 11.34 ? 122 ASP A CB  1 
ATOM   950  C  CG  . ASP A 1 144 ? 39.289  38.639 33.189  1.00 11.06 ? 122 ASP A CG  1 
ATOM   951  O  OD1 . ASP A 1 144 ? 38.782  39.729 33.521  1.00 10.44 ? 122 ASP A OD1 1 
ATOM   952  O  OD2 . ASP A 1 144 ? 40.086  38.012 33.921  1.00 15.87 ? 122 ASP A OD2 1 
ATOM   953  N  N   . LEU A 1 145 ? 36.327  37.381 29.524  1.00 10.59 ? 123 LEU A N   1 
ATOM   954  C  CA  . LEU A 1 145 ? 35.900  37.335 28.127  1.00 11.62 ? 123 LEU A CA  1 
ATOM   955  C  C   . LEU A 1 145 ? 34.605  38.109 27.937  1.00 12.35 ? 123 LEU A C   1 
ATOM   956  O  O   . LEU A 1 145 ? 34.136  38.295 26.810  1.00 14.83 ? 123 LEU A O   1 
ATOM   957  C  CB  . LEU A 1 145 ? 35.691  35.891 27.675  1.00 10.64 ? 123 LEU A CB  1 
ATOM   958  C  CG  . LEU A 1 145 ? 36.974  35.069 27.570  1.00 17.61 ? 123 LEU A CG  1 
ATOM   959  C  CD1 . LEU A 1 145 ? 36.646  33.617 27.264  1.00 18.65 ? 123 LEU A CD1 1 
ATOM   960  C  CD2 . LEU A 1 145 ? 37.902  35.662 26.521  1.00 19.63 ? 123 LEU A CD2 1 
ATOM   961  N  N   . LEU A 1 146 ? 34.031  38.562 29.047  1.00 7.89  ? 124 LEU A N   1 
ATOM   962  C  CA  . LEU A 1 146 ? 32.752  39.267 29.038  1.00 8.12  ? 124 LEU A CA  1 
ATOM   963  C  C   . LEU A 1 146 ? 32.906  40.746 29.412  1.00 11.05 ? 124 LEU A C   1 
ATOM   964  O  O   . LEU A 1 146 ? 31.918  41.439 29.650  1.00 15.09 ? 124 LEU A O   1 
ATOM   965  C  CB  . LEU A 1 146 ? 31.770  38.578 29.996  1.00 10.64 ? 124 LEU A CB  1 
ATOM   966  C  CG  . LEU A 1 146 ? 31.368  37.150 29.611  1.00 10.35 ? 124 LEU A CG  1 
ATOM   967  C  CD1 . LEU A 1 146 ? 30.565  36.502 30.736  1.00 11.61 ? 124 LEU A CD1 1 
ATOM   968  C  CD2 . LEU A 1 146 ? 30.567  37.139 28.323  1.00 10.80 ? 124 LEU A CD2 1 
ATOM   969  N  N   . GLY A 1 147 ? 34.137  41.234 29.456  1.00 10.78 ? 125 GLY A N   1 
ATOM   970  C  CA  . GLY A 1 147 ? 34.362  42.634 29.773  1.00 10.58 ? 125 GLY A CA  1 
ATOM   971  C  C   . GLY A 1 147 ? 35.350  42.871 30.900  1.00 11.19 ? 125 GLY A C   1 
ATOM   972  O  O   . GLY A 1 147 ? 35.970  43.937 30.983  1.00 11.83 ? 125 GLY A O   1 
ATOM   973  N  N   . GLY A 1 148 ? 35.486  41.882 31.777  1.00 9.67  ? 126 GLY A N   1 
ATOM   974  C  CA  . GLY A 1 148 ? 36.466  41.956 32.842  1.00 8.52  ? 126 GLY A CA  1 
ATOM   975  C  C   . GLY A 1 148 ? 35.872  41.854 34.230  1.00 9.91  ? 126 GLY A C   1 
ATOM   976  O  O   . GLY A 1 148 ? 34.728  42.263 34.475  1.00 11.36 ? 126 GLY A O   1 
ATOM   977  N  N   . VAL A 1 149 ? 36.671  41.325 35.149  1.00 10.32 ? 127 VAL A N   1 
ATOM   978  C  CA  . VAL A 1 149 ? 36.281  41.195 36.546  1.00 11.12 ? 127 VAL A CA  1 
ATOM   979  C  C   . VAL A 1 149 ? 36.213  42.558 37.232  1.00 12.22 ? 127 VAL A C   1 
ATOM   980  O  O   . VAL A 1 149 ? 37.227  43.252 37.365  1.00 12.81 ? 127 VAL A O   1 
ATOM   981  C  CB  . VAL A 1 149 ? 37.284  40.299 37.310  1.00 9.00  ? 127 VAL A CB  1 
ATOM   982  C  CG1 . VAL A 1 149 ? 36.899  40.206 38.779  1.00 9.84  ? 127 VAL A CG1 1 
ATOM   983  C  CG2 . VAL A 1 149 ? 37.334  38.912 36.687  1.00 12.02 ? 127 VAL A CG2 1 
ATOM   984  N  N   . ALA A 1 150 ? 35.014  42.942 37.662  1.00 10.06 ? 128 ALA A N   1 
ATOM   985  C  CA  . ALA A 1 150 ? 34.813  44.192 38.385  1.00 11.25 ? 128 ALA A CA  1 
ATOM   986  C  C   . ALA A 1 150 ? 34.881  43.943 39.889  1.00 11.69 ? 128 ALA A C   1 
ATOM   987  O  O   . ALA A 1 150 ? 35.166  44.853 40.669  1.00 15.42 ? 128 ALA A O   1 
ATOM   988  C  CB  . ALA A 1 150 ? 33.465  44.820 38.007  1.00 11.56 ? 128 ALA A CB  1 
ATOM   989  N  N   . ALA A 1 151 ? 34.613  42.700 40.282  1.00 11.46 ? 129 ALA A N   1 
ATOM   990  C  CA  . ALA A 1 151 ? 34.652  42.307 41.684  1.00 14.12 ? 129 ALA A CA  1 
ATOM   991  C  C   . ALA A 1 151 ? 34.972  40.825 41.804  1.00 9.99  ? 129 ALA A C   1 
ATOM   992  O  O   . ALA A 1 151 ? 34.337  40.001 41.145  1.00 11.34 ? 129 ALA A O   1 
ATOM   993  C  CB  . ALA A 1 151 ? 33.312  42.606 42.345  1.00 16.58 ? 129 ALA A CB  1 
ATOM   994  N  N   . GLU A 1 152 ? 35.950  40.489 42.651  1.00 10.36 ? 130 GLU A N   1 
ATOM   995  C  CA  . GLU A 1 152 ? 36.304  39.094 42.914  1.00 11.95 ? 130 GLU A CA  1 
ATOM   996  C  C   . GLU A 1 152 ? 35.308  38.437 43.860  1.00 12.04 ? 130 GLU A C   1 
ATOM   997  O  O   . GLU A 1 152 ? 35.088  37.223 43.804  1.00 15.42 ? 130 GLU A O   1 
ATOM   998  C  CB  . GLU A 1 152 ? 37.701  38.999 43.534  1.00 13.35 ? 130 GLU A CB  1 
ATOM   999  C  CG  . GLU A 1 152 ? 38.832  39.393 42.612  1.00 14.55 ? 130 GLU A CG  1 
ATOM   1000 C  CD  . GLU A 1 152 ? 39.154  38.322 41.595  1.00 15.00 ? 130 GLU A CD  1 
ATOM   1001 O  OE1 . GLU A 1 152 ? 38.655  37.181 41.741  1.00 19.01 ? 130 GLU A OE1 1 
ATOM   1002 O  OE2 . GLU A 1 152 ? 39.912  38.631 40.652  1.00 19.24 ? 130 GLU A OE2 1 
ATOM   1003 N  N   . ARG A 1 153 ? 34.721  39.232 44.743  1.00 14.49 ? 131 ARG A N   1 
ATOM   1004 C  CA  . ARG A 1 153 ? 33.729  38.723 45.680  1.00 14.91 ? 131 ARG A CA  1 
ATOM   1005 C  C   . ARG A 1 153 ? 32.392  39.317 45.296  1.00 15.59 ? 131 ARG A C   1 
ATOM   1006 O  O   . ARG A 1 153 ? 32.203  40.533 45.363  1.00 17.77 ? 131 ARG A O   1 
ATOM   1007 C  CB  . ARG A 1 153 ? 34.108  39.094 47.119  1.00 19.79 ? 131 ARG A CB  1 
ATOM   1008 C  CG  . ARG A 1 153 ? 33.198  38.518 48.198  1.00 22.06 ? 131 ARG A CG  1 
ATOM   1009 C  CD  . ARG A 1 153 ? 33.895  38.574 49.565  1.00 28.71 ? 131 ARG A CD  1 
ATOM   1010 N  NE  . ARG A 1 153 ? 32.969  38.804 50.671  1.00 38.07 ? 131 ARG A NE  1 
ATOM   1011 C  CZ  . ARG A 1 153 ? 32.570  40.010 51.070  1.00 45.24 ? 131 ARG A CZ  1 
ATOM   1012 N  NH1 . ARG A 1 153 ? 33.007  41.099 50.448  1.00 48.35 ? 131 ARG A NH1 1 
ATOM   1013 N  NH2 . ARG A 1 153 ? 31.729  40.131 52.089  1.00 44.86 ? 131 ARG A NH2 1 
ATOM   1014 N  N   A VAL A 1 154 ? 31.456  38.443 44.942  0.61 12.23 ? 132 VAL A N   1 
ATOM   1015 N  N   B VAL A 1 154 ? 31.476  38.482 44.819  0.39 12.26 ? 132 VAL A N   1 
ATOM   1016 C  CA  A VAL A 1 154 ? 30.167  38.831 44.398  0.61 13.11 ? 132 VAL A CA  1 
ATOM   1017 C  CA  B VAL A 1 154 ? 30.173  38.985 44.408  0.39 11.67 ? 132 VAL A CA  1 
ATOM   1018 C  C   A VAL A 1 154 ? 29.073  38.683 45.463  0.61 12.36 ? 132 VAL A C   1 
ATOM   1019 C  C   B VAL A 1 154 ? 29.132  38.751 45.484  0.39 12.35 ? 132 VAL A C   1 
ATOM   1020 O  O   A VAL A 1 154 ? 29.005  37.651 46.129  0.61 14.51 ? 132 VAL A O   1 
ATOM   1021 O  O   B VAL A 1 154 ? 29.158  37.732 46.177  0.39 14.56 ? 132 VAL A O   1 
ATOM   1022 C  CB  A VAL A 1 154 ? 29.831  37.916 43.200  0.61 13.91 ? 132 VAL A CB  1 
ATOM   1023 C  CB  B VAL A 1 154 ? 29.682  38.381 43.067  0.39 15.47 ? 132 VAL A CB  1 
ATOM   1024 C  CG1 A VAL A 1 154 ? 28.726  38.513 42.364  0.61 15.96 ? 132 VAL A CG1 1 
ATOM   1025 C  CG1 B VAL A 1 154 ? 30.473  38.947 41.915  0.39 16.06 ? 132 VAL A CG1 1 
ATOM   1026 C  CG2 A VAL A 1 154 ? 31.075  37.693 42.335  0.61 15.31 ? 132 VAL A CG2 1 
ATOM   1027 C  CG2 B VAL A 1 154 ? 29.780  36.871 43.084  0.39 13.40 ? 132 VAL A CG2 1 
ATOM   1028 N  N   . PRO A 1 155 ? 28.213  39.705 45.634  1.00 11.10 ? 133 PRO A N   1 
ATOM   1029 C  CA  . PRO A 1 155 ? 27.137  39.547 46.610  1.00 9.34  ? 133 PRO A CA  1 
ATOM   1030 C  C   . PRO A 1 155 ? 26.154  38.486 46.141  1.00 9.64  ? 133 PRO A C   1 
ATOM   1031 O  O   . PRO A 1 155 ? 25.962  38.287 44.939  1.00 9.94  ? 133 PRO A O   1 
ATOM   1032 C  CB  . PRO A 1 155 ? 26.454  40.919 46.605  1.00 11.03 ? 133 PRO A CB  1 
ATOM   1033 C  CG  . PRO A 1 155 ? 26.733  41.471 45.236  1.00 13.27 ? 133 PRO A CG  1 
ATOM   1034 C  CD  . PRO A 1 155 ? 28.121  40.986 44.906  1.00 13.25 ? 133 PRO A CD  1 
ATOM   1035 N  N   . SER A 1 156 ? 25.552  37.788 47.091  1.00 9.88  ? 134 SER A N   1 
ATOM   1036 C  CA  . SER A 1 156 ? 24.424  36.930 46.791  1.00 8.70  ? 134 SER A CA  1 
ATOM   1037 C  C   . SER A 1 156 ? 23.186  37.526 47.450  1.00 9.36  ? 134 SER A C   1 
ATOM   1038 O  O   . SER A 1 156 ? 23.249  38.592 48.075  1.00 9.20  ? 134 SER A O   1 
ATOM   1039 C  CB  . SER A 1 156 ? 24.686  35.500 47.297  1.00 9.83  ? 134 SER A CB  1 
ATOM   1040 O  OG  . SER A 1 156 ? 23.737  34.596 46.758  1.00 9.35  ? 134 SER A OG  1 
ATOM   1041 N  N   . TYR A 1 157 ? 22.051  36.857 47.296  1.00 8.27  ? 135 TYR A N   1 
ATOM   1042 C  CA  . TYR A 1 157 ? 20.864  37.233 48.060  1.00 8.89  ? 135 TYR A CA  1 
ATOM   1043 C  C   . TYR A 1 157 ? 20.138  35.962 48.465  1.00 8.93  ? 135 TYR A C   1 
ATOM   1044 O  O   . TYR A 1 157 ? 20.272  34.926 47.805  1.00 10.19 ? 135 TYR A O   1 
ATOM   1045 C  CB  . TYR A 1 157 ? 19.956  38.228 47.296  1.00 8.00  ? 135 TYR A CB  1 
ATOM   1046 C  CG  . TYR A 1 157 ? 19.202  37.686 46.092  1.00 8.51  ? 135 TYR A CG  1 
ATOM   1047 C  CD1 . TYR A 1 157 ? 17.937  37.114 46.237  1.00 7.67  ? 135 TYR A CD1 1 
ATOM   1048 C  CD2 . TYR A 1 157 ? 19.738  37.770 44.811  1.00 7.65  ? 135 TYR A CD2 1 
ATOM   1049 C  CE1 . TYR A 1 157 ? 17.223  36.641 45.133  1.00 11.37 ? 135 TYR A CE1 1 
ATOM   1050 C  CE2 . TYR A 1 157 ? 19.038  37.287 43.708  1.00 7.66  ? 135 TYR A CE2 1 
ATOM   1051 C  CZ  . TYR A 1 157 ? 17.786  36.726 43.876  1.00 8.05  ? 135 TYR A CZ  1 
ATOM   1052 O  OH  . TYR A 1 157 ? 17.095  36.246 42.775  1.00 9.57  ? 135 TYR A OH  1 
ATOM   1053 N  N   . TYR A 1 158 ? 19.396  36.020 49.568  1.00 8.56  ? 136 TYR A N   1 
ATOM   1054 C  CA  . TYR A 1 158 ? 18.670  34.842 50.025  1.00 10.66 ? 136 TYR A CA  1 
ATOM   1055 C  C   . TYR A 1 158 ? 17.191  34.974 49.688  1.00 10.43 ? 136 TYR A C   1 
ATOM   1056 O  O   . TYR A 1 158 ? 16.590  36.024 49.913  1.00 10.58 ? 136 TYR A O   1 
ATOM   1057 C  CB  . TYR A 1 158 ? 18.864  34.607 51.529  1.00 10.24 ? 136 TYR A CB  1 
ATOM   1058 C  CG  . TYR A 1 158 ? 18.428  33.217 51.921  1.00 14.37 ? 136 TYR A CG  1 
ATOM   1059 C  CD1 . TYR A 1 158 ? 19.303  32.149 51.797  1.00 15.51 ? 136 TYR A CD1 1 
ATOM   1060 C  CD2 . TYR A 1 158 ? 17.140  32.967 52.368  1.00 16.87 ? 136 TYR A CD2 1 
ATOM   1061 C  CE1 . TYR A 1 158 ? 18.921  30.867 52.127  1.00 20.62 ? 136 TYR A CE1 1 
ATOM   1062 C  CE2 . TYR A 1 158 ? 16.742  31.674 52.710  1.00 14.84 ? 136 TYR A CE2 1 
ATOM   1063 C  CZ  . TYR A 1 158 ? 17.642  30.633 52.583  1.00 19.43 ? 136 TYR A CZ  1 
ATOM   1064 O  OH  . TYR A 1 158 ? 17.282  29.339 52.907  1.00 25.25 ? 136 TYR A OH  1 
ATOM   1065 N  N   . ALA A 1 159 ? 16.616  33.912 49.129  1.00 12.60 ? 137 ALA A N   1 
ATOM   1066 C  CA  . ALA A 1 159 ? 15.209  33.936 48.750  1.00 13.07 ? 137 ALA A CA  1 
ATOM   1067 C  C   . ALA A 1 159 ? 14.426  32.962 49.611  1.00 13.33 ? 137 ALA A C   1 
ATOM   1068 O  O   . ALA A 1 159 ? 14.655  31.756 49.555  1.00 17.48 ? 137 ALA A O   1 
ATOM   1069 C  CB  . ALA A 1 159 ? 15.046  33.595 47.276  1.00 13.45 ? 137 ALA A CB  1 
ATOM   1070 N  N   . THR A 1 160 ? 13.496  33.483 50.407  1.00 11.97 ? 138 THR A N   1 
ATOM   1071 C  CA  . THR A 1 160 ? 12.699  32.613 51.259  1.00 10.18 ? 138 THR A CA  1 
ATOM   1072 C  C   . THR A 1 160 ? 11.574  31.973 50.455  1.00 13.92 ? 138 THR A C   1 
ATOM   1073 O  O   . THR A 1 160 ? 10.959  32.616 49.614  1.00 17.22 ? 138 THR A O   1 
ATOM   1074 C  CB  . THR A 1 160 ? 12.134  33.367 52.482  1.00 13.80 ? 138 THR A CB  1 
ATOM   1075 O  OG1 . THR A 1 160 ? 11.260  34.415 52.054  1.00 13.16 ? 138 THR A OG1 1 
ATOM   1076 C  CG2 . THR A 1 160 ? 13.263  33.972 53.296  1.00 17.84 ? 138 THR A CG2 1 
ATOM   1077 N  N   . GLY A 1 161 ? 11.317  30.697 50.700  1.00 20.00 ? 139 GLY A N   1 
ATOM   1078 C  CA  . GLY A 1 161 ? 10.142  30.066 50.127  1.00 22.64 ? 139 GLY A CA  1 
ATOM   1079 C  C   . GLY A 1 161 ? 8.912   30.617 50.821  1.00 22.10 ? 139 GLY A C   1 
ATOM   1080 O  O   . GLY A 1 161 ? 9.013   31.255 51.864  1.00 22.98 ? 139 GLY A O   1 
ATOM   1081 N  N   . ILE A 1 162 ? 7.743   30.398 50.236  1.00 20.28 ? 140 ILE A N   1 
ATOM   1082 C  CA  . ILE A 1 162 ? 6.505   30.801 50.888  1.00 21.81 ? 140 ILE A CA  1 
ATOM   1083 C  C   . ILE A 1 162 ? 6.322   30.016 52.191  1.00 23.65 ? 140 ILE A C   1 
ATOM   1084 O  O   . ILE A 1 162 ? 6.570   28.809 52.228  1.00 26.68 ? 140 ILE A O   1 
ATOM   1085 C  CB  . ILE A 1 162 ? 5.299   30.586 49.950  1.00 21.38 ? 140 ILE A CB  1 
ATOM   1086 C  CG1 . ILE A 1 162 ? 5.482   31.419 48.676  1.00 21.33 ? 140 ILE A CG1 1 
ATOM   1087 C  CG2 . ILE A 1 162 ? 4.004   30.962 50.643  1.00 25.42 ? 140 ILE A CG2 1 
ATOM   1088 C  CD1 . ILE A 1 162 ? 4.451   31.135 47.603  1.00 19.54 ? 140 ILE A CD1 1 
ATOM   1089 N  N   . GLY A 1 163 ? 5.918   30.705 53.260  1.00 19.85 ? 141 GLY A N   1 
ATOM   1090 C  CA  . GLY A 1 163 ? 5.723   30.069 54.557  1.00 20.66 ? 141 GLY A CA  1 
ATOM   1091 C  C   . GLY A 1 163 ? 4.939   30.944 55.525  1.00 19.63 ? 141 GLY A C   1 
ATOM   1092 O  O   . GLY A 1 163 ? 4.422   31.988 55.134  1.00 22.44 ? 141 GLY A O   1 
ATOM   1093 N  N   . GLN A 1 164 ? 4.851   30.530 56.786  1.00 21.27 ? 142 GLN A N   1 
ATOM   1094 C  CA  . GLN A 1 164 ? 4.124   31.300 57.803  1.00 20.07 ? 142 GLN A CA  1 
ATOM   1095 C  C   . GLN A 1 164 ? 4.864   32.585 58.197  1.00 18.34 ? 142 GLN A C   1 
ATOM   1096 O  O   . GLN A 1 164 ? 6.087   32.578 58.317  1.00 17.87 ? 142 GLN A O   1 
ATOM   1097 C  CB  . GLN A 1 164 ? 3.860   30.436 59.035  1.00 25.59 ? 142 GLN A CB  1 
ATOM   1098 C  CG  . GLN A 1 164 ? 2.842   29.336 58.794  1.00 34.76 ? 142 GLN A CG  1 
ATOM   1099 C  CD  . GLN A 1 164 ? 1.488   29.890 58.389  1.00 44.65 ? 142 GLN A CD  1 
ATOM   1100 O  OE1 . GLN A 1 164 ? 1.023   29.679 57.265  1.00 48.44 ? 142 GLN A OE1 1 
ATOM   1101 N  NE2 . GLN A 1 164 ? 0.848   30.611 59.305  1.00 46.12 ? 142 GLN A NE2 1 
ATOM   1102 N  N   . PRO A 1 165 ? 4.121   33.694 58.388  1.00 14.30 ? 143 PRO A N   1 
ATOM   1103 C  CA  . PRO A 1 165 ? 4.717   35.018 58.628  1.00 12.92 ? 143 PRO A CA  1 
ATOM   1104 C  C   . PRO A 1 165 ? 5.811   35.054 59.704  1.00 13.27 ? 143 PRO A C   1 
ATOM   1105 O  O   . PRO A 1 165 ? 6.883   35.596 59.435  1.00 13.71 ? 143 PRO A O   1 
ATOM   1106 C  CB  . PRO A 1 165 ? 3.515   35.869 59.046  1.00 15.64 ? 143 PRO A CB  1 
ATOM   1107 C  CG  . PRO A 1 165 ? 2.371   35.252 58.272  1.00 15.24 ? 143 PRO A CG  1 
ATOM   1108 C  CD  . PRO A 1 165 ? 2.648   33.769 58.279  1.00 16.76 ? 143 PRO A CD  1 
ATOM   1109 N  N   . ASP A 1 166 ? 5.553   34.492 60.882  1.00 15.13 ? 144 ASP A N   1 
ATOM   1110 C  CA  . ASP A 1 166 ? 6.553   34.508 61.947  1.00 15.03 ? 144 ASP A CA  1 
ATOM   1111 C  C   . ASP A 1 166 ? 7.770   33.660 61.591  1.00 15.87 ? 144 ASP A C   1 
ATOM   1112 O  O   . ASP A 1 166 ? 8.903   34.018 61.925  1.00 17.96 ? 144 ASP A O   1 
ATOM   1113 C  CB  . ASP A 1 166 ? 5.958   33.996 63.259  1.00 19.60 ? 144 ASP A CB  1 
ATOM   1114 C  CG  . ASP A 1 166 ? 4.808   34.843 63.755  1.00 28.38 ? 144 ASP A CG  1 
ATOM   1115 O  OD1 . ASP A 1 166 ? 4.813   36.064 63.519  1.00 28.70 ? 144 ASP A OD1 1 
ATOM   1116 O  OD2 . ASP A 1 166 ? 3.900   34.277 64.399  1.00 37.19 ? 144 ASP A OD2 1 
ATOM   1117 N  N   . GLU A 1 167 ? 7.534   32.536 60.920  1.00 15.88 ? 145 GLU A N   1 
ATOM   1118 C  CA  . GLU A 1 167 ? 8.609   31.639 60.499  1.00 14.60 ? 145 GLU A CA  1 
ATOM   1119 C  C   . GLU A 1 167 ? 9.542   32.306 59.487  1.00 12.17 ? 145 GLU A C   1 
ATOM   1120 O  O   . GLU A 1 167 ? 10.767  32.227 59.607  1.00 13.80 ? 145 GLU A O   1 
ATOM   1121 C  CB  . GLU A 1 167 ? 8.016   30.360 59.895  1.00 21.72 ? 145 GLU A CB  1 
ATOM   1122 C  CG  . GLU A 1 167 ? 8.993   29.548 59.049  1.00 32.26 ? 145 GLU A CG  1 
ATOM   1123 C  CD  . GLU A 1 167 ? 8.300   28.489 58.196  1.00 44.79 ? 145 GLU A CD  1 
ATOM   1124 O  OE1 . GLU A 1 167 ? 7.063   28.581 58.005  1.00 47.06 ? 145 GLU A OE1 1 
ATOM   1125 O  OE2 . GLU A 1 167 ? 8.994   27.562 57.718  1.00 45.74 ? 145 GLU A OE2 1 
ATOM   1126 N  N   . ILE A 1 168 ? 8.955   32.963 58.491  1.00 11.63 ? 146 ILE A N   1 
ATOM   1127 C  CA  . ILE A 1 168 ? 9.720   33.656 57.460  1.00 10.39 ? 146 ILE A CA  1 
ATOM   1128 C  C   . ILE A 1 168 ? 10.499  34.837 58.040  1.00 11.05 ? 146 ILE A C   1 
ATOM   1129 O  O   . ILE A 1 168 ? 11.650  35.062 57.672  1.00 10.85 ? 146 ILE A O   1 
ATOM   1130 C  CB  . ILE A 1 168 ? 8.803   34.140 56.320  1.00 11.16 ? 146 ILE A CB  1 
ATOM   1131 C  CG1 . ILE A 1 168 ? 8.107   32.941 55.666  1.00 13.09 ? 146 ILE A CG1 1 
ATOM   1132 C  CG2 . ILE A 1 168 ? 9.582   34.969 55.289  1.00 11.46 ? 146 ILE A CG2 1 
ATOM   1133 C  CD1 . ILE A 1 168 ? 9.061   31.871 55.157  1.00 13.65 ? 146 ILE A CD1 1 
ATOM   1134 N  N   . ALA A 1 169 ? 9.876   35.585 58.952  1.00 10.75 ? 147 ALA A N   1 
ATOM   1135 C  CA  . ALA A 1 169 ? 10.565  36.685 59.628  1.00 13.00 ? 147 ALA A CA  1 
ATOM   1136 C  C   . ALA A 1 169 ? 11.809  36.214 60.387  1.00 14.29 ? 147 ALA A C   1 
ATOM   1137 O  O   . ALA A 1 169 ? 12.840  36.885 60.366  1.00 10.65 ? 147 ALA A O   1 
ATOM   1138 C  CB  . ALA A 1 169 ? 9.621   37.424 60.561  1.00 12.27 ? 147 ALA A CB  1 
ATOM   1139 N  N   . ARG A 1 170 ? 11.699  35.070 61.059  1.00 11.29 ? 148 ARG A N   1 
ATOM   1140 C  CA  . ARG A 1 170 ? 12.831  34.477 61.762  1.00 11.91 ? 148 ARG A CA  1 
ATOM   1141 C  C   . ARG A 1 170 ? 13.961  34.107 60.794  1.00 12.21 ? 148 ARG A C   1 
ATOM   1142 O  O   . ARG A 1 170 ? 15.128  34.437 61.028  1.00 13.44 ? 148 ARG A O   1 
ATOM   1143 C  CB  . ARG A 1 170 ? 12.367  33.248 62.560  1.00 13.09 ? 148 ARG A CB  1 
ATOM   1144 C  CG  . ARG A 1 170 ? 13.186  32.966 63.799  1.00 25.59 ? 148 ARG A CG  1 
ATOM   1145 C  CD  . ARG A 1 170 ? 12.617  31.781 64.584  1.00 29.94 ? 148 ARG A CD  1 
ATOM   1146 N  NE  . ARG A 1 170 ? 11.399  32.110 65.327  1.00 38.27 ? 148 ARG A NE  1 
ATOM   1147 C  CZ  . ARG A 1 170 ? 11.388  32.749 66.496  1.00 40.64 ? 148 ARG A CZ  1 
ATOM   1148 N  NH1 . ARG A 1 170 ? 12.528  33.150 67.043  1.00 31.25 ? 148 ARG A NH1 1 
ATOM   1149 N  NH2 . ARG A 1 170 ? 10.240  32.999 67.114  1.00 46.56 ? 148 ARG A NH2 1 
ATOM   1150 N  N   . ILE A 1 171 ? 13.615  33.447 59.692  1.00 11.81 ? 149 ILE A N   1 
ATOM   1151 C  CA  . ILE A 1 171 ? 14.611  33.076 58.690  1.00 11.97 ? 149 ILE A CA  1 
ATOM   1152 C  C   . ILE A 1 171 ? 15.278  34.321 58.101  1.00 12.56 ? 149 ILE A C   1 
ATOM   1153 O  O   . ILE A 1 171 ? 16.493  34.341 57.896  1.00 9.86  ? 149 ILE A O   1 
ATOM   1154 C  CB  . ILE A 1 171 ? 13.989  32.217 57.565  1.00 16.23 ? 149 ILE A CB  1 
ATOM   1155 C  CG1 . ILE A 1 171 ? 13.516  30.873 58.121  1.00 17.86 ? 149 ILE A CG1 1 
ATOM   1156 C  CG2 . ILE A 1 171 ? 14.983  31.992 56.427  1.00 15.59 ? 149 ILE A CG2 1 
ATOM   1157 C  CD1 . ILE A 1 171 ? 12.664  30.079 57.139  1.00 22.55 ? 149 ILE A CD1 1 
ATOM   1158 N  N   . ALA A 1 172 ? 14.483  35.357 57.834  1.00 10.38 ? 150 ALA A N   1 
ATOM   1159 C  CA  . ALA A 1 172 ? 15.025  36.618 57.333  1.00 10.50 ? 150 ALA A CA  1 
ATOM   1160 C  C   . ALA A 1 172 ? 16.134  37.153 58.245  1.00 9.74  ? 150 ALA A C   1 
ATOM   1161 O  O   . ALA A 1 172 ? 17.228  37.482 57.772  1.00 11.45 ? 150 ALA A O   1 
ATOM   1162 C  CB  . ALA A 1 172 ? 13.899  37.659 57.147  1.00 9.73  ? 150 ALA A CB  1 
ATOM   1163 N  N   . ALA A 1 173 ? 15.861  37.215 59.548  1.00 9.87  ? 151 ALA A N   1 
ATOM   1164 C  CA  . ALA A 1 173 ? 16.838  37.704 60.507  1.00 10.08 ? 151 ALA A CA  1 
ATOM   1165 C  C   . ALA A 1 173 ? 18.090  36.831 60.497  1.00 10.78 ? 151 ALA A C   1 
ATOM   1166 O  O   . ALA A 1 173 ? 19.214  37.338 60.582  1.00 10.58 ? 151 ALA A O   1 
ATOM   1167 C  CB  . ALA A 1 173 ? 16.234  37.721 61.898  1.00 10.91 ? 151 ALA A CB  1 
ATOM   1168 N  N   . GLU A 1 174 ? 17.881  35.516 60.422  1.00 11.58 ? 152 GLU A N   1 
ATOM   1169 C  CA  . GLU A 1 174 ? 18.987  34.559 60.427  1.00 12.83 ? 152 GLU A CA  1 
ATOM   1170 C  C   . GLU A 1 174 ? 19.913  34.773 59.228  1.00 10.81 ? 152 GLU A C   1 
ATOM   1171 O  O   . GLU A 1 174 ? 21.139  34.746 59.360  1.00 11.28 ? 152 GLU A O   1 
ATOM   1172 C  CB  . GLU A 1 174 ? 18.447  33.120 60.426  1.00 12.40 ? 152 GLU A CB  1 
ATOM   1173 C  CG  . GLU A 1 174 ? 17.713  32.704 61.698  1.00 15.57 ? 152 GLU A CG  1 
ATOM   1174 C  CD  . GLU A 1 174 ? 16.943  31.394 61.555  1.00 21.05 ? 152 GLU A CD  1 
ATOM   1175 O  OE1 . GLU A 1 174 ? 17.172  30.647 60.576  1.00 24.08 ? 152 GLU A OE1 1 
ATOM   1176 O  OE2 . GLU A 1 174 ? 16.113  31.108 62.441  1.00 20.53 ? 152 GLU A OE2 1 
ATOM   1177 N  N   . LYS A 1 175 ? 19.325  34.984 58.055  1.00 10.02 ? 153 LYS A N   1 
ATOM   1178 C  CA  . LYS A 1 175 ? 20.114  35.110 56.835  1.00 9.59  ? 153 LYS A CA  1 
ATOM   1179 C  C   . LYS A 1 175 ? 20.821  36.462 56.711  1.00 10.99 ? 153 LYS A C   1 
ATOM   1180 O  O   . LYS A 1 175 ? 21.916  36.547 56.143  1.00 10.94 ? 153 LYS A O   1 
ATOM   1181 C  CB  . LYS A 1 175 ? 19.253  34.815 55.606  1.00 10.33 ? 153 LYS A CB  1 
ATOM   1182 C  CG  . LYS A 1 175 ? 18.708  33.392 55.609  1.00 15.72 ? 153 LYS A CG  1 
ATOM   1183 C  CD  . LYS A 1 175 ? 19.843  32.382 55.628  1.00 17.26 ? 153 LYS A CD  1 
ATOM   1184 C  CE  . LYS A 1 175 ? 19.332  30.968 55.857  1.00 24.59 ? 153 LYS A CE  1 
ATOM   1185 N  NZ  . LYS A 1 175 ? 20.438  29.974 55.740  1.00 33.01 ? 153 LYS A NZ  1 
ATOM   1186 N  N   . VAL A 1 176 ? 20.205  37.520 57.236  1.00 9.09  ? 154 VAL A N   1 
ATOM   1187 C  CA  . VAL A 1 176 ? 20.910  38.796 57.372  1.00 9.83  ? 154 VAL A CA  1 
ATOM   1188 C  C   . VAL A 1 176 ? 22.175  38.625 58.221  1.00 11.68 ? 154 VAL A C   1 
ATOM   1189 O  O   . VAL A 1 176 ? 23.252  39.100 57.851  1.00 11.67 ? 154 VAL A O   1 
ATOM   1190 C  CB  . VAL A 1 176 ? 19.991  39.895 57.959  1.00 10.47 ? 154 VAL A CB  1 
ATOM   1191 C  CG1 . VAL A 1 176 ? 20.801  41.115 58.399  1.00 14.15 ? 154 VAL A CG1 1 
ATOM   1192 C  CG2 . VAL A 1 176 ? 18.905  40.276 56.943  1.00 10.45 ? 154 VAL A CG2 1 
ATOM   1193 N  N   . ALA A 1 177 ? 22.051  37.923 59.347  1.00 11.95 ? 155 ALA A N   1 
ATOM   1194 C  CA  . ALA A 1 177 ? 23.180  37.724 60.243  1.00 11.60 ? 155 ALA A CA  1 
ATOM   1195 C  C   . ALA A 1 177 ? 24.291  36.920 59.578  1.00 11.58 ? 155 ALA A C   1 
ATOM   1196 O  O   . ALA A 1 177 ? 25.468  37.122 59.872  1.00 12.17 ? 155 ALA A O   1 
ATOM   1197 C  CB  . ALA A 1 177 ? 22.727  37.042 61.523  1.00 12.59 ? 155 ALA A CB  1 
ATOM   1198 N  N   . GLU A 1 178 ? 23.911  36.007 58.689  1.00 12.63 ? 156 GLU A N   1 
ATOM   1199 C  CA  . GLU A 1 178 ? 24.897  35.214 57.948  1.00 13.40 ? 156 GLU A CA  1 
ATOM   1200 C  C   . GLU A 1 178 ? 25.694  36.060 56.952  1.00 17.88 ? 156 GLU A C   1 
ATOM   1201 O  O   . GLU A 1 178 ? 26.786  35.663 56.526  1.00 19.02 ? 156 GLU A O   1 
ATOM   1202 C  CB  . GLU A 1 178 ? 24.219  34.047 57.221  1.00 13.31 ? 156 GLU A CB  1 
ATOM   1203 C  CG  . GLU A 1 178 ? 23.792  32.909 58.138  1.00 21.60 ? 156 GLU A CG  1 
ATOM   1204 C  CD  . GLU A 1 178 ? 23.251  31.715 57.371  1.00 27.79 ? 156 GLU A CD  1 
ATOM   1205 O  OE1 . GLU A 1 178 ? 23.317  31.726 56.125  1.00 27.00 ? 156 GLU A OE1 1 
ATOM   1206 O  OE2 . GLU A 1 178 ? 22.771  30.764 58.021  1.00 35.73 ? 156 GLU A OE2 1 
ATOM   1207 N  N   . GLY A 1 179 ? 25.151  37.214 56.571  1.00 12.32 ? 157 GLY A N   1 
ATOM   1208 C  CA  . GLY A 1 179 ? 25.882  38.143 55.727  1.00 10.65 ? 157 GLY A CA  1 
ATOM   1209 C  C   . GLY A 1 179 ? 25.245  38.545 54.411  1.00 9.74  ? 157 GLY A C   1 
ATOM   1210 O  O   . GLY A 1 179 ? 25.790  39.395 53.703  1.00 10.27 ? 157 GLY A O   1 
ATOM   1211 N  N   . PHE A 1 180 ? 24.099  37.957 54.080  1.00 9.47  ? 158 PHE A N   1 
ATOM   1212 C  CA  . PHE A 1 180 ? 23.404  38.319 52.842  1.00 8.63  ? 158 PHE A CA  1 
ATOM   1213 C  C   . PHE A 1 180 ? 23.011  39.788 52.847  1.00 10.50 ? 158 PHE A C   1 
ATOM   1214 O  O   . PHE A 1 180 ? 22.346  40.252 53.773  1.00 10.08 ? 158 PHE A O   1 
ATOM   1215 C  CB  . PHE A 1 180 ? 22.155  37.464 52.645  1.00 8.30  ? 158 PHE A CB  1 
ATOM   1216 C  CG  . PHE A 1 180 ? 22.445  36.041 52.256  1.00 8.52  ? 158 PHE A CG  1 
ATOM   1217 C  CD1 . PHE A 1 180 ? 22.607  35.693 50.916  1.00 8.98  ? 158 PHE A CD1 1 
ATOM   1218 C  CD2 . PHE A 1 180 ? 22.531  35.044 53.220  1.00 10.09 ? 158 PHE A CD2 1 
ATOM   1219 C  CE1 . PHE A 1 180 ? 22.854  34.371 50.554  1.00 9.50  ? 158 PHE A CE1 1 
ATOM   1220 C  CE2 . PHE A 1 180 ? 22.785  33.727 52.864  1.00 10.98 ? 158 PHE A CE2 1 
ATOM   1221 C  CZ  . PHE A 1 180 ? 22.949  33.389 51.523  1.00 9.72  ? 158 PHE A CZ  1 
ATOM   1222 N  N   . PRO A 1 181 ? 23.440  40.534 51.821  1.00 8.21  ? 159 PRO A N   1 
ATOM   1223 C  CA  . PRO A 1 181 ? 23.145  41.968 51.759  1.00 10.64 ? 159 PRO A CA  1 
ATOM   1224 C  C   . PRO A 1 181 ? 21.725  42.285 51.271  1.00 10.10 ? 159 PRO A C   1 
ATOM   1225 O  O   . PRO A 1 181 ? 21.320  43.459 51.299  1.00 8.87  ? 159 PRO A O   1 
ATOM   1226 C  CB  . PRO A 1 181 ? 24.201  42.496 50.778  1.00 14.20 ? 159 PRO A CB  1 
ATOM   1227 C  CG  . PRO A 1 181 ? 24.538  41.339 49.921  1.00 15.72 ? 159 PRO A CG  1 
ATOM   1228 C  CD  . PRO A 1 181 ? 24.382  40.107 50.766  1.00 11.41 ? 159 PRO A CD  1 
ATOM   1229 N  N   . ARG A 1 182 ? 20.990  41.262 50.838  1.00 9.36  ? 160 ARG A N   1 
ATOM   1230 C  CA  . ARG A 1 182 ? 19.660  41.437 50.269  1.00 7.65  ? 160 ARG A CA  1 
ATOM   1231 C  C   . ARG A 1 182 ? 18.827  40.190 50.523  1.00 8.78  ? 160 ARG A C   1 
ATOM   1232 O  O   . ARG A 1 182 ? 19.356  39.073 50.493  1.00 8.97  ? 160 ARG A O   1 
ATOM   1233 C  CB  . ARG A 1 182 ? 19.773  41.685 48.759  1.00 6.90  ? 160 ARG A CB  1 
ATOM   1234 C  CG  . ARG A 1 182 ? 18.437  41.860 48.012  1.00 7.35  ? 160 ARG A CG  1 
ATOM   1235 C  CD  . ARG A 1 182 ? 18.719  42.081 46.530  1.00 10.03 ? 160 ARG A CD  1 
ATOM   1236 N  NE  . ARG A 1 182 ? 17.573  42.577 45.764  1.00 10.66 ? 160 ARG A NE  1 
ATOM   1237 C  CZ  . ARG A 1 182 ? 16.993  41.907 44.773  1.00 10.75 ? 160 ARG A CZ  1 
ATOM   1238 N  NH1 . ARG A 1 182 ? 17.421  40.696 44.436  1.00 12.66 ? 160 ARG A NH1 1 
ATOM   1239 N  NH2 . ARG A 1 182 ? 15.981  42.452 44.106  1.00 9.24  ? 160 ARG A NH2 1 
ATOM   1240 N  N   . LEU A 1 183 ? 17.537  40.388 50.794  1.00 7.45  ? 161 LEU A N   1 
ATOM   1241 C  CA  . LEU A 1 183 ? 16.601  39.283 50.963  1.00 9.21  ? 161 LEU A CA  1 
ATOM   1242 C  C   . LEU A 1 183 ? 15.461  39.436 49.977  1.00 10.04 ? 161 LEU A C   1 
ATOM   1243 O  O   . LEU A 1 183 ? 14.985  40.554 49.736  1.00 10.01 ? 161 LEU A O   1 
ATOM   1244 C  CB  . LEU A 1 183 ? 15.997  39.290 52.362  1.00 10.24 ? 161 LEU A CB  1 
ATOM   1245 C  CG  . LEU A 1 183 ? 16.916  39.093 53.555  1.00 16.93 ? 161 LEU A CG  1 
ATOM   1246 C  CD1 . LEU A 1 183 ? 16.075  39.056 54.805  1.00 18.57 ? 161 LEU A CD1 1 
ATOM   1247 C  CD2 . LEU A 1 183 ? 17.745  37.828 53.430  1.00 20.41 ? 161 LEU A CD2 1 
ATOM   1248 N  N   . GLN A 1 184 ? 15.022  38.309 49.423  1.00 7.84  ? 162 GLN A N   1 
ATOM   1249 C  CA  . GLN A 1 184 ? 13.822  38.260 48.608  1.00 8.26  ? 162 GLN A CA  1 
ATOM   1250 C  C   . GLN A 1 184 ? 12.808  37.376 49.321  1.00 8.62  ? 162 GLN A C   1 
ATOM   1251 O  O   . GLN A 1 184 ? 13.114  36.231 49.680  1.00 10.22 ? 162 GLN A O   1 
ATOM   1252 C  CB  . GLN A 1 184 ? 14.142  37.671 47.236  1.00 7.99  ? 162 GLN A CB  1 
ATOM   1253 C  CG  . GLN A 1 184 ? 12.940  37.601 46.314  1.00 8.23  ? 162 GLN A CG  1 
ATOM   1254 C  CD  . GLN A 1 184 ? 13.128  36.598 45.191  1.00 11.91 ? 162 GLN A CD  1 
ATOM   1255 O  OE1 . GLN A 1 184 ? 12.905  35.398 45.367  1.00 14.98 ? 162 GLN A OE1 1 
ATOM   1256 N  NE2 . GLN A 1 184 ? 13.518  37.086 44.025  1.00 12.94 ? 162 GLN A NE2 1 
ATOM   1257 N  N   . ILE A 1 185 ? 11.619  37.923 49.548  1.00 8.12  ? 163 ILE A N   1 
ATOM   1258 C  CA  . ILE A 1 185 ? 10.538  37.209 50.227  1.00 9.43  ? 163 ILE A CA  1 
ATOM   1259 C  C   . ILE A 1 185 ? 9.516   36.772 49.194  1.00 10.81 ? 163 ILE A C   1 
ATOM   1260 O  O   . ILE A 1 185 ? 8.920   37.609 48.519  1.00 8.78  ? 163 ILE A O   1 
ATOM   1261 C  CB  . ILE A 1 185 ? 9.843   38.131 51.253  1.00 10.63 ? 163 ILE A CB  1 
ATOM   1262 C  CG1 . ILE A 1 185 ? 10.883  38.780 52.186  1.00 12.09 ? 163 ILE A CG1 1 
ATOM   1263 C  CG2 . ILE A 1 185 ? 8.777   37.353 52.042  1.00 14.13 ? 163 ILE A CG2 1 
ATOM   1264 C  CD1 . ILE A 1 185 ? 11.753  37.772 52.950  1.00 13.43 ? 163 ILE A CD1 1 
ATOM   1265 N  N   . LYS A 1 186 ? 9.331   35.464 49.029  1.00 8.62  ? 164 LYS A N   1 
ATOM   1266 C  CA  . LYS A 1 186 ? 8.324   34.999 48.077  1.00 8.25  ? 164 LYS A CA  1 
ATOM   1267 C  C   . LYS A 1 186 ? 6.933   35.040 48.703  1.00 11.43 ? 164 LYS A C   1 
ATOM   1268 O  O   . LYS A 1 186 ? 6.750   34.657 49.869  1.00 14.36 ? 164 LYS A O   1 
ATOM   1269 C  CB  . LYS A 1 186 ? 8.671   33.606 47.539  1.00 15.08 ? 164 LYS A CB  1 
ATOM   1270 C  CG  . LYS A 1 186 ? 9.942   33.605 46.680  1.00 20.58 ? 164 LYS A CG  1 
ATOM   1271 C  CD  . LYS A 1 186 ? 10.115  32.305 45.896  1.00 21.55 ? 164 LYS A CD  1 
ATOM   1272 C  CE  . LYS A 1 186 ? 11.267  32.415 44.891  1.00 23.12 ? 164 LYS A CE  1 
ATOM   1273 N  NZ  . LYS A 1 186 ? 11.116  33.620 44.020  1.00 27.43 ? 164 LYS A NZ  1 
ATOM   1274 N  N   . ILE A 1 187 ? 5.963   35.530 47.933  1.00 10.29 ? 165 ILE A N   1 
ATOM   1275 C  CA  . ILE A 1 187 ? 4.581   35.649 48.392  1.00 10.98 ? 165 ILE A CA  1 
ATOM   1276 C  C   . ILE A 1 187 ? 3.604   35.119 47.350  1.00 13.65 ? 165 ILE A C   1 
ATOM   1277 O  O   . ILE A 1 187 ? 4.007   34.740 46.245  1.00 12.58 ? 165 ILE A O   1 
ATOM   1278 C  CB  . ILE A 1 187 ? 4.211   37.113 48.725  1.00 8.58  ? 165 ILE A CB  1 
ATOM   1279 C  CG1 . ILE A 1 187 ? 4.301   38.009 47.489  1.00 9.51  ? 165 ILE A CG1 1 
ATOM   1280 C  CG2 . ILE A 1 187 ? 5.094   37.663 49.860  1.00 10.77 ? 165 ILE A CG2 1 
ATOM   1281 C  CD1 . ILE A 1 187 ? 3.579   39.330 47.668  1.00 11.88 ? 165 ILE A CD1 1 
ATOM   1282 N  N   . GLY A 1 188 ? 2.322   35.088 47.707  1.00 12.50 ? 166 GLY A N   1 
ATOM   1283 C  CA  . GLY A 1 188 ? 1.272   34.728 46.768  1.00 16.37 ? 166 GLY A CA  1 
ATOM   1284 C  C   . GLY A 1 188 ? 0.669   33.349 46.964  1.00 14.16 ? 166 GLY A C   1 
ATOM   1285 O  O   . GLY A 1 188 ? 1.144   32.552 47.777  1.00 15.98 ? 166 GLY A O   1 
ATOM   1286 N  N   . GLY A 1 189 ? -0.396  33.068 46.213  1.00 15.23 ? 167 GLY A N   1 
ATOM   1287 C  CA  . GLY A 1 189 ? -1.054  31.771 46.264  1.00 16.83 ? 167 GLY A CA  1 
ATOM   1288 C  C   . GLY A 1 189 ? -1.954  31.578 47.471  1.00 17.79 ? 167 GLY A C   1 
ATOM   1289 O  O   . GLY A 1 189 ? -2.331  30.454 47.803  1.00 18.51 ? 167 GLY A O   1 
ATOM   1290 N  N   . ARG A 1 190 ? -2.309  32.685 48.115  1.00 15.76 ? 168 ARG A N   1 
ATOM   1291 C  CA  . ARG A 1 190 ? -3.082  32.669 49.351  1.00 14.88 ? 168 ARG A CA  1 
ATOM   1292 C  C   . ARG A 1 190 ? -3.607  34.093 49.529  1.00 14.95 ? 168 ARG A C   1 
ATOM   1293 O  O   . ARG A 1 190 ? -3.195  34.987 48.783  1.00 14.98 ? 168 ARG A O   1 
ATOM   1294 C  CB  . ARG A 1 190 ? -2.171  32.275 50.518  1.00 16.59 ? 168 ARG A CB  1 
ATOM   1295 C  CG  . ARG A 1 190 ? -1.076  33.284 50.773  1.00 15.27 ? 168 ARG A CG  1 
ATOM   1296 C  CD  . ARG A 1 190 ? -0.063  32.827 51.816  1.00 16.14 ? 168 ARG A CD  1 
ATOM   1297 N  NE  . ARG A 1 190 ? 1.007   33.812 51.903  1.00 16.23 ? 168 ARG A NE  1 
ATOM   1298 C  CZ  . ARG A 1 190 ? 2.103   33.677 52.641  1.00 19.39 ? 168 ARG A CZ  1 
ATOM   1299 N  NH1 . ARG A 1 190 ? 2.276   32.595 53.388  1.00 22.00 ? 168 ARG A NH1 1 
ATOM   1300 N  NH2 . ARG A 1 190 ? 3.022   34.637 52.633  1.00 17.51 ? 168 ARG A NH2 1 
ATOM   1301 N  N   . PRO A 1 191 ? -4.519  34.318 50.496  1.00 14.86 ? 169 PRO A N   1 
ATOM   1302 C  CA  . PRO A 1 191 ? -5.008  35.691 50.680  1.00 14.47 ? 169 PRO A CA  1 
ATOM   1303 C  C   . PRO A 1 191 ? -3.887  36.699 50.946  1.00 13.20 ? 169 PRO A C   1 
ATOM   1304 O  O   . PRO A 1 191 ? -2.976  36.457 51.755  1.00 12.78 ? 169 PRO A O   1 
ATOM   1305 C  CB  . PRO A 1 191 ? -5.938  35.572 51.886  1.00 17.18 ? 169 PRO A CB  1 
ATOM   1306 C  CG  . PRO A 1 191 ? -6.425  34.160 51.837  1.00 17.32 ? 169 PRO A CG  1 
ATOM   1307 C  CD  . PRO A 1 191 ? -5.247  33.360 51.351  1.00 16.26 ? 169 PRO A CD  1 
ATOM   1308 N  N   . VAL A 1 192 ? -3.957  37.834 50.256  1.00 12.74 ? 170 VAL A N   1 
ATOM   1309 C  CA  . VAL A 1 192 ? -2.848  38.781 50.260  1.00 11.68 ? 170 VAL A CA  1 
ATOM   1310 C  C   . VAL A 1 192 ? -2.578  39.383 51.644  1.00 11.48 ? 170 VAL A C   1 
ATOM   1311 O  O   . VAL A 1 192 ? -1.454  39.807 51.922  1.00 11.78 ? 170 VAL A O   1 
ATOM   1312 C  CB  . VAL A 1 192 ? -3.038  39.877 49.162  1.00 11.47 ? 170 VAL A CB  1 
ATOM   1313 C  CG1 . VAL A 1 192 ? -4.131  40.860 49.553  1.00 13.70 ? 170 VAL A CG1 1 
ATOM   1314 C  CG2 . VAL A 1 192 ? -1.730  40.599 48.882  1.00 11.69 ? 170 VAL A CG2 1 
ATOM   1315 N  N   . GLU A 1 193 ? -3.578  39.397 52.524  1.00 12.26 ? 171 GLU A N   1 
ATOM   1316 C  CA  . GLU A 1 193 ? -3.335  39.922 53.874  1.00 12.27 ? 171 GLU A CA  1 
ATOM   1317 C  C   . GLU A 1 193 ? -2.261  39.125 54.607  1.00 11.97 ? 171 GLU A C   1 
ATOM   1318 O  O   . GLU A 1 193 ? -1.552  39.675 55.450  1.00 12.79 ? 171 GLU A O   1 
ATOM   1319 C  CB  . GLU A 1 193 ? -4.618  40.002 54.705  1.00 14.45 ? 171 GLU A CB  1 
ATOM   1320 C  CG  . GLU A 1 193 ? -5.276  38.666 54.974  1.00 17.95 ? 171 GLU A CG  1 
ATOM   1321 C  CD  . GLU A 1 193 ? -6.428  38.403 54.038  1.00 23.14 ? 171 GLU A CD  1 
ATOM   1322 O  OE1 . GLU A 1 193 ? -7.397  37.755 54.477  1.00 25.92 ? 171 GLU A OE1 1 
ATOM   1323 O  OE2 . GLU A 1 193 ? -6.370  38.848 52.870  1.00 21.61 ? 171 GLU A OE2 1 
ATOM   1324 N  N   . ILE A 1 194 ? -2.125  37.844 54.268  1.00 12.18 ? 172 ILE A N   1 
ATOM   1325 C  CA  . ILE A 1 194 ? -1.072  37.008 54.863  1.00 12.03 ? 172 ILE A CA  1 
ATOM   1326 C  C   . ILE A 1 194 ? 0.300   37.400 54.306  1.00 10.99 ? 172 ILE A C   1 
ATOM   1327 O  O   . ILE A 1 194 ? 1.296   37.422 55.037  1.00 12.05 ? 172 ILE A O   1 
ATOM   1328 C  CB  . ILE A 1 194 ? -1.348  35.505 54.639  1.00 13.95 ? 172 ILE A CB  1 
ATOM   1329 C  CG1 . ILE A 1 194 ? -2.711  35.125 55.219  1.00 16.97 ? 172 ILE A CG1 1 
ATOM   1330 C  CG2 . ILE A 1 194 ? -0.258  34.643 55.276  1.00 13.24 ? 172 ILE A CG2 1 
ATOM   1331 C  CD1 . ILE A 1 194 ? -3.187  33.754 54.794  1.00 21.33 ? 172 ILE A CD1 1 
ATOM   1332 N  N   . ASP A 1 195 ? 0.352   37.711 53.013  1.00 10.52 ? 173 ASP A N   1 
ATOM   1333 C  CA  . ASP A 1 195 ? 1.574   38.218 52.395  1.00 10.19 ? 173 ASP A CA  1 
ATOM   1334 C  C   . ASP A 1 195 ? 1.992   39.541 53.031  1.00 9.20  ? 173 ASP A C   1 
ATOM   1335 O  O   . ASP A 1 195 ? 3.170   39.755 53.303  1.00 9.86  ? 173 ASP A O   1 
ATOM   1336 C  CB  . ASP A 1 195 ? 1.383   38.444 50.887  1.00 9.87  ? 173 ASP A CB  1 
ATOM   1337 C  CG  . ASP A 1 195 ? 1.121   37.158 50.111  1.00 12.79 ? 173 ASP A CG  1 
ATOM   1338 O  OD1 . ASP A 1 195 ? 1.592   36.087 50.536  1.00 16.46 ? 173 ASP A OD1 1 
ATOM   1339 O  OD2 . ASP A 1 195 ? 0.465   37.239 49.050  1.00 14.72 ? 173 ASP A OD2 1 
ATOM   1340 N  N   . ILE A 1 196 ? 1.022   40.431 53.239  1.00 9.52  ? 174 ILE A N   1 
ATOM   1341 C  CA  . ILE A 1 196 ? 1.292   41.744 53.827  1.00 9.37  ? 174 ILE A CA  1 
ATOM   1342 C  C   . ILE A 1 196 ? 1.791   41.602 55.268  1.00 10.07 ? 174 ILE A C   1 
ATOM   1343 O  O   . ILE A 1 196 ? 2.736   42.281 55.676  1.00 10.29 ? 174 ILE A O   1 
ATOM   1344 C  CB  . ILE A 1 196 ? 0.040   42.664 53.735  1.00 9.91  ? 174 ILE A CB  1 
ATOM   1345 C  CG1 . ILE A 1 196 ? -0.228  43.023 52.273  1.00 10.68 ? 174 ILE A CG1 1 
ATOM   1346 C  CG2 . ILE A 1 196 ? 0.219   43.921 54.569  1.00 10.07 ? 174 ILE A CG2 1 
ATOM   1347 C  CD1 . ILE A 1 196 ? -1.618  43.616 52.029  1.00 13.79 ? 174 ILE A CD1 1 
ATOM   1348 N  N   . GLU A 1 197 ? 1.177   40.703 56.036  1.00 10.53 ? 175 GLU A N   1 
ATOM   1349 C  CA  . GLU A 1 197 ? 1.649   40.421 57.392  1.00 12.76 ? 175 GLU A CA  1 
ATOM   1350 C  C   . GLU A 1 197 ? 3.094   39.917 57.370  1.00 11.00 ? 175 GLU A C   1 
ATOM   1351 O  O   . GLU A 1 197 ? 3.909   40.317 58.202  1.00 10.68 ? 175 GLU A O   1 
ATOM   1352 C  CB  . GLU A 1 197 ? 0.740   39.391 58.069  1.00 12.26 ? 175 GLU A CB  1 
ATOM   1353 C  CG  . GLU A 1 197 ? 1.186   38.979 59.477  1.00 13.88 ? 175 GLU A CG  1 
ATOM   1354 C  CD  . GLU A 1 197 ? 0.410   37.783 60.013  1.00 23.07 ? 175 GLU A CD  1 
ATOM   1355 O  OE1 . GLU A 1 197 ? -0.690  37.495 59.491  1.00 25.29 ? 175 GLU A OE1 1 
ATOM   1356 O  OE2 . GLU A 1 197 ? 0.898   37.128 60.958  1.00 24.42 ? 175 GLU A OE2 1 
ATOM   1357 N  N   . THR A 1 198 ? 3.402   39.038 56.417  1.00 9.72  ? 176 THR A N   1 
ATOM   1358 C  CA  . THR A 1 198 ? 4.760   38.508 56.263  1.00 9.28  ? 176 THR A CA  1 
ATOM   1359 C  C   . THR A 1 198 ? 5.746   39.636 55.990  1.00 11.60 ? 176 THR A C   1 
ATOM   1360 O  O   . THR A 1 198 ? 6.792   39.715 56.627  1.00 9.27  ? 176 THR A O   1 
ATOM   1361 C  CB  . THR A 1 198 ? 4.849   37.465 55.118  1.00 10.38 ? 176 THR A CB  1 
ATOM   1362 O  OG1 . THR A 1 198 ? 3.974   36.362 55.408  1.00 11.69 ? 176 THR A OG1 1 
ATOM   1363 C  CG2 . THR A 1 198 ? 6.281   36.937 54.984  1.00 10.79 ? 176 THR A CG2 1 
ATOM   1364 N  N   . VAL A 1 199 ? 5.412   40.506 55.038  1.00 8.29  ? 177 VAL A N   1 
ATOM   1365 C  CA  . VAL A 1 199 ? 6.284   41.634 54.694  1.00 8.27  ? 177 VAL A CA  1 
ATOM   1366 C  C   . VAL A 1 199 ? 6.530   42.548 55.904  1.00 8.40  ? 177 VAL A C   1 
ATOM   1367 O  O   . VAL A 1 199 ? 7.668   42.944 56.170  1.00 9.94  ? 177 VAL A O   1 
ATOM   1368 C  CB  . VAL A 1 199 ? 5.728   42.440 53.494  1.00 8.50  ? 177 VAL A CB  1 
ATOM   1369 C  CG1 . VAL A 1 199 ? 6.568   43.699 53.243  1.00 10.69 ? 177 VAL A CG1 1 
ATOM   1370 C  CG2 . VAL A 1 199 ? 5.712   41.570 52.247  1.00 10.03 ? 177 VAL A CG2 1 
ATOM   1371 N  N   A ARG A 1 200 ? 5.469   42.876 56.635  0.48 8.69  ? 178 ARG A N   1 
ATOM   1372 N  N   B ARG A 1 200 ? 5.474   42.865 56.644  0.52 8.85  ? 178 ARG A N   1 
ATOM   1373 C  CA  A ARG A 1 200 ? 5.603   43.728 57.816  0.48 9.19  ? 178 ARG A CA  1 
ATOM   1374 C  CA  B ARG A 1 200 ? 5.616   43.718 57.819  0.52 9.19  ? 178 ARG A CA  1 
ATOM   1375 C  C   A ARG A 1 200 ? 6.468   43.088 58.905  0.48 10.97 ? 178 ARG A C   1 
ATOM   1376 C  C   B ARG A 1 200 ? 6.483   43.083 58.900  0.52 10.97 ? 178 ARG A C   1 
ATOM   1377 O  O   A ARG A 1 200 ? 7.283   43.764 59.537  0.48 10.66 ? 178 ARG A O   1 
ATOM   1378 O  O   B ARG A 1 200 ? 7.310   43.753 59.526  0.52 10.51 ? 178 ARG A O   1 
ATOM   1379 C  CB  A ARG A 1 200 ? 4.225   44.113 58.370  0.48 9.94  ? 178 ARG A CB  1 
ATOM   1380 C  CB  B ARG A 1 200 ? 4.242   44.082 58.378  0.52 9.94  ? 178 ARG A CB  1 
ATOM   1381 C  CG  A ARG A 1 200 ? 3.465   45.111 57.492  0.48 11.73 ? 178 ARG A CG  1 
ATOM   1382 C  CG  B ARG A 1 200 ? 3.429   44.922 57.415  0.52 11.90 ? 178 ARG A CG  1 
ATOM   1383 C  CD  A ARG A 1 200 ? 2.082   45.422 58.058  0.48 13.92 ? 178 ARG A CD  1 
ATOM   1384 C  CD  B ARG A 1 200 ? 2.214   45.526 58.084  0.52 14.10 ? 178 ARG A CD  1 
ATOM   1385 N  NE  A ARG A 1 200 ? 1.356   46.391 57.235  0.48 15.87 ? 178 ARG A NE  1 
ATOM   1386 N  NE  B ARG A 1 200 ? 1.673   46.612 57.272  0.52 16.14 ? 178 ARG A NE  1 
ATOM   1387 C  CZ  A ARG A 1 200 ? 0.030   46.459 57.144  0.48 19.50 ? 178 ARG A CZ  1 
ATOM   1388 C  CZ  B ARG A 1 200 ? 2.185   47.838 57.235  0.52 14.89 ? 178 ARG A CZ  1 
ATOM   1389 N  NH1 A ARG A 1 200 ? -0.731  45.612 57.825  0.48 19.38 ? 178 ARG A NH1 1 
ATOM   1390 N  NH1 B ARG A 1 200 ? 3.245   48.145 57.973  0.52 15.95 ? 178 ARG A NH1 1 
ATOM   1391 N  NH2 A ARG A 1 200 ? -0.542  47.376 56.368  0.48 11.68 ? 178 ARG A NH2 1 
ATOM   1392 N  NH2 B ARG A 1 200 ? 1.636   48.763 56.464  0.52 15.71 ? 178 ARG A NH2 1 
ATOM   1393 N  N   . LYS A 1 201 ? 6.300   41.788 59.121  1.00 9.75  ? 179 LYS A N   1 
ATOM   1394 C  CA  . LYS A 1 201 ? 7.082   41.093 60.139  1.00 10.03 ? 179 LYS A CA  1 
ATOM   1395 C  C   . LYS A 1 201 ? 8.556   40.950 59.762  1.00 9.49  ? 179 LYS A C   1 
ATOM   1396 O  O   . LYS A 1 201 ? 9.432   41.102 60.617  1.00 10.91 ? 179 LYS A O   1 
ATOM   1397 C  CB  . LYS A 1 201 ? 6.435   39.756 60.503  1.00 11.44 ? 179 LYS A CB  1 
ATOM   1398 C  CG  . LYS A 1 201 ? 5.203   39.979 61.378  1.00 15.91 ? 179 LYS A CG  1 
ATOM   1399 C  CD  . LYS A 1 201 ? 4.436   38.715 61.674  1.00 16.50 ? 179 LYS A CD  1 
ATOM   1400 C  CE  . LYS A 1 201 ? 3.313   39.017 62.666  1.00 20.03 ? 179 LYS A CE  1 
ATOM   1401 N  NZ  . LYS A 1 201 ? 2.605   37.792 63.119  1.00 23.11 ? 179 LYS A NZ  1 
ATOM   1402 N  N   . VAL A 1 202 ? 8.823   40.681 58.485  1.00 8.77  ? 180 VAL A N   1 
ATOM   1403 C  CA  . VAL A 1 202 ? 10.194  40.667 57.989  1.00 8.31  ? 180 VAL A CA  1 
ATOM   1404 C  C   . VAL A 1 202 ? 10.841  42.040 58.185  1.00 10.23 ? 180 VAL A C   1 
ATOM   1405 O  O   . VAL A 1 202 ? 11.971  42.144 58.682  1.00 9.61  ? 180 VAL A O   1 
ATOM   1406 C  CB  . VAL A 1 202 ? 10.245  40.253 56.503  1.00 7.70  ? 180 VAL A CB  1 
ATOM   1407 C  CG1 . VAL A 1 202 ? 11.604  40.546 55.917  1.00 9.46  ? 180 VAL A CG1 1 
ATOM   1408 C  CG2 . VAL A 1 202 ? 9.919   38.773 56.357  1.00 7.94  ? 180 VAL A CG2 1 
ATOM   1409 N  N   . TRP A 1 203 ? 10.121  43.098 57.814  1.00 9.96  ? 181 TRP A N   1 
ATOM   1410 C  CA  . TRP A 1 203 ? 10.673  44.445 57.941  1.00 10.66 ? 181 TRP A CA  1 
ATOM   1411 C  C   . TRP A 1 203 ? 11.002  44.778 59.393  1.00 11.81 ? 181 TRP A C   1 
ATOM   1412 O  O   . TRP A 1 203 ? 12.057  45.344 59.679  1.00 10.75 ? 181 TRP A O   1 
ATOM   1413 C  CB  . TRP A 1 203 ? 9.747   45.495 57.301  1.00 10.10 ? 181 TRP A CB  1 
ATOM   1414 C  CG  . TRP A 1 203 ? 10.282  46.894 57.397  1.00 11.76 ? 181 TRP A CG  1 
ATOM   1415 C  CD1 . TRP A 1 203 ? 9.702   47.959 58.027  1.00 14.43 ? 181 TRP A CD1 1 
ATOM   1416 C  CD2 . TRP A 1 203 ? 11.521  47.371 56.860  1.00 11.01 ? 181 TRP A CD2 1 
ATOM   1417 N  NE1 . TRP A 1 203 ? 10.504  49.070 57.908  1.00 15.90 ? 181 TRP A NE1 1 
ATOM   1418 C  CE2 . TRP A 1 203 ? 11.621  48.735 57.198  1.00 13.18 ? 181 TRP A CE2 1 
ATOM   1419 C  CE3 . TRP A 1 203 ? 12.548  46.778 56.127  1.00 12.62 ? 181 TRP A CE3 1 
ATOM   1420 C  CZ2 . TRP A 1 203 ? 12.722  49.511 56.827  1.00 15.69 ? 181 TRP A CZ2 1 
ATOM   1421 C  CZ3 . TRP A 1 203 ? 13.633  47.551 55.759  1.00 19.45 ? 181 TRP A CZ3 1 
ATOM   1422 C  CH2 . TRP A 1 203 ? 13.714  48.896 56.111  1.00 13.77 ? 181 TRP A CH2 1 
ATOM   1423 N  N   . GLU A 1 204 ? 10.124  44.392 60.318  1.00 9.71  ? 182 GLU A N   1 
ATOM   1424 C  CA  . GLU A 1 204 ? 10.407  44.595 61.734  1.00 16.14 ? 182 GLU A CA  1 
ATOM   1425 C  C   . GLU A 1 204 ? 11.741  43.972 62.164  1.00 15.22 ? 182 GLU A C   1 
ATOM   1426 O  O   . GLU A 1 204 ? 12.452  44.539 62.993  1.00 14.08 ? 182 GLU A O   1 
ATOM   1427 C  CB  . GLU A 1 204 ? 9.261   44.074 62.593  1.00 17.69 ? 182 GLU A CB  1 
ATOM   1428 C  CG  . GLU A 1 204 ? 8.072   45.015 62.608  1.00 28.03 ? 182 GLU A CG  1 
ATOM   1429 C  CD  . GLU A 1 204 ? 8.474   46.431 62.993  1.00 38.54 ? 182 GLU A CD  1 
ATOM   1430 O  OE1 . GLU A 1 204 ? 9.073   46.601 64.079  1.00 43.96 ? 182 GLU A OE1 1 
ATOM   1431 O  OE2 . GLU A 1 204 ? 8.207   47.370 62.206  1.00 35.29 ? 182 GLU A OE2 1 
ATOM   1432 N  N   . ARG A 1 205 ? 12.092  42.828 61.581  1.00 11.37 ? 183 ARG A N   1 
ATOM   1433 C  CA  . ARG A 1 205 ? 13.367  42.168 61.913  1.00 14.20 ? 183 ARG A CA  1 
ATOM   1434 C  C   . ARG A 1 205 ? 14.596  42.779 61.246  1.00 15.55 ? 183 ARG A C   1 
ATOM   1435 O  O   . ARG A 1 205 ? 15.674  42.820 61.849  1.00 18.40 ? 183 ARG A O   1 
ATOM   1436 C  CB  . ARG A 1 205 ? 13.316  40.678 61.558  1.00 16.20 ? 183 ARG A CB  1 
ATOM   1437 C  CG  . ARG A 1 205 ? 12.340  39.883 62.375  1.00 19.46 ? 183 ARG A CG  1 
ATOM   1438 C  CD  . ARG A 1 205 ? 12.742  39.837 63.842  1.00 21.56 ? 183 ARG A CD  1 
ATOM   1439 N  NE  . ARG A 1 205 ? 12.911  38.464 64.311  1.00 26.10 ? 183 ARG A NE  1 
ATOM   1440 C  CZ  . ARG A 1 205 ? 11.912  37.593 64.446  1.00 26.88 ? 183 ARG A CZ  1 
ATOM   1441 N  NH1 . ARG A 1 205 ? 10.665  37.941 64.142  1.00 24.68 ? 183 ARG A NH1 1 
ATOM   1442 N  NH2 . ARG A 1 205 ? 12.157  36.367 64.883  1.00 23.48 ? 183 ARG A NH2 1 
ATOM   1443 N  N   . ILE A 1 206 ? 14.450  43.236 60.006  1.00 13.23 ? 184 ILE A N   1 
ATOM   1444 C  CA  . ILE A 1 206 ? 15.621  43.628 59.219  1.00 12.11 ? 184 ILE A CA  1 
ATOM   1445 C  C   . ILE A 1 206 ? 15.838  45.137 59.087  1.00 14.39 ? 184 ILE A C   1 
ATOM   1446 O  O   . ILE A 1 206 ? 16.888  45.566 58.606  1.00 15.52 ? 184 ILE A O   1 
ATOM   1447 C  CB  . ILE A 1 206 ? 15.641  42.951 57.818  1.00 12.11 ? 184 ILE A CB  1 
ATOM   1448 C  CG1 . ILE A 1 206 ? 14.591  43.561 56.883  1.00 13.13 ? 184 ILE A CG1 1 
ATOM   1449 C  CG2 . ILE A 1 206 ? 15.470  41.436 57.951  1.00 14.39 ? 184 ILE A CG2 1 
ATOM   1450 C  CD1 . ILE A 1 206 ? 14.748  43.108 55.425  1.00 14.49 ? 184 ILE A CD1 1 
ATOM   1451 N  N   . ARG A 1 207 ? 14.859  45.943 59.500  1.00 12.47 ? 185 ARG A N   1 
ATOM   1452 C  CA  . ARG A 1 207 ? 15.036  47.398 59.475  1.00 12.21 ? 185 ARG A CA  1 
ATOM   1453 C  C   . ARG A 1 207 ? 16.258  47.808 60.295  1.00 14.41 ? 185 ARG A C   1 
ATOM   1454 O  O   . ARG A 1 207 ? 16.491  47.286 61.389  1.00 16.87 ? 185 ARG A O   1 
ATOM   1455 C  CB  . ARG A 1 207 ? 13.790  48.114 59.998  1.00 14.57 ? 185 ARG A CB  1 
ATOM   1456 C  CG  . ARG A 1 207 ? 13.444  47.757 61.429  1.00 23.38 ? 185 ARG A CG  1 
ATOM   1457 C  CD  . ARG A 1 207 ? 12.081  48.278 61.823  1.00 32.38 ? 185 ARG A CD  1 
ATOM   1458 N  NE  . ARG A 1 207 ? 11.998  49.725 61.672  1.00 39.68 ? 185 ARG A NE  1 
ATOM   1459 C  CZ  . ARG A 1 207 ? 10.856  50.402 61.657  1.00 44.26 ? 185 ARG A CZ  1 
ATOM   1460 N  NH1 . ARG A 1 207 ? 10.866  51.721 61.513  1.00 48.91 ? 185 ARG A NH1 1 
ATOM   1461 N  NH2 . ARG A 1 207 ? 9.703   49.756 61.782  1.00 42.22 ? 185 ARG A NH2 1 
ATOM   1462 N  N   . GLY A 1 208 ? 17.044  48.733 59.758  1.00 16.05 ? 186 GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 208 ? 18.223  49.211 60.459  1.00 16.49 ? 186 GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 208 ? 19.474  48.375 60.243  1.00 15.92 ? 186 GLY A C   1 
ATOM   1465 O  O   . GLY A 1 208 ? 20.532  48.701 60.776  1.00 18.69 ? 186 GLY A O   1 
ATOM   1466 N  N   . THR A 1 209 ? 19.366  47.304 59.466  1.00 13.57 ? 187 THR A N   1 
ATOM   1467 C  CA  . THR A 1 209 ? 20.516  46.436 59.204  1.00 13.28 ? 187 THR A CA  1 
ATOM   1468 C  C   . THR A 1 209 ? 21.173  46.743 57.862  1.00 13.47 ? 187 THR A C   1 
ATOM   1469 O  O   . THR A 1 209 ? 22.188  46.143 57.509  1.00 17.27 ? 187 THR A O   1 
ATOM   1470 C  CB  . THR A 1 209 ? 20.138  44.932 59.251  1.00 13.05 ? 187 THR A CB  1 
ATOM   1471 O  OG1 . THR A 1 209 ? 19.256  44.612 58.167  1.00 12.65 ? 187 THR A OG1 1 
ATOM   1472 C  CG2 . THR A 1 209 ? 19.463  44.588 60.569  1.00 12.12 ? 187 THR A CG2 1 
ATOM   1473 N  N   . GLY A 1 210 ? 20.582  47.669 57.116  1.00 14.80 ? 188 GLY A N   1 
ATOM   1474 C  CA  . GLY A 1 210 ? 21.107  48.020 55.806  1.00 15.37 ? 188 GLY A CA  1 
ATOM   1475 C  C   . GLY A 1 210 ? 20.852  46.973 54.734  1.00 18.80 ? 188 GLY A C   1 
ATOM   1476 O  O   . GLY A 1 210 ? 21.431  47.029 53.651  1.00 27.12 ? 188 GLY A O   1 
ATOM   1477 N  N   . THR A 1 211 ? 19.981  46.018 55.035  1.00 12.23 ? 189 THR A N   1 
ATOM   1478 C  CA  . THR A 1 211 ? 19.663  44.940 54.110  1.00 8.63  ? 189 THR A CA  1 
ATOM   1479 C  C   . THR A 1 211 ? 18.612  45.397 53.099  1.00 10.30 ? 189 THR A C   1 
ATOM   1480 O  O   . THR A 1 211 ? 17.589  45.975 53.476  1.00 10.09 ? 189 THR A O   1 
ATOM   1481 C  CB  . THR A 1 211 ? 19.110  43.724 54.897  1.00 7.48  ? 189 THR A CB  1 
ATOM   1482 O  OG1 . THR A 1 211 ? 20.084  43.305 55.864  1.00 10.19 ? 189 THR A OG1 1 
ATOM   1483 C  CG2 . THR A 1 211 ? 18.768  42.559 53.963  1.00 10.43 ? 189 THR A CG2 1 
ATOM   1484 N  N   . ARG A 1 212 ? 18.844  45.136 51.814  1.00 8.20  ? 190 ARG A N   1 
ATOM   1485 C  CA  . ARG A 1 212 ? 17.846  45.489 50.800  1.00 6.77  ? 190 ARG A CA  1 
ATOM   1486 C  C   . ARG A 1 212 ? 16.767  44.422 50.701  1.00 7.41  ? 190 ARG A C   1 
ATOM   1487 O  O   . ARG A 1 212 ? 17.017  43.242 50.970  1.00 7.27  ? 190 ARG A O   1 
ATOM   1488 C  CB  . ARG A 1 212 ? 18.498  45.759 49.439  1.00 13.46 ? 190 ARG A CB  1 
ATOM   1489 C  CG  . ARG A 1 212 ? 19.314  47.054 49.441  1.00 18.06 ? 190 ARG A CG  1 
ATOM   1490 C  CD  . ARG A 1 212 ? 19.743  47.483 48.029  1.00 19.04 ? 190 ARG A CD  1 
ATOM   1491 N  NE  . ARG A 1 212 ? 20.286  46.370 47.269  1.00 17.55 ? 190 ARG A NE  1 
ATOM   1492 C  CZ  . ARG A 1 212 ? 21.480  45.833 47.493  1.00 22.33 ? 190 ARG A CZ  1 
ATOM   1493 N  NH1 . ARG A 1 212 ? 22.259  46.310 48.462  1.00 24.72 ? 190 ARG A NH1 1 
ATOM   1494 N  NH2 . ARG A 1 212 ? 21.901  44.821 46.752  1.00 19.98 ? 190 ARG A NH2 1 
ATOM   1495 N  N   . LEU A 1 213 ? 15.558  44.851 50.345  1.00 8.54  ? 191 LEU A N   1 
ATOM   1496 C  CA  . LEU A 1 213 ? 14.412  43.960 50.364  1.00 9.26  ? 191 LEU A CA  1 
ATOM   1497 C  C   . LEU A 1 213 ? 13.691  43.894 49.021  1.00 7.58  ? 191 LEU A C   1 
ATOM   1498 O  O   . LEU A 1 213 ? 13.385  44.925 48.412  1.00 9.13  ? 191 LEU A O   1 
ATOM   1499 C  CB  . LEU A 1 213 ? 13.437  44.410 51.449  1.00 9.92  ? 191 LEU A CB  1 
ATOM   1500 C  CG  . LEU A 1 213 ? 12.143  43.617 51.615  1.00 10.33 ? 191 LEU A CG  1 
ATOM   1501 C  CD1 . LEU A 1 213 ? 12.433  42.196 52.062  1.00 14.35 ? 191 LEU A CD1 1 
ATOM   1502 C  CD2 . LEU A 1 213 ? 11.240  44.321 52.622  1.00 12.00 ? 191 LEU A CD2 1 
ATOM   1503 N  N   . ALA A 1 214 ? 13.406  42.671 48.582  1.00 7.18  ? 192 ALA A N   1 
ATOM   1504 C  CA  . ALA A 1 214 ? 12.570  42.423 47.413  1.00 5.91  ? 192 ALA A CA  1 
ATOM   1505 C  C   . ALA A 1 214 ? 11.409  41.530 47.838  1.00 5.88  ? 192 ALA A C   1 
ATOM   1506 O  O   . ALA A 1 214 ? 11.577  40.639 48.668  1.00 10.17 ? 192 ALA A O   1 
ATOM   1507 C  CB  . ALA A 1 214 ? 13.380  41.732 46.309  1.00 9.05  ? 192 ALA A CB  1 
ATOM   1508 N  N   . VAL A 1 215 ? 10.232  41.776 47.274  1.00 6.03  ? 193 VAL A N   1 
ATOM   1509 C  CA  . VAL A 1 215 ? 9.056   40.957 47.540  1.00 7.30  ? 193 VAL A CA  1 
ATOM   1510 C  C   . VAL A 1 215 ? 8.593   40.394 46.200  1.00 7.94  ? 193 VAL A C   1 
ATOM   1511 O  O   . VAL A 1 215 ? 8.227   41.153 45.297  1.00 9.10  ? 193 VAL A O   1 
ATOM   1512 C  CB  . VAL A 1 215 ? 7.944   41.786 48.214  1.00 8.19  ? 193 VAL A CB  1 
ATOM   1513 C  CG1 . VAL A 1 215 ? 6.651   40.992 48.304  1.00 9.16  ? 193 VAL A CG1 1 
ATOM   1514 C  CG2 . VAL A 1 215 ? 8.384   42.207 49.625  1.00 9.19  ? 193 VAL A CG2 1 
ATOM   1515 N  N   . ASP A 1 216 ? 8.637   39.067 46.059  1.00 6.86  ? 194 ASP A N   1 
ATOM   1516 C  CA  . ASP A 1 216 ? 8.411   38.414 44.765  1.00 7.32  ? 194 ASP A CA  1 
ATOM   1517 C  C   . ASP A 1 216 ? 7.043   37.736 44.701  1.00 7.90  ? 194 ASP A C   1 
ATOM   1518 O  O   . ASP A 1 216 ? 6.794   36.753 45.397  1.00 8.19  ? 194 ASP A O   1 
ATOM   1519 C  CB  . ASP A 1 216 ? 9.525   37.383 44.515  1.00 8.13  ? 194 ASP A CB  1 
ATOM   1520 C  CG  . ASP A 1 216 ? 9.576   36.901 43.079  1.00 9.80  ? 194 ASP A CG  1 
ATOM   1521 O  OD1 . ASP A 1 216 ? 8.588   37.061 42.335  1.00 9.79  ? 194 ASP A OD1 1 
ATOM   1522 O  OD2 . ASP A 1 216 ? 10.626  36.347 42.690  1.00 10.47 ? 194 ASP A OD2 1 
ATOM   1523 N  N   . GLY A 1 217 ? 6.155   38.263 43.862  1.00 9.24  ? 195 GLY A N   1 
ATOM   1524 C  CA  . GLY A 1 217 ? 4.841   37.663 43.687  1.00 9.28  ? 195 GLY A CA  1 
ATOM   1525 C  C   . GLY A 1 217 ? 4.790   36.477 42.739  1.00 10.10 ? 195 GLY A C   1 
ATOM   1526 O  O   . GLY A 1 217 ? 3.762   35.809 42.639  1.00 11.96 ? 195 GLY A O   1 
ATOM   1527 N  N   . ASN A 1 218 ? 5.892   36.221 42.042  1.00 7.50  ? 196 ASN A N   1 
ATOM   1528 C  CA  . ASN A 1 218 ? 6.010   35.106 41.093  1.00 9.65  ? 196 ASN A CA  1 
ATOM   1529 C  C   . ASN A 1 218 ? 4.785   34.892 40.204  1.00 8.85  ? 196 ASN A C   1 
ATOM   1530 O  O   . ASN A 1 218 ? 4.245   33.781 40.124  1.00 10.51 ? 196 ASN A O   1 
ATOM   1531 C  CB  . ASN A 1 218 ? 6.400   33.813 41.807  1.00 15.56 ? 196 ASN A CB  1 
ATOM   1532 C  CG  . ASN A 1 218 ? 7.853   33.818 42.244  1.00 19.38 ? 196 ASN A CG  1 
ATOM   1533 O  OD1 . ASN A 1 218 ? 8.156   33.875 43.436  1.00 17.09 ? 196 ASN A OD1 1 
ATOM   1534 N  ND2 . ASN A 1 218 ? 8.761   33.763 41.276  1.00 17.64 ? 196 ASN A ND2 1 
ATOM   1535 N  N   . ARG A 1 219 ? 4.348   35.978 39.574  1.00 8.28  ? 197 ARG A N   1 
ATOM   1536 C  CA  . ARG A 1 219 ? 3.252   35.955 38.600  1.00 5.90  ? 197 ARG A CA  1 
ATOM   1537 C  C   . ARG A 1 219 ? 1.862   35.724 39.199  1.00 7.32  ? 197 ARG A C   1 
ATOM   1538 O  O   . ARG A 1 219 ? 0.900   35.507 38.455  1.00 10.81 ? 197 ARG A O   1 
ATOM   1539 C  CB  . ARG A 1 219 ? 3.497   34.899 37.510  1.00 6.58  ? 197 ARG A CB  1 
ATOM   1540 C  CG  . ARG A 1 219 ? 4.779   35.058 36.728  1.00 7.58  ? 197 ARG A CG  1 
ATOM   1541 C  CD  . ARG A 1 219 ? 4.817   34.110 35.538  1.00 9.15  ? 197 ARG A CD  1 
ATOM   1542 N  NE  . ARG A 1 219 ? 4.932   32.699 35.907  1.00 14.52 ? 197 ARG A NE  1 
ATOM   1543 C  CZ  . ARG A 1 219 ? 4.034   31.769 35.586  1.00 19.39 ? 197 ARG A CZ  1 
ATOM   1544 N  NH1 . ARG A 1 219 ? 2.940   32.105 34.910  1.00 20.15 ? 197 ARG A NH1 1 
ATOM   1545 N  NH2 . ARG A 1 219 ? 4.226   30.504 35.939  1.00 19.21 ? 197 ARG A NH2 1 
ATOM   1546 N  N   . SER A 1 220 ? 1.740   35.772 40.520  1.00 8.36  ? 198 SER A N   1 
ATOM   1547 C  CA  . SER A 1 220 ? 0.533   35.225 41.157  1.00 9.33  ? 198 SER A CA  1 
ATOM   1548 C  C   . SER A 1 220 ? -0.512  36.232 41.652  1.00 11.16 ? 198 SER A C   1 
ATOM   1549 O  O   . SER A 1 220 ? -1.617  35.830 42.022  1.00 11.23 ? 198 SER A O   1 
ATOM   1550 C  CB  . SER A 1 220 ? 0.911   34.286 42.306  1.00 12.76 ? 198 SER A CB  1 
ATOM   1551 O  OG  . SER A 1 220 ? 1.311   35.022 43.449  1.00 13.01 ? 198 SER A OG  1 
ATOM   1552 N  N   . LEU A 1 221 ? -0.176  37.520 41.676  1.00 7.29  ? 199 LEU A N   1 
ATOM   1553 C  CA  . LEU A 1 221 ? -1.100  38.527 42.211  1.00 7.44  ? 199 LEU A CA  1 
ATOM   1554 C  C   . LEU A 1 221 ? -1.942  39.135 41.100  1.00 6.58  ? 199 LEU A C   1 
ATOM   1555 O  O   . LEU A 1 221 ? -1.396  39.591 40.099  1.00 7.51  ? 199 LEU A O   1 
ATOM   1556 C  CB  . LEU A 1 221 ? -0.340  39.678 42.879  1.00 6.92  ? 199 LEU A CB  1 
ATOM   1557 C  CG  . LEU A 1 221 ? 0.707   39.345 43.940  1.00 10.28 ? 199 LEU A CG  1 
ATOM   1558 C  CD1 . LEU A 1 221 ? 1.302   40.618 44.508  1.00 11.78 ? 199 LEU A CD1 1 
ATOM   1559 C  CD2 . LEU A 1 221 ? 0.087   38.526 45.038  1.00 10.74 ? 199 LEU A CD2 1 
ATOM   1560 N  N   . PRO A 1 222 ? -3.273  39.163 41.273  1.00 6.52  ? 200 PRO A N   1 
ATOM   1561 C  CA  . PRO A 1 222 ? -4.064  40.020 40.385  1.00 6.35  ? 200 PRO A CA  1 
ATOM   1562 C  C   . PRO A 1 222 ? -3.691  41.466 40.678  1.00 8.98  ? 200 PRO A C   1 
ATOM   1563 O  O   . PRO A 1 222 ? -3.231  41.748 41.783  1.00 7.49  ? 200 PRO A O   1 
ATOM   1564 C  CB  . PRO A 1 222 ? -5.510  39.774 40.850  1.00 8.98  ? 200 PRO A CB  1 
ATOM   1565 C  CG  . PRO A 1 222 ? -5.467  38.488 41.622  1.00 14.45 ? 200 PRO A CG  1 
ATOM   1566 C  CD  . PRO A 1 222 ? -4.105  38.473 42.272  1.00 8.49  ? 200 PRO A CD  1 
ATOM   1567 N  N   A SER A 1 223 ? -3.901  42.364 39.719  0.30 8.20  ? 201 SER A N   1 
ATOM   1568 N  N   B SER A 1 223 ? -3.884  42.364 39.716  0.70 8.16  ? 201 SER A N   1 
ATOM   1569 C  CA  A SER A 1 223 ? -3.604  43.784 39.915  0.30 7.79  ? 201 SER A CA  1 
ATOM   1570 C  CA  B SER A 1 223 ? -3.559  43.773 39.936  0.70 7.43  ? 201 SER A CA  1 
ATOM   1571 C  C   A SER A 1 223 ? -4.220  44.329 41.201  0.30 7.32  ? 201 SER A C   1 
ATOM   1572 C  C   B SER A 1 223 ? -4.223  44.340 41.200  0.70 6.89  ? 201 SER A C   1 
ATOM   1573 O  O   A SER A 1 223 ? -3.608  45.147 41.890  0.30 8.27  ? 201 SER A O   1 
ATOM   1574 O  O   B SER A 1 223 ? -3.641  45.188 41.881  0.70 8.99  ? 201 SER A O   1 
ATOM   1575 C  CB  A SER A 1 223 ? -4.091  44.602 38.721  0.30 7.91  ? 201 SER A CB  1 
ATOM   1576 C  CB  B SER A 1 223 ? -3.911  44.616 38.704  0.70 8.17  ? 201 SER A CB  1 
ATOM   1577 O  OG  A SER A 1 223 ? -3.456  44.180 37.532  0.30 7.08  ? 201 SER A OG  1 
ATOM   1578 O  OG  B SER A 1 223 ? -5.284  44.560 38.377  0.70 8.52  ? 201 SER A OG  1 
ATOM   1579 N  N   . ARG A 1 224 ? -5.428  43.867 41.511  1.00 6.69  ? 202 ARG A N   1 
ATOM   1580 C  CA  . ARG A 1 224 ? -6.134  44.241 42.745  1.00 6.41  ? 202 ARG A CA  1 
ATOM   1581 C  C   . ARG A 1 224 ? -5.240  44.126 43.978  1.00 7.06  ? 202 ARG A C   1 
ATOM   1582 O  O   . ARG A 1 224 ? -5.198  45.030 44.830  1.00 7.74  ? 202 ARG A O   1 
ATOM   1583 C  CB  . ARG A 1 224 ? -7.359  43.319 42.929  1.00 8.59  ? 202 ARG A CB  1 
ATOM   1584 C  CG  . ARG A 1 224 ? -8.087  43.471 44.274  1.00 9.52  ? 202 ARG A CG  1 
ATOM   1585 C  CD  . ARG A 1 224 ? -9.049  42.300 44.525  1.00 9.11  ? 202 ARG A CD  1 
ATOM   1586 N  NE  . ARG A 1 224 ? -8.316  41.076 44.866  1.00 8.58  ? 202 ARG A NE  1 
ATOM   1587 C  CZ  . ARG A 1 224 ? -8.780  39.834 44.725  1.00 8.19  ? 202 ARG A CZ  1 
ATOM   1588 N  NH1 . ARG A 1 224 ? -10.003 39.604 44.248  1.00 10.15 ? 202 ARG A NH1 1 
ATOM   1589 N  NH2 . ARG A 1 224 ? -8.005  38.808 45.062  1.00 8.49  ? 202 ARG A NH2 1 
ATOM   1590 N  N   . ASP A 1 225 ? -4.500  43.022 44.056  1.00 7.54  ? 203 ASP A N   1 
ATOM   1591 C  CA  . ASP A 1 225 ? -3.706  42.722 45.246  1.00 6.32  ? 203 ASP A CA  1 
ATOM   1592 C  C   . ASP A 1 225 ? -2.321  43.355 45.196  1.00 8.40  ? 203 ASP A C   1 
ATOM   1593 O  O   . ASP A 1 225 ? -1.764  43.710 46.234  1.00 8.99  ? 203 ASP A O   1 
ATOM   1594 C  CB  . ASP A 1 225 ? -3.631  41.195 45.467  1.00 7.42  ? 203 ASP A CB  1 
ATOM   1595 C  CG  . ASP A 1 225 ? -4.968  40.596 45.892  1.00 6.71  ? 203 ASP A CG  1 
ATOM   1596 O  OD1 . ASP A 1 225 ? -5.859  41.359 46.314  1.00 8.52  ? 203 ASP A OD1 1 
ATOM   1597 O  OD2 . ASP A 1 225 ? -5.118  39.352 45.816  1.00 9.86  ? 203 ASP A OD2 1 
ATOM   1598 N  N   . ALA A 1 226 ? -1.770  43.526 43.999  1.00 7.35  ? 204 ALA A N   1 
ATOM   1599 C  CA  . ALA A 1 226 ? -0.486  44.208 43.872  1.00 8.23  ? 204 ALA A CA  1 
ATOM   1600 C  C   . ALA A 1 226 ? -0.649  45.669 44.275  1.00 7.33  ? 204 ALA A C   1 
ATOM   1601 O  O   . ALA A 1 226 ? 0.208   46.229 44.974  1.00 7.18  ? 204 ALA A O   1 
ATOM   1602 C  CB  . ALA A 1 226 ? 0.047   44.091 42.444  1.00 8.44  ? 204 ALA A CB  1 
ATOM   1603 N  N   . LEU A 1 227 ? -1.738  46.284 43.810  1.00 8.72  ? 205 LEU A N   1 
ATOM   1604 C  CA  . LEU A 1 227 ? -2.087  47.652 44.195  1.00 5.89  ? 205 LEU A CA  1 
ATOM   1605 C  C   . LEU A 1 227 ? -2.195  47.776 45.711  1.00 6.85  ? 205 LEU A C   1 
ATOM   1606 O  O   . LEU A 1 227 ? -1.649  48.720 46.296  1.00 8.13  ? 205 LEU A O   1 
ATOM   1607 C  CB  . LEU A 1 227 ? -3.412  48.077 43.549  1.00 7.68  ? 205 LEU A CB  1 
ATOM   1608 C  CG  . LEU A 1 227 ? -3.412  48.354 42.047  1.00 8.85  ? 205 LEU A CG  1 
ATOM   1609 C  CD1 . LEU A 1 227 ? -4.850  48.399 41.540  1.00 8.25  ? 205 LEU A CD1 1 
ATOM   1610 C  CD2 . LEU A 1 227 ? -2.692  49.662 41.745  1.00 9.58  ? 205 LEU A CD2 1 
ATOM   1611 N  N   . ARG A 1 228 ? -2.876  46.818 46.350  1.00 6.74  ? 206 ARG A N   1 
ATOM   1612 C  CA  . ARG A 1 228 ? -3.080  46.866 47.797  1.00 7.04  ? 206 ARG A CA  1 
ATOM   1613 C  C   . ARG A 1 228 ? -1.772  46.741 48.567  1.00 7.13  ? 206 ARG A C   1 
ATOM   1614 O  O   . ARG A 1 228 ? -1.530  47.481 49.517  1.00 7.84  ? 206 ARG A O   1 
ATOM   1615 C  CB  . ARG A 1 228 ? -4.034  45.755 48.237  1.00 7.28  ? 206 ARG A CB  1 
ATOM   1616 C  CG  . ARG A 1 228 ? -4.201  45.642 49.750  1.00 7.80  ? 206 ARG A CG  1 
ATOM   1617 C  CD  . ARG A 1 228 ? -5.191  44.552 50.077  1.00 6.87  ? 206 ARG A CD  1 
ATOM   1618 N  NE  . ARG A 1 228 ? -5.275  44.303 51.514  1.00 7.51  ? 206 ARG A NE  1 
ATOM   1619 C  CZ  . ARG A 1 228 ? -6.035  43.358 52.059  1.00 9.62  ? 206 ARG A CZ  1 
ATOM   1620 N  NH1 . ARG A 1 228 ? -6.770  42.558 51.285  1.00 10.43 ? 206 ARG A NH1 1 
ATOM   1621 N  NH2 . ARG A 1 228 ? -6.055  43.204 53.377  1.00 9.73  ? 206 ARG A NH2 1 
ATOM   1622 N  N   . LEU A 1 229 ? -0.930  45.799 48.154  1.00 6.16  ? 207 LEU A N   1 
ATOM   1623 C  CA  . LEU A 1 229 ? 0.350   45.578 48.822  1.00 6.43  ? 207 LEU A CA  1 
ATOM   1624 C  C   . LEU A 1 229 ? 1.213   46.847 48.843  1.00 8.06  ? 207 LEU A C   1 
ATOM   1625 O  O   . LEU A 1 229 ? 1.743   47.236 49.892  1.00 7.83  ? 207 LEU A O   1 
ATOM   1626 C  CB  . LEU A 1 229 ? 1.095   44.414 48.157  1.00 7.48  ? 207 LEU A CB  1 
ATOM   1627 C  CG  . LEU A 1 229 ? 2.562   44.212 48.528  1.00 10.75 ? 207 LEU A CG  1 
ATOM   1628 C  CD1 . LEU A 1 229 ? 2.728   43.956 50.024  1.00 11.50 ? 207 LEU A CD1 1 
ATOM   1629 C  CD2 . LEU A 1 229 ? 3.110   43.040 47.728  1.00 10.35 ? 207 LEU A CD2 1 
ATOM   1630 N  N   . SER A 1 230 ? 1.330   47.524 47.707  1.00 6.74  ? 208 SER A N   1 
ATOM   1631 C  CA  . SER A 1 230 ? 2.109   48.758 47.658  1.00 6.80  ? 208 SER A CA  1 
ATOM   1632 C  C   . SER A 1 230 ? 1.428   49.883 48.440  1.00 7.75  ? 208 SER A C   1 
ATOM   1633 O  O   . SER A 1 230 ? 2.076   50.567 49.232  1.00 8.27  ? 208 SER A O   1 
ATOM   1634 C  CB  . SER A 1 230 ? 2.377   49.166 46.203  1.00 8.17  ? 208 SER A CB  1 
ATOM   1635 O  OG  . SER A 1 230 ? 3.105   50.375 46.131  1.00 7.38  ? 208 SER A OG  1 
ATOM   1636 N  N   . ARG A 1 231 ? 0.123   50.048 48.231  1.00 7.46  ? 209 ARG A N   1 
ATOM   1637 C  CA  . ARG A 1 231 ? -0.645  51.126 48.861  1.00 6.80  ? 209 ARG A CA  1 
ATOM   1638 C  C   . ARG A 1 231 ? -0.569  51.080 50.384  1.00 7.24  ? 209 ARG A C   1 
ATOM   1639 O  O   . ARG A 1 231 ? -0.477  52.124 51.047  1.00 9.57  ? 209 ARG A O   1 
ATOM   1640 C  CB  . ARG A 1 231 ? -2.106  51.038 48.414  1.00 7.54  ? 209 ARG A CB  1 
ATOM   1641 C  CG  . ARG A 1 231 ? -3.020  52.118 48.982  1.00 8.09  ? 209 ARG A CG  1 
ATOM   1642 C  CD  . ARG A 1 231 ? -4.436  51.945 48.450  1.00 7.12  ? 209 ARG A CD  1 
ATOM   1643 N  NE  . ARG A 1 231 ? -5.112  50.798 49.072  1.00 7.14  ? 209 ARG A NE  1 
ATOM   1644 C  CZ  . ARG A 1 231 ? -5.512  49.704 48.428  1.00 6.58  ? 209 ARG A CZ  1 
ATOM   1645 N  NH1 . ARG A 1 231 ? -5.331  49.570 47.117  1.00 7.51  ? 209 ARG A NH1 1 
ATOM   1646 N  NH2 . ARG A 1 231 ? -6.104  48.727 49.108  1.00 6.83  ? 209 ARG A NH2 1 
ATOM   1647 N  N   . GLU A 1 232 ? -0.592  49.869 50.937  1.00 6.46  ? 210 GLU A N   1 
ATOM   1648 C  CA  . GLU A 1 232 ? -0.607  49.710 52.389  1.00 6.67  ? 210 GLU A CA  1 
ATOM   1649 C  C   . GLU A 1 232 ? 0.753   49.879 53.050  1.00 9.30  ? 210 GLU A C   1 
ATOM   1650 O  O   . GLU A 1 232 ? 0.809   50.084 54.260  1.00 10.83 ? 210 GLU A O   1 
ATOM   1651 C  CB  . GLU A 1 232 ? -1.197  48.355 52.802  1.00 8.60  ? 210 GLU A CB  1 
ATOM   1652 C  CG  . GLU A 1 232 ? -2.694  48.232 52.552  1.00 7.64  ? 210 GLU A CG  1 
ATOM   1653 C  CD  . GLU A 1 232 ? -3.310  47.004 53.195  1.00 10.30 ? 210 GLU A CD  1 
ATOM   1654 O  OE1 . GLU A 1 232 ? -2.612  46.301 53.961  1.00 10.57 ? 210 GLU A OE1 1 
ATOM   1655 O  OE2 . GLU A 1 232 ? -4.511  46.739 52.933  1.00 9.92  ? 210 GLU A OE2 1 
ATOM   1656 N  N   . CYS A 1 233 ? 1.832   49.795 52.272  1.00 9.87  ? 211 CYS A N   1 
ATOM   1657 C  CA  . CYS A 1 233 ? 3.182   49.717 52.839  1.00 9.35  ? 211 CYS A CA  1 
ATOM   1658 C  C   . CYS A 1 233 ? 4.207   50.734 52.322  1.00 7.42  ? 211 CYS A C   1 
ATOM   1659 O  O   . CYS A 1 233 ? 5.333   50.356 52.003  1.00 8.41  ? 211 CYS A O   1 
ATOM   1660 C  CB  . CYS A 1 233 ? 3.752   48.317 52.597  1.00 7.78  ? 211 CYS A CB  1 
ATOM   1661 S  SG  . CYS A 1 233 ? 2.750   46.974 53.295  1.00 10.35 ? 211 CYS A SG  1 
ATOM   1662 N  N   . PRO A 1 234 ? 3.849   52.028 52.264  1.00 6.93  ? 212 PRO A N   1 
ATOM   1663 C  CA  . PRO A 1 234 ? 4.820   52.975 51.695  1.00 7.92  ? 212 PRO A CA  1 
ATOM   1664 C  C   . PRO A 1 234 ? 6.114   53.102 52.497  1.00 9.53  ? 212 PRO A C   1 
ATOM   1665 O  O   . PRO A 1 234 ? 7.153   53.469 51.928  1.00 8.72  ? 212 PRO A O   1 
ATOM   1666 C  CB  . PRO A 1 234 ? 4.064   54.316 51.747  1.00 10.76 ? 212 PRO A CB  1 
ATOM   1667 C  CG  . PRO A 1 234 ? 3.057   54.133 52.852  1.00 12.29 ? 212 PRO A CG  1 
ATOM   1668 C  CD  . PRO A 1 234 ? 2.616   52.705 52.696  1.00 9.47  ? 212 PRO A CD  1 
ATOM   1669 N  N   . GLU A 1 235 ? 6.037   52.823 53.796  1.00 8.68  ? 213 GLU A N   1 
ATOM   1670 C  CA  . GLU A 1 235 ? 7.170   52.929 54.709  1.00 10.31 ? 213 GLU A CA  1 
ATOM   1671 C  C   . GLU A 1 235 ? 8.109   51.718 54.671  1.00 10.78 ? 213 GLU A C   1 
ATOM   1672 O  O   . GLU A 1 235 ? 9.157   51.715 55.327  1.00 12.68 ? 213 GLU A O   1 
ATOM   1673 C  CB  . GLU A 1 235 ? 6.650   53.134 56.140  1.00 11.07 ? 213 GLU A CB  1 
ATOM   1674 C  CG  . GLU A 1 235 ? 6.135   51.847 56.855  1.00 16.55 ? 213 GLU A CG  1 
ATOM   1675 C  CD  . GLU A 1 235 ? 4.690   51.423 56.507  1.00 21.23 ? 213 GLU A CD  1 
ATOM   1676 O  OE1 . GLU A 1 235 ? 4.107   51.907 55.537  1.00 17.14 ? 213 GLU A OE1 1 
ATOM   1677 O  OE2 . GLU A 1 235 ? 4.131   50.582 57.233  1.00 34.16 ? 213 GLU A OE2 1 
ATOM   1678 N  N   . ILE A 1 236 ? 7.738   50.689 53.913  1.00 7.51  ? 214 ILE A N   1 
ATOM   1679 C  CA  . ILE A 1 236 ? 8.576   49.496 53.792  1.00 8.80  ? 214 ILE A CA  1 
ATOM   1680 C  C   . ILE A 1 236 ? 9.265   49.488 52.431  1.00 7.69  ? 214 ILE A C   1 
ATOM   1681 O  O   . ILE A 1 236 ? 8.598   49.460 51.393  1.00 8.80  ? 214 ILE A O   1 
ATOM   1682 C  CB  . ILE A 1 236 ? 7.760   48.191 53.969  1.00 8.72  ? 214 ILE A CB  1 
ATOM   1683 C  CG1 . ILE A 1 236 ? 6.928   48.258 55.252  1.00 12.93 ? 214 ILE A CG1 1 
ATOM   1684 C  CG2 . ILE A 1 236 ? 8.704   46.980 53.998  1.00 8.29  ? 214 ILE A CG2 1 
ATOM   1685 C  CD1 . ILE A 1 236 ? 6.218   46.942 55.599  1.00 12.91 ? 214 ILE A CD1 1 
ATOM   1686 N  N   . PRO A 1 237 ? 10.608  49.514 52.424  1.00 6.57  ? 215 PRO A N   1 
ATOM   1687 C  CA  . PRO A 1 237 ? 11.311  49.771 51.166  1.00 7.57  ? 215 PRO A CA  1 
ATOM   1688 C  C   . PRO A 1 237 ? 11.602  48.539 50.323  1.00 9.74  ? 215 PRO A C   1 
ATOM   1689 O  O   . PRO A 1 237 ? 12.756  48.285 49.958  1.00 14.15 ? 215 PRO A O   1 
ATOM   1690 C  CB  . PRO A 1 237 ? 12.612  50.429 51.627  1.00 8.90  ? 215 PRO A CB  1 
ATOM   1691 C  CG  . PRO A 1 237 ? 12.881  49.782 52.960  1.00 10.52 ? 215 PRO A CG  1 
ATOM   1692 C  CD  . PRO A 1 237 ? 11.511  49.581 53.586  1.00 9.04  ? 215 PRO A CD  1 
ATOM   1693 N  N   . PHE A 1 238 ? 10.562  47.802 49.968  1.00 6.10  ? 216 PHE A N   1 
ATOM   1694 C  CA  . PHE A 1 238 ? 10.751  46.717 49.021  1.00 6.79  ? 216 PHE A CA  1 
ATOM   1695 C  C   . PHE A 1 238 ? 10.692  47.191 47.588  1.00 6.19  ? 216 PHE A C   1 
ATOM   1696 O  O   . PHE A 1 238 ? 10.125  48.249 47.289  1.00 7.17  ? 216 PHE A O   1 
ATOM   1697 C  CB  . PHE A 1 238 ? 9.746   45.572 49.241  1.00 6.85  ? 216 PHE A CB  1 
ATOM   1698 C  CG  . PHE A 1 238 ? 8.296   45.982 49.222  1.00 5.94  ? 216 PHE A CG  1 
ATOM   1699 C  CD1 . PHE A 1 238 ? 7.612   46.131 48.034  1.00 7.06  ? 216 PHE A CD1 1 
ATOM   1700 C  CD2 . PHE A 1 238 ? 7.598   46.160 50.413  1.00 8.45  ? 216 PHE A CD2 1 
ATOM   1701 C  CE1 . PHE A 1 238 ? 6.272   46.490 48.024  1.00 7.49  ? 216 PHE A CE1 1 
ATOM   1702 C  CE2 . PHE A 1 238 ? 6.256   46.513 50.412  1.00 7.97  ? 216 PHE A CE2 1 
ATOM   1703 C  CZ  . PHE A 1 238 ? 5.589   46.680 49.216  1.00 9.23  ? 216 PHE A CZ  1 
ATOM   1704 N  N   . VAL A 1 239 ? 11.299  46.412 46.701  1.00 6.28  ? 217 VAL A N   1 
ATOM   1705 C  CA  . VAL A 1 239 ? 10.908  46.468 45.301  1.00 7.15  ? 217 VAL A CA  1 
ATOM   1706 C  C   . VAL A 1 239 ? 9.928   45.320 45.115  1.00 7.16  ? 217 VAL A C   1 
ATOM   1707 O  O   . VAL A 1 239 ? 10.044  44.282 45.781  1.00 7.03  ? 217 VAL A O   1 
ATOM   1708 C  CB  . VAL A 1 239 ? 12.106  46.387 44.318  1.00 7.66  ? 217 VAL A CB  1 
ATOM   1709 C  CG1 . VAL A 1 239 ? 12.996  47.615 44.465  1.00 9.36  ? 217 VAL A CG1 1 
ATOM   1710 C  CG2 . VAL A 1 239 ? 12.910  45.103 44.511  1.00 11.60 ? 217 VAL A CG2 1 
ATOM   1711 N  N   . LEU A 1 240 ? 8.947   45.522 44.244  1.00 6.01  ? 218 LEU A N   1 
ATOM   1712 C  CA  . LEU A 1 240 ? 7.931   44.514 43.968  1.00 7.95  ? 218 LEU A CA  1 
ATOM   1713 C  C   . LEU A 1 240 ? 8.340   43.777 42.701  1.00 7.11  ? 218 LEU A C   1 
ATOM   1714 O  O   . LEU A 1 240 ? 8.315   44.344 41.607  1.00 7.54  ? 218 LEU A O   1 
ATOM   1715 C  CB  . LEU A 1 240 ? 6.572   45.194 43.785  1.00 10.10 ? 218 LEU A CB  1 
ATOM   1716 C  CG  . LEU A 1 240 ? 5.337   44.321 43.654  1.00 12.04 ? 218 LEU A CG  1 
ATOM   1717 C  CD1 . LEU A 1 240 ? 5.363   43.246 44.735  1.00 13.37 ? 218 LEU A CD1 1 
ATOM   1718 C  CD2 . LEU A 1 240 ? 4.067   45.174 43.748  1.00 13.49 ? 218 LEU A CD2 1 
ATOM   1719 N  N   . GLU A 1 241 ? 8.741   42.519 42.859  1.00 5.28  ? 219 GLU A N   1 
ATOM   1720 C  CA  . GLU A 1 241 ? 9.268   41.734 41.749  1.00 5.27  ? 219 GLU A CA  1 
ATOM   1721 C  C   . GLU A 1 241 ? 8.166   40.872 41.141  1.00 6.35  ? 219 GLU A C   1 
ATOM   1722 O  O   . GLU A 1 241 ? 7.474   40.148 41.865  1.00 6.64  ? 219 GLU A O   1 
ATOM   1723 C  CB  . GLU A 1 241 ? 10.413  40.849 42.253  1.00 6.88  ? 219 GLU A CB  1 
ATOM   1724 C  CG  . GLU A 1 241 ? 11.015  39.950 41.185  1.00 7.78  ? 219 GLU A CG  1 
ATOM   1725 C  CD  . GLU A 1 241 ? 12.148  39.095 41.715  1.00 17.91 ? 219 GLU A CD  1 
ATOM   1726 O  OE1 . GLU A 1 241 ? 12.729  39.460 42.766  1.00 19.70 ? 219 GLU A OE1 1 
ATOM   1727 O  OE2 . GLU A 1 241 ? 12.450  38.054 41.090  1.00 12.91 ? 219 GLU A OE2 1 
ATOM   1728 N  N   . GLN A 1 242 ? 8.010   40.971 39.816  1.00 6.27  ? 220 GLN A N   1 
ATOM   1729 C  CA  . GLN A 1 242 ? 7.023   40.222 39.037  1.00 6.68  ? 220 GLN A CA  1 
ATOM   1730 C  C   . GLN A 1 242 ? 5.711   39.971 39.783  1.00 6.75  ? 220 GLN A C   1 
ATOM   1731 O  O   . GLN A 1 242 ? 5.319   38.822 40.013  1.00 7.26  ? 220 GLN A O   1 
ATOM   1732 C  CB  . GLN A 1 242 ? 7.617   38.901 38.515  1.00 5.67  ? 220 GLN A CB  1 
ATOM   1733 C  CG  . GLN A 1 242 ? 6.780   38.243 37.405  1.00 6.34  ? 220 GLN A CG  1 
ATOM   1734 C  CD  . GLN A 1 242 ? 6.956   38.904 36.053  1.00 11.11 ? 220 GLN A CD  1 
ATOM   1735 O  OE1 . GLN A 1 242 ? 8.060   39.309 35.682  1.00 7.98  ? 220 GLN A OE1 1 
ATOM   1736 N  NE2 . GLN A 1 242 ? 5.863   39.007 35.297  1.00 10.12 ? 220 GLN A NE2 1 
ATOM   1737 N  N   . PRO A 1 243 ? 5.040   41.053 40.195  1.00 6.45  ? 221 PRO A N   1 
ATOM   1738 C  CA  . PRO A 1 243 ? 3.842   40.835 41.015  1.00 7.96  ? 221 PRO A CA  1 
ATOM   1739 C  C   . PRO A 1 243 ? 2.731   40.147 40.247  1.00 8.95  ? 221 PRO A C   1 
ATOM   1740 O  O   . PRO A 1 243 ? 2.034   39.299 40.804  1.00 8.55  ? 221 PRO A O   1 
ATOM   1741 C  CB  . PRO A 1 243 ? 3.405   42.259 41.393  1.00 7.11  ? 221 PRO A CB  1 
ATOM   1742 C  CG  . PRO A 1 243 ? 4.065   43.164 40.394  1.00 6.56  ? 221 PRO A CG  1 
ATOM   1743 C  CD  . PRO A 1 243 ? 5.371   42.487 40.060  1.00 6.56  ? 221 PRO A CD  1 
ATOM   1744 N  N   . CYS A 1 244 ? 2.570   40.532 38.985  1.00 6.30  ? 222 CYS A N   1 
ATOM   1745 C  CA  . CYS A 1 244 ? 1.511   40.014 38.136  1.00 6.49  ? 222 CYS A CA  1 
ATOM   1746 C  C   . CYS A 1 244 ? 2.056   39.087 37.053  1.00 7.39  ? 222 CYS A C   1 
ATOM   1747 O  O   . CYS A 1 244 ? 3.258   39.074 36.770  1.00 8.05  ? 222 CYS A O   1 
ATOM   1748 C  CB  . CYS A 1 244 ? 0.750   41.176 37.496  1.00 5.85  ? 222 CYS A CB  1 
ATOM   1749 S  SG  . CYS A 1 244 ? 0.100   42.367 38.682  1.00 9.64  ? 222 CYS A SG  1 
ATOM   1750 N  N   . ASN A 1 245 ? 1.161   38.315 36.439  1.00 7.19  ? 223 ASN A N   1 
ATOM   1751 C  CA  . ASN A 1 245 ? 1.552   37.293 35.465  1.00 7.74  ? 223 ASN A CA  1 
ATOM   1752 C  C   . ASN A 1 245 ? 2.156   37.862 34.178  1.00 9.53  ? 223 ASN A C   1 
ATOM   1753 O  O   . ASN A 1 245 ? 3.203   37.392 33.722  1.00 13.19 ? 223 ASN A O   1 
ATOM   1754 C  CB  . ASN A 1 245 ? 0.355   36.385 35.134  1.00 8.73  ? 223 ASN A CB  1 
ATOM   1755 C  CG  . ASN A 1 245 ? 0.722   35.249 34.187  1.00 12.30 ? 223 ASN A CG  1 
ATOM   1756 O  OD1 . ASN A 1 245 ? 1.745   34.577 34.365  1.00 14.05 ? 223 ASN A OD1 1 
ATOM   1757 N  ND2 . ASN A 1 245 ? -0.113  35.028 33.172  1.00 12.46 ? 223 ASN A ND2 1 
ATOM   1758 N  N   . THR A 1 246 ? 1.496   38.861 33.594  1.00 7.89  ? 224 THR A N   1 
ATOM   1759 C  CA  . THR A 1 246 ? 1.911   39.419 32.300  1.00 8.05  ? 224 THR A CA  1 
ATOM   1760 C  C   . THR A 1 246 ? 2.538   40.807 32.413  1.00 8.40  ? 224 THR A C   1 
ATOM   1761 O  O   . THR A 1 246 ? 2.228   41.576 33.335  1.00 8.71  ? 224 THR A O   1 
ATOM   1762 C  CB  . THR A 1 246 ? 0.733   39.490 31.289  1.00 10.15 ? 224 THR A CB  1 
ATOM   1763 O  OG1 . THR A 1 246 ? -0.269  40.409 31.750  1.00 9.01  ? 224 THR A OG1 1 
ATOM   1764 C  CG2 . THR A 1 246 ? 0.107   38.107 31.067  1.00 11.74 ? 224 THR A CG2 1 
ATOM   1765 N  N   . LEU A 1 247 ? 3.416   41.131 31.463  1.00 8.05  ? 225 LEU A N   1 
ATOM   1766 C  CA  . LEU A 1 247 ? 3.983   42.467 31.380  1.00 8.05  ? 225 LEU A CA  1 
ATOM   1767 C  C   . LEU A 1 247 ? 2.875   43.488 31.134  1.00 9.04  ? 225 LEU A C   1 
ATOM   1768 O  O   . LEU A 1 247 ? 2.951   44.626 31.606  1.00 9.19  ? 225 LEU A O   1 
ATOM   1769 C  CB  . LEU A 1 247 ? 5.040   42.534 30.264  1.00 7.50  ? 225 LEU A CB  1 
ATOM   1770 C  CG  . LEU A 1 247 ? 5.762   43.867 30.064  1.00 9.19  ? 225 LEU A CG  1 
ATOM   1771 C  CD1 . LEU A 1 247 ? 6.331   44.363 31.390  1.00 11.86 ? 225 LEU A CD1 1 
ATOM   1772 C  CD2 . LEU A 1 247 ? 6.885   43.713 29.041  1.00 10.01 ? 225 LEU A CD2 1 
ATOM   1773 N  N   . GLU A 1 248 ? 1.836   43.078 30.408  1.00 9.62  ? 226 GLU A N   1 
ATOM   1774 C  CA  . GLU A 1 248 ? 0.703   43.964 30.167  1.00 8.91  ? 226 GLU A CA  1 
ATOM   1775 C  C   . GLU A 1 248 ? 0.034   44.401 31.469  1.00 9.08  ? 226 GLU A C   1 
ATOM   1776 O  O   . GLU A 1 248 ? -0.318  45.571 31.614  1.00 11.58 ? 226 GLU A O   1 
ATOM   1777 C  CB  . GLU A 1 248 ? -0.320  43.320 29.221  1.00 10.62 ? 226 GLU A CB  1 
ATOM   1778 C  CG  . GLU A 1 248 ? 0.179   43.161 27.794  1.00 11.32 ? 226 GLU A CG  1 
ATOM   1779 C  CD  . GLU A 1 248 ? 0.610   44.482 27.215  1.00 15.18 ? 226 GLU A CD  1 
ATOM   1780 O  OE1 . GLU A 1 248 ? -0.247  45.385 27.084  1.00 19.03 ? 226 GLU A OE1 1 
ATOM   1781 O  OE2 . GLU A 1 248 ? 1.810   44.630 26.905  1.00 17.85 ? 226 GLU A OE2 1 
ATOM   1782 N  N   . GLU A 1 249 ? -0.131  43.474 32.413  1.00 7.76  ? 227 GLU A N   1 
ATOM   1783 C  CA  . GLU A 1 249 ? -0.728  43.830 33.706  1.00 6.95  ? 227 GLU A CA  1 
ATOM   1784 C  C   . GLU A 1 249 ? 0.203   44.746 34.489  1.00 10.48 ? 227 GLU A C   1 
ATOM   1785 O  O   . GLU A 1 249 ? -0.239  45.705 35.133  1.00 9.56  ? 227 GLU A O   1 
ATOM   1786 C  CB  . GLU A 1 249 ? -1.009  42.582 34.550  1.00 7.40  ? 227 GLU A CB  1 
ATOM   1787 C  CG  . GLU A 1 249 ? -2.110  41.666 34.033  1.00 8.35  ? 227 GLU A CG  1 
ATOM   1788 C  CD  . GLU A 1 249 ? -2.027  40.294 34.677  1.00 11.31 ? 227 GLU A CD  1 
ATOM   1789 O  OE1 . GLU A 1 249 ? -2.385  40.165 35.871  1.00 10.68 ? 227 GLU A OE1 1 
ATOM   1790 O  OE2 . GLU A 1 249 ? -1.590  39.345 33.992  1.00 9.51  ? 227 GLU A OE2 1 
ATOM   1791 N  N   . ILE A 1 250 ? 1.495   44.440 34.453  1.00 9.98  ? 228 ILE A N   1 
ATOM   1792 C  CA  . ILE A 1 250 ? 2.474   45.257 35.165  1.00 9.61  ? 228 ILE A CA  1 
ATOM   1793 C  C   . ILE A 1 250 ? 2.507   46.682 34.603  1.00 10.42 ? 228 ILE A C   1 
ATOM   1794 O  O   . ILE A 1 250 ? 2.558   47.661 35.361  1.00 11.42 ? 228 ILE A O   1 
ATOM   1795 C  CB  . ILE A 1 250 ? 3.863   44.589 35.152  1.00 8.68  ? 228 ILE A CB  1 
ATOM   1796 C  CG1 . ILE A 1 250 ? 3.822   43.316 36.006  1.00 10.76 ? 228 ILE A CG1 1 
ATOM   1797 C  CG2 . ILE A 1 250 ? 4.924   45.536 35.701  1.00 12.20 ? 228 ILE A CG2 1 
ATOM   1798 C  CD1 . ILE A 1 250 ? 5.060   42.438 35.890  1.00 13.73 ? 228 ILE A CD1 1 
ATOM   1799 N  N   . ALA A 1 251 ? 2.426   46.812 33.280  1.00 7.82  ? 229 ALA A N   1 
ATOM   1800 C  CA  . ALA A 1 251 ? 2.438   48.138 32.670  1.00 11.68 ? 229 ALA A CA  1 
ATOM   1801 C  C   . ALA A 1 251 ? 1.200   48.932 33.067  1.00 12.80 ? 229 ALA A C   1 
ATOM   1802 O  O   . ALA A 1 251 ? 1.259   50.156 33.231  1.00 12.33 ? 229 ALA A O   1 
ATOM   1803 C  CB  . ALA A 1 251 ? 2.559   48.033 31.157  1.00 11.27 ? 229 ALA A CB  1 
ATOM   1804 N  N   . ALA A 1 252 ? 0.086   48.225 33.243  1.00 9.91  ? 230 ALA A N   1 
ATOM   1805 C  CA  . ALA A 1 252 ? -1.182  48.852 33.613  1.00 13.42 ? 230 ALA A CA  1 
ATOM   1806 C  C   . ALA A 1 252 ? -1.189  49.404 35.036  1.00 14.98 ? 230 ALA A C   1 
ATOM   1807 O  O   . ALA A 1 252 ? -1.811  50.438 35.287  1.00 17.53 ? 230 ALA A O   1 
ATOM   1808 C  CB  . ALA A 1 252 ? -2.331  47.874 33.417  1.00 15.69 ? 230 ALA A CB  1 
ATOM   1809 N  N   . ILE A 1 253 ? -0.503  48.733 35.959  1.00 12.92 ? 231 ILE A N   1 
ATOM   1810 C  CA  . ILE A 1 253 ? -0.515  49.164 37.363  1.00 12.75 ? 231 ILE A CA  1 
ATOM   1811 C  C   . ILE A 1 253 ? 0.629   50.087 37.732  1.00 10.67 ? 231 ILE A C   1 
ATOM   1812 O  O   . ILE A 1 253 ? 0.579   50.752 38.767  1.00 9.92  ? 231 ILE A O   1 
ATOM   1813 C  CB  . ILE A 1 253 ? -0.424  47.963 38.354  1.00 15.28 ? 231 ILE A CB  1 
ATOM   1814 C  CG1 . ILE A 1 253 ? 0.963   47.308 38.305  1.00 14.27 ? 231 ILE A CG1 1 
ATOM   1815 C  CG2 . ILE A 1 253 ? -1.500  46.960 38.077  1.00 26.39 ? 231 ILE A CG2 1 
ATOM   1816 C  CD1 . ILE A 1 253 ? 1.203   46.298 39.422  1.00 22.63 ? 231 ILE A CD1 1 
ATOM   1817 N  N   A ARG A 1 254 ? 1.641   50.127 36.875  0.35 9.64  ? 232 ARG A N   1 
ATOM   1818 N  N   B ARG A 1 254 ? 1.674   50.124 36.906  0.65 9.75  ? 232 ARG A N   1 
ATOM   1819 C  CA  A ARG A 1 254 ? 2.904   50.779 37.194  0.35 10.34 ? 232 ARG A CA  1 
ATOM   1820 C  CA  B ARG A 1 254 ? 2.929   50.789 37.290  0.65 8.32  ? 232 ARG A CA  1 
ATOM   1821 C  C   A ARG A 1 254 ? 2.783   52.214 37.716  0.35 9.70  ? 232 ARG A C   1 
ATOM   1822 C  C   B ARG A 1 254 ? 2.768   52.239 37.764  0.65 9.52  ? 232 ARG A C   1 
ATOM   1823 O  O   A ARG A 1 254 ? 3.446   52.586 38.683  0.35 10.88 ? 232 ARG A O   1 
ATOM   1824 O  O   B ARG A 1 254 ? 3.382   52.648 38.751  0.65 10.67 ? 232 ARG A O   1 
ATOM   1825 C  CB  A ARG A 1 254 ? 3.809   50.745 35.970  0.35 13.68 ? 232 ARG A CB  1 
ATOM   1826 C  CB  B ARG A 1 254 ? 3.945   50.717 36.147  0.65 14.11 ? 232 ARG A CB  1 
ATOM   1827 C  CG  A ARG A 1 254 ? 5.147   51.351 36.227  0.35 20.60 ? 232 ARG A CG  1 
ATOM   1828 C  CG  B ARG A 1 254 ? 5.294   51.335 36.480  0.65 22.12 ? 232 ARG A CG  1 
ATOM   1829 C  CD  A ARG A 1 254 ? 5.952   51.451 34.962  0.35 22.86 ? 232 ARG A CD  1 
ATOM   1830 C  CD  B ARG A 1 254 ? 6.179   51.435 35.244  0.65 23.00 ? 232 ARG A CD  1 
ATOM   1831 N  NE  A ARG A 1 254 ? 7.119   52.284 35.201  0.35 22.38 ? 232 ARG A NE  1 
ATOM   1832 N  NE  B ARG A 1 254 ? 5.420   51.823 34.055  0.65 24.63 ? 232 ARG A NE  1 
ATOM   1833 C  CZ  A ARG A 1 254 ? 7.086   53.611 35.223  0.35 21.05 ? 232 ARG A CZ  1 
ATOM   1834 C  CZ  B ARG A 1 254 ? 5.056   53.069 33.762  0.65 27.42 ? 232 ARG A CZ  1 
ATOM   1835 N  NH1 A ARG A 1 254 ? 8.195   54.291 35.457  0.35 15.75 ? 232 ARG A NH1 1 
ATOM   1836 N  NH1 B ARG A 1 254 ? 4.369   53.316 32.656  0.65 34.91 ? 232 ARG A NH1 1 
ATOM   1837 N  NH2 A ARG A 1 254 ? 5.948   54.255 34.997  0.35 27.63 ? 232 ARG A NH2 1 
ATOM   1838 N  NH2 B ARG A 1 254 ? 5.369   54.070 34.573  0.65 29.72 ? 232 ARG A NH2 1 
ATOM   1839 N  N   . GLY A 1 255 ? 1.931   53.013 37.085  1.00 10.33 ? 233 GLY A N   1 
ATOM   1840 C  CA  . GLY A 1 255 ? 1.774   54.408 37.467  1.00 7.88  ? 233 GLY A CA  1 
ATOM   1841 C  C   . GLY A 1 255 ? 1.055   54.618 38.790  1.00 10.71 ? 233 GLY A C   1 
ATOM   1842 O  O   . GLY A 1 255 ? 1.125   55.700 39.385  1.00 15.76 ? 233 GLY A O   1 
ATOM   1843 N  N   . ARG A 1 256 ? 0.361   53.581 39.254  1.00 6.99  ? 234 ARG A N   1 
ATOM   1844 C  CA  . ARG A 1 256 ? -0.390  53.631 40.503  1.00 9.57  ? 234 ARG A CA  1 
ATOM   1845 C  C   . ARG A 1 256 ? 0.360   52.973 41.661  1.00 11.39 ? 234 ARG A C   1 
ATOM   1846 O  O   . ARG A 1 256 ? -0.182  52.847 42.759  1.00 16.81 ? 234 ARG A O   1 
ATOM   1847 C  CB  . ARG A 1 256 ? -1.751  52.949 40.307  1.00 11.78 ? 234 ARG A CB  1 
ATOM   1848 C  CG  . ARG A 1 256 ? -2.571  53.578 39.169  1.00 13.59 ? 234 ARG A CG  1 
ATOM   1849 C  CD  . ARG A 1 256 ? -3.617  52.602 38.602  1.00 16.05 ? 234 ARG A CD  1 
ATOM   1850 N  NE  . ARG A 1 256 ? -4.793  52.564 39.459  1.00 15.26 ? 234 ARG A NE  1 
ATOM   1851 C  CZ  . ARG A 1 256 ? -5.714  51.600 39.435  1.00 17.38 ? 234 ARG A CZ  1 
ATOM   1852 N  NH1 . ARG A 1 256 ? -5.598  50.590 38.587  1.00 15.99 ? 234 ARG A NH1 1 
ATOM   1853 N  NH2 . ARG A 1 256 ? -6.750  51.655 40.265  1.00 20.14 ? 234 ARG A NH2 1 
ATOM   1854 N  N   . VAL A 1 257 ? 1.599   52.554 41.409  1.00 10.40 ? 235 VAL A N   1 
ATOM   1855 C  CA  . VAL A 1 257 ? 2.414   51.855 42.407  1.00 9.74  ? 235 VAL A CA  1 
ATOM   1856 C  C   . VAL A 1 257 ? 3.684   52.659 42.685  1.00 7.86  ? 235 VAL A C   1 
ATOM   1857 O  O   . VAL A 1 257 ? 4.477   52.916 41.781  1.00 13.22 ? 235 VAL A O   1 
ATOM   1858 C  CB  . VAL A 1 257 ? 2.767   50.433 41.912  1.00 8.42  ? 235 VAL A CB  1 
ATOM   1859 C  CG1 . VAL A 1 257 ? 3.838   49.778 42.775  1.00 8.46  ? 235 VAL A CG1 1 
ATOM   1860 C  CG2 . VAL A 1 257 ? 1.513   49.579 41.890  1.00 11.21 ? 235 VAL A CG2 1 
ATOM   1861 N  N   . GLN A 1 258 ? 3.868   53.070 43.941  1.00 10.99 ? 236 GLN A N   1 
ATOM   1862 C  CA  . GLN A 1 258 ? 4.989   53.949 44.294  1.00 11.54 ? 236 GLN A CA  1 
ATOM   1863 C  C   . GLN A 1 258 ? 6.258   53.221 44.730  1.00 7.67  ? 236 GLN A C   1 
ATOM   1864 O  O   . GLN A 1 258 ? 7.295   53.854 44.965  1.00 9.90  ? 236 GLN A O   1 
ATOM   1865 C  CB  . GLN A 1 258 ? 4.555   54.966 45.352  1.00 14.26 ? 236 GLN A CB  1 
ATOM   1866 C  CG  . GLN A 1 258 ? 3.584   56.002 44.797  1.00 21.34 ? 236 GLN A CG  1 
ATOM   1867 C  CD  . GLN A 1 258 ? 3.287   57.115 45.778  1.00 33.02 ? 236 GLN A CD  1 
ATOM   1868 O  OE1 . GLN A 1 258 ? 3.175   56.886 46.981  1.00 34.04 ? 236 GLN A OE1 1 
ATOM   1869 N  NE2 . GLN A 1 258 ? 3.171   58.338 45.265  1.00 35.97 ? 236 GLN A NE2 1 
ATOM   1870 N  N   . HIS A 1 259 ? 6.186   51.891 44.800  1.00 7.73  ? 237 HIS A N   1 
ATOM   1871 C  CA  . HIS A 1 259 ? 7.389   51.083 44.974  1.00 7.58  ? 237 HIS A CA  1 
ATOM   1872 C  C   . HIS A 1 259 ? 7.984   50.738 43.620  1.00 5.74  ? 237 HIS A C   1 
ATOM   1873 O  O   . HIS A 1 259 ? 7.241   50.515 42.658  1.00 8.53  ? 237 HIS A O   1 
ATOM   1874 C  CB  . HIS A 1 259 ? 7.067   49.770 45.694  1.00 5.56  ? 237 HIS A CB  1 
ATOM   1875 C  CG  . HIS A 1 259 ? 6.706   49.940 47.136  1.00 5.72  ? 237 HIS A CG  1 
ATOM   1876 N  ND1 . HIS A 1 259 ? 5.422   50.211 47.551  1.00 6.11  ? 237 HIS A ND1 1 
ATOM   1877 C  CD2 . HIS A 1 259 ? 7.457   49.861 48.259  1.00 5.92  ? 237 HIS A CD2 1 
ATOM   1878 C  CE1 . HIS A 1 259 ? 5.397   50.295 48.869  1.00 6.86  ? 237 HIS A CE1 1 
ATOM   1879 N  NE2 . HIS A 1 259 ? 6.621   50.105 49.325  1.00 7.46  ? 237 HIS A NE2 1 
ATOM   1880 N  N   . GLY A 1 260 ? 9.315   50.679 43.558  1.00 6.59  ? 238 GLY A N   1 
ATOM   1881 C  CA  . GLY A 1 260 ? 9.993   50.161 42.382  1.00 6.66  ? 238 GLY A CA  1 
ATOM   1882 C  C   . GLY A 1 260 ? 9.448   48.791 42.012  1.00 7.71  ? 238 GLY A C   1 
ATOM   1883 O  O   . GLY A 1 260 ? 9.157   47.959 42.885  1.00 7.99  ? 238 GLY A O   1 
ATOM   1884 N  N   . ILE A 1 261 ? 9.296   48.557 40.717  1.00 6.44  ? 239 ILE A N   1 
ATOM   1885 C  CA  . ILE A 1 261 ? 8.830   47.264 40.219  1.00 5.23  ? 239 ILE A CA  1 
ATOM   1886 C  C   . ILE A 1 261 ? 9.947   46.600 39.409  1.00 7.17  ? 239 ILE A C   1 
ATOM   1887 O  O   . ILE A 1 261 ? 10.529  47.232 38.540  1.00 7.92  ? 239 ILE A O   1 
ATOM   1888 C  CB  . ILE A 1 261 ? 7.582   47.434 39.333  1.00 5.77  ? 239 ILE A CB  1 
ATOM   1889 C  CG1 . ILE A 1 261 ? 6.396   47.885 40.185  1.00 9.80  ? 239 ILE A CG1 1 
ATOM   1890 C  CG2 . ILE A 1 261 ? 7.210   46.109 38.657  1.00 8.42  ? 239 ILE A CG2 1 
ATOM   1891 C  CD1 . ILE A 1 261 ? 5.195   48.353 39.365  1.00 14.84 ? 239 ILE A CD1 1 
ATOM   1892 N  N   . TYR A 1 262 ? 10.254  45.334 39.695  1.00 6.34  ? 240 TYR A N   1 
ATOM   1893 C  CA  . TYR A 1 262 ? 11.257  44.604 38.904  1.00 4.97  ? 240 TYR A CA  1 
ATOM   1894 C  C   . TYR A 1 262 ? 10.575  43.532 38.071  1.00 5.85  ? 240 TYR A C   1 
ATOM   1895 O  O   . TYR A 1 262 ? 9.592   42.942 38.510  1.00 8.51  ? 240 TYR A O   1 
ATOM   1896 C  CB  . TYR A 1 262 ? 12.286  43.894 39.789  1.00 6.12  ? 240 TYR A CB  1 
ATOM   1897 C  CG  . TYR A 1 262 ? 13.370  44.759 40.400  1.00 6.84  ? 240 TYR A CG  1 
ATOM   1898 C  CD1 . TYR A 1 262 ? 13.243  46.142 40.485  1.00 7.40  ? 240 TYR A CD1 1 
ATOM   1899 C  CD2 . TYR A 1 262 ? 14.528  44.184 40.887  1.00 5.12  ? 240 TYR A CD2 1 
ATOM   1900 C  CE1 . TYR A 1 262 ? 14.243  46.918 41.056  1.00 8.17  ? 240 TYR A CE1 1 
ATOM   1901 C  CE2 . TYR A 1 262 ? 15.534  44.948 41.460  1.00 7.62  ? 240 TYR A CE2 1 
ATOM   1902 C  CZ  . TYR A 1 262 ? 15.390  46.316 41.532  1.00 7.79  ? 240 TYR A CZ  1 
ATOM   1903 O  OH  . TYR A 1 262 ? 16.379  47.085 42.114  1.00 7.52  ? 240 TYR A OH  1 
ATOM   1904 N  N   . LEU A 1 263 ? 11.089  43.284 36.865  1.00 5.43  ? 241 LEU A N   1 
ATOM   1905 C  CA  . LEU A 1 263 ? 10.632  42.143 36.070  1.00 5.98  ? 241 LEU A CA  1 
ATOM   1906 C  C   . LEU A 1 263 ? 11.526  40.932 36.305  1.00 7.75  ? 241 LEU A C   1 
ATOM   1907 O  O   . LEU A 1 263 ? 12.727  41.080 36.512  1.00 9.41  ? 241 LEU A O   1 
ATOM   1908 C  CB  . LEU A 1 263 ? 10.634  42.486 34.579  1.00 5.78  ? 241 LEU A CB  1 
ATOM   1909 C  CG  . LEU A 1 263 ? 9.788   43.677 34.148  1.00 8.50  ? 241 LEU A CG  1 
ATOM   1910 C  CD1 . LEU A 1 263 ? 9.874   43.854 32.637  1.00 10.47 ? 241 LEU A CD1 1 
ATOM   1911 C  CD2 . LEU A 1 263 ? 8.322   43.550 34.585  1.00 8.90  ? 241 LEU A CD2 1 
ATOM   1912 N  N   . ASP A 1 264 ? 10.931  39.739 36.280  1.00 5.36  ? 242 ASP A N   1 
ATOM   1913 C  CA  . ASP A 1 264 ? 11.687  38.487 36.335  1.00 5.37  ? 242 ASP A CA  1 
ATOM   1914 C  C   . ASP A 1 264 ? 11.184  37.619 35.191  1.00 6.99  ? 242 ASP A C   1 
ATOM   1915 O  O   . ASP A 1 264 ? 11.698  37.734 34.076  1.00 5.73  ? 242 ASP A O   1 
ATOM   1916 C  CB  . ASP A 1 264 ? 11.530  37.812 37.708  1.00 7.44  ? 242 ASP A CB  1 
ATOM   1917 C  CG  . ASP A 1 264 ? 12.370  36.539 37.860  1.00 10.78 ? 242 ASP A CG  1 
ATOM   1918 O  OD1 . ASP A 1 264 ? 12.948  36.054 36.869  1.00 12.11 ? 242 ASP A OD1 1 
ATOM   1919 O  OD2 . ASP A 1 264 ? 12.433  35.991 38.989  1.00 10.93 ? 242 ASP A OD2 1 
ATOM   1920 N  N   . GLU A 1 265 ? 10.163  36.797 35.440  1.00 7.03  ? 243 GLU A N   1 
ATOM   1921 C  CA  . GLU A 1 265 ? 9.627   35.908 34.402  1.00 7.71  ? 243 GLU A CA  1 
ATOM   1922 C  C   . GLU A 1 265 ? 9.283   36.590 33.076  1.00 7.67  ? 243 GLU A C   1 
ATOM   1923 O  O   . GLU A 1 265 ? 9.377   35.962 32.023  1.00 9.44  ? 243 GLU A O   1 
ATOM   1924 C  CB  . GLU A 1 265 ? 8.402   35.133 34.922  1.00 5.96  ? 243 GLU A CB  1 
ATOM   1925 C  CG  . GLU A 1 265 ? 8.721   34.097 36.003  1.00 8.13  ? 243 GLU A CG  1 
ATOM   1926 C  CD  . GLU A 1 265 ? 8.627   34.640 37.423  1.00 10.29 ? 243 GLU A CD  1 
ATOM   1927 O  OE1 . GLU A 1 265 ? 8.931   35.826 37.645  1.00 7.81  ? 243 GLU A OE1 1 
ATOM   1928 O  OE2 . GLU A 1 265 ? 8.233   33.871 38.335  1.00 14.44 ? 243 GLU A OE2 1 
ATOM   1929 N  N   . SER A 1 266 ? 8.874   37.860 33.116  1.00 5.32  ? 244 SER A N   1 
ATOM   1930 C  CA  . SER A 1 266 ? 8.507   38.572 31.895  1.00 7.69  ? 244 SER A CA  1 
ATOM   1931 C  C   . SER A 1 266 ? 9.709   38.854 30.991  1.00 9.34  ? 244 SER A C   1 
ATOM   1932 O  O   . SER A 1 266 ? 9.541   39.057 29.786  1.00 10.54 ? 244 SER A O   1 
ATOM   1933 C  CB  . SER A 1 266 ? 7.772   39.882 32.218  1.00 9.87  ? 244 SER A CB  1 
ATOM   1934 O  OG  . SER A 1 266 ? 6.413   39.636 32.530  1.00 9.84  ? 244 SER A OG  1 
ATOM   1935 N  N   . GLY A 1 267 ? 10.909  38.856 31.569  1.00 8.49  ? 245 GLY A N   1 
ATOM   1936 C  CA  . GLY A 1 267 ? 12.110  39.196 30.812  1.00 9.33  ? 245 GLY A CA  1 
ATOM   1937 C  C   . GLY A 1 267 ? 12.628  38.020 30.009  1.00 9.54  ? 245 GLY A C   1 
ATOM   1938 O  O   . GLY A 1 267 ? 13.693  37.473 30.313  1.00 9.55  ? 245 GLY A O   1 
ATOM   1939 N  N   . GLU A 1 268 ? 11.881  37.652 28.967  1.00 9.04  ? 246 GLU A N   1 
ATOM   1940 C  CA  . GLU A 1 268 ? 12.116  36.406 28.238  1.00 9.70  ? 246 GLU A CA  1 
ATOM   1941 C  C   . GLU A 1 268 ? 13.206  36.498 27.188  1.00 11.40 ? 246 GLU A C   1 
ATOM   1942 O  O   . GLU A 1 268 ? 13.744  35.479 26.769  1.00 11.00 ? 246 GLU A O   1 
ATOM   1943 C  CB  . GLU A 1 268 ? 10.837  35.952 27.542  1.00 13.72 ? 246 GLU A CB  1 
ATOM   1944 C  CG  . GLU A 1 268 ? 9.731   35.512 28.466  1.00 20.10 ? 246 GLU A CG  1 
ATOM   1945 C  CD  . GLU A 1 268 ? 8.530   35.018 27.689  1.00 32.22 ? 246 GLU A CD  1 
ATOM   1946 O  OE1 . GLU A 1 268 ? 7.601   35.819 27.470  1.00 37.55 ? 246 GLU A OE1 1 
ATOM   1947 O  OE2 . GLU A 1 268 ? 8.528   33.837 27.284  1.00 38.37 ? 246 GLU A OE2 1 
ATOM   1948 N  N   . ASP A 1 269 ? 13.508  37.711 26.734  1.00 9.02  ? 247 ASP A N   1 
ATOM   1949 C  CA  . ASP A 1 269 ? 14.521  37.875 25.696  1.00 8.39  ? 247 ASP A CA  1 
ATOM   1950 C  C   . ASP A 1 269 ? 15.023  39.305 25.676  1.00 9.48  ? 247 ASP A C   1 
ATOM   1951 O  O   . ASP A 1 269 ? 14.478  40.173 26.372  1.00 6.90  ? 247 ASP A O   1 
ATOM   1952 C  CB  . ASP A 1 269 ? 14.000  37.441 24.312  1.00 10.50 ? 247 ASP A CB  1 
ATOM   1953 C  CG  . ASP A 1 269 ? 12.668  38.070 23.948  1.00 13.76 ? 247 ASP A CG  1 
ATOM   1954 O  OD1 . ASP A 1 269 ? 12.397  39.220 24.343  1.00 12.30 ? 247 ASP A OD1 1 
ATOM   1955 O  OD2 . ASP A 1 269 ? 11.877  37.415 23.236  1.00 22.79 ? 247 ASP A OD2 1 
ATOM   1956 N  N   . LEU A 1 270 ? 16.073  39.552 24.900  1.00 7.47  ? 248 LEU A N   1 
ATOM   1957 C  CA  . LEU A 1 270 ? 16.629  40.900 24.841  1.00 8.27  ? 248 LEU A CA  1 
ATOM   1958 C  C   . LEU A 1 270 ? 15.611  41.910 24.313  1.00 8.44  ? 248 LEU A C   1 
ATOM   1959 O  O   . LEU A 1 270 ? 15.557  43.049 24.783  1.00 6.23  ? 248 LEU A O   1 
ATOM   1960 C  CB  . LEU A 1 270 ? 17.911  40.911 24.000  1.00 7.99  ? 248 LEU A CB  1 
ATOM   1961 C  CG  . LEU A 1 270 ? 18.891  42.031 24.350  1.00 8.91  ? 248 LEU A CG  1 
ATOM   1962 C  CD1 . LEU A 1 270 ? 19.501  41.815 25.744  1.00 12.29 ? 248 LEU A CD1 1 
ATOM   1963 C  CD2 . LEU A 1 270 ? 19.979  42.108 23.295  1.00 8.48  ? 248 LEU A CD2 1 
ATOM   1964 N  N   . SER A 1 271 ? 14.778  41.501 23.359  1.00 7.26  ? 249 SER A N   1 
ATOM   1965 C  CA  . SER A 1 271 ? 13.759  42.395 22.812  1.00 7.10  ? 249 SER A CA  1 
ATOM   1966 C  C   . SER A 1 271 ? 12.813  42.918 23.896  1.00 6.74  ? 249 SER A C   1 
ATOM   1967 O  O   . SER A 1 271 ? 12.440  44.099 23.901  1.00 7.26  ? 249 SER A O   1 
ATOM   1968 C  CB  . SER A 1 271 ? 12.964  41.688 21.706  1.00 8.62  ? 249 SER A CB  1 
ATOM   1969 O  OG  . SER A 1 271 ? 11.961  42.544 21.179  1.00 9.15  ? 249 SER A OG  1 
ATOM   1970 N  N   . THR A 1 272 ? 12.407  42.044 24.810  1.00 6.99  ? 250 THR A N   1 
ATOM   1971 C  CA  . THR A 1 272 ? 11.516  42.469 25.898  1.00 6.43  ? 250 THR A CA  1 
ATOM   1972 C  C   . THR A 1 272 ? 12.218  43.423 26.865  1.00 6.69  ? 250 THR A C   1 
ATOM   1973 O  O   . THR A 1 272 ? 11.619  44.391 27.353  1.00 7.56  ? 250 THR A O   1 
ATOM   1974 C  CB  . THR A 1 272 ? 10.950  41.261 26.656  1.00 8.78  ? 250 THR A CB  1 
ATOM   1975 O  OG1 . THR A 1 272 ? 10.256  40.435 25.717  1.00 12.41 ? 250 THR A OG1 1 
ATOM   1976 C  CG2 . THR A 1 272 ? 9.960   41.710 27.717  1.00 11.67 ? 250 THR A CG2 1 
ATOM   1977 N  N   . VAL A 1 273 ? 13.495  43.161 27.123  1.00 6.96  ? 251 VAL A N   1 
ATOM   1978 C  CA  . VAL A 1 273 ? 14.296  44.047 27.955  1.00 7.24  ? 251 VAL A CA  1 
ATOM   1979 C  C   . VAL A 1 273 ? 14.384  45.439 27.327  1.00 6.84  ? 251 VAL A C   1 
ATOM   1980 O  O   . VAL A 1 273 ? 14.276  46.454 28.023  1.00 6.60  ? 251 VAL A O   1 
ATOM   1981 C  CB  . VAL A 1 273 ? 15.705  43.465 28.177  1.00 7.12  ? 251 VAL A CB  1 
ATOM   1982 C  CG1 . VAL A 1 273 ? 16.628  44.481 28.871  1.00 7.74  ? 251 VAL A CG1 1 
ATOM   1983 C  CG2 . VAL A 1 273 ? 15.609  42.189 29.015  1.00 9.35  ? 251 VAL A CG2 1 
ATOM   1984 N  N   . ILE A 1 274 ? 14.575  45.483 26.011  1.00 6.05  ? 252 ILE A N   1 
ATOM   1985 C  CA  . ILE A 1 274 ? 14.634  46.749 25.283  1.00 6.36  ? 252 ILE A CA  1 
ATOM   1986 C  C   . ILE A 1 274 ? 13.317  47.527 25.397  1.00 5.60  ? 252 ILE A C   1 
ATOM   1987 O  O   . ILE A 1 274 ? 13.320  48.749 25.574  1.00 5.78  ? 252 ILE A O   1 
ATOM   1988 C  CB  . ILE A 1 274 ? 15.041  46.502 23.806  1.00 5.73  ? 252 ILE A CB  1 
ATOM   1989 C  CG1 . ILE A 1 274 ? 16.480  45.985 23.762  1.00 5.70  ? 252 ILE A CG1 1 
ATOM   1990 C  CG2 . ILE A 1 274 ? 14.884  47.763 22.949  1.00 8.09  ? 252 ILE A CG2 1 
ATOM   1991 C  CD1 . ILE A 1 274 ? 16.817  45.229 22.490  1.00 6.06  ? 252 ILE A CD1 1 
ATOM   1992 N  N   . ARG A 1 275 ? 12.189  46.822 25.304  1.00 6.44  ? 253 ARG A N   1 
ATOM   1993 C  CA  . ARG A 1 275 ? 10.885  47.442 25.509  1.00 6.29  ? 253 ARG A CA  1 
ATOM   1994 C  C   . ARG A 1 275 ? 10.764  47.993 26.917  1.00 7.20  ? 253 ARG A C   1 
ATOM   1995 O  O   . ARG A 1 275 ? 10.381  49.148 27.109  1.00 8.00  ? 253 ARG A O   1 
ATOM   1996 C  CB  . ARG A 1 275 ? 9.762   46.427 25.295  1.00 6.50  ? 253 ARG A CB  1 
ATOM   1997 C  CG  . ARG A 1 275 ? 8.376   47.061 25.442  1.00 8.43  ? 253 ARG A CG  1 
ATOM   1998 C  CD  . ARG A 1 275 ? 7.262   46.023 25.491  1.00 9.76  ? 253 ARG A CD  1 
ATOM   1999 N  NE  . ARG A 1 275 ? 5.982   46.661 25.792  1.00 13.42 ? 253 ARG A NE  1 
ATOM   2000 C  CZ  . ARG A 1 275 ? 4.869   45.996 26.083  1.00 17.27 ? 253 ARG A CZ  1 
ATOM   2001 N  NH1 . ARG A 1 275 ? 4.878   44.671 26.100  1.00 19.23 ? 253 ARG A NH1 1 
ATOM   2002 N  NH2 . ARG A 1 275 ? 3.755   46.662 26.357  1.00 18.68 ? 253 ARG A NH2 1 
ATOM   2003 N  N   . ALA A 1 276 ? 11.104  47.166 27.901  1.00 6.15  ? 254 ALA A N   1 
ATOM   2004 C  CA  . ALA A 1 276 ? 10.951  47.559 29.292  1.00 7.02  ? 254 ALA A CA  1 
ATOM   2005 C  C   . ALA A 1 276 ? 11.838  48.753 29.640  1.00 7.24  ? 254 ALA A C   1 
ATOM   2006 O  O   . ALA A 1 276 ? 11.391  49.690 30.301  1.00 8.90  ? 254 ALA A O   1 
ATOM   2007 C  CB  . ALA A 1 276 ? 11.237  46.375 30.218  1.00 5.38  ? 254 ALA A CB  1 
ATOM   2008 N  N   . ALA A 1 277 ? 13.087  48.743 29.181  1.00 6.49  ? 255 ALA A N   1 
ATOM   2009 C  CA  . ALA A 1 277 ? 13.983  49.851 29.516  1.00 6.88  ? 255 ALA A CA  1 
ATOM   2010 C  C   . ALA A 1 277 ? 13.645  51.104 28.713  1.00 7.65  ? 255 ALA A C   1 
ATOM   2011 O  O   . ALA A 1 277 ? 13.590  52.216 29.261  1.00 8.71  ? 255 ALA A O   1 
ATOM   2012 C  CB  . ALA A 1 277 ? 15.432  49.442 29.307  1.00 8.31  ? 255 ALA A CB  1 
ATOM   2013 N  N   . GLY A 1 278 ? 13.398  50.925 27.417  1.00 7.89  ? 256 GLY A N   1 
ATOM   2014 C  CA  . GLY A 1 278 ? 13.101  52.043 26.531  1.00 7.40  ? 256 GLY A CA  1 
ATOM   2015 C  C   . GLY A 1 278 ? 11.791  52.753 26.822  1.00 7.44  ? 256 GLY A C   1 
ATOM   2016 O  O   . GLY A 1 278 ? 11.673  53.959 26.594  1.00 10.85 ? 256 GLY A O   1 
ATOM   2017 N  N   . GLN A 1 279 ? 10.808  52.015 27.333  1.00 8.24  ? 257 GLN A N   1 
ATOM   2018 C  CA  . GLN A 1 279 ? 9.508   52.609 27.646  1.00 10.47 ? 257 GLN A CA  1 
ATOM   2019 C  C   . GLN A 1 279 ? 9.314   52.887 29.135  1.00 11.13 ? 257 GLN A C   1 
ATOM   2020 O  O   . GLN A 1 279 ? 8.249   53.364 29.544  1.00 11.56 ? 257 GLN A O   1 
ATOM   2021 C  CB  . GLN A 1 279 ? 8.374   51.725 27.113  1.00 9.61  ? 257 GLN A CB  1 
ATOM   2022 C  CG  . GLN A 1 279 ? 8.407   51.551 25.601  1.00 10.12 ? 257 GLN A CG  1 
ATOM   2023 C  CD  . GLN A 1 279 ? 7.239   50.743 25.087  1.00 12.86 ? 257 GLN A CD  1 
ATOM   2024 O  OE1 . GLN A 1 279 ? 6.394   50.288 25.860  1.00 16.56 ? 257 GLN A OE1 1 
ATOM   2025 N  NE2 . GLN A 1 279 ? 7.180   50.559 23.779  1.00 12.86 ? 257 GLN A NE2 1 
ATOM   2026 N  N   . GLY A 1 280 ? 10.328  52.582 29.944  1.00 8.42  ? 258 GLY A N   1 
ATOM   2027 C  CA  . GLY A 1 280 ? 10.273  52.858 31.375  1.00 8.06  ? 258 GLY A CA  1 
ATOM   2028 C  C   . GLY A 1 280 ? 9.254   52.019 32.124  1.00 8.96  ? 258 GLY A C   1 
ATOM   2029 O  O   . GLY A 1 280 ? 8.577   52.512 33.029  1.00 12.92 ? 258 GLY A O   1 
ATOM   2030 N  N   . LEU A 1 281 ? 9.148   50.743 31.765  1.00 7.05  ? 259 LEU A N   1 
ATOM   2031 C  CA  . LEU A 1 281 ? 8.128   49.872 32.348  1.00 7.66  ? 259 LEU A CA  1 
ATOM   2032 C  C   . LEU A 1 281 ? 8.564   49.200 33.649  1.00 10.10 ? 259 LEU A C   1 
ATOM   2033 O  O   . LEU A 1 281 ? 7.738   48.575 34.323  1.00 9.74  ? 259 LEU A O   1 
ATOM   2034 C  CB  . LEU A 1 281 ? 7.705   48.786 31.350  1.00 8.84  ? 259 LEU A CB  1 
ATOM   2035 C  CG  . LEU A 1 281 ? 7.228   49.209 29.962  1.00 8.49  ? 259 LEU A CG  1 
ATOM   2036 C  CD1 . LEU A 1 281 ? 6.822   47.975 29.160  1.00 9.41  ? 259 LEU A CD1 1 
ATOM   2037 C  CD2 . LEU A 1 281 ? 6.081   50.202 30.085  1.00 11.52 ? 259 LEU A CD2 1 
ATOM   2038 N  N   . CYS A 1 282 ? 9.844   49.301 34.007  1.00 6.35  ? 260 CYS A N   1 
ATOM   2039 C  CA  . CYS A 1 282 ? 10.297  48.722 35.269  1.00 6.09  ? 260 CYS A CA  1 
ATOM   2040 C  C   . CYS A 1 282 ? 11.508  49.462 35.809  1.00 8.60  ? 260 CYS A C   1 
ATOM   2041 O  O   . CYS A 1 282 ? 12.095  50.303 35.117  1.00 10.13 ? 260 CYS A O   1 
ATOM   2042 C  CB  . CYS A 1 282 ? 10.601  47.224 35.120  1.00 7.18  ? 260 CYS A CB  1 
ATOM   2043 S  SG  . CYS A 1 282 ? 12.004  46.877 34.033  1.00 8.73  ? 260 CYS A SG  1 
ATOM   2044 N  N   . ASP A 1 283 ? 11.873  49.145 37.049  1.00 5.37  ? 261 ASP A N   1 
ATOM   2045 C  CA  . ASP A 1 283 ? 12.967  49.818 37.734  1.00 6.76  ? 261 ASP A CA  1 
ATOM   2046 C  C   . ASP A 1 283 ? 14.160  48.902 37.984  1.00 6.95  ? 261 ASP A C   1 
ATOM   2047 O  O   . ASP A 1 283 ? 15.107  49.280 38.663  1.00 8.76  ? 261 ASP A O   1 
ATOM   2048 C  CB  . ASP A 1 283 ? 12.449  50.402 39.051  1.00 6.93  ? 261 ASP A CB  1 
ATOM   2049 C  CG  . ASP A 1 283 ? 11.267  51.302 38.829  1.00 6.09  ? 261 ASP A CG  1 
ATOM   2050 O  OD1 . ASP A 1 283 ? 11.482  52.385 38.246  1.00 10.26 ? 261 ASP A OD1 1 
ATOM   2051 O  OD2 . ASP A 1 283 ? 10.127  50.926 39.176  1.00 7.63  ? 261 ASP A OD2 1 
ATOM   2052 N  N   . GLY A 1 284 ? 14.100  47.693 37.432  1.00 5.94  ? 262 GLY A N   1 
ATOM   2053 C  CA  . GLY A 1 284 ? 15.151  46.710 37.623  1.00 8.45  ? 262 GLY A CA  1 
ATOM   2054 C  C   . GLY A 1 284 ? 14.701  45.324 37.213  1.00 6.21  ? 262 GLY A C   1 
ATOM   2055 O  O   . GLY A 1 284 ? 13.554  45.145 36.774  1.00 5.51  ? 262 GLY A O   1 
ATOM   2056 N  N   . PHE A 1 285 ? 15.595  44.343 37.365  1.00 5.88  ? 263 PHE A N   1 
ATOM   2057 C  CA  . PHE A 1 285 ? 15.315  42.981 36.913  1.00 5.69  ? 263 PHE A CA  1 
ATOM   2058 C  C   . PHE A 1 285 ? 15.862  41.921 37.851  1.00 6.99  ? 263 PHE A C   1 
ATOM   2059 O  O   . PHE A 1 285 ? 16.951  42.063 38.407  1.00 8.26  ? 263 PHE A O   1 
ATOM   2060 C  CB  . PHE A 1 285 ? 15.976  42.708 35.550  1.00 6.60  ? 263 PHE A CB  1 
ATOM   2061 C  CG  . PHE A 1 285 ? 15.475  43.564 34.426  1.00 4.92  ? 263 PHE A CG  1 
ATOM   2062 C  CD1 . PHE A 1 285 ? 16.043  44.811 34.184  1.00 6.47  ? 263 PHE A CD1 1 
ATOM   2063 C  CD2 . PHE A 1 285 ? 14.453  43.119 33.596  1.00 6.90  ? 263 PHE A CD2 1 
ATOM   2064 C  CE1 . PHE A 1 285 ? 15.598  45.597 33.140  1.00 9.21  ? 263 PHE A CE1 1 
ATOM   2065 C  CE2 . PHE A 1 285 ? 13.994  43.908 32.548  1.00 7.57  ? 263 PHE A CE2 1 
ATOM   2066 C  CZ  . PHE A 1 285 ? 14.574  45.152 32.321  1.00 6.24  ? 263 PHE A CZ  1 
ATOM   2067 N  N   . GLY A 1 286 ? 15.120  40.831 37.992  1.00 7.07  ? 264 GLY A N   1 
ATOM   2068 C  CA  . GLY A 1 286 ? 15.725  39.576 38.396  1.00 5.96  ? 264 GLY A CA  1 
ATOM   2069 C  C   . GLY A 1 286 ? 15.945  38.851 37.085  1.00 12.76 ? 264 GLY A C   1 
ATOM   2070 O  O   . GLY A 1 286 ? 14.976  38.550 36.397  1.00 13.21 ? 264 GLY A O   1 
ATOM   2071 N  N   . MET A 1 287 ? 17.193  38.607 36.692  1.00 6.76  ? 265 MET A N   1 
ATOM   2072 C  CA  . MET A 1 287 ? 17.392  37.991 35.386  1.00 9.45  ? 265 MET A CA  1 
ATOM   2073 C  C   . MET A 1 287 ? 18.067  36.643 35.483  1.00 8.26  ? 265 MET A C   1 
ATOM   2074 O  O   . MET A 1 287 ? 19.099  36.499 36.150  1.00 8.72  ? 265 MET A O   1 
ATOM   2075 C  CB  . MET A 1 287 ? 18.187  38.905 34.456  1.00 9.86  ? 265 MET A CB  1 
ATOM   2076 C  CG  . MET A 1 287 ? 18.388  38.328 33.042  1.00 7.74  ? 265 MET A CG  1 
ATOM   2077 S  SD  . MET A 1 287 ? 16.890  37.916 32.109  1.00 8.83  ? 265 MET A SD  1 
ATOM   2078 C  CE  . MET A 1 287 ? 16.252  39.540 31.702  1.00 8.65  ? 265 MET A CE  1 
ATOM   2079 N  N   . LYS A 1 288 ? 17.480  35.664 34.795  1.00 7.18  ? 266 LYS A N   1 
ATOM   2080 C  CA  . LYS A 1 288 ? 18.013  34.306 34.757  1.00 7.27  ? 266 LYS A CA  1 
ATOM   2081 C  C   . LYS A 1 288 ? 18.775  34.031 33.464  1.00 6.82  ? 266 LYS A C   1 
ATOM   2082 O  O   . LYS A 1 288 ? 18.267  34.251 32.363  1.00 7.98  ? 266 LYS A O   1 
ATOM   2083 C  CB  . LYS A 1 288 ? 16.892  33.283 34.977  1.00 7.53  ? 266 LYS A CB  1 
ATOM   2084 C  CG  . LYS A 1 288 ? 16.336  33.335 36.396  1.00 10.16 ? 266 LYS A CG  1 
ATOM   2085 C  CD  . LYS A 1 288 ? 15.178  32.377 36.593  1.00 12.60 ? 266 LYS A CD  1 
ATOM   2086 C  CE  . LYS A 1 288 ? 14.701  32.405 38.041  1.00 14.84 ? 266 LYS A CE  1 
ATOM   2087 N  NZ  . LYS A 1 288 ? 14.200  33.759 38.442  1.00 14.77 ? 266 LYS A NZ  1 
ATOM   2088 N  N   . LEU A 1 289 ? 20.001  33.540 33.622  1.00 7.07  ? 267 LEU A N   1 
ATOM   2089 C  CA  . LEU A 1 289 ? 20.899  33.305 32.493  1.00 8.10  ? 267 LEU A CA  1 
ATOM   2090 C  C   . LEU A 1 289 ? 20.303  32.359 31.435  1.00 7.66  ? 267 LEU A C   1 
ATOM   2091 O  O   . LEU A 1 289 ? 20.386  32.617 30.223  1.00 8.70  ? 267 LEU A O   1 
ATOM   2092 C  CB  . LEU A 1 289 ? 22.233  32.770 33.035  1.00 8.48  ? 267 LEU A CB  1 
ATOM   2093 C  CG  . LEU A 1 289 ? 23.406  32.518 32.104  1.00 16.59 ? 267 LEU A CG  1 
ATOM   2094 C  CD1 . LEU A 1 289 ? 23.674  33.747 31.281  1.00 22.13 ? 267 LEU A CD1 1 
ATOM   2095 C  CD2 . LEU A 1 289 ? 24.624  32.211 32.964  1.00 13.06 ? 267 LEU A CD2 1 
ATOM   2096 N  N   . THR A 1 290 ? 19.676  31.271 31.873  1.00 7.50  ? 268 THR A N   1 
ATOM   2097 C  CA  . THR A 1 290 ? 19.110  30.338 30.907  1.00 8.00  ? 268 THR A CA  1 
ATOM   2098 C  C   . THR A 1 290 ? 17.926  30.932 30.153  1.00 8.92  ? 268 THR A C   1 
ATOM   2099 O  O   . THR A 1 290 ? 17.758  30.668 28.965  1.00 10.49 ? 268 THR A O   1 
ATOM   2100 C  CB  . THR A 1 290 ? 18.740  28.973 31.523  1.00 8.56  ? 268 THR A CB  1 
ATOM   2101 O  OG1 . THR A 1 290 ? 17.859  29.159 32.641  1.00 8.33  ? 268 THR A OG1 1 
ATOM   2102 C  CG2 . THR A 1 290 ? 19.990  28.222 31.952  1.00 10.28 ? 268 THR A CG2 1 
ATOM   2103 N  N   . ARG A 1 291 ? 17.116  31.742 30.832  1.00 6.29  ? 269 ARG A N   1 
ATOM   2104 C  CA  . ARG A 1 291 ? 15.977  32.387 30.183  1.00 5.70  ? 269 ARG A CA  1 
ATOM   2105 C  C   . ARG A 1 291 ? 16.378  33.337 29.051  1.00 9.42  ? 269 ARG A C   1 
ATOM   2106 O  O   . ARG A 1 291 ? 15.752  33.339 27.981  1.00 7.33  ? 269 ARG A O   1 
ATOM   2107 C  CB  . ARG A 1 291 ? 15.119  33.142 31.209  1.00 7.94  ? 269 ARG A CB  1 
ATOM   2108 C  CG  . ARG A 1 291 ? 13.929  33.858 30.571  1.00 7.47  ? 269 ARG A CG  1 
ATOM   2109 C  CD  . ARG A 1 291 ? 13.002  34.482 31.626  1.00 8.47  ? 269 ARG A CD  1 
ATOM   2110 N  NE  . ARG A 1 291 ? 13.692  35.501 32.415  1.00 7.77  ? 269 ARG A NE  1 
ATOM   2111 C  CZ  . ARG A 1 291 ? 13.755  35.517 33.745  1.00 7.45  ? 269 ARG A CZ  1 
ATOM   2112 N  NH1 . ARG A 1 291 ? 14.424  36.490 34.350  1.00 10.02 ? 269 ARG A NH1 1 
ATOM   2113 N  NH2 . ARG A 1 291 ? 13.146  34.582 34.465  1.00 8.81  ? 269 ARG A NH2 1 
ATOM   2114 N  N   A ILE A 1 292 ? 17.408  34.144 29.270  0.41 7.63  ? 270 ILE A N   1 
ATOM   2115 N  N   B ILE A 1 292 ? 17.416  34.139 29.288  0.59 7.29  ? 270 ILE A N   1 
ATOM   2116 C  CA  A ILE A 1 292 ? 17.787  35.117 28.254  0.41 7.17  ? 270 ILE A CA  1 
ATOM   2117 C  CA  B ILE A 1 292 ? 17.849  35.138 28.311  0.59 7.46  ? 270 ILE A CA  1 
ATOM   2118 C  C   A ILE A 1 292 ? 18.591  34.475 27.122  0.41 7.17  ? 270 ILE A C   1 
ATOM   2119 C  C   B ILE A 1 292 ? 18.606  34.488 27.146  0.59 7.28  ? 270 ILE A C   1 
ATOM   2120 O  O   A ILE A 1 292 ? 18.754  35.058 26.046  0.41 7.62  ? 270 ILE A O   1 
ATOM   2121 O  O   B ILE A 1 292 ? 18.750  35.082 26.071  0.59 7.64  ? 270 ILE A O   1 
ATOM   2122 C  CB  A ILE A 1 292 ? 18.531  36.315 28.863  0.41 7.29  ? 270 ILE A CB  1 
ATOM   2123 C  CB  B ILE A 1 292 ? 18.694  36.264 28.975  0.59 6.46  ? 270 ILE A CB  1 
ATOM   2124 C  CG1 A ILE A 1 292 ? 18.372  37.541 27.963  0.41 8.41  ? 270 ILE A CG1 1 
ATOM   2125 C  CG1 B ILE A 1 292 ? 18.649  37.547 28.135  0.59 8.56  ? 270 ILE A CG1 1 
ATOM   2126 C  CG2 A ILE A 1 292 ? 20.003  35.992 29.096  0.41 6.38  ? 270 ILE A CG2 1 
ATOM   2127 C  CG2 B ILE A 1 292 ? 20.133  35.821 29.202  0.59 7.20  ? 270 ILE A CG2 1 
ATOM   2128 C  CD1 A ILE A 1 292 ? 18.785  38.810 28.630  0.41 9.52  ? 270 ILE A CD1 1 
ATOM   2129 C  CD1 B ILE A 1 292 ? 17.286  38.216 28.139  0.59 5.41  ? 270 ILE A CD1 1 
ATOM   2130 N  N   . GLY A 1 293 ? 19.076  33.262 27.365  1.00 6.64  ? 271 GLY A N   1 
ATOM   2131 C  CA  . GLY A 1 293 ? 19.716  32.482 26.316  1.00 6.40  ? 271 GLY A CA  1 
ATOM   2132 C  C   . GLY A 1 293 ? 21.215  32.265 26.398  1.00 8.27  ? 271 GLY A C   1 
ATOM   2133 O  O   . GLY A 1 293 ? 21.817  31.790 25.427  1.00 12.11 ? 271 GLY A O   1 
ATOM   2134 N  N   . GLY A 1 294 ? 21.824  32.603 27.531  1.00 8.11  ? 272 GLY A N   1 
ATOM   2135 C  CA  . GLY A 1 294 ? 23.251  32.373 27.703  1.00 8.01  ? 272 GLY A CA  1 
ATOM   2136 C  C   . GLY A 1 294 ? 24.032  33.642 27.964  1.00 7.65  ? 272 GLY A C   1 
ATOM   2137 O  O   . GLY A 1 294 ? 23.457  34.733 28.091  1.00 8.81  ? 272 GLY A O   1 
ATOM   2138 N  N   . LEU A 1 295 ? 25.350  33.499 28.052  1.00 5.89  ? 273 LEU A N   1 
ATOM   2139 C  CA  . LEU A 1 295 ? 26.223  34.593 28.461  1.00 5.85  ? 273 LEU A CA  1 
ATOM   2140 C  C   . LEU A 1 295 ? 26.357  35.681 27.392  1.00 6.95  ? 273 LEU A C   1 
ATOM   2141 O  O   . LEU A 1 295 ? 26.485  36.855 27.722  1.00 8.90  ? 273 LEU A O   1 
ATOM   2142 C  CB  . LEU A 1 295 ? 27.599  34.033 28.830  1.00 6.29  ? 273 LEU A CB  1 
ATOM   2143 C  CG  . LEU A 1 295 ? 27.610  33.134 30.063  1.00 6.99  ? 273 LEU A CG  1 
ATOM   2144 C  CD1 . LEU A 1 295 ? 28.883  32.293 30.111  1.00 8.46  ? 273 LEU A CD1 1 
ATOM   2145 C  CD2 . LEU A 1 295 ? 27.517  34.005 31.310  1.00 7.88  ? 273 LEU A CD2 1 
ATOM   2146 N  N   . GLN A 1 296 ? 26.339  35.304 26.114  1.00 7.06  ? 274 GLN A N   1 
ATOM   2147 C  CA  . GLN A 1 296 ? 26.423  36.298 25.043  1.00 6.50  ? 274 GLN A CA  1 
ATOM   2148 C  C   . GLN A 1 296 ? 25.282  37.309 25.177  1.00 8.80  ? 274 GLN A C   1 
ATOM   2149 O  O   . GLN A 1 296 ? 25.505  38.528 25.117  1.00 8.91  ? 274 GLN A O   1 
ATOM   2150 C  CB  . GLN A 1 296 ? 26.395  35.602 23.679  1.00 9.20  ? 274 GLN A CB  1 
ATOM   2151 C  CG  . GLN A 1 296 ? 26.905  36.457 22.512  1.00 9.22  ? 274 GLN A CG  1 
ATOM   2152 C  CD  . GLN A 1 296 ? 25.859  37.421 21.980  1.00 12.03 ? 274 GLN A CD  1 
ATOM   2153 O  OE1 . GLN A 1 296 ? 24.662  37.110 21.957  1.00 9.94  ? 274 GLN A OE1 1 
ATOM   2154 N  NE2 . GLN A 1 296 ? 26.305  38.598 21.542  1.00 11.62 ? 274 GLN A NE2 1 
ATOM   2155 N  N   . GLN A 1 297 ? 24.069  36.804 25.384  1.00 7.68  ? 275 GLN A N   1 
ATOM   2156 C  CA  . GLN A 1 297 ? 22.899  37.667 25.535  1.00 5.79  ? 275 GLN A CA  1 
ATOM   2157 C  C   . GLN A 1 297 ? 22.863  38.355 26.890  1.00 7.47  ? 275 GLN A C   1 
ATOM   2158 O  O   . GLN A 1 297 ? 22.438  39.512 27.002  1.00 8.27  ? 275 GLN A O   1 
ATOM   2159 C  CB  . GLN A 1 297 ? 21.619  36.865 25.303  1.00 7.57  ? 275 GLN A CB  1 
ATOM   2160 C  CG  . GLN A 1 297 ? 21.440  36.456 23.842  1.00 7.51  ? 275 GLN A CG  1 
ATOM   2161 C  CD  . GLN A 1 297 ? 20.991  37.617 22.972  1.00 8.19  ? 275 GLN A CD  1 
ATOM   2162 O  OE1 . GLN A 1 297 ? 19.815  38.006 22.988  1.00 9.05  ? 275 GLN A OE1 1 
ATOM   2163 N  NE2 . GLN A 1 297 ? 21.919  38.169 22.185  1.00 8.66  ? 275 GLN A NE2 1 
ATOM   2164 N  N   . MET A 1 298 ? 23.322  37.653 27.920  1.00 7.60  ? 276 MET A N   1 
ATOM   2165 C  CA  . MET A 1 298 ? 23.334  38.219 29.257  1.00 6.68  ? 276 MET A CA  1 
ATOM   2166 C  C   . MET A 1 298 ? 24.254  39.432 29.338  1.00 7.94  ? 276 MET A C   1 
ATOM   2167 O  O   . MET A 1 298 ? 23.951  40.392 30.047  1.00 8.03  ? 276 MET A O   1 
ATOM   2168 C  CB  . MET A 1 298 ? 23.762  37.162 30.273  1.00 7.09  ? 276 MET A CB  1 
ATOM   2169 C  CG  . MET A 1 298 ? 23.504  37.555 31.715  1.00 11.81 ? 276 MET A CG  1 
ATOM   2170 S  SD  . MET A 1 298 ? 21.754  37.454 32.147  1.00 11.34 ? 276 MET A SD  1 
ATOM   2171 C  CE  . MET A 1 298 ? 21.840  37.979 33.858  1.00 16.63 ? 276 MET A CE  1 
ATOM   2172 N  N   . ALA A 1 299 ? 25.376  39.403 28.617  1.00 7.66  ? 277 ALA A N   1 
ATOM   2173 C  CA  . ALA A 1 299 ? 26.296  40.545 28.614  1.00 8.14  ? 277 ALA A CA  1 
ATOM   2174 C  C   . ALA A 1 299 ? 25.655  41.783 27.994  1.00 7.96  ? 277 ALA A C   1 
ATOM   2175 O  O   . ALA A 1 299 ? 25.811  42.901 28.497  1.00 8.42  ? 277 ALA A O   1 
ATOM   2176 C  CB  . ALA A 1 299 ? 27.600  40.189 27.896  1.00 9.25  ? 277 ALA A CB  1 
ATOM   2177 N  N   . ALA A 1 300 ? 24.913  41.584 26.908  1.00 7.14  ? 278 ALA A N   1 
ATOM   2178 C  CA  . ALA A 1 300 ? 24.185  42.689 26.291  1.00 5.60  ? 278 ALA A CA  1 
ATOM   2179 C  C   . ALA A 1 300 ? 23.103  43.232 27.221  1.00 6.46  ? 278 ALA A C   1 
ATOM   2180 O  O   . ALA A 1 300 ? 22.882  44.446 27.300  1.00 6.55  ? 278 ALA A O   1 
ATOM   2181 C  CB  . ALA A 1 300 ? 23.580  42.241 24.960  1.00 6.54  ? 278 ALA A CB  1 
ATOM   2182 N  N   . PHE A 1 301 ? 22.420  42.325 27.913  1.00 7.37  ? 279 PHE A N   1 
ATOM   2183 C  CA  . PHE A 1 301 ? 21.436  42.710 28.920  1.00 6.54  ? 279 PHE A CA  1 
ATOM   2184 C  C   . PHE A 1 301 ? 22.069  43.582 29.999  1.00 6.30  ? 279 PHE A C   1 
ATOM   2185 O  O   . PHE A 1 301 ? 21.523  44.637 30.363  1.00 6.95  ? 279 PHE A O   1 
ATOM   2186 C  CB  . PHE A 1 301 ? 20.810  41.456 29.542  1.00 5.34  ? 279 PHE A CB  1 
ATOM   2187 C  CG  . PHE A 1 301 ? 20.129  41.707 30.853  1.00 7.12  ? 279 PHE A CG  1 
ATOM   2188 C  CD1 . PHE A 1 301 ? 18.858  42.280 30.902  1.00 8.79  ? 279 PHE A CD1 1 
ATOM   2189 C  CD2 . PHE A 1 301 ? 20.768  41.376 32.040  1.00 10.48 ? 279 PHE A CD2 1 
ATOM   2190 C  CE1 . PHE A 1 301 ? 18.239  42.524 32.127  1.00 10.10 ? 279 PHE A CE1 1 
ATOM   2191 C  CE2 . PHE A 1 301 ? 20.162  41.619 33.262  1.00 11.28 ? 279 PHE A CE2 1 
ATOM   2192 C  CZ  . PHE A 1 301 ? 18.899  42.192 33.304  1.00 8.68  ? 279 PHE A CZ  1 
ATOM   2193 N  N   . ARG A 1 302 ? 23.234  43.152 30.480  1.00 6.23  ? 280 ARG A N   1 
ATOM   2194 C  CA  . ARG A 1 302 ? 23.979  43.888 31.497  1.00 6.64  ? 280 ARG A CA  1 
ATOM   2195 C  C   . ARG A 1 302 ? 24.292  45.307 31.014  1.00 5.48  ? 280 ARG A C   1 
ATOM   2196 O  O   . ARG A 1 302 ? 24.114  46.285 31.761  1.00 8.00  ? 280 ARG A O   1 
ATOM   2197 C  CB  . ARG A 1 302 ? 25.280  43.153 31.821  1.00 6.62  ? 280 ARG A CB  1 
ATOM   2198 C  CG  . ARG A 1 302 ? 26.249  43.958 32.698  1.00 8.56  ? 280 ARG A CG  1 
ATOM   2199 C  CD  . ARG A 1 302 ? 27.689  43.510 32.457  1.00 7.29  ? 280 ARG A CD  1 
ATOM   2200 N  NE  . ARG A 1 302 ? 28.104  43.738 31.069  1.00 6.16  ? 280 ARG A NE  1 
ATOM   2201 C  CZ  . ARG A 1 302 ? 29.020  43.009 30.439  1.00 9.16  ? 280 ARG A CZ  1 
ATOM   2202 N  NH1 . ARG A 1 302 ? 29.618  42.004 31.065  1.00 8.18  ? 280 ARG A NH1 1 
ATOM   2203 N  NH2 . ARG A 1 302 ? 29.351  43.284 29.187  1.00 8.45  ? 280 ARG A NH2 1 
ATOM   2204 N  N   . ASP A 1 303 ? 24.727  45.419 29.761  1.00 6.09  ? 281 ASP A N   1 
ATOM   2205 C  CA  . ASP A 1 303 ? 25.073  46.721 29.197  1.00 5.70  ? 281 ASP A CA  1 
ATOM   2206 C  C   . ASP A 1 303 ? 23.865  47.654 29.053  1.00 7.07  ? 281 ASP A C   1 
ATOM   2207 O  O   . ASP A 1 303 ? 23.994  48.865 29.271  1.00 7.79  ? 281 ASP A O   1 
ATOM   2208 C  CB  . ASP A 1 303 ? 25.794  46.548 27.859  1.00 6.87  ? 281 ASP A CB  1 
ATOM   2209 C  CG  . ASP A 1 303 ? 27.131  45.848 28.012  1.00 11.76 ? 281 ASP A CG  1 
ATOM   2210 O  OD1 . ASP A 1 303 ? 27.711  45.927 29.110  1.00 14.49 ? 281 ASP A OD1 1 
ATOM   2211 O  OD2 . ASP A 1 303 ? 27.597  45.229 27.039  1.00 12.91 ? 281 ASP A OD2 1 
ATOM   2212 N  N   . ILE A 1 304 ? 22.701  47.094 28.717  1.00 6.60  ? 282 ILE A N   1 
ATOM   2213 C  CA  . ILE A 1 304 ? 21.459  47.865 28.639  1.00 6.13  ? 282 ILE A CA  1 
ATOM   2214 C  C   . ILE A 1 304 ? 21.098  48.399 30.019  1.00 8.44  ? 282 ILE A C   1 
ATOM   2215 O  O   . ILE A 1 304 ? 20.821  49.591 30.186  1.00 9.53  ? 282 ILE A O   1 
ATOM   2216 C  CB  . ILE A 1 304 ? 20.301  47.001 28.067  1.00 6.34  ? 282 ILE A CB  1 
ATOM   2217 C  CG1 . ILE A 1 304 ? 20.540  46.735 26.580  1.00 7.16  ? 282 ILE A CG1 1 
ATOM   2218 C  CG2 . ILE A 1 304 ? 18.951  47.670 28.291  1.00 7.80  ? 282 ILE A CG2 1 
ATOM   2219 C  CD1 . ILE A 1 304 ? 19.656  45.647 26.013  1.00 10.83 ? 282 ILE A CD1 1 
ATOM   2220 N  N   . CYS A 1 305 ? 21.130  47.526 31.025  1.00 6.10  ? 283 CYS A N   1 
ATOM   2221 C  CA  . CYS A 1 305 ? 20.814  47.961 32.385  1.00 6.75  ? 283 CYS A CA  1 
ATOM   2222 C  C   . CYS A 1 305 ? 21.791  49.011 32.899  1.00 6.75  ? 283 CYS A C   1 
ATOM   2223 O  O   . CYS A 1 305 ? 21.383  49.941 33.587  1.00 8.81  ? 283 CYS A O   1 
ATOM   2224 C  CB  . CYS A 1 305 ? 20.789  46.771 33.344  1.00 6.57  ? 283 CYS A CB  1 
ATOM   2225 S  SG  . CYS A 1 305 ? 19.400  45.662 33.090  1.00 7.11  ? 283 CYS A SG  1 
ATOM   2226 N  N   . GLU A 1 306 ? 23.074  48.867 32.579  1.00 8.00  ? 284 GLU A N   1 
ATOM   2227 C  CA  . GLU A 1 306 ? 24.052  49.832 33.079  1.00 6.31  ? 284 GLU A CA  1 
ATOM   2228 C  C   . GLU A 1 306 ? 23.837  51.220 32.469  1.00 8.55  ? 284 GLU A C   1 
ATOM   2229 O  O   . GLU A 1 306 ? 23.983  52.243 33.146  1.00 8.49  ? 284 GLU A O   1 
ATOM   2230 C  CB  . GLU A 1 306 ? 25.487  49.335 32.862  1.00 6.92  ? 284 GLU A CB  1 
ATOM   2231 C  CG  . GLU A 1 306 ? 26.530  50.225 33.560  1.00 7.44  ? 284 GLU A CG  1 
ATOM   2232 C  CD  . GLU A 1 306 ? 27.911  49.596 33.660  1.00 12.61 ? 284 GLU A CD  1 
ATOM   2233 O  OE1 . GLU A 1 306 ? 28.096  48.434 33.227  1.00 9.53  ? 284 GLU A OE1 1 
ATOM   2234 O  OE2 . GLU A 1 306 ? 28.820  50.277 34.182  1.00 16.46 ? 284 GLU A OE2 1 
ATOM   2235 N  N   . ALA A 1 307 ? 23.462  51.256 31.195  1.00 6.94  ? 285 ALA A N   1 
ATOM   2236 C  CA  . ALA A 1 307 ? 23.159  52.535 30.548  1.00 6.44  ? 285 ALA A CA  1 
ATOM   2237 C  C   . ALA A 1 307 ? 21.980  53.275 31.186  1.00 7.84  ? 285 ALA A C   1 
ATOM   2238 O  O   . ALA A 1 307 ? 21.897  54.498 31.097  1.00 8.63  ? 285 ALA A O   1 
ATOM   2239 C  CB  . ALA A 1 307 ? 22.917  52.327 29.037  1.00 7.46  ? 285 ALA A CB  1 
ATOM   2240 N  N   . ARG A 1 308 ? 21.064  52.544 31.816  1.00 8.32  ? 286 ARG A N   1 
ATOM   2241 C  CA  . ARG A 1 308 ? 19.882  53.166 32.392  1.00 8.06  ? 286 ARG A CA  1 
ATOM   2242 C  C   . ARG A 1 308 ? 19.820  53.080 33.905  1.00 8.31  ? 286 ARG A C   1 
ATOM   2243 O  O   . ARG A 1 308 ? 18.771  53.341 34.489  1.00 9.28  ? 286 ARG A O   1 
ATOM   2244 C  CB  . ARG A 1 308 ? 18.614  52.565 31.786  1.00 10.74 ? 286 ARG A CB  1 
ATOM   2245 C  CG  . ARG A 1 308 ? 18.350  53.030 30.376  1.00 10.53 ? 286 ARG A CG  1 
ATOM   2246 C  CD  . ARG A 1 308 ? 18.133  54.535 30.333  1.00 10.82 ? 286 ARG A CD  1 
ATOM   2247 N  NE  . ARG A 1 308 ? 17.910  54.963 28.958  1.00 11.15 ? 286 ARG A NE  1 
ATOM   2248 C  CZ  . ARG A 1 308 ? 16.717  54.972 28.370  1.00 9.01  ? 286 ARG A CZ  1 
ATOM   2249 N  NH1 . ARG A 1 308 ? 16.617  55.372 27.110  1.00 8.92  ? 286 ARG A NH1 1 
ATOM   2250 N  NH2 . ARG A 1 308 ? 15.626  54.611 29.052  1.00 10.78 ? 286 ARG A NH2 1 
ATOM   2251 N  N   . ALA A 1 309 ? 20.948  52.740 34.533  1.00 7.69  ? 287 ALA A N   1 
ATOM   2252 C  CA  . ALA A 1 309 ? 21.005  52.556 35.988  1.00 8.28  ? 287 ALA A CA  1 
ATOM   2253 C  C   . ALA A 1 309 ? 19.859  51.699 36.518  1.00 7.59  ? 287 ALA A C   1 
ATOM   2254 O  O   . ALA A 1 309 ? 19.174  52.068 37.479  1.00 9.28  ? 287 ALA A O   1 
ATOM   2255 C  CB  . ALA A 1 309 ? 21.043  53.910 36.717  1.00 9.58  ? 287 ALA A CB  1 
ATOM   2256 N  N   . LEU A 1 310 ? 19.637  50.560 35.868  1.00 7.01  ? 288 LEU A N   1 
ATOM   2257 C  CA  . LEU A 1 310 ? 18.644  49.600 36.318  1.00 6.16  ? 288 LEU A CA  1 
ATOM   2258 C  C   . LEU A 1 310 ? 19.328  48.443 37.055  1.00 8.06  ? 288 LEU A C   1 
ATOM   2259 O  O   . LEU A 1 310 ? 19.973  47.592 36.430  1.00 8.45  ? 288 LEU A O   1 
ATOM   2260 C  CB  . LEU A 1 310 ? 17.859  49.066 35.117  1.00 6.01  ? 288 LEU A CB  1 
ATOM   2261 C  CG  . LEU A 1 310 ? 17.015  50.111 34.380  1.00 5.98  ? 288 LEU A CG  1 
ATOM   2262 C  CD1 . LEU A 1 310 ? 16.527  49.563 33.042  1.00 7.88  ? 288 LEU A CD1 1 
ATOM   2263 C  CD2 . LEU A 1 310 ? 15.822  50.548 35.226  1.00 12.58 ? 288 LEU A CD2 1 
ATOM   2264 N  N   . PRO A 1 311 ? 19.194  48.402 38.389  1.00 5.34  ? 289 PRO A N   1 
ATOM   2265 C  CA  . PRO A 1 311 ? 19.834  47.313 39.136  1.00 5.37  ? 289 PRO A CA  1 
ATOM   2266 C  C   . PRO A 1 311 ? 19.267  45.948 38.756  1.00 6.43  ? 289 PRO A C   1 
ATOM   2267 O  O   . PRO A 1 311 ? 18.084  45.818 38.386  1.00 7.02  ? 289 PRO A O   1 
ATOM   2268 C  CB  . PRO A 1 311 ? 19.500  47.642 40.602  1.00 5.46  ? 289 PRO A CB  1 
ATOM   2269 C  CG  . PRO A 1 311 ? 19.150  49.117 40.594  1.00 8.34  ? 289 PRO A CG  1 
ATOM   2270 C  CD  . PRO A 1 311 ? 18.456  49.318 39.275  1.00 5.54  ? 289 PRO A CD  1 
ATOM   2271 N  N   . HIS A 1 312 ? 20.104  44.919 38.837  1.00 8.30  ? 290 HIS A N   1 
ATOM   2272 C  CA  . HIS A 1 312 ? 19.647  43.590 38.470  1.00 7.01  ? 290 HIS A CA  1 
ATOM   2273 C  C   . HIS A 1 312 ? 20.476  42.521 39.138  1.00 5.32  ? 290 HIS A C   1 
ATOM   2274 O  O   . HIS A 1 312 ? 21.616  42.756 39.551  1.00 7.27  ? 290 HIS A O   1 
ATOM   2275 C  CB  . HIS A 1 312 ? 19.662  43.382 36.944  1.00 8.57  ? 290 HIS A CB  1 
ATOM   2276 C  CG  . HIS A 1 312 ? 21.033  43.396 36.349  1.00 6.91  ? 290 HIS A CG  1 
ATOM   2277 N  ND1 . HIS A 1 312 ? 21.813  42.260 36.239  1.00 7.11  ? 290 HIS A ND1 1 
ATOM   2278 C  CD2 . HIS A 1 312 ? 21.771  44.409 35.842  1.00 7.62  ? 290 HIS A CD2 1 
ATOM   2279 C  CE1 . HIS A 1 312 ? 22.970  42.579 35.688  1.00 9.46  ? 290 HIS A CE1 1 
ATOM   2280 N  NE2 . HIS A 1 312 ? 22.973  43.878 35.439  1.00 8.51  ? 290 HIS A NE2 1 
ATOM   2281 N  N   . SER A 1 313 ? 19.888  41.339 39.240  1.00 8.24  ? 291 SER A N   1 
ATOM   2282 C  CA  . SER A 1 313 ? 20.617  40.169 39.692  1.00 7.03  ? 291 SER A CA  1 
ATOM   2283 C  C   . SER A 1 313 ? 21.046  39.334 38.488  1.00 9.75  ? 291 SER A C   1 
ATOM   2284 O  O   . SER A 1 313 ? 20.590  39.565 37.361  1.00 8.76  ? 291 SER A O   1 
ATOM   2285 C  CB  . SER A 1 313 ? 19.739  39.344 40.622  1.00 8.01  ? 291 SER A CB  1 
ATOM   2286 O  OG  . SER A 1 313 ? 18.544  38.962 39.962  1.00 10.58 ? 291 SER A OG  1 
ATOM   2287 N  N   . CYS A 1 314 ? 21.944  38.378 38.728  1.00 7.57  ? 292 CYS A N   1 
ATOM   2288 C  CA  . CYS A 1 314 ? 22.364  37.409 37.711  1.00 7.34  ? 292 CYS A CA  1 
ATOM   2289 C  C   . CYS A 1 314 ? 22.157  36.022 38.296  1.00 7.94  ? 292 CYS A C   1 
ATOM   2290 O  O   . CYS A 1 314 ? 23.018  35.518 39.034  1.00 9.76  ? 292 CYS A O   1 
ATOM   2291 C  CB  . CYS A 1 314 ? 23.847  37.593 37.370  1.00 8.51  ? 292 CYS A CB  1 
ATOM   2292 S  SG  . CYS A 1 314 ? 24.270  39.134 36.507  1.00 11.75 ? 292 CYS A SG  1 
ATOM   2293 N  N   . ASP A 1 315 ? 21.026  35.404 37.968  1.00 7.79  ? 293 ASP A N   1 
ATOM   2294 C  CA  . ASP A 1 315 ? 20.571  34.216 38.675  1.00 9.37  ? 293 ASP A CA  1 
ATOM   2295 C  C   . ASP A 1 315 ? 20.350  33.091 37.704  1.00 11.30 ? 293 ASP A C   1 
ATOM   2296 O  O   . ASP A 1 315 ? 20.515  33.251 36.495  1.00 9.79  ? 293 ASP A O   1 
ATOM   2297 C  CB  . ASP A 1 315 ? 19.220  34.487 39.366  1.00 11.64 ? 293 ASP A CB  1 
ATOM   2298 C  CG  . ASP A 1 315 ? 19.251  35.688 40.292  1.00 10.03 ? 293 ASP A CG  1 
ATOM   2299 O  OD1 . ASP A 1 315 ? 20.319  35.970 40.872  1.00 9.28  ? 293 ASP A OD1 1 
ATOM   2300 O  OD2 . ASP A 1 315 ? 18.189  36.346 40.435  1.00 11.25 ? 293 ASP A OD2 1 
ATOM   2301 N  N   . ASP A 1 316 ? 19.962  31.942 38.234  1.00 9.63  ? 294 ASP A N   1 
ATOM   2302 C  CA  . ASP A 1 316 ? 19.231  31.012 37.395  1.00 12.16 ? 294 ASP A CA  1 
ATOM   2303 C  C   . ASP A 1 316 ? 18.105  30.367 38.172  1.00 15.42 ? 294 ASP A C   1 
ATOM   2304 O  O   . ASP A 1 316 ? 17.911  30.660 39.356  1.00 15.17 ? 294 ASP A O   1 
ATOM   2305 C  CB  . ASP A 1 316 ? 20.131  29.972 36.737  1.00 10.50 ? 294 ASP A CB  1 
ATOM   2306 C  CG  . ASP A 1 316 ? 19.751  29.757 35.302  1.00 11.39 ? 294 ASP A CG  1 
ATOM   2307 O  OD1 . ASP A 1 316 ? 18.848  28.929 35.038  1.00 13.63 ? 294 ASP A OD1 1 
ATOM   2308 O  OD2 . ASP A 1 316 ? 20.306  30.477 34.454  1.00 12.10 ? 294 ASP A OD2 1 
ATOM   2309 N  N   . ALA A 1 317 ? 17.357  29.495 37.506  1.00 11.66 ? 295 ALA A N   1 
ATOM   2310 C  CA  . ALA A 1 317 ? 16.217  28.853 38.155  1.00 14.94 ? 295 ALA A CA  1 
ATOM   2311 C  C   . ALA A 1 317 ? 16.660  27.897 39.261  1.00 13.49 ? 295 ALA A C   1 
ATOM   2312 O  O   . ALA A 1 317 ? 16.048  27.845 40.327  1.00 13.38 ? 295 ALA A O   1 
ATOM   2313 C  CB  . ALA A 1 317 ? 15.354  28.125 37.127  1.00 12.97 ? 295 ALA A CB  1 
ATOM   2314 N  N   . TRP A 1 318 ? 17.725  27.143 38.989  1.00 11.53 ? 296 TRP A N   1 
ATOM   2315 C  CA  . TRP A 1 318 ? 18.258  26.146 39.907  1.00 9.64  ? 296 TRP A CA  1 
ATOM   2316 C  C   . TRP A 1 318 ? 19.504  25.577 39.248  1.00 9.91  ? 296 TRP A C   1 
ATOM   2317 O  O   . TRP A 1 318 ? 19.835  25.965 38.123  1.00 11.30 ? 296 TRP A O   1 
ATOM   2318 C  CB  . TRP A 1 318 ? 17.250  25.012 40.119  1.00 13.61 ? 296 TRP A CB  1 
ATOM   2319 C  CG  . TRP A 1 318 ? 17.395  24.300 41.437  1.00 13.75 ? 296 TRP A CG  1 
ATOM   2320 C  CD1 . TRP A 1 318 ? 18.079  23.146 41.683  1.00 14.34 ? 296 TRP A CD1 1 
ATOM   2321 C  CD2 . TRP A 1 318 ? 16.837  24.716 42.692  1.00 13.84 ? 296 TRP A CD2 1 
ATOM   2322 N  NE1 . TRP A 1 318 ? 17.978  22.813 43.022  1.00 16.11 ? 296 TRP A NE1 1 
ATOM   2323 C  CE2 . TRP A 1 318 ? 17.223  23.758 43.653  1.00 16.61 ? 296 TRP A CE2 1 
ATOM   2324 C  CE3 . TRP A 1 318 ? 16.044  25.795 43.084  1.00 16.07 ? 296 TRP A CE3 1 
ATOM   2325 C  CZ2 . TRP A 1 318 ? 16.839  23.858 44.998  1.00 19.72 ? 296 TRP A CZ2 1 
ATOM   2326 C  CZ3 . TRP A 1 318 ? 15.667  25.893 44.418  1.00 20.16 ? 296 TRP A CZ3 1 
ATOM   2327 C  CH2 . TRP A 1 318 ? 16.067  24.928 45.355  1.00 17.22 ? 296 TRP A CH2 1 
ATOM   2328 N  N   . GLY A 1 319 ? 20.179  24.660 39.934  1.00 10.37 ? 297 GLY A N   1 
ATOM   2329 C  CA  . GLY A 1 319 ? 21.315  23.959 39.356  1.00 8.69  ? 297 GLY A CA  1 
ATOM   2330 C  C   . GLY A 1 319 ? 22.602  24.021 40.155  1.00 11.69 ? 297 GLY A C   1 
ATOM   2331 O  O   . GLY A 1 319 ? 22.742  24.837 41.073  1.00 12.43 ? 297 GLY A O   1 
ATOM   2332 N  N   . GLY A 1 320 ? 23.549  23.171 39.764  1.00 9.67  ? 298 GLY A N   1 
ATOM   2333 C  CA  . GLY A 1 320 ? 24.799  22.983 40.489  1.00 11.28 ? 298 GLY A CA  1 
ATOM   2334 C  C   . GLY A 1 320 ? 25.959  23.843 40.022  1.00 10.86 ? 298 GLY A C   1 
ATOM   2335 O  O   . GLY A 1 320 ? 25.754  24.950 39.520  1.00 9.30  ? 298 GLY A O   1 
ATOM   2336 N  N   . ASP A 1 321 ? 27.179  23.320 40.182  1.00 9.55  ? 299 ASP A N   1 
ATOM   2337 C  CA  . ASP A 1 321 ? 28.391  24.126 40.001  1.00 8.41  ? 299 ASP A CA  1 
ATOM   2338 C  C   . ASP A 1 321 ? 28.535  24.767 38.632  1.00 8.56  ? 299 ASP A C   1 
ATOM   2339 O  O   . ASP A 1 321 ? 29.100  25.853 38.524  1.00 8.76  ? 299 ASP A O   1 
ATOM   2340 C  CB  . ASP A 1 321 ? 29.653  23.297 40.260  1.00 9.82  ? 299 ASP A CB  1 
ATOM   2341 C  CG  . ASP A 1 321 ? 29.902  23.035 41.726  1.00 10.74 ? 299 ASP A CG  1 
ATOM   2342 O  OD1 . ASP A 1 321 ? 29.526  23.873 42.578  1.00 12.08 ? 299 ASP A OD1 1 
ATOM   2343 O  OD2 . ASP A 1 321 ? 30.512  21.985 42.009  1.00 11.24 ? 299 ASP A OD2 1 
ATOM   2344 N  N   . ILE A 1 322 ? 28.064  24.094 37.586  1.00 8.84  ? 300 ILE A N   1 
ATOM   2345 C  CA  . ILE A 1 322 ? 28.275  24.599 36.232  1.00 7.65  ? 300 ILE A CA  1 
ATOM   2346 C  C   . ILE A 1 322 ? 27.446  25.855 35.963  1.00 8.23  ? 300 ILE A C   1 
ATOM   2347 O  O   . ILE A 1 322 ? 27.994  26.913 35.633  1.00 7.13  ? 300 ILE A O   1 
ATOM   2348 C  CB  . ILE A 1 322 ? 28.028  23.508 35.164  1.00 8.16  ? 300 ILE A CB  1 
ATOM   2349 C  CG1 . ILE A 1 322 ? 29.014  22.348 35.354  1.00 8.70  ? 300 ILE A CG1 1 
ATOM   2350 C  CG2 . ILE A 1 322 ? 28.142  24.099 33.757  1.00 8.24  ? 300 ILE A CG2 1 
ATOM   2351 C  CD1 . ILE A 1 322 ? 28.535  21.022 34.744  1.00 10.95 ? 300 ILE A CD1 1 
ATOM   2352 N  N   . ILE A 1 323 ? 26.132  25.769 36.145  1.00 7.23  ? 301 ILE A N   1 
ATOM   2353 C  CA  . ILE A 1 323 ? 25.317  26.974 35.971  1.00 7.52  ? 301 ILE A CA  1 
ATOM   2354 C  C   . ILE A 1 323 ? 25.651  28.039 37.025  1.00 6.85  ? 301 ILE A C   1 
ATOM   2355 O  O   . ILE A 1 323 ? 25.721  29.229 36.717  1.00 7.84  ? 301 ILE A O   1 
ATOM   2356 C  CB  . ILE A 1 323 ? 23.788  26.667 35.913  1.00 7.28  ? 301 ILE A CB  1 
ATOM   2357 C  CG1 . ILE A 1 323 ? 22.982  27.936 35.619  1.00 8.52  ? 301 ILE A CG1 1 
ATOM   2358 C  CG2 . ILE A 1 323 ? 23.297  26.032 37.207  1.00 10.29 ? 301 ILE A CG2 1 
ATOM   2359 C  CD1 . ILE A 1 323 ? 23.238  28.528 34.250  1.00 7.08  ? 301 ILE A CD1 1 
ATOM   2360 N  N   . ALA A 1 324 ? 25.916  27.612 38.259  1.00 7.06  ? 302 ALA A N   1 
ATOM   2361 C  CA  . ALA A 1 324 ? 26.278  28.567 39.306  1.00 7.03  ? 302 ALA A CA  1 
ATOM   2362 C  C   . ALA A 1 324 ? 27.532  29.358 38.947  1.00 7.38  ? 302 ALA A C   1 
ATOM   2363 O  O   . ALA A 1 324 ? 27.592  30.564 39.179  1.00 9.12  ? 302 ALA A O   1 
ATOM   2364 C  CB  . ALA A 1 324 ? 26.467  27.855 40.634  1.00 7.76  ? 302 ALA A CB  1 
ATOM   2365 N  N   . ALA A 1 325 ? 28.527  28.681 38.371  1.00 7.14  ? 303 ALA A N   1 
ATOM   2366 C  CA  . ALA A 1 325 ? 29.769  29.358 38.021  1.00 7.87  ? 303 ALA A CA  1 
ATOM   2367 C  C   . ALA A 1 325 ? 29.526  30.324 36.883  1.00 7.53  ? 303 ALA A C   1 
ATOM   2368 O  O   . ALA A 1 325 ? 30.082  31.418 36.872  1.00 6.86  ? 303 ALA A O   1 
ATOM   2369 C  CB  . ALA A 1 325 ? 30.864  28.361 37.650  1.00 7.92  ? 303 ALA A CB  1 
ATOM   2370 N  N   . ALA A 1 326 ? 28.691  29.931 35.925  1.00 6.75  ? 304 ALA A N   1 
ATOM   2371 C  CA  . ALA A 1 326 ? 28.365  30.832 34.827  1.00 6.68  ? 304 ALA A CA  1 
ATOM   2372 C  C   . ALA A 1 326 ? 27.719  32.109 35.359  1.00 8.55  ? 304 ALA A C   1 
ATOM   2373 O  O   . ALA A 1 326 ? 28.066  33.215 34.931  1.00 8.10  ? 304 ALA A O   1 
ATOM   2374 C  CB  . ALA A 1 326 ? 27.450  30.136 33.821  1.00 7.32  ? 304 ALA A CB  1 
ATOM   2375 N  N   . CYS A 1 327 ? 26.780  31.962 36.290  1.00 7.86  ? 305 CYS A N   1 
ATOM   2376 C  CA  . CYS A 1 327 ? 26.110  33.124 36.884  1.00 7.47  ? 305 CYS A CA  1 
ATOM   2377 C  C   . CYS A 1 327 ? 27.078  33.999 37.672  1.00 8.10  ? 305 CYS A C   1 
ATOM   2378 O  O   . CYS A 1 327 ? 26.971  35.229 37.657  1.00 7.39  ? 305 CYS A O   1 
ATOM   2379 C  CB  . CYS A 1 327 ? 24.963  32.674 37.795  1.00 8.49  ? 305 CYS A CB  1 
ATOM   2380 S  SG  . CYS A 1 327 ? 23.592  31.880 36.930  1.00 9.36  ? 305 CYS A SG  1 
ATOM   2381 N  N   . THR A 1 328 ? 28.018  33.368 38.369  1.00 8.15  ? 306 THR A N   1 
ATOM   2382 C  CA  . THR A 1 328 ? 28.999  34.095 39.152  1.00 8.18  ? 306 THR A CA  1 
ATOM   2383 C  C   . THR A 1 328 ? 29.942  34.898 38.248  1.00 6.77  ? 306 THR A C   1 
ATOM   2384 O  O   . THR A 1 328 ? 30.296  36.044 38.557  1.00 7.78  ? 306 THR A O   1 
ATOM   2385 C  CB  . THR A 1 328 ? 29.785  33.140 40.075  1.00 8.18  ? 306 THR A CB  1 
ATOM   2386 O  OG1 . THR A 1 328 ? 28.862  32.444 40.927  1.00 8.58  ? 306 THR A OG1 1 
ATOM   2387 C  CG2 . THR A 1 328 ? 30.780  33.916 40.934  1.00 9.02  ? 306 THR A CG2 1 
ATOM   2388 N  N   . HIS A 1 329 ? 30.330  34.305 37.126  1.00 7.02  ? 307 HIS A N   1 
ATOM   2389 C  CA  . HIS A 1 329 ? 31.213  34.989 36.190  1.00 7.22  ? 307 HIS A CA  1 
ATOM   2390 C  C   . HIS A 1 329 ? 30.578  36.241 35.579  1.00 6.56  ? 307 HIS A C   1 
ATOM   2391 O  O   . HIS A 1 329 ? 31.209  37.300 35.549  1.00 8.06  ? 307 HIS A O   1 
ATOM   2392 C  CB  . HIS A 1 329 ? 31.707  34.028 35.105  1.00 6.80  ? 307 HIS A CB  1 
ATOM   2393 C  CG  . HIS A 1 329 ? 32.916  33.246 35.509  1.00 7.07  ? 307 HIS A CG  1 
ATOM   2394 N  ND1 . HIS A 1 329 ? 34.197  33.696 35.283  1.00 9.36  ? 307 HIS A ND1 1 
ATOM   2395 C  CD2 . HIS A 1 329 ? 33.042  32.057 36.151  1.00 8.31  ? 307 HIS A CD2 1 
ATOM   2396 C  CE1 . HIS A 1 329 ? 35.062  32.817 35.758  1.00 10.82 ? 307 HIS A CE1 1 
ATOM   2397 N  NE2 . HIS A 1 329 ? 34.386  31.817 36.298  1.00 8.35  ? 307 HIS A NE2 1 
ATOM   2398 N  N   . ILE A 1 330 ? 29.349  36.142 35.078  1.00 7.62  ? 308 ILE A N   1 
ATOM   2399 C  CA  . ILE A 1 330 ? 28.708  37.359 34.577  1.00 7.37  ? 308 ILE A CA  1 
ATOM   2400 C  C   . ILE A 1 330 ? 28.454  38.335 35.725  1.00 7.97  ? 308 ILE A C   1 
ATOM   2401 O  O   . ILE A 1 330 ? 28.659  39.544 35.568  1.00 7.82  ? 308 ILE A O   1 
ATOM   2402 C  CB  . ILE A 1 330 ? 27.442  37.074 33.719  1.00 9.14  ? 308 ILE A CB  1 
ATOM   2403 C  CG1 . ILE A 1 330 ? 26.883  38.364 33.099  1.00 10.26 ? 308 ILE A CG1 1 
ATOM   2404 C  CG2 . ILE A 1 330 ? 26.354  36.387 34.523  1.00 9.35  ? 308 ILE A CG2 1 
ATOM   2405 C  CD1 . ILE A 1 330 ? 27.750  38.965 32.011  1.00 10.20 ? 308 ILE A CD1 1 
ATOM   2406 N  N   . GLY A 1 331 ? 28.077  37.808 36.891  1.00 7.17  ? 309 GLY A N   1 
ATOM   2407 C  CA  . GLY A 1 331 ? 27.875  38.637 38.076  1.00 8.04  ? 309 GLY A CA  1 
ATOM   2408 C  C   . GLY A 1 331 ? 29.100  39.459 38.454  1.00 9.26  ? 309 GLY A C   1 
ATOM   2409 O  O   . GLY A 1 331 ? 28.974  40.608 38.888  1.00 8.86  ? 309 GLY A O   1 
ATOM   2410 N  N   . ALA A 1 332 ? 30.286  38.881 38.264  1.00 6.51  ? 310 ALA A N   1 
ATOM   2411 C  CA  . ALA A 1 332 ? 31.540  39.545 38.604  1.00 6.61  ? 310 ALA A CA  1 
ATOM   2412 C  C   . ALA A 1 332 ? 31.861  40.723 37.688  1.00 8.24  ? 310 ALA A C   1 
ATOM   2413 O  O   . ALA A 1 332 ? 32.761  41.505 37.994  1.00 9.76  ? 310 ALA A O   1 
ATOM   2414 C  CB  . ALA A 1 332 ? 32.689  38.539 38.590  1.00 8.12  ? 310 ALA A CB  1 
ATOM   2415 N  N   . THR A 1 333 ? 31.130  40.847 36.577  1.00 7.86  ? 311 THR A N   1 
ATOM   2416 C  CA  . THR A 1 333 ? 31.361  41.936 35.625  1.00 8.47  ? 311 THR A CA  1 
ATOM   2417 C  C   . THR A 1 333 ? 30.428  43.119 35.813  1.00 8.62  ? 311 THR A C   1 
ATOM   2418 O  O   . THR A 1 333 ? 30.604  44.158 35.162  1.00 9.15  ? 311 THR A O   1 
ATOM   2419 C  CB  . THR A 1 333 ? 31.202  41.481 34.162  1.00 7.74  ? 311 THR A CB  1 
ATOM   2420 O  OG1 . THR A 1 333 ? 29.821  41.209 33.885  1.00 8.73  ? 311 THR A OG1 1 
ATOM   2421 C  CG2 . THR A 1 333 ? 32.062  40.250 33.862  1.00 6.73  ? 311 THR A CG2 1 
ATOM   2422 N  N   . VAL A 1 334 ? 29.437  42.960 36.686  1.00 7.98  ? 312 VAL A N   1 
ATOM   2423 C  CA  . VAL A 1 334 ? 28.402  43.979 36.877  1.00 8.44  ? 312 VAL A CA  1 
ATOM   2424 C  C   . VAL A 1 334 ? 28.917  45.133 37.742  1.00 6.20  ? 312 VAL A C   1 
ATOM   2425 O  O   . VAL A 1 334 ? 29.636  44.915 38.718  1.00 8.80  ? 312 VAL A O   1 
ATOM   2426 C  CB  . VAL A 1 334 ? 27.143  43.353 37.501  1.00 5.88  ? 312 VAL A CB  1 
ATOM   2427 C  CG1 . VAL A 1 334 ? 26.089  44.414 37.839  1.00 7.15  ? 312 VAL A CG1 1 
ATOM   2428 C  CG2 . VAL A 1 334 ? 26.545  42.298 36.563  1.00 7.14  ? 312 VAL A CG2 1 
ATOM   2429 N  N   . GLN A 1 335 ? 28.582  46.367 37.363  1.00 7.27  ? 313 GLN A N   1 
ATOM   2430 C  CA  . GLN A 1 335 ? 28.947  47.525 38.182  1.00 8.16  ? 313 GLN A CA  1 
ATOM   2431 C  C   . GLN A 1 335 ? 28.434  47.294 39.607  1.00 8.46  ? 313 GLN A C   1 
ATOM   2432 O  O   . GLN A 1 335 ? 27.257  47.000 39.798  1.00 8.26  ? 313 GLN A O   1 
ATOM   2433 C  CB  . GLN A 1 335 ? 28.351  48.808 37.587  1.00 10.59 ? 313 GLN A CB  1 
ATOM   2434 C  CG  . GLN A 1 335 ? 28.929  50.086 38.189  1.00 15.29 ? 313 GLN A CG  1 
ATOM   2435 C  CD  . GLN A 1 335 ? 28.252  51.338 37.663  1.00 20.15 ? 313 GLN A CD  1 
ATOM   2436 O  OE1 . GLN A 1 335 ? 27.086  51.309 37.285  1.00 21.24 ? 313 GLN A OE1 1 
ATOM   2437 N  NE2 . GLN A 1 335 ? 28.988  52.446 37.635  1.00 22.61 ? 313 GLN A NE2 1 
ATOM   2438 N  N   . PRO A 1 336 ? 29.324  47.373 40.611  1.00 7.99  ? 314 PRO A N   1 
ATOM   2439 C  CA  . PRO A 1 336 ? 28.906  46.987 41.966  1.00 7.29  ? 314 PRO A CA  1 
ATOM   2440 C  C   . PRO A 1 336 ? 27.646  47.705 42.466  1.00 9.41  ? 314 PRO A C   1 
ATOM   2441 O  O   . PRO A 1 336 ? 26.811  47.065 43.108  1.00 10.35 ? 314 PRO A O   1 
ATOM   2442 C  CB  . PRO A 1 336 ? 30.126  47.347 42.812  1.00 12.61 ? 314 PRO A CB  1 
ATOM   2443 C  CG  . PRO A 1 336 ? 31.278  47.088 41.862  1.00 12.22 ? 314 PRO A CG  1 
ATOM   2444 C  CD  . PRO A 1 336 ? 30.782  47.569 40.518  1.00 10.48 ? 314 PRO A CD  1 
ATOM   2445 N  N   . ARG A 1 337 ? 27.478  48.983 42.145  1.00 7.71  ? 315 ARG A N   1 
ATOM   2446 C  CA  . ARG A 1 337 ? 26.297  49.702 42.631  1.00 10.64 ? 315 ARG A CA  1 
ATOM   2447 C  C   . ARG A 1 337 ? 24.986  49.220 42.005  1.00 9.41  ? 315 ARG A C   1 
ATOM   2448 O  O   . ARG A 1 337 ? 23.903  49.520 42.519  1.00 11.94 ? 315 ARG A O   1 
ATOM   2449 C  CB  . ARG A 1 337 ? 26.450  51.204 42.412  1.00 15.87 ? 315 ARG A CB  1 
ATOM   2450 C  CG  . ARG A 1 337 ? 26.253  51.617 40.975  1.00 20.32 ? 315 ARG A CG  1 
ATOM   2451 C  CD  . ARG A 1 337 ? 26.170  53.119 40.835  1.00 30.41 ? 315 ARG A CD  1 
ATOM   2452 N  NE  . ARG A 1 337 ? 25.780  53.503 39.483  1.00 33.48 ? 315 ARG A NE  1 
ATOM   2453 C  CZ  . ARG A 1 337 ? 24.797  54.352 39.204  1.00 27.61 ? 315 ARG A CZ  1 
ATOM   2454 N  NH1 . ARG A 1 337 ? 24.106  54.908 40.187  1.00 28.76 ? 315 ARG A NH1 1 
ATOM   2455 N  NH2 . ARG A 1 337 ? 24.510  54.643 37.945  1.00 29.00 ? 315 ARG A NH2 1 
ATOM   2456 N  N   . LEU A 1 338 ? 25.071  48.468 40.908  1.00 9.07  ? 316 LEU A N   1 
ATOM   2457 C  CA  . LEU A 1 338 ? 23.864  47.942 40.266  1.00 8.07  ? 316 LEU A CA  1 
ATOM   2458 C  C   . LEU A 1 338 ? 23.664  46.450 40.528  1.00 7.93  ? 316 LEU A C   1 
ATOM   2459 O  O   . LEU A 1 338 ? 22.679  45.864 40.070  1.00 8.62  ? 316 LEU A O   1 
ATOM   2460 C  CB  . LEU A 1 338 ? 23.893  48.194 38.749  1.00 7.25  ? 316 LEU A CB  1 
ATOM   2461 C  CG  . LEU A 1 338 ? 23.936  49.645 38.261  1.00 8.41  ? 316 LEU A CG  1 
ATOM   2462 C  CD1 . LEU A 1 338 ? 23.953  49.700 36.725  1.00 11.18 ? 316 LEU A CD1 1 
ATOM   2463 C  CD2 . LEU A 1 338 ? 22.755  50.427 38.821  1.00 10.14 ? 316 LEU A CD2 1 
ATOM   2464 N  N   . ASN A 1 339 ? 24.581  45.828 41.267  1.00 6.83  ? 317 ASN A N   1 
ATOM   2465 C  CA  . ASN A 1 339 ? 24.536  44.369 41.419  1.00 7.16  ? 317 ASN A CA  1 
ATOM   2466 C  C   . ASN A 1 339 ? 23.628  43.929 42.569  1.00 8.66  ? 317 ASN A C   1 
ATOM   2467 O  O   . ASN A 1 339 ? 23.996  44.047 43.750  1.00 10.00 ? 317 ASN A O   1 
ATOM   2468 C  CB  . ASN A 1 339 ? 25.954  43.832 41.620  1.00 7.78  ? 317 ASN A CB  1 
ATOM   2469 C  CG  . ASN A 1 339 ? 26.054  42.330 41.433  1.00 8.32  ? 317 ASN A CG  1 
ATOM   2470 O  OD1 . ASN A 1 339 ? 25.059  41.606 41.497  1.00 10.40 ? 317 ASN A OD1 1 
ATOM   2471 N  ND2 . ASN A 1 339 ? 27.276  41.849 41.199  1.00 9.59  ? 317 ASN A ND2 1 
ATOM   2472 N  N   . GLU A 1 340 ? 22.448  43.421 42.224  1.00 6.69  ? 318 GLU A N   1 
ATOM   2473 C  CA  . GLU A 1 340 ? 21.499  42.949 43.235  1.00 5.87  ? 318 GLU A CA  1 
ATOM   2474 C  C   . GLU A 1 340 ? 21.839  41.555 43.746  1.00 10.77 ? 318 GLU A C   1 
ATOM   2475 O  O   . GLU A 1 340 ? 21.198  41.051 44.670  1.00 12.90 ? 318 GLU A O   1 
ATOM   2476 C  CB  . GLU A 1 340 ? 20.058  42.995 42.708  1.00 6.59  ? 318 GLU A CB  1 
ATOM   2477 C  CG  . GLU A 1 340 ? 19.525  44.421 42.472  1.00 7.04  ? 318 GLU A CG  1 
ATOM   2478 C  CD  . GLU A 1 340 ? 19.115  45.136 43.752  1.00 9.73  ? 318 GLU A CD  1 
ATOM   2479 O  OE1 . GLU A 1 340 ? 19.701  44.877 44.822  1.00 11.56 ? 318 GLU A OE1 1 
ATOM   2480 O  OE2 . GLU A 1 340 ? 18.193  45.980 43.699  1.00 7.71  ? 318 GLU A OE2 1 
ATOM   2481 N  N   . GLY A 1 341 ? 22.859  40.942 43.154  1.00 8.01  ? 319 GLY A N   1 
ATOM   2482 C  CA  . GLY A 1 341 ? 23.349  39.668 43.650  1.00 7.90  ? 319 GLY A CA  1 
ATOM   2483 C  C   . GLY A 1 341 ? 23.268  38.517 42.667  1.00 8.07  ? 319 GLY A C   1 
ATOM   2484 O  O   . GLY A 1 341 ? 22.582  38.596 41.649  1.00 9.46  ? 319 GLY A O   1 
ATOM   2485 N  N   . VAL A 1 342 ? 23.991  37.447 42.980  1.00 8.35  ? 320 VAL A N   1 
ATOM   2486 C  CA  . VAL A 1 342 ? 23.948  36.206 42.213  1.00 7.72  ? 320 VAL A CA  1 
ATOM   2487 C  C   . VAL A 1 342 ? 23.301  35.154 43.094  1.00 9.67  ? 320 VAL A C   1 
ATOM   2488 O  O   . VAL A 1 342 ? 23.860  34.787 44.134  1.00 11.16 ? 320 VAL A O   1 
ATOM   2489 C  CB  . VAL A 1 342 ? 25.379  35.765 41.814  1.00 10.03 ? 320 VAL A CB  1 
ATOM   2490 C  CG1 . VAL A 1 342 ? 25.391  34.355 41.192  1.00 8.78  ? 320 VAL A CG1 1 
ATOM   2491 C  CG2 . VAL A 1 342 ? 25.987  36.780 40.848  1.00 11.09 ? 320 VAL A CG2 1 
ATOM   2492 N  N   . TRP A 1 343 ? 22.115  34.691 42.704  1.00 8.89  ? 321 TRP A N   1 
ATOM   2493 C  CA  . TRP A 1 343 ? 21.441  33.621 43.436  1.00 9.04  ? 321 TRP A CA  1 
ATOM   2494 C  C   . TRP A 1 343 ? 21.902  32.263 42.900  1.00 9.50  ? 321 TRP A C   1 
ATOM   2495 O  O   . TRP A 1 343 ? 21.930  32.055 41.686  1.00 11.28 ? 321 TRP A O   1 
ATOM   2496 C  CB  . TRP A 1 343 ? 19.913  33.736 43.290  1.00 9.97  ? 321 TRP A CB  1 
ATOM   2497 C  CG  . TRP A 1 343 ? 19.180  32.752 44.156  1.00 7.81  ? 321 TRP A CG  1 
ATOM   2498 C  CD1 . TRP A 1 343 ? 18.689  32.970 45.407  1.00 10.07 ? 321 TRP A CD1 1 
ATOM   2499 C  CD2 . TRP A 1 343 ? 18.891  31.378 43.844  1.00 10.54 ? 321 TRP A CD2 1 
ATOM   2500 N  NE1 . TRP A 1 343 ? 18.103  31.825 45.891  1.00 11.59 ? 321 TRP A NE1 1 
ATOM   2501 C  CE2 . TRP A 1 343 ? 18.216  30.833 44.949  1.00 9.96  ? 321 TRP A CE2 1 
ATOM   2502 C  CE3 . TRP A 1 343 ? 19.135  30.560 42.731  1.00 11.47 ? 321 TRP A CE3 1 
ATOM   2503 C  CZ2 . TRP A 1 343 ? 17.779  29.505 44.985  1.00 14.01 ? 321 TRP A CZ2 1 
ATOM   2504 C  CZ3 . TRP A 1 343 ? 18.697  29.237 42.768  1.00 10.95 ? 321 TRP A CZ3 1 
ATOM   2505 C  CH2 . TRP A 1 343 ? 18.029  28.727 43.883  1.00 12.99 ? 321 TRP A CH2 1 
ATOM   2506 N  N   . VAL A 1 344 ? 22.255  31.347 43.800  1.00 7.78  ? 322 VAL A N   1 
ATOM   2507 C  CA  . VAL A 1 344 ? 22.608  29.972 43.421  1.00 8.73  ? 322 VAL A CA  1 
ATOM   2508 C  C   . VAL A 1 344 ? 21.887  28.976 44.336  1.00 9.40  ? 322 VAL A C   1 
ATOM   2509 O  O   . VAL A 1 344 ? 21.545  29.305 45.479  1.00 9.11  ? 322 VAL A O   1 
ATOM   2510 C  CB  . VAL A 1 344 ? 24.139  29.712 43.498  1.00 9.33  ? 322 VAL A CB  1 
ATOM   2511 C  CG1 . VAL A 1 344 ? 24.899  30.657 42.567  1.00 12.35 ? 322 VAL A CG1 1 
ATOM   2512 C  CG2 . VAL A 1 344 ? 24.638  29.882 44.922  1.00 11.29 ? 322 VAL A CG2 1 
ATOM   2513 N  N   . ALA A 1 345 ? 21.679  27.758 43.834  1.00 7.42  ? 323 ALA A N   1 
ATOM   2514 C  CA  . ALA A 1 345 ? 20.957  26.715 44.564  1.00 8.49  ? 323 ALA A CA  1 
ATOM   2515 C  C   . ALA A 1 345 ? 21.832  25.923 45.523  1.00 11.88 ? 323 ALA A C   1 
ATOM   2516 O  O   . ALA A 1 345 ? 21.332  25.063 46.247  1.00 12.40 ? 323 ALA A O   1 
ATOM   2517 C  CB  . ALA A 1 345 ? 20.270  25.760 43.578  1.00 9.16  ? 323 ALA A CB  1 
ATOM   2518 N  N   . GLN A 1 346 ? 23.137  26.208 45.514  1.00 10.27 ? 324 GLN A N   1 
ATOM   2519 C  CA  . GLN A 1 346 ? 24.115  25.487 46.338  1.00 9.33  ? 324 GLN A CA  1 
ATOM   2520 C  C   . GLN A 1 346 ? 23.693  25.129 47.781  1.00 10.21 ? 324 GLN A C   1 
ATOM   2521 O  O   . GLN A 1 346 ? 23.955  24.009 48.230  1.00 14.10 ? 324 GLN A O   1 
ATOM   2522 C  CB  . GLN A 1 346 ? 25.471  26.226 46.339  1.00 10.00 ? 324 GLN A CB  1 
ATOM   2523 C  CG  . GLN A 1 346 ? 26.596  25.464 47.055  1.00 12.60 ? 324 GLN A CG  1 
ATOM   2524 C  CD  . GLN A 1 346 ? 26.947  26.020 48.438  1.00 17.09 ? 324 GLN A CD  1 
ATOM   2525 O  OE1 . GLN A 1 346 ? 26.547  27.126 48.809  1.00 14.87 ? 324 GLN A OE1 1 
ATOM   2526 N  NE2 . GLN A 1 346 ? 27.715  25.250 49.198  1.00 19.32 ? 324 GLN A NE2 1 
ATOM   2527 N  N   . PRO A 1 347 ? 23.043  26.063 48.507  1.00 9.77  ? 325 PRO A N   1 
ATOM   2528 C  CA  . PRO A 1 347 ? 22.657  25.699 49.879  1.00 15.85 ? 325 PRO A CA  1 
ATOM   2529 C  C   . PRO A 1 347 ? 21.684  24.519 49.954  1.00 16.58 ? 325 PRO A C   1 
ATOM   2530 O  O   . PRO A 1 347 ? 21.596  23.869 51.004  1.00 20.46 ? 325 PRO A O   1 
ATOM   2531 C  CB  . PRO A 1 347 ? 21.980  26.972 50.394  1.00 17.66 ? 325 PRO A CB  1 
ATOM   2532 C  CG  . PRO A 1 347 ? 22.652  28.066 49.653  1.00 18.58 ? 325 PRO A CG  1 
ATOM   2533 C  CD  . PRO A 1 347 ? 22.859  27.507 48.262  1.00 13.63 ? 325 PRO A CD  1 
ATOM   2534 N  N   . TYR A 1 348 ? 20.980  24.253 48.857  1.00 14.71 ? 326 TYR A N   1 
ATOM   2535 C  CA  . TYR A 1 348 ? 19.957  23.207 48.811  1.00 15.47 ? 326 TYR A CA  1 
ATOM   2536 C  C   . TYR A 1 348 ? 20.459  21.935 48.118  1.00 15.23 ? 326 TYR A C   1 
ATOM   2537 O  O   . TYR A 1 348 ? 19.699  20.978 47.952  1.00 17.86 ? 326 TYR A O   1 
ATOM   2538 C  CB  . TYR A 1 348 ? 18.707  23.712 48.077  1.00 15.06 ? 326 TYR A CB  1 
ATOM   2539 C  CG  . TYR A 1 348 ? 18.177  25.063 48.529  1.00 18.61 ? 326 TYR A CG  1 
ATOM   2540 C  CD1 . TYR A 1 348 ? 17.266  25.164 49.574  1.00 22.18 ? 326 TYR A CD1 1 
ATOM   2541 C  CD2 . TYR A 1 348 ? 18.568  26.233 47.889  1.00 15.90 ? 326 TYR A CD2 1 
ATOM   2542 C  CE1 . TYR A 1 348 ? 16.770  26.400 49.978  1.00 20.24 ? 326 TYR A CE1 1 
ATOM   2543 C  CE2 . TYR A 1 348 ? 18.079  27.470 48.281  1.00 20.18 ? 326 TYR A CE2 1 
ATOM   2544 C  CZ  . TYR A 1 348 ? 17.182  27.548 49.329  1.00 22.99 ? 326 TYR A CZ  1 
ATOM   2545 O  OH  . TYR A 1 348 ? 16.697  28.782 49.717  1.00 20.43 ? 326 TYR A OH  1 
ATOM   2546 N  N   . ILE A 1 349 ? 21.729  21.932 47.707  1.00 13.00 ? 327 ILE A N   1 
ATOM   2547 C  CA  . ILE A 1 349 ? 22.312  20.814 46.963  1.00 12.49 ? 327 ILE A CA  1 
ATOM   2548 C  C   . ILE A 1 349 ? 23.389  20.094 47.777  1.00 15.44 ? 327 ILE A C   1 
ATOM   2549 O  O   . ILE A 1 349 ? 24.385  20.696 48.175  1.00 15.47 ? 327 ILE A O   1 
ATOM   2550 C  CB  . ILE A 1 349 ? 22.905  21.291 45.610  1.00 12.96 ? 327 ILE A CB  1 
ATOM   2551 C  CG1 . ILE A 1 349 ? 21.783  21.800 44.699  1.00 12.23 ? 327 ILE A CG1 1 
ATOM   2552 C  CG2 . ILE A 1 349 ? 23.685  20.175 44.927  1.00 14.72 ? 327 ILE A CG2 1 
ATOM   2553 C  CD1 . ILE A 1 349 ? 22.276  22.496 43.439  1.00 13.29 ? 327 ILE A CD1 1 
ATOM   2554 N  N   . ALA A 1 350 ? 23.185  18.805 48.029  1.00 15.61 ? 328 ALA A N   1 
ATOM   2555 C  CA  . ALA A 1 350 ? 24.068  18.066 48.927  1.00 20.05 ? 328 ALA A CA  1 
ATOM   2556 C  C   . ALA A 1 350 ? 25.456  17.815 48.339  1.00 20.67 ? 328 ALA A C   1 
ATOM   2557 O  O   . ALA A 1 350 ? 26.460  17.882 49.052  1.00 26.05 ? 328 ALA A O   1 
ATOM   2558 C  CB  . ALA A 1 350 ? 23.421  16.745 49.350  1.00 20.97 ? 328 ALA A CB  1 
ATOM   2559 N  N   . GLN A 1 351 ? 25.513  17.518 47.044  1.00 15.27 ? 329 GLN A N   1 
ATOM   2560 C  CA  . GLN A 1 351 ? 26.751  17.045 46.432  1.00 15.00 ? 329 GLN A CA  1 
ATOM   2561 C  C   . GLN A 1 351 ? 27.254  17.958 45.308  1.00 15.88 ? 329 GLN A C   1 
ATOM   2562 O  O   . GLN A 1 351 ? 26.644  18.026 44.238  1.00 16.28 ? 329 GLN A O   1 
ATOM   2563 C  CB  . GLN A 1 351 ? 26.530  15.630 45.899  1.00 20.86 ? 329 GLN A CB  1 
ATOM   2564 C  CG  . GLN A 1 351 ? 27.682  15.042 45.117  1.00 30.62 ? 329 GLN A CG  1 
ATOM   2565 C  CD  . GLN A 1 351 ? 27.438  13.587 44.760  1.00 40.87 ? 329 GLN A CD  1 
ATOM   2566 O  OE1 . GLN A 1 351 ? 26.797  13.279 43.751  1.00 45.89 ? 329 GLN A OE1 1 
ATOM   2567 N  NE2 . GLN A 1 351 ? 27.942  12.682 45.596  1.00 37.33 ? 329 GLN A NE2 1 
ATOM   2568 N  N   . PRO A 1 352 ? 28.375  18.664 45.539  1.00 13.68 ? 330 PRO A N   1 
ATOM   2569 C  CA  . PRO A 1 352 ? 28.938  19.506 44.473  1.00 14.44 ? 330 PRO A CA  1 
ATOM   2570 C  C   . PRO A 1 352 ? 29.598  18.685 43.363  1.00 13.54 ? 330 PRO A C   1 
ATOM   2571 O  O   . PRO A 1 352 ? 30.087  17.585 43.617  1.00 15.40 ? 330 PRO A O   1 
ATOM   2572 C  CB  . PRO A 1 352 ? 29.970  20.366 45.212  1.00 13.65 ? 330 PRO A CB  1 
ATOM   2573 C  CG  . PRO A 1 352 ? 30.363  19.548 46.414  1.00 13.93 ? 330 PRO A CG  1 
ATOM   2574 C  CD  . PRO A 1 352 ? 29.119  18.784 46.807  1.00 15.23 ? 330 PRO A CD  1 
ATOM   2575 N  N   . TYR A 1 353 ? 29.596  19.205 42.135  1.00 12.52 ? 331 TYR A N   1 
ATOM   2576 C  CA  . TYR A 1 353 ? 30.230  18.499 41.024  1.00 11.29 ? 331 TYR A CA  1 
ATOM   2577 C  C   . TYR A 1 353 ? 31.751  18.585 41.120  1.00 12.19 ? 331 TYR A C   1 
ATOM   2578 O  O   . TYR A 1 353 ? 32.463  17.679 40.698  1.00 12.72 ? 331 TYR A O   1 
ATOM   2579 C  CB  . TYR A 1 353 ? 29.793  19.079 39.672  1.00 11.03 ? 331 TYR A CB  1 
ATOM   2580 C  CG  . TYR A 1 353 ? 28.298  19.259 39.463  1.00 13.61 ? 331 TYR A CG  1 
ATOM   2581 C  CD1 . TYR A 1 353 ? 27.362  18.518 40.183  1.00 13.69 ? 331 TYR A CD1 1 
ATOM   2582 C  CD2 . TYR A 1 353 ? 27.827  20.166 38.516  1.00 10.12 ? 331 TYR A CD2 1 
ATOM   2583 C  CE1 . TYR A 1 353 ? 25.989  18.694 39.979  1.00 12.66 ? 331 TYR A CE1 1 
ATOM   2584 C  CE2 . TYR A 1 353 ? 26.459  20.349 38.308  1.00 13.54 ? 331 TYR A CE2 1 
ATOM   2585 C  CZ  . TYR A 1 353 ? 25.550  19.606 39.037  1.00 12.38 ? 331 TYR A CZ  1 
ATOM   2586 O  OH  . TYR A 1 353 ? 24.196  19.788 38.837  1.00 13.07 ? 331 TYR A OH  1 
ATOM   2587 N  N   . ASP A 1 354 ? 32.233  19.700 41.664  1.00 11.44 ? 332 ASP A N   1 
ATOM   2588 C  CA  . ASP A 1 354 ? 33.667  19.956 41.794  1.00 10.11 ? 332 ASP A CA  1 
ATOM   2589 C  C   . ASP A 1 354 ? 33.941  20.165 43.276  1.00 10.37 ? 332 ASP A C   1 
ATOM   2590 O  O   . ASP A 1 354 ? 33.639  21.233 43.817  1.00 11.64 ? 332 ASP A O   1 
ATOM   2591 C  CB  . ASP A 1 354 ? 34.041  21.208 40.978  1.00 10.54 ? 332 ASP A CB  1 
ATOM   2592 C  CG  . ASP A 1 354 ? 35.532  21.510 40.994  1.00 11.36 ? 332 ASP A CG  1 
ATOM   2593 O  OD1 . ASP A 1 354 ? 36.249  21.006 41.880  1.00 10.27 ? 332 ASP A OD1 1 
ATOM   2594 O  OD2 . ASP A 1 354 ? 36.003  22.266 40.116  1.00 13.14 ? 332 ASP A OD2 1 
ATOM   2595 N  N   . GLU A 1 355 ? 34.507  19.142 43.913  1.00 10.86 ? 333 GLU A N   1 
ATOM   2596 C  CA  . GLU A 1 355 ? 34.705  19.143 45.358  1.00 12.46 ? 333 GLU A CA  1 
ATOM   2597 C  C   . GLU A 1 355 ? 35.682  20.230 45.805  1.00 14.04 ? 333 GLU A C   1 
ATOM   2598 O  O   . GLU A 1 355 ? 35.556  20.766 46.906  1.00 16.02 ? 333 GLU A O   1 
ATOM   2599 C  CB  . GLU A 1 355 ? 35.163  17.753 45.830  1.00 13.81 ? 333 GLU A CB  1 
ATOM   2600 C  CG  . GLU A 1 355 ? 36.469  17.257 45.192  1.00 16.65 ? 333 GLU A CG  1 
ATOM   2601 C  CD  . GLU A 1 355 ? 36.690  15.756 45.353  1.00 23.19 ? 333 GLU A CD  1 
ATOM   2602 O  OE1 . GLU A 1 355 ? 35.692  14.999 45.427  1.00 24.49 ? 333 GLU A OE1 1 
ATOM   2603 O  OE2 . GLU A 1 355 ? 37.867  15.330 45.400  1.00 22.01 ? 333 GLU A OE2 1 
ATOM   2604 N  N   . GLU A 1 356 ? 36.636  20.569 44.941  1.00 11.95 ? 334 GLU A N   1 
ATOM   2605 C  CA  . GLU A 1 356 ? 37.680  21.536 45.288  1.00 11.10 ? 334 GLU A CA  1 
ATOM   2606 C  C   . GLU A 1 356 ? 37.288  22.974 44.983  1.00 11.03 ? 334 GLU A C   1 
ATOM   2607 O  O   . GLU A 1 356 ? 37.481  23.869 45.808  1.00 12.70 ? 334 GLU A O   1 
ATOM   2608 C  CB  . GLU A 1 356 ? 38.973  21.224 44.529  1.00 12.59 ? 334 GLU A CB  1 
ATOM   2609 C  CG  . GLU A 1 356 ? 39.714  19.991 44.997  1.00 22.08 ? 334 GLU A CG  1 
ATOM   2610 C  CD  . GLU A 1 356 ? 40.945  19.711 44.151  1.00 35.01 ? 334 GLU A CD  1 
ATOM   2611 O  OE1 . GLU A 1 356 ? 41.576  20.679 43.670  1.00 37.02 ? 334 GLU A OE1 1 
ATOM   2612 O  OE2 . GLU A 1 356 ? 41.274  18.520 43.959  1.00 42.92 ? 334 GLU A OE2 1 
ATOM   2613 N  N   . ASN A 1 357 ? 36.752  23.204 43.790  1.00 10.22 ? 335 ASN A N   1 
ATOM   2614 C  CA  . ASN A 1 357 ? 36.587  24.567 43.308  1.00 9.81  ? 335 ASN A CA  1 
ATOM   2615 C  C   . ASN A 1 357 ? 35.165  24.956 42.927  1.00 9.73  ? 335 ASN A C   1 
ATOM   2616 O  O   . ASN A 1 357 ? 34.942  26.006 42.310  1.00 11.57 ? 335 ASN A O   1 
ATOM   2617 C  CB  . ASN A 1 357 ? 37.541  24.813 42.135  1.00 11.94 ? 335 ASN A CB  1 
ATOM   2618 C  CG  . ASN A 1 357 ? 38.992  24.771 42.564  1.00 13.97 ? 335 ASN A CG  1 
ATOM   2619 O  OD1 . ASN A 1 357 ? 39.363  25.348 43.593  1.00 17.13 ? 335 ASN A OD1 1 
ATOM   2620 N  ND2 . ASN A 1 357 ? 39.816  24.074 41.795  1.00 16.90 ? 335 ASN A ND2 1 
ATOM   2621 N  N   . GLY A 1 358 ? 34.203  24.119 43.303  1.00 12.03 ? 336 GLY A N   1 
ATOM   2622 C  CA  . GLY A 1 358 ? 32.805  24.427 43.064  1.00 10.33 ? 336 GLY A CA  1 
ATOM   2623 C  C   . GLY A 1 358 ? 32.341  25.702 43.755  1.00 11.95 ? 336 GLY A C   1 
ATOM   2624 O  O   . GLY A 1 358 ? 32.981  26.194 44.694  1.00 13.16 ? 336 GLY A O   1 
ATOM   2625 N  N   . ILE A 1 359 ? 31.219  26.238 43.284  1.00 10.54 ? 337 ILE A N   1 
ATOM   2626 C  CA  . ILE A 1 359 ? 30.680  27.490 43.806  1.00 10.69 ? 337 ILE A CA  1 
ATOM   2627 C  C   . ILE A 1 359 ? 30.070  27.299 45.193  1.00 12.02 ? 337 ILE A C   1 
ATOM   2628 O  O   . ILE A 1 359 ? 29.241  26.411 45.402  1.00 13.87 ? 337 ILE A O   1 
ATOM   2629 C  CB  . ILE A 1 359 ? 29.604  28.067 42.854  1.00 7.98  ? 337 ILE A CB  1 
ATOM   2630 C  CG1 . ILE A 1 359 ? 30.225  28.467 41.510  1.00 13.50 ? 337 ILE A CG1 1 
ATOM   2631 C  CG2 . ILE A 1 359 ? 28.911  29.266 43.496  1.00 11.00 ? 337 ILE A CG2 1 
ATOM   2632 C  CD1 . ILE A 1 359 ? 31.212  29.645 41.609  1.00 12.46 ? 337 ILE A CD1 1 
ATOM   2633 N  N   . ARG A 1 360 ? 30.471  28.135 46.146  1.00 9.07  ? 338 ARG A N   1 
ATOM   2634 C  CA  . ARG A 1 360 ? 29.966  28.021 47.508  1.00 11.55 ? 338 ARG A CA  1 
ATOM   2635 C  C   . ARG A 1 360 ? 29.611  29.407 48.010  1.00 12.42 ? 338 ARG A C   1 
ATOM   2636 O  O   . ARG A 1 360 ? 30.374  30.347 47.805  1.00 12.38 ? 338 ARG A O   1 
ATOM   2637 C  CB  . ARG A 1 360 ? 31.032  27.416 48.426  1.00 11.21 ? 338 ARG A CB  1 
ATOM   2638 C  CG  . ARG A 1 360 ? 31.557  26.040 47.984  1.00 15.75 ? 338 ARG A CG  1 
ATOM   2639 C  CD  . ARG A 1 360 ? 32.699  25.534 48.869  1.00 14.67 ? 338 ARG A CD  1 
ATOM   2640 N  NE  . ARG A 1 360 ? 33.963  26.243 48.668  1.00 14.88 ? 338 ARG A NE  1 
ATOM   2641 C  CZ  . ARG A 1 360 ? 34.903  25.887 47.790  1.00 18.15 ? 338 ARG A CZ  1 
ATOM   2642 N  NH1 . ARG A 1 360 ? 34.728  24.834 46.999  1.00 15.03 ? 338 ARG A NH1 1 
ATOM   2643 N  NH2 . ARG A 1 360 ? 36.024  26.593 47.692  1.00 20.50 ? 338 ARG A NH2 1 
ATOM   2644 N  N   . ILE A 1 361 ? 28.464  29.546 48.670  1.00 9.50  ? 339 ILE A N   1 
ATOM   2645 C  CA  . ILE A 1 361 ? 28.166  30.806 49.343  1.00 10.29 ? 339 ILE A CA  1 
ATOM   2646 C  C   . ILE A 1 361 ? 28.899  30.853 50.675  1.00 13.28 ? 339 ILE A C   1 
ATOM   2647 O  O   . ILE A 1 361 ? 28.893  29.883 51.449  1.00 14.72 ? 339 ILE A O   1 
ATOM   2648 C  CB  . ILE A 1 361 ? 26.651  31.023 49.568  1.00 11.19 ? 339 ILE A CB  1 
ATOM   2649 C  CG1 . ILE A 1 361 ? 25.886  30.856 48.258  1.00 12.19 ? 339 ILE A CG1 1 
ATOM   2650 C  CG2 . ILE A 1 361 ? 26.389  32.418 50.144  1.00 16.70 ? 339 ILE A CG2 1 
ATOM   2651 C  CD1 . ILE A 1 361 ? 24.384  31.085 48.390  1.00 14.95 ? 339 ILE A CD1 1 
ATOM   2652 N  N   . ALA A 1 362 ? 29.565  31.974 50.924  1.00 10.93 ? 340 ALA A N   1 
ATOM   2653 C  CA  . ALA A 1 362 ? 30.238  32.191 52.203  1.00 16.06 ? 340 ALA A CA  1 
ATOM   2654 C  C   . ALA A 1 362 ? 29.981  33.617 52.655  1.00 13.12 ? 340 ALA A C   1 
ATOM   2655 O  O   . ALA A 1 362 ? 30.334  34.564 51.962  1.00 14.51 ? 340 ALA A O   1 
ATOM   2656 C  CB  . ALA A 1 362 ? 31.739  31.929 52.076  1.00 22.82 ? 340 ALA A CB  1 
ATOM   2657 N  N   . GLY A 1 363 ? 29.364  33.768 53.822  1.00 14.80 ? 341 GLY A N   1 
ATOM   2658 C  CA  . GLY A 1 363 ? 29.070  35.092 54.334  1.00 13.33 ? 341 GLY A CA  1 
ATOM   2659 C  C   . GLY A 1 363 ? 28.139  35.869 53.425  1.00 11.40 ? 341 GLY A C   1 
ATOM   2660 O  O   . GLY A 1 363 ? 28.277  37.087 53.284  1.00 14.46 ? 341 GLY A O   1 
ATOM   2661 N  N   . GLY A 1 364 ? 27.197  35.164 52.796  1.00 12.47 ? 342 GLY A N   1 
ATOM   2662 C  CA  . GLY A 1 364 ? 26.226  35.808 51.925  1.00 10.33 ? 342 GLY A CA  1 
ATOM   2663 C  C   . GLY A 1 364 ? 26.807  36.300 50.608  1.00 12.56 ? 342 GLY A C   1 
ATOM   2664 O  O   . GLY A 1 364 ? 26.154  37.058 49.894  1.00 11.27 ? 342 GLY A O   1 
ATOM   2665 N  N   . HIS A 1 365 ? 28.028  35.867 50.293  1.00 9.75  ? 343 HIS A N   1 
ATOM   2666 C  CA  . HIS A 1 365 ? 28.739  36.297 49.088  1.00 11.65 ? 343 HIS A CA  1 
ATOM   2667 C  C   . HIS A 1 365 ? 29.367  35.090 48.386  1.00 10.35 ? 343 HIS A C   1 
ATOM   2668 O  O   . HIS A 1 365 ? 29.427  34.003 48.955  1.00 11.19 ? 343 HIS A O   1 
ATOM   2669 C  CB  . HIS A 1 365 ? 29.824  37.315 49.454  1.00 11.52 ? 343 HIS A CB  1 
ATOM   2670 C  CG  . HIS A 1 365 ? 29.287  38.643 49.897  1.00 13.19 ? 343 HIS A CG  1 
ATOM   2671 N  ND1 . HIS A 1 365 ? 28.665  38.827 51.115  1.00 12.40 ? 343 HIS A ND1 1 
ATOM   2672 C  CD2 . HIS A 1 365 ? 29.288  39.855 49.289  1.00 13.28 ? 343 HIS A CD2 1 
ATOM   2673 C  CE1 . HIS A 1 365 ? 28.291  40.089 51.231  1.00 14.82 ? 343 HIS A CE1 1 
ATOM   2674 N  NE2 . HIS A 1 365 ? 28.657  40.735 50.137  1.00 13.99 ? 343 HIS A NE2 1 
ATOM   2675 N  N   . ILE A 1 366 ? 29.829  35.276 47.153  1.00 9.34  ? 344 ILE A N   1 
ATOM   2676 C  CA  . ILE A 1 366 ? 30.432  34.181 46.395  1.00 8.79  ? 344 ILE A CA  1 
ATOM   2677 C  C   . ILE A 1 366 ? 31.762  34.635 45.813  1.00 10.29 ? 344 ILE A C   1 
ATOM   2678 O  O   . ILE A 1 366 ? 31.820  35.665 45.142  1.00 11.88 ? 344 ILE A O   1 
ATOM   2679 C  CB  . ILE A 1 366 ? 29.526  33.724 45.221  1.00 7.59  ? 344 ILE A CB  1 
ATOM   2680 C  CG1 . ILE A 1 366 ? 28.160  33.258 45.733  1.00 10.80 ? 344 ILE A CG1 1 
ATOM   2681 C  CG2 . ILE A 1 366 ? 30.203  32.617 44.425  1.00 11.45 ? 344 ILE A CG2 1 
ATOM   2682 C  CD1 . ILE A 1 366 ? 27.107  33.100 44.629  1.00 9.83  ? 344 ILE A CD1 1 
ATOM   2683 N  N   . ASP A 1 367 ? 32.825  33.879 46.085  1.00 10.21 ? 345 ASP A N   1 
ATOM   2684 C  CA  . ASP A 1 367 ? 34.131  34.150 45.482  1.00 11.17 ? 345 ASP A CA  1 
ATOM   2685 C  C   . ASP A 1 367 ? 34.181  33.627 44.051  1.00 9.51  ? 345 ASP A C   1 
ATOM   2686 O  O   . ASP A 1 367 ? 33.766  32.494 43.770  1.00 11.73 ? 345 ASP A O   1 
ATOM   2687 C  CB  . ASP A 1 367 ? 35.258  33.496 46.294  1.00 11.92 ? 345 ASP A CB  1 
ATOM   2688 C  CG  . ASP A 1 367 ? 35.461  34.143 47.653  1.00 21.46 ? 345 ASP A CG  1 
ATOM   2689 O  OD1 . ASP A 1 367 ? 35.278  35.370 47.772  1.00 22.87 ? 345 ASP A OD1 1 
ATOM   2690 O  OD2 . ASP A 1 367 ? 35.817  33.412 48.601  1.00 28.67 ? 345 ASP A OD2 1 
ATOM   2691 N  N   . LEU A 1 368 ? 34.694  34.449 43.142  1.00 8.47  ? 346 LEU A N   1 
ATOM   2692 C  CA  . LEU A 1 368 ? 34.876  34.005 41.756  1.00 9.44  ? 346 LEU A CA  1 
ATOM   2693 C  C   . LEU A 1 368 ? 35.996  32.973 41.690  1.00 10.99 ? 346 LEU A C   1 
ATOM   2694 O  O   . LEU A 1 368 ? 37.068  33.186 42.251  1.00 11.08 ? 346 LEU A O   1 
ATOM   2695 C  CB  . LEU A 1 368 ? 35.221  35.201 40.868  1.00 8.97  ? 346 LEU A CB  1 
ATOM   2696 C  CG  . LEU A 1 368 ? 35.287  34.964 39.361  1.00 10.86 ? 346 LEU A CG  1 
ATOM   2697 C  CD1 . LEU A 1 368 ? 33.917  34.603 38.811  1.00 10.46 ? 346 LEU A CD1 1 
ATOM   2698 C  CD2 . LEU A 1 368 ? 35.846  36.197 38.663  1.00 13.65 ? 346 LEU A CD2 1 
ATOM   2699 N  N   . PRO A 1 369 ? 35.756  31.837 41.005  1.00 11.18 ? 347 PRO A N   1 
ATOM   2700 C  CA  . PRO A 1 369 ? 36.821  30.831 40.859  1.00 10.30 ? 347 PRO A CA  1 
ATOM   2701 C  C   . PRO A 1 369 ? 38.061  31.418 40.190  1.00 10.57 ? 347 PRO A C   1 
ATOM   2702 O  O   . PRO A 1 369 ? 37.944  32.361 39.399  1.00 10.77 ? 347 PRO A O   1 
ATOM   2703 C  CB  . PRO A 1 369 ? 36.175  29.771 39.957  1.00 11.30 ? 347 PRO A CB  1 
ATOM   2704 C  CG  . PRO A 1 369 ? 34.708  29.875 40.278  1.00 10.68 ? 347 PRO A CG  1 
ATOM   2705 C  CD  . PRO A 1 369 ? 34.479  31.368 40.439  1.00 10.00 ? 347 PRO A CD  1 
ATOM   2706 N  N   . LYS A 1 370 ? 39.229  30.871 40.511  1.00 10.89 ? 348 LYS A N   1 
ATOM   2707 C  CA  . LYS A 1 370 ? 40.490  31.415 40.019  1.00 10.68 ? 348 LYS A CA  1 
ATOM   2708 C  C   . LYS A 1 370 ? 40.902  30.886 38.647  1.00 14.63 ? 348 LYS A C   1 
ATOM   2709 O  O   . LYS A 1 370 ? 41.631  31.555 37.922  1.00 17.87 ? 348 LYS A O   1 
ATOM   2710 C  CB  . LYS A 1 370 ? 41.621  31.120 41.004  1.00 17.56 ? 348 LYS A CB  1 
ATOM   2711 C  CG  . LYS A 1 370 ? 41.315  31.454 42.454  1.00 23.44 ? 348 LYS A CG  1 
ATOM   2712 C  CD  . LYS A 1 370 ? 41.108  32.943 42.669  1.00 33.21 ? 348 LYS A CD  1 
ATOM   2713 C  CE  . LYS A 1 370 ? 40.988  33.258 44.159  1.00 37.27 ? 348 LYS A CE  1 
ATOM   2714 N  NZ  . LYS A 1 370 ? 40.845  34.717 44.416  1.00 36.98 ? 348 LYS A NZ  1 
ATOM   2715 N  N   . GLY A 1 371 ? 40.451  29.685 38.302  1.00 13.00 ? 349 GLY A N   1 
ATOM   2716 C  CA  . GLY A 1 371 ? 40.956  28.989 37.125  1.00 16.17 ? 349 GLY A CA  1 
ATOM   2717 C  C   . GLY A 1 371 ? 40.437  29.501 35.799  1.00 12.42 ? 349 GLY A C   1 
ATOM   2718 O  O   . GLY A 1 371 ? 39.503  30.300 35.756  1.00 14.22 ? 349 GLY A O   1 
ATOM   2719 N  N   . PRO A 1 372 ? 41.041  29.041 34.692  1.00 10.58 ? 350 PRO A N   1 
ATOM   2720 C  CA  . PRO A 1 372 ? 40.558  29.464 33.369  1.00 10.21 ? 350 PRO A CA  1 
ATOM   2721 C  C   . PRO A 1 372 ? 39.166  28.900 33.060  1.00 11.38 ? 350 PRO A C   1 
ATOM   2722 O  O   . PRO A 1 372 ? 38.728  27.949 33.716  1.00 11.91 ? 350 PRO A O   1 
ATOM   2723 C  CB  . PRO A 1 372 ? 41.592  28.867 32.407  1.00 13.49 ? 350 PRO A CB  1 
ATOM   2724 C  CG  . PRO A 1 372 ? 42.196  27.720 33.154  1.00 19.45 ? 350 PRO A CG  1 
ATOM   2725 C  CD  . PRO A 1 372 ? 42.179  28.108 34.606  1.00 13.28 ? 350 PRO A CD  1 
ATOM   2726 N  N   . GLY A 1 373 ? 38.494  29.462 32.062  1.00 9.52  ? 351 GLY A N   1 
ATOM   2727 C  CA  . GLY A 1 373 ? 37.120  29.075 31.777  1.00 9.08  ? 351 GLY A CA  1 
ATOM   2728 C  C   . GLY A 1 373 ? 36.220  29.432 32.949  1.00 8.92  ? 351 GLY A C   1 
ATOM   2729 O  O   . GLY A 1 373 ? 36.353  30.505 33.556  1.00 9.97  ? 351 GLY A O   1 
ATOM   2730 N  N   . LEU A 1 374 ? 35.293  28.536 33.265  1.00 7.62  ? 352 LEU A N   1 
ATOM   2731 C  CA  . LEU A 1 374 ? 34.415  28.721 34.421  1.00 7.54  ? 352 LEU A CA  1 
ATOM   2732 C  C   . LEU A 1 374 ? 35.142  28.476 35.737  1.00 10.14 ? 352 LEU A C   1 
ATOM   2733 O  O   . LEU A 1 374 ? 34.644  28.865 36.802  1.00 9.10  ? 352 LEU A O   1 
ATOM   2734 C  CB  . LEU A 1 374 ? 33.208  27.776 34.332  1.00 9.64  ? 352 LEU A CB  1 
ATOM   2735 C  CG  . LEU A 1 374 ? 32.197  28.017 33.208  1.00 9.22  ? 352 LEU A CG  1 
ATOM   2736 C  CD1 . LEU A 1 374 ? 31.207  26.848 33.158  1.00 10.79 ? 352 LEU A CD1 1 
ATOM   2737 C  CD2 . LEU A 1 374 ? 31.473  29.340 33.415  1.00 9.70  ? 352 LEU A CD2 1 
ATOM   2738 N  N   . GLY A 1 375 ? 36.307  27.830 35.667  1.00 8.64  ? 353 GLY A N   1 
ATOM   2739 C  CA  . GLY A 1 375 ? 37.088  27.515 36.858  1.00 8.39  ? 353 GLY A CA  1 
ATOM   2740 C  C   . GLY A 1 375 ? 36.610  26.268 37.578  1.00 12.69 ? 353 GLY A C   1 
ATOM   2741 O  O   . GLY A 1 375 ? 37.039  25.995 38.704  1.00 13.29 ? 353 GLY A O   1 
ATOM   2742 N  N   . ILE A 1 376 ? 35.734  25.517 36.911  1.00 12.35 ? 354 ILE A N   1 
ATOM   2743 C  CA  . ILE A 1 376 ? 35.081  24.320 37.445  1.00 13.57 ? 354 ILE A CA  1 
ATOM   2744 C  C   . ILE A 1 376 ? 35.498  23.094 36.650  1.00 14.85 ? 354 ILE A C   1 
ATOM   2745 O  O   . ILE A 1 376 ? 35.529  23.137 35.417  1.00 18.82 ? 354 ILE A O   1 
ATOM   2746 C  CB  . ILE A 1 376 ? 33.543  24.434 37.272  1.00 22.46 ? 354 ILE A CB  1 
ATOM   2747 C  CG1 . ILE A 1 376 ? 32.993  25.635 38.036  1.00 26.87 ? 354 ILE A CG1 1 
ATOM   2748 C  CG2 . ILE A 1 376 ? 32.831  23.145 37.689  1.00 23.12 ? 354 ILE A CG2 1 
ATOM   2749 C  CD1 . ILE A 1 376 ? 33.340  25.640 39.501  1.00 20.39 ? 354 ILE A CD1 1 
ATOM   2750 N  N   . THR A 1 377 ? 35.812  22.003 37.346  1.00 11.28 ? 355 THR A N   1 
ATOM   2751 C  CA  . THR A 1 377 ? 36.044  20.713 36.702  1.00 14.40 ? 355 THR A CA  1 
ATOM   2752 C  C   . THR A 1 377 ? 35.105  19.675 37.319  1.00 15.13 ? 355 THR A C   1 
ATOM   2753 O  O   . THR A 1 377 ? 35.346  19.200 38.429  1.00 15.63 ? 355 THR A O   1 
ATOM   2754 C  CB  . THR A 1 377 ? 37.494  20.260 36.873  1.00 24.18 ? 355 THR A CB  1 
ATOM   2755 O  OG1 . THR A 1 377 ? 38.370  21.247 36.308  1.00 28.48 ? 355 THR A OG1 1 
ATOM   2756 C  CG2 . THR A 1 377 ? 37.719  18.925 36.172  1.00 24.40 ? 355 THR A CG2 1 
ATOM   2757 N  N   . PRO A 1 378 ? 34.017  19.336 36.612  1.00 14.88 ? 356 PRO A N   1 
ATOM   2758 C  CA  . PRO A 1 378 ? 33.035  18.403 37.183  1.00 15.64 ? 356 PRO A CA  1 
ATOM   2759 C  C   . PRO A 1 378 ? 33.577  16.975 37.263  1.00 13.06 ? 356 PRO A C   1 
ATOM   2760 O  O   . PRO A 1 378 ? 34.374  16.569 36.410  1.00 16.52 ? 356 PRO A O   1 
ATOM   2761 C  CB  . PRO A 1 378 ? 31.865  18.457 36.184  1.00 19.11 ? 356 PRO A CB  1 
ATOM   2762 C  CG  . PRO A 1 378 ? 32.158  19.625 35.265  1.00 20.83 ? 356 PRO A CG  1 
ATOM   2763 C  CD  . PRO A 1 378 ? 33.640  19.779 35.257  1.00 17.04 ? 356 PRO A CD  1 
ATOM   2764 N  N   . ASP A 1 379 ? 33.168  16.233 38.289  1.00 16.51 ? 357 ASP A N   1 
ATOM   2765 C  CA  . ASP A 1 379 ? 33.449  14.804 38.352  1.00 18.40 ? 357 ASP A CA  1 
ATOM   2766 C  C   . ASP A 1 379 ? 32.351  14.089 37.577  1.00 18.54 ? 357 ASP A C   1 
ATOM   2767 O  O   . ASP A 1 379 ? 31.246  13.893 38.086  1.00 16.96 ? 357 ASP A O   1 
ATOM   2768 C  CB  . ASP A 1 379 ? 33.489  14.308 39.799  1.00 19.32 ? 357 ASP A CB  1 
ATOM   2769 C  CG  . ASP A 1 379 ? 33.898  12.848 39.904  1.00 24.58 ? 357 ASP A CG  1 
ATOM   2770 O  OD1 . ASP A 1 379 ? 34.000  12.168 38.858  1.00 22.27 ? 357 ASP A OD1 1 
ATOM   2771 O  OD2 . ASP A 1 379 ? 34.126  12.374 41.035  1.00 27.16 ? 357 ASP A OD2 1 
ATOM   2772 N  N   A GLU A 1 380 ? 32.675  13.701 36.348  0.53 19.95 ? 358 GLU A N   1 
ATOM   2773 N  N   B GLU A 1 380 ? 32.667  13.702 36.345  0.47 20.09 ? 358 GLU A N   1 
ATOM   2774 C  CA  A GLU A 1 380 ? 31.720  13.105 35.418  0.53 23.12 ? 358 GLU A CA  1 
ATOM   2775 C  CA  B GLU A 1 380 ? 31.685  13.121 35.433  0.47 22.80 ? 358 GLU A CA  1 
ATOM   2776 C  C   A GLU A 1 380 ? 31.090  11.822 35.956  0.53 24.80 ? 358 GLU A C   1 
ATOM   2777 C  C   B GLU A 1 380 ? 31.083  11.820 35.958  0.47 24.71 ? 358 GLU A C   1 
ATOM   2778 O  O   A GLU A 1 380 ? 29.949  11.495 35.626  0.53 24.19 ? 358 GLU A O   1 
ATOM   2779 O  O   B GLU A 1 380 ? 29.952  11.475 35.616  0.47 24.33 ? 358 GLU A O   1 
ATOM   2780 C  CB  A GLU A 1 380 ? 32.424  12.828 34.088  0.53 24.30 ? 358 GLU A CB  1 
ATOM   2781 C  CB  B GLU A 1 380 ? 32.323  12.899 34.060  0.47 24.26 ? 358 GLU A CB  1 
ATOM   2782 C  CG  A GLU A 1 380 ? 31.519  12.376 32.967  0.53 24.90 ? 358 GLU A CG  1 
ATOM   2783 C  CG  B GLU A 1 380 ? 33.024  14.134 33.525  0.47 24.40 ? 358 GLU A CG  1 
ATOM   2784 C  CD  A GLU A 1 380 ? 32.232  12.383 31.637  0.53 23.63 ? 358 GLU A CD  1 
ATOM   2785 C  CD  B GLU A 1 380 ? 33.846  13.863 32.279  0.47 24.97 ? 358 GLU A CD  1 
ATOM   2786 O  OE1 A GLU A 1 380 ? 31.855  11.585 30.754  0.53 23.18 ? 358 GLU A OE1 1 
ATOM   2787 O  OE1 B GLU A 1 380 ? 33.334  13.199 31.355  0.47 24.82 ? 358 GLU A OE1 1 
ATOM   2788 O  OE2 A GLU A 1 380 ? 33.172  13.193 31.478  0.53 24.63 ? 358 GLU A OE2 1 
ATOM   2789 O  OE2 B GLU A 1 380 ? 35.008  14.319 32.227  0.47 26.18 ? 358 GLU A OE2 1 
ATOM   2790 N  N   . SER A 1 381 ? 31.835  11.107 36.792  1.00 23.63 ? 359 SER A N   1 
ATOM   2791 C  CA  . SER A 1 381 ? 31.359  9.848  37.373  1.00 27.27 ? 359 SER A CA  1 
ATOM   2792 C  C   . SER A 1 381 ? 30.099  10.035 38.224  1.00 25.14 ? 359 SER A C   1 
ATOM   2793 O  O   . SER A 1 381 ? 29.319  9.098  38.411  1.00 29.73 ? 359 SER A O   1 
ATOM   2794 C  CB  . SER A 1 381 ? 32.463  9.162  38.190  1.00 25.93 ? 359 SER A CB  1 
ATOM   2795 O  OG  . SER A 1 381 ? 32.694  9.813  39.428  1.00 28.09 ? 359 SER A OG  1 
ATOM   2796 N  N   . LEU A 1 382 ? 29.898  11.246 38.733  1.00 20.48 ? 360 LEU A N   1 
ATOM   2797 C  CA  . LEU A 1 382 ? 28.701  11.560 39.503  1.00 19.68 ? 360 LEU A CA  1 
ATOM   2798 C  C   . LEU A 1 382 ? 27.439  11.524 38.642  1.00 24.16 ? 360 LEU A C   1 
ATOM   2799 O  O   . LEU A 1 382 ? 26.344  11.285 39.151  1.00 21.62 ? 360 LEU A O   1 
ATOM   2800 C  CB  . LEU A 1 382 ? 28.827  12.946 40.139  1.00 16.36 ? 360 LEU A CB  1 
ATOM   2801 C  CG  . LEU A 1 382 ? 29.899  13.101 41.218  1.00 22.41 ? 360 LEU A CG  1 
ATOM   2802 C  CD1 . LEU A 1 382 ? 29.934  14.538 41.727  1.00 22.06 ? 360 LEU A CD1 1 
ATOM   2803 C  CD2 . LEU A 1 382 ? 29.634  12.141 42.360  1.00 26.72 ? 360 LEU A CD2 1 
ATOM   2804 N  N   . PHE A 1 383 ? 27.597  11.778 37.345  1.00 25.03 ? 361 PHE A N   1 
ATOM   2805 C  CA  . PHE A 1 383 ? 26.455  11.973 36.455  1.00 23.17 ? 361 PHE A CA  1 
ATOM   2806 C  C   . PHE A 1 383 ? 25.976  10.670 35.828  1.00 29.08 ? 361 PHE A C   1 
ATOM   2807 O  O   . PHE A 1 383 ? 24.854  10.594 35.320  1.00 31.87 ? 361 PHE A O   1 
ATOM   2808 C  CB  . PHE A 1 383 ? 26.808  12.950 35.326  1.00 24.49 ? 361 PHE A CB  1 
ATOM   2809 C  CG  . PHE A 1 383 ? 27.265  14.302 35.797  1.00 23.36 ? 361 PHE A CG  1 
ATOM   2810 C  CD1 . PHE A 1 383 ? 26.816  14.831 36.999  1.00 24.37 ? 361 PHE A CD1 1 
ATOM   2811 C  CD2 . PHE A 1 383 ? 28.148  15.048 35.025  1.00 23.31 ? 361 PHE A CD2 1 
ATOM   2812 C  CE1 . PHE A 1 383 ? 27.239  16.078 37.426  1.00 20.15 ? 361 PHE A CE1 1 
ATOM   2813 C  CE2 . PHE A 1 383 ? 28.579  16.293 35.441  1.00 19.04 ? 361 PHE A CE2 1 
ATOM   2814 C  CZ  . PHE A 1 383 ? 28.124  16.814 36.642  1.00 19.64 ? 361 PHE A CZ  1 
ATOM   2815 N  N   . GLY A 1 384 ? 26.830  9.652  35.858  1.00 24.59 ? 362 GLY A N   1 
ATOM   2816 C  CA  . GLY A 1 384 ? 26.592  8.434  35.106  1.00 24.36 ? 362 GLY A CA  1 
ATOM   2817 C  C   . GLY A 1 384 ? 26.959  8.661  33.651  1.00 25.31 ? 362 GLY A C   1 
ATOM   2818 O  O   . GLY A 1 384 ? 27.389  9.757  33.284  1.00 24.72 ? 362 GLY A O   1 
ATOM   2819 N  N   . PRO A 1 385 ? 26.805  7.629  32.810  1.00 23.25 ? 363 PRO A N   1 
ATOM   2820 C  CA  . PRO A 1 385 ? 27.074  7.791  31.375  1.00 20.19 ? 363 PRO A CA  1 
ATOM   2821 C  C   . PRO A 1 385 ? 26.101  8.777  30.727  1.00 17.98 ? 363 PRO A C   1 
ATOM   2822 O  O   . PRO A 1 385 ? 25.007  8.994  31.254  1.00 16.96 ? 363 PRO A O   1 
ATOM   2823 C  CB  . PRO A 1 385 ? 26.879  6.374  30.813  1.00 23.81 ? 363 PRO A CB  1 
ATOM   2824 C  CG  . PRO A 1 385 ? 26.086  5.642  31.848  1.00 29.50 ? 363 PRO A CG  1 
ATOM   2825 C  CD  . PRO A 1 385 ? 26.481  6.238  33.164  1.00 26.31 ? 363 PRO A CD  1 
ATOM   2826 N  N   . PRO A 1 386 ? 26.506  9.401  29.611  1.00 17.97 ? 364 PRO A N   1 
ATOM   2827 C  CA  . PRO A 1 386 ? 25.593  10.334 28.945  1.00 16.50 ? 364 PRO A CA  1 
ATOM   2828 C  C   . PRO A 1 386 ? 24.293  9.631  28.567  1.00 18.50 ? 364 PRO A C   1 
ATOM   2829 O  O   . PRO A 1 386 ? 24.315  8.427  28.288  1.00 18.09 ? 364 PRO A O   1 
ATOM   2830 C  CB  . PRO A 1 386 ? 26.347  10.718 27.670  1.00 16.74 ? 364 PRO A CB  1 
ATOM   2831 C  CG  . PRO A 1 386 ? 27.776  10.421 27.947  1.00 20.81 ? 364 PRO A CG  1 
ATOM   2832 C  CD  . PRO A 1 386 ? 27.796  9.272  28.907  1.00 18.97 ? 364 PRO A CD  1 
ATOM   2833 N  N   . VAL A 1 387 ? 23.184  10.365 28.569  1.00 14.63 ? 365 VAL A N   1 
ATOM   2834 C  CA  . VAL A 1 387 ? 21.915  9.820  28.094  1.00 15.88 ? 365 VAL A CA  1 
ATOM   2835 C  C   . VAL A 1 387 ? 21.814  9.969  26.577  1.00 18.15 ? 365 VAL A C   1 
ATOM   2836 O  O   . VAL A 1 387 ? 21.015  9.290  25.932  1.00 17.31 ? 365 VAL A O   1 
ATOM   2837 C  CB  . VAL A 1 387 ? 20.688  10.465 28.786  1.00 15.24 ? 365 VAL A CB  1 
ATOM   2838 C  CG1 . VAL A 1 387 ? 20.699  10.166 30.276  1.00 20.32 ? 365 VAL A CG1 1 
ATOM   2839 C  CG2 . VAL A 1 387 ? 20.656  11.972 28.551  1.00 14.31 ? 365 VAL A CG2 1 
ATOM   2840 N  N   . ALA A 1 388 ? 22.643  10.848 26.013  1.00 14.46 ? 366 ALA A N   1 
ATOM   2841 C  CA  . ALA A 1 388 ? 22.730  11.023 24.560  1.00 14.19 ? 366 ALA A CA  1 
ATOM   2842 C  C   . ALA A 1 388 ? 24.103  11.554 24.168  1.00 14.68 ? 366 ALA A C   1 
ATOM   2843 O  O   . ALA A 1 388 ? 24.646  12.432 24.834  1.00 14.39 ? 366 ALA A O   1 
ATOM   2844 C  CB  . ALA A 1 388 ? 21.638  11.975 24.065  1.00 15.77 ? 366 ALA A CB  1 
ATOM   2845 N  N   . SER A 1 389 ? 24.664  11.006 23.093  1.00 13.38 ? 367 SER A N   1 
ATOM   2846 C  CA  . SER A 1 389 ? 25.968  11.425 22.598  1.00 14.61 ? 367 SER A CA  1 
ATOM   2847 C  C   . SER A 1 389 ? 25.898  11.677 21.107  1.00 13.80 ? 367 SER A C   1 
ATOM   2848 O  O   . SER A 1 389 ? 25.249  10.935 20.367  1.00 15.85 ? 367 SER A O   1 
ATOM   2849 C  CB  . SER A 1 389 ? 27.028  10.360 22.891  1.00 12.51 ? 367 SER A CB  1 
ATOM   2850 O  OG  . SER A 1 389 ? 27.264  10.255 24.281  1.00 15.34 ? 367 SER A OG  1 
ATOM   2851 N  N   . PHE A 1 390 ? 26.582  12.727 20.672  1.00 12.51 ? 368 PHE A N   1 
ATOM   2852 C  CA  . PHE A 1 390 ? 26.557  13.133 19.281  1.00 12.49 ? 368 PHE A CA  1 
ATOM   2853 C  C   . PHE A 1 390 ? 27.983  13.369 18.791  1.00 12.61 ? 368 PHE A C   1 
ATOM   2854 O  O   . PHE A 1 390 ? 28.806  13.978 19.485  1.00 14.82 ? 368 PHE A O   1 
ATOM   2855 C  CB  . PHE A 1 390 ? 25.709  14.398 19.135  1.00 13.83 ? 368 PHE A CB  1 
ATOM   2856 C  CG  . PHE A 1 390 ? 24.310  14.259 19.692  1.00 13.06 ? 368 PHE A CG  1 
ATOM   2857 C  CD1 . PHE A 1 390 ? 23.277  13.770 18.903  1.00 16.15 ? 368 PHE A CD1 1 
ATOM   2858 C  CD2 . PHE A 1 390 ? 24.034  14.609 21.011  1.00 14.43 ? 368 PHE A CD2 1 
ATOM   2859 C  CE1 . PHE A 1 390 ? 21.987  13.638 19.420  1.00 13.74 ? 368 PHE A CE1 1 
ATOM   2860 C  CE2 . PHE A 1 390 ? 22.746  14.479 21.528  1.00 14.47 ? 368 PHE A CE2 1 
ATOM   2861 C  CZ  . PHE A 1 390 ? 21.728  13.998 20.729  1.00 15.45 ? 368 PHE A CZ  1 
ATOM   2862 N  N   . SER A 1 391 ? 28.278  12.864 17.601  1.00 13.02 ? 369 SER A N   1 
ATOM   2863 C  CA  . SER A 1 391 ? 29.608  12.995 17.028  1.00 14.90 ? 369 SER A CA  1 
ATOM   2864 C  C   . SER A 1 391 ? 29.496  13.151 15.521  1.00 17.52 ? 369 SER A C   1 
ATOM   2865 O  O   . SER A 1 391 ? 30.498  13.113 14.811  1.00 18.37 ? 369 SER A O   1 
ATOM   2866 C  CB  . SER A 1 391 ? 30.468  11.779 17.376  1.00 21.52 ? 369 SER A CB  1 
ATOM   2867 O  OG  . SER A 1 391 ? 31.843  12.050 17.165  1.00 24.50 ? 369 SER A OG  1 
ATOM   2868 O  OXT . SER A 1 391 ? 28.394  13.318 14.988  1.00 18.74 ? 369 SER A OXT 1 
ATOM   2869 N  N   . MET B 1 23  ? 48.403  41.475 33.643  1.00 31.64 ? 1   MET B N   1 
ATOM   2870 C  CA  . MET B 1 23  ? 49.021  42.459 32.759  1.00 31.93 ? 1   MET B CA  1 
ATOM   2871 C  C   . MET B 1 23  ? 48.618  43.879 33.150  1.00 27.82 ? 1   MET B C   1 
ATOM   2872 O  O   . MET B 1 23  ? 47.527  44.100 33.678  1.00 24.89 ? 1   MET B O   1 
ATOM   2873 C  CB  . MET B 1 23  ? 48.643  42.188 31.301  1.00 32.94 ? 1   MET B CB  1 
ATOM   2874 C  CG  . MET B 1 23  ? 49.403  43.045 30.297  1.00 36.23 ? 1   MET B CG  1 
ATOM   2875 S  SD  . MET B 1 23  ? 48.761  42.900 28.623  1.00 48.67 ? 1   MET B SD  1 
ATOM   2876 C  CE  . MET B 1 23  ? 49.309  41.256 28.206  1.00 29.34 ? 1   MET B CE  1 
ATOM   2877 N  N   . LYS B 1 24  ? 49.507  44.838 32.895  1.00 23.76 ? 2   LYS B N   1 
ATOM   2878 C  CA  . LYS B 1 24  ? 49.258  46.230 33.257  1.00 22.33 ? 2   LYS B CA  1 
ATOM   2879 C  C   . LYS B 1 24  ? 49.724  47.199 32.171  1.00 17.33 ? 2   LYS B C   1 
ATOM   2880 O  O   . LYS B 1 24  ? 50.710  46.941 31.479  1.00 17.64 ? 2   LYS B O   1 
ATOM   2881 C  CB  . LYS B 1 24  ? 49.964  46.560 34.575  1.00 24.95 ? 2   LYS B CB  1 
ATOM   2882 C  CG  . LYS B 1 24  ? 49.523  45.710 35.760  1.00 29.66 ? 2   LYS B CG  1 
ATOM   2883 C  CD  . LYS B 1 24  ? 50.498  45.837 36.915  1.00 37.73 ? 2   LYS B CD  1 
ATOM   2884 C  CE  . LYS B 1 24  ? 50.669  47.287 37.340  1.00 45.08 ? 2   LYS B CE  1 
ATOM   2885 N  NZ  . LYS B 1 24  ? 51.877  47.466 38.193  1.00 48.70 ? 2   LYS B NZ  1 
ATOM   2886 N  N   . ILE B 1 25  ? 49.017  48.316 32.025  1.00 16.13 ? 3   ILE B N   1 
ATOM   2887 C  CA  . ILE B 1 25  ? 49.476  49.401 31.157  1.00 15.26 ? 3   ILE B CA  1 
ATOM   2888 C  C   . ILE B 1 25  ? 50.724  50.062 31.755  1.00 16.27 ? 3   ILE B C   1 
ATOM   2889 O  O   . ILE B 1 25  ? 50.707  50.506 32.909  1.00 16.79 ? 3   ILE B O   1 
ATOM   2890 C  CB  . ILE B 1 25  ? 48.371  50.471 30.957  1.00 14.52 ? 3   ILE B CB  1 
ATOM   2891 C  CG1 . ILE B 1 25  ? 47.153  49.880 30.239  1.00 13.34 ? 3   ILE B CG1 1 
ATOM   2892 C  CG2 . ILE B 1 25  ? 48.915  51.676 30.200  1.00 16.32 ? 3   ILE B CG2 1 
ATOM   2893 C  CD1 . ILE B 1 25  ? 45.989  50.867 30.074  1.00 13.61 ? 3   ILE B CD1 1 
ATOM   2894 N  N   . ALA B 1 26  ? 51.804  50.127 30.978  1.00 16.19 ? 4   ALA B N   1 
ATOM   2895 C  CA  . ALA B 1 26  ? 53.037  50.765 31.439  1.00 16.97 ? 4   ALA B CA  1 
ATOM   2896 C  C   . ALA B 1 26  ? 53.208  52.164 30.855  1.00 16.80 ? 4   ALA B C   1 
ATOM   2897 O  O   . ALA B 1 26  ? 53.723  53.071 31.521  1.00 16.54 ? 4   ALA B O   1 
ATOM   2898 C  CB  . ALA B 1 26  ? 54.239  49.904 31.094  1.00 18.05 ? 4   ALA B CB  1 
ATOM   2899 N  N   . GLU B 1 27  ? 52.795  52.335 29.602  1.00 16.87 ? 5   GLU B N   1 
ATOM   2900 C  CA  . GLU B 1 27  ? 52.953  53.619 28.914  1.00 15.80 ? 5   GLU B CA  1 
ATOM   2901 C  C   . GLU B 1 27  ? 51.749  53.915 28.036  1.00 13.48 ? 5   GLU B C   1 
ATOM   2902 O  O   . GLU B 1 27  ? 51.124  52.998 27.506  1.00 16.25 ? 5   GLU B O   1 
ATOM   2903 C  CB  . GLU B 1 27  ? 54.193  53.599 28.014  1.00 18.41 ? 5   GLU B CB  1 
ATOM   2904 C  CG  . GLU B 1 27  ? 55.464  53.118 28.687  1.00 19.16 ? 5   GLU B CG  1 
ATOM   2905 C  CD  . GLU B 1 27  ? 56.630  53.006 27.729  1.00 25.95 ? 5   GLU B CD  1 
ATOM   2906 O  OE1 . GLU B 1 27  ? 56.461  53.298 26.526  1.00 20.95 ? 5   GLU B OE1 1 
ATOM   2907 O  OE2 . GLU B 1 27  ? 57.724  52.616 28.187  1.00 27.17 ? 5   GLU B OE2 1 
ATOM   2908 N  N   . ILE B 1 28  ? 51.431  55.198 27.878  1.00 16.78 ? 6   ILE B N   1 
ATOM   2909 C  CA  . ILE B 1 28  ? 50.426  55.635 26.915  1.00 15.01 ? 6   ILE B CA  1 
ATOM   2910 C  C   . ILE B 1 28  ? 51.011  56.793 26.115  1.00 14.56 ? 6   ILE B C   1 
ATOM   2911 O  O   . ILE B 1 28  ? 51.530  57.760 26.692  1.00 16.34 ? 6   ILE B O   1 
ATOM   2912 C  CB  . ILE B 1 28  ? 49.102  56.074 27.593  1.00 14.15 ? 6   ILE B CB  1 
ATOM   2913 C  CG1 . ILE B 1 28  ? 48.415  54.877 28.258  1.00 14.22 ? 6   ILE B CG1 1 
ATOM   2914 C  CG2 . ILE B 1 28  ? 48.149  56.677 26.567  1.00 14.87 ? 6   ILE B CG2 1 
ATOM   2915 C  CD1 . ILE B 1 28  ? 47.173  55.254 29.069  1.00 12.92 ? 6   ILE B CD1 1 
ATOM   2916 N  N   . HIS B 1 29  ? 50.948  56.686 24.792  1.00 13.60 ? 7   HIS B N   1 
ATOM   2917 C  CA  . HIS B 1 29  ? 51.511  57.704 23.916  1.00 12.88 ? 7   HIS B CA  1 
ATOM   2918 C  C   . HIS B 1 29  ? 50.445  58.273 22.991  1.00 13.40 ? 7   HIS B C   1 
ATOM   2919 O  O   . HIS B 1 29  ? 49.711  57.515 22.351  1.00 13.38 ? 7   HIS B O   1 
ATOM   2920 C  CB  . HIS B 1 29  ? 52.668  57.125 23.101  1.00 15.08 ? 7   HIS B CB  1 
ATOM   2921 C  CG  . HIS B 1 29  ? 53.778  56.579 23.941  1.00 15.31 ? 7   HIS B CG  1 
ATOM   2922 N  ND1 . HIS B 1 29  ? 54.774  57.378 24.470  1.00 17.32 ? 7   HIS B ND1 1 
ATOM   2923 C  CD2 . HIS B 1 29  ? 54.054  55.319 24.346  1.00 15.30 ? 7   HIS B CD2 1 
ATOM   2924 C  CE1 . HIS B 1 29  ? 55.611  56.630 25.160  1.00 18.13 ? 7   HIS B CE1 1 
ATOM   2925 N  NE2 . HIS B 1 29  ? 55.197  55.375 25.106  1.00 16.60 ? 7   HIS B NE2 1 
ATOM   2926 N  N   . VAL B 1 30  ? 50.365  59.603 22.931  1.00 14.22 ? 8   VAL B N   1 
ATOM   2927 C  CA  . VAL B 1 30  ? 49.370  60.288 22.107  1.00 13.25 ? 8   VAL B CA  1 
ATOM   2928 C  C   . VAL B 1 30  ? 50.053  60.997 20.935  1.00 15.43 ? 8   VAL B C   1 
ATOM   2929 O  O   . VAL B 1 30  ? 51.037  61.714 21.128  1.00 16.50 ? 8   VAL B O   1 
ATOM   2930 C  CB  . VAL B 1 30  ? 48.583  61.308 22.939  1.00 12.84 ? 8   VAL B CB  1 
ATOM   2931 C  CG1 . VAL B 1 30  ? 47.543  62.005 22.074  1.00 13.69 ? 8   VAL B CG1 1 
ATOM   2932 C  CG2 . VAL B 1 30  ? 47.913  60.620 24.131  1.00 13.74 ? 8   VAL B CG2 1 
ATOM   2933 N  N   . TYR B 1 31  ? 49.524  60.802 19.728  1.00 12.32 ? 9   TYR B N   1 
ATOM   2934 C  CA  . TYR B 1 31  ? 50.147  61.323 18.511  1.00 13.12 ? 9   TYR B CA  1 
ATOM   2935 C  C   . TYR B 1 31  ? 49.187  62.212 17.729  1.00 16.53 ? 9   TYR B C   1 
ATOM   2936 O  O   . TYR B 1 31  ? 47.987  61.928 17.649  1.00 15.17 ? 9   TYR B O   1 
ATOM   2937 C  CB  . TYR B 1 31  ? 50.585  60.179 17.586  1.00 15.48 ? 9   TYR B CB  1 
ATOM   2938 C  CG  . TYR B 1 31  ? 51.539  59.161 18.183  1.00 15.10 ? 9   TYR B CG  1 
ATOM   2939 C  CD1 . TYR B 1 31  ? 51.068  58.136 19.003  1.00 16.33 ? 9   TYR B CD1 1 
ATOM   2940 C  CD2 . TYR B 1 31  ? 52.900  59.203 17.901  1.00 20.46 ? 9   TYR B CD2 1 
ATOM   2941 C  CE1 . TYR B 1 31  ? 51.930  57.194 19.537  1.00 16.58 ? 9   TYR B CE1 1 
ATOM   2942 C  CE2 . TYR B 1 31  ? 53.769  58.264 18.433  1.00 20.08 ? 9   TYR B CE2 1 
ATOM   2943 C  CZ  . TYR B 1 31  ? 53.272  57.267 19.253  1.00 19.35 ? 9   TYR B CZ  1 
ATOM   2944 O  OH  . TYR B 1 31  ? 54.124  56.326 19.785  1.00 22.53 ? 9   TYR B OH  1 
ATOM   2945 N  N   . ALA B 1 32  ? 49.726  63.282 17.150  1.00 19.15 ? 10  ALA B N   1 
ATOM   2946 C  CA  . ALA B 1 32  ? 49.004  64.099 16.179  1.00 19.32 ? 10  ALA B CA  1 
ATOM   2947 C  C   . ALA B 1 32  ? 49.525  63.799 14.770  1.00 24.81 ? 10  ALA B C   1 
ATOM   2948 O  O   . ALA B 1 32  ? 50.739  63.730 14.556  1.00 28.19 ? 10  ALA B O   1 
ATOM   2949 C  CB  . ALA B 1 32  ? 49.171  65.575 16.507  1.00 22.29 ? 10  ALA B CB  1 
ATOM   2950 N  N   . HIS B 1 33  ? 48.619  63.628 13.809  1.00 16.69 ? 11  HIS B N   1 
ATOM   2951 C  CA  . HIS B 1 33  ? 48.999  63.277 12.436  1.00 18.64 ? 11  HIS B CA  1 
ATOM   2952 C  C   . HIS B 1 33  ? 48.016  63.865 11.412  1.00 19.97 ? 11  HIS B C   1 
ATOM   2953 O  O   . HIS B 1 33  ? 46.812  63.838 11.629  1.00 20.14 ? 11  HIS B O   1 
ATOM   2954 C  CB  . HIS B 1 33  ? 49.068  61.746 12.313  1.00 18.42 ? 11  HIS B CB  1 
ATOM   2955 C  CG  . HIS B 1 33  ? 49.450  61.244 10.955  1.00 19.17 ? 11  HIS B CG  1 
ATOM   2956 N  ND1 . HIS B 1 33  ? 50.668  61.522 10.367  1.00 23.80 ? 11  HIS B ND1 1 
ATOM   2957 C  CD2 . HIS B 1 33  ? 48.792  60.438 10.087  1.00 18.05 ? 11  HIS B CD2 1 
ATOM   2958 C  CE1 . HIS B 1 33  ? 50.731  60.931 9.188   1.00 28.24 ? 11  HIS B CE1 1 
ATOM   2959 N  NE2 . HIS B 1 33  ? 49.606  60.262 8.995   1.00 23.95 ? 11  HIS B NE2 1 
ATOM   2960 N  N   . ASP B 1 34  ? 48.523  64.393 10.296  1.00 23.11 ? 12  ASP B N   1 
ATOM   2961 C  CA  . ASP B 1 34  ? 47.655  65.028 9.292   1.00 26.55 ? 12  ASP B CA  1 
ATOM   2962 C  C   . ASP B 1 34  ? 47.259  64.115 8.115   1.00 30.11 ? 12  ASP B C   1 
ATOM   2963 O  O   . ASP B 1 34  ? 48.061  63.298 7.665   1.00 32.85 ? 12  ASP B O   1 
ATOM   2964 C  CB  . ASP B 1 34  ? 48.321  66.297 8.746   1.00 31.69 ? 12  ASP B CB  1 
ATOM   2965 C  CG  . ASP B 1 34  ? 48.356  67.431 9.759   1.00 34.25 ? 12  ASP B CG  1 
ATOM   2966 O  OD1 . ASP B 1 34  ? 47.303  67.743 10.356  1.00 31.75 ? 12  ASP B OD1 1 
ATOM   2967 O  OD2 . ASP B 1 34  ? 49.443  68.013 9.953   1.00 36.23 ? 12  ASP B OD2 1 
ATOM   2968 N  N   . LEU B 1 35  ? 46.036  64.293 7.601   1.00 27.14 ? 13  LEU B N   1 
ATOM   2969 C  CA  . LEU B 1 35  ? 45.517  63.512 6.464   1.00 20.84 ? 13  LEU B CA  1 
ATOM   2970 C  C   . LEU B 1 35  ? 44.752  64.391 5.460   1.00 24.05 ? 13  LEU B C   1 
ATOM   2971 O  O   . LEU B 1 35  ? 43.540  64.565 5.589   1.00 33.12 ? 13  LEU B O   1 
ATOM   2972 C  CB  . LEU B 1 35  ? 44.534  62.437 6.971   1.00 25.06 ? 13  LEU B CB  1 
ATOM   2973 C  CG  . LEU B 1 35  ? 44.895  61.329 7.971   1.00 21.22 ? 13  LEU B CG  1 
ATOM   2974 C  CD1 . LEU B 1 35  ? 43.613  60.674 8.516   1.00 20.20 ? 13  LEU B CD1 1 
ATOM   2975 C  CD2 . LEU B 1 35  ? 45.770  60.270 7.330   1.00 20.81 ? 13  LEU B CD2 1 
ATOM   2976 N  N   . PRO B 1 36  ? 45.440  64.947 4.451   1.00 25.88 ? 14  PRO B N   1 
ATOM   2977 C  CA  . PRO B 1 36  ? 44.721  65.803 3.489   1.00 25.72 ? 14  PRO B CA  1 
ATOM   2978 C  C   . PRO B 1 36  ? 43.805  65.033 2.518   1.00 30.42 ? 14  PRO B C   1 
ATOM   2979 O  O   . PRO B 1 36  ? 44.139  63.919 2.106   1.00 29.90 ? 14  PRO B O   1 
ATOM   2980 C  CB  . PRO B 1 36  ? 45.848  66.551 2.759   1.00 28.15 ? 14  PRO B CB  1 
ATOM   2981 C  CG  . PRO B 1 36  ? 47.060  65.717 2.955   1.00 27.70 ? 14  PRO B CG  1 
ATOM   2982 C  CD  . PRO B 1 36  ? 46.898  64.972 4.252   1.00 25.11 ? 14  PRO B CD  1 
ATOM   2983 N  N   . VAL B 1 37  ? 42.658  65.621 2.172   1.00 30.27 ? 15  VAL B N   1 
ATOM   2984 C  CA  . VAL B 1 37  ? 41.671  64.937 1.325   1.00 34.18 ? 15  VAL B CA  1 
ATOM   2985 C  C   . VAL B 1 37  ? 42.007  64.969 -0.166  1.00 36.83 ? 15  VAL B C   1 
ATOM   2986 O  O   . VAL B 1 37  ? 42.061  66.034 -0.787  1.00 38.65 ? 15  VAL B O   1 
ATOM   2987 C  CB  . VAL B 1 37  ? 40.205  65.435 1.561   1.00 33.60 ? 15  VAL B CB  1 
ATOM   2988 C  CG1 . VAL B 1 37  ? 40.074  66.916 1.320   1.00 40.31 ? 15  VAL B CG1 1 
ATOM   2989 C  CG2 . VAL B 1 37  ? 39.243  64.688 0.659   1.00 31.70 ? 15  VAL B CG2 1 
ATOM   2990 N  N   . LYS B 1 38  ? 42.238  63.790 -0.737  1.00 32.67 ? 16  LYS B N   1 
ATOM   2991 C  CA  . LYS B 1 38  ? 42.503  63.687 -2.169  1.00 34.99 ? 16  LYS B CA  1 
ATOM   2992 C  C   . LYS B 1 38  ? 41.289  64.182 -2.942  1.00 41.76 ? 16  LYS B C   1 
ATOM   2993 O  O   . LYS B 1 38  ? 40.159  63.783 -2.648  1.00 44.80 ? 16  LYS B O   1 
ATOM   2994 C  CB  . LYS B 1 38  ? 42.820  62.244 -2.563  1.00 37.01 ? 16  LYS B CB  1 
ATOM   2995 C  CG  . LYS B 1 38  ? 44.015  61.637 -1.843  1.00 37.74 ? 16  LYS B CG  1 
ATOM   2996 C  CD  . LYS B 1 38  ? 44.572  60.445 -2.612  1.00 42.94 ? 16  LYS B CD  1 
ATOM   2997 C  CE  . LYS B 1 38  ? 43.466  59.477 -3.000  1.00 45.30 ? 16  LYS B CE  1 
ATOM   2998 N  NZ  . LYS B 1 38  ? 43.971  58.181 -3.539  1.00 47.31 ? 16  LYS B NZ  1 
ATOM   2999 N  N   . ASP B 1 39  ? 41.528  65.063 -3.912  1.00 45.15 ? 17  ASP B N   1 
ATOM   3000 C  CA  . ASP B 1 39  ? 40.459  65.647 -4.720  1.00 47.24 ? 17  ASP B CA  1 
ATOM   3001 C  C   . ASP B 1 39  ? 39.406  66.346 -3.860  1.00 45.07 ? 17  ASP B C   1 
ATOM   3002 O  O   . ASP B 1 39  ? 38.208  66.298 -4.151  1.00 45.26 ? 17  ASP B O   1 
ATOM   3003 C  CB  . ASP B 1 39  ? 39.820  64.582 -5.612  1.00 52.77 ? 17  ASP B CB  1 
ATOM   3004 C  CG  . ASP B 1 39  ? 40.814  63.962 -6.575  1.00 61.22 ? 17  ASP B CG  1 
ATOM   3005 O  OD1 . ASP B 1 39  ? 41.434  64.715 -7.357  1.00 64.56 ? 17  ASP B OD1 1 
ATOM   3006 O  OD2 . ASP B 1 39  ? 40.987  62.724 -6.540  1.00 63.32 ? 17  ASP B OD2 1 
ATOM   3007 N  N   . GLY B 1 40  ? 39.868  66.996 -2.797  1.00 42.78 ? 18  GLY B N   1 
ATOM   3008 C  CA  . GLY B 1 40  ? 38.985  67.714 -1.900  1.00 39.85 ? 18  GLY B CA  1 
ATOM   3009 C  C   . GLY B 1 40  ? 38.444  68.990 -2.514  1.00 40.51 ? 18  GLY B C   1 
ATOM   3010 O  O   . GLY B 1 40  ? 38.858  69.378 -3.607  1.00 39.75 ? 18  GLY B O   1 
ATOM   3011 N  N   . PRO B 1 41  ? 37.524  69.660 -1.801  1.00 43.53 ? 19  PRO B N   1 
ATOM   3012 C  CA  . PRO B 1 41  ? 37.105  69.237 -0.461  1.00 39.45 ? 19  PRO B CA  1 
ATOM   3013 C  C   . PRO B 1 41  ? 35.955  68.226 -0.474  1.00 39.83 ? 19  PRO B C   1 
ATOM   3014 O  O   . PRO B 1 41  ? 35.382  67.938 -1.529  1.00 39.19 ? 19  PRO B O   1 
ATOM   3015 C  CB  . PRO B 1 41  ? 36.634  70.545 0.167   1.00 41.27 ? 19  PRO B CB  1 
ATOM   3016 C  CG  . PRO B 1 41  ? 36.052  71.296 -0.983  1.00 44.95 ? 19  PRO B CG  1 
ATOM   3017 C  CD  . PRO B 1 41  ? 36.883  70.928 -2.199  1.00 45.76 ? 19  PRO B CD  1 
ATOM   3018 N  N   . TYR B 1 42  ? 35.645  67.688 0.703   1.00 36.47 ? 20  TYR B N   1 
ATOM   3019 C  CA  . TYR B 1 42  ? 34.490  66.819 0.889   1.00 37.50 ? 20  TYR B CA  1 
ATOM   3020 C  C   . TYR B 1 42  ? 33.413  67.622 1.611   1.00 38.06 ? 20  TYR B C   1 
ATOM   3021 O  O   . TYR B 1 42  ? 33.636  68.130 2.715   1.00 32.57 ? 20  TYR B O   1 
ATOM   3022 C  CB  . TYR B 1 42  ? 34.882  65.576 1.694   1.00 39.75 ? 20  TYR B CB  1 
ATOM   3023 C  CG  . TYR B 1 42  ? 33.789  64.535 1.819   1.00 41.10 ? 20  TYR B CG  1 
ATOM   3024 C  CD1 . TYR B 1 42  ? 33.474  63.698 0.754   1.00 40.84 ? 20  TYR B CD1 1 
ATOM   3025 C  CD2 . TYR B 1 42  ? 33.083  64.381 3.007   1.00 39.31 ? 20  TYR B CD2 1 
ATOM   3026 C  CE1 . TYR B 1 42  ? 32.481  62.744 0.864   1.00 40.02 ? 20  TYR B CE1 1 
ATOM   3027 C  CE2 . TYR B 1 42  ? 32.088  63.429 3.129   1.00 38.64 ? 20  TYR B CE2 1 
ATOM   3028 C  CZ  . TYR B 1 42  ? 31.796  62.612 2.052   1.00 39.08 ? 20  TYR B CZ  1 
ATOM   3029 O  OH  . TYR B 1 42  ? 30.807  61.665 2.166   1.00 41.89 ? 20  TYR B OH  1 
ATOM   3030 N  N   . THR B 1 43  ? 32.251  67.752 0.977   1.00 39.49 ? 21  THR B N   1 
ATOM   3031 C  CA  . THR B 1 43  ? 31.220  68.655 1.481   1.00 41.00 ? 21  THR B CA  1 
ATOM   3032 C  C   . THR B 1 43  ? 30.028  67.949 2.120   1.00 40.26 ? 21  THR B C   1 
ATOM   3033 O  O   . THR B 1 43  ? 29.248  67.267 1.449   1.00 41.63 ? 21  THR B O   1 
ATOM   3034 C  CB  . THR B 1 43  ? 30.725  69.622 0.384   1.00 45.68 ? 21  THR B CB  1 
ATOM   3035 O  OG1 . THR B 1 43  ? 31.831  70.388 -0.112  1.00 48.80 ? 21  THR B OG1 1 
ATOM   3036 C  CG2 . THR B 1 43  ? 29.670  70.568 0.943   1.00 42.43 ? 21  THR B CG2 1 
ATOM   3037 N  N   . ILE B 1 44  ? 29.913  68.134 3.430   1.00 33.74 ? 22  ILE B N   1 
ATOM   3038 C  CA  . ILE B 1 44  ? 28.774  67.687 4.212   1.00 35.05 ? 22  ILE B CA  1 
ATOM   3039 C  C   . ILE B 1 44  ? 28.017  68.961 4.570   1.00 37.97 ? 22  ILE B C   1 
ATOM   3040 O  O   . ILE B 1 44  ? 28.633  70.014 4.747   1.00 33.93 ? 22  ILE B O   1 
ATOM   3041 C  CB  . ILE B 1 44  ? 29.256  66.969 5.484   1.00 35.02 ? 22  ILE B CB  1 
ATOM   3042 C  CG1 . ILE B 1 44  ? 30.477  66.102 5.157   1.00 32.87 ? 22  ILE B CG1 1 
ATOM   3043 C  CG2 . ILE B 1 44  ? 28.154  66.137 6.096   1.00 32.28 ? 22  ILE B CG2 1 
ATOM   3044 C  CD1 . ILE B 1 44  ? 30.944  65.217 6.296   1.00 28.87 ? 22  ILE B CD1 1 
ATOM   3045 N  N   . ALA B 1 45  ? 26.691  68.889 4.655   1.00 38.74 ? 23  ALA B N   1 
ATOM   3046 C  CA  . ALA B 1 45  ? 25.891  70.091 4.895   1.00 39.12 ? 23  ALA B CA  1 
ATOM   3047 C  C   . ALA B 1 45  ? 26.283  70.772 6.206   1.00 36.25 ? 23  ALA B C   1 
ATOM   3048 O  O   . ALA B 1 45  ? 26.120  71.984 6.365   1.00 37.82 ? 23  ALA B O   1 
ATOM   3049 C  CB  . ALA B 1 45  ? 24.399  69.762 4.873   1.00 39.19 ? 23  ALA B CB  1 
ATOM   3050 N  N   . SER B 1 46  ? 26.827  69.984 7.128   1.00 33.53 ? 24  SER B N   1 
ATOM   3051 C  CA  . SER B 1 46  ? 27.266  70.490 8.421   1.00 32.28 ? 24  SER B CA  1 
ATOM   3052 C  C   . SER B 1 46  ? 28.787  70.677 8.521   1.00 30.59 ? 24  SER B C   1 
ATOM   3053 O  O   . SER B 1 46  ? 29.278  71.220 9.516   1.00 30.03 ? 24  SER B O   1 
ATOM   3054 C  CB  . SER B 1 46  ? 26.784  69.558 9.536   1.00 32.00 ? 24  SER B CB  1 
ATOM   3055 O  OG  . SER B 1 46  ? 27.345  68.261 9.393   1.00 29.94 ? 24  SER B OG  1 
ATOM   3056 N  N   . SER B 1 47  ? 29.534  70.226 7.513   1.00 30.33 ? 25  SER B N   1 
ATOM   3057 C  CA  . SER B 1 47  ? 30.998  70.332 7.566   1.00 27.06 ? 25  SER B CA  1 
ATOM   3058 C  C   . SER B 1 47  ? 31.680  70.189 6.205   1.00 29.62 ? 25  SER B C   1 
ATOM   3059 O  O   . SER B 1 47  ? 31.542  69.159 5.552   1.00 28.37 ? 25  SER B O   1 
ATOM   3060 C  CB  . SER B 1 47  ? 31.571  69.281 8.520   1.00 29.20 ? 25  SER B CB  1 
ATOM   3061 O  OG  . SER B 1 47  ? 32.954  69.497 8.747   1.00 32.70 ? 25  SER B OG  1 
ATOM   3062 N  N   . THR B 1 48  ? 32.431  71.216 5.800   1.00 34.24 ? 26  THR B N   1 
ATOM   3063 C  CA  . THR B 1 48  ? 33.271  71.153 4.602   1.00 37.68 ? 26  THR B CA  1 
ATOM   3064 C  C   . THR B 1 48  ? 34.745  71.107 5.014   1.00 35.82 ? 26  THR B C   1 
ATOM   3065 O  O   . THR B 1 48  ? 35.213  71.968 5.764   1.00 30.44 ? 26  THR B O   1 
ATOM   3066 C  CB  . THR B 1 48  ? 33.047  72.367 3.671   1.00 43.31 ? 26  THR B CB  1 
ATOM   3067 O  OG1 . THR B 1 48  ? 31.701  72.363 3.173   1.00 45.60 ? 26  THR B OG1 1 
ATOM   3068 C  CG2 . THR B 1 48  ? 34.005  72.318 2.491   1.00 43.81 ? 26  THR B CG2 1 
ATOM   3069 N  N   . VAL B 1 49  ? 35.472  70.103 4.527   1.00 37.17 ? 27  VAL B N   1 
ATOM   3070 C  CA  . VAL B 1 49  ? 36.852  69.876 4.960   1.00 35.49 ? 27  VAL B CA  1 
ATOM   3071 C  C   . VAL B 1 49  ? 37.847  69.724 3.798   1.00 39.41 ? 27  VAL B C   1 
ATOM   3072 O  O   . VAL B 1 49  ? 37.558  69.044 2.814   1.00 41.28 ? 27  VAL B O   1 
ATOM   3073 C  CB  . VAL B 1 49  ? 36.949  68.624 5.839   1.00 34.40 ? 27  VAL B CB  1 
ATOM   3074 C  CG1 . VAL B 1 49  ? 38.386  68.358 6.192   1.00 35.12 ? 27  VAL B CG1 1 
ATOM   3075 C  CG2 . VAL B 1 49  ? 36.102  68.779 7.113   1.00 25.37 ? 27  VAL B CG2 1 
ATOM   3076 N  N   . TRP B 1 50  ? 39.018  70.350 3.929   1.00 35.31 ? 28  TRP B N   1 
ATOM   3077 C  CA  . TRP B 1 50  ? 40.112  70.178 2.972   1.00 36.99 ? 28  TRP B CA  1 
ATOM   3078 C  C   . TRP B 1 50  ? 41.248  69.297 3.520   1.00 36.34 ? 28  TRP B C   1 
ATOM   3079 O  O   . TRP B 1 50  ? 42.039  68.747 2.749   1.00 39.47 ? 28  TRP B O   1 
ATOM   3080 C  CB  . TRP B 1 50  ? 40.657  71.535 2.511   1.00 36.05 ? 28  TRP B CB  1 
ATOM   3081 C  CG  . TRP B 1 50  ? 39.670  72.359 1.729   1.00 45.20 ? 28  TRP B CG  1 
ATOM   3082 C  CD1 . TRP B 1 50  ? 39.538  72.415 0.369   1.00 50.60 ? 28  TRP B CD1 1 
ATOM   3083 C  CD2 . TRP B 1 50  ? 38.682  73.251 2.264   1.00 49.15 ? 28  TRP B CD2 1 
ATOM   3084 N  NE1 . TRP B 1 50  ? 38.529  73.287 0.026   1.00 53.83 ? 28  TRP B NE1 1 
ATOM   3085 C  CE2 . TRP B 1 50  ? 37.986  73.811 1.171   1.00 54.17 ? 28  TRP B CE2 1 
ATOM   3086 C  CE3 . TRP B 1 50  ? 38.318  73.628 3.561   1.00 49.32 ? 28  TRP B CE3 1 
ATOM   3087 C  CZ2 . TRP B 1 50  ? 36.947  74.729 1.338   1.00 55.89 ? 28  TRP B CZ2 1 
ATOM   3088 C  CZ3 . TRP B 1 50  ? 37.285  74.541 3.724   1.00 51.91 ? 28  TRP B CZ3 1 
ATOM   3089 C  CH2 . TRP B 1 50  ? 36.612  75.079 2.618   1.00 54.16 ? 28  TRP B CH2 1 
ATOM   3090 N  N   . SER B 1 51  ? 41.336  69.170 4.842   1.00 34.59 ? 29  SER B N   1 
ATOM   3091 C  CA  . SER B 1 51  ? 42.282  68.232 5.464   1.00 33.89 ? 29  SER B CA  1 
ATOM   3092 C  C   . SER B 1 51  ? 41.871  67.849 6.886   1.00 31.63 ? 29  SER B C   1 
ATOM   3093 O  O   . SER B 1 51  ? 41.210  68.627 7.575   1.00 30.79 ? 29  SER B O   1 
ATOM   3094 C  CB  . SER B 1 51  ? 43.707  68.792 5.466   1.00 38.33 ? 29  SER B CB  1 
ATOM   3095 O  OG  . SER B 1 51  ? 44.586  67.926 6.168   1.00 40.33 ? 29  SER B OG  1 
ATOM   3096 N  N   . LEU B 1 52  ? 42.279  66.656 7.321   1.00 28.73 ? 30  LEU B N   1 
ATOM   3097 C  CA  . LEU B 1 52  ? 41.872  66.123 8.626   1.00 25.93 ? 30  LEU B CA  1 
ATOM   3098 C  C   . LEU B 1 52  ? 43.047  65.873 9.582   1.00 24.96 ? 30  LEU B C   1 
ATOM   3099 O  O   . LEU B 1 52  ? 44.105  65.398 9.176   1.00 24.37 ? 30  LEU B O   1 
ATOM   3100 C  CB  . LEU B 1 52  ? 41.071  64.827 8.454   1.00 22.01 ? 30  LEU B CB  1 
ATOM   3101 C  CG  . LEU B 1 52  ? 39.661  64.851 7.845   1.00 21.75 ? 30  LEU B CG  1 
ATOM   3102 C  CD1 . LEU B 1 52  ? 38.762  65.830 8.580   1.00 21.61 ? 30  LEU B CD1 1 
ATOM   3103 C  CD2 . LEU B 1 52  ? 39.684  65.139 6.346   1.00 25.81 ? 30  LEU B CD2 1 
ATOM   3104 N  N   . GLN B 1 53  ? 42.845  66.181 10.860  1.00 16.91 ? 31  GLN B N   1 
ATOM   3105 C  CA  . GLN B 1 53  ? 43.853  65.921 11.886  1.00 16.10 ? 31  GLN B CA  1 
ATOM   3106 C  C   . GLN B 1 53  ? 43.437  64.734 12.739  1.00 14.66 ? 31  GLN B C   1 
ATOM   3107 O  O   . GLN B 1 53  ? 42.506  64.829 13.546  1.00 13.81 ? 31  GLN B O   1 
ATOM   3108 C  CB  . GLN B 1 53  ? 44.014  67.135 12.796  1.00 17.43 ? 31  GLN B CB  1 
ATOM   3109 C  CG  . GLN B 1 53  ? 44.217  68.448 12.073  1.00 25.07 ? 31  GLN B CG  1 
ATOM   3110 C  CD  . GLN B 1 53  ? 43.964  69.636 12.987  1.00 36.96 ? 31  GLN B CD  1 
ATOM   3111 O  OE1 . GLN B 1 53  ? 44.818  70.001 13.797  1.00 42.32 ? 31  GLN B OE1 1 
ATOM   3112 N  NE2 . GLN B 1 53  ? 42.779  70.232 12.873  1.00 38.33 ? 31  GLN B NE2 1 
ATOM   3113 N  N   . THR B 1 54  ? 44.127  63.614 12.558  1.00 14.51 ? 32  THR B N   1 
ATOM   3114 C  CA  . THR B 1 54  ? 43.800  62.422 13.324  1.00 13.36 ? 32  THR B CA  1 
ATOM   3115 C  C   . THR B 1 54  ? 44.639  62.349 14.597  1.00 12.70 ? 32  THR B C   1 
ATOM   3116 O  O   . THR B 1 54  ? 45.694  62.991 14.706  1.00 13.22 ? 32  THR B O   1 
ATOM   3117 C  CB  . THR B 1 54  ? 43.973  61.141 12.485  1.00 13.62 ? 32  THR B CB  1 
ATOM   3118 O  OG1 . THR B 1 54  ? 43.387  60.035 13.181  1.00 12.64 ? 32  THR B OG1 1 
ATOM   3119 C  CG2 . THR B 1 54  ? 45.450  60.868 12.227  1.00 14.20 ? 32  THR B CG2 1 
ATOM   3120 N  N   . THR B 1 55  ? 44.155  61.583 15.567  1.00 11.70 ? 33  THR B N   1 
ATOM   3121 C  CA  . THR B 1 55  ? 44.869  61.385 16.822  1.00 11.50 ? 33  THR B CA  1 
ATOM   3122 C  C   . THR B 1 55  ? 45.036  59.887 17.047  1.00 10.82 ? 33  THR B C   1 
ATOM   3123 O  O   . THR B 1 55  ? 44.056  59.135 17.023  1.00 10.39 ? 33  THR B O   1 
ATOM   3124 C  CB  . THR B 1 55  ? 44.094  62.000 17.997  1.00 10.51 ? 33  THR B CB  1 
ATOM   3125 O  OG1 . THR B 1 55  ? 44.009  63.420 17.811  1.00 10.98 ? 33  THR B OG1 1 
ATOM   3126 C  CG2 . THR B 1 55  ? 44.799  61.712 19.322  1.00 13.68 ? 33  THR B CG2 1 
ATOM   3127 N  N   . LEU B 1 56  ? 46.284  59.455 17.221  1.00 11.89 ? 34  LEU B N   1 
ATOM   3128 C  CA  . LEU B 1 56  ? 46.586  58.044 17.450  1.00 11.33 ? 34  LEU B CA  1 
ATOM   3129 C  C   . LEU B 1 56  ? 46.987  57.845 18.904  1.00 14.22 ? 34  LEU B C   1 
ATOM   3130 O  O   . LEU B 1 56  ? 47.564  58.736 19.529  1.00 13.32 ? 34  LEU B O   1 
ATOM   3131 C  CB  . LEU B 1 56  ? 47.725  57.554 16.551  1.00 11.82 ? 34  LEU B CB  1 
ATOM   3132 C  CG  . LEU B 1 56  ? 47.648  57.714 15.031  1.00 16.09 ? 34  LEU B CG  1 
ATOM   3133 C  CD1 . LEU B 1 56  ? 46.273  57.347 14.489  1.00 17.61 ? 34  LEU B CD1 1 
ATOM   3134 C  CD2 . LEU B 1 56  ? 48.054  59.112 14.589  1.00 20.20 ? 34  LEU B CD2 1 
ATOM   3135 N  N   . VAL B 1 57  ? 46.660  56.676 19.443  1.00 11.70 ? 35  VAL B N   1 
ATOM   3136 C  CA  . VAL B 1 57  ? 47.045  56.320 20.799  1.00 12.57 ? 35  VAL B CA  1 
ATOM   3137 C  C   . VAL B 1 57  ? 47.763  54.979 20.768  1.00 12.24 ? 35  VAL B C   1 
ATOM   3138 O  O   . VAL B 1 57  ? 47.276  54.023 20.168  1.00 10.59 ? 35  VAL B O   1 
ATOM   3139 C  CB  . VAL B 1 57  ? 45.814  56.200 21.717  1.00 17.04 ? 35  VAL B CB  1 
ATOM   3140 C  CG1 . VAL B 1 57  ? 46.209  55.644 23.075  1.00 22.93 ? 35  VAL B CG1 1 
ATOM   3141 C  CG2 . VAL B 1 57  ? 45.149  57.542 21.883  1.00 16.74 ? 35  VAL B CG2 1 
ATOM   3142 N  N   . LYS B 1 58  ? 48.926  54.916 21.407  1.00 13.20 ? 36  LYS B N   1 
ATOM   3143 C  CA  . LYS B 1 58  ? 49.631  53.656 21.582  1.00 13.84 ? 36  LYS B CA  1 
ATOM   3144 C  C   . LYS B 1 58  ? 49.653  53.308 23.066  1.00 13.53 ? 36  LYS B C   1 
ATOM   3145 O  O   . LYS B 1 58  ? 50.151  54.085 23.878  1.00 14.24 ? 36  LYS B O   1 
ATOM   3146 C  CB  . LYS B 1 58  ? 51.058  53.786 21.048  1.00 14.72 ? 36  LYS B CB  1 
ATOM   3147 C  CG  . LYS B 1 58  ? 51.884  52.508 21.079  1.00 15.23 ? 36  LYS B CG  1 
ATOM   3148 C  CD  . LYS B 1 58  ? 53.356  52.839 20.795  1.00 18.07 ? 36  LYS B CD  1 
ATOM   3149 C  CE  . LYS B 1 58  ? 54.183  51.577 20.604  1.00 25.37 ? 36  LYS B CE  1 
ATOM   3150 N  NZ  . LYS B 1 58  ? 55.602  51.896 20.245  1.00 24.60 ? 36  LYS B NZ  1 
ATOM   3151 N  N   . ILE B 1 59  ? 49.093  52.158 23.427  1.00 13.02 ? 37  ILE B N   1 
ATOM   3152 C  CA  . ILE B 1 59  ? 49.196  51.661 24.798  1.00 14.65 ? 37  ILE B CA  1 
ATOM   3153 C  C   . ILE B 1 59  ? 50.264  50.569 24.851  1.00 12.93 ? 37  ILE B C   1 
ATOM   3154 O  O   . ILE B 1 59  ? 50.224  49.621 24.072  1.00 13.16 ? 37  ILE B O   1 
ATOM   3155 C  CB  . ILE B 1 59  ? 47.853  51.079 25.293  1.00 14.17 ? 37  ILE B CB  1 
ATOM   3156 C  CG1 . ILE B 1 59  ? 46.754  52.145 25.290  1.00 13.13 ? 37  ILE B CG1 1 
ATOM   3157 C  CG2 . ILE B 1 59  ? 48.009  50.482 26.686  1.00 23.29 ? 37  ILE B CG2 1 
ATOM   3158 C  CD1 . ILE B 1 59  ? 45.386  51.593 25.674  1.00 19.31 ? 37  ILE B CD1 1 
ATOM   3159 N  N   . VAL B 1 60  ? 51.234  50.714 25.751  1.00 14.58 ? 38  VAL B N   1 
ATOM   3160 C  CA  . VAL B 1 60  ? 52.280  49.704 25.913  1.00 15.44 ? 38  VAL B CA  1 
ATOM   3161 C  C   . VAL B 1 60  ? 52.137  48.988 27.250  1.00 17.02 ? 38  VAL B C   1 
ATOM   3162 O  O   . VAL B 1 60  ? 52.091  49.630 28.303  1.00 16.64 ? 38  VAL B O   1 
ATOM   3163 C  CB  . VAL B 1 60  ? 53.684  50.328 25.838  1.00 16.32 ? 38  VAL B CB  1 
ATOM   3164 C  CG1 . VAL B 1 60  ? 54.755  49.243 25.823  1.00 18.52 ? 38  VAL B CG1 1 
ATOM   3165 C  CG2 . VAL B 1 60  ? 53.805  51.221 24.614  1.00 18.48 ? 38  VAL B CG2 1 
ATOM   3166 N  N   . ALA B 1 61  ? 52.075  47.660 27.201  1.00 16.13 ? 39  ALA B N   1 
ATOM   3167 C  CA  . ALA B 1 61  ? 51.979  46.848 28.409  1.00 16.86 ? 39  ALA B CA  1 
ATOM   3168 C  C   . ALA B 1 61  ? 53.341  46.718 29.068  1.00 18.13 ? 39  ALA B C   1 
ATOM   3169 O  O   . ALA B 1 61  ? 54.370  47.017 28.453  1.00 21.45 ? 39  ALA B O   1 
ATOM   3170 C  CB  . ALA B 1 61  ? 51.433  45.465 28.080  1.00 18.46 ? 39  ALA B CB  1 
ATOM   3171 N  N   . ASP B 1 62  ? 53.340  46.249 30.314  1.00 21.39 ? 40  ASP B N   1 
ATOM   3172 C  CA  . ASP B 1 62  ? 54.581  45.935 31.021  1.00 24.01 ? 40  ASP B CA  1 
ATOM   3173 C  C   . ASP B 1 62  ? 55.431  44.957 30.217  1.00 25.13 ? 40  ASP B C   1 
ATOM   3174 O  O   . ASP B 1 62  ? 56.657  45.031 30.232  1.00 27.19 ? 40  ASP B O   1 
ATOM   3175 C  CB  . ASP B 1 62  ? 54.288  45.299 32.383  1.00 32.42 ? 40  ASP B CB  1 
ATOM   3176 C  CG  . ASP B 1 62  ? 53.814  46.297 33.411  1.00 43.45 ? 40  ASP B CG  1 
ATOM   3177 O  OD1 . ASP B 1 62  ? 54.142  47.496 33.286  1.00 48.00 ? 40  ASP B OD1 1 
ATOM   3178 O  OD2 . ASP B 1 62  ? 53.118  45.871 34.360  1.00 48.93 ? 40  ASP B OD2 1 
ATOM   3179 N  N   . SER B 1 63  ? 54.767  44.039 29.522  1.00 23.35 ? 41  SER B N   1 
ATOM   3180 C  CA  . SER B 1 63  ? 55.449  43.007 28.745  1.00 26.31 ? 41  SER B CA  1 
ATOM   3181 C  C   . SER B 1 63  ? 56.165  43.588 27.531  1.00 27.37 ? 41  SER B C   1 
ATOM   3182 O  O   . SER B 1 63  ? 57.039  42.942 26.949  1.00 28.38 ? 41  SER B O   1 
ATOM   3183 C  CB  . SER B 1 63  ? 54.451  41.950 28.284  1.00 26.28 ? 41  SER B CB  1 
ATOM   3184 O  OG  . SER B 1 63  ? 53.544  42.491 27.341  1.00 25.92 ? 41  SER B OG  1 
ATOM   3185 N  N   . GLY B 1 64  ? 55.792  44.806 27.152  1.00 21.42 ? 42  GLY B N   1 
ATOM   3186 C  CA  . GLY B 1 64  ? 56.339  45.443 25.966  1.00 21.30 ? 42  GLY B CA  1 
ATOM   3187 C  C   . GLY B 1 64  ? 55.389  45.389 24.776  1.00 22.08 ? 42  GLY B C   1 
ATOM   3188 O  O   . GLY B 1 64  ? 55.588  46.091 23.782  1.00 21.29 ? 42  GLY B O   1 
ATOM   3189 N  N   . LEU B 1 65  ? 54.357  44.556 24.877  1.00 21.94 ? 43  LEU B N   1 
ATOM   3190 C  CA  . LEU B 1 65  ? 53.360  44.428 23.815  1.00 19.91 ? 43  LEU B CA  1 
ATOM   3191 C  C   . LEU B 1 65  ? 52.571  45.731 23.672  1.00 19.40 ? 43  LEU B C   1 
ATOM   3192 O  O   . LEU B 1 65  ? 52.247  46.372 24.668  1.00 18.36 ? 43  LEU B O   1 
ATOM   3193 C  CB  . LEU B 1 65  ? 52.414  43.268 24.128  1.00 17.97 ? 43  LEU B CB  1 
ATOM   3194 C  CG  . LEU B 1 65  ? 51.493  42.750 23.024  1.00 19.85 ? 43  LEU B CG  1 
ATOM   3195 C  CD1 . LEU B 1 65  ? 52.298  42.158 21.879  1.00 23.28 ? 43  LEU B CD1 1 
ATOM   3196 C  CD2 . LEU B 1 65  ? 50.539  41.715 23.593  1.00 24.45 ? 43  LEU B CD2 1 
ATOM   3197 N  N   . ALA B 1 66  ? 52.256  46.120 22.437  1.00 16.49 ? 44  ALA B N   1 
ATOM   3198 C  CA  . ALA B 1 66  ? 51.564  47.390 22.198  1.00 14.72 ? 44  ALA B CA  1 
ATOM   3199 C  C   . ALA B 1 66  ? 50.253  47.220 21.451  1.00 14.04 ? 44  ALA B C   1 
ATOM   3200 O  O   . ALA B 1 66  ? 50.087  46.289 20.662  1.00 16.38 ? 44  ALA B O   1 
ATOM   3201 C  CB  . ALA B 1 66  ? 52.460  48.348 21.446  1.00 17.20 ? 44  ALA B CB  1 
ATOM   3202 N  N   . GLY B 1 67  ? 49.320  48.132 21.711  1.00 13.15 ? 45  GLY B N   1 
ATOM   3203 C  CA  . GLY B 1 67  ? 48.065  48.156 20.979  1.00 14.59 ? 45  GLY B CA  1 
ATOM   3204 C  C   . GLY B 1 67  ? 47.802  49.566 20.483  1.00 13.25 ? 45  GLY B C   1 
ATOM   3205 O  O   . GLY B 1 67  ? 48.235  50.531 21.111  1.00 11.92 ? 45  GLY B O   1 
ATOM   3206 N  N   . TRP B 1 68  ? 47.095  49.689 19.362  1.00 12.63 ? 46  TRP B N   1 
ATOM   3207 C  CA  . TRP B 1 68  ? 46.851  51.001 18.756  1.00 11.32 ? 46  TRP B CA  1 
ATOM   3208 C  C   . TRP B 1 68  ? 45.379  51.374 18.669  1.00 10.70 ? 46  TRP B C   1 
ATOM   3209 O  O   . TRP B 1 68  ? 44.533  50.520 18.387  1.00 10.72 ? 46  TRP B O   1 
ATOM   3210 C  CB  . TRP B 1 68  ? 47.446  51.044 17.346  1.00 13.48 ? 46  TRP B CB  1 
ATOM   3211 C  CG  . TRP B 1 68  ? 48.944  51.135 17.329  1.00 12.56 ? 46  TRP B CG  1 
ATOM   3212 C  CD1 . TRP B 1 68  ? 49.828  50.096 17.270  1.00 13.81 ? 46  TRP B CD1 1 
ATOM   3213 C  CD2 . TRP B 1 68  ? 49.728  52.333 17.359  1.00 13.64 ? 46  TRP B CD2 1 
ATOM   3214 N  NE1 . TRP B 1 68  ? 51.122  50.579 17.267  1.00 15.78 ? 46  TRP B NE1 1 
ATOM   3215 C  CE2 . TRP B 1 68  ? 51.084  51.944 17.325  1.00 15.34 ? 46  TRP B CE2 1 
ATOM   3216 C  CE3 . TRP B 1 68  ? 49.415  53.694 17.422  1.00 14.04 ? 46  TRP B CE3 1 
ATOM   3217 C  CZ2 . TRP B 1 68  ? 52.124  52.875 17.346  1.00 16.94 ? 46  TRP B CZ2 1 
ATOM   3218 C  CZ3 . TRP B 1 68  ? 50.455  54.615 17.439  1.00 16.35 ? 46  TRP B CZ3 1 
ATOM   3219 C  CH2 . TRP B 1 68  ? 51.790  54.197 17.399  1.00 16.38 ? 46  TRP B CH2 1 
ATOM   3220 N  N   . GLY B 1 69  ? 45.090  52.657 18.910  1.00 10.25 ? 47  GLY B N   1 
ATOM   3221 C  CA  . GLY B 1 69  ? 43.758  53.219 18.708  1.00 9.78  ? 47  GLY B CA  1 
ATOM   3222 C  C   . GLY B 1 69  ? 43.829  54.523 17.917  1.00 10.07 ? 47  GLY B C   1 
ATOM   3223 O  O   . GLY B 1 69  ? 44.911  55.079 17.722  1.00 11.80 ? 47  GLY B O   1 
ATOM   3224 N  N   . GLU B 1 70  ? 42.677  55.013 17.459  1.00 9.68  ? 48  GLU B N   1 
ATOM   3225 C  CA  . GLU B 1 70  ? 42.633  56.203 16.607  1.00 9.98  ? 48  GLU B CA  1 
ATOM   3226 C  C   . GLU B 1 70  ? 41.283  56.904 16.733  1.00 9.62  ? 48  GLU B C   1 
ATOM   3227 O  O   . GLU B 1 70  ? 40.258  56.249 16.867  1.00 9.37  ? 48  GLU B O   1 
ATOM   3228 C  CB  . GLU B 1 70  ? 42.877  55.798 15.142  1.00 10.76 ? 48  GLU B CB  1 
ATOM   3229 C  CG  . GLU B 1 70  ? 42.779  56.966 14.151  1.00 11.35 ? 48  GLU B CG  1 
ATOM   3230 C  CD  . GLU B 1 70  ? 43.290  56.625 12.767  1.00 12.35 ? 48  GLU B CD  1 
ATOM   3231 O  OE1 . GLU B 1 70  ? 43.374  55.425 12.413  1.00 12.54 ? 48  GLU B OE1 1 
ATOM   3232 O  OE2 . GLU B 1 70  ? 43.611  57.568 12.009  1.00 13.35 ? 48  GLU B OE2 1 
ATOM   3233 N  N   . THR B 1 71  ? 41.290  58.234 16.684  1.00 9.73  ? 49  THR B N   1 
ATOM   3234 C  CA  . THR B 1 71  ? 40.044  58.997 16.604  1.00 9.61  ? 49  THR B CA  1 
ATOM   3235 C  C   . THR B 1 71  ? 40.268  60.250 15.754  1.00 10.32 ? 49  THR B C   1 
ATOM   3236 O  O   . THR B 1 71  ? 41.258  60.959 15.936  1.00 10.56 ? 49  THR B O   1 
ATOM   3237 C  CB  . THR B 1 71  ? 39.477  59.323 18.004  1.00 8.89  ? 49  THR B CB  1 
ATOM   3238 O  OG1 . THR B 1 71  ? 38.198  59.962 17.877  1.00 9.79  ? 49  THR B OG1 1 
ATOM   3239 C  CG2 . THR B 1 71  ? 40.430  60.221 18.801  1.00 11.46 ? 49  THR B CG2 1 
ATOM   3240 N  N   . CYS B 1 72  ? 39.372  60.490 14.797  1.00 10.82 ? 50  CYS B N   1 
ATOM   3241 C  CA  . CYS B 1 72  ? 39.557  61.570 13.824  1.00 11.80 ? 50  CYS B CA  1 
ATOM   3242 C  C   . CYS B 1 72  ? 38.232  62.237 13.447  1.00 12.13 ? 50  CYS B C   1 
ATOM   3243 O  O   . CYS B 1 72  ? 37.547  61.790 12.530  1.00 12.65 ? 50  CYS B O   1 
ATOM   3244 C  CB  . CYS B 1 72  ? 40.223  61.019 12.554  1.00 12.70 ? 50  CYS B CB  1 
ATOM   3245 S  SG  . CYS B 1 72  ? 40.704  62.285 11.332  1.00 14.20 ? 50  CYS B SG  1 
ATOM   3246 N  N   . PRO B 1 73  ? 37.864  63.317 14.154  1.00 11.93 ? 51  PRO B N   1 
ATOM   3247 C  CA  . PRO B 1 73  ? 36.644  64.057 13.802  1.00 12.39 ? 51  PRO B CA  1 
ATOM   3248 C  C   . PRO B 1 73  ? 36.719  64.593 12.379  1.00 14.45 ? 51  PRO B C   1 
ATOM   3249 O  O   . PRO B 1 73  ? 37.821  64.904 11.903  1.00 15.05 ? 51  PRO B O   1 
ATOM   3250 C  CB  . PRO B 1 73  ? 36.625  65.203 14.824  1.00 12.09 ? 51  PRO B CB  1 
ATOM   3251 C  CG  . PRO B 1 73  ? 37.338  64.621 16.022  1.00 11.06 ? 51  PRO B CG  1 
ATOM   3252 C  CD  . PRO B 1 73  ? 38.449  63.780 15.424  1.00 12.01 ? 51  PRO B CD  1 
ATOM   3253 N  N   . VAL B 1 74  ? 35.577  64.676 11.695  1.00 14.44 ? 52  VAL B N   1 
ATOM   3254 C  CA  . VAL B 1 74  ? 35.569  65.104 10.303  1.00 16.80 ? 52  VAL B CA  1 
ATOM   3255 C  C   . VAL B 1 74  ? 35.335  66.620 10.242  1.00 19.42 ? 52  VAL B C   1 
ATOM   3256 O  O   . VAL B 1 74  ? 34.280  67.116 9.838   1.00 21.23 ? 52  VAL B O   1 
ATOM   3257 C  CB  . VAL B 1 74  ? 34.585  64.256 9.422   1.00 17.86 ? 52  VAL B CB  1 
ATOM   3258 C  CG1 . VAL B 1 74  ? 33.140  64.376 9.894   1.00 16.19 ? 52  VAL B CG1 1 
ATOM   3259 C  CG2 . VAL B 1 74  ? 34.726  64.611 7.949   1.00 19.43 ? 52  VAL B CG2 1 
ATOM   3260 N  N   . GLY B 1 75  ? 36.353  67.353 10.668  1.00 17.14 ? 53  GLY B N   1 
ATOM   3261 C  CA  . GLY B 1 75  ? 36.207  68.779 10.872  1.00 18.45 ? 53  GLY B CA  1 
ATOM   3262 C  C   . GLY B 1 75  ? 35.629  69.015 12.253  1.00 22.08 ? 53  GLY B C   1 
ATOM   3263 O  O   . GLY B 1 75  ? 35.087  68.103 12.874  1.00 23.10 ? 53  GLY B O   1 
ATOM   3264 N  N   . PRO B 1 76  ? 35.748  70.247 12.749  1.00 16.68 ? 54  PRO B N   1 
ATOM   3265 C  CA  . PRO B 1 76  ? 35.283  70.536 14.110  1.00 15.62 ? 54  PRO B CA  1 
ATOM   3266 C  C   . PRO B 1 76  ? 33.787  70.855 14.215  1.00 15.76 ? 54  PRO B C   1 
ATOM   3267 O  O   . PRO B 1 76  ? 33.307  71.064 15.333  1.00 14.96 ? 54  PRO B O   1 
ATOM   3268 C  CB  . PRO B 1 76  ? 36.108  71.766 14.499  1.00 16.20 ? 54  PRO B CB  1 
ATOM   3269 C  CG  . PRO B 1 76  ? 36.381  72.459 13.190  1.00 17.95 ? 54  PRO B CG  1 
ATOM   3270 C  CD  . PRO B 1 76  ? 36.551  71.345 12.178  1.00 18.08 ? 54  PRO B CD  1 
ATOM   3271 N  N   . THR B 1 77  ? 33.061  70.896 13.098  1.00 16.86 ? 55  THR B N   1 
ATOM   3272 C  CA  . THR B 1 77  ? 31.650  71.296 13.153  1.00 17.23 ? 55  THR B CA  1 
ATOM   3273 C  C   . THR B 1 77  ? 30.652  70.158 12.930  1.00 16.78 ? 55  THR B C   1 
ATOM   3274 O  O   . THR B 1 77  ? 29.447  70.366 13.066  1.00 17.00 ? 55  THR B O   1 
ATOM   3275 C  CB  . THR B 1 77  ? 31.307  72.433 12.164  1.00 20.97 ? 55  THR B CB  1 
ATOM   3276 O  OG1 . THR B 1 77  ? 31.704  72.060 10.836  1.00 20.24 ? 55  THR B OG1 1 
ATOM   3277 C  CG2 . THR B 1 77  ? 31.985  73.742 12.563  1.00 20.43 ? 55  THR B CG2 1 
ATOM   3278 N  N   . TYR B 1 78  ? 31.132  68.976 12.565  1.00 16.28 ? 56  TYR B N   1 
ATOM   3279 C  CA  . TYR B 1 78  ? 30.223  67.856 12.277  1.00 16.03 ? 56  TYR B CA  1 
ATOM   3280 C  C   . TYR B 1 78  ? 29.556  67.313 13.547  1.00 15.71 ? 56  TYR B C   1 
ATOM   3281 O  O   . TYR B 1 78  ? 28.356  67.009 13.552  1.00 16.28 ? 56  TYR B O   1 
ATOM   3282 C  CB  . TYR B 1 78  ? 30.980  66.721 11.583  1.00 15.95 ? 56  TYR B CB  1 
ATOM   3283 C  CG  . TYR B 1 78  ? 30.139  65.487 11.291  1.00 15.75 ? 56  TYR B CG  1 
ATOM   3284 C  CD1 . TYR B 1 78  ? 29.414  65.383 10.109  1.00 19.30 ? 56  TYR B CD1 1 
ATOM   3285 C  CD2 . TYR B 1 78  ? 30.088  64.421 12.190  1.00 21.80 ? 56  TYR B CD2 1 
ATOM   3286 C  CE1 . TYR B 1 78  ? 28.646  64.255 9.831   1.00 21.58 ? 56  TYR B CE1 1 
ATOM   3287 C  CE2 . TYR B 1 78  ? 29.319  63.287 11.921  1.00 21.09 ? 56  TYR B CE2 1 
ATOM   3288 C  CZ  . TYR B 1 78  ? 28.606  63.212 10.742  1.00 22.18 ? 56  TYR B CZ  1 
ATOM   3289 O  OH  . TYR B 1 78  ? 27.846  62.090 10.463  1.00 19.22 ? 56  TYR B OH  1 
ATOM   3290 N  N   . ALA B 1 79  ? 30.350  67.198 14.609  1.00 13.55 ? 57  ALA B N   1 
ATOM   3291 C  CA  . ALA B 1 79  ? 29.909  66.612 15.872  1.00 13.94 ? 57  ALA B CA  1 
ATOM   3292 C  C   . ALA B 1 79  ? 30.627  67.350 16.991  1.00 14.62 ? 57  ALA B C   1 
ATOM   3293 O  O   . ALA B 1 79  ? 31.584  68.074 16.725  1.00 12.20 ? 57  ALA B O   1 
ATOM   3294 C  CB  . ALA B 1 79  ? 30.262  65.146 15.895  1.00 13.13 ? 57  ALA B CB  1 
ATOM   3295 N  N   . PRO B 1 80  ? 30.166  67.190 18.243  1.00 13.78 ? 58  PRO B N   1 
ATOM   3296 C  CA  . PRO B 1 80  ? 30.812  67.890 19.363  1.00 12.97 ? 58  PRO B CA  1 
ATOM   3297 C  C   . PRO B 1 80  ? 32.140  67.242 19.733  1.00 12.13 ? 58  PRO B C   1 
ATOM   3298 O  O   . PRO B 1 80  ? 32.301  66.659 20.811  1.00 12.22 ? 58  PRO B O   1 
ATOM   3299 C  CB  . PRO B 1 80  ? 29.808  67.720 20.499  1.00 13.19 ? 58  PRO B CB  1 
ATOM   3300 C  CG  . PRO B 1 80  ? 29.089  66.443 20.170  1.00 17.90 ? 58  PRO B CG  1 
ATOM   3301 C  CD  . PRO B 1 80  ? 28.947  66.475 18.672  1.00 16.04 ? 58  PRO B CD  1 
ATOM   3302 N  N   . SER B 1 81  ? 33.103  67.374 18.832  1.00 10.40 ? 59  SER B N   1 
ATOM   3303 C  CA  . SER B 1 81  ? 34.373  66.688 18.935  1.00 10.01 ? 59  SER B CA  1 
ATOM   3304 C  C   . SER B 1 81  ? 35.334  67.371 17.975  1.00 10.89 ? 59  SER B C   1 
ATOM   3305 O  O   . SER B 1 81  ? 34.925  67.861 16.918  1.00 12.69 ? 59  SER B O   1 
ATOM   3306 C  CB  . SER B 1 81  ? 34.197  65.223 18.546  1.00 15.71 ? 59  SER B CB  1 
ATOM   3307 O  OG  . SER B 1 81  ? 33.681  65.093 17.231  1.00 19.78 ? 59  SER B OG  1 
ATOM   3308 N  N   . HIS B 1 82  ? 36.603  67.438 18.359  1.00 10.77 ? 60  HIS B N   1 
ATOM   3309 C  CA  . HIS B 1 82  ? 37.621  68.047 17.510  1.00 11.69 ? 60  HIS B CA  1 
ATOM   3310 C  C   . HIS B 1 82  ? 38.998  67.522 17.871  1.00 11.39 ? 60  HIS B C   1 
ATOM   3311 O  O   . HIS B 1 82  ? 39.173  66.943 18.932  1.00 10.56 ? 60  HIS B O   1 
ATOM   3312 C  CB  . HIS B 1 82  ? 37.542  69.587 17.532  1.00 12.53 ? 60  HIS B CB  1 
ATOM   3313 C  CG  . HIS B 1 82  ? 37.934  70.238 18.830  1.00 14.02 ? 60  HIS B CG  1 
ATOM   3314 N  ND1 . HIS B 1 82  ? 37.312  69.977 20.037  1.00 18.63 ? 60  HIS B ND1 1 
ATOM   3315 C  CD2 . HIS B 1 82  ? 38.850  71.203 19.086  1.00 12.77 ? 60  HIS B CD2 1 
ATOM   3316 C  CE1 . HIS B 1 82  ? 37.848  70.734 20.980  1.00 11.31 ? 60  HIS B CE1 1 
ATOM   3317 N  NE2 . HIS B 1 82  ? 38.783  71.488 20.429  1.00 15.27 ? 60  HIS B NE2 1 
ATOM   3318 N  N   . ALA B 1 83  ? 39.964  67.681 16.975  1.00 12.20 ? 61  ALA B N   1 
ATOM   3319 C  CA  . ALA B 1 83  ? 41.279  67.075 17.182  1.00 12.05 ? 61  ALA B CA  1 
ATOM   3320 C  C   . ALA B 1 83  ? 41.973  67.567 18.455  1.00 11.96 ? 61  ALA B C   1 
ATOM   3321 O  O   . ALA B 1 83  ? 42.513  66.765 19.214  1.00 11.12 ? 61  ALA B O   1 
ATOM   3322 C  CB  . ALA B 1 83  ? 42.172  67.291 15.967  1.00 14.08 ? 61  ALA B CB  1 
ATOM   3323 N  N   . LEU B 1 84  ? 41.951  68.875 18.692  1.00 12.30 ? 62  LEU B N   1 
ATOM   3324 C  CA  . LEU B 1 84  ? 42.577  69.426 19.892  1.00 12.48 ? 62  LEU B CA  1 
ATOM   3325 C  C   . LEU B 1 84  ? 41.856  68.903 21.135  1.00 11.71 ? 62  LEU B C   1 
ATOM   3326 O  O   . LEU B 1 84  ? 42.484  68.638 22.170  1.00 10.95 ? 62  LEU B O   1 
ATOM   3327 C  CB  . LEU B 1 84  ? 42.569  70.956 19.862  1.00 13.11 ? 62  LEU B CB  1 
ATOM   3328 C  CG  . LEU B 1 84  ? 43.477  71.591 18.808  1.00 14.40 ? 62  LEU B CG  1 
ATOM   3329 C  CD1 . LEU B 1 84  ? 43.316  73.111 18.776  1.00 15.47 ? 62  LEU B CD1 1 
ATOM   3330 C  CD2 . LEU B 1 84  ? 44.935  71.212 19.060  1.00 21.93 ? 62  LEU B CD2 1 
ATOM   3331 N  N   . GLY B 1 85  ? 40.544  68.739 21.022  1.00 10.73 ? 63  GLY B N   1 
ATOM   3332 C  CA  . GLY B 1 85  ? 39.765  68.196 22.116  1.00 9.86  ? 63  GLY B CA  1 
ATOM   3333 C  C   . GLY B 1 85  ? 40.070  66.737 22.404  1.00 12.46 ? 63  GLY B C   1 
ATOM   3334 O  O   . GLY B 1 85  ? 40.086  66.320 23.562  1.00 10.27 ? 63  GLY B O   1 
ATOM   3335 N  N   . ALA B 1 86  ? 40.277  65.946 21.355  1.00 9.31  ? 64  ALA B N   1 
ATOM   3336 C  CA  . ALA B 1 86  ? 40.625  64.545 21.540  1.00 8.85  ? 64  ALA B CA  1 
ATOM   3337 C  C   . ALA B 1 86  ? 41.930  64.449 22.325  1.00 8.93  ? 64  ALA B C   1 
ATOM   3338 O  O   . ALA B 1 86  ? 42.059  63.643 23.245  1.00 9.71  ? 64  ALA B O   1 
ATOM   3339 C  CB  . ALA B 1 86  ? 40.773  63.854 20.190  1.00 12.52 ? 64  ALA B CB  1 
ATOM   3340 N  N   . ARG B 1 87  ? 42.898  65.275 21.959  1.00 9.70  ? 65  ARG B N   1 
ATOM   3341 C  CA  . ARG B 1 87  ? 44.183  65.239 22.638  1.00 10.88 ? 65  ARG B CA  1 
ATOM   3342 C  C   . ARG B 1 87  ? 44.119  65.742 24.078  1.00 10.20 ? 65  ARG B C   1 
ATOM   3343 O  O   . ARG B 1 87  ? 44.792  65.188 24.947  1.00 12.67 ? 65  ARG B O   1 
ATOM   3344 C  CB  . ARG B 1 87  ? 45.249  65.952 21.814  1.00 12.76 ? 65  ARG B CB  1 
ATOM   3345 C  CG  . ARG B 1 87  ? 45.377  65.275 20.455  1.00 14.82 ? 65  ARG B CG  1 
ATOM   3346 C  CD  . ARG B 1 87  ? 46.683  65.549 19.797  1.00 27.92 ? 65  ARG B CD  1 
ATOM   3347 N  NE  . ARG B 1 87  ? 46.640  66.748 18.973  1.00 32.54 ? 65  ARG B NE  1 
ATOM   3348 C  CZ  . ARG B 1 87  ? 46.199  66.778 17.719  1.00 31.53 ? 65  ARG B CZ  1 
ATOM   3349 N  NH1 . ARG B 1 87  ? 46.221  67.914 17.034  1.00 23.97 ? 65  ARG B NH1 1 
ATOM   3350 N  NH2 . ARG B 1 87  ? 45.735  65.677 17.149  1.00 23.34 ? 65  ARG B NH2 1 
ATOM   3351 N  N   . ALA B 1 88  ? 43.309  66.773 24.324  1.00 9.70  ? 66  ALA B N   1 
ATOM   3352 C  CA  . ALA B 1 88  ? 43.063  67.251 25.686  1.00 9.59  ? 66  ALA B CA  1 
ATOM   3353 C  C   . ALA B 1 88  ? 42.420  66.172 26.556  1.00 10.92 ? 66  ALA B C   1 
ATOM   3354 O  O   . ALA B 1 88  ? 42.811  65.986 27.711  1.00 10.15 ? 66  ALA B O   1 
ATOM   3355 C  CB  . ALA B 1 88  ? 42.184  68.497 25.664  1.00 10.31 ? 66  ALA B CB  1 
ATOM   3356 N  N   . ALA B 1 89  ? 41.423  65.484 26.007  1.00 8.46  ? 67  ALA B N   1 
ATOM   3357 C  CA  . ALA B 1 89  ? 40.731  64.425 26.738  1.00 7.98  ? 67  ALA B CA  1 
ATOM   3358 C  C   . ALA B 1 89  ? 41.665  63.268 27.057  1.00 9.10  ? 67  ALA B C   1 
ATOM   3359 O  O   . ALA B 1 89  ? 41.626  62.711 28.161  1.00 9.22  ? 67  ALA B O   1 
ATOM   3360 C  CB  . ALA B 1 89  ? 39.527  63.931 25.942  1.00 8.30  ? 67  ALA B CB  1 
ATOM   3361 N  N   . LEU B 1 90  ? 42.501  62.899 26.091  1.00 9.78  ? 68  LEU B N   1 
ATOM   3362 C  CA  . LEU B 1 90  ? 43.443  61.802 26.318  1.00 9.47  ? 68  LEU B CA  1 
ATOM   3363 C  C   . LEU B 1 90  ? 44.477  62.193 27.364  1.00 11.34 ? 68  LEU B C   1 
ATOM   3364 O  O   . LEU B 1 90  ? 44.837  61.381 28.210  1.00 11.60 ? 68  LEU B O   1 
ATOM   3365 C  CB  . LEU B 1 90  ? 44.108  61.343 25.014  1.00 9.71  ? 68  LEU B CB  1 
ATOM   3366 C  CG  . LEU B 1 90  ? 43.119  60.642 24.086  1.00 9.99  ? 68  LEU B CG  1 
ATOM   3367 C  CD1 . LEU B 1 90  ? 43.671  60.588 22.669  1.00 11.44 ? 68  LEU B CD1 1 
ATOM   3368 C  CD2 . LEU B 1 90  ? 42.794  59.247 24.586  1.00 9.50  ? 68  LEU B CD2 1 
ATOM   3369 N  N   . ALA B 1 91  ? 44.945  63.437 27.316  1.00 9.44  ? 69  ALA B N   1 
ATOM   3370 C  CA  . ALA B 1 91  ? 45.918  63.918 28.299  1.00 11.92 ? 69  ALA B CA  1 
ATOM   3371 C  C   . ALA B 1 91  ? 45.320  63.918 29.702  1.00 12.17 ? 69  ALA B C   1 
ATOM   3372 O  O   . ALA B 1 91  ? 46.019  63.662 30.689  1.00 14.69 ? 69  ALA B O   1 
ATOM   3373 C  CB  . ALA B 1 91  ? 46.411  65.309 27.928  1.00 15.00 ? 69  ALA B CB  1 
ATOM   3374 N  N   . GLU B 1 92  ? 44.032  64.233 29.790  1.00 10.21 ? 70  GLU B N   1 
ATOM   3375 C  CA  . GLU B 1 92  ? 43.331  64.252 31.070  1.00 9.83  ? 70  GLU B CA  1 
ATOM   3376 C  C   . GLU B 1 92  ? 43.250  62.854 31.673  1.00 11.73 ? 70  GLU B C   1 
ATOM   3377 O  O   . GLU B 1 92  ? 43.442  62.670 32.875  1.00 13.94 ? 70  GLU B O   1 
ATOM   3378 C  CB  . GLU B 1 92  ? 41.923  64.810 30.884  1.00 14.03 ? 70  GLU B CB  1 
ATOM   3379 C  CG  . GLU B 1 92  ? 41.079  64.837 32.155  1.00 16.08 ? 70  GLU B CG  1 
ATOM   3380 C  CD  . GLU B 1 92  ? 41.438  65.986 33.056  1.00 25.17 ? 70  GLU B CD  1 
ATOM   3381 O  OE1 . GLU B 1 92  ? 41.510  67.127 32.546  1.00 27.78 ? 70  GLU B OE1 1 
ATOM   3382 O  OE2 . GLU B 1 92  ? 41.651  65.754 34.269  1.00 22.65 ? 70  GLU B OE2 1 
ATOM   3383 N  N   . MET B 1 93  ? 42.948  61.868 30.836  1.00 8.91  ? 71  MET B N   1 
ATOM   3384 C  CA  . MET B 1 93  ? 42.716  60.505 31.328  1.00 8.99  ? 71  MET B CA  1 
ATOM   3385 C  C   . MET B 1 93  ? 43.973  59.662 31.506  1.00 13.86 ? 71  MET B C   1 
ATOM   3386 O  O   . MET B 1 93  ? 44.038  58.817 32.403  1.00 11.30 ? 71  MET B O   1 
ATOM   3387 C  CB  . MET B 1 93  ? 41.765  59.761 30.389  1.00 8.42  ? 71  MET B CB  1 
ATOM   3388 C  CG  . MET B 1 93  ? 40.348  60.321 30.325  1.00 7.96  ? 71  MET B CG  1 
ATOM   3389 S  SD  . MET B 1 93  ? 39.255  59.310 29.315  1.00 8.87  ? 71  MET B SD  1 
ATOM   3390 C  CE  . MET B 1 93  ? 39.969  59.521 27.678  1.00 11.18 ? 71  MET B CE  1 
ATOM   3391 N  N   . ALA B 1 94  ? 44.965  59.870 30.649  1.00 12.08 ? 72  ALA B N   1 
ATOM   3392 C  CA  . ALA B 1 94  ? 46.120  58.967 30.603  1.00 11.74 ? 72  ALA B CA  1 
ATOM   3393 C  C   . ALA B 1 94  ? 46.844  58.673 31.937  1.00 12.32 ? 72  ALA B C   1 
ATOM   3394 O  O   . ALA B 1 94  ? 47.102  57.503 32.234  1.00 13.64 ? 72  ALA B O   1 
ATOM   3395 C  CB  . ALA B 1 94  ? 47.115  59.423 29.543  1.00 11.53 ? 72  ALA B CB  1 
ATOM   3396 N  N   . PRO B 1 95  ? 47.170  59.711 32.741  1.00 12.24 ? 73  PRO B N   1 
ATOM   3397 C  CA  . PRO B 1 95  ? 47.880  59.422 33.998  1.00 13.40 ? 73  PRO B CA  1 
ATOM   3398 C  C   . PRO B 1 95  ? 47.103  58.455 34.896  1.00 12.82 ? 73  PRO B C   1 
ATOM   3399 O  O   . PRO B 1 95  ? 47.711  57.631 35.591  1.00 17.65 ? 73  PRO B O   1 
ATOM   3400 C  CB  . PRO B 1 95  ? 47.971  60.797 34.677  1.00 15.28 ? 73  PRO B CB  1 
ATOM   3401 C  CG  . PRO B 1 95  ? 47.886  61.782 33.543  1.00 14.93 ? 73  PRO B CG  1 
ATOM   3402 C  CD  . PRO B 1 95  ? 46.919  61.156 32.580  1.00 11.50 ? 73  PRO B CD  1 
ATOM   3403 N  N   . GLY B 1 96  ? 45.776  58.548 34.862  1.00 12.11 ? 74  GLY B N   1 
ATOM   3404 C  CA  . GLY B 1 96  ? 44.929  57.724 35.705  1.00 13.41 ? 74  GLY B CA  1 
ATOM   3405 C  C   . GLY B 1 96  ? 44.725  56.316 35.179  1.00 13.74 ? 74  GLY B C   1 
ATOM   3406 O  O   . GLY B 1 96  ? 44.066  55.502 35.825  1.00 14.63 ? 74  GLY B O   1 
ATOM   3407 N  N   . LEU B 1 97  ? 45.284  56.031 34.005  1.00 12.78 ? 75  LEU B N   1 
ATOM   3408 C  CA  . LEU B 1 97  ? 45.129  54.716 33.384  1.00 11.97 ? 75  LEU B CA  1 
ATOM   3409 C  C   . LEU B 1 97  ? 46.391  53.860 33.480  1.00 15.31 ? 75  LEU B C   1 
ATOM   3410 O  O   . LEU B 1 97  ? 46.334  52.651 33.251  1.00 14.17 ? 75  LEU B O   1 
ATOM   3411 C  CB  . LEU B 1 97  ? 44.700  54.856 31.918  1.00 10.99 ? 75  LEU B CB  1 
ATOM   3412 C  CG  . LEU B 1 97  ? 43.321  55.458 31.650  1.00 10.60 ? 75  LEU B CG  1 
ATOM   3413 C  CD1 . LEU B 1 97  ? 43.106  55.641 30.145  1.00 13.19 ? 75  LEU B CD1 1 
ATOM   3414 C  CD2 . LEU B 1 97  ? 42.225  54.581 32.247  1.00 11.21 ? 75  LEU B CD2 1 
ATOM   3415 N  N   . ILE B 1 98  ? 47.523  54.482 33.812  1.00 12.21 ? 76  ILE B N   1 
ATOM   3416 C  CA  . ILE B 1 98  ? 48.762  53.728 34.017  1.00 12.39 ? 76  ILE B CA  1 
ATOM   3417 C  C   . ILE B 1 98  ? 48.546  52.716 35.140  1.00 11.76 ? 76  ILE B C   1 
ATOM   3418 O  O   . ILE B 1 98  ? 48.059  53.074 36.215  1.00 16.27 ? 76  ILE B O   1 
ATOM   3419 C  CB  . ILE B 1 98  ? 49.948  54.657 34.363  1.00 13.94 ? 76  ILE B CB  1 
ATOM   3420 C  CG1 . ILE B 1 98  ? 50.153  55.704 33.263  1.00 12.08 ? 76  ILE B CG1 1 
ATOM   3421 C  CG2 . ILE B 1 98  ? 51.223  53.853 34.583  1.00 17.22 ? 76  ILE B CG2 1 
ATOM   3422 C  CD1 . ILE B 1 98  ? 50.299  55.114 31.863  1.00 16.00 ? 76  ILE B CD1 1 
ATOM   3423 N  N   . GLY B 1 99  ? 48.866  51.450 34.876  1.00 13.74 ? 77  GLY B N   1 
ATOM   3424 C  CA  . GLY B 1 99  ? 48.686  50.394 35.862  1.00 18.11 ? 77  GLY B CA  1 
ATOM   3425 C  C   . GLY B 1 99  ? 47.399  49.600 35.707  1.00 18.46 ? 77  GLY B C   1 
ATOM   3426 O  O   . GLY B 1 99  ? 47.240  48.540 36.312  1.00 19.42 ? 77  GLY B O   1 
ATOM   3427 N  N   . ALA B 1 100 ? 46.474  50.110 34.901  1.00 15.26 ? 78  ALA B N   1 
ATOM   3428 C  CA  . ALA B 1 100 ? 45.215  49.411 34.642  1.00 13.44 ? 78  ALA B CA  1 
ATOM   3429 C  C   . ALA B 1 100 ? 45.451  48.150 33.806  1.00 14.58 ? 78  ALA B C   1 
ATOM   3430 O  O   . ALA B 1 100 ? 46.418  48.070 33.051  1.00 14.08 ? 78  ALA B O   1 
ATOM   3431 C  CB  . ALA B 1 100 ? 44.254  50.327 33.933  1.00 13.06 ? 78  ALA B CB  1 
ATOM   3432 N  N   . ASN B 1 101 ? 44.560  47.171 33.935  1.00 13.40 ? 79  ASN B N   1 
ATOM   3433 C  CA  . ASN B 1 101 ? 44.635  45.950 33.133  1.00 14.14 ? 79  ASN B CA  1 
ATOM   3434 C  C   . ASN B 1 101 ? 43.994  46.187 31.769  1.00 14.18 ? 79  ASN B C   1 
ATOM   3435 O  O   . ASN B 1 101 ? 42.787  46.425 31.669  1.00 14.64 ? 79  ASN B O   1 
ATOM   3436 C  CB  . ASN B 1 101 ? 43.942  44.802 33.880  1.00 17.77 ? 79  ASN B CB  1 
ATOM   3437 C  CG  . ASN B 1 101 ? 44.082  43.460 33.182  1.00 16.93 ? 79  ASN B CG  1 
ATOM   3438 O  OD1 . ASN B 1 101 ? 44.383  43.383 31.986  1.00 14.55 ? 79  ASN B OD1 1 
ATOM   3439 N  ND2 . ASN B 1 101 ? 43.842  42.385 33.930  1.00 18.11 ? 79  ASN B ND2 1 
ATOM   3440 N  N   . PRO B 1 102 ? 44.798  46.115 30.698  1.00 13.06 ? 80  PRO B N   1 
ATOM   3441 C  CA  . PRO B 1 102 ? 44.266  46.452 29.372  1.00 15.03 ? 80  PRO B CA  1 
ATOM   3442 C  C   . PRO B 1 102 ? 43.449  45.327 28.741  1.00 17.47 ? 80  PRO B C   1 
ATOM   3443 O  O   . PRO B 1 102 ? 42.944  45.489 27.632  1.00 16.68 ? 80  PRO B O   1 
ATOM   3444 C  CB  . PRO B 1 102 ? 45.536  46.685 28.547  1.00 14.49 ? 80  PRO B CB  1 
ATOM   3445 C  CG  . PRO B 1 102 ? 46.528  45.781 29.164  1.00 15.00 ? 80  PRO B CG  1 
ATOM   3446 C  CD  . PRO B 1 102 ? 46.234  45.779 30.648  1.00 13.71 ? 80  PRO B CD  1 
ATOM   3447 N  N   . LEU B 1 103 ? 43.324  44.202 29.437  1.00 11.05 ? 81  LEU B N   1 
ATOM   3448 C  CA  . LEU B 1 103 ? 42.611  43.044 28.899  1.00 8.73  ? 81  LEU B CA  1 
ATOM   3449 C  C   . LEU B 1 103 ? 41.156  43.009 29.370  1.00 11.03 ? 81  LEU B C   1 
ATOM   3450 O  O   . LEU B 1 103 ? 40.453  42.008 29.171  1.00 11.70 ? 81  LEU B O   1 
ATOM   3451 C  CB  . LEU B 1 103 ? 43.315  41.746 29.321  1.00 10.72 ? 81  LEU B CB  1 
ATOM   3452 C  CG  . LEU B 1 103 ? 44.812  41.636 29.011  1.00 13.19 ? 81  LEU B CG  1 
ATOM   3453 C  CD1 . LEU B 1 103 ? 45.396  40.393 29.663  1.00 15.49 ? 81  LEU B CD1 1 
ATOM   3454 C  CD2 . LEU B 1 103 ? 45.081  41.617 27.506  1.00 17.48 ? 81  LEU B CD2 1 
ATOM   3455 N  N   . GLN B 1 104 ? 40.709  44.106 29.986  1.00 11.38 ? 82  GLN B N   1 
ATOM   3456 C  CA  . GLN B 1 104 ? 39.370  44.189 30.568  1.00 9.48  ? 82  GLN B CA  1 
ATOM   3457 C  C   . GLN B 1 104 ? 38.655  45.449 30.081  1.00 8.51  ? 82  GLN B C   1 
ATOM   3458 O  O   . GLN B 1 104 ? 38.637  46.464 30.768  1.00 10.67 ? 82  GLN B O   1 
ATOM   3459 C  CB  . GLN B 1 104 ? 39.461  44.206 32.098  1.00 9.88  ? 82  GLN B CB  1 
ATOM   3460 C  CG  . GLN B 1 104 ? 40.173  42.998 32.703  1.00 10.90 ? 82  GLN B CG  1 
ATOM   3461 C  CD  . GLN B 1 104 ? 40.327  43.112 34.198  1.00 12.98 ? 82  GLN B CD  1 
ATOM   3462 O  OE1 . GLN B 1 104 ? 40.612  44.193 34.720  1.00 15.33 ? 82  GLN B OE1 1 
ATOM   3463 N  NE2 . GLN B 1 104 ? 40.140  41.999 34.904  1.00 12.12 ? 82  GLN B NE2 1 
ATOM   3464 N  N   . PRO B 1 105 ? 38.078  45.396 28.876  1.00 9.90  ? 83  PRO B N   1 
ATOM   3465 C  CA  . PRO B 1 105 ? 37.569  46.616 28.233  1.00 11.56 ? 83  PRO B CA  1 
ATOM   3466 C  C   . PRO B 1 105 ? 36.447  47.318 28.989  1.00 10.32 ? 83  PRO B C   1 
ATOM   3467 O  O   . PRO B 1 105 ? 36.388  48.542 28.956  1.00 9.74  ? 83  PRO B O   1 
ATOM   3468 C  CB  . PRO B 1 105 ? 37.041  46.114 26.885  1.00 12.71 ? 83  PRO B CB  1 
ATOM   3469 C  CG  . PRO B 1 105 ? 37.720  44.836 26.656  1.00 19.54 ? 83  PRO B CG  1 
ATOM   3470 C  CD  . PRO B 1 105 ? 37.963  44.219 28.001  1.00 15.10 ? 83  PRO B CD  1 
ATOM   3471 N  N   . LEU B 1 106 ? 35.563  46.572 29.648  1.00 8.69  ? 84  LEU B N   1 
ATOM   3472 C  CA  . LEU B 1 106 ? 34.479  47.208 30.396  1.00 10.61 ? 84  LEU B CA  1 
ATOM   3473 C  C   . LEU B 1 106 ? 34.997  47.851 31.689  1.00 8.80  ? 84  LEU B C   1 
ATOM   3474 O  O   . LEU B 1 106 ? 34.595  48.964 32.050  1.00 9.57  ? 84  LEU B O   1 
ATOM   3475 C  CB  . LEU B 1 106 ? 33.350  46.201 30.674  1.00 8.98  ? 84  LEU B CB  1 
ATOM   3476 C  CG  . LEU B 1 106 ? 32.125  46.695 31.458  1.00 10.06 ? 84  LEU B CG  1 
ATOM   3477 C  CD1 . LEU B 1 106 ? 31.607  48.009 30.899  1.00 9.26  ? 84  LEU B CD1 1 
ATOM   3478 C  CD2 . LEU B 1 106 ? 31.004  45.645 31.477  1.00 11.17 ? 84  LEU B CD2 1 
ATOM   3479 N  N   . VAL B 1 107 ? 35.894  47.156 32.383  1.00 8.11  ? 85  VAL B N   1 
ATOM   3480 C  CA  . VAL B 1 107 ? 36.524  47.713 33.577  1.00 8.25  ? 85  VAL B CA  1 
ATOM   3481 C  C   . VAL B 1 107 ? 37.307  48.967 33.205  1.00 9.06  ? 85  VAL B C   1 
ATOM   3482 O  O   . VAL B 1 107 ? 37.269  49.980 33.916  1.00 10.16 ? 85  VAL B O   1 
ATOM   3483 C  CB  . VAL B 1 107 ? 37.455  46.684 34.239  1.00 8.65  ? 85  VAL B CB  1 
ATOM   3484 C  CG1 . VAL B 1 107 ? 38.198  47.299 35.432  1.00 9.71  ? 85  VAL B CG1 1 
ATOM   3485 C  CG2 . VAL B 1 107 ? 36.651  45.479 34.675  1.00 9.13  ? 85  VAL B CG2 1 
ATOM   3486 N  N   . LEU B 1 108 ? 37.993  48.898 32.066  1.00 9.95  ? 86  LEU B N   1 
ATOM   3487 C  CA  . LEU B 1 108 ? 38.756  50.037 31.570  1.00 10.15 ? 86  LEU B CA  1 
ATOM   3488 C  C   . LEU B 1 108 ? 37.856  51.226 31.238  1.00 11.60 ? 86  LEU B C   1 
ATOM   3489 O  O   . LEU B 1 108 ? 38.211  52.373 31.536  1.00 10.57 ? 86  LEU B O   1 
ATOM   3490 C  CB  . LEU B 1 108 ? 39.590  49.624 30.353  1.00 10.83 ? 86  LEU B CB  1 
ATOM   3491 C  CG  . LEU B 1 108 ? 40.699  50.561 29.868  1.00 14.73 ? 86  LEU B CG  1 
ATOM   3492 C  CD1 . LEU B 1 108 ? 41.768  50.723 30.937  1.00 17.78 ? 86  LEU B CD1 1 
ATOM   3493 C  CD2 . LEU B 1 108 ? 41.314  50.014 28.579  1.00 15.64 ? 86  LEU B CD2 1 
ATOM   3494 N  N   A ARG B 1 109 ? 36.697  50.961 30.639  0.55 8.96  ? 87  ARG B N   1 
ATOM   3495 N  N   B ARG B 1 109 ? 36.699  50.963 30.632  0.45 9.00  ? 87  ARG B N   1 
ATOM   3496 C  CA  A ARG B 1 109 ? 35.756  52.029 30.317  0.55 8.30  ? 87  ARG B CA  1 
ATOM   3497 C  CA  B ARG B 1 109 ? 35.755  52.033 30.315  0.45 8.51  ? 87  ARG B CA  1 
ATOM   3498 C  C   A ARG B 1 109 ? 35.245  52.724 31.577  0.55 10.17 ? 87  ARG B C   1 
ATOM   3499 C  C   B ARG B 1 109 ? 35.242  52.724 31.575  0.45 10.04 ? 87  ARG B C   1 
ATOM   3500 O  O   A ARG B 1 109 ? 35.164  53.950 31.631  0.55 10.09 ? 87  ARG B O   1 
ATOM   3501 O  O   B ARG B 1 109 ? 35.152  53.950 31.625  0.45 10.15 ? 87  ARG B O   1 
ATOM   3502 C  CB  A ARG B 1 109 ? 34.578  51.505 29.483  0.55 9.87  ? 87  ARG B CB  1 
ATOM   3503 C  CB  B ARG B 1 109 ? 34.576  51.523 29.473  0.45 10.01 ? 87  ARG B CB  1 
ATOM   3504 C  CG  A ARG B 1 109 ? 33.662  52.623 29.002  0.55 13.44 ? 87  ARG B CG  1 
ATOM   3505 C  CG  B ARG B 1 109 ? 33.515  52.598 29.232  0.45 13.34 ? 87  ARG B CG  1 
ATOM   3506 C  CD  A ARG B 1 109 ? 32.552  52.124 28.074  0.55 13.12 ? 87  ARG B CD  1 
ATOM   3507 C  CD  B ARG B 1 109 ? 32.540  52.237 28.113  0.45 13.04 ? 87  ARG B CD  1 
ATOM   3508 N  NE  A ARG B 1 109 ? 31.617  51.226 28.746  0.55 10.06 ? 87  ARG B NE  1 
ATOM   3509 N  NE  B ARG B 1 109 ? 31.480  53.235 27.993  0.45 14.82 ? 87  ARG B NE  1 
ATOM   3510 C  CZ  A ARG B 1 109 ? 30.699  51.624 29.623  0.55 13.72 ? 87  ARG B CZ  1 
ATOM   3511 C  CZ  B ARG B 1 109 ? 31.578  54.363 27.291  0.45 10.96 ? 87  ARG B CZ  1 
ATOM   3512 N  NH1 A ARG B 1 109 ? 30.599  52.911 29.952  0.55 16.33 ? 87  ARG B NH1 1 
ATOM   3513 N  NH1 B ARG B 1 109 ? 32.690  54.658 26.624  0.45 6.56  ? 87  ARG B NH1 1 
ATOM   3514 N  NH2 A ARG B 1 109 ? 29.890  50.738 30.184  0.55 10.67 ? 87  ARG B NH2 1 
ATOM   3515 N  NH2 B ARG B 1 109 ? 30.554  55.200 27.257  0.45 13.51 ? 87  ARG B NH2 1 
ATOM   3516 N  N   . ARG B 1 110 ? 34.917  51.940 32.600  1.00 8.74  ? 88  ARG B N   1 
ATOM   3517 C  CA  . ARG B 1 110 ? 34.475  52.514 33.864  1.00 9.77  ? 88  ARG B CA  1 
ATOM   3518 C  C   . ARG B 1 110 ? 35.575  53.354 34.508  1.00 9.86  ? 88  ARG B C   1 
ATOM   3519 O  O   . ARG B 1 110 ? 35.297  54.391 35.104  1.00 11.66 ? 88  ARG B O   1 
ATOM   3520 C  CB  . ARG B 1 110 ? 34.001  51.434 34.846  1.00 9.86  ? 88  ARG B CB  1 
ATOM   3521 C  CG  . ARG B 1 110 ? 32.766  50.686 34.382  1.00 9.56  ? 88  ARG B CG  1 
ATOM   3522 C  CD  . ARG B 1 110 ? 32.077  49.981 35.552  1.00 14.37 ? 88  ARG B CD  1 
ATOM   3523 N  NE  . ARG B 1 110 ? 31.077  49.045 35.049  1.00 10.62 ? 88  ARG B NE  1 
ATOM   3524 C  CZ  . ARG B 1 110 ? 31.232  47.725 35.027  1.00 8.51  ? 88  ARG B CZ  1 
ATOM   3525 N  NH1 . ARG B 1 110 ? 32.326  47.169 35.539  1.00 11.32 ? 88  ARG B NH1 1 
ATOM   3526 N  NH2 . ARG B 1 110 ? 30.282  46.961 34.519  1.00 7.77  ? 88  ARG B NH2 1 
ATOM   3527 N  N   . ARG B 1 111 ? 36.820  52.901 34.387  1.00 9.97  ? 89  ARG B N   1 
ATOM   3528 C  CA  . ARG B 1 111 ? 37.946  53.644 34.944  1.00 8.88  ? 89  ARG B CA  1 
ATOM   3529 C  C   . ARG B 1 111 ? 38.071  54.981 34.213  1.00 9.62  ? 89  ARG B C   1 
ATOM   3530 O  O   . ARG B 1 111 ? 38.301  56.014 34.843  1.00 11.79 ? 89  ARG B O   1 
ATOM   3531 C  CB  . ARG B 1 111 ? 39.241  52.818 34.854  1.00 9.10  ? 89  ARG B CB  1 
ATOM   3532 C  CG  . ARG B 1 111 ? 40.456  53.466 35.521  1.00 9.59  ? 89  ARG B CG  1 
ATOM   3533 C  CD  . ARG B 1 111 ? 41.586  52.444 35.659  1.00 15.17 ? 89  ARG B CD  1 
ATOM   3534 N  NE  . ARG B 1 111 ? 42.824  53.056 36.134  1.00 19.10 ? 89  ARG B NE  1 
ATOM   3535 C  CZ  . ARG B 1 111 ? 43.736  52.427 36.868  1.00 20.22 ? 89  ARG B CZ  1 
ATOM   3536 N  NH1 . ARG B 1 111 ? 44.834  53.064 37.248  1.00 20.85 ? 89  ARG B NH1 1 
ATOM   3537 N  NH2 . ARG B 1 111 ? 43.550  51.161 37.223  1.00 20.94 ? 89  ARG B NH2 1 
ATOM   3538 N  N   . MET B 1 112 ? 37.878  54.963 32.895  1.00 9.97  ? 90  MET B N   1 
ATOM   3539 C  CA  . MET B 1 112 ? 37.886  56.207 32.122  1.00 10.81 ? 90  MET B CA  1 
ATOM   3540 C  C   . MET B 1 112 ? 36.761  57.136 32.571  1.00 9.94  ? 90  MET B C   1 
ATOM   3541 O  O   . MET B 1 112 ? 36.976  58.347 32.738  1.00 9.19  ? 90  MET B O   1 
ATOM   3542 C  CB  . MET B 1 112 ? 37.792  55.929 30.617  1.00 8.95  ? 90  MET B CB  1 
ATOM   3543 C  CG  . MET B 1 112 ? 39.109  55.433 30.036  1.00 9.77  ? 90  MET B CG  1 
ATOM   3544 S  SD  . MET B 1 112 ? 39.152  55.396 28.238  1.00 9.55  ? 90  MET B SD  1 
ATOM   3545 C  CE  . MET B 1 112 ? 38.196  53.925 27.875  1.00 12.75 ? 90  MET B CE  1 
ATOM   3546 N  N   . ASP B 1 113 ? 35.569  56.577 32.774  1.00 8.89  ? 91  ASP B N   1 
ATOM   3547 C  CA  . ASP B 1 113 ? 34.427  57.371 33.242  1.00 9.38  ? 91  ASP B CA  1 
ATOM   3548 C  C   . ASP B 1 113 ? 34.715  58.042 34.588  1.00 11.13 ? 91  ASP B C   1 
ATOM   3549 O  O   . ASP B 1 113 ? 34.174  59.107 34.887  1.00 12.24 ? 91  ASP B O   1 
ATOM   3550 C  CB  . ASP B 1 113 ? 33.160  56.508 33.377  1.00 9.99  ? 91  ASP B CB  1 
ATOM   3551 C  CG  . ASP B 1 113 ? 32.593  56.038 32.041  1.00 14.12 ? 91  ASP B CG  1 
ATOM   3552 O  OD1 . ASP B 1 113 ? 32.943  56.589 30.971  1.00 11.57 ? 91  ASP B OD1 1 
ATOM   3553 O  OD2 . ASP B 1 113 ? 31.750  55.108 32.071  1.00 16.75 ? 91  ASP B OD2 1 
ATOM   3554 N  N   . GLY B 1 114 ? 35.571  57.415 35.395  1.00 10.08 ? 92  GLY B N   1 
ATOM   3555 C  CA  . GLY B 1 114 ? 35.944  57.951 36.691  1.00 10.75 ? 92  GLY B CA  1 
ATOM   3556 C  C   . GLY B 1 114 ? 36.951  59.084 36.600  1.00 11.08 ? 92  GLY B C   1 
ATOM   3557 O  O   . GLY B 1 114 ? 37.237  59.757 37.595  1.00 14.70 ? 92  GLY B O   1 
ATOM   3558 N  N   . LEU B 1 115 ? 37.484  59.294 35.396  1.00 10.30 ? 93  LEU B N   1 
ATOM   3559 C  CA  . LEU B 1 115 ? 38.493  60.322 35.164  1.00 10.76 ? 93  LEU B CA  1 
ATOM   3560 C  C   . LEU B 1 115 ? 37.969  61.495 34.334  1.00 9.44  ? 93  LEU B C   1 
ATOM   3561 O  O   . LEU B 1 115 ? 38.465  62.625 34.458  1.00 10.39 ? 93  LEU B O   1 
ATOM   3562 C  CB  . LEU B 1 115 ? 39.718  59.703 34.484  1.00 9.96  ? 93  LEU B CB  1 
ATOM   3563 C  CG  . LEU B 1 115 ? 40.433  58.603 35.274  1.00 9.92  ? 93  LEU B CG  1 
ATOM   3564 C  CD1 . LEU B 1 115 ? 41.359  57.819 34.355  1.00 12.31 ? 93  LEU B CD1 1 
ATOM   3565 C  CD2 . LEU B 1 115 ? 41.218  59.179 36.441  1.00 13.01 ? 93  LEU B CD2 1 
ATOM   3566 N  N   . LEU B 1 116 ? 36.971  61.232 33.500  1.00 9.15  ? 94  LEU B N   1 
ATOM   3567 C  CA  . LEU B 1 116 ? 36.439  62.251 32.593  1.00 9.28  ? 94  LEU B CA  1 
ATOM   3568 C  C   . LEU B 1 116 ? 35.028  61.886 32.169  1.00 8.38  ? 94  LEU B C   1 
ATOM   3569 O  O   . LEU B 1 116 ? 34.778  60.774 31.709  1.00 8.57  ? 94  LEU B O   1 
ATOM   3570 C  CB  . LEU B 1 116 ? 37.343  62.381 31.357  1.00 8.67  ? 94  LEU B CB  1 
ATOM   3571 C  CG  . LEU B 1 116 ? 36.916  63.384 30.277  1.00 9.05  ? 94  LEU B CG  1 
ATOM   3572 C  CD1 . LEU B 1 116 ? 36.942  64.793 30.823  1.00 12.00 ? 94  LEU B CD1 1 
ATOM   3573 C  CD2 . LEU B 1 116 ? 37.821  63.283 29.063  1.00 11.24 ? 94  LEU B CD2 1 
ATOM   3574 N  N   . CYS B 1 117 ? 34.097  62.818 32.349  1.00 8.56  ? 95  CYS B N   1 
ATOM   3575 C  CA  . CYS B 1 117 ? 32.723  62.628 31.895  1.00 8.00  ? 95  CYS B CA  1 
ATOM   3576 C  C   . CYS B 1 117 ? 32.604  62.872 30.392  1.00 9.07  ? 95  CYS B C   1 
ATOM   3577 O  O   . CYS B 1 117 ? 33.192  63.820 29.860  1.00 9.52  ? 95  CYS B O   1 
ATOM   3578 C  CB  . CYS B 1 117 ? 31.805  63.577 32.679  1.00 8.12  ? 95  CYS B CB  1 
ATOM   3579 S  SG  . CYS B 1 117 ? 30.074  63.629 32.147  1.00 13.15 ? 95  CYS B SG  1 
ATOM   3580 N  N   . GLY B 1 118 ? 31.861  62.005 29.709  1.00 8.06  ? 96  GLY B N   1 
ATOM   3581 C  CA  . GLY B 1 118 ? 31.602  62.176 28.286  1.00 9.15  ? 96  GLY B CA  1 
ATOM   3582 C  C   . GLY B 1 118 ? 32.837  61.903 27.448  1.00 8.31  ? 96  GLY B C   1 
ATOM   3583 O  O   . GLY B 1 118 ? 33.624  61.014 27.771  1.00 9.09  ? 96  GLY B O   1 
ATOM   3584 N  N   . HIS B 1 119 ? 32.993  62.666 26.363  1.00 8.29  ? 97  HIS B N   1 
ATOM   3585 C  CA  . HIS B 1 119 ? 34.167  62.550 25.484  1.00 6.92  ? 97  HIS B CA  1 
ATOM   3586 C  C   . HIS B 1 119 ? 34.337  61.118 24.964  1.00 6.69  ? 97  HIS B C   1 
ATOM   3587 O  O   . HIS B 1 119 ? 35.446  60.569 24.964  1.00 7.13  ? 97  HIS B O   1 
ATOM   3588 C  CB  . HIS B 1 119 ? 35.444  63.049 26.191  1.00 8.72  ? 97  HIS B CB  1 
ATOM   3589 C  CG  . HIS B 1 119 ? 35.391  64.495 26.588  1.00 7.98  ? 97  HIS B CG  1 
ATOM   3590 N  ND1 . HIS B 1 119 ? 34.717  64.931 27.712  1.00 8.59  ? 97  HIS B ND1 1 
ATOM   3591 C  CD2 . HIS B 1 119 ? 35.919  65.603 26.012  1.00 8.78  ? 97  HIS B CD2 1 
ATOM   3592 C  CE1 . HIS B 1 119 ? 34.831  66.245 27.806  1.00 9.72  ? 97  HIS B CE1 1 
ATOM   3593 N  NE2 . HIS B 1 119 ? 35.553  66.679 26.788  1.00 10.99 ? 97  HIS B NE2 1 
ATOM   3594 N  N   . ASN B 1 120 ? 33.234  60.520 24.532  1.00 6.92  ? 98  ASN B N   1 
ATOM   3595 C  CA  . ASN B 1 120 ? 33.275  59.166 23.985  1.00 6.12  ? 98  ASN B CA  1 
ATOM   3596 C  C   . ASN B 1 120 ? 34.306  59.019 22.876  1.00 7.40  ? 98  ASN B C   1 
ATOM   3597 O  O   . ASN B 1 120 ? 34.975  57.985 22.784  1.00 7.16  ? 98  ASN B O   1 
ATOM   3598 C  CB  . ASN B 1 120 ? 31.907  58.734 23.456  1.00 8.10  ? 98  ASN B CB  1 
ATOM   3599 C  CG  . ASN B 1 120 ? 31.049  58.083 24.517  1.00 10.39 ? 98  ASN B CG  1 
ATOM   3600 O  OD1 . ASN B 1 120 ? 31.555  57.655 25.557  1.00 10.53 ? 98  ASN B OD1 1 
ATOM   3601 N  ND2 . ASN B 1 120 ? 29.744  57.989 24.257  1.00 8.48  ? 98  ASN B ND2 1 
ATOM   3602 N  N   . TYR B 1 121 ? 34.429  60.043 22.031  1.00 6.75  ? 99  TYR B N   1 
ATOM   3603 C  CA  . TYR B 1 121 ? 35.332  59.949 20.892  1.00 9.48  ? 99  TYR B CA  1 
ATOM   3604 C  C   . TYR B 1 121 ? 36.786  59.738 21.294  1.00 9.04  ? 99  TYR B C   1 
ATOM   3605 O  O   . TYR B 1 121 ? 37.554  59.137 20.542  1.00 8.74  ? 99  TYR B O   1 
ATOM   3606 C  CB  . TYR B 1 121 ? 35.213  61.182 19.994  1.00 8.16  ? 99  TYR B CB  1 
ATOM   3607 C  CG  . TYR B 1 121 ? 35.787  62.500 20.529  1.00 14.44 ? 99  TYR B CG  1 
ATOM   3608 C  CD1 . TYR B 1 121 ? 35.570  62.954 21.853  1.00 29.02 ? 99  TYR B CD1 1 
ATOM   3609 C  CD2 . TYR B 1 121 ? 36.546  63.299 19.696  1.00 17.34 ? 99  TYR B CD2 1 
ATOM   3610 C  CE1 . TYR B 1 121 ? 36.147  64.199 22.324  1.00 7.22  ? 99  TYR B CE1 1 
ATOM   3611 C  CE2 . TYR B 1 121 ? 37.053  64.510 20.121  1.00 16.53 ? 99  TYR B CE2 1 
ATOM   3612 C  CZ  . TYR B 1 121 ? 36.837  64.961 21.405  1.00 17.66 ? 99  TYR B CZ  1 
ATOM   3613 O  OH  . TYR B 1 121 ? 37.362  66.175 21.735  1.00 19.88 ? 99  TYR B OH  1 
ATOM   3614 N  N   . ALA B 1 122 ? 37.157  60.227 22.476  1.00 6.85  ? 100 ALA B N   1 
ATOM   3615 C  CA  . ALA B 1 122 ? 38.522  60.073 22.972  1.00 8.15  ? 100 ALA B CA  1 
ATOM   3616 C  C   . ALA B 1 122 ? 38.647  58.739 23.688  1.00 9.30  ? 100 ALA B C   1 
ATOM   3617 O  O   . ALA B 1 122 ? 39.615  58.010 23.496  1.00 7.52  ? 100 ALA B O   1 
ATOM   3618 C  CB  . ALA B 1 122 ? 38.875  61.205 23.919  1.00 9.55  ? 100 ALA B CB  1 
ATOM   3619 N  N   . LYS B 1 123 ? 37.666  58.428 24.525  1.00 10.01 ? 101 LYS B N   1 
ATOM   3620 C  CA  . LYS B 1 123 ? 37.620  57.129 25.191  1.00 6.95  ? 101 LYS B CA  1 
ATOM   3621 C  C   . LYS B 1 123 ? 37.697  55.963 24.202  1.00 7.75  ? 101 LYS B C   1 
ATOM   3622 O  O   . LYS B 1 123 ? 38.333  54.945 24.485  1.00 8.72  ? 101 LYS B O   1 
ATOM   3623 C  CB  . LYS B 1 123 ? 36.358  57.028 26.053  1.00 6.80  ? 101 LYS B CB  1 
ATOM   3624 C  CG  . LYS B 1 123 ? 36.379  57.993 27.243  1.00 7.08  ? 101 LYS B CG  1 
ATOM   3625 C  CD  . LYS B 1 123 ? 35.096  57.908 28.031  1.00 9.01  ? 101 LYS B CD  1 
ATOM   3626 C  CE  . LYS B 1 123 ? 35.134  58.826 29.253  1.00 8.19  ? 101 LYS B CE  1 
ATOM   3627 N  NZ  . LYS B 1 123 ? 33.760  58.978 29.858  1.00 8.29  ? 101 LYS B NZ  1 
ATOM   3628 N  N   . ALA B 1 124 ? 37.061  56.118 23.040  1.00 6.48  ? 102 ALA B N   1 
ATOM   3629 C  CA  . ALA B 1 124 ? 37.056  55.073 22.019  1.00 6.48  ? 102 ALA B CA  1 
ATOM   3630 C  C   . ALA B 1 124 ? 38.459  54.705 21.560  1.00 7.83  ? 102 ALA B C   1 
ATOM   3631 O  O   . ALA B 1 124 ? 38.717  53.545 21.237  1.00 7.83  ? 102 ALA B O   1 
ATOM   3632 C  CB  . ALA B 1 124 ? 36.207  55.499 20.821  1.00 6.81  ? 102 ALA B CB  1 
ATOM   3633 N  N   . ALA B 1 125 ? 39.363  55.679 21.526  1.00 7.83  ? 103 ALA B N   1 
ATOM   3634 C  CA  . ALA B 1 125 ? 40.727  55.406 21.084  1.00 7.66  ? 103 ALA B CA  1 
ATOM   3635 C  C   . ALA B 1 125 ? 41.453  54.480 22.060  1.00 10.48 ? 103 ALA B C   1 
ATOM   3636 O  O   . ALA B 1 125 ? 42.212  53.611 21.643  1.00 9.96  ? 103 ALA B O   1 
ATOM   3637 C  CB  . ALA B 1 125 ? 41.500  56.699 20.887  1.00 8.97  ? 103 ALA B CB  1 
ATOM   3638 N  N   . ILE B 1 126 ? 41.227  54.682 23.357  1.00 7.42  ? 104 ILE B N   1 
ATOM   3639 C  CA  . ILE B 1 126 ? 41.785  53.804 24.383  1.00 8.34  ? 104 ILE B CA  1 
ATOM   3640 C  C   . ILE B 1 126 ? 41.169  52.410 24.300  1.00 11.71 ? 104 ILE B C   1 
ATOM   3641 O  O   . ILE B 1 126 ? 41.877  51.400 24.356  1.00 9.36  ? 104 ILE B O   1 
ATOM   3642 C  CB  . ILE B 1 126 ? 41.544  54.391 25.803  1.00 9.10  ? 104 ILE B CB  1 
ATOM   3643 C  CG1 . ILE B 1 126 ? 42.355  55.671 26.012  1.00 11.44 ? 104 ILE B CG1 1 
ATOM   3644 C  CG2 . ILE B 1 126 ? 41.887  53.378 26.886  1.00 9.08  ? 104 ILE B CG2 1 
ATOM   3645 C  CD1 . ILE B 1 126 ? 43.870  55.441 26.095  1.00 14.72 ? 104 ILE B CD1 1 
ATOM   3646 N  N   . ASP B 1 127 ? 39.846  52.366 24.160  1.00 7.04  ? 105 ASP B N   1 
ATOM   3647 C  CA  . ASP B 1 127 ? 39.110  51.117 24.007  1.00 6.98  ? 105 ASP B CA  1 
ATOM   3648 C  C   . ASP B 1 127 ? 39.661  50.305 22.836  1.00 9.33  ? 105 ASP B C   1 
ATOM   3649 O  O   . ASP B 1 127 ? 39.917  49.108 22.966  1.00 7.71  ? 105 ASP B O   1 
ATOM   3650 C  CB  . ASP B 1 127 ? 37.615  51.450 23.839  1.00 6.49  ? 105 ASP B CB  1 
ATOM   3651 C  CG  . ASP B 1 127 ? 36.777  50.274 23.358  1.00 10.16 ? 105 ASP B CG  1 
ATOM   3652 O  OD1 . ASP B 1 127 ? 36.971  49.824 22.210  1.00 8.23  ? 105 ASP B OD1 1 
ATOM   3653 O  OD2 . ASP B 1 127 ? 35.875  49.826 24.104  1.00 10.02 ? 105 ASP B OD2 1 
ATOM   3654 N  N   . ILE B 1 128 ? 39.843  50.949 21.684  1.00 8.63  ? 106 ILE B N   1 
ATOM   3655 C  CA  . ILE B 1 128 ? 40.318  50.232 20.508  1.00 8.48  ? 106 ILE B CA  1 
ATOM   3656 C  C   . ILE B 1 128 ? 41.734  49.687 20.711  1.00 7.42  ? 106 ILE B C   1 
ATOM   3657 O  O   . ILE B 1 128 ? 42.017  48.544 20.348  1.00 7.20  ? 106 ILE B O   1 
ATOM   3658 C  CB  . ILE B 1 128 ? 40.218  51.098 19.238  1.00 6.68  ? 106 ILE B CB  1 
ATOM   3659 C  CG1 . ILE B 1 128 ? 38.741  51.352 18.914  1.00 8.02  ? 106 ILE B CG1 1 
ATOM   3660 C  CG2 . ILE B 1 128 ? 40.955  50.431 18.053  1.00 8.10  ? 106 ILE B CG2 1 
ATOM   3661 C  CD1 . ILE B 1 128 ? 38.525  52.524 17.988  1.00 9.84  ? 106 ILE B CD1 1 
ATOM   3662 N  N   . ALA B 1 129 ? 42.605  50.492 21.312  1.00 7.42  ? 107 ALA B N   1 
ATOM   3663 C  CA  . ALA B 1 129 ? 43.974  50.064 21.589  1.00 9.93  ? 107 ALA B CA  1 
ATOM   3664 C  C   . ALA B 1 129 ? 43.997  48.862 22.539  1.00 11.01 ? 107 ALA B C   1 
ATOM   3665 O  O   . ALA B 1 129 ? 44.823  47.955 22.379  1.00 9.60  ? 107 ALA B O   1 
ATOM   3666 C  CB  . ALA B 1 129 ? 44.798  51.226 22.152  1.00 8.14  ? 107 ALA B CB  1 
ATOM   3667 N  N   . ALA B 1 130 ? 43.097  48.858 23.520  1.00 9.76  ? 108 ALA B N   1 
ATOM   3668 C  CA  . ALA B 1 130 ? 42.977  47.725 24.439  1.00 11.34 ? 108 ALA B CA  1 
ATOM   3669 C  C   . ALA B 1 130 ? 42.564  46.446 23.713  1.00 11.99 ? 108 ALA B C   1 
ATOM   3670 O  O   . ALA B 1 130 ? 43.143  45.388 23.944  1.00 9.19  ? 108 ALA B O   1 
ATOM   3671 C  CB  . ALA B 1 130 ? 41.993  48.044 25.567  1.00 14.14 ? 108 ALA B CB  1 
ATOM   3672 N  N   . TYR B 1 131 ? 41.571  46.537 22.832  1.00 7.35  ? 109 TYR B N   1 
ATOM   3673 C  CA  . TYR B 1 131 ? 41.159  45.362 22.060  1.00 7.24  ? 109 TYR B CA  1 
ATOM   3674 C  C   . TYR B 1 131 ? 42.275  44.849 21.149  1.00 8.46  ? 109 TYR B C   1 
ATOM   3675 O  O   . TYR B 1 131 ? 42.455  43.633 20.997  1.00 9.78  ? 109 TYR B O   1 
ATOM   3676 C  CB  . TYR B 1 131 ? 39.886  45.649 21.246  1.00 6.86  ? 109 TYR B CB  1 
ATOM   3677 C  CG  . TYR B 1 131 ? 38.616  45.447 22.038  1.00 6.67  ? 109 TYR B CG  1 
ATOM   3678 C  CD1 . TYR B 1 131 ? 38.081  44.170 22.219  1.00 9.70  ? 109 TYR B CD1 1 
ATOM   3679 C  CD2 . TYR B 1 131 ? 37.941  46.530 22.590  1.00 8.25  ? 109 TYR B CD2 1 
ATOM   3680 C  CE1 . TYR B 1 131 ? 36.915  43.982 22.950  1.00 12.37 ? 109 TYR B CE1 1 
ATOM   3681 C  CE2 . TYR B 1 131 ? 36.778  46.353 23.312  1.00 7.63  ? 109 TYR B CE2 1 
ATOM   3682 C  CZ  . TYR B 1 131 ? 36.270  45.084 23.487  1.00 10.93 ? 109 TYR B CZ  1 
ATOM   3683 O  OH  . TYR B 1 131 ? 35.105  44.911 24.213  1.00 13.68 ? 109 TYR B OH  1 
ATOM   3684 N  N   . ASP B 1 132 ? 43.017  45.770 20.537  1.00 7.56  ? 110 ASP B N   1 
ATOM   3685 C  CA  . ASP B 1 132 ? 44.166  45.404 19.707  1.00 10.30 ? 110 ASP B CA  1 
ATOM   3686 C  C   . ASP B 1 132 ? 45.167  44.615 20.547  1.00 11.04 ? 110 ASP B C   1 
ATOM   3687 O  O   . ASP B 1 132 ? 45.625  43.547 20.145  1.00 10.18 ? 110 ASP B O   1 
ATOM   3688 C  CB  . ASP B 1 132 ? 44.814  46.669 19.127  1.00 7.95  ? 110 ASP B CB  1 
ATOM   3689 C  CG  . ASP B 1 132 ? 45.843  46.375 18.041  1.00 8.23  ? 110 ASP B CG  1 
ATOM   3690 O  OD1 . ASP B 1 132 ? 45.712  45.361 17.314  1.00 9.14  ? 110 ASP B OD1 1 
ATOM   3691 O  OD2 . ASP B 1 132 ? 46.795  47.167 17.899  1.00 11.20 ? 110 ASP B OD2 1 
ATOM   3692 N  N   . LEU B 1 133 ? 45.480  45.143 21.729  1.00 11.18 ? 111 LEU B N   1 
ATOM   3693 C  CA  . LEU B 1 133 ? 46.408  44.510 22.660  1.00 9.99  ? 111 LEU B CA  1 
ATOM   3694 C  C   . LEU B 1 133 ? 45.912  43.126 23.091  1.00 12.93 ? 111 LEU B C   1 
ATOM   3695 O  O   . LEU B 1 133 ? 46.691  42.161 23.098  1.00 14.76 ? 111 LEU B O   1 
ATOM   3696 C  CB  . LEU B 1 133 ? 46.620  45.433 23.874  1.00 13.78 ? 111 LEU B CB  1 
ATOM   3697 C  CG  . LEU B 1 133 ? 47.866  45.285 24.749  1.00 21.19 ? 111 LEU B CG  1 
ATOM   3698 C  CD1 . LEU B 1 133 ? 49.087  45.186 23.886  1.00 24.65 ? 111 LEU B CD1 1 
ATOM   3699 C  CD2 . LEU B 1 133 ? 48.011  46.476 25.684  1.00 23.01 ? 111 LEU B CD2 1 
ATOM   3700 N  N   . MET B 1 134 ? 44.627  43.029 23.445  1.00 9.80  ? 112 MET B N   1 
ATOM   3701 C  CA  . MET B 1 134 ? 44.029  41.746 23.836  1.00 9.98  ? 112 MET B CA  1 
ATOM   3702 C  C   . MET B 1 134 ? 44.168  40.714 22.728  1.00 10.57 ? 112 MET B C   1 
ATOM   3703 O  O   . MET B 1 134 ? 44.542  39.561 22.976  1.00 12.19 ? 112 MET B O   1 
ATOM   3704 C  CB  . MET B 1 134 ? 42.534  41.883 24.148  1.00 13.99 ? 112 MET B CB  1 
ATOM   3705 C  CG  . MET B 1 134 ? 42.186  42.743 25.342  1.00 18.40 ? 112 MET B CG  1 
ATOM   3706 S  SD  . MET B 1 134 ? 40.409  43.053 25.393  1.00 22.98 ? 112 MET B SD  1 
ATOM   3707 C  CE  . MET B 1 134 ? 39.818  41.381 25.501  1.00 15.25 ? 112 MET B CE  1 
ATOM   3708 N  N   . GLY B 1 135 ? 43.846  41.118 21.504  1.00 8.96  ? 113 GLY B N   1 
ATOM   3709 C  CA  . GLY B 1 135 ? 43.925  40.202 20.385  1.00 8.69  ? 113 GLY B CA  1 
ATOM   3710 C  C   . GLY B 1 135 ? 45.342  39.709 20.155  1.00 11.13 ? 113 GLY B C   1 
ATOM   3711 O  O   . GLY B 1 135 ? 45.574  38.526 19.896  1.00 11.47 ? 113 GLY B O   1 
ATOM   3712 N  N   . LYS B 1 136 ? 46.301  40.622 20.238  1.00 9.73  ? 114 LYS B N   1 
ATOM   3713 C  CA  . LYS B 1 136 ? 47.700  40.245 20.077  1.00 9.42  ? 114 LYS B CA  1 
ATOM   3714 C  C   . LYS B 1 136 ? 48.160  39.295 21.182  1.00 13.07 ? 114 LYS B C   1 
ATOM   3715 O  O   . LYS B 1 136 ? 48.917  38.359 20.936  1.00 13.41 ? 114 LYS B O   1 
ATOM   3716 C  CB  . LYS B 1 136 ? 48.587  41.486 20.065  1.00 12.24 ? 114 LYS B CB  1 
ATOM   3717 C  CG  . LYS B 1 136 ? 48.418  42.370 18.844  1.00 11.01 ? 114 LYS B CG  1 
ATOM   3718 C  CD  . LYS B 1 136 ? 49.517  43.411 18.863  1.00 21.05 ? 114 LYS B CD  1 
ATOM   3719 C  CE  . LYS B 1 136 ? 49.280  44.536 17.900  1.00 22.35 ? 114 LYS B CE  1 
ATOM   3720 N  NZ  . LYS B 1 136 ? 50.484  45.434 17.938  1.00 23.30 ? 114 LYS B NZ  1 
ATOM   3721 N  N   . HIS B 1 137 ? 47.698  39.544 22.403  1.00 11.40 ? 115 HIS B N   1 
ATOM   3722 C  CA  . HIS B 1 137 ? 48.128  38.761 23.553  1.00 12.02 ? 115 HIS B CA  1 
ATOM   3723 C  C   . HIS B 1 137 ? 47.600  37.330 23.491  1.00 13.64 ? 115 HIS B C   1 
ATOM   3724 O  O   . HIS B 1 137 ? 48.330  36.367 23.776  1.00 14.25 ? 115 HIS B O   1 
ATOM   3725 C  CB  . HIS B 1 137 ? 47.669  39.447 24.843  1.00 14.16 ? 115 HIS B CB  1 
ATOM   3726 C  CG  . HIS B 1 137 ? 48.038  38.701 26.084  1.00 19.57 ? 115 HIS B CG  1 
ATOM   3727 N  ND1 . HIS B 1 137 ? 49.348  38.533 26.485  1.00 20.05 ? 115 HIS B ND1 1 
ATOM   3728 C  CD2 . HIS B 1 137 ? 47.276  38.070 27.006  1.00 21.92 ? 115 HIS B CD2 1 
ATOM   3729 C  CE1 . HIS B 1 137 ? 49.373  37.837 27.606  1.00 25.42 ? 115 HIS B CE1 1 
ATOM   3730 N  NE2 . HIS B 1 137 ? 48.131  37.540 27.943  1.00 23.14 ? 115 HIS B NE2 1 
ATOM   3731 N  N   . TYR B 1 138 ? 46.337  37.193 23.102  1.00 12.87 ? 116 TYR B N   1 
ATOM   3732 C  CA  . TYR B 1 138 ? 45.690  35.884 23.058  1.00 12.82 ? 116 TYR B CA  1 
ATOM   3733 C  C   . TYR B 1 138 ? 45.871  35.179 21.719  1.00 13.83 ? 116 TYR B C   1 
ATOM   3734 O  O   . TYR B 1 138 ? 45.621  33.973 21.616  1.00 17.12 ? 116 TYR B O   1 
ATOM   3735 C  CB  . TYR B 1 138 ? 44.192  36.014 23.341  1.00 16.30 ? 116 TYR B CB  1 
ATOM   3736 C  CG  . TYR B 1 138 ? 43.828  36.503 24.728  1.00 18.39 ? 116 TYR B CG  1 
ATOM   3737 C  CD1 . TYR B 1 138 ? 44.418  35.962 25.863  1.00 22.46 ? 116 TYR B CD1 1 
ATOM   3738 C  CD2 . TYR B 1 138 ? 42.873  37.497 24.893  1.00 19.30 ? 116 TYR B CD2 1 
ATOM   3739 C  CE1 . TYR B 1 138 ? 44.073  36.413 27.132  1.00 23.39 ? 116 TYR B CE1 1 
ATOM   3740 C  CE2 . TYR B 1 138 ? 42.519  37.951 26.147  1.00 22.29 ? 116 TYR B CE2 1 
ATOM   3741 C  CZ  . TYR B 1 138 ? 43.121  37.408 27.262  1.00 24.67 ? 116 TYR B CZ  1 
ATOM   3742 O  OH  . TYR B 1 138 ? 42.761  37.868 28.509  1.00 24.13 ? 116 TYR B OH  1 
ATOM   3743 N  N   . GLY B 1 139 ? 46.291  35.923 20.694  1.00 13.09 ? 117 GLY B N   1 
ATOM   3744 C  CA  . GLY B 1 139 ? 46.451  35.372 19.355  1.00 13.08 ? 117 GLY B CA  1 
ATOM   3745 C  C   . GLY B 1 139 ? 45.108  35.212 18.660  1.00 16.76 ? 117 GLY B C   1 
ATOM   3746 O  O   . GLY B 1 139 ? 44.849  34.198 18.003  1.00 20.90 ? 117 GLY B O   1 
ATOM   3747 N  N   A VAL B 1 140 ? 44.256  36.219 18.798  0.38 13.75 ? 118 VAL B N   1 
ATOM   3748 N  N   B VAL B 1 140 ? 44.261  36.230 18.800  0.62 13.31 ? 118 VAL B N   1 
ATOM   3749 C  CA  A VAL B 1 140 ? 42.896  36.147 18.289  0.38 14.01 ? 118 VAL B CA  1 
ATOM   3750 C  CA  B VAL B 1 140 ? 42.869  36.195 18.353  0.62 14.41 ? 118 VAL B CA  1 
ATOM   3751 C  C   A VAL B 1 140 ? 42.551  37.447 17.569  0.38 12.93 ? 118 VAL B C   1 
ATOM   3752 C  C   B VAL B 1 140 ? 42.555  37.461 17.569  0.62 12.92 ? 118 VAL B C   1 
ATOM   3753 O  O   A VAL B 1 140 ? 43.030  38.519 17.940  0.38 12.44 ? 118 VAL B O   1 
ATOM   3754 O  O   B VAL B 1 140 ? 43.046  38.537 17.913  0.62 12.30 ? 118 VAL B O   1 
ATOM   3755 C  CB  A VAL B 1 140 ? 41.902  35.893 19.449  0.38 15.18 ? 118 VAL B CB  1 
ATOM   3756 C  CB  B VAL B 1 140 ? 41.914  36.168 19.574  0.62 13.61 ? 118 VAL B CB  1 
ATOM   3757 C  CG1 A VAL B 1 140 ? 42.052  36.957 20.504  0.38 13.27 ? 118 VAL B CG1 1 
ATOM   3758 C  CG1 B VAL B 1 140 ? 40.467  36.007 19.143  0.62 16.68 ? 118 VAL B CG1 1 
ATOM   3759 C  CG2 A VAL B 1 140 ? 40.470  35.836 18.955  0.38 18.01 ? 118 VAL B CG2 1 
ATOM   3760 C  CG2 B VAL B 1 140 ? 42.299  35.058 20.516  0.62 16.32 ? 118 VAL B CG2 1 
ATOM   3761 N  N   . ARG B 1 141 ? 41.744  37.350 16.521  1.00 12.05 ? 119 ARG B N   1 
ATOM   3762 C  CA  . ARG B 1 141 ? 41.275  38.542 15.818  1.00 10.17 ? 119 ARG B CA  1 
ATOM   3763 C  C   . ARG B 1 141 ? 40.253  39.292 16.668  1.00 8.72  ? 119 ARG B C   1 
ATOM   3764 O  O   . ARG B 1 141 ? 39.453  38.678 17.393  1.00 11.40 ? 119 ARG B O   1 
ATOM   3765 C  CB  . ARG B 1 141 ? 40.682  38.174 14.456  1.00 14.52 ? 119 ARG B CB  1 
ATOM   3766 C  CG  . ARG B 1 141 ? 41.745  37.789 13.436  1.00 13.73 ? 119 ARG B CG  1 
ATOM   3767 C  CD  . ARG B 1 141 ? 41.206  37.858 12.019  1.00 15.29 ? 119 ARG B CD  1 
ATOM   3768 N  NE  . ARG B 1 141 ? 40.319  36.739 11.760  1.00 11.97 ? 119 ARG B NE  1 
ATOM   3769 C  CZ  . ARG B 1 141 ? 39.723  36.509 10.596  1.00 9.18  ? 119 ARG B CZ  1 
ATOM   3770 N  NH1 . ARG B 1 141 ? 38.943  35.449 10.452  1.00 11.03 ? 119 ARG B NH1 1 
ATOM   3771 N  NH2 . ARG B 1 141 ? 39.914  37.336 9.576   1.00 9.08  ? 119 ARG B NH2 1 
ATOM   3772 N  N   . VAL B 1 142 ? 40.279  40.623 16.589  1.00 7.19  ? 120 VAL B N   1 
ATOM   3773 C  CA  . VAL B 1 142 ? 39.347  41.435 17.369  1.00 8.61  ? 120 VAL B CA  1 
ATOM   3774 C  C   . VAL B 1 142 ? 37.885  41.054 17.118  1.00 7.85  ? 120 VAL B C   1 
ATOM   3775 O  O   . VAL B 1 142 ? 37.097  40.971 18.055  1.00 9.23  ? 120 VAL B O   1 
ATOM   3776 C  CB  . VAL B 1 142 ? 39.610  42.943 17.163  1.00 6.80  ? 120 VAL B CB  1 
ATOM   3777 C  CG1 . VAL B 1 142 ? 38.426  43.777 17.625  1.00 8.31  ? 120 VAL B CG1 1 
ATOM   3778 C  CG2 . VAL B 1 142 ? 40.862  43.360 17.919  1.00 9.84  ? 120 VAL B CG2 1 
ATOM   3779 N  N   . ALA B 1 143 ? 37.520  40.778 15.870  1.00 7.16  ? 121 ALA B N   1 
ATOM   3780 C  CA  . ALA B 1 143 ? 36.142  40.361 15.594  1.00 7.78  ? 121 ALA B CA  1 
ATOM   3781 C  C   . ALA B 1 143 ? 35.738  39.112 16.384  1.00 10.45 ? 121 ALA B C   1 
ATOM   3782 O  O   . ALA B 1 143 ? 34.585  38.984 16.811  1.00 9.19  ? 121 ALA B O   1 
ATOM   3783 C  CB  . ALA B 1 143 ? 35.933  40.145 14.114  1.00 7.59  ? 121 ALA B CB  1 
ATOM   3784 N  N   . ASP B 1 144 ? 36.682  38.201 16.597  1.00 8.24  ? 122 ASP B N   1 
ATOM   3785 C  CA  . ASP B 1 144 ? 36.379  36.989 17.357  1.00 9.16  ? 122 ASP B CA  1 
ATOM   3786 C  C   . ASP B 1 144 ? 36.234  37.265 18.854  1.00 16.02 ? 122 ASP B C   1 
ATOM   3787 O  O   . ASP B 1 144 ? 35.534  36.533 19.549  1.00 24.90 ? 122 ASP B O   1 
ATOM   3788 C  CB  . ASP B 1 144 ? 37.414  35.893 17.073  1.00 8.67  ? 122 ASP B CB  1 
ATOM   3789 C  CG  . ASP B 1 144 ? 37.163  35.193 15.758  1.00 11.03 ? 122 ASP B CG  1 
ATOM   3790 O  OD1 . ASP B 1 144 ? 35.983  35.102 15.350  1.00 10.53 ? 122 ASP B OD1 1 
ATOM   3791 O  OD2 . ASP B 1 144 ? 38.144  34.725 15.135  1.00 15.07 ? 122 ASP B OD2 1 
ATOM   3792 N  N   . LEU B 1 145 ? 36.859  38.336 19.341  1.00 9.66  ? 123 LEU B N   1 
ATOM   3793 C  CA  . LEU B 1 145 ? 36.678  38.757 20.734  1.00 9.74  ? 123 LEU B CA  1 
ATOM   3794 C  C   . LEU B 1 145 ? 35.327  39.431 20.941  1.00 11.86 ? 123 LEU B C   1 
ATOM   3795 O  O   . LEU B 1 145 ? 34.877  39.623 22.072  1.00 14.98 ? 123 LEU B O   1 
ATOM   3796 C  CB  . LEU B 1 145 ? 37.788  39.723 21.163  1.00 10.17 ? 123 LEU B CB  1 
ATOM   3797 C  CG  . LEU B 1 145 ? 39.169  39.087 21.280  1.00 16.00 ? 123 LEU B CG  1 
ATOM   3798 C  CD1 . LEU B 1 145 ? 40.240  40.151 21.502  1.00 18.32 ? 123 LEU B CD1 1 
ATOM   3799 C  CD2 . LEU B 1 145 ? 39.181  38.069 22.407  1.00 20.77 ? 123 LEU B CD2 1 
ATOM   3800 N  N   . LEU B 1 146 ? 34.693  39.810 19.840  1.00 8.46  ? 124 LEU B N   1 
ATOM   3801 C  CA  . LEU B 1 146 ? 33.446  40.546 19.900  1.00 6.15  ? 124 LEU B CA  1 
ATOM   3802 C  C   . LEU B 1 146 ? 32.262  39.653 19.558  1.00 10.24 ? 124 LEU B C   1 
ATOM   3803 O  O   . LEU B 1 146 ? 31.163  40.141 19.375  1.00 10.93 ? 124 LEU B O   1 
ATOM   3804 C  CB  . LEU B 1 146 ? 33.500  41.746 18.953  1.00 9.40  ? 124 LEU B CB  1 
ATOM   3805 C  CG  . LEU B 1 146 ? 34.557  42.804 19.285  1.00 8.78  ? 124 LEU B CG  1 
ATOM   3806 C  CD1 . LEU B 1 146 ? 34.682  43.806 18.140  1.00 12.14 ? 124 LEU B CD1 1 
ATOM   3807 C  CD2 . LEU B 1 146 ? 34.214  43.518 20.581  1.00 11.84 ? 124 LEU B CD2 1 
ATOM   3808 N  N   . GLY B 1 147 ? 32.490  38.345 19.472  1.00 11.04 ? 125 GLY B N   1 
ATOM   3809 C  CA  . GLY B 1 147 ? 31.393  37.423 19.210  1.00 9.91  ? 125 GLY B CA  1 
ATOM   3810 C  C   . GLY B 1 147 ? 31.619  36.479 18.045  1.00 9.06  ? 125 GLY B C   1 
ATOM   3811 O  O   . GLY B 1 147 ? 31.003  35.410 17.974  1.00 9.79  ? 125 GLY B O   1 
ATOM   3812 N  N   . GLY B 1 148 ? 32.492  36.876 17.124  1.00 9.03  ? 126 GLY B N   1 
ATOM   3813 C  CA  . GLY B 1 148 ? 32.874  36.000 16.035  1.00 8.39  ? 126 GLY B CA  1 
ATOM   3814 C  C   . GLY B 1 148 ? 32.696  36.595 14.655  1.00 7.36  ? 126 GLY B C   1 
ATOM   3815 O  O   . GLY B 1 148 ? 31.764  37.362 14.395  1.00 9.86  ? 126 GLY B O   1 
ATOM   3816 N  N   . VAL B 1 149 ? 33.615  36.221 13.767  1.00 8.51  ? 127 VAL B N   1 
ATOM   3817 C  CA  . VAL B 1 149 ? 33.538  36.597 12.359  1.00 10.20 ? 127 VAL B CA  1 
ATOM   3818 C  C   . VAL B 1 149 ? 32.351  35.926 11.680  1.00 10.62 ? 127 VAL B C   1 
ATOM   3819 O  O   . VAL B 1 149 ? 32.319  34.695 11.528  1.00 12.36 ? 127 VAL B O   1 
ATOM   3820 C  CB  . VAL B 1 149 ? 34.829  36.217 11.613  1.00 8.25  ? 127 VAL B CB  1 
ATOM   3821 C  CG1 . VAL B 1 149 ? 34.693  36.529 10.124  1.00 9.21  ? 127 VAL B CG1 1 
ATOM   3822 C  CG2 . VAL B 1 149 ? 36.028  36.951 12.217  1.00 11.93 ? 127 VAL B CG2 1 
ATOM   3823 N  N   . ALA B 1 150 ? 31.377  36.743 11.283  1.00 7.78  ? 128 ALA B N   1 
ATOM   3824 C  CA  . ALA B 1 150 ? 30.213  36.266 10.550  1.00 8.32  ? 128 ALA B CA  1 
ATOM   3825 C  C   . ALA B 1 150 ? 30.475  36.319 9.050   1.00 11.74 ? 128 ALA B C   1 
ATOM   3826 O  O   . ALA B 1 150 ? 29.841  35.596 8.275   1.00 13.12 ? 128 ALA B O   1 
ATOM   3827 C  CB  . ALA B 1 150 ? 28.986  37.092 10.899  1.00 10.66 ? 128 ALA B CB  1 
ATOM   3828 N  N   . ALA B 1 151 ? 31.403  37.188 8.652   1.00 10.99 ? 129 ALA B N   1 
ATOM   3829 C  CA  . ALA B 1 151 ? 31.776  37.351 7.246   1.00 13.53 ? 129 ALA B CA  1 
ATOM   3830 C  C   . ALA B 1 151 ? 33.208  37.851 7.130   1.00 10.92 ? 129 ALA B C   1 
ATOM   3831 O  O   . ALA B 1 151 ? 33.578  38.839 7.767   1.00 13.25 ? 129 ALA B O   1 
ATOM   3832 C  CB  . ALA B 1 151 ? 30.838  38.332 6.570   1.00 15.99 ? 129 ALA B CB  1 
ATOM   3833 N  N   . GLU B 1 152 ? 34.000  37.188 6.292   1.00 10.62 ? 130 GLU B N   1 
ATOM   3834 C  CA  . GLU B 1 152 ? 35.386  37.600 6.051   1.00 9.86  ? 130 GLU B CA  1 
ATOM   3835 C  C   . GLU B 1 152 ? 35.476  38.882 5.234   1.00 10.69 ? 130 GLU B C   1 
ATOM   3836 O  O   . GLU B 1 152 ? 36.436  39.637 5.365   1.00 15.59 ? 130 GLU B O   1 
ATOM   3837 C  CB  . GLU B 1 152 ? 36.180  36.492 5.353   1.00 12.64 ? 130 GLU B CB  1 
ATOM   3838 C  CG  . GLU B 1 152 ? 36.519  35.316 6.243   1.00 14.86 ? 130 GLU B CG  1 
ATOM   3839 C  CD  . GLU B 1 152 ? 37.589  35.624 7.282   1.00 11.72 ? 130 GLU B CD  1 
ATOM   3840 O  OE1 . GLU B 1 152 ? 38.391  36.569 7.095   1.00 14.68 ? 130 GLU B OE1 1 
ATOM   3841 O  OE2 . GLU B 1 152 ? 37.650  34.877 8.276   1.00 15.95 ? 130 GLU B OE2 1 
ATOM   3842 N  N   . ARG B 1 153 ? 34.479  39.113 4.384   1.00 8.58  ? 131 ARG B N   1 
ATOM   3843 C  CA  . ARG B 1 153 ? 34.432  40.310 3.549   1.00 8.47  ? 131 ARG B CA  1 
ATOM   3844 C  C   . ARG B 1 153 ? 33.115  41.014 3.834   1.00 11.13 ? 131 ARG B C   1 
ATOM   3845 O  O   . ARG B 1 153 ? 32.042  40.396 3.778   1.00 12.43 ? 131 ARG B O   1 
ATOM   3846 C  CB  . ARG B 1 153 ? 34.528  39.938 2.064   1.00 11.84 ? 131 ARG B CB  1 
ATOM   3847 C  CG  . ARG B 1 153 ? 34.769  41.134 1.145   1.00 13.13 ? 131 ARG B CG  1 
ATOM   3848 C  CD  . ARG B 1 153 ? 34.489  40.802 -0.317  1.00 13.85 ? 131 ARG B CD  1 
ATOM   3849 N  NE  . ARG B 1 153 ? 35.192  39.605 -0.780  1.00 12.33 ? 131 ARG B NE  1 
ATOM   3850 C  CZ  . ARG B 1 153 ? 36.438  39.597 -1.254  1.00 12.23 ? 131 ARG B CZ  1 
ATOM   3851 N  NH1 . ARG B 1 153 ? 37.133  40.729 -1.319  1.00 9.93  ? 131 ARG B NH1 1 
ATOM   3852 N  NH2 . ARG B 1 153 ? 36.990  38.460 -1.657  1.00 12.20 ? 131 ARG B NH2 1 
ATOM   3853 N  N   . VAL B 1 154 ? 33.189  42.300 4.154   1.00 7.90  ? 132 VAL B N   1 
ATOM   3854 C  CA  . VAL B 1 154 ? 31.977  43.041 4.486   1.00 8.69  ? 132 VAL B CA  1 
ATOM   3855 C  C   . VAL B 1 154 ? 31.638  44.049 3.401   1.00 8.85  ? 132 VAL B C   1 
ATOM   3856 O  O   . VAL B 1 154 ? 32.521  44.547 2.707   1.00 9.47  ? 132 VAL B O   1 
ATOM   3857 C  CB  . VAL B 1 154 ? 32.081  43.743 5.857   1.00 14.21 ? 132 VAL B CB  1 
ATOM   3858 C  CG1 . VAL B 1 154 ? 32.191  42.706 6.963   1.00 14.88 ? 132 VAL B CG1 1 
ATOM   3859 C  CG2 . VAL B 1 154 ? 33.260  44.694 5.899   1.00 11.61 ? 132 VAL B CG2 1 
ATOM   3860 N  N   . PRO B 1 155 ? 30.347  44.353 3.244   1.00 9.30  ? 133 PRO B N   1 
ATOM   3861 C  CA  . PRO B 1 155 ? 29.993  45.396 2.278   1.00 7.96  ? 133 PRO B CA  1 
ATOM   3862 C  C   . PRO B 1 155 ? 30.446  46.773 2.745   1.00 7.74  ? 133 PRO B C   1 
ATOM   3863 O  O   . PRO B 1 155 ? 30.554  47.004 3.951   1.00 8.08  ? 133 PRO B O   1 
ATOM   3864 C  CB  . PRO B 1 155 ? 28.463  45.325 2.243   1.00 9.39  ? 133 PRO B CB  1 
ATOM   3865 C  CG  . PRO B 1 155 ? 28.085  44.801 3.611   1.00 9.60  ? 133 PRO B CG  1 
ATOM   3866 C  CD  . PRO B 1 155 ? 29.176  43.820 3.967   1.00 9.75  ? 133 PRO B CD  1 
ATOM   3867 N  N   . SER B 1 156 ? 30.732  47.673 1.803   1.00 7.22  ? 134 SER B N   1 
ATOM   3868 C  CA  . SER B 1 156 ? 30.913  49.086 2.136   1.00 6.63  ? 134 SER B CA  1 
ATOM   3869 C  C   . SER B 1 156 ? 29.804  49.877 1.444   1.00 8.31  ? 134 SER B C   1 
ATOM   3870 O  O   . SER B 1 156 ? 28.933  49.302 0.786   1.00 8.92  ? 134 SER B O   1 
ATOM   3871 C  CB  . SER B 1 156 ? 32.298  49.585 1.699   1.00 6.62  ? 134 SER B CB  1 
ATOM   3872 O  OG  . SER B 1 156 ? 32.571  50.867 2.261   1.00 7.97  ? 134 SER B OG  1 
ATOM   3873 N  N   . TYR B 1 157 ? 29.816  51.192 1.609   1.00 6.73  ? 135 TYR B N   1 
ATOM   3874 C  CA  . TYR B 1 157 ? 28.915  52.043 0.847   1.00 6.11  ? 135 TYR B CA  1 
ATOM   3875 C  C   . TYR B 1 157 ? 29.647  53.318 0.475   1.00 7.54  ? 135 TYR B C   1 
ATOM   3876 O  O   . TYR B 1 157 ? 30.590  53.732 1.170   1.00 9.08  ? 135 TYR B O   1 
ATOM   3877 C  CB  . TYR B 1 157 ? 27.601  52.335 1.602   1.00 6.58  ? 135 TYR B CB  1 
ATOM   3878 C  CG  . TYR B 1 157 ? 27.701  53.209 2.845   1.00 8.05  ? 135 TYR B CG  1 
ATOM   3879 C  CD1 . TYR B 1 157 ? 27.556  54.594 2.768   1.00 6.92  ? 135 TYR B CD1 1 
ATOM   3880 C  CD2 . TYR B 1 157 ? 27.893  52.645 4.103   1.00 6.77  ? 135 TYR B CD2 1 
ATOM   3881 C  CE1 . TYR B 1 157 ? 27.625  55.391 3.906   1.00 6.78  ? 135 TYR B CE1 1 
ATOM   3882 C  CE2 . TYR B 1 157 ? 27.964  53.445 5.244   1.00 6.17  ? 135 TYR B CE2 1 
ATOM   3883 C  CZ  . TYR B 1 157 ? 27.828  54.806 5.136   1.00 7.25  ? 135 TYR B CZ  1 
ATOM   3884 O  OH  . TYR B 1 157 ? 27.890  55.609 6.261   1.00 9.59  ? 135 TYR B OH  1 
ATOM   3885 N  N   . TYR B 1 158 ? 29.238  53.929 -0.633  1.00 7.68  ? 136 TYR B N   1 
ATOM   3886 C  CA  . TYR B 1 158 ? 29.895  55.143 -1.089  1.00 8.67  ? 136 TYR B CA  1 
ATOM   3887 C  C   . TYR B 1 158 ? 29.019  56.326 -0.733  1.00 10.13 ? 136 TYR B C   1 
ATOM   3888 O  O   . TYR B 1 158 ? 27.821  56.315 -1.013  1.00 9.16  ? 136 TYR B O   1 
ATOM   3889 C  CB  . TYR B 1 158 ? 30.151  55.116 -2.600  1.00 9.95  ? 136 TYR B CB  1 
ATOM   3890 C  CG  . TYR B 1 158 ? 31.072  56.240 -3.014  1.00 12.40 ? 136 TYR B CG  1 
ATOM   3891 C  CD1 . TYR B 1 158 ? 32.444  56.111 -2.867  1.00 15.96 ? 136 TYR B CD1 1 
ATOM   3892 C  CD2 . TYR B 1 158 ? 30.568  57.439 -3.494  1.00 21.85 ? 136 TYR B CD2 1 
ATOM   3893 C  CE1 . TYR B 1 158 ? 33.299  57.139 -3.211  1.00 21.52 ? 136 TYR B CE1 1 
ATOM   3894 C  CE2 . TYR B 1 158 ? 31.419  58.478 -3.846  1.00 20.76 ? 136 TYR B CE2 1 
ATOM   3895 C  CZ  . TYR B 1 158 ? 32.780  58.317 -3.698  1.00 25.76 ? 136 TYR B CZ  1 
ATOM   3896 O  OH  . TYR B 1 158 ? 33.641  59.335 -4.044  1.00 35.08 ? 136 TYR B OH  1 
ATOM   3897 N  N   . ALA B 1 159 ? 29.614  57.333 -0.100  1.00 8.22  ? 137 ALA B N   1 
ATOM   3898 C  CA  . ALA B 1 159 ? 28.879  58.532 0.278   1.00 6.77  ? 137 ALA B CA  1 
ATOM   3899 C  C   . ALA B 1 159 ? 29.273  59.675 -0.644  1.00 11.97 ? 137 ALA B C   1 
ATOM   3900 O  O   . ALA B 1 159 ? 30.433  60.084 -0.669  1.00 15.13 ? 137 ALA B O   1 
ATOM   3901 C  CB  . ALA B 1 159 ? 29.164  58.893 1.742   1.00 11.46 ? 137 ALA B CB  1 
ATOM   3902 N  N   . THR B 1 160 ? 28.318  60.194 -1.413  1.00 8.76  ? 138 THR B N   1 
ATOM   3903 C  CA  . THR B 1 160 ? 28.629  61.288 -2.324  1.00 9.15  ? 138 THR B CA  1 
ATOM   3904 C  C   . THR B 1 160 ? 28.659  62.623 -1.597  1.00 13.50 ? 138 THR B C   1 
ATOM   3905 O  O   . THR B 1 160 ? 27.982  62.805 -0.593  1.00 18.82 ? 138 THR B O   1 
ATOM   3906 C  CB  . THR B 1 160 ? 27.626  61.383 -3.485  1.00 14.79 ? 138 THR B CB  1 
ATOM   3907 O  OG1 . THR B 1 160 ? 26.321  61.664 -2.969  1.00 16.54 ? 138 THR B OG1 1 
ATOM   3908 C  CG2 . THR B 1 160 ? 27.607  60.086 -4.297  1.00 22.51 ? 138 THR B CG2 1 
ATOM   3909 N  N   . GLY B 1 161 ? 29.452  63.555 -2.110  1.00 21.97 ? 139 GLY B N   1 
ATOM   3910 C  CA  . GLY B 1 161 ? 29.440  64.906 -1.587  1.00 23.22 ? 139 GLY B CA  1 
ATOM   3911 C  C   . GLY B 1 161 ? 28.236  65.646 -2.135  1.00 22.30 ? 139 GLY B C   1 
ATOM   3912 O  O   . GLY B 1 161 ? 27.513  65.130 -2.980  1.00 24.90 ? 139 GLY B O   1 
ATOM   3913 N  N   . ILE B 1 162 ? 28.000  66.854 -1.643  1.00 26.63 ? 140 ILE B N   1 
ATOM   3914 C  CA  . ILE B 1 162 ? 26.929  67.671 -2.195  1.00 24.60 ? 140 ILE B CA  1 
ATOM   3915 C  C   . ILE B 1 162 ? 27.435  68.299 -3.493  1.00 26.68 ? 140 ILE B C   1 
ATOM   3916 O  O   . ILE B 1 162 ? 28.573  68.763 -3.551  1.00 32.28 ? 140 ILE B O   1 
ATOM   3917 C  CB  . ILE B 1 162 ? 26.473  68.740 -1.187  1.00 21.40 ? 140 ILE B CB  1 
ATOM   3918 C  CG1 . ILE B 1 162 ? 25.950  68.062 0.084   1.00 23.73 ? 140 ILE B CG1 1 
ATOM   3919 C  CG2 . ILE B 1 162 ? 25.386  69.614 -1.786  1.00 21.62 ? 140 ILE B CG2 1 
ATOM   3920 C  CD1 . ILE B 1 162 ? 25.830  68.983 1.284   1.00 25.59 ? 140 ILE B CD1 1 
ATOM   3921 N  N   . GLY B 1 163 ? 26.608  68.285 -4.536  1.00 20.26 ? 141 GLY B N   1 
ATOM   3922 C  CA  . GLY B 1 163 ? 26.999  68.822 -5.831  1.00 22.23 ? 141 GLY B CA  1 
ATOM   3923 C  C   . GLY B 1 163 ? 25.851  68.922 -6.821  1.00 22.78 ? 141 GLY B C   1 
ATOM   3924 O  O   . GLY B 1 163 ? 24.689  68.776 -6.444  1.00 24.41 ? 141 GLY B O   1 
ATOM   3925 N  N   . GLN B 1 164 ? 26.172  69.178 -8.088  1.00 21.06 ? 142 GLN B N   1 
ATOM   3926 C  CA  . GLN B 1 164 ? 25.167  69.271 -9.147  1.00 19.86 ? 142 GLN B CA  1 
ATOM   3927 C  C   . GLN B 1 164 ? 24.469  67.937 -9.332  1.00 15.58 ? 142 GLN B C   1 
ATOM   3928 O  O   . GLN B 1 164 ? 25.128  66.902 -9.358  1.00 15.59 ? 142 GLN B O   1 
ATOM   3929 C  CB  . GLN B 1 164 ? 25.824  69.645 -10.477 1.00 26.49 ? 142 GLN B CB  1 
ATOM   3930 C  CG  . GLN B 1 164 ? 25.756  71.109 -10.850 1.00 28.91 ? 142 GLN B CG  1 
ATOM   3931 C  CD  . GLN B 1 164 ? 26.361  71.376 -12.217 1.00 34.62 ? 142 GLN B CD  1 
ATOM   3932 O  OE1 . GLN B 1 164 ? 25.731  71.127 -13.246 1.00 33.59 ? 142 GLN B OE1 1 
ATOM   3933 N  NE2 . GLN B 1 164 ? 27.593  71.875 -12.234 1.00 39.35 ? 142 GLN B NE2 1 
ATOM   3934 N  N   . PRO B 1 165 ? 23.135  67.954 -9.476  1.00 15.27 ? 143 PRO B N   1 
ATOM   3935 C  CA  . PRO B 1 165 ? 22.353  66.720 -9.628  1.00 14.65 ? 143 PRO B CA  1 
ATOM   3936 C  C   . PRO B 1 165 ? 22.887  65.721 -10.667 1.00 13.45 ? 143 PRO B C   1 
ATOM   3937 O  O   . PRO B 1 165 ? 23.029  64.536 -10.346 1.00 15.69 ? 143 PRO B O   1 
ATOM   3938 C  CB  . PRO B 1 165 ? 20.966  67.238 -10.016 1.00 18.26 ? 143 PRO B CB  1 
ATOM   3939 C  CG  . PRO B 1 165 ? 20.867  68.542 -9.273  1.00 16.76 ? 143 PRO B CG  1 
ATOM   3940 C  CD  . PRO B 1 165 ? 22.265  69.137 -9.318  1.00 17.87 ? 143 PRO B CD  1 
ATOM   3941 N  N   A ASP B 1 166 ? 23.185  66.192 -11.875 0.48 15.70 ? 144 ASP B N   1 
ATOM   3942 N  N   B ASP B 1 166 ? 23.176  66.171 -11.887 0.52 15.68 ? 144 ASP B N   1 
ATOM   3943 C  CA  A ASP B 1 166 ? 23.677  65.318 -12.937 0.48 14.52 ? 144 ASP B CA  1 
ATOM   3944 C  CA  B ASP B 1 166 ? 23.655  65.245 -12.912 0.52 14.07 ? 144 ASP B CA  1 
ATOM   3945 C  C   A ASP B 1 166 ? 25.064  64.753 -12.652 0.48 14.77 ? 144 ASP B C   1 
ATOM   3946 C  C   B ASP B 1 166 ? 25.081  64.743 -12.667 0.52 14.75 ? 144 ASP B C   1 
ATOM   3947 O  O   A ASP B 1 166 ? 25.360  63.607 -12.995 0.48 13.85 ? 144 ASP B O   1 
ATOM   3948 O  O   B ASP B 1 166 ? 25.418  63.623 -13.050 0.52 13.95 ? 144 ASP B O   1 
ATOM   3949 C  CB  A ASP B 1 166 ? 23.674  66.053 -14.279 0.48 16.08 ? 144 ASP B CB  1 
ATOM   3950 C  CB  B ASP B 1 166 ? 23.498  65.821 -14.326 0.52 16.53 ? 144 ASP B CB  1 
ATOM   3951 C  CG  A ASP B 1 166 ? 22.279  66.276 -14.808 0.48 21.04 ? 144 ASP B CG  1 
ATOM   3952 C  CG  B ASP B 1 166 ? 24.086  67.205 -14.467 0.52 18.28 ? 144 ASP B CG  1 
ATOM   3953 O  OD1 A ASP B 1 166 ? 21.680  65.307 -15.319 0.48 27.69 ? 144 ASP B OD1 1 
ATOM   3954 O  OD1 B ASP B 1 166 ? 24.958  67.580 -13.652 0.52 19.51 ? 144 ASP B OD1 1 
ATOM   3955 O  OD2 A ASP B 1 166 ? 21.783  67.415 -14.713 0.48 28.22 ? 144 ASP B OD2 1 
ATOM   3956 O  OD2 B ASP B 1 166 ? 23.672  67.917 -15.409 0.52 21.73 ? 144 ASP B OD2 1 
ATOM   3957 N  N   . GLU B 1 167 ? 25.911  65.557 -12.022 1.00 13.28 ? 145 GLU B N   1 
ATOM   3958 C  CA  . GLU B 1 167 ? 27.257  65.111 -11.664 1.00 17.03 ? 145 GLU B CA  1 
ATOM   3959 C  C   . GLU B 1 167 ? 27.206  64.035 -10.590 1.00 12.80 ? 145 GLU B C   1 
ATOM   3960 O  O   . GLU B 1 167 ? 27.920  63.036 -10.675 1.00 12.29 ? 145 GLU B O   1 
ATOM   3961 C  CB  . GLU B 1 167 ? 28.141  66.273 -11.206 1.00 20.05 ? 145 GLU B CB  1 
ATOM   3962 C  CG  . GLU B 1 167 ? 29.581  65.856 -10.887 1.00 29.40 ? 145 GLU B CG  1 
ATOM   3963 C  CD  . GLU B 1 167 ? 30.308  65.185 -12.055 1.00 38.75 ? 145 GLU B CD  1 
ATOM   3964 O  OE1 . GLU B 1 167 ? 29.869  65.314 -13.221 1.00 41.24 ? 145 GLU B OE1 1 
ATOM   3965 O  OE2 . GLU B 1 167 ? 31.339  64.526 -11.797 1.00 42.53 ? 145 GLU B OE2 1 
ATOM   3966 N  N   . ILE B 1 168 ? 26.347  64.226 -9.592  1.00 11.70 ? 146 ILE B N   1 
ATOM   3967 C  CA  . ILE B 1 168 ? 26.185  63.233 -8.536  1.00 11.24 ? 146 ILE B CA  1 
ATOM   3968 C  C   . ILE B 1 168 ? 25.603  61.936 -9.108  1.00 12.27 ? 146 ILE B C   1 
ATOM   3969 O  O   . ILE B 1 168 ? 26.026  60.839 -8.740  1.00 9.79  ? 146 ILE B O   1 
ATOM   3970 C  CB  . ILE B 1 168 ? 25.300  63.766 -7.375  1.00 9.35  ? 146 ILE B CB  1 
ATOM   3971 C  CG1 . ILE B 1 168 ? 25.962  64.988 -6.725  1.00 15.61 ? 146 ILE B CG1 1 
ATOM   3972 C  CG2 . ILE B 1 168 ? 25.041  62.678 -6.334  1.00 8.28  ? 146 ILE B CG2 1 
ATOM   3973 C  CD1 . ILE B 1 168 ? 27.396  64.755 -6.270  1.00 17.30 ? 146 ILE B CD1 1 
ATOM   3974 N  N   . ALA B 1 169 ? 24.650  62.063 -10.028 1.00 11.65 ? 147 ALA B N   1 
ATOM   3975 C  CA  . ALA B 1 169 ? 24.084  60.889 -10.695 1.00 12.30 ? 147 ALA B CA  1 
ATOM   3976 C  C   . ALA B 1 169 ? 25.139  60.108 -11.479 1.00 13.21 ? 147 ALA B C   1 
ATOM   3977 O  O   . ALA B 1 169 ? 25.128  58.878 -11.465 1.00 12.64 ? 147 ALA B O   1 
ATOM   3978 C  CB  . ALA B 1 169 ? 22.920  61.284 -11.603 1.00 13.86 ? 147 ALA B CB  1 
ATOM   3979 N  N   . ARG B 1 170 ? 26.038  60.818 -12.161 1.00 11.71 ? 148 ARG B N   1 
ATOM   3980 C  CA  . ARG B 1 170 ? 27.139  60.172 -12.888 1.00 11.62 ? 148 ARG B CA  1 
ATOM   3981 C  C   . ARG B 1 170 ? 28.062  59.410 -11.943 1.00 11.83 ? 148 ARG B C   1 
ATOM   3982 O  O   . ARG B 1 170 ? 28.399  58.245 -12.190 1.00 13.87 ? 148 ARG B O   1 
ATOM   3983 C  CB  . ARG B 1 170 ? 27.951  61.199 -13.682 1.00 14.28 ? 148 ARG B CB  1 
ATOM   3984 C  CG  . ARG B 1 170 ? 29.162  60.582 -14.377 1.00 21.29 ? 148 ARG B CG  1 
ATOM   3985 C  CD  . ARG B 1 170 ? 30.056  61.616 -15.054 1.00 29.68 ? 148 ARG B CD  1 
ATOM   3986 N  NE  . ARG B 1 170 ? 30.809  62.420 -14.092 1.00 35.59 ? 148 ARG B NE  1 
ATOM   3987 C  CZ  . ARG B 1 170 ? 31.859  61.983 -13.399 1.00 40.85 ? 148 ARG B CZ  1 
ATOM   3988 N  NH1 . ARG B 1 170 ? 32.481  62.789 -12.552 1.00 42.20 ? 148 ARG B NH1 1 
ATOM   3989 N  NH2 . ARG B 1 170 ? 32.289  60.738 -13.544 1.00 43.61 ? 148 ARG B NH2 1 
ATOM   3990 N  N   . ILE B 1 171 ? 28.464  60.068 -10.859 1.00 11.85 ? 149 ILE B N   1 
ATOM   3991 C  CA  . ILE B 1 171 ? 29.313  59.441 -9.848  1.00 12.84 ? 149 ILE B CA  1 
ATOM   3992 C  C   . ILE B 1 171 ? 28.632  58.214 -9.247  1.00 14.06 ? 149 ILE B C   1 
ATOM   3993 O  O   . ILE B 1 171 ? 29.262  57.164 -9.074  1.00 12.72 ? 149 ILE B O   1 
ATOM   3994 C  CB  . ILE B 1 171 ? 29.711  60.450 -8.749  1.00 14.64 ? 149 ILE B CB  1 
ATOM   3995 C  CG1 . ILE B 1 171 ? 30.564  61.563 -9.361  1.00 18.99 ? 149 ILE B CG1 1 
ATOM   3996 C  CG2 . ILE B 1 171 ? 30.458  59.753 -7.601  1.00 15.42 ? 149 ILE B CG2 1 
ATOM   3997 C  CD1 . ILE B 1 171 ? 30.794  62.735 -8.433  1.00 23.50 ? 149 ILE B CD1 1 
ATOM   3998 N  N   . ALA B 1 172 ? 27.341  58.336 -8.955  1.00 11.05 ? 150 ALA B N   1 
ATOM   3999 C  CA  . ALA B 1 172 ? 26.583  57.217 -8.407  1.00 10.34 ? 150 ALA B CA  1 
ATOM   4000 C  C   . ALA B 1 172 ? 26.649  56.008 -9.335  1.00 9.74  ? 150 ALA B C   1 
ATOM   4001 O  O   . ALA B 1 172 ? 26.896  54.893 -8.884  1.00 12.08 ? 150 ALA B O   1 
ATOM   4002 C  CB  . ALA B 1 172 ? 25.134  57.625 -8.139  1.00 11.34 ? 150 ALA B CB  1 
ATOM   4003 N  N   . ALA B 1 173 ? 26.448  56.238 -10.632 1.00 12.19 ? 151 ALA B N   1 
ATOM   4004 C  CA  . ALA B 1 173 ? 26.491  55.166 -11.621 1.00 12.81 ? 151 ALA B CA  1 
ATOM   4005 C  C   . ALA B 1 173 ? 27.869  54.513 -11.661 1.00 10.47 ? 151 ALA B C   1 
ATOM   4006 O  O   . ALA B 1 173 ? 27.987  53.285 -11.773 1.00 13.20 ? 151 ALA B O   1 
ATOM   4007 C  CB  . ALA B 1 173 ? 26.129  55.703 -12.989 1.00 15.18 ? 151 ALA B CB  1 
ATOM   4008 N  N   A GLU B 1 174 ? 28.905  55.340 -11.572 0.52 11.41 ? 152 GLU B N   1 
ATOM   4009 N  N   B GLU B 1 174 ? 28.911  55.329 -11.566 0.48 11.46 ? 152 GLU B N   1 
ATOM   4010 C  CA  A GLU B 1 174 ? 30.287  54.866 -11.577 0.52 11.24 ? 152 GLU B CA  1 
ATOM   4011 C  CA  B GLU B 1 174 ? 30.276  54.812 -11.589 0.48 10.81 ? 152 GLU B CA  1 
ATOM   4012 C  C   A GLU B 1 174 ? 30.576  53.954 -10.386 0.52 11.29 ? 152 GLU B C   1 
ATOM   4013 C  C   B GLU B 1 174 ? 30.570  53.932 -10.380 0.48 11.26 ? 152 GLU B C   1 
ATOM   4014 O  O   A GLU B 1 174 ? 31.200  52.899 -10.536 0.52 11.81 ? 152 GLU B O   1 
ATOM   4015 O  O   B GLU B 1 174 ? 31.191  52.874 -10.512 0.48 11.72 ? 152 GLU B O   1 
ATOM   4016 C  CB  A GLU B 1 174 ? 31.246  56.063 -11.570 0.52 13.05 ? 152 GLU B CB  1 
ATOM   4017 C  CB  B GLU B 1 174 ? 31.280  55.963 -11.676 0.48 13.97 ? 152 GLU B CB  1 
ATOM   4018 C  CG  A GLU B 1 174 ? 32.721  55.694 -11.524 0.52 19.10 ? 152 GLU B CG  1 
ATOM   4019 C  CG  B GLU B 1 174 ? 31.170  56.747 -12.964 0.48 18.19 ? 152 GLU B CG  1 
ATOM   4020 C  CD  A GLU B 1 174 ? 33.613  56.907 -11.338 0.52 30.42 ? 152 GLU B CD  1 
ATOM   4021 C  CD  B GLU B 1 174 ? 32.279  57.754 -13.143 0.48 27.44 ? 152 GLU B CD  1 
ATOM   4022 O  OE1 A GLU B 1 174 ? 33.512  57.849 -12.153 0.52 36.23 ? 152 GLU B OE1 1 
ATOM   4023 O  OE1 B GLU B 1 174 ? 33.153  57.843 -12.256 0.48 33.80 ? 152 GLU B OE1 1 
ATOM   4024 O  OE2 A GLU B 1 174 ? 34.409  56.923 -10.373 0.52 27.81 ? 152 GLU B OE2 1 
ATOM   4025 O  OE2 B GLU B 1 174 ? 32.278  58.460 -14.174 0.48 27.93 ? 152 GLU B OE2 1 
ATOM   4026 N  N   . LYS B 1 175 ? 30.117  54.361 -9.206  1.00 9.99  ? 153 LYS B N   1 
ATOM   4027 C  CA  . LYS B 1 175 ? 30.363  53.601 -7.983  1.00 9.69  ? 153 LYS B CA  1 
ATOM   4028 C  C   . LYS B 1 175 ? 29.597  52.277 -7.933  1.00 10.39 ? 153 LYS B C   1 
ATOM   4029 O  O   . LYS B 1 175 ? 30.100  51.279 -7.402  1.00 11.41 ? 153 LYS B O   1 
ATOM   4030 C  CB  . LYS B 1 175 ? 30.068  54.457 -6.743  1.00 9.50  ? 153 LYS B CB  1 
ATOM   4031 C  CG  . LYS B 1 175 ? 30.975  55.663 -6.630  1.00 13.02 ? 153 LYS B CG  1 
ATOM   4032 C  CD  . LYS B 1 175 ? 32.430  55.245 -6.551  1.00 16.22 ? 153 LYS B CD  1 
ATOM   4033 C  CE  . LYS B 1 175 ? 33.357  56.447 -6.716  1.00 21.53 ? 153 LYS B CE  1 
ATOM   4034 N  NZ  . LYS B 1 175 ? 34.782  56.041 -6.627  1.00 27.05 ? 153 LYS B NZ  1 
ATOM   4035 N  N   . VAL B 1 176 ? 28.383  52.269 -8.482  1.00 11.07 ? 154 VAL B N   1 
ATOM   4036 C  CA  . VAL B 1 176 ? 27.648  51.017 -8.664  1.00 12.93 ? 154 VAL B CA  1 
ATOM   4037 C  C   . VAL B 1 176 ? 28.427  50.065 -9.589  1.00 12.03 ? 154 VAL B C   1 
ATOM   4038 O  O   . VAL B 1 176 ? 28.569  48.878 -9.289  1.00 13.79 ? 154 VAL B O   1 
ATOM   4039 C  CB  . VAL B 1 176 ? 26.218  51.272 -9.203  1.00 12.74 ? 154 VAL B CB  1 
ATOM   4040 C  CG1 . VAL B 1 176 ? 25.559  49.964 -9.622  1.00 15.73 ? 154 VAL B CG1 1 
ATOM   4041 C  CG2 . VAL B 1 176 ? 25.383  51.979 -8.145  1.00 12.50 ? 154 VAL B CG2 1 
ATOM   4042 N  N   . ALA B 1 177 ? 28.947  50.588 -10.698 1.00 11.31 ? 155 ALA B N   1 
ATOM   4043 C  CA  . ALA B 1 177 ? 29.763  49.782 -11.611 1.00 11.30 ? 155 ALA B CA  1 
ATOM   4044 C  C   . ALA B 1 177 ? 31.029  49.242 -10.946 1.00 16.68 ? 155 ALA B C   1 
ATOM   4045 O  O   . ALA B 1 177 ? 31.518  48.176 -11.316 1.00 16.94 ? 155 ALA B O   1 
ATOM   4046 C  CB  . ALA B 1 177 ? 30.112  50.571 -12.864 1.00 13.75 ? 155 ALA B CB  1 
ATOM   4047 N  N   . GLU B 1 178 ? 31.553  49.971 -9.963  1.00 14.77 ? 156 GLU B N   1 
ATOM   4048 C  CA  . GLU B 1 178 ? 32.707  49.495 -9.195  1.00 14.43 ? 156 GLU B CA  1 
ATOM   4049 C  C   . GLU B 1 178 ? 32.338  48.367 -8.243  1.00 17.98 ? 156 GLU B C   1 
ATOM   4050 O  O   . GLU B 1 178 ? 33.211  47.623 -7.795  1.00 19.96 ? 156 GLU B O   1 
ATOM   4051 C  CB  . GLU B 1 178 ? 33.323  50.612 -8.360  1.00 18.63 ? 156 GLU B CB  1 
ATOM   4052 C  CG  . GLU B 1 178 ? 34.200  51.588 -9.087  1.00 23.84 ? 156 GLU B CG  1 
ATOM   4053 C  CD  . GLU B 1 178 ? 34.904  52.517 -8.116  1.00 29.15 ? 156 GLU B CD  1 
ATOM   4054 O  OE1 . GLU B 1 178 ? 35.113  52.115 -6.946  1.00 29.27 ? 156 GLU B OE1 1 
ATOM   4055 O  OE2 . GLU B 1 178 ? 35.238  53.647 -8.519  1.00 34.31 ? 156 GLU B OE2 1 
ATOM   4056 N  N   . GLY B 1 179 ? 31.057  48.266 -7.898  1.00 13.03 ? 157 GLY B N   1 
ATOM   4057 C  CA  . GLY B 1 179 ? 30.599  47.189 -7.038  1.00 12.27 ? 157 GLY B CA  1 
ATOM   4058 C  C   . GLY B 1 179 ? 30.014  47.556 -5.686  1.00 9.20  ? 157 GLY B C   1 
ATOM   4059 O  O   . GLY B 1 179 ? 29.621  46.667 -4.924  1.00 10.92 ? 157 GLY B O   1 
ATOM   4060 N  N   . PHE B 1 180 ? 29.943  48.847 -5.368  1.00 9.83  ? 158 PHE B N   1 
ATOM   4061 C  CA  . PHE B 1 180 ? 29.302  49.265 -4.123  1.00 8.97  ? 158 PHE B CA  1 
ATOM   4062 C  C   . PHE B 1 180 ? 27.846  48.817 -4.124  1.00 10.04 ? 158 PHE B C   1 
ATOM   4063 O  O   . PHE B 1 180 ? 27.114  49.092 -5.077  1.00 11.63 ? 158 PHE B O   1 
ATOM   4064 C  CB  . PHE B 1 180 ? 29.376  50.783 -3.965  1.00 8.13  ? 158 PHE B CB  1 
ATOM   4065 C  CG  . PHE B 1 180 ? 30.722  51.287 -3.496  1.00 7.59  ? 158 PHE B CG  1 
ATOM   4066 C  CD1 . PHE B 1 180 ? 31.014  51.340 -2.141  1.00 10.09 ? 158 PHE B CD1 1 
ATOM   4067 C  CD2 . PHE B 1 180 ? 31.688  51.707 -4.405  1.00 8.72  ? 158 PHE B CD2 1 
ATOM   4068 C  CE1 . PHE B 1 180 ? 32.238  51.811 -1.692  1.00 10.16 ? 158 PHE B CE1 1 
ATOM   4069 C  CE2 . PHE B 1 180 ? 32.919  52.168 -3.967  1.00 11.74 ? 158 PHE B CE2 1 
ATOM   4070 C  CZ  . PHE B 1 180 ? 33.190  52.221 -2.605  1.00 9.36  ? 158 PHE B CZ  1 
ATOM   4071 N  N   . PRO B 1 181 ? 27.426  48.106 -3.069  1.00 10.16 ? 159 PRO B N   1 
ATOM   4072 C  CA  . PRO B 1 181 ? 26.050  47.606 -2.946  1.00 11.77 ? 159 PRO B CA  1 
ATOM   4073 C  C   . PRO B 1 181 ? 25.073  48.645 -2.406  1.00 10.78 ? 159 PRO B C   1 
ATOM   4074 O  O   . PRO B 1 181 ? 23.861  48.396 -2.403  1.00 10.38 ? 159 PRO B O   1 
ATOM   4075 C  CB  . PRO B 1 181 ? 26.188  46.443 -1.958  1.00 10.73 ? 159 PRO B CB  1 
ATOM   4076 C  CG  . PRO B 1 181 ? 27.378  46.807 -1.125  1.00 11.40 ? 159 PRO B CG  1 
ATOM   4077 C  CD  . PRO B 1 181 ? 28.311  47.581 -2.008  1.00 11.64 ? 159 PRO B CD  1 
ATOM   4078 N  N   . ARG B 1 182 ? 25.585  49.788 -1.952  1.00 8.26  ? 160 ARG B N   1 
ATOM   4079 C  CA  . ARG B 1 182 ? 24.750  50.824 -1.350  1.00 6.21  ? 160 ARG B CA  1 
ATOM   4080 C  C   . ARG B 1 182 ? 25.407  52.173 -1.590  1.00 7.59  ? 160 ARG B C   1 
ATOM   4081 O  O   . ARG B 1 182 ? 26.646  52.274 -1.610  1.00 7.38  ? 160 ARG B O   1 
ATOM   4082 C  CB  . ARG B 1 182 ? 24.612  50.564 0.155   1.00 5.86  ? 160 ARG B CB  1 
ATOM   4083 C  CG  . ARG B 1 182 ? 23.748  51.556 0.926   1.00 6.14  ? 160 ARG B CG  1 
ATOM   4084 C  CD  . ARG B 1 182 ? 23.681  51.130 2.399   1.00 8.19  ? 160 ARG B CD  1 
ATOM   4085 N  NE  . ARG B 1 182 ? 22.689  51.853 3.197   1.00 7.47  ? 160 ARG B NE  1 
ATOM   4086 C  CZ  . ARG B 1 182 ? 22.975  52.703 4.182   1.00 9.13  ? 160 ARG B CZ  1 
ATOM   4087 N  NH1 . ARG B 1 182 ? 24.238  52.986 4.500   1.00 11.59 ? 160 ARG B NH1 1 
ATOM   4088 N  NH2 . ARG B 1 182 ? 21.990  53.279 4.865   1.00 10.32 ? 160 ARG B NH2 1 
ATOM   4089 N  N   . LEU B 1 183 ? 24.578  53.190 -1.805  1.00 6.64  ? 161 LEU B N   1 
ATOM   4090 C  CA  . LEU B 1 183 ? 25.041  54.566 -1.957  1.00 8.67  ? 161 LEU B CA  1 
ATOM   4091 C  C   . LEU B 1 183 ? 24.359  55.446 -0.927  1.00 9.60  ? 161 LEU B C   1 
ATOM   4092 O  O   . LEU B 1 183 ? 23.193  55.240 -0.598  1.00 10.15 ? 161 LEU B O   1 
ATOM   4093 C  CB  . LEU B 1 183 ? 24.699  55.094 -3.348  1.00 11.41 ? 161 LEU B CB  1 
ATOM   4094 C  CG  . LEU B 1 183 ? 25.282  54.329 -4.534  1.00 14.29 ? 161 LEU B CG  1 
ATOM   4095 C  CD1 . LEU B 1 183 ? 24.809  54.976 -5.819  1.00 16.21 ? 161 LEU B CD1 1 
ATOM   4096 C  CD2 . LEU B 1 183 ? 26.803  54.271 -4.489  1.00 12.77 ? 161 LEU B CD2 1 
ATOM   4097 N  N   . GLN B 1 184 ? 25.091  56.429 -0.413  1.00 6.08  ? 162 GLN B N   1 
ATOM   4098 C  CA  . GLN B 1 184 ? 24.501  57.443 0.447   1.00 6.43  ? 162 GLN B CA  1 
ATOM   4099 C  C   . GLN B 1 184 ? 24.666  58.783 -0.250  1.00 10.05 ? 162 GLN B C   1 
ATOM   4100 O  O   . GLN B 1 184 ? 25.788  59.190 -0.555  1.00 11.42 ? 162 GLN B O   1 
ATOM   4101 C  CB  . GLN B 1 184 ? 25.209  57.476 1.807   1.00 8.34  ? 162 GLN B CB  1 
ATOM   4102 C  CG  . GLN B 1 184 ? 24.637  58.530 2.771   1.00 11.46 ? 162 GLN B CG  1 
ATOM   4103 C  CD  . GLN B 1 184 ? 25.579  58.848 3.921   1.00 16.38 ? 162 GLN B CD  1 
ATOM   4104 O  OE1 . GLN B 1 184 ? 26.524  59.626 3.771   1.00 21.71 ? 162 GLN B OE1 1 
ATOM   4105 N  NE2 . GLN B 1 184 ? 25.321  58.255 5.073   1.00 13.64 ? 162 GLN B NE2 1 
ATOM   4106 N  N   . ILE B 1 185 ? 23.547  59.452 -0.516  1.00 8.23  ? 163 ILE B N   1 
ATOM   4107 C  CA  . ILE B 1 185 ? 23.561  60.755 -1.178  1.00 6.45  ? 163 ILE B CA  1 
ATOM   4108 C  C   . ILE B 1 185 ? 23.437  61.850 -0.136  1.00 8.56  ? 163 ILE B C   1 
ATOM   4109 O  O   . ILE B 1 185 ? 22.423  61.940 0.546   1.00 8.76  ? 163 ILE B O   1 
ATOM   4110 C  CB  . ILE B 1 185 ? 22.398  60.867 -2.179  1.00 9.58  ? 163 ILE B CB  1 
ATOM   4111 C  CG1 . ILE B 1 185 ? 22.447  59.701 -3.174  1.00 10.59 ? 163 ILE B CG1 1 
ATOM   4112 C  CG2 . ILE B 1 185 ? 22.422  62.216 -2.893  1.00 13.60 ? 163 ILE B CG2 1 
ATOM   4113 C  CD1 . ILE B 1 185 ? 23.792  59.514 -3.870  1.00 16.60 ? 163 ILE B CD1 1 
ATOM   4114 N  N   . LYS B 1 186 ? 24.465  62.686 -0.009  1.00 8.82  ? 164 LYS B N   1 
ATOM   4115 C  CA  . LYS B 1 186 ? 24.392  63.800 0.938   1.00 7.80  ? 164 LYS B CA  1 
ATOM   4116 C  C   . LYS B 1 186 ? 23.593  64.958 0.348   1.00 8.83  ? 164 LYS B C   1 
ATOM   4117 O  O   . LYS B 1 186 ? 23.744  65.292 -0.834  1.00 13.06 ? 164 LYS B O   1 
ATOM   4118 C  CB  . LYS B 1 186 ? 25.798  64.230 1.388   1.00 13.38 ? 164 LYS B CB  1 
ATOM   4119 C  CG  . LYS B 1 186 ? 26.480  63.153 2.248   1.00 21.61 ? 164 LYS B CG  1 
ATOM   4120 C  CD  . LYS B 1 186 ? 27.585  63.701 3.146   1.00 30.51 ? 164 LYS B CD  1 
ATOM   4121 C  CE  . LYS B 1 186 ? 28.075  62.631 4.131   1.00 31.84 ? 164 LYS B CE  1 
ATOM   4122 N  NZ  . LYS B 1 186 ? 26.974  62.127 5.016   1.00 25.69 ? 164 LYS B NZ  1 
ATOM   4123 N  N   . ILE B 1 187 ? 22.721  65.543 1.170   1.00 8.73  ? 165 ILE B N   1 
ATOM   4124 C  CA  . ILE B 1 187 ? 21.878  66.659 0.742   1.00 9.94  ? 165 ILE B CA  1 
ATOM   4125 C  C   . ILE B 1 187 ? 21.832  67.762 1.801   1.00 14.40 ? 165 ILE B C   1 
ATOM   4126 O  O   . ILE B 1 187 ? 22.368  67.600 2.894   1.00 12.22 ? 165 ILE B O   1 
ATOM   4127 C  CB  . ILE B 1 187 ? 20.432  66.196 0.415   1.00 11.04 ? 165 ILE B CB  1 
ATOM   4128 C  CG1 . ILE B 1 187 ? 19.747  65.612 1.653   1.00 11.99 ? 165 ILE B CG1 1 
ATOM   4129 C  CG2 . ILE B 1 187 ? 20.425  65.192 -0.750  1.00 14.00 ? 165 ILE B CG2 1 
ATOM   4130 C  CD1 . ILE B 1 187 ? 18.234  65.569 1.554   1.00 12.35 ? 165 ILE B CD1 1 
ATOM   4131 N  N   . GLY B 1 188 ? 21.205  68.884 1.457   1.00 14.27 ? 166 GLY B N   1 
ATOM   4132 C  CA  . GLY B 1 188 ? 20.937  69.949 2.416   1.00 12.92 ? 166 GLY B CA  1 
ATOM   4133 C  C   . GLY B 1 188 ? 21.826  71.166 2.239   1.00 14.67 ? 166 GLY B C   1 
ATOM   4134 O  O   . GLY B 1 188 ? 22.767  71.164 1.439   1.00 17.61 ? 166 GLY B O   1 
ATOM   4135 N  N   . GLY B 1 189 ? 21.527  72.226 2.988   1.00 14.47 ? 167 GLY B N   1 
ATOM   4136 C  CA  . GLY B 1 189 ? 22.330  73.435 2.915   1.00 16.46 ? 167 GLY B CA  1 
ATOM   4137 C  C   . GLY B 1 189 ? 22.065  74.287 1.684   1.00 16.22 ? 167 GLY B C   1 
ATOM   4138 O  O   . GLY B 1 189 ? 22.838  75.192 1.366   1.00 17.24 ? 167 GLY B O   1 
ATOM   4139 N  N   . ARG B 1 190 ? 20.955  74.004 1.010   1.00 16.94 ? 168 ARG B N   1 
ATOM   4140 C  CA  . ARG B 1 190 ? 20.559  74.689 -0.214  1.00 15.13 ? 168 ARG B CA  1 
ATOM   4141 C  C   . ARG B 1 190 ? 19.067  74.406 -0.393  1.00 14.54 ? 168 ARG B C   1 
ATOM   4142 O  O   . ARG B 1 190 ? 18.508  73.597 0.356   1.00 14.04 ? 168 ARG B O   1 
ATOM   4143 C  CB  . ARG B 1 190 ? 21.358  74.141 -1.401  1.00 14.48 ? 168 ARG B CB  1 
ATOM   4144 C  CG  . ARG B 1 190 ? 21.074  72.677 -1.662  1.00 13.57 ? 168 ARG B CG  1 
ATOM   4145 C  CD  . ARG B 1 190 ? 21.943  72.085 -2.756  1.00 13.78 ? 168 ARG B CD  1 
ATOM   4146 N  NE  . ARG B 1 190 ? 21.702  70.648 -2.837  1.00 15.46 ? 168 ARG B NE  1 
ATOM   4147 C  CZ  . ARG B 1 190 ? 22.345  69.823 -3.653  1.00 17.90 ? 168 ARG B CZ  1 
ATOM   4148 N  NH1 . ARG B 1 190 ? 23.276  70.291 -4.474  1.00 19.69 ? 168 ARG B NH1 1 
ATOM   4149 N  NH2 . ARG B 1 190 ? 22.053  68.527 -3.640  1.00 20.82 ? 168 ARG B NH2 1 
ATOM   4150 N  N   . PRO B 1 191 ? 18.407  75.073 -1.360  1.00 13.29 ? 169 PRO B N   1 
ATOM   4151 C  CA  . PRO B 1 191 ? 16.983  74.785 -1.590  1.00 12.32 ? 169 PRO B CA  1 
ATOM   4152 C  C   . PRO B 1 191 ? 16.699  73.298 -1.833  1.00 14.55 ? 169 PRO B C   1 
ATOM   4153 O  O   . PRO B 1 191 ? 17.382  72.648 -2.634  1.00 12.42 ? 169 PRO B O   1 
ATOM   4154 C  CB  . PRO B 1 191 ? 16.663  75.610 -2.834  1.00 17.96 ? 169 PRO B CB  1 
ATOM   4155 C  CG  . PRO B 1 191 ? 17.583  76.797 -2.721  1.00 19.14 ? 169 PRO B CG  1 
ATOM   4156 C  CD  . PRO B 1 191 ? 18.866  76.230 -2.158  1.00 16.41 ? 169 PRO B CD  1 
ATOM   4157 N  N   . VAL B 1 192 ? 15.701  72.759 -1.137  1.00 10.96 ? 170 VAL B N   1 
ATOM   4158 C  CA  . VAL B 1 192 ? 15.460  71.320 -1.164  1.00 9.88  ? 170 VAL B CA  1 
ATOM   4159 C  C   . VAL B 1 192 ? 15.072  70.798 -2.556  1.00 10.02 ? 170 VAL B C   1 
ATOM   4160 O  O   . VAL B 1 192 ? 15.262  69.610 -2.850  1.00 10.65 ? 170 VAL B O   1 
ATOM   4161 C  CB  . VAL B 1 192 ? 14.425  70.886 -0.060  1.00 9.63  ? 170 VAL B CB  1 
ATOM   4162 C  CG1 . VAL B 1 192 ? 12.994  71.298 -0.445  1.00 12.30 ? 170 VAL B CG1 1 
ATOM   4163 C  CG2 . VAL B 1 192 ? 14.499  69.396 0.190   1.00 9.33  ? 170 VAL B CG2 1 
ATOM   4164 N  N   . GLU B 1 193 ? 14.550  71.665 -3.426  1.00 10.65 ? 171 GLU B N   1 
ATOM   4165 C  CA  . GLU B 1 193 ? 14.242  71.205 -4.783  1.00 11.28 ? 171 GLU B CA  1 
ATOM   4166 C  C   . GLU B 1 193 ? 15.485  70.659 -5.490  1.00 11.64 ? 171 GLU B C   1 
ATOM   4167 O  O   . GLU B 1 193 ? 15.387  69.736 -6.297  1.00 12.35 ? 171 GLU B O   1 
ATOM   4168 C  CB  . GLU B 1 193 ? 13.566  72.290 -5.628  1.00 14.77 ? 171 GLU B CB  1 
ATOM   4169 C  CG  . GLU B 1 193 ? 14.367  73.563 -5.788  1.00 20.66 ? 171 GLU B CG  1 
ATOM   4170 C  CD  . GLU B 1 193 ? 14.006  74.607 -4.744  1.00 33.48 ? 171 GLU B CD  1 
ATOM   4171 O  OE1 . GLU B 1 193 ? 14.259  75.803 -5.001  1.00 41.29 ? 171 GLU B OE1 1 
ATOM   4172 O  OE2 . GLU B 1 193 ? 13.477  74.238 -3.668  1.00 28.44 ? 171 GLU B OE2 1 
ATOM   4173 N  N   . ILE B 1 194 ? 16.656  71.209 -5.169  1.00 10.40 ? 172 ILE B N   1 
ATOM   4174 C  CA  . ILE B 1 194 ? 17.900  70.712 -5.768  1.00 9.82  ? 172 ILE B CA  1 
ATOM   4175 C  C   . ILE B 1 194 ? 18.244  69.329 -5.205  1.00 10.36 ? 172 ILE B C   1 
ATOM   4176 O  O   . ILE B 1 194 ? 18.701  68.447 -5.938  1.00 11.13 ? 172 ILE B O   1 
ATOM   4177 C  CB  . ILE B 1 194 ? 19.076  71.681 -5.548  1.00 11.78 ? 172 ILE B CB  1 
ATOM   4178 C  CG1 . ILE B 1 194 ? 18.692  73.091 -5.996  1.00 18.12 ? 172 ILE B CG1 1 
ATOM   4179 C  CG2 . ILE B 1 194 ? 20.312  71.212 -6.321  1.00 12.93 ? 172 ILE B CG2 1 
ATOM   4180 C  CD1 . ILE B 1 194 ? 19.745  74.141 -5.711  1.00 23.20 ? 172 ILE B CD1 1 
ATOM   4181 N  N   . ASP B 1 195 ? 18.012  69.130 -3.909  1.00 11.07 ? 173 ASP B N   1 
ATOM   4182 C  CA  . ASP B 1 195 ? 18.209  67.819 -3.300  1.00 9.31  ? 173 ASP B CA  1 
ATOM   4183 C  C   . ASP B 1 195 ? 17.286  66.785 -3.936  1.00 10.37 ? 173 ASP B C   1 
ATOM   4184 O  O   . ASP B 1 195 ? 17.684  65.653 -4.194  1.00 9.23  ? 173 ASP B O   1 
ATOM   4185 C  CB  . ASP B 1 195 ? 17.919  67.866 -1.794  1.00 10.92 ? 173 ASP B CB  1 
ATOM   4186 C  CG  . ASP B 1 195 ? 18.861  68.776 -1.034  1.00 13.84 ? 173 ASP B CG  1 
ATOM   4187 O  OD1 . ASP B 1 195 ? 20.037  68.901 -1.434  1.00 15.39 ? 173 ASP B OD1 1 
ATOM   4188 O  OD2 . ASP B 1 195 ? 18.418  69.346 -0.014  1.00 15.96 ? 173 ASP B OD2 1 
ATOM   4189 N  N   . ILE B 1 196 ? 16.035  67.174 -4.163  1.00 9.63  ? 174 ILE B N   1 
ATOM   4190 C  CA  . ILE B 1 196 ? 15.060  66.259 -4.735  1.00 8.50  ? 174 ILE B CA  1 
ATOM   4191 C  C   . ILE B 1 196 ? 15.421  65.904 -6.181  1.00 9.67  ? 174 ILE B C   1 
ATOM   4192 O  O   . ILE B 1 196 ? 15.322  64.741 -6.586  1.00 10.31 ? 174 ILE B O   1 
ATOM   4193 C  CB  . ILE B 1 196 ? 13.621  66.828 -4.605  1.00 7.80  ? 174 ILE B CB  1 
ATOM   4194 C  CG1 . ILE B 1 196 ? 13.216  66.868 -3.125  1.00 8.56  ? 174 ILE B CG1 1 
ATOM   4195 C  CG2 . ILE B 1 196 ? 12.629  65.995 -5.397  1.00 10.34 ? 174 ILE B CG2 1 
ATOM   4196 C  CD1 . ILE B 1 196 ? 12.019  67.766 -2.838  1.00 11.35 ? 174 ILE B CD1 1 
ATOM   4197 N  N   . GLU B 1 197 ? 15.859  66.896 -6.951  1.00 10.16 ? 175 GLU B N   1 
ATOM   4198 C  CA  . GLU B 1 197 ? 16.330  66.643 -8.308  1.00 10.22 ? 175 GLU B CA  1 
ATOM   4199 C  C   . GLU B 1 197 ? 17.515  65.678 -8.285  1.00 10.77 ? 175 GLU B C   1 
ATOM   4200 O  O   . GLU B 1 197 ? 17.606  64.787 -9.128  1.00 10.18 ? 175 GLU B O   1 
ATOM   4201 C  CB  . GLU B 1 197 ? 16.717  67.957 -8.994  1.00 11.88 ? 175 GLU B CB  1 
ATOM   4202 C  CG  . GLU B 1 197 ? 17.114  67.793 -10.463 1.00 15.30 ? 175 GLU B CG  1 
ATOM   4203 C  CD  . GLU B 1 197 ? 17.762  69.035 -11.056 1.00 27.53 ? 175 GLU B CD  1 
ATOM   4204 O  OE1 . GLU B 1 197 ? 17.720  70.115 -10.420 1.00 25.40 ? 175 GLU B OE1 1 
ATOM   4205 O  OE2 . GLU B 1 197 ? 18.325  68.928 -12.168 1.00 30.63 ? 175 GLU B OE2 1 
ATOM   4206 N  N   . THR B 1 198 ? 18.415  65.852 -7.317  1.00 9.75  ? 176 THR B N   1 
ATOM   4207 C  CA  . THR B 1 198 ? 19.566  64.955 -7.181  1.00 8.90  ? 176 THR B CA  1 
ATOM   4208 C  C   . THR B 1 198 ? 19.124  63.525 -6.925  1.00 8.10  ? 176 THR B C   1 
ATOM   4209 O  O   . THR B 1 198 ? 19.592  62.594 -7.581  1.00 9.65  ? 176 THR B O   1 
ATOM   4210 C  CB  . THR B 1 198 ? 20.515  65.392 -6.044  1.00 9.11  ? 176 THR B CB  1 
ATOM   4211 O  OG1 . THR B 1 198 ? 21.037  66.699 -6.325  1.00 12.36 ? 176 THR B OG1 1 
ATOM   4212 C  CG2 . THR B 1 198 ? 21.675  64.405 -5.905  1.00 10.36 ? 176 THR B CG2 1 
ATOM   4213 N  N   . VAL B 1 199 ? 18.220  63.352 -5.966  1.00 9.05  ? 177 VAL B N   1 
ATOM   4214 C  CA  . VAL B 1 199 ? 17.706  62.030 -5.632  1.00 8.14  ? 177 VAL B CA  1 
ATOM   4215 C  C   . VAL B 1 199 ? 17.051  61.361 -6.850  1.00 9.69  ? 177 VAL B C   1 
ATOM   4216 O  O   . VAL B 1 199 ? 17.300  60.172 -7.133  1.00 9.05  ? 177 VAL B O   1 
ATOM   4217 C  CB  . VAL B 1 199 ? 16.736  62.120 -4.443  1.00 9.24  ? 177 VAL B CB  1 
ATOM   4218 C  CG1 . VAL B 1 199 ? 16.065  60.772 -4.176  1.00 10.82 ? 177 VAL B CG1 1 
ATOM   4219 C  CG2 . VAL B 1 199 ? 17.485  62.593 -3.200  1.00 9.80  ? 177 VAL B CG2 1 
ATOM   4220 N  N   A ARG B 1 200 ? 16.243  62.124 -7.581  0.51 9.38  ? 178 ARG B N   1 
ATOM   4221 N  N   B ARG B 1 200 ? 16.229  62.122 -7.571  0.49 9.34  ? 178 ARG B N   1 
ATOM   4222 C  CA  A ARG B 1 200 ? 15.561  61.597 -8.758  0.51 9.27  ? 178 ARG B CA  1 
ATOM   4223 C  CA  B ARG B 1 200 ? 15.544  61.605 -8.756  0.49 9.31  ? 178 ARG B CA  1 
ATOM   4224 C  C   A ARG B 1 200 ? 16.524  61.196 -9.871  0.51 9.17  ? 178 ARG B C   1 
ATOM   4225 C  C   B ARG B 1 200 ? 16.513  61.205 -9.873  0.49 9.18  ? 178 ARG B C   1 
ATOM   4226 O  O   A ARG B 1 200 ? 16.359  60.149 -10.500 0.51 10.19 ? 178 ARG B O   1 
ATOM   4227 O  O   B ARG B 1 200 ? 16.342  60.160 -10.504 0.49 10.21 ? 178 ARG B O   1 
ATOM   4228 C  CB  A ARG B 1 200 ? 14.531  62.606 -9.271  0.51 8.71  ? 178 ARG B CB  1 
ATOM   4229 C  CB  B ARG B 1 200 ? 14.495  62.610 -9.265  0.49 9.83  ? 178 ARG B CB  1 
ATOM   4230 C  CG  A ARG B 1 200 ? 13.382  62.814 -8.301  0.51 10.19 ? 178 ARG B CG  1 
ATOM   4231 C  CG  B ARG B 1 200 ? 13.230  62.685 -8.395  0.49 9.79  ? 178 ARG B CG  1 
ATOM   4232 C  CD  A ARG B 1 200 ? 12.189  63.472 -8.960  0.51 12.26 ? 178 ARG B CD  1 
ATOM   4233 C  CD  B ARG B 1 200 ? 12.202  63.682 -8.944  0.49 12.24 ? 178 ARG B CD  1 
ATOM   4234 N  NE  A ARG B 1 200 ? 10.988  63.295 -8.144  0.51 12.20 ? 178 ARG B NE  1 
ATOM   4235 N  NE  B ARG B 1 200 ? 11.049  63.841 -8.050  0.49 11.93 ? 178 ARG B NE  1 
ATOM   4236 C  CZ  A ARG B 1 200 ? 10.266  62.179 -8.117  0.51 14.78 ? 178 ARG B CZ  1 
ATOM   4237 C  CZ  B ARG B 1 200 ? 10.266  64.919 -8.015  0.49 15.39 ? 178 ARG B CZ  1 
ATOM   4238 N  NH1 A ARG B 1 200 ? 10.618  61.141 -8.863  0.51 17.91 ? 178 ARG B NH1 1 
ATOM   4239 N  NH1 B ARG B 1 200 ? 10.511  65.947 -8.814  0.49 14.81 ? 178 ARG B NH1 1 
ATOM   4240 N  NH2 A ARG B 1 200 ? 9.191   62.097 -7.348  0.51 13.25 ? 178 ARG B NH2 1 
ATOM   4241 N  NH2 B ARG B 1 200 ? 9.243   64.983 -7.169  0.49 12.25 ? 178 ARG B NH2 1 
ATOM   4242 N  N   . LYS B 1 201 ? 17.534  62.025 -10.109 1.00 8.97  ? 179 LYS B N   1 
ATOM   4243 C  CA  . LYS B 1 201 ? 18.524  61.727 -11.147 1.00 9.36  ? 179 LYS B CA  1 
ATOM   4244 C  C   . LYS B 1 201 ? 19.418  60.544 -10.769 1.00 10.35 ? 179 LYS B C   1 
ATOM   4245 O  O   . LYS B 1 201 ? 19.754  59.722 -11.627 1.00 11.51 ? 179 LYS B O   1 
ATOM   4246 C  CB  . LYS B 1 201 ? 19.345  62.967 -11.540 1.00 10.64 ? 179 LYS B CB  1 
ATOM   4247 C  CG  . LYS B 1 201 ? 18.523  63.974 -12.343 1.00 13.60 ? 179 LYS B CG  1 
ATOM   4248 C  CD  . LYS B 1 201 ? 19.300  65.208 -12.758 1.00 19.35 ? 179 LYS B CD  1 
ATOM   4249 C  CE  . LYS B 1 201 ? 18.473  65.997 -13.770 1.00 25.64 ? 179 LYS B CE  1 
ATOM   4250 N  NZ  . LYS B 1 201 ? 18.959  67.389 -13.928 1.00 27.57 ? 179 LYS B NZ  1 
ATOM   4251 N  N   . VAL B 1 202 ? 19.795  60.446 -9.498  1.00 8.69  ? 180 VAL B N   1 
ATOM   4252 C  CA  . VAL B 1 202 ? 20.523  59.267 -9.029  1.00 9.57  ? 180 VAL B CA  1 
ATOM   4253 C  C   . VAL B 1 202 ? 19.682  58.004 -9.231  1.00 10.56 ? 180 VAL B C   1 
ATOM   4254 O  O   . VAL B 1 202 ? 20.164  57.000 -9.763  1.00 10.23 ? 180 VAL B O   1 
ATOM   4255 C  CB  . VAL B 1 202 ? 20.949  59.416 -7.554  1.00 8.58  ? 180 VAL B CB  1 
ATOM   4256 C  CG1 . VAL B 1 202 ? 21.412  58.071 -6.978  1.00 9.62  ? 180 VAL B CG1 1 
ATOM   4257 C  CG2 . VAL B 1 202 ? 22.055  60.454 -7.426  1.00 8.90  ? 180 VAL B CG2 1 
ATOM   4258 N  N   . TRP B 1 203 ? 18.414  58.061 -8.840  1.00 10.54 ? 181 TRP B N   1 
ATOM   4259 C  CA  . TRP B 1 203 ? 17.553  56.887 -8.957  1.00 11.06 ? 181 TRP B CA  1 
ATOM   4260 C  C   . TRP B 1 203 ? 17.382  56.456 -10.414 1.00 11.92 ? 181 TRP B C   1 
ATOM   4261 O  O   . TRP B 1 203 ? 17.377  55.257 -10.719 1.00 11.85 ? 181 TRP B O   1 
ATOM   4262 C  CB  . TRP B 1 203 ? 16.187  57.133 -8.284  1.00 11.72 ? 181 TRP B CB  1 
ATOM   4263 C  CG  . TRP B 1 203 ? 15.264  55.940 -8.378  1.00 15.29 ? 181 TRP B CG  1 
ATOM   4264 C  CD1 . TRP B 1 203 ? 14.047  55.884 -9.005  1.00 16.32 ? 181 TRP B CD1 1 
ATOM   4265 C  CD2 . TRP B 1 203 ? 15.504  54.631 -7.848  1.00 13.22 ? 181 TRP B CD2 1 
ATOM   4266 N  NE1 . TRP B 1 203 ? 13.514  54.618 -8.883  1.00 14.81 ? 181 TRP B NE1 1 
ATOM   4267 C  CE2 . TRP B 1 203 ? 14.389  53.833 -8.183  1.00 14.97 ? 181 TRP B CE2 1 
ATOM   4268 C  CE3 . TRP B 1 203 ? 16.550  54.059 -7.119  1.00 14.01 ? 181 TRP B CE3 1 
ATOM   4269 C  CZ2 . TRP B 1 203 ? 14.302  52.489 -7.817  1.00 16.80 ? 181 TRP B CZ2 1 
ATOM   4270 C  CZ3 . TRP B 1 203 ? 16.460  52.725 -6.760  1.00 20.13 ? 181 TRP B CZ3 1 
ATOM   4271 C  CH2 . TRP B 1 203 ? 15.346  51.957 -7.114  1.00 14.51 ? 181 TRP B CH2 1 
ATOM   4272 N  N   . GLU B 1 204 ? 17.249  57.424 -11.317 1.00 10.19 ? 182 GLU B N   1 
ATOM   4273 C  CA  . GLU B 1 204 ? 17.133  57.108 -12.738 1.00 14.50 ? 182 GLU B CA  1 
ATOM   4274 C  C   . GLU B 1 204 ? 18.310  56.255 -13.211 1.00 17.24 ? 182 GLU B C   1 
ATOM   4275 O  O   . GLU B 1 204 ? 18.149  55.358 -14.041 1.00 17.38 ? 182 GLU B O   1 
ATOM   4276 C  CB  . GLU B 1 204 ? 17.038  58.390 -13.563 1.00 17.91 ? 182 GLU B CB  1 
ATOM   4277 C  CG  . GLU B 1 204 ? 16.907  58.154 -15.056 1.00 29.77 ? 182 GLU B CG  1 
ATOM   4278 C  CD  . GLU B 1 204 ? 16.613  59.430 -15.821 1.00 44.32 ? 182 GLU B CD  1 
ATOM   4279 O  OE1 . GLU B 1 204 ? 17.329  60.437 -15.611 1.00 44.83 ? 182 GLU B OE1 1 
ATOM   4280 O  OE2 . GLU B 1 204 ? 15.657  59.426 -16.629 1.00 51.59 ? 182 GLU B OE2 1 
ATOM   4281 N  N   . ARG B 1 205 ? 19.490  56.508 -12.658 1.00 11.80 ? 183 ARG B N   1 
ATOM   4282 C  CA  . ARG B 1 205 ? 20.677  55.786 -13.109 1.00 14.36 ? 183 ARG B CA  1 
ATOM   4283 C  C   . ARG B 1 205 ? 20.934  54.459 -12.395 1.00 16.63 ? 183 ARG B C   1 
ATOM   4284 O  O   . ARG B 1 205 ? 21.553  53.562 -12.970 1.00 21.31 ? 183 ARG B O   1 
ATOM   4285 C  CB  . ARG B 1 205 ? 21.914  56.691 -13.066 1.00 17.08 ? 183 ARG B CB  1 
ATOM   4286 C  CG  . ARG B 1 205 ? 21.760  57.909 -13.964 1.00 25.01 ? 183 ARG B CG  1 
ATOM   4287 C  CD  . ARG B 1 205 ? 23.076  58.574 -14.299 1.00 29.19 ? 183 ARG B CD  1 
ATOM   4288 N  NE  . ARG B 1 205 ? 23.954  57.700 -15.070 1.00 31.38 ? 183 ARG B NE  1 
ATOM   4289 C  CZ  . ARG B 1 205 ? 24.961  58.140 -15.816 1.00 27.99 ? 183 ARG B CZ  1 
ATOM   4290 N  NH1 . ARG B 1 205 ? 25.194  59.443 -15.907 1.00 25.98 ? 183 ARG B NH1 1 
ATOM   4291 N  NH2 . ARG B 1 205 ? 25.725  57.281 -16.480 1.00 29.96 ? 183 ARG B NH2 1 
ATOM   4292 N  N   . ILE B 1 206 ? 20.447  54.309 -11.168 1.00 12.22 ? 184 ILE B N   1 
ATOM   4293 C  CA  . ILE B 1 206 ? 20.758  53.104 -10.396 1.00 14.05 ? 184 ILE B CA  1 
ATOM   4294 C  C   . ILE B 1 206 ? 19.588  52.145 -10.212 1.00 18.07 ? 184 ILE B C   1 
ATOM   4295 O  O   . ILE B 1 206 ? 19.778  51.031 -9.713  1.00 17.20 ? 184 ILE B O   1 
ATOM   4296 C  CB  . ILE B 1 206 ? 21.353  53.428 -9.005  1.00 14.92 ? 184 ILE B CB  1 
ATOM   4297 C  CG1 . ILE B 1 206 ? 20.282  53.995 -8.073  1.00 13.23 ? 184 ILE B CG1 1 
ATOM   4298 C  CG2 . ILE B 1 206 ? 22.555  54.366 -9.145  1.00 15.62 ? 184 ILE B CG2 1 
ATOM   4299 C  CD1 . ILE B 1 206 ? 20.675  53.993 -6.603  1.00 16.35 ? 184 ILE B CD1 1 
ATOM   4300 N  N   . ARG B 1 207 ? 18.387  52.572 -10.597 1.00 14.14 ? 185 ARG B N   1 
ATOM   4301 C  CA  . ARG B 1 207 ? 17.217  51.703 -10.504 1.00 14.79 ? 185 ARG B CA  1 
ATOM   4302 C  C   . ARG B 1 207 ? 17.427  50.419 -11.301 1.00 17.18 ? 185 ARG B C   1 
ATOM   4303 O  O   . ARG B 1 207 ? 17.984  50.441 -12.402 1.00 17.94 ? 185 ARG B O   1 
ATOM   4304 C  CB  . ARG B 1 207 ? 15.951  52.426 -10.968 1.00 17.62 ? 185 ARG B CB  1 
ATOM   4305 C  CG  . ARG B 1 207 ? 15.948  52.855 -12.423 1.00 23.17 ? 185 ARG B CG  1 
ATOM   4306 C  CD  . ARG B 1 207 ? 14.643  53.552 -12.769 1.00 31.98 ? 185 ARG B CD  1 
ATOM   4307 N  NE  . ARG B 1 207 ? 13.495  52.724 -12.416 1.00 38.23 ? 185 ARG B NE  1 
ATOM   4308 C  CZ  . ARG B 1 207 ? 12.243  53.168 -12.353 1.00 45.20 ? 185 ARG B CZ  1 
ATOM   4309 N  NH1 . ARG B 1 207 ? 11.976  54.442 -12.614 1.00 44.80 ? 185 ARG B NH1 1 
ATOM   4310 N  NH2 . ARG B 1 207 ? 11.257  52.341 -12.021 1.00 47.49 ? 185 ARG B NH2 1 
ATOM   4311 N  N   . GLY B 1 208 ? 17.017  49.296 -10.719 1.00 17.78 ? 186 GLY B N   1 
ATOM   4312 C  CA  . GLY B 1 208 ? 17.146  48.012 -11.384 1.00 19.97 ? 186 GLY B CA  1 
ATOM   4313 C  C   . GLY B 1 208 ? 18.505  47.354 -11.211 1.00 24.43 ? 186 GLY B C   1 
ATOM   4314 O  O   . GLY B 1 208 ? 18.764  46.300 -11.788 1.00 26.41 ? 186 GLY B O   1 
ATOM   4315 N  N   . THR B 1 209 ? 19.378  47.967 -10.417 1.00 20.72 ? 187 THR B N   1 
ATOM   4316 C  CA  . THR B 1 209 ? 20.705  47.402 -10.187 1.00 20.05 ? 187 THR B CA  1 
ATOM   4317 C  C   . THR B 1 209 ? 20.786  46.712 -8.829  1.00 21.06 ? 187 THR B C   1 
ATOM   4318 O  O   . THR B 1 209 ? 21.806  46.114 -8.496  1.00 25.21 ? 187 THR B O   1 
ATOM   4319 C  CB  . THR B 1 209 ? 21.822  48.470 -10.285 1.00 18.24 ? 187 THR B CB  1 
ATOM   4320 O  OG1 . THR B 1 209 ? 21.657  49.444 -9.245  1.00 14.72 ? 187 THR B OG1 1 
ATOM   4321 C  CG2 . THR B 1 209 ? 21.777  49.168 -11.626 1.00 18.75 ? 187 THR B CG2 1 
ATOM   4322 N  N   . GLY B 1 210 ? 19.712  46.802 -8.049  1.00 18.45 ? 188 GLY B N   1 
ATOM   4323 C  CA  . GLY B 1 210 ? 19.672  46.192 -6.731  1.00 20.08 ? 188 GLY B CA  1 
ATOM   4324 C  C   . GLY B 1 210 ? 20.466  46.973 -5.698  1.00 22.85 ? 188 GLY B C   1 
ATOM   4325 O  O   . GLY B 1 210 ? 20.658  46.522 -4.571  1.00 25.20 ? 188 GLY B O   1 
ATOM   4326 N  N   . THR B 1 211 ? 20.933  48.153 -6.089  1.00 16.20 ? 189 THR B N   1 
ATOM   4327 C  CA  . THR B 1 211 ? 21.701  49.013 -5.188  1.00 11.96 ? 189 THR B CA  1 
ATOM   4328 C  C   . THR B 1 211 ? 20.807  49.679 -4.143  1.00 12.36 ? 189 THR B C   1 
ATOM   4329 O  O   . THR B 1 211 ? 19.783  50.286 -4.479  1.00 14.15 ? 189 THR B O   1 
ATOM   4330 C  CB  . THR B 1 211 ? 22.468  50.101 -5.990  1.00 12.00 ? 189 THR B CB  1 
ATOM   4331 O  OG1 . THR B 1 211 ? 23.278  49.484 -6.996  1.00 13.83 ? 189 THR B OG1 1 
ATOM   4332 C  CG2 . THR B 1 211 ? 23.362  50.940 -5.065  1.00 10.82 ? 189 THR B CG2 1 
ATOM   4333 N  N   . ARG B 1 212 ? 21.188  49.580 -2.872  1.00 9.97  ? 190 ARG B N   1 
ATOM   4334 C  CA  . ARG B 1 212 ? 20.416  50.231 -1.815  1.00 10.91 ? 190 ARG B CA  1 
ATOM   4335 C  C   . ARG B 1 212 ? 20.746  51.712 -1.755  1.00 11.23 ? 190 ARG B C   1 
ATOM   4336 O  O   . ARG B 1 212 ? 21.863  52.122 -2.076  1.00 9.14  ? 190 ARG B O   1 
ATOM   4337 C  CB  . ARG B 1 212 ? 20.640  49.568 -0.449  1.00 15.71 ? 190 ARG B CB  1 
ATOM   4338 C  CG  . ARG B 1 212 ? 19.944  48.208 -0.323  1.00 26.69 ? 190 ARG B CG  1 
ATOM   4339 C  CD  . ARG B 1 212 ? 19.788  47.745 1.136   1.00 30.71 ? 190 ARG B CD  1 
ATOM   4340 N  NE  . ARG B 1 212 ? 21.027  47.841 1.887   1.00 24.50 ? 190 ARG B NE  1 
ATOM   4341 C  CZ  . ARG B 1 212 ? 22.099  47.087 1.665   1.00 29.57 ? 190 ARG B CZ  1 
ATOM   4342 N  NH1 . ARG B 1 212 ? 22.100  46.170 0.704   1.00 35.74 ? 190 ARG B NH1 1 
ATOM   4343 N  NH2 . ARG B 1 212 ? 23.180  47.256 2.405   1.00 28.94 ? 190 ARG B NH2 1 
ATOM   4344 N  N   . LEU B 1 213 ? 19.771  52.512 -1.342  1.00 10.13 ? 191 LEU B N   1 
ATOM   4345 C  CA  . LEU B 1 213 ? 19.930  53.959 -1.354  1.00 9.80  ? 191 LEU B CA  1 
ATOM   4346 C  C   . LEU B 1 213 ? 19.630  54.577 0.007   1.00 9.80  ? 191 LEU B C   1 
ATOM   4347 O  O   . LEU B 1 213 ? 18.619  54.259 0.638   1.00 9.27  ? 191 LEU B O   1 
ATOM   4348 C  CB  . LEU B 1 213 ? 19.005  54.568 -2.411  1.00 11.33 ? 191 LEU B CB  1 
ATOM   4349 C  CG  . LEU B 1 213 ? 19.069  56.077 -2.618  1.00 12.33 ? 191 LEU B CG  1 
ATOM   4350 C  CD1 . LEU B 1 213 ? 20.448  56.484 -3.121  1.00 13.97 ? 191 LEU B CD1 1 
ATOM   4351 C  CD2 . LEU B 1 213 ? 17.989  56.513 -3.613  1.00 14.42 ? 191 LEU B CD2 1 
ATOM   4352 N  N   . ALA B 1 214 ? 20.521  55.454 0.461   1.00 6.48  ? 192 ALA B N   1 
ATOM   4353 C  CA  . ALA B 1 214 ? 20.256  56.295 1.621   1.00 6.67  ? 192 ALA B CA  1 
ATOM   4354 C  C   . ALA B 1 214 ? 20.425  57.748 1.217   1.00 8.42  ? 192 ALA B C   1 
ATOM   4355 O  O   . ALA B 1 214 ? 21.245  58.067 0.357   1.00 9.67  ? 192 ALA B O   1 
ATOM   4356 C  CB  . ALA B 1 214 ? 21.201  55.954 2.781   1.00 9.76  ? 192 ALA B CB  1 
ATOM   4357 N  N   . VAL B 1 215 ? 19.628  58.620 1.824   1.00 6.42  ? 193 VAL B N   1 
ATOM   4358 C  CA  . VAL B 1 215 ? 19.727  60.056 1.597   1.00 5.59  ? 193 VAL B CA  1 
ATOM   4359 C  C   . VAL B 1 215 ? 19.975  60.717 2.947   1.00 8.73  ? 193 VAL B C   1 
ATOM   4360 O  O   . VAL B 1 215 ? 19.156  60.587 3.861   1.00 8.88  ? 193 VAL B O   1 
ATOM   4361 C  CB  . VAL B 1 215 ? 18.441  60.597 0.935   1.00 7.65  ? 193 VAL B CB  1 
ATOM   4362 C  CG1 . VAL B 1 215 ? 18.481  62.111 0.837   1.00 12.54 ? 193 VAL B CG1 1 
ATOM   4363 C  CG2 . VAL B 1 215 ? 18.279  60.004 -0.465  1.00 7.47  ? 193 VAL B CG2 1 
ATOM   4364 N  N   . ASP B 1 216 ? 21.116  61.394 3.080   1.00 8.48  ? 194 ASP B N   1 
ATOM   4365 C  CA  . ASP B 1 216 ? 21.586  61.879 4.386   1.00 7.56  ? 194 ASP B CA  1 
ATOM   4366 C  C   . ASP B 1 216 ? 21.493  63.391 4.460   1.00 7.10  ? 194 ASP B C   1 
ATOM   4367 O  O   . ASP B 1 216 ? 22.225  64.098 3.768   1.00 7.96  ? 194 ASP B O   1 
ATOM   4368 C  CB  . ASP B 1 216 ? 23.038  61.443 4.612   1.00 7.92  ? 194 ASP B CB  1 
ATOM   4369 C  CG  . ASP B 1 216 ? 23.505  61.648 6.043   1.00 10.38 ? 194 ASP B CG  1 
ATOM   4370 O  OD1 . ASP B 1 216 ? 22.873  62.431 6.788   1.00 10.13 ? 194 ASP B OD1 1 
ATOM   4371 O  OD2 . ASP B 1 216 ? 24.517  61.018 6.437   1.00 10.58 ? 194 ASP B OD2 1 
ATOM   4372 N  N   . GLY B 1 217 ? 20.590  63.887 5.303   1.00 9.37  ? 195 GLY B N   1 
ATOM   4373 C  CA  . GLY B 1 217 ? 20.421  65.323 5.484   1.00 11.74 ? 195 GLY B CA  1 
ATOM   4374 C  C   . GLY B 1 217 ? 21.444  65.973 6.403   1.00 10.26 ? 195 GLY B C   1 
ATOM   4375 O  O   . GLY B 1 217 ? 21.520  67.202 6.487   1.00 12.44 ? 195 GLY B O   1 
ATOM   4376 N  N   . ASN B 1 218 ? 22.225  65.147 7.092   1.00 7.65  ? 196 ASN B N   1 
ATOM   4377 C  CA  . ASN B 1 218 ? 23.239  65.628 8.032   1.00 10.37 ? 196 ASN B CA  1 
ATOM   4378 C  C   . ASN B 1 218 ? 22.778  66.784 8.925   1.00 11.83 ? 196 ASN B C   1 
ATOM   4379 O  O   . ASN B 1 218 ? 23.441  67.819 9.013   1.00 9.83  ? 196 ASN B O   1 
ATOM   4380 C  CB  . ASN B 1 218 ? 24.533  65.975 7.291   1.00 16.26 ? 196 ASN B CB  1 
ATOM   4381 C  CG  . ASN B 1 218 ? 25.262  64.734 6.812   1.00 17.61 ? 196 ASN B CG  1 
ATOM   4382 O  OD1 . ASN B 1 218 ? 25.351  64.472 5.609   1.00 19.02 ? 196 ASN B OD1 1 
ATOM   4383 N  ND2 . ASN B 1 218 ? 25.783  63.955 7.758   1.00 17.57 ? 196 ASN B ND2 1 
ATOM   4384 N  N   . ARG B 1 219 ? 21.621  66.590 9.555   1.00 9.48  ? 197 ARG B N   1 
ATOM   4385 C  CA  . ARG B 1 219 ? 21.069  67.525 10.546  1.00 8.67  ? 197 ARG B CA  1 
ATOM   4386 C  C   . ARG B 1 219 ? 20.539  68.831 9.963   1.00 9.50  ? 197 ARG B C   1 
ATOM   4387 O  O   . ARG B 1 219 ? 20.214  69.750 10.720  1.00 10.76 ? 197 ARG B O   1 
ATOM   4388 C  CB  . ARG B 1 219 ? 22.104  67.861 11.639  1.00 9.02  ? 197 ARG B CB  1 
ATOM   4389 C  CG  . ARG B 1 219 ? 22.630  66.668 12.403  1.00 8.03  ? 197 ARG B CG  1 
ATOM   4390 C  CD  . ARG B 1 219 ? 23.454  67.121 13.601  1.00 11.03 ? 197 ARG B CD  1 
ATOM   4391 N  NE  . ARG B 1 219 ? 24.699  67.788 13.220  1.00 14.34 ? 197 ARG B NE  1 
ATOM   4392 C  CZ  . ARG B 1 219 ? 25.053  69.009 13.615  1.00 19.42 ? 197 ARG B CZ  1 
ATOM   4393 N  NH1 . ARG B 1 219 ? 24.244  69.731 14.389  1.00 18.81 ? 197 ARG B NH1 1 
ATOM   4394 N  NH2 . ARG B 1 219 ? 26.218  69.516 13.229  1.00 21.19 ? 197 ARG B NH2 1 
ATOM   4395 N  N   . SER B 1 220 ? 20.445  68.924 8.637   1.00 7.26  ? 198 SER B N   1 
ATOM   4396 C  CA  . SER B 1 220 ? 20.285  70.239 8.005   1.00 7.33  ? 198 SER B CA  1 
ATOM   4397 C  C   . SER B 1 220 ? 18.892  70.611 7.512   1.00 11.28 ? 198 SER B C   1 
ATOM   4398 O  O   . SER B 1 220 ? 18.666  71.772 7.149   1.00 11.00 ? 198 SER B O   1 
ATOM   4399 C  CB  . SER B 1 220 ? 21.292  70.419 6.864   1.00 11.82 ? 198 SER B CB  1 
ATOM   4400 O  OG  . SER B 1 220 ? 20.903  69.670 5.731   1.00 13.51 ? 198 SER B OG  1 
ATOM   4401 N  N   . LEU B 1 221 ? 17.967  69.658 7.493   1.00 9.27  ? 199 LEU B N   1 
ATOM   4402 C  CA  . LEU B 1 221 ? 16.644  69.925 6.936   1.00 6.08  ? 199 LEU B CA  1 
ATOM   4403 C  C   . LEU B 1 221 ? 15.672  70.323 8.031   1.00 6.78  ? 199 LEU B C   1 
ATOM   4404 O  O   . LEU B 1 221 ? 15.517  69.601 9.014   1.00 7.85  ? 199 LEU B O   1 
ATOM   4405 C  CB  . LEU B 1 221 ? 16.072  68.689 6.226   1.00 7.48  ? 199 LEU B CB  1 
ATOM   4406 C  CG  . LEU B 1 221 ? 16.903  67.915 5.198   1.00 10.83 ? 199 LEU B CG  1 
ATOM   4407 C  CD1 . LEU B 1 221 ? 16.064  66.771 4.644   1.00 12.55 ? 199 LEU B CD1 1 
ATOM   4408 C  CD2 . LEU B 1 221 ? 17.349  68.805 4.071   1.00 11.91 ? 199 LEU B CD2 1 
ATOM   4409 N  N   . PRO B 1 222 ? 14.993  71.465 7.858   1.00 6.30  ? 200 PRO B N   1 
ATOM   4410 C  CA  . PRO B 1 222 ? 13.837  71.696 8.730   1.00 6.29  ? 200 PRO B CA  1 
ATOM   4411 C  C   . PRO B 1 222 ? 12.783  70.625 8.439   1.00 6.58  ? 200 PRO B C   1 
ATOM   4412 O  O   . PRO B 1 222 ? 12.760  70.073 7.328   1.00 7.16  ? 200 PRO B O   1 
ATOM   4413 C  CB  . PRO B 1 222 ? 13.331  73.079 8.286   1.00 6.65  ? 200 PRO B CB  1 
ATOM   4414 C  CG  . PRO B 1 222 ? 14.483  73.698 7.541   1.00 13.90 ? 200 PRO B CG  1 
ATOM   4415 C  CD  . PRO B 1 222 ? 15.180  72.541 6.876   1.00 8.56  ? 200 PRO B CD  1 
ATOM   4416 N  N   . SER B 1 223 ? 11.932  70.323 9.413   1.00 6.16  ? 201 SER B N   1 
ATOM   4417 C  CA  . SER B 1 223 ? 10.878  69.331 9.193   1.00 7.15  ? 201 SER B CA  1 
ATOM   4418 C  C   . SER B 1 223 ? 10.042  69.605 7.930   1.00 6.77  ? 201 SER B C   1 
ATOM   4419 O  O   . SER B 1 223 ? 9.668   68.665 7.231   1.00 8.28  ? 201 SER B O   1 
ATOM   4420 C  CB  . SER B 1 223 ? 9.992   69.179 10.436  1.00 10.37 ? 201 SER B CB  1 
ATOM   4421 O  OG  . SER B 1 223 ? 9.284   70.365 10.740  1.00 11.14 ? 201 SER B OG  1 
ATOM   4422 N  N   . ARG B 1 224 ? 9.774   70.879 7.632   1.00 7.62  ? 202 ARG B N   1 
ATOM   4423 C  CA  . ARG B 1 224 ? 9.133   71.281 6.371   1.00 7.06  ? 202 ARG B CA  1 
ATOM   4424 C  C   . ARG B 1 224 ? 9.710   70.553 5.161   1.00 9.49  ? 202 ARG B C   1 
ATOM   4425 O  O   . ARG B 1 224 ? 8.964   70.034 4.321   1.00 7.50  ? 202 ARG B O   1 
ATOM   4426 C  CB  . ARG B 1 224 ? 9.297   72.795 6.162   1.00 8.11  ? 202 ARG B CB  1 
ATOM   4427 C  CG  . ARG B 1 224 ? 8.792   73.312 4.807   1.00 7.31  ? 202 ARG B CG  1 
ATOM   4428 C  CD  . ARG B 1 224 ? 9.305   74.739 4.542   1.00 7.65  ? 202 ARG B CD  1 
ATOM   4429 N  NE  . ARG B 1 224 ? 10.736  74.724 4.222   1.00 7.78  ? 202 ARG B NE  1 
ATOM   4430 C  CZ  . ARG B 1 224 ? 11.575  75.748 4.394   1.00 8.28  ? 202 ARG B CZ  1 
ATOM   4431 N  NH1 . ARG B 1 224 ? 11.151  76.898 4.891   1.00 8.08  ? 202 ARG B NH1 1 
ATOM   4432 N  NH2 . ARG B 1 224 ? 12.859  75.604 4.073   1.00 10.12 ? 202 ARG B NH2 1 
ATOM   4433 N  N   . ASP B 1 225 ? 11.040  70.493 5.088   1.00 6.53  ? 203 ASP B N   1 
ATOM   4434 C  CA  . ASP B 1 225 ? 11.711  69.957 3.912   1.00 6.56  ? 203 ASP B CA  1 
ATOM   4435 C  C   . ASP B 1 225 ? 11.868  68.439 3.949   1.00 6.99  ? 203 ASP B C   1 
ATOM   4436 O  O   . ASP B 1 225 ? 11.830  67.786 2.898   1.00 6.92  ? 203 ASP B O   1 
ATOM   4437 C  CB  . ASP B 1 225 ? 13.059  70.669 3.693   1.00 7.60  ? 203 ASP B CB  1 
ATOM   4438 C  CG  . ASP B 1 225 ? 12.887  72.114 3.254   1.00 9.69  ? 203 ASP B CG  1 
ATOM   4439 O  OD1 . ASP B 1 225 ? 11.770  72.480 2.819   1.00 8.56  ? 203 ASP B OD1 1 
ATOM   4440 O  OD2 . ASP B 1 225 ? 13.870  72.889 3.333   1.00 10.85 ? 203 ASP B OD2 1 
ATOM   4441 N  N   . ALA B 1 226 ? 12.025  67.876 5.147   1.00 7.15  ? 204 ALA B N   1 
ATOM   4442 C  CA  . ALA B 1 226 ? 12.057  66.421 5.301   1.00 6.72  ? 204 ALA B CA  1 
ATOM   4443 C  C   . ALA B 1 226 ? 10.719  65.817 4.882   1.00 6.91  ? 204 ALA B C   1 
ATOM   4444 O  O   . ALA B 1 226 ? 10.681  64.817 4.148   1.00 6.91  ? 204 ALA B O   1 
ATOM   4445 C  CB  . ALA B 1 226 ? 12.393  66.038 6.745   1.00 7.98  ? 204 ALA B CB  1 
ATOM   4446 N  N   . LEU B 1 227 ? 9.624   66.431 5.339   1.00 5.93  ? 205 LEU B N   1 
ATOM   4447 C  CA  . LEU B 1 227 ? 8.276   66.024 4.923   1.00 6.31  ? 205 LEU B CA  1 
ATOM   4448 C  C   . LEU B 1 227 ? 8.122   66.068 3.408   1.00 6.52  ? 205 LEU B C   1 
ATOM   4449 O  O   . LEU B 1 227 ? 7.590   65.128 2.807   1.00 7.65  ? 205 LEU B O   1 
ATOM   4450 C  CB  . LEU B 1 227 ? 7.215   66.930 5.571   1.00 6.90  ? 205 LEU B CB  1 
ATOM   4451 C  CG  . LEU B 1 227 ? 7.033   66.820 7.087   1.00 8.63  ? 205 LEU B CG  1 
ATOM   4452 C  CD1 . LEU B 1 227 ? 6.252   68.026 7.607   1.00 7.70  ? 205 LEU B CD1 1 
ATOM   4453 C  CD2 . LEU B 1 227 ? 6.295   65.534 7.425   1.00 8.83  ? 205 LEU B CD2 1 
ATOM   4454 N  N   . ARG B 1 228 ? 8.581   67.157 2.792   1.00 6.49  ? 206 ARG B N   1 
ATOM   4455 C  CA  . ARG B 1 228 ? 8.467   67.324 1.345   1.00 6.77  ? 206 ARG B CA  1 
ATOM   4456 C  C   . ARG B 1 228 ? 9.249   66.271 0.556   1.00 6.71  ? 206 ARG B C   1 
ATOM   4457 O  O   . ARG B 1 228 ? 8.725   65.684 -0.396  1.00 6.99  ? 206 ARG B O   1 
ATOM   4458 C  CB  . ARG B 1 228 ? 8.901   68.734 0.933   1.00 7.03  ? 206 ARG B CB  1 
ATOM   4459 C  CG  . ARG B 1 228 ? 8.947   68.932 -0.569  1.00 7.37  ? 206 ARG B CG  1 
ATOM   4460 C  CD  . ARG B 1 228 ? 9.375   70.344 -0.919  1.00 7.67  ? 206 ARG B CD  1 
ATOM   4461 N  NE  . ARG B 1 228 ? 9.548   70.516 -2.356  1.00 8.02  ? 206 ARG B NE  1 
ATOM   4462 C  CZ  . ARG B 1 228 ? 9.948   71.654 -2.918  1.00 8.37  ? 206 ARG B CZ  1 
ATOM   4463 N  NH1 . ARG B 1 228 ? 10.226  72.710 -2.159  1.00 11.30 ? 206 ARG B NH1 1 
ATOM   4464 N  NH2 . ARG B 1 228 ? 10.079  71.737 -4.242  1.00 9.26  ? 206 ARG B NH2 1 
ATOM   4465 N  N   . LEU B 1 229 ? 10.497  66.033 0.946   1.00 6.51  ? 207 LEU B N   1 
ATOM   4466 C  CA  . LEU B 1 229 ? 11.328  65.045 0.263   1.00 7.24  ? 207 LEU B CA  1 
ATOM   4467 C  C   . LEU B 1 229 ? 10.666  63.661 0.241   1.00 7.64  ? 207 LEU B C   1 
ATOM   4468 O  O   . LEU B 1 229 ? 10.589  63.009 -0.806  1.00 8.05  ? 207 LEU B O   1 
ATOM   4469 C  CB  . LEU B 1 229 ? 12.692  64.979 0.943   1.00 10.23 ? 207 LEU B CB  1 
ATOM   4470 C  CG  . LEU B 1 229 ? 13.598  63.803 0.582   1.00 9.83  ? 207 LEU B CG  1 
ATOM   4471 C  CD1 . LEU B 1 229 ? 13.934  63.798 -0.907  1.00 10.15 ? 207 LEU B CD1 1 
ATOM   4472 C  CD2 . LEU B 1 229 ? 14.863  63.891 1.427   1.00 13.73 ? 207 LEU B CD2 1 
ATOM   4473 N  N   . SER B 1 230 ? 10.155  63.217 1.387   1.00 6.36  ? 208 SER B N   1 
ATOM   4474 C  CA  . SER B 1 230 ? 9.512   61.903 1.442   1.00 7.19  ? 208 SER B CA  1 
ATOM   4475 C  C   . SER B 1 230 ? 8.180   61.889 0.676   1.00 8.59  ? 208 SER B C   1 
ATOM   4476 O  O   . SER B 1 230 ? 7.907   60.973 -0.109  1.00 6.63  ? 208 SER B O   1 
ATOM   4477 C  CB  . SER B 1 230 ? 9.309   61.484 2.896   1.00 5.80  ? 208 SER B CB  1 
ATOM   4478 O  OG  . SER B 1 230 ? 8.645   60.233 2.978   1.00 7.49  ? 208 SER B OG  1 
ATOM   4479 N  N   . ARG B 1 231 ? 7.362   62.913 0.898   1.00 8.24  ? 209 ARG B N   1 
ATOM   4480 C  CA  . ARG B 1 231 ? 6.040   63.013 0.268   1.00 6.77  ? 209 ARG B CA  1 
ATOM   4481 C  C   . ARG B 1 231 ? 6.105   62.984 -1.262  1.00 8.75  ? 209 ARG B C   1 
ATOM   4482 O  O   . ARG B 1 231 ? 5.248   62.376 -1.930  1.00 8.43  ? 209 ARG B O   1 
ATOM   4483 C  CB  . ARG B 1 231 ? 5.360   64.307 0.734   1.00 6.89  ? 209 ARG B CB  1 
ATOM   4484 C  CG  . ARG B 1 231 ? 3.944   64.503 0.236   1.00 7.21  ? 209 ARG B CG  1 
ATOM   4485 C  CD  . ARG B 1 231 ? 3.374   65.844 0.706   1.00 7.42  ? 209 ARG B CD  1 
ATOM   4486 N  NE  . ARG B 1 231 ? 4.019   66.998 0.070   1.00 7.51  ? 209 ARG B NE  1 
ATOM   4487 C  CZ  . ARG B 1 231 ? 4.764   67.902 0.709   1.00 7.40  ? 209 ARG B CZ  1 
ATOM   4488 N  NH1 . ARG B 1 231 ? 4.987   67.809 2.020   1.00 7.38  ? 209 ARG B NH1 1 
ATOM   4489 N  NH2 . ARG B 1 231 ? 5.299   68.908 0.026   1.00 7.70  ? 209 ARG B NH2 1 
ATOM   4490 N  N   . GLU B 1 232 ? 7.122   63.637 -1.820  1.00 8.10  ? 210 GLU B N   1 
ATOM   4491 C  CA  . GLU B 1 232 ? 7.252   63.748 -3.274  1.00 7.48  ? 210 GLU B CA  1 
ATOM   4492 C  C   . GLU B 1 232 ? 7.818   62.496 -3.938  1.00 8.40  ? 210 GLU B C   1 
ATOM   4493 O  O   . GLU B 1 232 ? 7.656   62.314 -5.147  1.00 10.75 ? 210 GLU B O   1 
ATOM   4494 C  CB  . GLU B 1 232 ? 8.111   64.964 -3.655  1.00 8.05  ? 210 GLU B CB  1 
ATOM   4495 C  CG  . GLU B 1 232 ? 7.427   66.303 -3.435  1.00 7.97  ? 210 GLU B CG  1 
ATOM   4496 C  CD  . GLU B 1 232 ? 8.198   67.456 -4.048  1.00 11.79 ? 210 GLU B CD  1 
ATOM   4497 O  OE1 . GLU B 1 232 ? 9.136   67.202 -4.828  1.00 11.98 ? 210 GLU B OE1 1 
ATOM   4498 O  OE2 . GLU B 1 232 ? 7.849   68.618 -3.763  1.00 9.51  ? 210 GLU B OE2 1 
ATOM   4499 N  N   . CYS B 1 233 ? 8.468   61.631 -3.158  1.00 7.14  ? 211 CYS B N   1 
ATOM   4500 C  CA  . CYS B 1 233 ? 9.208   60.521 -3.746  1.00 7.30  ? 211 CYS B CA  1 
ATOM   4501 C  C   . CYS B 1 233 ? 8.868   59.132 -3.202  1.00 7.99  ? 211 CYS B C   1 
ATOM   4502 O  O   . CYS B 1 233 ? 9.774   58.355 -2.890  1.00 6.78  ? 211 CYS B O   1 
ATOM   4503 C  CB  . CYS B 1 233 ? 10.712  60.753 -3.562  1.00 7.87  ? 211 CYS B CB  1 
ATOM   4504 S  SG  . CYS B 1 233 ? 11.325  62.311 -4.246  1.00 10.99 ? 211 CYS B SG  1 
ATOM   4505 N  N   . PRO B 1 234 ? 7.570   58.783 -3.124  1.00 8.24  ? 212 PRO B N   1 
ATOM   4506 C  CA  . PRO B 1 234 ? 7.266   57.456 -2.561  1.00 9.10  ? 212 PRO B CA  1 
ATOM   4507 C  C   . PRO B 1 234 ? 7.814   56.296 -3.389  1.00 7.85  ? 212 PRO B C   1 
ATOM   4508 O  O   . PRO B 1 234 ? 8.071   55.220 -2.831  1.00 7.51  ? 212 PRO B O   1 
ATOM   4509 C  CB  . PRO B 1 234 ? 5.734   57.417 -2.567  1.00 9.28  ? 212 PRO B CB  1 
ATOM   4510 C  CG  . PRO B 1 234 ? 5.327   58.402 -3.633  1.00 12.31 ? 212 PRO B CG  1 
ATOM   4511 C  CD  . PRO B 1 234 ? 6.352   59.501 -3.541  1.00 10.63 ? 212 PRO B CD  1 
ATOM   4512 N  N   . GLU B 1 235 ? 7.993   56.512 -4.691  1.00 8.46  ? 213 GLU B N   1 
ATOM   4513 C  CA  . GLU B 1 235 ? 8.487   55.470 -5.588  1.00 8.07  ? 213 GLU B CA  1 
ATOM   4514 C  C   . GLU B 1 235 ? 10.013  55.274 -5.549  1.00 9.41  ? 213 GLU B C   1 
ATOM   4515 O  O   . GLU B 1 235 ? 10.543  54.357 -6.198  1.00 11.39 ? 213 GLU B O   1 
ATOM   4516 C  CB  . GLU B 1 235 ? 8.029   55.757 -7.024  1.00 11.06 ? 213 GLU B CB  1 
ATOM   4517 C  CG  . GLU B 1 235 ? 8.870   56.805 -7.787  1.00 16.44 ? 213 GLU B CG  1 
ATOM   4518 C  CD  . GLU B 1 235 ? 8.605   58.270 -7.395  1.00 22.70 ? 213 GLU B CD  1 
ATOM   4519 O  OE1 . GLU B 1 235 ? 7.801   58.549 -6.493  1.00 15.25 ? 213 GLU B OE1 1 
ATOM   4520 O  OE2 . GLU B 1 235 ? 9.217   59.160 -8.018  1.00 30.64 ? 213 GLU B OE2 1 
ATOM   4521 N  N   . ILE B 1 236 ? 10.720  56.141 -4.824  1.00 8.53  ? 214 ILE B N   1 
ATOM   4522 C  CA  . ILE B 1 236 ? 12.178  56.028 -4.713  1.00 9.65  ? 214 ILE B CA  1 
ATOM   4523 C  C   . ILE B 1 236 ? 12.538  55.445 -3.350  1.00 8.07  ? 214 ILE B C   1 
ATOM   4524 O  O   . ILE B 1 236 ? 12.204  56.022 -2.314  1.00 8.40  ? 214 ILE B O   1 
ATOM   4525 C  CB  . ILE B 1 236 ? 12.881  57.391 -4.900  1.00 11.27 ? 214 ILE B CB  1 
ATOM   4526 C  CG1 . ILE B 1 236 ? 12.427  58.052 -6.209  1.00 11.21 ? 214 ILE B CG1 1 
ATOM   4527 C  CG2 . ILE B 1 236 ? 14.405  57.204 -4.884  1.00 10.04 ? 214 ILE B CG2 1 
ATOM   4528 C  CD1 . ILE B 1 236 ? 13.154  59.360 -6.547  1.00 12.66 ? 214 ILE B CD1 1 
ATOM   4529 N  N   . PRO B 1 237 ? 13.221  54.292 -3.341  1.00 6.91  ? 215 PRO B N   1 
ATOM   4530 C  CA  . PRO B 1 237 ? 13.365  53.546 -2.089  1.00 7.52  ? 215 PRO B CA  1 
ATOM   4531 C  C   . PRO B 1 237 ? 14.577  53.943 -1.248  1.00 9.61  ? 215 PRO B C   1 
ATOM   4532 O  O   . PRO B 1 237 ? 15.435  53.114 -0.932  1.00 12.48 ? 215 PRO B O   1 
ATOM   4533 C  CB  . PRO B 1 237 ? 13.491  52.095 -2.567  1.00 7.71  ? 215 PRO B CB  1 
ATOM   4534 C  CG  . PRO B 1 237 ? 14.212  52.229 -3.883  1.00 8.45  ? 215 PRO B CG  1 
ATOM   4535 C  CD  . PRO B 1 237 ? 13.657  53.501 -4.509  1.00 10.20 ? 215 PRO B CD  1 
ATOM   4536 N  N   . PHE B 1 238 ? 14.631  55.199 -0.844  1.00 7.93  ? 216 PHE B N   1 
ATOM   4537 C  CA  . PHE B 1 238 ? 15.685  55.592 0.079   1.00 7.24  ? 216 PHE B CA  1 
ATOM   4538 C  C   . PHE B 1 238 ? 15.255  55.405 1.519   1.00 5.70  ? 216 PHE B C   1 
ATOM   4539 O  O   . PHE B 1 238 ? 14.055  55.354 1.830   1.00 7.64  ? 216 PHE B O   1 
ATOM   4540 C  CB  . PHE B 1 238 ? 16.142  57.045 -0.155  1.00 7.18  ? 216 PHE B CB  1 
ATOM   4541 C  CG  . PHE B 1 238 ? 15.034  58.069 -0.141  1.00 7.36  ? 216 PHE B CG  1 
ATOM   4542 C  CD1 . PHE B 1 238 ? 14.559  58.593 1.052   1.00 6.96  ? 216 PHE B CD1 1 
ATOM   4543 C  CD2 . PHE B 1 238 ? 14.505  58.545 -1.334  1.00 8.99  ? 216 PHE B CD2 1 
ATOM   4544 C  CE1 . PHE B 1 238 ? 13.551  59.556 1.059   1.00 8.34  ? 216 PHE B CE1 1 
ATOM   4545 C  CE2 . PHE B 1 238 ? 13.494  59.510 -1.341  1.00 8.27  ? 216 PHE B CE2 1 
ATOM   4546 C  CZ  . PHE B 1 238 ? 13.018  60.012 -0.132  1.00 7.46  ? 216 PHE B CZ  1 
ATOM   4547 N  N   . VAL B 1 239 ? 16.240  55.296 2.403   1.00 5.59  ? 217 VAL B N   1 
ATOM   4548 C  CA  . VAL B 1 239 ? 16.001  55.604 3.808   1.00 7.59  ? 217 VAL B CA  1 
ATOM   4549 C  C   . VAL B 1 239 ? 16.477  57.029 4.017   1.00 7.59  ? 217 VAL B C   1 
ATOM   4550 O  O   . VAL B 1 239 ? 17.419  57.488 3.356   1.00 7.85  ? 217 VAL B O   1 
ATOM   4551 C  CB  . VAL B 1 239 ? 16.691  54.621 4.795   1.00 6.56  ? 217 VAL B CB  1 
ATOM   4552 C  CG1 . VAL B 1 239 ? 16.110  53.210 4.631   1.00 8.92  ? 217 VAL B CG1 1 
ATOM   4553 C  CG2 . VAL B 1 239 ? 18.208  54.601 4.619   1.00 9.86  ? 217 VAL B CG2 1 
ATOM   4554 N  N   . LEU B 1 240 ? 15.802  57.744 4.901   1.00 6.08  ? 218 LEU B N   1 
ATOM   4555 C  CA  . LEU B 1 240 ? 16.138  59.129 5.182   1.00 7.54  ? 218 LEU B CA  1 
ATOM   4556 C  C   . LEU B 1 240 ? 16.990  59.159 6.440   1.00 6.87  ? 218 LEU B C   1 
ATOM   4557 O  O   . LEU B 1 240 ? 16.501  58.877 7.543   1.00 6.10  ? 218 LEU B O   1 
ATOM   4558 C  CB  . LEU B 1 240 ? 14.843  59.918 5.367   1.00 13.24 ? 218 LEU B CB  1 
ATOM   4559 C  CG  . LEU B 1 240 ? 14.916  61.426 5.534   1.00 14.58 ? 218 LEU B CG  1 
ATOM   4560 C  CD1 . LEU B 1 240 ? 15.835  62.019 4.480   1.00 13.84 ? 218 LEU B CD1 1 
ATOM   4561 C  CD2 . LEU B 1 240 ? 13.499  62.029 5.445   1.00 11.50 ? 218 LEU B CD2 1 
ATOM   4562 N  N   . GLU B 1 241 ? 18.270  59.471 6.274   1.00 6.41  ? 219 GLU B N   1 
ATOM   4563 C  CA  . GLU B 1 241 ? 19.216  59.421 7.393   1.00 5.66  ? 219 GLU B CA  1 
ATOM   4564 C  C   . GLU B 1 241 ? 19.386  60.806 7.993   1.00 8.23  ? 219 GLU B C   1 
ATOM   4565 O  O   . GLU B 1 241 ? 19.638  61.770 7.260   1.00 8.10  ? 219 GLU B O   1 
ATOM   4566 C  CB  . GLU B 1 241 ? 20.568  58.893 6.895   1.00 7.55  ? 219 GLU B CB  1 
ATOM   4567 C  CG  . GLU B 1 241 ? 21.640  58.831 7.968   1.00 12.48 ? 219 GLU B CG  1 
ATOM   4568 C  CD  . GLU B 1 241 ? 22.962  58.319 7.427   1.00 18.31 ? 219 GLU B CD  1 
ATOM   4569 O  OE1 . GLU B 1 241 ? 22.945  57.661 6.359   1.00 21.90 ? 219 GLU B OE1 1 
ATOM   4570 O  OE2 . GLU B 1 241 ? 24.015  58.593 8.051   1.00 10.80 ? 219 GLU B OE2 1 
ATOM   4571 N  N   . GLN B 1 242 ? 19.243  60.883 9.321   1.00 6.86  ? 220 GLN B N   1 
ATOM   4572 C  CA  . GLN B 1 242 ? 19.363  62.121 10.105  1.00 5.74  ? 220 GLN B CA  1 
ATOM   4573 C  C   . GLN B 1 242 ? 18.889  63.374 9.359   1.00 6.01  ? 220 GLN B C   1 
ATOM   4574 O  O   . GLN B 1 242 ? 19.665  64.319 9.141   1.00 6.70  ? 220 GLN B O   1 
ATOM   4575 C  CB  . GLN B 1 242 ? 20.806  62.290 10.607  1.00 6.17  ? 220 GLN B CB  1 
ATOM   4576 C  CG  . GLN B 1 242 ? 20.967  63.312 11.761  1.00 7.06  ? 220 GLN B CG  1 
ATOM   4577 C  CD  . GLN B 1 242 ? 20.452  62.806 13.104  1.00 7.41  ? 220 GLN B CD  1 
ATOM   4578 O  OE1 . GLN B 1 242 ? 20.663  61.645 13.481  1.00 7.01  ? 220 GLN B OE1 1 
ATOM   4579 N  NE2 . GLN B 1 242 ? 19.781  63.687 13.845  1.00 10.03 ? 220 GLN B NE2 1 
ATOM   4580 N  N   . PRO B 1 243 ? 17.607  63.390 8.956   1.00 6.17  ? 221 PRO B N   1 
ATOM   4581 C  CA  . PRO B 1 243 ? 17.165  64.526 8.147   1.00 8.67  ? 221 PRO B CA  1 
ATOM   4582 C  C   . PRO B 1 243 ? 17.202  65.827 8.921   1.00 7.80  ? 221 PRO B C   1 
ATOM   4583 O  O   . PRO B 1 243 ? 17.586  66.856 8.371   1.00 7.02  ? 221 PRO B O   1 
ATOM   4584 C  CB  . PRO B 1 243 ? 15.713  64.171 7.799   1.00 8.26  ? 221 PRO B CB  1 
ATOM   4585 C  CG  . PRO B 1 243 ? 15.303  63.143 8.806   1.00 8.54  ? 221 PRO B CG  1 
ATOM   4586 C  CD  . PRO B 1 243 ? 16.554  62.367 9.099   1.00 8.57  ? 221 PRO B CD  1 
ATOM   4587 N  N   . CYS B 1 244 ? 16.817  65.759 10.192  1.00 7.39  ? 222 CYS B N   1 
ATOM   4588 C  CA  . CYS B 1 244 ? 16.682  66.934 11.030  1.00 6.81  ? 222 CYS B CA  1 
ATOM   4589 C  C   . CYS B 1 244 ? 17.752  66.938 12.114  1.00 8.79  ? 222 CYS B C   1 
ATOM   4590 O  O   . CYS B 1 244 ? 18.363  65.905 12.389  1.00 7.57  ? 222 CYS B O   1 
ATOM   4591 C  CB  . CYS B 1 244 ? 15.284  66.965 11.654  1.00 8.23  ? 222 CYS B CB  1 
ATOM   4592 S  SG  . CYS B 1 244 ? 13.935  66.930 10.438  1.00 9.43  ? 222 CYS B SG  1 
ATOM   4593 N  N   . ASN B 1 245 ? 17.956  68.101 12.734  1.00 8.72  ? 223 ASN B N   1 
ATOM   4594 C  CA  . ASN B 1 245 ? 19.036  68.277 13.707  1.00 6.84  ? 223 ASN B CA  1 
ATOM   4595 C  C   . ASN B 1 245 ? 18.845  67.468 14.989  1.00 12.52 ? 223 ASN B C   1 
ATOM   4596 O  O   . ASN B 1 245 ? 19.750  66.747 15.424  1.00 13.15 ? 223 ASN B O   1 
ATOM   4597 C  CB  . ASN B 1 245 ? 19.215  69.761 14.026  1.00 8.66  ? 223 ASN B CB  1 
ATOM   4598 C  CG  . ASN B 1 245 ? 20.368  70.020 14.974  1.00 10.64 ? 223 ASN B CG  1 
ATOM   4599 O  OD1 . ASN B 1 245 ? 21.464  69.466 14.813  1.00 14.44 ? 223 ASN B OD1 1 
ATOM   4600 N  ND2 . ASN B 1 245 ? 20.131  70.860 15.969  1.00 12.92 ? 223 ASN B ND2 1 
ATOM   4601 N  N   . THR B 1 246 ? 17.665  67.572 15.592  1.00 8.61  ? 224 THR B N   1 
ATOM   4602 C  CA  . THR B 1 246 ? 17.421  66.902 16.867  1.00 7.17  ? 224 THR B CA  1 
ATOM   4603 C  C   . THR B 1 246 ? 16.565  65.646 16.749  1.00 8.24  ? 224 THR B C   1 
ATOM   4604 O  O   . THR B 1 246 ? 15.723  65.534 15.844  1.00 9.01  ? 224 THR B O   1 
ATOM   4605 C  CB  . THR B 1 246 ? 16.743  67.852 17.868  1.00 9.64  ? 224 THR B CB  1 
ATOM   4606 O  OG1 . THR B 1 246 ? 15.466  68.251 17.357  1.00 8.37  ? 224 THR B OG1 1 
ATOM   4607 C  CG2 . THR B 1 246 ? 17.609  69.086 18.103  1.00 10.13 ? 224 THR B CG2 1 
ATOM   4608 N  N   . LEU B 1 247 ? 16.763  64.710 17.679  1.00 7.36  ? 225 LEU B N   1 
ATOM   4609 C  CA  . LEU B 1 247 ? 15.906  63.536 17.772  1.00 5.80  ? 225 LEU B CA  1 
ATOM   4610 C  C   . LEU B 1 247 ? 14.455  63.960 18.020  1.00 6.90  ? 225 LEU B C   1 
ATOM   4611 O  O   . LEU B 1 247 ? 13.523  63.317 17.552  1.00 9.93  ? 225 LEU B O   1 
ATOM   4612 C  CB  . LEU B 1 247 ? 16.393  62.594 18.882  1.00 7.55  ? 225 LEU B CB  1 
ATOM   4613 C  CG  . LEU B 1 247 ? 15.616  61.295 19.093  1.00 9.74  ? 225 LEU B CG  1 
ATOM   4614 C  CD1 . LEU B 1 247 ? 15.417  60.544 17.782  1.00 11.13 ? 225 LEU B CD1 1 
ATOM   4615 C  CD2 . LEU B 1 247 ? 16.350  60.418 20.103  1.00 10.31 ? 225 LEU B CD2 1 
ATOM   4616 N  N   . GLU B 1 248 ? 14.265  65.066 18.735  1.00 7.20  ? 226 GLU B N   1 
ATOM   4617 C  CA  . GLU B 1 248 ? 12.908  65.552 18.979  1.00 7.58  ? 226 GLU B CA  1 
ATOM   4618 C  C   . GLU B 1 248 ? 12.172  65.896 17.689  1.00 9.10  ? 226 GLU B C   1 
ATOM   4619 O  O   . GLU B 1 248 ? 10.989  65.568 17.544  1.00 9.33  ? 226 GLU B O   1 
ATOM   4620 C  CB  . GLU B 1 248 ? 12.927  66.751 19.931  1.00 9.64  ? 226 GLU B CB  1 
ATOM   4621 C  CG  . GLU B 1 248 ? 13.336  66.360 21.341  1.00 10.54 ? 226 GLU B CG  1 
ATOM   4622 C  CD  . GLU B 1 248 ? 12.382  65.348 21.930  1.00 18.18 ? 226 GLU B CD  1 
ATOM   4623 O  OE1 . GLU B 1 248 ? 11.163  65.631 21.978  1.00 17.67 ? 226 GLU B OE1 1 
ATOM   4624 O  OE2 . GLU B 1 248 ? 12.844  64.262 22.329  1.00 19.94 ? 226 GLU B OE2 1 
ATOM   4625 N  N   . GLU B 1 249 ? 12.865  66.542 16.756  1.00 8.60  ? 227 GLU B N   1 
ATOM   4626 C  CA  . GLU B 1 249 ? 12.262  66.856 15.460  1.00 7.95  ? 227 GLU B CA  1 
ATOM   4627 C  C   . GLU B 1 249 ? 11.953  65.588 14.673  1.00 8.99  ? 227 GLU B C   1 
ATOM   4628 O  O   . GLU B 1 249 ? 10.890  65.477 14.057  1.00 8.31  ? 227 GLU B O   1 
ATOM   4629 C  CB  . GLU B 1 249 ? 13.189  67.736 14.627  1.00 7.71  ? 227 GLU B CB  1 
ATOM   4630 C  CG  . GLU B 1 249 ? 13.335  69.183 15.077  1.00 9.04  ? 227 GLU B CG  1 
ATOM   4631 C  CD  . GLU B 1 249 ? 14.572  69.794 14.455  1.00 9.50  ? 227 GLU B CD  1 
ATOM   4632 O  OE1 . GLU B 1 249 ? 14.513  70.175 13.265  1.00 9.50  ? 227 GLU B OE1 1 
ATOM   4633 O  OE2 . GLU B 1 249 ? 15.623  69.842 15.137  1.00 10.12 ? 227 GLU B OE2 1 
ATOM   4634 N  N   . ILE B 1 250 ? 12.900  64.648 14.667  1.00 8.48  ? 228 ILE B N   1 
ATOM   4635 C  CA  . ILE B 1 250 ? 12.693  63.372 13.985  1.00 7.90  ? 228 ILE B CA  1 
ATOM   4636 C  C   . ILE B 1 250 ? 11.486  62.625 14.556  1.00 7.26  ? 228 ILE B C   1 
ATOM   4637 O  O   . ILE B 1 250 ? 10.654  62.117 13.801  1.00 9.62  ? 228 ILE B O   1 
ATOM   4638 C  CB  . ILE B 1 250 ? 13.974  62.524 14.007  1.00 9.52  ? 228 ILE B CB  1 
ATOM   4639 C  CG1 . ILE B 1 250 ? 15.044  63.210 13.154  1.00 10.61 ? 228 ILE B CG1 1 
ATOM   4640 C  CG2 . ILE B 1 250 ? 13.697  61.103 13.489  1.00 11.33 ? 228 ILE B CG2 1 
ATOM   4641 C  CD1 . ILE B 1 250 ? 16.412  62.544 13.192  1.00 14.16 ? 228 ILE B CD1 1 
ATOM   4642 N  N   . ALA B 1 251 ? 11.366  62.577 15.882  1.00 8.48  ? 229 ALA B N   1 
ATOM   4643 C  CA  . ALA B 1 251 ? 10.237  61.904 16.518  1.00 11.64 ? 229 ALA B CA  1 
ATOM   4644 C  C   . ALA B 1 251 ? 8.913   62.560 16.128  1.00 9.14  ? 229 ALA B C   1 
ATOM   4645 O  O   . ALA B 1 251 ? 7.884   61.886 15.974  1.00 12.35 ? 229 ALA B O   1 
ATOM   4646 C  CB  . ALA B 1 251 ? 10.409  61.903 18.049  1.00 10.10 ? 229 ALA B CB  1 
ATOM   4647 N  N   . ALA B 1 252 ? 8.934   63.875 15.961  1.00 9.30  ? 230 ALA B N   1 
ATOM   4648 C  CA  . ALA B 1 252 ? 7.715   64.597 15.619  1.00 10.53 ? 230 ALA B CA  1 
ATOM   4649 C  C   . ALA B 1 252 ? 7.240   64.335 14.192  1.00 12.21 ? 230 ALA B C   1 
ATOM   4650 O  O   . ALA B 1 252 ? 6.030   64.353 13.938  1.00 16.17 ? 230 ALA B O   1 
ATOM   4651 C  CB  . ALA B 1 252 ? 7.902   66.091 15.852  1.00 13.11 ? 230 ALA B CB  1 
ATOM   4652 N  N   . ILE B 1 253 ? 8.172   64.101 13.268  1.00 11.76 ? 231 ILE B N   1 
ATOM   4653 C  CA  . ILE B 1 253 ? 7.817   63.921 11.849  1.00 9.90  ? 231 ILE B CA  1 
ATOM   4654 C  C   . ILE B 1 253 ? 7.603   62.471 11.443  1.00 7.87  ? 231 ILE B C   1 
ATOM   4655 O  O   . ILE B 1 253 ? 7.005   62.206 10.401  1.00 8.86  ? 231 ILE B O   1 
ATOM   4656 C  CB  . ILE B 1 253 ? 8.895   64.485 10.871  1.00 15.30 ? 231 ILE B CB  1 
ATOM   4657 C  CG1 . ILE B 1 253 ? 10.177  63.656 10.925  1.00 18.80 ? 231 ILE B CG1 1 
ATOM   4658 C  CG2 . ILE B 1 253 ? 9.179   65.933 11.159  1.00 29.05 ? 231 ILE B CG2 1 
ATOM   4659 C  CD1 . ILE B 1 253 ? 11.215  64.047 9.866   1.00 25.54 ? 231 ILE B CD1 1 
ATOM   4660 N  N   . ARG B 1 254 ? 8.095   61.540 12.253  1.00 8.90  ? 232 ARG B N   1 
ATOM   4661 C  CA  . ARG B 1 254 ? 8.163   60.129 11.847  1.00 7.73  ? 232 ARG B CA  1 
ATOM   4662 C  C   . ARG B 1 254 ? 6.836   59.522 11.368  1.00 10.09 ? 232 ARG B C   1 
ATOM   4663 O  O   . ARG B 1 254 ? 6.796   58.816 10.357  1.00 9.46  ? 232 ARG B O   1 
ATOM   4664 C  CB  . ARG B 1 254 ? 8.755   59.293 12.983  1.00 14.30 ? 232 ARG B CB  1 
ATOM   4665 C  CG  . ARG B 1 254 ? 8.832   57.810 12.686  1.00 22.54 ? 232 ARG B CG  1 
ATOM   4666 C  CD  . ARG B 1 254 ? 9.272   57.040 13.923  1.00 25.47 ? 232 ARG B CD  1 
ATOM   4667 N  NE  . ARG B 1 254 ? 8.550   57.478 15.111  1.00 32.12 ? 232 ARG B NE  1 
ATOM   4668 C  CZ  . ARG B 1 254 ? 7.336   57.054 15.447  1.00 38.77 ? 232 ARG B CZ  1 
ATOM   4669 N  NH1 . ARG B 1 254 ? 6.697   56.181 14.679  1.00 40.02 ? 232 ARG B NH1 1 
ATOM   4670 N  NH2 . ARG B 1 254 ? 6.757   57.509 16.551  1.00 45.10 ? 232 ARG B NH2 1 
ATOM   4671 N  N   . GLY B 1 255 ? 5.746   59.811 12.071  1.00 8.67  ? 233 GLY B N   1 
ATOM   4672 C  CA  . GLY B 1 255 ? 4.451   59.274 11.685  1.00 7.00  ? 233 GLY B CA  1 
ATOM   4673 C  C   . GLY B 1 255 ? 3.928   59.769 10.348  1.00 8.65  ? 233 GLY B C   1 
ATOM   4674 O  O   . GLY B 1 255 ? 3.047   59.150 9.743   1.00 10.74 ? 233 GLY B O   1 
ATOM   4675 N  N   . ARG B 1 256 ? 4.456   60.897 9.891   1.00 6.91  ? 234 ARG B N   1 
ATOM   4676 C  CA  . ARG B 1 256 ? 4.006   61.502 8.641   1.00 6.30  ? 234 ARG B CA  1 
ATOM   4677 C  C   . ARG B 1 256 ? 4.965   61.219 7.475   1.00 9.39  ? 234 ARG B C   1 
ATOM   4678 O  O   . ARG B 1 256 ? 4.773   61.741 6.370   1.00 14.13 ? 234 ARG B O   1 
ATOM   4679 C  CB  . ARG B 1 256 ? 3.846   63.016 8.840   1.00 8.88  ? 234 ARG B CB  1 
ATOM   4680 C  CG  . ARG B 1 256 ? 2.860   63.382 9.954   1.00 9.84  ? 234 ARG B CG  1 
ATOM   4681 C  CD  . ARG B 1 256 ? 3.172   64.767 10.546  1.00 12.72 ? 234 ARG B CD  1 
ATOM   4682 N  NE  . ARG B 1 256 ? 2.673   65.831 9.682   1.00 11.53 ? 234 ARG B NE  1 
ATOM   4683 C  CZ  . ARG B 1 256 ? 3.098   67.098 9.723   1.00 13.27 ? 234 ARG B CZ  1 
ATOM   4684 N  NH1 . ARG B 1 256 ? 4.044   67.459 10.577  1.00 13.88 ? 234 ARG B NH1 1 
ATOM   4685 N  NH2 . ARG B 1 256 ? 2.586   68.002 8.893   1.00 15.33 ? 234 ARG B NH2 1 
ATOM   4686 N  N   . VAL B 1 257 ? 5.985   60.400 7.726   1.00 8.05  ? 235 VAL B N   1 
ATOM   4687 C  CA  . VAL B 1 257 ? 7.015   60.086 6.734   1.00 9.35  ? 235 VAL B CA  1 
ATOM   4688 C  C   . VAL B 1 257 ? 6.997   58.585 6.450   1.00 7.87  ? 235 VAL B C   1 
ATOM   4689 O  O   . VAL B 1 257 ? 7.235   57.779 7.345   1.00 9.76  ? 235 VAL B O   1 
ATOM   4690 C  CB  . VAL B 1 257 ? 8.422   60.524 7.235   1.00 7.42  ? 235 VAL B CB  1 
ATOM   4691 C  CG1 . VAL B 1 257 ? 9.533   59.929 6.376   1.00 8.63  ? 235 VAL B CG1 1 
ATOM   4692 C  CG2 . VAL B 1 257 ? 8.515   62.057 7.257   1.00 9.58  ? 235 VAL B CG2 1 
ATOM   4693 N  N   . GLN B 1 258 ? 6.717   58.206 5.203   1.00 8.99  ? 236 GLN B N   1 
ATOM   4694 C  CA  . GLN B 1 258 ? 6.551   56.787 4.888   1.00 9.04  ? 236 GLN B CA  1 
ATOM   4695 C  C   . GLN B 1 258 ? 7.824   56.077 4.420   1.00 7.99  ? 236 GLN B C   1 
ATOM   4696 O  O   . GLN B 1 258 ? 7.812   54.863 4.186   1.00 8.61  ? 236 GLN B O   1 
ATOM   4697 C  CB  . GLN B 1 258 ? 5.390   56.591 3.905   1.00 11.80 ? 236 GLN B CB  1 
ATOM   4698 C  CG  . GLN B 1 258 ? 4.037   56.938 4.551   1.00 15.40 ? 236 GLN B CG  1 
ATOM   4699 C  CD  . GLN B 1 258 ? 2.861   56.809 3.607   1.00 25.07 ? 236 GLN B CD  1 
ATOM   4700 O  OE1 . GLN B 1 258 ? 2.733   57.569 2.647   1.00 24.67 ? 236 GLN B OE1 1 
ATOM   4701 N  NE2 . GLN B 1 258 ? 1.979   55.853 3.890   1.00 28.51 ? 236 GLN B NE2 1 
ATOM   4702 N  N   . HIS B 1 259 ? 8.924   56.822 4.313   1.00 7.16  ? 237 HIS B N   1 
ATOM   4703 C  CA  . HIS B 1 259 ? 10.242  56.214 4.130   1.00 6.70  ? 237 HIS B CA  1 
ATOM   4704 C  C   . HIS B 1 259 ? 10.845  55.889 5.482   1.00 6.15  ? 237 HIS B C   1 
ATOM   4705 O  O   . HIS B 1 259 ? 10.658  56.633 6.453   1.00 7.55  ? 237 HIS B O   1 
ATOM   4706 C  CB  . HIS B 1 259 ? 11.199  57.161 3.406   1.00 6.37  ? 237 HIS B CB  1 
ATOM   4707 C  CG  . HIS B 1 259 ? 10.850  57.388 1.970   1.00 7.68  ? 237 HIS B CG  1 
ATOM   4708 N  ND1 . HIS B 1 259 ? 9.957   58.353 1.567   1.00 6.58  ? 237 HIS B ND1 1 
ATOM   4709 C  CD2 . HIS B 1 259 ? 11.288  56.778 0.845   1.00 6.55  ? 237 HIS B CD2 1 
ATOM   4710 C  CE1 . HIS B 1 259 ? 9.852   58.326 0.247   1.00 6.45  ? 237 HIS B CE1 1 
ATOM   4711 N  NE2 . HIS B 1 259 ? 10.641  57.373 -0.212  1.00 6.76  ? 237 HIS B NE2 1 
ATOM   4712 N  N   . GLY B 1 260 ? 11.595  54.795 5.543   1.00 5.27  ? 238 GLY B N   1 
ATOM   4713 C  CA  . GLY B 1 260 ? 12.344  54.487 6.750   1.00 4.88  ? 238 GLY B CA  1 
ATOM   4714 C  C   . GLY B 1 260 ? 13.248  55.651 7.131   1.00 5.68  ? 238 GLY B C   1 
ATOM   4715 O  O   . GLY B 1 260 ? 13.817  56.317 6.256   1.00 6.29  ? 238 GLY B O   1 
ATOM   4716 N  N   . ILE B 1 261 ? 13.372  55.897 8.433   1.00 5.17  ? 239 ILE B N   1 
ATOM   4717 C  CA  . ILE B 1 261 ? 14.246  56.959 8.938   1.00 5.52  ? 239 ILE B CA  1 
ATOM   4718 C  C   . ILE B 1 261 ? 15.371  56.356 9.778   1.00 5.38  ? 239 ILE B C   1 
ATOM   4719 O  O   . ILE B 1 261 ? 15.110  55.540 10.670  1.00 7.73  ? 239 ILE B O   1 
ATOM   4720 C  CB  . ILE B 1 261 ? 13.459  57.950 9.800   1.00 6.10  ? 239 ILE B CB  1 
ATOM   4721 C  CG1 . ILE B 1 261 ? 12.497  58.758 8.934   1.00 8.54  ? 239 ILE B CG1 1 
ATOM   4722 C  CG2 . ILE B 1 261 ? 14.407  58.908 10.520  1.00 10.57 ? 239 ILE B CG2 1 
ATOM   4723 C  CD1 . ILE B 1 261 ? 11.456  59.530 9.756   1.00 12.84 ? 239 ILE B CD1 1 
ATOM   4724 N  N   . TYR B 1 262 ? 16.614  56.735 9.478   1.00 5.45  ? 240 TYR B N   1 
ATOM   4725 C  CA  . TYR B 1 262 ? 17.771  56.266 10.253  1.00 5.61  ? 240 TYR B CA  1 
ATOM   4726 C  C   . TYR B 1 262 ? 18.321  57.410 11.097  1.00 6.72  ? 240 TYR B C   1 
ATOM   4727 O  O   . TYR B 1 262 ? 18.300  58.559 10.679  1.00 7.28  ? 240 TYR B O   1 
ATOM   4728 C  CB  . TYR B 1 262 ? 18.891  55.757 9.327   1.00 6.12  ? 240 TYR B CB  1 
ATOM   4729 C  CG  . TYR B 1 262 ? 18.691  54.385 8.713   1.00 6.66  ? 240 TYR B CG  1 
ATOM   4730 C  CD1 . TYR B 1 262 ? 17.435  53.776 8.667   1.00 4.90  ? 240 TYR B CD1 1 
ATOM   4731 C  CD2 . TYR B 1 262 ? 19.773  53.691 8.187   1.00 7.79  ? 240 TYR B CD2 1 
ATOM   4732 C  CE1 . TYR B 1 262 ? 17.269  52.507 8.094   1.00 5.11  ? 240 TYR B CE1 1 
ATOM   4733 C  CE2 . TYR B 1 262 ? 19.616  52.433 7.611   1.00 4.64  ? 240 TYR B CE2 1 
ATOM   4734 C  CZ  . TYR B 1 262 ? 18.369  51.845 7.580   1.00 5.19  ? 240 TYR B CZ  1 
ATOM   4735 O  OH  . TYR B 1 262 ? 18.220  50.597 7.009   1.00 8.06  ? 240 TYR B OH  1 
ATOM   4736 N  N   . LEU B 1 263 ? 18.818  57.093 12.286  1.00 5.63  ? 241 LEU B N   1 
ATOM   4737 C  CA  . LEU B 1 263 ? 19.545  58.072 13.100  1.00 5.99  ? 241 LEU B CA  1 
ATOM   4738 C  C   . LEU B 1 263 ? 21.048  57.935 12.839  1.00 5.80  ? 241 LEU B C   1 
ATOM   4739 O  O   . LEU B 1 263 ? 21.545  56.823 12.630  1.00 9.10  ? 241 LEU B O   1 
ATOM   4740 C  CB  . LEU B 1 263 ? 19.255  57.836 14.582  1.00 5.05  ? 241 LEU B CB  1 
ATOM   4741 C  CG  . LEU B 1 263 ? 17.790  57.942 15.004  1.00 8.95  ? 241 LEU B CG  1 
ATOM   4742 C  CD1 . LEU B 1 263 ? 17.681  57.771 16.507  1.00 12.93 ? 241 LEU B CD1 1 
ATOM   4743 C  CD2 . LEU B 1 263 ? 17.205  59.285 14.579  1.00 7.30  ? 241 LEU B CD2 1 
ATOM   4744 N  N   . ASP B 1 264 ? 21.766  59.061 12.828  1.00 4.65  ? 242 ASP B N   1 
ATOM   4745 C  CA  . ASP B 1 264 ? 23.233  59.053 12.779  1.00 6.32  ? 242 ASP B CA  1 
ATOM   4746 C  C   . ASP B 1 264 ? 23.708  59.899 13.951  1.00 8.53  ? 242 ASP B C   1 
ATOM   4747 O  O   . ASP B 1 264 ? 23.887  59.374 15.058  1.00 6.44  ? 242 ASP B O   1 
ATOM   4748 C  CB  . ASP B 1 264 ? 23.739  59.592 11.426  1.00 8.39  ? 242 ASP B CB  1 
ATOM   4749 C  CG  . ASP B 1 264 ? 25.265  59.495 11.262  1.00 12.04 ? 242 ASP B CG  1 
ATOM   4750 O  OD1 . ASP B 1 264 ? 25.979  59.249 12.261  1.00 9.37  ? 242 ASP B OD1 1 
ATOM   4751 O  OD2 . ASP B 1 264 ? 25.769  59.707 10.126  1.00 10.49 ? 242 ASP B OD2 1 
ATOM   4752 N  N   . GLU B 1 265 ? 23.880  61.200 13.725  1.00 6.87  ? 243 GLU B N   1 
ATOM   4753 C  CA  . GLU B 1 265 ? 24.364  62.113 14.767  1.00 7.07  ? 243 GLU B CA  1 
ATOM   4754 C  C   . GLU B 1 265 ? 23.601  62.037 16.100  1.00 8.33  ? 243 GLU B C   1 
ATOM   4755 O  O   . GLU B 1 265 ? 24.186  62.245 17.166  1.00 8.91  ? 243 GLU B O   1 
ATOM   4756 C  CB  . GLU B 1 265 ? 24.384  63.559 14.237  1.00 7.36  ? 243 GLU B CB  1 
ATOM   4757 C  CG  . GLU B 1 265 ? 25.446  63.814 13.152  1.00 8.95  ? 243 GLU B CG  1 
ATOM   4758 C  CD  . GLU B 1 265 ? 24.934  63.624 11.721  1.00 12.43 ? 243 GLU B CD  1 
ATOM   4759 O  OE1 . GLU B 1 265 ? 24.095  62.732 11.480  1.00 9.01  ? 243 GLU B OE1 1 
ATOM   4760 O  OE2 . GLU B 1 265 ? 25.373  64.386 10.822  1.00 19.07 ? 243 GLU B OE2 1 
ATOM   4761 N  N   . SER B 1 266 ? 22.302  61.741 16.057  1.00 5.92  ? 244 SER B N   1 
ATOM   4762 C  CA  . SER B 1 266 ? 21.516  61.678 17.294  1.00 5.65  ? 244 SER B CA  1 
ATOM   4763 C  C   . SER B 1 266 ? 21.883  60.486 18.173  1.00 9.32  ? 244 SER B C   1 
ATOM   4764 O  O   . SER B 1 266 ? 21.636  60.509 19.383  1.00 11.44 ? 244 SER B O   1 
ATOM   4765 C  CB  . SER B 1 266 ? 20.009  61.654 17.002  1.00 7.17  ? 244 SER B CB  1 
ATOM   4766 O  OG  . SER B 1 266 ? 19.554  62.922 16.565  1.00 9.00  ? 244 SER B OG  1 
ATOM   4767 N  N   . GLY B 1 267 ? 22.466  59.450 17.575  1.00 8.17  ? 245 GLY B N   1 
ATOM   4768 C  CA  . GLY B 1 267 ? 22.828  58.244 18.310  1.00 8.25  ? 245 GLY B CA  1 
ATOM   4769 C  C   . GLY B 1 267 ? 24.111  58.422 19.099  1.00 7.83  ? 245 GLY B C   1 
ATOM   4770 O  O   . GLY B 1 267 ? 25.134  57.809 18.783  1.00 8.85  ? 245 GLY B O   1 
ATOM   4771 N  N   . GLU B 1 268 ? 24.044  59.239 20.150  1.00 8.43  ? 246 GLU B N   1 
ATOM   4772 C  CA  . GLU B 1 268 ? 25.229  59.685 20.873  1.00 9.89  ? 246 GLU B CA  1 
ATOM   4773 C  C   . GLU B 1 268 ? 25.727  58.712 21.927  1.00 8.93  ? 246 GLU B C   1 
ATOM   4774 O  O   . GLU B 1 268 ? 26.872  58.804 22.354  1.00 9.92  ? 246 GLU B O   1 
ATOM   4775 C  CB  . GLU B 1 268 ? 24.965  61.029 21.553  1.00 15.03 ? 246 GLU B CB  1 
ATOM   4776 C  CG  . GLU B 1 268 ? 24.656  62.155 20.594  1.00 23.37 ? 246 GLU B CG  1 
ATOM   4777 C  CD  . GLU B 1 268 ? 24.541  63.476 21.314  1.00 35.68 ? 246 GLU B CD  1 
ATOM   4778 O  OE1 . GLU B 1 268 ? 25.562  63.934 21.872  1.00 37.74 ? 246 GLU B OE1 1 
ATOM   4779 O  OE2 . GLU B 1 268 ? 23.429  64.041 21.337  1.00 39.26 ? 246 GLU B OE2 1 
ATOM   4780 N  N   . ASP B 1 269 ? 24.863  57.805 22.367  1.00 10.44 ? 247 ASP B N   1 
ATOM   4781 C  CA  . ASP B 1 269 ? 25.243  56.850 23.407  1.00 7.73  ? 247 ASP B CA  1 
ATOM   4782 C  C   . ASP B 1 269 ? 24.267  55.694 23.442  1.00 7.31  ? 247 ASP B C   1 
ATOM   4783 O  O   . ASP B 1 269 ? 23.224  55.728 22.775  1.00 7.54  ? 247 ASP B O   1 
ATOM   4784 C  CB  . ASP B 1 269 ? 25.356  57.524 24.785  1.00 9.52  ? 247 ASP B CB  1 
ATOM   4785 C  CG  . ASP B 1 269 ? 24.137  58.355 25.148  1.00 16.13 ? 247 ASP B CG  1 
ATOM   4786 O  OD1 . ASP B 1 269 ? 23.001  57.982 24.809  1.00 10.93 ? 247 ASP B OD1 1 
ATOM   4787 O  OD2 . ASP B 1 269 ? 24.313  59.398 25.809  1.00 23.66 ? 247 ASP B OD2 1 
ATOM   4788 N  N   . LEU B 1 270 ? 24.602  54.656 24.201  1.00 6.90  ? 248 LEU B N   1 
ATOM   4789 C  CA  . LEU B 1 270 ? 23.743  53.474 24.258  1.00 6.16  ? 248 LEU B CA  1 
ATOM   4790 C  C   . LEU B 1 270 ? 22.356  53.795 24.819  1.00 6.55  ? 248 LEU B C   1 
ATOM   4791 O  O   . LEU B 1 270 ? 21.350  53.238 24.365  1.00 6.92  ? 248 LEU B O   1 
ATOM   4792 C  CB  . LEU B 1 270 ? 24.416  52.359 25.066  1.00 8.95  ? 248 LEU B CB  1 
ATOM   4793 C  CG  . LEU B 1 270 ? 23.916  50.946 24.776  1.00 11.12 ? 248 LEU B CG  1 
ATOM   4794 C  CD1 . LEU B 1 270 ? 24.349  50.489 23.378  1.00 12.94 ? 248 LEU B CD1 1 
ATOM   4795 C  CD2 . LEU B 1 270 ? 24.402  49.972 25.835  1.00 9.91  ? 248 LEU B CD2 1 
ATOM   4796 N  N   . SER B 1 271 ? 22.289  54.696 25.799  1.00 7.44  ? 249 SER B N   1 
ATOM   4797 C  CA  . SER B 1 271 ? 21.001  55.141 26.342  1.00 5.18  ? 249 SER B CA  1 
ATOM   4798 C  C   . SER B 1 271 ? 20.077  55.695 25.263  1.00 5.00  ? 249 SER B C   1 
ATOM   4799 O  O   . SER B 1 271 ? 18.875  55.395 25.252  1.00 6.97  ? 249 SER B O   1 
ATOM   4800 C  CB  . SER B 1 271 ? 21.225  56.202 27.432  1.00 7.32  ? 249 SER B CB  1 
ATOM   4801 O  OG  . SER B 1 271 ? 19.996  56.641 27.993  1.00 8.68  ? 249 SER B OG  1 
ATOM   4802 N  N   . THR B 1 272 ? 20.629  56.498 24.352  1.00 6.18  ? 250 THR B N   1 
ATOM   4803 C  CA  . THR B 1 272 ? 19.807  57.062 23.277  1.00 7.05  ? 250 THR B CA  1 
ATOM   4804 C  C   . THR B 1 272 ? 19.338  55.976 22.303  1.00 5.76  ? 250 THR B C   1 
ATOM   4805 O  O   . THR B 1 272 ? 18.187  55.995 21.826  1.00 5.50  ? 250 THR B O   1 
ATOM   4806 C  CB  . THR B 1 272 ? 20.547  58.183 22.524  1.00 8.76  ? 250 THR B CB  1 
ATOM   4807 O  OG1 . THR B 1 272 ? 20.919  59.201 23.455  1.00 11.62 ? 250 THR B OG1 1 
ATOM   4808 C  CG2 . THR B 1 272 ? 19.648  58.805 21.463  1.00 8.76  ? 250 THR B CG2 1 
ATOM   4809 N  N   . VAL B 1 273 ? 20.213  55.011 22.030  1.00 6.32  ? 251 VAL B N   1 
ATOM   4810 C  CA  . VAL B 1 273 ? 19.846  53.877 21.177  1.00 6.49  ? 251 VAL B CA  1 
ATOM   4811 C  C   . VAL B 1 273 ? 18.706  53.075 21.820  1.00 6.05  ? 251 VAL B C   1 
ATOM   4812 O  O   . VAL B 1 273 ? 17.764  52.644 21.137  1.00 7.01  ? 251 VAL B O   1 
ATOM   4813 C  CB  . VAL B 1 273 ? 21.060  52.970 20.903  1.00 6.21  ? 251 VAL B CB  1 
ATOM   4814 C  CG1 . VAL B 1 273 ? 20.642  51.654 20.225  1.00 6.39  ? 251 VAL B CG1 1 
ATOM   4815 C  CG2 . VAL B 1 273 ? 22.088  53.707 20.054  1.00 6.81  ? 251 VAL B CG2 1 
ATOM   4816 N  N   . ILE B 1 274 ? 18.785  52.897 23.136  1.00 4.72  ? 252 ILE B N   1 
ATOM   4817 C  CA  . ILE B 1 274 ? 17.720  52.214 23.866  1.00 5.01  ? 252 ILE B CA  1 
ATOM   4818 C  C   . ILE B 1 274 ? 16.368  52.939 23.765  1.00 7.10  ? 252 ILE B C   1 
ATOM   4819 O  O   . ILE B 1 274 ? 15.321  52.295 23.581  1.00 5.26  ? 252 ILE B O   1 
ATOM   4820 C  CB  . ILE B 1 274 ? 18.154  51.965 25.333  1.00 5.11  ? 252 ILE B CB  1 
ATOM   4821 C  CG1 . ILE B 1 274 ? 19.277  50.914 25.357  1.00 5.61  ? 252 ILE B CG1 1 
ATOM   4822 C  CG2 . ILE B 1 274 ? 16.968  51.523 26.200  1.00 9.44  ? 252 ILE B CG2 1 
ATOM   4823 C  CD1 . ILE B 1 274 ? 20.158  50.975 26.621  1.00 8.03  ? 252 ILE B CD1 1 
ATOM   4824 N  N   . ARG B 1 275 ? 16.388  54.271 23.879  1.00 6.38  ? 253 ARG B N   1 
ATOM   4825 C  CA  . ARG B 1 275 ? 15.180  55.069 23.680  1.00 5.82  ? 253 ARG B CA  1 
ATOM   4826 C  C   . ARG B 1 275 ? 14.624  54.881 22.283  1.00 4.80  ? 253 ARG B C   1 
ATOM   4827 O  O   . ARG B 1 275 ? 13.427  54.627 22.107  1.00 6.69  ? 253 ARG B O   1 
ATOM   4828 C  CB  . ARG B 1 275 ? 15.465  56.562 23.890  1.00 6.64  ? 253 ARG B CB  1 
ATOM   4829 C  CG  . ARG B 1 275 ? 14.211  57.433 23.727  1.00 7.44  ? 253 ARG B CG  1 
ATOM   4830 C  CD  . ARG B 1 275 ? 14.542  58.913 23.744  1.00 12.41 ? 253 ARG B CD  1 
ATOM   4831 N  NE  . ARG B 1 275 ? 13.356  59.724 23.471  1.00 15.06 ? 253 ARG B NE  1 
ATOM   4832 C  CZ  . ARG B 1 275 ? 13.402  61.021 23.186  1.00 14.82 ? 253 ARG B CZ  1 
ATOM   4833 N  NH1 . ARG B 1 275 ? 14.573  61.643 23.143  1.00 16.80 ? 253 ARG B NH1 1 
ATOM   4834 N  NH2 . ARG B 1 275 ? 12.282  61.683 22.940  1.00 20.55 ? 253 ARG B NH2 1 
ATOM   4835 N  N   . ALA B 1 276 ? 15.503  55.000 21.293  1.00 5.71  ? 254 ALA B N   1 
ATOM   4836 C  CA  . ALA B 1 276 ? 15.073  54.955 19.896  1.00 6.41  ? 254 ALA B CA  1 
ATOM   4837 C  C   . ALA B 1 276 ? 14.519  53.582 19.531  1.00 6.52  ? 254 ALA B C   1 
ATOM   4838 O  O   . ALA B 1 276 ? 13.481  53.481 18.867  1.00 7.59  ? 254 ALA B O   1 
ATOM   4839 C  CB  . ALA B 1 276 ? 16.210  55.333 18.973  1.00 7.20  ? 254 ALA B CB  1 
ATOM   4840 N  N   . ALA B 1 277 ? 15.199  52.515 19.956  1.00 6.45  ? 255 ALA B N   1 
ATOM   4841 C  CA  . ALA B 1 277 ? 14.714  51.172 19.644  1.00 5.59  ? 255 ALA B CA  1 
ATOM   4842 C  C   . ALA B 1 277 ? 13.460  50.827 20.443  1.00 6.25  ? 255 ALA B C   1 
ATOM   4843 O  O   . ALA B 1 277 ? 12.501  50.266 19.911  1.00 8.89  ? 255 ALA B O   1 
ATOM   4844 C  CB  . ALA B 1 277 ? 15.809  50.139 19.898  1.00 7.37  ? 255 ALA B CB  1 
ATOM   4845 N  N   . GLY B 1 278 ? 13.455  51.180 21.724  1.00 7.06  ? 256 GLY B N   1 
ATOM   4846 C  CA  . GLY B 1 278 ? 12.370  50.790 22.599  1.00 7.16  ? 256 GLY B CA  1 
ATOM   4847 C  C   . GLY B 1 278 ? 11.088  51.555 22.356  1.00 8.11  ? 256 GLY B C   1 
ATOM   4848 O  O   . GLY B 1 278 ? 10.003  51.046 22.639  1.00 9.72  ? 256 GLY B O   1 
ATOM   4849 N  N   . GLN B 1 279 ? 11.210  52.777 21.838  1.00 8.30  ? 257 GLN B N   1 
ATOM   4850 C  CA  . GLN B 1 279 ? 10.031  53.589 21.547  1.00 9.24  ? 257 GLN B CA  1 
ATOM   4851 C  C   . GLN B 1 279 ? 9.697   53.603 20.069  1.00 8.30  ? 257 GLN B C   1 
ATOM   4852 O  O   . GLN B 1 279 ? 8.760   54.293 19.649  1.00 11.37 ? 257 GLN B O   1 
ATOM   4853 C  CB  . GLN B 1 279 ? 10.226  55.018 22.046  1.00 6.24  ? 257 GLN B CB  1 
ATOM   4854 C  CG  . GLN B 1 279 ? 10.364  55.073 23.563  1.00 9.26  ? 257 GLN B CG  1 
ATOM   4855 C  CD  . GLN B 1 279 ? 10.539  56.467 24.088  1.00 15.55 ? 257 GLN B CD  1 
ATOM   4856 O  OE1 . GLN B 1 279 ? 10.605  57.432 23.322  1.00 17.20 ? 257 GLN B OE1 1 
ATOM   4857 N  NE2 . GLN B 1 279 ? 10.614  56.591 25.405  1.00 14.52 ? 257 GLN B NE2 1 
ATOM   4858 N  N   . GLY B 1 280 ? 10.467  52.858 19.276  1.00 7.12  ? 258 GLY B N   1 
ATOM   4859 C  CA  . GLY B 1 280 ? 10.221  52.774 17.844  1.00 8.53  ? 258 GLY B CA  1 
ATOM   4860 C  C   . GLY B 1 280 ? 10.385  54.091 17.107  1.00 9.55  ? 258 GLY B C   1 
ATOM   4861 O  O   . GLY B 1 280 ? 9.547   54.452 16.270  1.00 14.07 ? 258 GLY B O   1 
ATOM   4862 N  N   . LEU B 1 281 ? 11.464  54.813 17.406  1.00 6.31  ? 259 LEU B N   1 
ATOM   4863 C  CA  . LEU B 1 281 ? 11.647  56.157 16.851  1.00 6.57  ? 259 LEU B CA  1 
ATOM   4864 C  C   . LEU B 1 281 ? 12.414  56.153 15.536  1.00 8.38  ? 259 LEU B C   1 
ATOM   4865 O  O   . LEU B 1 281 ? 12.496  57.183 14.874  1.00 8.92  ? 259 LEU B O   1 
ATOM   4866 C  CB  . LEU B 1 281 ? 12.369  57.067 17.850  1.00 7.63  ? 259 LEU B CB  1 
ATOM   4867 C  CG  . LEU B 1 281 ? 11.751  57.264 19.238  1.00 7.80  ? 259 LEU B CG  1 
ATOM   4868 C  CD1 . LEU B 1 281 ? 12.583  58.265 20.038  1.00 10.64 ? 259 LEU B CD1 1 
ATOM   4869 C  CD2 . LEU B 1 281 ? 10.277  57.708 19.156  1.00 9.67  ? 259 LEU B CD2 1 
ATOM   4870 N  N   . CYS B 1 282 ? 13.008  55.020 15.165  1.00 8.18  ? 260 CYS B N   1 
ATOM   4871 C  CA  . CYS B 1 282 ? 13.720  54.959 13.894  1.00 6.40  ? 260 CYS B CA  1 
ATOM   4872 C  C   . CYS B 1 282 ? 13.703  53.546 13.340  1.00 6.90  ? 260 CYS B C   1 
ATOM   4873 O  O   . CYS B 1 282 ? 13.299  52.608 14.021  1.00 9.04  ? 260 CYS B O   1 
ATOM   4874 C  CB  . CYS B 1 282 ? 15.170  55.456 14.033  1.00 7.49  ? 260 CYS B CB  1 
ATOM   4875 S  SG  . CYS B 1 282 ? 16.182  54.419 15.119  1.00 8.87  ? 260 CYS B SG  1 
ATOM   4876 N  N   . ASP B 1 283 ? 14.169  53.407 12.105  1.00 5.74  ? 261 ASP B N   1 
ATOM   4877 C  CA  . ASP B 1 283 ? 14.154  52.125 11.411  1.00 4.88  ? 261 ASP B CA  1 
ATOM   4878 C  C   . ASP B 1 283 ? 15.572  51.605 11.161  1.00 5.55  ? 261 ASP B C   1 
ATOM   4879 O  O   . ASP B 1 283 ? 15.761  50.596 10.499  1.00 7.62  ? 261 ASP B O   1 
ATOM   4880 C  CB  . ASP B 1 283 ? 13.385  52.273 10.096  1.00 4.97  ? 261 ASP B CB  1 
ATOM   4881 C  CG  . ASP B 1 283 ? 12.001  52.824 10.319  1.00 6.93  ? 261 ASP B CG  1 
ATOM   4882 O  OD1 . ASP B 1 283 ? 11.177  52.078 10.888  1.00 10.13 ? 261 ASP B OD1 1 
ATOM   4883 O  OD2 . ASP B 1 283 ? 11.753  54.013 9.999   1.00 6.45  ? 261 ASP B OD2 1 
ATOM   4884 N  N   . GLY B 1 284 ? 16.572  52.292 11.702  1.00 5.40  ? 262 GLY B N   1 
ATOM   4885 C  CA  . GLY B 1 284 ? 17.943  51.856 11.522  1.00 6.82  ? 262 GLY B CA  1 
ATOM   4886 C  C   . GLY B 1 284 ? 18.909  52.952 11.905  1.00 4.92  ? 262 GLY B C   1 
ATOM   4887 O  O   . GLY B 1 284 ? 18.494  54.006 12.386  1.00 5.04  ? 262 GLY B O   1 
ATOM   4888 N  N   . PHE B 1 285 ? 20.198  52.693 11.711  1.00 5.16  ? 263 PHE B N   1 
ATOM   4889 C  CA  . PHE B 1 285 ? 21.234  53.620 12.166  1.00 4.43  ? 263 PHE B CA  1 
ATOM   4890 C  C   . PHE B 1 285 ? 22.418  53.695 11.224  1.00 6.10  ? 263 PHE B C   1 
ATOM   4891 O  O   . PHE B 1 285 ? 22.843  52.692 10.650  1.00 6.65  ? 263 PHE B O   1 
ATOM   4892 C  CB  . PHE B 1 285 ? 21.820  53.184 13.526  1.00 5.71  ? 263 PHE B CB  1 
ATOM   4893 C  CG  . PHE B 1 285 ? 20.829  53.141 14.667  1.00 5.09  ? 263 PHE B CG  1 
ATOM   4894 C  CD1 . PHE B 1 285 ? 20.085  51.992 14.916  1.00 6.87  ? 263 PHE B CD1 1 
ATOM   4895 C  CD2 . PHE B 1 285 ? 20.690  54.225 15.526  1.00 7.43  ? 263 PHE B CD2 1 
ATOM   4896 C  CE1 . PHE B 1 285 ? 19.186  51.934 15.978  1.00 9.43  ? 263 PHE B CE1 1 
ATOM   4897 C  CE2 . PHE B 1 285 ? 19.789  54.182 16.596  1.00 6.59  ? 263 PHE B CE2 1 
ATOM   4898 C  CZ  . PHE B 1 285 ? 19.038  53.035 16.826  1.00 8.11  ? 263 PHE B CZ  1 
ATOM   4899 N  N   . GLY B 1 286 ? 22.976  54.891 11.100  1.00 5.90  ? 264 GLY B N   1 
ATOM   4900 C  CA  . GLY B 1 286 ? 24.352  55.027 10.653  1.00 6.11  ? 264 GLY B CA  1 
ATOM   4901 C  C   . GLY B 1 286 ? 25.148  55.251 11.926  1.00 9.08  ? 264 GLY B C   1 
ATOM   4902 O  O   . GLY B 1 286 ? 25.033  56.312 12.535  1.00 16.08 ? 264 GLY B O   1 
ATOM   4903 N  N   . MET B 1 287 ? 25.905  54.256 12.382  1.00 6.39  ? 265 MET B N   1 
ATOM   4904 C  CA  . MET B 1 287 ? 26.530  54.393 13.696  1.00 4.87  ? 265 MET B CA  1 
ATOM   4905 C  C   . MET B 1 287 ? 28.039  54.506 13.605  1.00 7.21  ? 265 MET B C   1 
ATOM   4906 O  O   . MET B 1 287 ? 28.690  53.711 12.922  1.00 8.51  ? 265 MET B O   1 
ATOM   4907 C  CB  . MET B 1 287 ? 26.138  53.234 14.623  1.00 7.85  ? 265 MET B CB  1 
ATOM   4908 C  CG  . MET B 1 287 ? 26.740  53.327 16.042  1.00 7.96  ? 265 MET B CG  1 
ATOM   4909 S  SD  . MET B 1 287 ? 26.351  54.812 16.981  1.00 7.90  ? 265 MET B SD  1 
ATOM   4910 C  CE  . MET B 1 287 ? 24.626  54.513 17.366  1.00 8.48  ? 265 MET B CE  1 
ATOM   4911 N  N   . LYS B 1 288 ? 28.579  55.508 14.296  1.00 6.58  ? 266 LYS B N   1 
ATOM   4912 C  CA  . LYS B 1 288 ? 30.016  55.755 14.337  1.00 5.68  ? 266 LYS B CA  1 
ATOM   4913 C  C   . LYS B 1 288 ? 30.637  55.230 15.625  1.00 8.94  ? 266 LYS B C   1 
ATOM   4914 O  O   . LYS B 1 288 ? 30.168  55.531 16.736  1.00 7.53  ? 266 LYS B O   1 
ATOM   4915 C  CB  . LYS B 1 288 ? 30.315  57.247 14.152  1.00 7.09  ? 266 LYS B CB  1 
ATOM   4916 C  CG  . LYS B 1 288 ? 29.890  57.749 12.762  1.00 8.87  ? 266 LYS B CG  1 
ATOM   4917 C  CD  . LYS B 1 288 ? 30.324  59.174 12.519  1.00 10.42 ? 266 LYS B CD  1 
ATOM   4918 C  CE  . LYS B 1 288 ? 30.110  59.567 11.060  1.00 11.06 ? 266 LYS B CE  1 
ATOM   4919 N  NZ  . LYS B 1 288 ? 28.683  59.510 10.615  1.00 14.67 ? 266 LYS B NZ  1 
ATOM   4920 N  N   . LEU B 1 289 ? 31.698  54.452 15.456  1.00 6.85  ? 267 LEU B N   1 
ATOM   4921 C  CA  . LEU B 1 289 ? 32.357  53.761 16.561  1.00 5.91  ? 267 LEU B CA  1 
ATOM   4922 C  C   . LEU B 1 289 ? 32.865  54.726 17.631  1.00 8.84  ? 267 LEU B C   1 
ATOM   4923 O  O   . LEU B 1 289 ? 32.665  54.499 18.829  1.00 7.98  ? 267 LEU B O   1 
ATOM   4924 C  CB  . LEU B 1 289 ? 33.502  52.905 16.008  1.00 9.04  ? 267 LEU B CB  1 
ATOM   4925 C  CG  . LEU B 1 289 ? 34.296  52.014 16.950  1.00 15.49 ? 267 LEU B CG  1 
ATOM   4926 C  CD1 . LEU B 1 289 ? 33.357  51.188 17.786  1.00 16.08 ? 267 LEU B CD1 1 
ATOM   4927 C  CD2 . LEU B 1 289 ? 35.191  51.104 16.120  1.00 10.33 ? 267 LEU B CD2 1 
ATOM   4928 N  N   . THR B 1 290 ? 33.522  55.808 17.217  1.00 7.47  ? 268 THR B N   1 
ATOM   4929 C  CA  . THR B 1 290 ? 34.026  56.760 18.202  1.00 6.20  ? 268 THR B CA  1 
ATOM   4930 C  C   . THR B 1 290 ? 32.913  57.467 18.966  1.00 6.93  ? 268 THR B C   1 
ATOM   4931 O  O   . THR B 1 290 ? 33.058  57.726 20.164  1.00 8.51  ? 268 THR B O   1 
ATOM   4932 C  CB  . THR B 1 290 ? 35.019  57.777 17.603  1.00 7.59  ? 268 THR B CB  1 
ATOM   4933 O  OG1 . THR B 1 290 ? 34.415  58.447 16.486  1.00 10.48 ? 268 THR B OG1 1 
ATOM   4934 C  CG2 . THR B 1 290 ? 36.287  57.079 17.170  1.00 9.05  ? 268 THR B CG2 1 
ATOM   4935 N  N   . ARG B 1 291 ? 31.806  57.770 18.289  1.00 5.26  ? 269 ARG B N   1 
ATOM   4936 C  CA  . ARG B 1 291 ? 30.694  58.454 18.948  1.00 5.18  ? 269 ARG B CA  1 
ATOM   4937 C  C   . ARG B 1 291 ? 30.092  57.616 20.075  1.00 6.86  ? 269 ARG B C   1 
ATOM   4938 O  O   . ARG B 1 291 ? 29.774  58.144 21.144  1.00 7.27  ? 269 ARG B O   1 
ATOM   4939 C  CB  . ARG B 1 291 ? 29.619  58.835 17.923  1.00 5.89  ? 269 ARG B CB  1 
ATOM   4940 C  CG  . ARG B 1 291 ? 28.366  59.458 18.553  1.00 7.93  ? 269 ARG B CG  1 
ATOM   4941 C  CD  . ARG B 1 291 ? 27.368  59.932 17.496  1.00 7.10  ? 269 ARG B CD  1 
ATOM   4942 N  NE  . ARG B 1 291 ? 26.842  58.832 16.698  1.00 6.00  ? 269 ARG B NE  1 
ATOM   4943 C  CZ  . ARG B 1 291 ? 26.844  58.792 15.368  1.00 5.36  ? 269 ARG B CZ  1 
ATOM   4944 N  NH1 . ARG B 1 291 ? 27.339  59.806 14.664  1.00 6.95  ? 269 ARG B NH1 1 
ATOM   4945 N  NH2 . ARG B 1 291 ? 26.329  57.741 14.747  1.00 7.80  ? 269 ARG B NH2 1 
ATOM   4946 N  N   . ILE B 1 292 ? 29.941  56.315 19.845  1.00 6.37  ? 270 ILE B N   1 
ATOM   4947 C  CA  . ILE B 1 292 ? 29.297  55.460 20.836  1.00 6.64  ? 270 ILE B CA  1 
ATOM   4948 C  C   . ILE B 1 292 ? 30.264  55.111 21.975  1.00 8.26  ? 270 ILE B C   1 
ATOM   4949 O  O   . ILE B 1 292 ? 29.844  54.646 23.040  1.00 8.17  ? 270 ILE B O   1 
ATOM   4950 C  CB  . ILE B 1 292 ? 28.695  54.187 20.178  1.00 7.11  ? 270 ILE B CB  1 
ATOM   4951 C  CG1 . ILE B 1 292 ? 27.550  53.622 21.025  1.00 10.51 ? 270 ILE B CG1 1 
ATOM   4952 C  CG2 . ILE B 1 292 ? 29.774  53.140 19.919  1.00 7.35  ? 270 ILE B CG2 1 
ATOM   4953 C  CD1 . ILE B 1 292 ? 26.338  54.492 21.004  1.00 13.88 ? 270 ILE B CD1 1 
ATOM   4954 N  N   . GLY B 1 293 ? 31.559  55.341 21.756  1.00 6.97  ? 271 GLY B N   1 
ATOM   4955 C  CA  . GLY B 1 293 ? 32.540  55.186 22.824  1.00 6.13  ? 271 GLY B CA  1 
ATOM   4956 C  C   . GLY B 1 293 ? 33.467  53.987 22.713  1.00 8.39  ? 271 GLY B C   1 
ATOM   4957 O  O   . GLY B 1 293 ? 34.206  53.677 23.659  1.00 11.59 ? 271 GLY B O   1 
ATOM   4958 N  N   . GLY B 1 294 ? 33.452  53.311 21.569  1.00 7.69  ? 272 GLY B N   1 
ATOM   4959 C  CA  . GLY B 1 294 ? 34.383  52.218 21.354  1.00 7.35  ? 272 GLY B CA  1 
ATOM   4960 C  C   . GLY B 1 294 ? 33.721  50.887 21.103  1.00 7.56  ? 272 GLY B C   1 
ATOM   4961 O  O   . GLY B 1 294 ? 32.495  50.792 21.013  1.00 6.88  ? 272 GLY B O   1 
ATOM   4962 N  N   . LEU B 1 295 ? 34.549  49.854 20.975  1.00 6.34  ? 273 LEU B N   1 
ATOM   4963 C  CA  . LEU B 1 295 ? 34.077  48.523 20.606  1.00 5.70  ? 273 LEU B CA  1 
ATOM   4964 C  C   . LEU B 1 295 ? 33.210  47.839 21.673  1.00 8.83  ? 273 LEU B C   1 
ATOM   4965 O  O   . LEU B 1 295 ? 32.272  47.121 21.333  1.00 7.79  ? 273 LEU B O   1 
ATOM   4966 C  CB  . LEU B 1 295 ? 35.263  47.635 20.217  1.00 5.76  ? 273 LEU B CB  1 
ATOM   4967 C  CG  . LEU B 1 295 ? 35.992  48.025 18.932  1.00 7.24  ? 273 LEU B CG  1 
ATOM   4968 C  CD1 . LEU B 1 295 ? 37.340  47.314 18.845  1.00 7.12  ? 273 LEU B CD1 1 
ATOM   4969 C  CD2 . LEU B 1 295 ? 35.134  47.686 17.722  1.00 8.96  ? 273 LEU B CD2 1 
ATOM   4970 N  N   . GLN B 1 296 ? 33.513  48.056 22.953  1.00 7.40  ? 274 GLN B N   1 
ATOM   4971 C  CA  . GLN B 1 296 ? 32.705  47.452 24.013  1.00 7.64  ? 274 GLN B CA  1 
ATOM   4972 C  C   . GLN B 1 296 ? 31.242  47.909 23.895  1.00 8.08  ? 274 GLN B C   1 
ATOM   4973 O  O   . GLN B 1 296 ? 30.310  47.094 23.945  1.00 7.81  ? 274 GLN B O   1 
ATOM   4974 C  CB  . GLN B 1 296 ? 33.291  47.802 25.389  1.00 9.89  ? 274 GLN B CB  1 
ATOM   4975 C  CG  . GLN B 1 296 ? 32.784  46.928 26.542  1.00 11.07 ? 274 GLN B CG  1 
ATOM   4976 C  CD  . GLN B 1 296 ? 31.421  47.341 27.077  1.00 9.32  ? 274 GLN B CD  1 
ATOM   4977 O  OE1 . GLN B 1 296 ? 31.073  48.523 27.102  1.00 10.53 ? 274 GLN B OE1 1 
ATOM   4978 N  NE2 . GLN B 1 296 ? 30.649  46.358 27.526  1.00 9.67  ? 274 GLN B NE2 1 
ATOM   4979 N  N   . GLN B 1 297 ? 31.047  49.208 23.693  1.00 5.88  ? 275 GLN B N   1 
ATOM   4980 C  CA  . GLN B 1 297 ? 29.706  49.756 23.566  1.00 6.20  ? 275 GLN B CA  1 
ATOM   4981 C  C   . GLN B 1 297 ? 29.089  49.432 22.208  1.00 6.18  ? 275 GLN B C   1 
ATOM   4982 O  O   . GLN B 1 297 ? 27.881  49.200 22.100  1.00 6.72  ? 275 GLN B O   1 
ATOM   4983 C  CB  . GLN B 1 297 ? 29.731  51.268 23.808  1.00 5.48  ? 275 GLN B CB  1 
ATOM   4984 C  CG  . GLN B 1 297 ? 30.001  51.634 25.263  1.00 6.18  ? 275 GLN B CG  1 
ATOM   4985 C  CD  . GLN B 1 297 ? 28.778  51.430 26.128  1.00 7.10  ? 275 GLN B CD  1 
ATOM   4986 O  OE1 . GLN B 1 297 ? 27.840  52.240 26.109  1.00 8.24  ? 275 GLN B OE1 1 
ATOM   4987 N  NE2 . GLN B 1 297 ? 28.771  50.337 26.900  1.00 8.14  ? 275 GLN B NE2 1 
ATOM   4988 N  N   . MET B 1 298 ? 29.926  49.400 21.177  1.00 6.09  ? 276 MET B N   1 
ATOM   4989 C  CA  . MET B 1 298 ? 29.454  49.093 19.834  1.00 6.39  ? 276 MET B CA  1 
ATOM   4990 C  C   . MET B 1 298 ? 28.893  47.679 19.738  1.00 6.80  ? 276 MET B C   1 
ATOM   4991 O  O   . MET B 1 298 ? 27.911  47.437 19.023  1.00 7.28  ? 276 MET B O   1 
ATOM   4992 C  CB  . MET B 1 298 ? 30.581  49.301 18.812  1.00 6.02  ? 276 MET B CB  1 
ATOM   4993 C  CG  . MET B 1 298 ? 30.110  49.358 17.357  1.00 12.22 ? 276 MET B CG  1 
ATOM   4994 S  SD  . MET B 1 298 ? 29.284  50.909 16.929  1.00 10.54 ? 276 MET B SD  1 
ATOM   4995 C  CE  . MET B 1 298 ? 28.906  50.594 15.195  1.00 12.10 ? 276 MET B CE  1 
ATOM   4996 N  N   . ALA B 1 299 ? 29.496  46.739 20.460  1.00 7.99  ? 277 ALA B N   1 
ATOM   4997 C  CA  . ALA B 1 299 ? 28.996  45.361 20.453  1.00 6.80  ? 277 ALA B CA  1 
ATOM   4998 C  C   . ALA B 1 299 ? 27.613  45.300 21.078  1.00 6.28  ? 277 ALA B C   1 
ATOM   4999 O  O   . ALA B 1 299 ? 26.733  44.594 20.581  1.00 8.05  ? 277 ALA B O   1 
ATOM   5000 C  CB  . ALA B 1 299 ? 29.964  44.423 21.181  1.00 9.03  ? 277 ALA B CB  1 
ATOM   5001 N  N   . ALA B 1 300 ? 27.413  46.051 22.165  1.00 6.03  ? 278 ALA B N   1 
ATOM   5002 C  CA  . ALA B 1 300 ? 26.092  46.112 22.796  1.00 5.96  ? 278 ALA B CA  1 
ATOM   5003 C  C   . ALA B 1 300 ? 25.059  46.733 21.865  1.00 6.36  ? 278 ALA B C   1 
ATOM   5004 O  O   . ALA B 1 300 ? 23.918  46.252 21.776  1.00 6.22  ? 278 ALA B O   1 
ATOM   5005 C  CB  . ALA B 1 300 ? 26.159  46.873 24.131  1.00 7.78  ? 278 ALA B CB  1 
ATOM   5006 N  N   . PHE B 1 301 ? 25.472  47.800 21.172  1.00 6.98  ? 279 PHE B N   1 
ATOM   5007 C  CA  . PHE B 1 301 ? 24.642  48.450 20.167  1.00 7.21  ? 279 PHE B CA  1 
ATOM   5008 C  C   . PHE B 1 301 ? 24.226  47.452 19.092  1.00 5.75  ? 279 PHE B C   1 
ATOM   5009 O  O   . PHE B 1 301 ? 23.044  47.377 18.723  1.00 5.79  ? 279 PHE B O   1 
ATOM   5010 C  CB  . PHE B 1 301 ? 25.398  49.628 19.543  1.00 4.53  ? 279 PHE B CB  1 
ATOM   5011 C  CG  . PHE B 1 301 ? 24.829  50.083 18.230  1.00 8.56  ? 279 PHE B CG  1 
ATOM   5012 C  CD1 . PHE B 1 301 ? 23.683  50.863 18.185  1.00 8.90  ? 279 PHE B CD1 1 
ATOM   5013 C  CD2 . PHE B 1 301 ? 25.449  49.731 17.040  1.00 8.22  ? 279 PHE B CD2 1 
ATOM   5014 C  CE1 . PHE B 1 301 ? 23.158  51.274 16.968  1.00 8.36  ? 279 PHE B CE1 1 
ATOM   5015 C  CE2 . PHE B 1 301 ? 24.927  50.144 15.823  1.00 6.70  ? 279 PHE B CE2 1 
ATOM   5016 C  CZ  . PHE B 1 301 ? 23.778  50.915 15.794  1.00 8.56  ? 279 PHE B CZ  1 
ATOM   5017 N  N   . ARG B 1 302 ? 25.197  46.686 18.603  1.00 5.48  ? 280 ARG B N   1 
ATOM   5018 C  CA  . ARG B 1 302 ? 24.930  45.670 17.587  1.00 5.79  ? 280 ARG B CA  1 
ATOM   5019 C  C   . ARG B 1 302 ? 23.880  44.669 18.076  1.00 7.26  ? 280 ARG B C   1 
ATOM   5020 O  O   . ARG B 1 302 ? 22.960  44.293 17.336  1.00 6.81  ? 280 ARG B O   1 
ATOM   5021 C  CB  . ARG B 1 302 ? 26.228  44.931 17.245  1.00 5.33  ? 280 ARG B CB  1 
ATOM   5022 C  CG  . ARG B 1 302 ? 26.035  43.685 16.372  1.00 7.60  ? 280 ARG B CG  1 
ATOM   5023 C  CD  . ARG B 1 302 ? 27.158  42.683 16.593  1.00 9.36  ? 280 ARG B CD  1 
ATOM   5024 N  NE  . ARG B 1 302 ? 27.179  42.182 17.975  1.00 7.44  ? 280 ARG B NE  1 
ATOM   5025 C  CZ  . ARG B 1 302 ? 28.274  41.750 18.591  1.00 7.65  ? 280 ARG B CZ  1 
ATOM   5026 N  NH1 . ARG B 1 302 ? 29.447  41.758 17.958  1.00 7.47  ? 280 ARG B NH1 1 
ATOM   5027 N  NH2 . ARG B 1 302 ? 28.206  41.317 19.845  1.00 7.12  ? 280 ARG B NH2 1 
ATOM   5028 N  N   . ASP B 1 303 ? 24.024  44.234 19.321  1.00 6.05  ? 281 ASP B N   1 
ATOM   5029 C  CA  . ASP B 1 303 ? 23.088  43.269 19.894  1.00 5.49  ? 281 ASP B CA  1 
ATOM   5030 C  C   . ASP B 1 303 ? 21.665  43.825 20.052  1.00 6.39  ? 281 ASP B C   1 
ATOM   5031 O  O   . ASP B 1 303 ? 20.676  43.091 19.865  1.00 6.90  ? 281 ASP B O   1 
ATOM   5032 C  CB  . ASP B 1 303 ? 23.643  42.753 21.226  1.00 5.30  ? 281 ASP B CB  1 
ATOM   5033 C  CG  . ASP B 1 303 ? 24.922  41.937 21.046  1.00 10.61 ? 281 ASP B CG  1 
ATOM   5034 O  OD1 . ASP B 1 303 ? 25.149  41.404 19.935  1.00 13.28 ? 281 ASP B OD1 1 
ATOM   5035 O  OD2 . ASP B 1 303 ? 25.699  41.829 22.017  1.00 13.52 ? 281 ASP B OD2 1 
ATOM   5036 N  N   . ILE B 1 304 ? 21.550  45.112 20.381  1.00 6.00  ? 282 ILE B N   1 
ATOM   5037 C  CA  . ILE B 1 304 ? 20.242  45.757 20.462  1.00 4.97  ? 282 ILE B CA  1 
ATOM   5038 C  C   . ILE B 1 304 ? 19.571  45.788 19.080  1.00 6.71  ? 282 ILE B C   1 
ATOM   5039 O  O   . ILE B 1 304 ? 18.397  45.420 18.921  1.00 6.63  ? 282 ILE B O   1 
ATOM   5040 C  CB  . ILE B 1 304 ? 20.366  47.188 21.020  1.00 6.47  ? 282 ILE B CB  1 
ATOM   5041 C  CG1 . ILE B 1 304 ? 20.751  47.154 22.507  1.00 7.82  ? 282 ILE B CG1 1 
ATOM   5042 C  CG2 . ILE B 1 304 ? 19.064  47.948 20.827  1.00 7.20  ? 282 ILE B CG2 1 
ATOM   5043 C  CD1 . ILE B 1 304 ? 21.193  48.515 23.043  1.00 10.39 ? 282 ILE B CD1 1 
ATOM   5044 N  N   . CYS B 1 305 ? 20.329  46.207 18.074  1.00 6.10  ? 283 CYS B N   1 
ATOM   5045 C  CA  . CYS B 1 305 ? 19.818  46.260 16.706  1.00 5.62  ? 283 CYS B CA  1 
ATOM   5046 C  C   . CYS B 1 305 ? 19.410  44.885 16.189  1.00 6.32  ? 283 CYS B C   1 
ATOM   5047 O  O   . CYS B 1 305 ? 18.389  44.754 15.509  1.00 7.77  ? 283 CYS B O   1 
ATOM   5048 C  CB  . CYS B 1 305 ? 20.861  46.880 15.770  1.00 6.34  ? 283 CYS B CB  1 
ATOM   5049 S  SG  . CYS B 1 305 ? 21.063  48.667 16.021  1.00 6.27  ? 283 CYS B SG  1 
ATOM   5050 N  N   . GLU B 1 306 ? 20.186  43.855 16.514  1.00 5.38  ? 284 GLU B N   1 
ATOM   5051 C  CA  . GLU B 1 306 ? 19.865  42.519 16.022  1.00 5.06  ? 284 GLU B CA  1 
ATOM   5052 C  C   . GLU B 1 306 ? 18.567  41.996 16.639  1.00 7.10  ? 284 GLU B C   1 
ATOM   5053 O  O   . GLU B 1 306 ? 17.775  41.332 15.970  1.00 8.10  ? 284 GLU B O   1 
ATOM   5054 C  CB  . GLU B 1 306 ? 21.044  41.559 16.251  1.00 6.48  ? 284 GLU B CB  1 
ATOM   5055 C  CG  . GLU B 1 306 ? 20.830  40.213 15.595  1.00 6.41  ? 284 GLU B CG  1 
ATOM   5056 C  CD  . GLU B 1 306 ? 22.081  39.356 15.473  1.00 12.20 ? 284 GLU B CD  1 
ATOM   5057 O  OE1 . GLU B 1 306 ? 23.196  39.787 15.862  1.00 9.77  ? 284 GLU B OE1 1 
ATOM   5058 O  OE2 . GLU B 1 306 ? 21.936  38.213 14.974  1.00 14.26 ? 284 GLU B OE2 1 
ATOM   5059 N  N   . ALA B 1 307 ? 18.339  42.331 17.907  1.00 7.51  ? 285 ALA B N   1 
ATOM   5060 C  CA  . ALA B 1 307 ? 17.119  41.917 18.590  1.00 5.45  ? 285 ALA B CA  1 
ATOM   5061 C  C   . ALA B 1 307 ? 15.870  42.532 17.966  1.00 6.25  ? 285 ALA B C   1 
ATOM   5062 O  O   . ALA B 1 307 ? 14.779  41.954 18.045  1.00 8.11  ? 285 ALA B O   1 
ATOM   5063 C  CB  . ALA B 1 307 ? 17.202  42.273 20.076  1.00 7.45  ? 285 ALA B CB  1 
ATOM   5064 N  N   . ARG B 1 308 ? 16.026  43.698 17.353  1.00 6.98  ? 286 ARG B N   1 
ATOM   5065 C  CA  . ARG B 1 308 ? 14.896  44.406 16.756  1.00 8.25  ? 286 ARG B CA  1 
ATOM   5066 C  C   . ARG B 1 308 ? 14.951  44.525 15.235  1.00 8.65  ? 286 ARG B C   1 
ATOM   5067 O  O   . ARG B 1 308 ? 14.185  45.302 14.662  1.00 8.13  ? 286 ARG B O   1 
ATOM   5068 C  CB  . ARG B 1 308 ? 14.750  45.796 17.393  1.00 8.90  ? 286 ARG B CB  1 
ATOM   5069 C  CG  . ARG B 1 308 ? 14.215  45.746 18.836  1.00 9.24  ? 286 ARG B CG  1 
ATOM   5070 C  CD  . ARG B 1 308 ? 12.808  45.151 18.872  1.00 11.80 ? 286 ARG B CD  1 
ATOM   5071 N  NE  . ARG B 1 308 ? 12.279  45.149 20.233  1.00 10.59 ? 286 ARG B NE  1 
ATOM   5072 C  CZ  . ARG B 1 308 ? 11.722  46.209 20.810  1.00 10.56 ? 286 ARG B CZ  1 
ATOM   5073 N  NH1 . ARG B 1 308 ? 11.284  46.126 22.058  1.00 10.18 ? 286 ARG B NH1 1 
ATOM   5074 N  NH2 . ARG B 1 308 ? 11.589  47.341 20.127  1.00 12.11 ? 286 ARG B NH2 1 
ATOM   5075 N  N   . ALA B 1 309 ? 15.834  43.751 14.591  1.00 6.62  ? 287 ALA B N   1 
ATOM   5076 C  CA  . ALA B 1 309 ? 15.989  43.792 13.127  1.00 8.43  ? 287 ALA B CA  1 
ATOM   5077 C  C   . ALA B 1 309 ? 16.126  45.222 12.594  1.00 7.48  ? 287 ALA B C   1 
ATOM   5078 O  O   . ALA B 1 309 ? 15.448  45.623 11.628  1.00 8.10  ? 287 ALA B O   1 
ATOM   5079 C  CB  . ALA B 1 309 ? 14.823  43.070 12.431  1.00 9.79  ? 287 ALA B CB  1 
ATOM   5080 N  N   . LEU B 1 310 ? 16.990  46.000 13.240  1.00 6.53  ? 288 LEU B N   1 
ATOM   5081 C  CA  . LEU B 1 310 ? 17.270  47.364 12.808  1.00 4.82  ? 288 LEU B CA  1 
ATOM   5082 C  C   . LEU B 1 310 ? 18.596  47.373 12.064  1.00 7.53  ? 288 LEU B C   1 
ATOM   5083 O  O   . LEU B 1 310 ? 19.656  47.261 12.689  1.00 8.50  ? 288 LEU B O   1 
ATOM   5084 C  CB  . LEU B 1 310 ? 17.369  48.294 14.028  1.00 5.59  ? 288 LEU B CB  1 
ATOM   5085 C  CG  . LEU B 1 310 ? 16.053  48.483 14.785  1.00 5.01  ? 288 LEU B CG  1 
ATOM   5086 C  CD1 . LEU B 1 310 ? 16.263  49.179 16.129  1.00 6.72  ? 288 LEU B CD1 1 
ATOM   5087 C  CD2 . LEU B 1 310 ? 15.091  49.307 13.945  1.00 9.13  ? 288 LEU B CD2 1 
ATOM   5088 N  N   . PRO B 1 311 ? 18.558  47.491 10.730  1.00 4.75  ? 289 PRO B N   1 
ATOM   5089 C  CA  . PRO B 1 311 ? 19.818  47.513 9.975   1.00 4.54  ? 289 PRO B CA  1 
ATOM   5090 C  C   . PRO B 1 311 ? 20.681  48.717 10.346  1.00 5.78  ? 289 PRO B C   1 
ATOM   5091 O  O   . PRO B 1 311 ? 20.158  49.781 10.700  1.00 6.57  ? 289 PRO B O   1 
ATOM   5092 C  CB  . PRO B 1 311 ? 19.340  47.618 8.510   1.00 4.71  ? 289 PRO B CB  1 
ATOM   5093 C  CG  . PRO B 1 311 ? 17.907  47.105 8.528   1.00 6.95  ? 289 PRO B CG  1 
ATOM   5094 C  CD  . PRO B 1 311 ? 17.389  47.638 9.841   1.00 7.07  ? 289 PRO B CD  1 
ATOM   5095 N  N   . HIS B 1 312 ? 21.995  48.548 10.289  1.00 6.01  ? 290 HIS B N   1 
ATOM   5096 C  CA  . HIS B 1 312 ? 22.900  49.637 10.609  1.00 5.02  ? 290 HIS B CA  1 
ATOM   5097 C  C   . HIS B 1 312 ? 24.242  49.474 9.925   1.00 7.44  ? 290 HIS B C   1 
ATOM   5098 O  O   . HIS B 1 312 ? 24.631  48.376 9.522   1.00 6.64  ? 290 HIS B O   1 
ATOM   5099 C  CB  . HIS B 1 312 ? 23.122  49.739 12.128  1.00 6.79  ? 290 HIS B CB  1 
ATOM   5100 C  CG  . HIS B 1 312 ? 23.825  48.554 12.718  1.00 7.52  ? 290 HIS B CG  1 
ATOM   5101 N  ND1 . HIS B 1 312 ? 25.201  48.469 12.805  1.00 5.81  ? 290 HIS B ND1 1 
ATOM   5102 C  CD2 . HIS B 1 312 ? 23.341  47.399 13.231  1.00 8.39  ? 290 HIS B CD2 1 
ATOM   5103 C  CE1 . HIS B 1 312 ? 25.531  47.308 13.353  1.00 7.16  ? 290 HIS B CE1 1 
ATOM   5104 N  NE2 . HIS B 1 312 ? 24.423  46.644 13.623  1.00 9.23  ? 290 HIS B NE2 1 
ATOM   5105 N  N   . SER B 1 313 ? 24.956  50.584 9.810   1.00 6.49  ? 291 SER B N   1 
ATOM   5106 C  CA  . SER B 1 313 ? 26.330  50.558 9.344   1.00 7.17  ? 291 SER B CA  1 
ATOM   5107 C  C   . SER B 1 313 ? 27.261  50.620 10.554  1.00 8.77  ? 291 SER B C   1 
ATOM   5108 O  O   . SER B 1 313 ? 26.811  50.893 11.675  1.00 7.85  ? 291 SER B O   1 
ATOM   5109 C  CB  . SER B 1 313 ? 26.579  51.738 8.405   1.00 9.69  ? 291 SER B CB  1 
ATOM   5110 O  OG  . SER B 1 313 ? 26.237  52.950 9.049   1.00 9.63  ? 291 SER B OG  1 
ATOM   5111 N  N   . CYS B 1 314 ? 28.542  50.339 10.324  1.00 7.08  ? 292 CYS B N   1 
ATOM   5112 C  CA  . CYS B 1 314 ? 29.592  50.483 11.335  1.00 7.00  ? 292 CYS B CA  1 
ATOM   5113 C  C   . CYS B 1 314 ? 30.672  51.356 10.723  1.00 7.88  ? 292 CYS B C   1 
ATOM   5114 O  O   . CYS B 1 314 ? 31.506  50.874 9.955   1.00 9.40  ? 292 CYS B O   1 
ATOM   5115 C  CB  . CYS B 1 314 ? 30.198  49.118 11.698  1.00 7.14  ? 292 CYS B CB  1 
ATOM   5116 S  SG  . CYS B 1 314 ? 29.062  47.956 12.528  1.00 10.04 ? 292 CYS B SG  1 
ATOM   5117 N  N   . ASP B 1 315 ? 30.646  52.643 11.064  1.00 7.31  ? 293 ASP B N   1 
ATOM   5118 C  CA  . ASP B 1 315 ? 31.413  53.651 10.347  1.00 8.06  ? 293 ASP B CA  1 
ATOM   5119 C  C   . ASP B 1 315 ? 32.286  54.423 11.305  1.00 6.99  ? 293 ASP B C   1 
ATOM   5120 O  O   . ASP B 1 315 ? 32.235  54.215 12.513  1.00 8.68  ? 293 ASP B O   1 
ATOM   5121 C  CB  . ASP B 1 315 ? 30.441  54.664 9.710   1.00 8.35  ? 293 ASP B CB  1 
ATOM   5122 C  CG  . ASP B 1 315 ? 29.436  54.020 8.776   1.00 8.52  ? 293 ASP B CG  1 
ATOM   5123 O  OD1 . ASP B 1 315 ? 29.747  52.972 8.176   1.00 7.81  ? 293 ASP B OD1 1 
ATOM   5124 O  OD2 . ASP B 1 315 ? 28.321  54.571 8.643   1.00 11.15 ? 293 ASP B OD2 1 
ATOM   5125 N  N   . ASP B 1 316 ? 33.082  55.337 10.773  1.00 6.48  ? 294 ASP B N   1 
ATOM   5126 C  CA  . ASP B 1 316 ? 33.487  56.450 11.602  1.00 7.20  ? 294 ASP B CA  1 
ATOM   5127 C  C   . ASP B 1 316 ? 33.461  57.753 10.828  1.00 9.59  ? 294 ASP B C   1 
ATOM   5128 O  O   . ASP B 1 316 ? 33.105  57.775 9.657   1.00 12.76 ? 294 ASP B O   1 
ATOM   5129 C  CB  . ASP B 1 316 ? 34.827  56.212 12.287  1.00 9.78  ? 294 ASP B CB  1 
ATOM   5130 C  CG  . ASP B 1 316 ? 34.782  56.621 13.733  1.00 10.63 ? 294 ASP B CG  1 
ATOM   5131 O  OD1 . ASP B 1 316 ? 34.986  57.823 14.021  1.00 12.97 ? 294 ASP B OD1 1 
ATOM   5132 O  OD2 . ASP B 1 316 ? 34.468  55.746 14.560  1.00 9.01  ? 294 ASP B OD2 1 
ATOM   5133 N  N   . ALA B 1 317 ? 33.811  58.840 11.502  1.00 10.49 ? 295 ALA B N   1 
ATOM   5134 C  CA  . ALA B 1 317 ? 33.790  60.153 10.875  1.00 11.60 ? 295 ALA B CA  1 
ATOM   5135 C  C   . ALA B 1 317 ? 34.854  60.261 9.784   1.00 12.12 ? 295 ALA B C   1 
ATOM   5136 O  O   . ALA B 1 317 ? 34.605  60.823 8.708   1.00 14.24 ? 295 ALA B O   1 
ATOM   5137 C  CB  . ALA B 1 317 ? 34.000  61.225 11.925  1.00 12.90 ? 295 ALA B CB  1 
ATOM   5138 N  N   . TRP B 1 318 ? 36.042  59.728 10.080  1.00 10.54 ? 296 TRP B N   1 
ATOM   5139 C  CA  . TRP B 1 318 ? 37.194  59.776 9.186   1.00 8.78  ? 296 TRP B CA  1 
ATOM   5140 C  C   . TRP B 1 318 ? 38.315  58.969 9.838   1.00 9.11  ? 296 TRP B C   1 
ATOM   5141 O  O   . TRP B 1 318 ? 38.140  58.454 10.941  1.00 9.66  ? 296 TRP B O   1 
ATOM   5142 C  CB  . TRP B 1 318 ? 37.662  61.224 8.982   1.00 12.67 ? 296 TRP B CB  1 
ATOM   5143 C  CG  . TRP B 1 318 ? 38.430  61.469 7.702   1.00 14.58 ? 296 TRP B CG  1 
ATOM   5144 C  CD1 . TRP B 1 318 ? 39.783  61.453 7.536   1.00 14.26 ? 296 TRP B CD1 1 
ATOM   5145 C  CD2 . TRP B 1 318 ? 37.871  61.782 6.421   1.00 12.73 ? 296 TRP B CD2 1 
ATOM   5146 N  NE1 . TRP B 1 318 ? 40.105  61.735 6.225   1.00 19.48 ? 296 TRP B NE1 1 
ATOM   5147 C  CE2 . TRP B 1 318 ? 38.950  61.934 5.523   1.00 13.30 ? 296 TRP B CE2 1 
ATOM   5148 C  CE3 . TRP B 1 318 ? 36.568  61.935 5.949   1.00 15.43 ? 296 TRP B CE3 1 
ATOM   5149 C  CZ2 . TRP B 1 318 ? 38.753  62.246 4.172   1.00 17.64 ? 296 TRP B CZ2 1 
ATOM   5150 C  CZ3 . TRP B 1 318 ? 36.379  62.246 4.607   1.00 21.76 ? 296 TRP B CZ3 1 
ATOM   5151 C  CH2 . TRP B 1 318 ? 37.466  62.396 3.740   1.00 16.51 ? 296 TRP B CH2 1 
ATOM   5152 N  N   . GLY B 1 319 ? 39.457  58.863 9.163   1.00 9.51  ? 297 GLY B N   1 
ATOM   5153 C  CA  . GLY B 1 319 ? 40.641  58.279 9.769   1.00 8.87  ? 297 GLY B CA  1 
ATOM   5154 C  C   . GLY B 1 319 ? 41.256  57.141 8.983   1.00 10.45 ? 297 GLY B C   1 
ATOM   5155 O  O   . GLY B 1 319 ? 40.635  56.597 8.068   1.00 12.91 ? 297 GLY B O   1 
ATOM   5156 N  N   . GLY B 1 320 ? 42.473  56.777 9.374   1.00 10.25 ? 298 GLY B N   1 
ATOM   5157 C  CA  . GLY B 1 320 ? 43.271  55.796 8.653   1.00 12.17 ? 298 GLY B CA  1 
ATOM   5158 C  C   . GLY B 1 320 ? 43.082  54.350 9.076   1.00 8.68  ? 298 GLY B C   1 
ATOM   5159 O  O   . GLY B 1 320 ? 42.014  53.970 9.569   1.00 8.19  ? 298 GLY B O   1 
ATOM   5160 N  N   . ASP B 1 321 ? 44.135  53.550 8.879   1.00 11.25 ? 299 ASP B N   1 
ATOM   5161 C  CA  . ASP B 1 321 ? 44.070  52.095 9.063   1.00 9.74  ? 299 ASP B CA  1 
ATOM   5162 C  C   . ASP B 1 321 ? 43.599  51.613 10.427  1.00 9.00  ? 299 ASP B C   1 
ATOM   5163 O  O   . ASP B 1 321 ? 42.949  50.575 10.520  1.00 8.75  ? 299 ASP B O   1 
ATOM   5164 C  CB  . ASP B 1 321 ? 45.430  51.441 8.771   1.00 8.55  ? 299 ASP B CB  1 
ATOM   5165 C  CG  . ASP B 1 321 ? 45.723  51.344 7.293   1.00 8.83  ? 299 ASP B CG  1 
ATOM   5166 O  OD1 . ASP B 1 321 ? 44.772  51.170 6.505   1.00 12.18 ? 299 ASP B OD1 1 
ATOM   5167 O  OD2 . ASP B 1 321 ? 46.906  51.422 6.929   1.00 10.39 ? 299 ASP B OD2 1 
ATOM   5168 N  N   . ILE B 1 322 ? 43.962  52.331 11.485  1.00 8.46  ? 300 ILE B N   1 
ATOM   5169 C  CA  . ILE B 1 322 ? 43.614  51.879 12.833  1.00 9.48  ? 300 ILE B CA  1 
ATOM   5170 C  C   . ILE B 1 322 ? 42.104  51.957 13.097  1.00 8.16  ? 300 ILE B C   1 
ATOM   5171 O  O   . ILE B 1 322 ? 41.472  50.942 13.414  1.00 8.10  ? 300 ILE B O   1 
ATOM   5172 C  CB  . ILE B 1 322 ? 44.446  52.610 13.917  1.00 7.89  ? 300 ILE B CB  1 
ATOM   5173 C  CG1 . ILE B 1 322 ? 45.931  52.285 13.737  1.00 9.09  ? 300 ILE B CG1 1 
ATOM   5174 C  CG2 . ILE B 1 322 ? 43.991  52.196 15.306  1.00 9.72  ? 300 ILE B CG2 1 
ATOM   5175 C  CD1 . ILE B 1 322 ? 46.868  53.341 14.320  1.00 10.51 ? 300 ILE B CD1 1 
ATOM   5176 N  N   . ILE B 1 323 ? 41.503  53.136 12.935  1.00 7.59  ? 301 ILE B N   1 
ATOM   5177 C  CA  . ILE B 1 323 ? 40.058  53.238 13.130  1.00 6.70  ? 301 ILE B CA  1 
ATOM   5178 C  C   . ILE B 1 323 ? 39.297  52.435 12.071  1.00 6.53  ? 301 ILE B C   1 
ATOM   5179 O  O   . ILE B 1 323 ? 38.282  51.808 12.375  1.00 6.54  ? 301 ILE B O   1 
ATOM   5180 C  CB  . ILE B 1 323 ? 39.574  54.722 13.221  1.00 7.83  ? 301 ILE B CB  1 
ATOM   5181 C  CG1 . ILE B 1 323 ? 38.080  54.793 13.539  1.00 7.06  ? 301 ILE B CG1 1 
ATOM   5182 C  CG2 . ILE B 1 323 ? 39.860  55.486 11.929  1.00 9.97  ? 301 ILE B CG2 1 
ATOM   5183 C  CD1 . ILE B 1 323 ? 37.661  54.159 14.882  1.00 7.94  ? 301 ILE B CD1 1 
ATOM   5184 N  N   . ALA B 1 324 ? 39.808  52.428 10.840  1.00 7.47  ? 302 ALA B N   1 
ATOM   5185 C  CA  . ALA B 1 324 ? 39.161  51.666 9.773   1.00 7.15  ? 302 ALA B CA  1 
ATOM   5186 C  C   . ALA B 1 324 ? 39.119  50.181 10.098  1.00 6.79  ? 302 ALA B C   1 
ATOM   5187 O  O   . ALA B 1 324 ? 38.104  49.526 9.865   1.00 6.44  ? 302 ALA B O   1 
ATOM   5188 C  CB  . ALA B 1 324 ? 39.854  51.899 8.433   1.00 8.11  ? 302 ALA B CB  1 
ATOM   5189 N  N   . ALA B 1 325 ? 40.218  49.656 10.631  1.00 6.81  ? 303 ALA B N   1 
ATOM   5190 C  CA  . ALA B 1 325 ? 40.277  48.239 10.972  1.00 6.82  ? 303 ALA B CA  1 
ATOM   5191 C  C   . ALA B 1 325 ? 39.312  47.936 12.103  1.00 6.70  ? 303 ALA B C   1 
ATOM   5192 O  O   . ALA B 1 325 ? 38.629  46.910 12.073  1.00 6.40  ? 303 ALA B O   1 
ATOM   5193 C  CB  . ALA B 1 325 ? 41.686  47.825 11.337  1.00 7.16  ? 303 ALA B CB  1 
ATOM   5194 N  N   . ALA B 1 326 ? 39.238  48.830 13.088  1.00 6.43  ? 304 ALA B N   1 
ATOM   5195 C  CA  . ALA B 1 326 ? 38.288  48.640 14.186  1.00 6.32  ? 304 ALA B CA  1 
ATOM   5196 C  C   . ALA B 1 326 ? 36.849  48.572 13.684  1.00 7.03  ? 304 ALA B C   1 
ATOM   5197 O  O   . ALA B 1 326 ? 36.067  47.703 14.110  1.00 6.57  ? 304 ALA B O   1 
ATOM   5198 C  CB  . ALA B 1 326 ? 38.457  49.738 15.246  1.00 6.85  ? 304 ALA B CB  1 
ATOM   5199 N  N   . CYS B 1 327 ? 36.500  49.469 12.766  1.00 5.84  ? 305 CYS B N   1 
ATOM   5200 C  CA  . CYS B 1 327 ? 35.155  49.471 12.188  1.00 7.87  ? 305 CYS B CA  1 
ATOM   5201 C  C   . CYS B 1 327 ? 34.882  48.201 11.395  1.00 5.63  ? 305 CYS B C   1 
ATOM   5202 O  O   . CYS B 1 327 ? 33.771  47.662 11.423  1.00 6.80  ? 305 CYS B O   1 
ATOM   5203 C  CB  . CYS B 1 327 ? 34.956  50.688 11.282  1.00 7.95  ? 305 CYS B CB  1 
ATOM   5204 S  SG  . CYS B 1 327 ? 34.971  52.274 12.153  1.00 8.43  ? 305 CYS B SG  1 
ATOM   5205 N  N   . THR B 1 328 ? 35.899  47.730 10.681  1.00 7.31  ? 306 THR B N   1 
ATOM   5206 C  CA  . THR B 1 328 ? 35.759  46.533 9.864   1.00 5.99  ? 306 THR B CA  1 
ATOM   5207 C  C   . THR B 1 328 ? 35.577  45.302 10.758  1.00 5.96  ? 306 THR B C   1 
ATOM   5208 O  O   . THR B 1 328 ? 34.765  44.420 10.450  1.00 7.30  ? 306 THR B O   1 
ATOM   5209 C  CB  . THR B 1 328 ? 36.958  46.366 8.891   1.00 6.68  ? 306 THR B CB  1 
ATOM   5210 O  OG1 . THR B 1 328 ? 37.108  47.554 8.094   1.00 7.69  ? 306 THR B OG1 1 
ATOM   5211 C  CG2 . THR B 1 328 ? 36.723  45.184 7.964   1.00 7.05  ? 306 THR B CG2 1 
ATOM   5212 N  N   . HIS B 1 329 ? 36.308  45.240 11.872  1.00 6.03  ? 307 HIS B N   1 
ATOM   5213 C  CA  . HIS B 1 329 ? 36.178  44.103 12.782  1.00 6.05  ? 307 HIS B CA  1 
ATOM   5214 C  C   . HIS B 1 329 ? 34.777  43.999 13.387  1.00 6.02  ? 307 HIS B C   1 
ATOM   5215 O  O   . HIS B 1 329 ? 34.183  42.914 13.387  1.00 7.30  ? 307 HIS B O   1 
ATOM   5216 C  CB  . HIS B 1 329 ? 37.246  44.146 13.884  1.00 7.78  ? 307 HIS B CB  1 
ATOM   5217 C  CG  . HIS B 1 329 ? 38.555  43.567 13.459  1.00 6.95  ? 307 HIS B CG  1 
ATOM   5218 N  ND1 . HIS B 1 329 ? 38.863  42.235 13.621  1.00 7.58  ? 307 HIS B ND1 1 
ATOM   5219 C  CD2 . HIS B 1 329 ? 39.628  44.132 12.855  1.00 8.26  ? 307 HIS B CD2 1 
ATOM   5220 C  CE1 . HIS B 1 329 ? 40.073  42.003 13.142  1.00 8.30  ? 307 HIS B CE1 1 
ATOM   5221 N  NE2 . HIS B 1 329 ? 40.557  43.137 12.668  1.00 8.78  ? 307 HIS B NE2 1 
ATOM   5222 N  N   . ILE B 1 330 ? 34.238  45.102 13.901  1.00 5.60  ? 308 ILE B N   1 
ATOM   5223 C  CA  . ILE B 1 330 ? 32.866  45.027 14.422  1.00 5.40  ? 308 ILE B CA  1 
ATOM   5224 C  C   . ILE B 1 330 ? 31.872  44.750 13.288  1.00 5.31  ? 308 ILE B C   1 
ATOM   5225 O  O   . ILE B 1 330 ? 30.932  43.958 13.450  1.00 6.73  ? 308 ILE B O   1 
ATOM   5226 C  CB  . ILE B 1 330 ? 32.477  46.265 15.299  1.00 5.63  ? 308 ILE B CB  1 
ATOM   5227 C  CG1 . ILE B 1 330 ? 31.093  46.076 15.936  1.00 7.28  ? 308 ILE B CG1 1 
ATOM   5228 C  CG2 . ILE B 1 330 ? 32.487  47.554 14.488  1.00 6.87  ? 308 ILE B CG2 1 
ATOM   5229 C  CD1 . ILE B 1 330 ? 31.072  45.050 17.062  1.00 7.61  ? 308 ILE B CD1 1 
ATOM   5230 N  N   . GLY B 1 331 ? 32.096  45.365 12.127  1.00 6.73  ? 309 GLY B N   1 
ATOM   5231 C  CA  . GLY B 1 331 ? 31.238  45.132 10.970  1.00 5.75  ? 309 GLY B CA  1 
ATOM   5232 C  C   . GLY B 1 331 ? 31.188  43.664 10.559  1.00 7.43  ? 309 GLY B C   1 
ATOM   5233 O  O   . GLY B 1 331 ? 30.149  43.153 10.123  1.00 6.98  ? 309 GLY B O   1 
ATOM   5234 N  N   . ALA B 1 332 ? 32.317  42.978 10.712  1.00 6.26  ? 310 ALA B N   1 
ATOM   5235 C  CA  . ALA B 1 332 ? 32.418  41.561 10.365  1.00 6.29  ? 310 ALA B CA  1 
ATOM   5236 C  C   . ALA B 1 332 ? 31.616  40.650 11.298  1.00 7.85  ? 310 ALA B C   1 
ATOM   5237 O  O   . ALA B 1 332 ? 31.405  39.479 10.987  1.00 8.54  ? 310 ALA B O   1 
ATOM   5238 C  CB  . ALA B 1 332 ? 33.889  41.128 10.332  1.00 7.22  ? 310 ALA B CB  1 
ATOM   5239 N  N   . THR B 1 333 ? 31.176  41.179 12.436  1.00 6.34  ? 311 THR B N   1 
ATOM   5240 C  CA  . THR B 1 333 ? 30.348  40.403 13.361  1.00 7.18  ? 311 THR B CA  1 
ATOM   5241 C  C   . THR B 1 333 ? 28.845  40.567 13.159  1.00 6.43  ? 311 THR B C   1 
ATOM   5242 O  O   . THR B 1 333 ? 28.056  39.874 13.801  1.00 9.55  ? 311 THR B O   1 
ATOM   5243 C  CB  . THR B 1 333 ? 30.638  40.758 14.836  1.00 7.14  ? 311 THR B CB  1 
ATOM   5244 O  OG1 . THR B 1 333 ? 30.121  42.060 15.139  1.00 7.91  ? 311 THR B OG1 1 
ATOM   5245 C  CG2 . THR B 1 333 ? 32.131  40.702 15.126  1.00 7.36  ? 311 THR B CG2 1 
ATOM   5246 N  N   . VAL B 1 334 ? 28.447  41.511 12.310  1.00 6.95  ? 312 VAL B N   1 
ATOM   5247 C  CA  . VAL B 1 334 ? 27.030  41.844 12.140  1.00 5.40  ? 312 VAL B CA  1 
ATOM   5248 C  C   . VAL B 1 334 ? 26.328  40.806 11.281  1.00 6.23  ? 312 VAL B C   1 
ATOM   5249 O  O   . VAL B 1 334 ? 26.898  40.294 10.324  1.00 7.81  ? 312 VAL B O   1 
ATOM   5250 C  CB  . VAL B 1 334 ? 26.901  43.239 11.499  1.00 5.08  ? 312 VAL B CB  1 
ATOM   5251 C  CG1 . VAL B 1 334 ? 25.436  43.614 11.210  1.00 4.97  ? 312 VAL B CG1 1 
ATOM   5252 C  CG2 . VAL B 1 334 ? 27.547  44.287 12.413  1.00 4.96  ? 312 VAL B CG2 1 
ATOM   5253 N  N   . GLN B 1 335 ? 25.085  40.477 11.632  1.00 6.50  ? 313 GLN B N   1 
ATOM   5254 C  CA  . GLN B 1 335 ? 24.301  39.555 10.825  1.00 7.15  ? 313 GLN B CA  1 
ATOM   5255 C  C   . GLN B 1 335 ? 24.239  40.133 9.425   1.00 8.85  ? 313 GLN B C   1 
ATOM   5256 O  O   . GLN B 1 335 ? 23.863  41.288 9.253   1.00 8.65  ? 313 GLN B O   1 
ATOM   5257 C  CB  . GLN B 1 335 ? 22.888  39.441 11.397  1.00 10.22 ? 313 GLN B CB  1 
ATOM   5258 C  CG  . GLN B 1 335 ? 22.109  38.253 10.857  1.00 14.28 ? 313 GLN B CG  1 
ATOM   5259 C  CD  . GLN B 1 335 ? 20.681  38.199 11.369  1.00 19.64 ? 313 GLN B CD  1 
ATOM   5260 O  OE1 . GLN B 1 335 ? 20.069  39.229 11.647  1.00 21.62 ? 313 GLN B OE1 1 
ATOM   5261 N  NE2 . GLN B 1 335 ? 20.142  36.992 11.493  1.00 24.86 ? 313 GLN B NE2 1 
ATOM   5262 N  N   . PRO B 1 336 ? 24.629  39.345 8.413   1.00 7.03  ? 314 PRO B N   1 
ATOM   5263 C  CA  . PRO B 1 336 ? 24.731  39.928 7.073   1.00 8.18  ? 314 PRO B CA  1 
ATOM   5264 C  C   . PRO B 1 336 ? 23.475  40.665 6.575   1.00 8.15  ? 314 PRO B C   1 
ATOM   5265 O  O   . PRO B 1 336 ? 23.601  41.737 5.973   1.00 9.63  ? 314 PRO B O   1 
ATOM   5266 C  CB  . PRO B 1 336 ? 25.081  38.714 6.212   1.00 10.58 ? 314 PRO B CB  1 
ATOM   5267 C  CG  . PRO B 1 336 ? 25.953  37.898 7.137   1.00 11.74 ? 314 PRO B CG  1 
ATOM   5268 C  CD  . PRO B 1 336 ? 25.304  38.037 8.502   1.00 10.05 ? 314 PRO B CD  1 
ATOM   5269 N  N   . ARG B 1 337 ? 22.283  40.140 6.862   1.00 8.57  ? 315 ARG B N   1 
ATOM   5270 C  CA  . ARG B 1 337 ? 21.052  40.797 6.404   1.00 7.64  ? 315 ARG B CA  1 
ATOM   5271 C  C   . ARG B 1 337 ? 20.810  42.173 7.032   1.00 9.39  ? 315 ARG B C   1 
ATOM   5272 O  O   . ARG B 1 337 ? 19.981  42.949 6.533   1.00 10.98 ? 315 ARG B O   1 
ATOM   5273 C  CB  . ARG B 1 337 ? 19.835  39.904 6.653   1.00 10.05 ? 315 ARG B CB  1 
ATOM   5274 C  CG  . ARG B 1 337 ? 19.511  39.717 8.114   1.00 16.65 ? 315 ARG B CG  1 
ATOM   5275 C  CD  . ARG B 1 337 ? 18.155  39.062 8.305   1.00 26.02 ? 315 ARG B CD  1 
ATOM   5276 N  NE  . ARG B 1 337 ? 17.701  39.196 9.685   1.00 30.31 ? 315 ARG B NE  1 
ATOM   5277 C  CZ  . ARG B 1 337 ? 16.506  39.661 10.035  1.00 26.01 ? 315 ARG B CZ  1 
ATOM   5278 N  NH1 . ARG B 1 337 ? 15.638  40.028 9.103   1.00 25.54 ? 315 ARG B NH1 1 
ATOM   5279 N  NH2 . ARG B 1 337 ? 16.179  39.750 11.316  1.00 28.01 ? 315 ARG B NH2 1 
ATOM   5280 N  N   . LEU B 1 338 ? 21.507  42.473 8.127   1.00 7.17  ? 316 LEU B N   1 
ATOM   5281 C  CA  . LEU B 1 338 ? 21.364  43.765 8.797   1.00 5.88  ? 316 LEU B CA  1 
ATOM   5282 C  C   . LEU B 1 338 ? 22.528  44.714 8.530   1.00 6.87  ? 316 LEU B C   1 
ATOM   5283 O  O   . LEU B 1 338 ? 22.529  45.851 9.002   1.00 6.60  ? 316 LEU B O   1 
ATOM   5284 C  CB  . LEU B 1 338 ? 21.215  43.577 10.316  1.00 8.36  ? 316 LEU B CB  1 
ATOM   5285 C  CG  . LEU B 1 338 ? 20.007  42.786 10.816  1.00 8.25  ? 316 LEU B CG  1 
ATOM   5286 C  CD1 . LEU B 1 338 ? 19.985  42.797 12.345  1.00 10.73 ? 316 LEU B CD1 1 
ATOM   5287 C  CD2 . LEU B 1 338 ? 18.698  43.346 10.273  1.00 7.60  ? 316 LEU B CD2 1 
ATOM   5288 N  N   . ASN B 1 339 ? 23.524  44.255 7.778   1.00 6.51  ? 317 ASN B N   1 
ATOM   5289 C  CA  . ASN B 1 339 ? 24.742  45.038 7.609   1.00 5.59  ? 317 ASN B CA  1 
ATOM   5290 C  C   . ASN B 1 339 ? 24.630  46.037 6.464   1.00 5.32  ? 317 ASN B C   1 
ATOM   5291 O  O   . ASN B 1 339 ? 24.693  45.664 5.284   1.00 7.09  ? 317 ASN B O   1 
ATOM   5292 C  CB  . ASN B 1 339 ? 25.922  44.091 7.374   1.00 7.78  ? 317 ASN B CB  1 
ATOM   5293 C  CG  . ASN B 1 339 ? 27.263  44.773 7.533   1.00 7.60  ? 317 ASN B CG  1 
ATOM   5294 O  OD1 . ASN B 1 339 ? 27.369  45.997 7.481   1.00 8.33  ? 317 ASN B OD1 1 
ATOM   5295 N  ND2 . ASN B 1 339 ? 28.306  43.973 7.715   1.00 8.40  ? 317 ASN B ND2 1 
ATOM   5296 N  N   . GLU B 1 340 ? 24.463  47.310 6.816   1.00 5.75  ? 318 GLU B N   1 
ATOM   5297 C  CA  . GLU B 1 340 ? 24.341  48.349 5.801   1.00 4.96  ? 318 GLU B CA  1 
ATOM   5298 C  C   . GLU B 1 340 ? 25.713  48.802 5.315   1.00 8.44  ? 318 GLU B C   1 
ATOM   5299 O  O   . GLU B 1 340 ? 25.811  49.671 4.446   1.00 11.93 ? 318 GLU B O   1 
ATOM   5300 C  CB  . GLU B 1 340 ? 23.568  49.551 6.350   1.00 7.68  ? 318 GLU B CB  1 
ATOM   5301 C  CG  . GLU B 1 340 ? 22.086  49.292 6.588   1.00 7.28  ? 318 GLU B CG  1 
ATOM   5302 C  CD  . GLU B 1 340 ? 21.270  49.338 5.308   1.00 10.14 ? 318 GLU B CD  1 
ATOM   5303 O  OE1 . GLU B 1 340 ? 21.795  49.015 4.220   1.00 12.05 ? 318 GLU B OE1 1 
ATOM   5304 O  OE2 . GLU B 1 340 ? 20.082  49.701 5.387   1.00 8.43  ? 318 GLU B OE2 1 
ATOM   5305 N  N   . GLY B 1 341 ? 26.772  48.231 5.885   1.00 7.47  ? 319 GLY B N   1 
ATOM   5306 C  CA  . GLY B 1 341 ? 28.117  48.474 5.382   1.00 6.87  ? 319 GLY B CA  1 
ATOM   5307 C  C   . GLY B 1 341 ? 29.074  49.108 6.370   1.00 6.74  ? 319 GLY B C   1 
ATOM   5308 O  O   . GLY B 1 341 ? 28.666  49.607 7.416   1.00 9.33  ? 319 GLY B O   1 
ATOM   5309 N  N   . VAL B 1 342 ? 30.358  49.091 6.020   1.00 7.36  ? 320 VAL B N   1 
ATOM   5310 C  CA  . VAL B 1 342 ? 31.395  49.756 6.795   1.00 8.38  ? 320 VAL B CA  1 
ATOM   5311 C  C   . VAL B 1 342 ? 31.964  50.867 5.916   1.00 8.32  ? 320 VAL B C   1 
ATOM   5312 O  O   . VAL B 1 342 ? 32.532  50.582 4.862   1.00 9.50  ? 320 VAL B O   1 
ATOM   5313 C  CB  . VAL B 1 342 ? 32.500  48.754 7.175   1.00 7.51  ? 320 VAL B CB  1 
ATOM   5314 C  CG1 . VAL B 1 342 ? 33.716  49.462 7.785   1.00 8.55  ? 320 VAL B CG1 1 
ATOM   5315 C  CG2 . VAL B 1 342 ? 31.950  47.689 8.143   1.00 8.78  ? 320 VAL B CG2 1 
ATOM   5316 N  N   . TRP B 1 343 ? 31.786  52.124 6.327   1.00 7.26  ? 321 TRP B N   1 
ATOM   5317 C  CA  . TRP B 1 343 ? 32.352  53.263 5.592   1.00 6.67  ? 321 TRP B CA  1 
ATOM   5318 C  C   . TRP B 1 343 ? 33.748  53.574 6.127   1.00 7.69  ? 321 TRP B C   1 
ATOM   5319 O  O   . TRP B 1 343 ? 33.955  53.622 7.341   1.00 10.07 ? 321 TRP B O   1 
ATOM   5320 C  CB  . TRP B 1 343 ? 31.464  54.513 5.715   1.00 8.33  ? 321 TRP B CB  1 
ATOM   5321 C  CG  . TRP B 1 343 ? 31.944  55.644 4.856   1.00 8.71  ? 321 TRP B CG  1 
ATOM   5322 C  CD1 . TRP B 1 343 ? 31.530  55.950 3.591   1.00 8.80  ? 321 TRP B CD1 1 
ATOM   5323 C  CD2 . TRP B 1 343 ? 32.963  56.599 5.187   1.00 8.25  ? 321 TRP B CD2 1 
ATOM   5324 N  NE1 . TRP B 1 343 ? 32.221  57.046 3.122   1.00 10.77 ? 321 TRP B NE1 1 
ATOM   5325 C  CE2 . TRP B 1 343 ? 33.104  57.458 4.081   1.00 10.06 ? 321 TRP B CE2 1 
ATOM   5326 C  CE3 . TRP B 1 343 ? 33.760  56.813 6.318   1.00 9.66  ? 321 TRP B CE3 1 
ATOM   5327 C  CZ2 . TRP B 1 343 ? 34.023  58.509 4.065   1.00 10.55 ? 321 TRP B CZ2 1 
ATOM   5328 C  CZ3 . TRP B 1 343 ? 34.667  57.863 6.301   1.00 12.31 ? 321 TRP B CZ3 1 
ATOM   5329 C  CH2 . TRP B 1 343 ? 34.786  58.701 5.186   1.00 12.27 ? 321 TRP B CH2 1 
ATOM   5330 N  N   . VAL B 1 344 ? 34.697  53.785 5.222   1.00 8.13  ? 322 VAL B N   1 
ATOM   5331 C  CA  . VAL B 1 344 ? 36.063  54.137 5.598   1.00 8.75  ? 322 VAL B CA  1 
ATOM   5332 C  C   . VAL B 1 344 ? 36.562  55.281 4.719   1.00 9.88  ? 322 VAL B C   1 
ATOM   5333 O  O   . VAL B 1 344 ? 36.119  55.446 3.576   1.00 9.66  ? 322 VAL B O   1 
ATOM   5334 C  CB  . VAL B 1 344 ? 37.043  52.926 5.488   1.00 8.30  ? 322 VAL B CB  1 
ATOM   5335 C  CG1 . VAL B 1 344 ? 36.597  51.768 6.391   1.00 10.12 ? 322 VAL B CG1 1 
ATOM   5336 C  CG2 . VAL B 1 344 ? 37.171  52.458 4.049   1.00 9.27  ? 322 VAL B CG2 1 
ATOM   5337 N  N   . ALA B 1 345 ? 37.488  56.070 5.256   1.00 8.07  ? 323 ALA B N   1 
ATOM   5338 C  CA  . ALA B 1 345 ? 38.030  57.214 4.533   1.00 9.02  ? 323 ALA B CA  1 
ATOM   5339 C  C   . ALA B 1 345 ? 39.161  56.860 3.567   1.00 12.07 ? 323 ALA B C   1 
ATOM   5340 O  O   . ALA B 1 345 ? 39.674  57.742 2.885   1.00 11.55 ? 323 ALA B O   1 
ATOM   5341 C  CB  . ALA B 1 345 ? 38.497  58.287 5.519   1.00 9.49  ? 323 ALA B CB  1 
ATOM   5342 N  N   . GLN B 1 346 ? 39.549  55.580 3.521   1.00 9.52  ? 324 GLN B N   1 
ATOM   5343 C  CA  . GLN B 1 346 ? 40.679  55.119 2.702   1.00 10.42 ? 324 GLN B CA  1 
ATOM   5344 C  C   . GLN B 1 346 ? 40.791  55.699 1.269   1.00 12.52 ? 324 GLN B C   1 
ATOM   5345 O  O   . GLN B 1 346 ? 41.889  56.074 0.853   1.00 13.27 ? 324 GLN B O   1 
ATOM   5346 C  CB  . GLN B 1 346 ? 40.748  53.576 2.682   1.00 9.97  ? 324 GLN B CB  1 
ATOM   5347 C  CG  . GLN B 1 346 ? 41.896  53.010 1.846   1.00 13.33 ? 324 GLN B CG  1 
ATOM   5348 C  CD  . GLN B 1 346 ? 41.459  52.466 0.488   1.00 13.95 ? 324 GLN B CD  1 
ATOM   5349 O  OE1 . GLN B 1 346 ? 40.284  52.181 0.261   1.00 13.54 ? 324 GLN B OE1 1 
ATOM   5350 N  NE2 . GLN B 1 346 ? 42.420  52.316 -0.421  1.00 15.33 ? 324 GLN B NE2 1 
ATOM   5351 N  N   . PRO B 1 347 ? 39.667  55.795 0.522   1.00 11.26 ? 325 PRO B N   1 
ATOM   5352 C  CA  . PRO B 1 347 ? 39.774  56.354 -0.837  1.00 14.60 ? 325 PRO B CA  1 
ATOM   5353 C  C   . PRO B 1 347 ? 40.256  57.803 -0.886  1.00 16.24 ? 325 PRO B C   1 
ATOM   5354 O  O   . PRO B 1 347 ? 40.692  58.273 -1.940  1.00 18.26 ? 325 PRO B O   1 
ATOM   5355 C  CB  . PRO B 1 347 ? 38.339  56.282 -1.350  1.00 17.85 ? 325 PRO B CB  1 
ATOM   5356 C  CG  . PRO B 1 347 ? 37.757  55.108 -0.629  1.00 18.75 ? 325 PRO B CG  1 
ATOM   5357 C  CD  . PRO B 1 347 ? 38.336  55.201 0.757   1.00 13.60 ? 325 PRO B CD  1 
ATOM   5358 N  N   . TYR B 1 348 ? 40.166  58.500 0.239   1.00 13.54 ? 326 TYR B N   1 
ATOM   5359 C  CA  . TYR B 1 348 ? 40.537  59.906 0.295   1.00 14.62 ? 326 TYR B CA  1 
ATOM   5360 C  C   . TYR B 1 348 ? 41.872  60.110 1.005   1.00 15.60 ? 326 TYR B C   1 
ATOM   5361 O  O   . TYR B 1 348 ? 42.269  61.249 1.262   1.00 16.96 ? 326 TYR B O   1 
ATOM   5362 C  CB  . TYR B 1 348 ? 39.461  60.711 1.024   1.00 16.06 ? 326 TYR B CB  1 
ATOM   5363 C  CG  . TYR B 1 348 ? 38.042  60.485 0.543   1.00 15.22 ? 326 TYR B CG  1 
ATOM   5364 C  CD1 . TYR B 1 348 ? 37.246  59.508 1.119   1.00 18.04 ? 326 TYR B CD1 1 
ATOM   5365 C  CD2 . TYR B 1 348 ? 37.493  61.266 -0.468  1.00 23.00 ? 326 TYR B CD2 1 
ATOM   5366 C  CE1 . TYR B 1 348 ? 35.944  59.301 0.698   1.00 19.52 ? 326 TYR B CE1 1 
ATOM   5367 C  CE2 . TYR B 1 348 ? 36.185  61.068 -0.897  1.00 24.57 ? 326 TYR B CE2 1 
ATOM   5368 C  CZ  . TYR B 1 348 ? 35.418  60.081 -0.308  1.00 24.37 ? 326 TYR B CZ  1 
ATOM   5369 O  OH  . TYR B 1 348 ? 34.113  59.874 -0.718  1.00 20.83 ? 326 TYR B OH  1 
ATOM   5370 N  N   . ILE B 1 349 ? 42.561  59.019 1.330   1.00 12.44 ? 327 ILE B N   1 
ATOM   5371 C  CA  . ILE B 1 349 ? 43.800  59.112 2.104   1.00 13.32 ? 327 ILE B CA  1 
ATOM   5372 C  C   . ILE B 1 349 ? 44.984  58.624 1.280   1.00 13.98 ? 327 ILE B C   1 
ATOM   5373 O  O   . ILE B 1 349 ? 44.984  57.499 0.782   1.00 16.30 ? 327 ILE B O   1 
ATOM   5374 C  CB  . ILE B 1 349 ? 43.707  58.306 3.426   1.00 15.91 ? 327 ILE B CB  1 
ATOM   5375 C  CG1 . ILE B 1 349 ? 42.690  58.957 4.378   1.00 13.68 ? 327 ILE B CG1 1 
ATOM   5376 C  CG2 . ILE B 1 349 ? 45.087  58.184 4.085   1.00 15.89 ? 327 ILE B CG2 1 
ATOM   5377 C  CD1 . ILE B 1 349 ? 42.307  58.075 5.570   1.00 14.48 ? 327 ILE B CD1 1 
ATOM   5378 N  N   . ALA B 1 350 ? 45.996  59.476 1.137   1.00 15.22 ? 328 ALA B N   1 
ATOM   5379 C  CA  . ALA B 1 350 ? 47.129  59.175 0.265   1.00 20.11 ? 328 ALA B CA  1 
ATOM   5380 C  C   . ALA B 1 350 ? 48.057  58.086 0.801   1.00 22.36 ? 328 ALA B C   1 
ATOM   5381 O  O   . ALA B 1 350 ? 48.498  57.212 0.049   1.00 32.12 ? 328 ALA B O   1 
ATOM   5382 C  CB  . ALA B 1 350 ? 47.912  60.441 -0.019  1.00 21.87 ? 328 ALA B CB  1 
ATOM   5383 N  N   . GLN B 1 351 ? 48.349  58.142 2.096   1.00 17.28 ? 329 GLN B N   1 
ATOM   5384 C  CA  . GLN B 1 351 ? 49.368  57.292 2.703   1.00 17.45 ? 329 GLN B CA  1 
ATOM   5385 C  C   . GLN B 1 351 ? 48.797  56.374 3.785   1.00 17.90 ? 329 GLN B C   1 
ATOM   5386 O  O   . GLN B 1 351 ? 48.386  56.839 4.845   1.00 18.47 ? 329 GLN B O   1 
ATOM   5387 C  CB  . GLN B 1 351 ? 50.468  58.172 3.306   1.00 18.52 ? 329 GLN B CB  1 
ATOM   5388 C  CG  . GLN B 1 351 ? 51.531  57.417 4.089   1.00 24.69 ? 329 GLN B CG  1 
ATOM   5389 C  CD  . GLN B 1 351 ? 52.383  56.521 3.213   1.00 35.59 ? 329 GLN B CD  1 
ATOM   5390 O  OE1 . GLN B 1 351 ? 53.081  56.991 2.308   1.00 40.14 ? 329 GLN B OE1 1 
ATOM   5391 N  NE2 . GLN B 1 351 ? 52.333  55.219 3.479   1.00 34.77 ? 329 GLN B NE2 1 
ATOM   5392 N  N   . PRO B 1 352 ? 48.777  55.059 3.525   1.00 15.94 ? 330 PRO B N   1 
ATOM   5393 C  CA  . PRO B 1 352 ? 48.303  54.103 4.534   1.00 13.57 ? 330 PRO B CA  1 
ATOM   5394 C  C   . PRO B 1 352 ? 49.312  53.956 5.670   1.00 15.61 ? 330 PRO B C   1 
ATOM   5395 O  O   . PRO B 1 352 ? 50.512  54.165 5.464   1.00 17.75 ? 330 PRO B O   1 
ATOM   5396 C  CB  . PRO B 1 352 ? 48.214  52.778 3.763   1.00 19.09 ? 330 PRO B CB  1 
ATOM   5397 C  CG  . PRO B 1 352 ? 48.421  53.124 2.310   1.00 22.85 ? 330 PRO B CG  1 
ATOM   5398 C  CD  . PRO B 1 352 ? 49.184  54.398 2.274   1.00 20.98 ? 330 PRO B CD  1 
ATOM   5399 N  N   . TYR B 1 353 ? 48.844  53.594 6.858   1.00 15.03 ? 331 TYR B N   1 
ATOM   5400 C  CA  . TYR B 1 353 ? 49.761  53.344 7.962   1.00 13.29 ? 331 TYR B CA  1 
ATOM   5401 C  C   . TYR B 1 353 ? 50.455  51.998 7.795   1.00 14.27 ? 331 TYR B C   1 
ATOM   5402 O  O   . TYR B 1 353 ? 51.566  51.809 8.275   1.00 15.27 ? 331 TYR B O   1 
ATOM   5403 C  CB  . TYR B 1 353 ? 49.038  53.346 9.313   1.00 13.59 ? 331 TYR B CB  1 
ATOM   5404 C  CG  . TYR B 1 353 ? 48.190  54.566 9.600   1.00 13.64 ? 331 TYR B CG  1 
ATOM   5405 C  CD1 . TYR B 1 353 ? 48.437  55.790 8.980   1.00 16.29 ? 331 TYR B CD1 1 
ATOM   5406 C  CD2 . TYR B 1 353 ? 47.137  54.489 10.500  1.00 14.62 ? 331 TYR B CD2 1 
ATOM   5407 C  CE1 . TYR B 1 353 ? 47.638  56.906 9.249   1.00 16.27 ? 331 TYR B CE1 1 
ATOM   5408 C  CE2 . TYR B 1 353 ? 46.345  55.588 10.774  1.00 14.72 ? 331 TYR B CE2 1 
ATOM   5409 C  CZ  . TYR B 1 353 ? 46.593  56.789 10.148  1.00 15.93 ? 331 TYR B CZ  1 
ATOM   5410 O  OH  . TYR B 1 353 ? 45.789  57.874 10.432  1.00 15.95 ? 331 TYR B OH  1 
ATOM   5411 N  N   . ASP B 1 354 ? 49.776  51.066 7.130   1.00 14.23 ? 332 ASP B N   1 
ATOM   5412 C  CA  . ASP B 1 354 ? 50.254  49.695 6.980   1.00 16.23 ? 332 ASP B CA  1 
ATOM   5413 C  C   . ASP B 1 354 ? 50.083  49.308 5.518   1.00 15.10 ? 332 ASP B C   1 
ATOM   5414 O  O   . ASP B 1 354 ? 48.973  49.029 5.064   1.00 13.90 ? 332 ASP B O   1 
ATOM   5415 C  CB  . ASP B 1 354 ? 49.434  48.762 7.887   1.00 12.37 ? 332 ASP B CB  1 
ATOM   5416 C  CG  . ASP B 1 354 ? 49.910  47.314 7.852   1.00 13.00 ? 332 ASP B CG  1 
ATOM   5417 O  OD1 . ASP B 1 354 ? 50.645  46.922 6.922   1.00 12.42 ? 332 ASP B OD1 1 
ATOM   5418 O  OD2 . ASP B 1 354 ? 49.536  46.555 8.769   1.00 14.57 ? 332 ASP B OD2 1 
ATOM   5419 N  N   . GLU B 1 355 ? 51.181  49.299 4.771   1.00 15.22 ? 333 GLU B N   1 
ATOM   5420 C  CA  . GLU B 1 355 ? 51.086  49.008 3.343   1.00 17.12 ? 333 GLU B CA  1 
ATOM   5421 C  C   . GLU B 1 355 ? 50.929  47.523 3.021   1.00 18.02 ? 333 GLU B C   1 
ATOM   5422 O  O   . GLU B 1 355 ? 50.623  47.171 1.887   1.00 26.07 ? 333 GLU B O   1 
ATOM   5423 C  CB  . GLU B 1 355 ? 52.268  49.623 2.580   1.00 25.26 ? 333 GLU B CB  1 
ATOM   5424 C  CG  . GLU B 1 355 ? 52.198  51.145 2.546   1.00 28.18 ? 333 GLU B CG  1 
ATOM   5425 C  CD  . GLU B 1 355 ? 53.179  51.779 1.588   1.00 36.77 ? 333 GLU B CD  1 
ATOM   5426 O  OE1 . GLU B 1 355 ? 54.067  51.066 1.069   1.00 35.60 ? 333 GLU B OE1 1 
ATOM   5427 O  OE2 . GLU B 1 355 ? 53.058  53.001 1.355   1.00 38.54 ? 333 GLU B OE2 1 
ATOM   5428 N  N   . GLU B 1 356 ? 51.127  46.660 4.017   1.00 14.79 ? 334 GLU B N   1 
ATOM   5429 C  CA  . GLU B 1 356 ? 50.976  45.216 3.816   1.00 15.06 ? 334 GLU B CA  1 
ATOM   5430 C  C   . GLU B 1 356 ? 49.578  44.722 4.147   1.00 15.49 ? 334 GLU B C   1 
ATOM   5431 O  O   . GLU B 1 356 ? 49.041  43.858 3.447   1.00 14.93 ? 334 GLU B O   1 
ATOM   5432 C  CB  . GLU B 1 356 ? 51.953  44.435 4.690   1.00 17.93 ? 334 GLU B CB  1 
ATOM   5433 C  CG  . GLU B 1 356 ? 53.414  44.641 4.393   1.00 27.05 ? 334 GLU B CG  1 
ATOM   5434 C  CD  . GLU B 1 356 ? 54.282  43.955 5.428   1.00 41.37 ? 334 GLU B CD  1 
ATOM   5435 O  OE1 . GLU B 1 356 ? 54.104  42.733 5.638   1.00 43.22 ? 334 GLU B OE1 1 
ATOM   5436 O  OE2 . GLU B 1 356 ? 55.124  44.641 6.046   1.00 49.87 ? 334 GLU B OE2 1 
ATOM   5437 N  N   . ASN B 1 357 ? 48.997  45.249 5.226   1.00 10.50 ? 335 ASN B N   1 
ATOM   5438 C  CA  . ASN B 1 357 ? 47.723  44.737 5.729   1.00 11.82 ? 335 ASN B CA  1 
ATOM   5439 C  C   . ASN B 1 357 ? 46.643  45.785 5.908   1.00 10.37 ? 335 ASN B C   1 
ATOM   5440 O  O   . ASN B 1 357 ? 45.561  45.472 6.405   1.00 11.55 ? 335 ASN B O   1 
ATOM   5441 C  CB  . ASN B 1 357 ? 47.918  44.016 7.068   1.00 14.47 ? 335 ASN B CB  1 
ATOM   5442 C  CG  . ASN B 1 357 ? 49.149  43.140 7.086   1.00 22.68 ? 335 ASN B CG  1 
ATOM   5443 O  OD1 . ASN B 1 357 ? 49.174  42.088 6.463   1.00 21.17 ? 335 ASN B OD1 1 
ATOM   5444 N  ND2 . ASN B 1 357 ? 50.174  43.566 7.819   1.00 27.46 ? 335 ASN B ND2 1 
ATOM   5445 N  N   . GLY B 1 358 ? 46.925  47.027 5.522   1.00 10.62 ? 336 GLY B N   1 
ATOM   5446 C  CA  . GLY B 1 358 ? 45.992  48.116 5.770   1.00 11.77 ? 336 GLY B CA  1 
ATOM   5447 C  C   . GLY B 1 358 ? 44.649  47.930 5.085   1.00 10.96 ? 336 GLY B C   1 
ATOM   5448 O  O   . GLY B 1 358 ? 44.539  47.221 4.085   1.00 10.91 ? 336 GLY B O   1 
ATOM   5449 N  N   . ILE B 1 359 ? 43.623  48.577 5.621   1.00 8.37  ? 337 ILE B N   1 
ATOM   5450 C  CA  . ILE B 1 359 ? 42.260  48.441 5.116   1.00 8.05  ? 337 ILE B CA  1 
ATOM   5451 C  C   . ILE B 1 359 ? 42.102  49.096 3.750   1.00 8.25  ? 337 ILE B C   1 
ATOM   5452 O  O   . ILE B 1 359 ? 42.447  50.268 3.575   1.00 10.78 ? 337 ILE B O   1 
ATOM   5453 C  CB  . ILE B 1 359 ? 41.253  49.102 6.082   1.00 8.92  ? 337 ILE B CB  1 
ATOM   5454 C  CG1 . ILE B 1 359 ? 41.219  48.346 7.415   1.00 11.14 ? 337 ILE B CG1 1 
ATOM   5455 C  CG2 . ILE B 1 359 ? 39.864  49.165 5.464   1.00 9.80  ? 337 ILE B CG2 1 
ATOM   5456 C  CD1 . ILE B 1 359 ? 40.660  46.936 7.313   1.00 12.43 ? 337 ILE B CD1 1 
ATOM   5457 N  N   . ARG B 1 360 ? 41.580  48.351 2.779   1.00 9.11  ? 338 ARG B N   1 
ATOM   5458 C  CA  . ARG B 1 360 ? 41.351  48.892 1.438   1.00 8.51  ? 338 ARG B CA  1 
ATOM   5459 C  C   . ARG B 1 360 ? 39.998  48.463 0.909   1.00 9.91  ? 338 ARG B C   1 
ATOM   5460 O  O   . ARG B 1 360 ? 39.563  47.329 1.138   1.00 11.36 ? 338 ARG B O   1 
ATOM   5461 C  CB  . ARG B 1 360 ? 42.444  48.432 0.456   1.00 13.03 ? 338 ARG B CB  1 
ATOM   5462 C  CG  . ARG B 1 360 ? 43.870  48.699 0.949   1.00 13.72 ? 338 ARG B CG  1 
ATOM   5463 C  CD  . ARG B 1 360 ? 44.905  48.527 -0.141  1.00 18.93 ? 338 ARG B CD  1 
ATOM   5464 N  NE  . ARG B 1 360 ? 44.786  47.239 -0.807  1.00 17.71 ? 338 ARG B NE  1 
ATOM   5465 C  CZ  . ARG B 1 360 ? 45.684  46.764 -1.665  1.00 19.79 ? 338 ARG B CZ  1 
ATOM   5466 N  NH1 . ARG B 1 360 ? 46.773  47.466 -1.927  1.00 18.09 ? 338 ARG B NH1 1 
ATOM   5467 N  NH2 . ARG B 1 360 ? 45.499  45.585 -2.237  1.00 22.45 ? 338 ARG B NH2 1 
ATOM   5468 N  N   . ILE B 1 361 ? 39.324  49.361 0.196   1.00 9.79  ? 339 ILE B N   1 
ATOM   5469 C  CA  . ILE B 1 361 ? 38.082  48.985 -0.463  1.00 9.56  ? 339 ILE B CA  1 
ATOM   5470 C  C   . ILE B 1 361 ? 38.433  48.315 -1.784  1.00 10.13 ? 339 ILE B C   1 
ATOM   5471 O  O   . ILE B 1 361 ? 39.265  48.819 -2.546  1.00 12.35 ? 339 ILE B O   1 
ATOM   5472 C  CB  . ILE B 1 361 ? 37.167  50.203 -0.721  1.00 10.70 ? 339 ILE B CB  1 
ATOM   5473 C  CG1 . ILE B 1 361 ? 36.833  50.912 0.593   1.00 11.71 ? 339 ILE B CG1 1 
ATOM   5474 C  CG2 . ILE B 1 361 ? 35.875  49.765 -1.440  1.00 15.60 ? 339 ILE B CG2 1 
ATOM   5475 C  CD1 . ILE B 1 361 ? 35.928  52.136 0.437   1.00 15.27 ? 339 ILE B CD1 1 
ATOM   5476 N  N   . ALA B 1 362 ? 37.827  47.161 -2.039  1.00 8.50  ? 340 ALA B N   1 
ATOM   5477 C  CA  . ALA B 1 362 ? 37.987  46.488 -3.321  1.00 8.92  ? 340 ALA B CA  1 
ATOM   5478 C  C   . ALA B 1 362 ? 36.621  46.016 -3.789  1.00 8.94  ? 340 ALA B C   1 
ATOM   5479 O  O   . ALA B 1 362 ? 35.945  45.268 -3.087  1.00 8.59  ? 340 ALA B O   1 
ATOM   5480 C  CB  . ALA B 1 362 ? 38.947  45.308 -3.191  1.00 13.65 ? 340 ALA B CB  1 
ATOM   5481 N  N   . GLY B 1 363 ? 36.202  46.462 -4.973  1.00 9.02  ? 341 GLY B N   1 
ATOM   5482 C  CA  . GLY B 1 363 ? 34.877  46.118 -5.469  1.00 11.41 ? 341 GLY B CA  1 
ATOM   5483 C  C   . GLY B 1 363 ? 33.728  46.550 -4.560  1.00 9.36  ? 341 GLY B C   1 
ATOM   5484 O  O   . GLY B 1 363 ? 32.727  45.836 -4.438  1.00 10.30 ? 341 GLY B O   1 
ATOM   5485 N  N   . GLY B 1 364 ? 33.870  47.701 -3.909  1.00 9.39  ? 342 GLY B N   1 
ATOM   5486 C  CA  . GLY B 1 364 ? 32.816  48.215 -3.040  1.00 8.09  ? 342 GLY B CA  1 
ATOM   5487 C  C   . GLY B 1 364 ? 32.637  47.447 -1.742  1.00 10.99 ? 342 GLY B C   1 
ATOM   5488 O  O   . GLY B 1 364 ? 31.635  47.631 -1.048  1.00 8.69  ? 342 GLY B O   1 
ATOM   5489 N  N   . HIS B 1 365 ? 33.612  46.598 -1.413  1.00 8.42  ? 343 HIS B N   1 
ATOM   5490 C  CA  . HIS B 1 365 ? 33.593  45.798 -0.193  1.00 7.26  ? 343 HIS B CA  1 
ATOM   5491 C  C   . HIS B 1 365 ? 34.942  45.916 0.517   1.00 7.33  ? 343 HIS B C   1 
ATOM   5492 O  O   . HIS B 1 365 ? 35.896  46.458 -0.039  1.00 9.06  ? 343 HIS B O   1 
ATOM   5493 C  CB  . HIS B 1 365 ? 33.296  44.333 -0.539  1.00 9.15  ? 343 HIS B CB  1 
ATOM   5494 C  CG  . HIS B 1 365 ? 31.893  44.094 -1.006  1.00 8.91  ? 343 HIS B CG  1 
ATOM   5495 N  ND1 . HIS B 1 365 ? 31.434  44.517 -2.237  1.00 9.56  ? 343 HIS B ND1 1 
ATOM   5496 C  CD2 . HIS B 1 365 ? 30.852  43.456 -0.416  1.00 8.55  ? 343 HIS B CD2 1 
ATOM   5497 C  CE1 . HIS B 1 365 ? 30.166  44.167 -2.377  1.00 11.43 ? 343 HIS B CE1 1 
ATOM   5498 N  NE2 . HIS B 1 365 ? 29.787  43.527 -1.283  1.00 10.82 ? 343 HIS B NE2 1 
ATOM   5499 N  N   . ILE B 1 366 ? 35.019  45.415 1.749   1.00 7.11  ? 344 ILE B N   1 
ATOM   5500 C  CA  . ILE B 1 366 ? 36.274  45.414 2.506   1.00 7.20  ? 344 ILE B CA  1 
ATOM   5501 C  C   . ILE B 1 366 ? 36.599  44.029 3.053   1.00 7.50  ? 344 ILE B C   1 
ATOM   5502 O  O   . ILE B 1 366 ? 35.793  43.433 3.767   1.00 9.54  ? 344 ILE B O   1 
ATOM   5503 C  CB  . ILE B 1 366 ? 36.206  46.402 3.690   1.00 6.90  ? 344 ILE B CB  1 
ATOM   5504 C  CG1 . ILE B 1 366 ? 35.948  47.821 3.182   1.00 9.13  ? 344 ILE B CG1 1 
ATOM   5505 C  CG2 . ILE B 1 366 ? 37.508  46.380 4.493   1.00 8.88  ? 344 ILE B CG2 1 
ATOM   5506 C  CD1 . ILE B 1 366 ? 35.584  48.799 4.271   1.00 11.96 ? 344 ILE B CD1 1 
ATOM   5507 N  N   . ASP B 1 367 ? 37.789  43.529 2.723   1.00 7.62  ? 345 ASP B N   1 
ATOM   5508 C  CA  . ASP B 1 367 ? 38.288  42.261 3.252   1.00 8.37  ? 345 ASP B CA  1 
ATOM   5509 C  C   . ASP B 1 367 ? 38.846  42.492 4.667   1.00 7.82  ? 345 ASP B C   1 
ATOM   5510 O  O   . ASP B 1 367 ? 39.663  43.398 4.888   1.00 10.02 ? 345 ASP B O   1 
ATOM   5511 C  CB  . ASP B 1 367 ? 39.380  41.722 2.317   1.00 8.89  ? 345 ASP B CB  1 
ATOM   5512 C  CG  . ASP B 1 367 ? 39.717  40.251 2.563   1.00 12.88 ? 345 ASP B CG  1 
ATOM   5513 O  OD1 . ASP B 1 367 ? 38.826  39.481 2.979   1.00 11.37 ? 345 ASP B OD1 1 
ATOM   5514 O  OD2 . ASP B 1 367 ? 40.880  39.864 2.310   1.00 13.45 ? 345 ASP B OD2 1 
ATOM   5515 N  N   . LEU B 1 368 ? 38.386  41.691 5.627   1.00 8.15  ? 346 LEU B N   1 
ATOM   5516 C  CA  . LEU B 1 368 ? 38.874  41.788 7.006   1.00 8.44  ? 346 LEU B CA  1 
ATOM   5517 C  C   . LEU B 1 368 ? 40.336  41.364 7.079   1.00 9.27  ? 346 LEU B C   1 
ATOM   5518 O  O   . LEU B 1 368 ? 40.718  40.375 6.465   1.00 8.82  ? 346 LEU B O   1 
ATOM   5519 C  CB  . LEU B 1 368 ? 38.040  40.879 7.908   1.00 8.18  ? 346 LEU B CB  1 
ATOM   5520 C  CG  . LEU B 1 368 ? 38.290  40.949 9.415   1.00 10.26 ? 346 LEU B CG  1 
ATOM   5521 C  CD1 . LEU B 1 368 ? 37.874  42.310 9.960   1.00 8.78  ? 346 LEU B CD1 1 
ATOM   5522 C  CD2 . LEU B 1 368 ? 37.537  39.822 10.117  1.00 10.45 ? 346 LEU B CD2 1 
ATOM   5523 N  N   . PRO B 1 369 ? 41.166  42.104 7.833   1.00 7.72  ? 347 PRO B N   1 
ATOM   5524 C  CA  . PRO B 1 369 ? 42.551  41.641 7.995   1.00 8.10  ? 347 PRO B CA  1 
ATOM   5525 C  C   . PRO B 1 369 ? 42.588  40.255 8.644   1.00 8.18  ? 347 PRO B C   1 
ATOM   5526 O  O   . PRO B 1 369 ? 41.650  39.906 9.364   1.00 8.67  ? 347 PRO B O   1 
ATOM   5527 C  CB  . PRO B 1 369 ? 43.155  42.694 8.932   1.00 11.14 ? 347 PRO B CB  1 
ATOM   5528 C  CG  . PRO B 1 369 ? 42.361  43.932 8.653   1.00 12.26 ? 347 PRO B CG  1 
ATOM   5529 C  CD  . PRO B 1 369 ? 40.953  43.431 8.437   1.00 8.30  ? 347 PRO B CD  1 
ATOM   5530 N  N   . LYS B 1 370 ? 43.633  39.478 8.379   1.00 9.23  ? 348 LYS B N   1 
ATOM   5531 C  CA  . LYS B 1 370 ? 43.661  38.075 8.807   1.00 9.18  ? 348 LYS B CA  1 
ATOM   5532 C  C   . LYS B 1 370 ? 44.485  37.818 10.076  1.00 11.45 ? 348 LYS B C   1 
ATOM   5533 O  O   . LYS B 1 370 ? 44.362  36.753 10.690  1.00 14.71 ? 348 LYS B O   1 
ATOM   5534 C  CB  . LYS B 1 370 ? 44.129  37.173 7.658   1.00 9.48  ? 348 LYS B CB  1 
ATOM   5535 C  CG  . LYS B 1 370 ? 43.430  37.439 6.317   1.00 10.36 ? 348 LYS B CG  1 
ATOM   5536 C  CD  . LYS B 1 370 ? 41.917  37.334 6.426   1.00 11.70 ? 348 LYS B CD  1 
ATOM   5537 C  CE  . LYS B 1 370 ? 41.244  37.652 5.087   1.00 9.76  ? 348 LYS B CE  1 
ATOM   5538 N  NZ  . LYS B 1 370 ? 39.827  38.107 5.257   1.00 11.69 ? 348 LYS B NZ  1 
ATOM   5539 N  N   . GLY B 1 371 ? 45.305  38.788 10.479  1.00 9.72  ? 349 GLY B N   1 
ATOM   5540 C  CA  . GLY B 1 371 ? 46.188  38.602 11.624  1.00 12.87 ? 349 GLY B CA  1 
ATOM   5541 C  C   . GLY B 1 371 ? 45.555  38.885 12.979  1.00 11.35 ? 349 GLY B C   1 
ATOM   5542 O  O   . GLY B 1 371 ? 44.415  39.344 13.058  1.00 11.98 ? 349 GLY B O   1 
ATOM   5543 N  N   . PRO B 1 372 ? 46.302  38.626 14.062  1.00 11.10 ? 350 PRO B N   1 
ATOM   5544 C  CA  . PRO B 1 372 ? 45.774  38.821 15.421  1.00 10.35 ? 350 PRO B CA  1 
ATOM   5545 C  C   . PRO B 1 372 ? 45.555  40.297 15.738  1.00 9.97  ? 350 PRO B C   1 
ATOM   5546 O  O   . PRO B 1 372 ? 46.129  41.172 15.080  1.00 12.39 ? 350 PRO B O   1 
ATOM   5547 C  CB  . PRO B 1 372 ? 46.878  38.254 16.327  1.00 13.86 ? 350 PRO B CB  1 
ATOM   5548 C  CG  . PRO B 1 372 ? 47.833  37.542 15.419  1.00 22.97 ? 350 PRO B CG  1 
ATOM   5549 C  CD  . PRO B 1 372 ? 47.698  38.164 14.067  1.00 14.76 ? 350 PRO B CD  1 
ATOM   5550 N  N   . GLY B 1 373 ? 44.727  40.567 16.740  1.00 9.03  ? 351 GLY B N   1 
ATOM   5551 C  CA  . GLY B 1 373 ? 44.385  41.939 17.082  1.00 9.68  ? 351 GLY B CA  1 
ATOM   5552 C  C   . GLY B 1 373 ? 43.579  42.569 15.963  1.00 10.72 ? 351 GLY B C   1 
ATOM   5553 O  O   . GLY B 1 373 ? 42.716  41.915 15.365  1.00 8.99  ? 351 GLY B O   1 
ATOM   5554 N  N   . LEU B 1 374 ? 43.846  43.840 15.677  1.00 9.40  ? 352 LEU B N   1 
ATOM   5555 C  CA  . LEU B 1 374 ? 43.195  44.514 14.550  1.00 7.55  ? 352 LEU B CA  1 
ATOM   5556 C  C   . LEU B 1 374 ? 43.747  44.017 13.216  1.00 10.28 ? 352 LEU B C   1 
ATOM   5557 O  O   . LEU B 1 374 ? 43.156  44.273 12.161  1.00 9.57  ? 352 LEU B O   1 
ATOM   5558 C  CB  . LEU B 1 374 ? 43.413  46.027 14.634  1.00 7.94  ? 352 LEU B CB  1 
ATOM   5559 C  CG  . LEU B 1 374 ? 42.730  46.756 15.795  1.00 9.13  ? 352 LEU B CG  1 
ATOM   5560 C  CD1 . LEU B 1 374 ? 43.220  48.201 15.887  1.00 10.28 ? 352 LEU B CD1 1 
ATOM   5561 C  CD2 . LEU B 1 374 ? 41.204  46.726 15.659  1.00 9.52  ? 352 LEU B CD2 1 
ATOM   5562 N  N   . GLY B 1 375 ? 44.893  43.345 13.255  1.00 9.46  ? 353 GLY B N   1 
ATOM   5563 C  CA  . GLY B 1 375 ? 45.535  42.873 12.034  1.00 10.66 ? 353 GLY B CA  1 
ATOM   5564 C  C   . GLY B 1 375 ? 46.334  43.955 11.331  1.00 13.10 ? 353 GLY B C   1 
ATOM   5565 O  O   . GLY B 1 375 ? 46.706  43.808 10.156  1.00 10.75 ? 353 GLY B O   1 
ATOM   5566 N  N   . ILE B 1 376 ? 46.621  45.028 12.067  1.00 11.98 ? 354 ILE B N   1 
ATOM   5567 C  CA  . ILE B 1 376 ? 47.288  46.212 11.532  1.00 14.44 ? 354 ILE B CA  1 
ATOM   5568 C  C   . ILE B 1 376 ? 48.588  46.454 12.275  1.00 11.33 ? 354 ILE B C   1 
ATOM   5569 O  O   . ILE B 1 376 ? 48.607  46.442 13.505  1.00 15.87 ? 354 ILE B O   1 
ATOM   5570 C  CB  . ILE B 1 376 ? 46.421  47.466 11.746  1.00 16.26 ? 354 ILE B CB  1 
ATOM   5571 C  CG1 . ILE B 1 376 ? 45.082  47.321 11.034  1.00 17.67 ? 354 ILE B CG1 1 
ATOM   5572 C  CG2 . ILE B 1 376 ? 47.157  48.723 11.278  1.00 20.58 ? 354 ILE B CG2 1 
ATOM   5573 C  CD1 . ILE B 1 376 ? 45.206  47.126 9.539   1.00 14.88 ? 354 ILE B CD1 1 
ATOM   5574 N  N   . THR B 1 377 ? 49.668  46.683 11.532  1.00 12.81 ? 355 THR B N   1 
ATOM   5575 C  CA  . THR B 1 377 ? 50.948  47.050 12.125  1.00 16.11 ? 355 THR B CA  1 
ATOM   5576 C  C   . THR B 1 377 ? 51.325  48.409 11.551  1.00 16.53 ? 355 THR B C   1 
ATOM   5577 O  O   . THR B 1 377 ? 51.870  48.487 10.452  1.00 18.20 ? 355 THR B O   1 
ATOM   5578 C  CB  . THR B 1 377 ? 52.038  46.023 11.771  1.00 20.80 ? 355 THR B CB  1 
ATOM   5579 O  OG1 . THR B 1 377 ? 51.645  44.721 12.230  1.00 21.16 ? 355 THR B OG1 1 
ATOM   5580 C  CG2 . THR B 1 377 ? 53.370  46.404 12.412  1.00 23.43 ? 355 THR B CG2 1 
ATOM   5581 N  N   . PRO B 1 378 ? 51.014  49.495 12.278  1.00 17.94 ? 356 PRO B N   1 
ATOM   5582 C  CA  . PRO B 1 378 ? 51.303  50.799 11.672  1.00 18.00 ? 356 PRO B CA  1 
ATOM   5583 C  C   . PRO B 1 378 ? 52.791  51.125 11.678  1.00 20.22 ? 356 PRO B C   1 
ATOM   5584 O  O   . PRO B 1 378 ? 53.530  50.734 12.587  1.00 23.44 ? 356 PRO B O   1 
ATOM   5585 C  CB  . PRO B 1 378 ? 50.532  51.783 12.559  1.00 22.08 ? 356 PRO B CB  1 
ATOM   5586 C  CG  . PRO B 1 378 ? 50.447  51.106 13.881  1.00 24.33 ? 356 PRO B CG  1 
ATOM   5587 C  CD  . PRO B 1 378 ? 50.384  49.621 13.604  1.00 19.08 ? 356 PRO B CD  1 
ATOM   5588 N  N   . ASP B 1 379 ? 53.219  51.816 10.631  1.00 16.21 ? 357 ASP B N   1 
ATOM   5589 C  CA  . ASP B 1 379 ? 54.566  52.347 10.544  1.00 20.06 ? 357 ASP B CA  1 
ATOM   5590 C  C   . ASP B 1 379 ? 54.560  53.562 11.461  1.00 22.37 ? 357 ASP B C   1 
ATOM   5591 O  O   . ASP B 1 379 ? 54.241  54.664 11.023  1.00 20.66 ? 357 ASP B O   1 
ATOM   5592 C  CB  . ASP B 1 379 ? 54.840  52.763 9.099   1.00 16.78 ? 357 ASP B CB  1 
ATOM   5593 C  CG  . ASP B 1 379 ? 56.277  53.187 8.873   1.00 22.20 ? 357 ASP B CG  1 
ATOM   5594 O  OD1 . ASP B 1 379 ? 57.021  53.321 9.866   1.00 25.09 ? 357 ASP B OD1 1 
ATOM   5595 O  OD2 . ASP B 1 379 ? 56.651  53.386 7.700   1.00 26.01 ? 357 ASP B OD2 1 
ATOM   5596 N  N   A GLU B 1 380 ? 54.883  53.360 12.733  0.47 25.06 ? 358 GLU B N   1 
ATOM   5597 N  N   B GLU B 1 380 ? 54.915  53.342 12.730  0.53 25.06 ? 358 GLU B N   1 
ATOM   5598 C  CA  A GLU B 1 380 ? 54.725  54.425 13.720  0.47 25.70 ? 358 GLU B CA  1 
ATOM   5599 C  CA  B GLU B 1 380 ? 54.816  54.362 13.779  0.53 25.67 ? 358 GLU B CA  1 
ATOM   5600 C  C   A GLU B 1 380 ? 55.638  55.624 13.481  0.47 28.06 ? 358 GLU B C   1 
ATOM   5601 C  C   B GLU B 1 380 ? 55.624  55.612 13.462  0.53 28.04 ? 358 GLU B C   1 
ATOM   5602 O  O   A GLU B 1 380 ? 55.391  56.709 14.013  0.47 27.71 ? 358 GLU B O   1 
ATOM   5603 O  O   B GLU B 1 380 ? 55.298  56.714 13.916  0.53 27.93 ? 358 GLU B O   1 
ATOM   5604 C  CB  A GLU B 1 380 ? 54.890  53.886 15.141  0.47 25.29 ? 358 GLU B CB  1 
ATOM   5605 C  CB  B GLU B 1 380 ? 55.254  53.796 15.141  0.53 25.22 ? 358 GLU B CB  1 
ATOM   5606 C  CG  A GLU B 1 380 ? 55.821  52.706 15.263  0.47 24.28 ? 358 GLU B CG  1 
ATOM   5607 C  CG  B GLU B 1 380 ? 55.132  54.807 16.289  0.53 23.83 ? 358 GLU B CG  1 
ATOM   5608 C  CD  A GLU B 1 380 ? 55.845  52.164 16.671  0.47 20.90 ? 358 GLU B CD  1 
ATOM   5609 C  CD  B GLU B 1 380 ? 55.584  54.271 17.629  0.53 18.46 ? 358 GLU B CD  1 
ATOM   5610 O  OE1 A GLU B 1 380 ? 56.055  50.944 16.833  0.47 20.16 ? 358 GLU B OE1 1 
ATOM   5611 O  OE1 B GLU B 1 380 ? 55.616  53.037 17.804  0.53 20.00 ? 358 GLU B OE1 1 
ATOM   5612 O  OE2 A GLU B 1 380 ? 55.653  52.962 17.615  0.47 20.59 ? 358 GLU B OE2 1 
ATOM   5613 O  OE2 B GLU B 1 380 ? 55.911  55.096 18.512  0.53 20.02 ? 358 GLU B OE2 1 
ATOM   5614 N  N   . SER B 1 381 ? 56.681  55.428 12.678  1.00 29.42 ? 359 SER B N   1 
ATOM   5615 C  CA  . SER B 1 381 ? 57.565  56.521 12.298  1.00 33.87 ? 359 SER B CA  1 
ATOM   5616 C  C   . SER B 1 381 ? 56.777  57.645 11.619  1.00 36.45 ? 359 SER B C   1 
ATOM   5617 O  O   . SER B 1 381 ? 57.031  58.820 11.864  1.00 37.40 ? 359 SER B O   1 
ATOM   5618 C  CB  . SER B 1 381 ? 58.673  56.006 11.375  1.00 32.02 ? 359 SER B CB  1 
ATOM   5619 O  OG  . SER B 1 381 ? 58.197  55.830 10.054  1.00 35.15 ? 359 SER B OG  1 
ATOM   5620 N  N   . LEU B 1 382 ? 55.801  57.270 10.795  1.00 32.68 ? 360 LEU B N   1 
ATOM   5621 C  CA  . LEU B 1 382 ? 54.932  58.223 10.100  1.00 24.63 ? 360 LEU B CA  1 
ATOM   5622 C  C   . LEU B 1 382 ? 54.298  59.278 11.017  1.00 30.14 ? 360 LEU B C   1 
ATOM   5623 O  O   . LEU B 1 382 ? 53.972  60.378 10.571  1.00 30.31 ? 360 LEU B O   1 
ATOM   5624 C  CB  . LEU B 1 382 ? 53.803  57.474 9.377   1.00 24.73 ? 360 LEU B CB  1 
ATOM   5625 C  CG  . LEU B 1 382 ? 54.133  56.539 8.212   1.00 27.51 ? 360 LEU B CG  1 
ATOM   5626 C  CD1 . LEU B 1 382 ? 52.877  55.807 7.759   1.00 26.85 ? 360 LEU B CD1 1 
ATOM   5627 C  CD2 . LEU B 1 382 ? 54.744  57.305 7.054   1.00 30.90 ? 360 LEU B CD2 1 
ATOM   5628 N  N   . PHE B 1 383 ? 54.122  58.936 12.292  1.00 30.71 ? 361 PHE B N   1 
ATOM   5629 C  CA  . PHE B 1 383 ? 53.303  59.740 13.200  1.00 28.36 ? 361 PHE B CA  1 
ATOM   5630 C  C   . PHE B 1 383 ? 54.045  60.908 13.858  1.00 31.69 ? 361 PHE B C   1 
ATOM   5631 O  O   . PHE B 1 383 ? 53.413  61.824 14.390  1.00 34.62 ? 361 PHE B O   1 
ATOM   5632 C  CB  . PHE B 1 383 ? 52.661  58.846 14.271  1.00 27.53 ? 361 PHE B CB  1 
ATOM   5633 C  CG  . PHE B 1 383 ? 51.759  57.777 13.711  1.00 22.31 ? 361 PHE B CG  1 
ATOM   5634 C  CD1 . PHE B 1 383 ? 51.136  57.951 12.483  1.00 22.01 ? 361 PHE B CD1 1 
ATOM   5635 C  CD2 . PHE B 1 383 ? 51.539  56.597 14.409  1.00 20.97 ? 361 PHE B CD2 1 
ATOM   5636 C  CE1 . PHE B 1 383 ? 50.309  56.974 11.960  1.00 24.49 ? 361 PHE B CE1 1 
ATOM   5637 C  CE2 . PHE B 1 383 ? 50.713  55.611 13.892  1.00 23.51 ? 361 PHE B CE2 1 
ATOM   5638 C  CZ  . PHE B 1 383 ? 50.095  55.800 12.666  1.00 21.70 ? 361 PHE B CZ  1 
ATOM   5639 N  N   . GLY B 1 384 ? 55.375  60.878 13.818  1.00 29.03 ? 362 GLY B N   1 
ATOM   5640 C  CA  . GLY B 1 384 ? 56.188  61.887 14.482  1.00 30.32 ? 362 GLY B CA  1 
ATOM   5641 C  C   . GLY B 1 384 ? 56.326  61.527 15.947  1.00 30.07 ? 362 GLY B C   1 
ATOM   5642 O  O   . GLY B 1 384 ? 55.745  60.533 16.385  1.00 31.01 ? 362 GLY B O   1 
ATOM   5643 N  N   . PRO B 1 385 ? 57.094  62.318 16.717  1.00 21.21 ? 363 PRO B N   1 
ATOM   5644 C  CA  . PRO B 1 385 ? 57.154  61.993 18.143  1.00 20.78 ? 363 PRO B CA  1 
ATOM   5645 C  C   . PRO B 1 385 ? 55.786  62.230 18.771  1.00 18.90 ? 363 PRO B C   1 
ATOM   5646 O  O   . PRO B 1 385 ? 55.006  63.018 18.234  1.00 21.76 ? 363 PRO B O   1 
ATOM   5647 C  CB  . PRO B 1 385 ? 58.175  62.997 18.691  1.00 24.46 ? 363 PRO B CB  1 
ATOM   5648 C  CG  . PRO B 1 385 ? 58.123  64.147 17.731  1.00 23.28 ? 363 PRO B CG  1 
ATOM   5649 C  CD  . PRO B 1 385 ? 57.879  63.521 16.386  1.00 23.39 ? 363 PRO B CD  1 
ATOM   5650 N  N   . PRO B 1 386 ? 55.491  61.544 19.880  1.00 19.39 ? 364 PRO B N   1 
ATOM   5651 C  CA  . PRO B 1 386 ? 54.231  61.795 20.586  1.00 18.02 ? 364 PRO B CA  1 
ATOM   5652 C  C   . PRO B 1 386 ? 54.110  63.251 21.023  1.00 22.09 ? 364 PRO B C   1 
ATOM   5653 O  O   . PRO B 1 386 ? 55.117  63.880 21.364  1.00 22.54 ? 364 PRO B O   1 
ATOM   5654 C  CB  . PRO B 1 386 ? 54.345  60.907 21.826  1.00 21.97 ? 364 PRO B CB  1 
ATOM   5655 C  CG  . PRO B 1 386 ? 55.304  59.833 21.448  1.00 20.29 ? 364 PRO B CG  1 
ATOM   5656 C  CD  . PRO B 1 386 ? 56.257  60.433 20.471  1.00 21.63 ? 364 PRO B CD  1 
ATOM   5657 N  N   . VAL B 1 387 ? 52.894  63.786 21.016  1.00 20.71 ? 365 VAL B N   1 
ATOM   5658 C  CA  . VAL B 1 387 ? 52.682  65.127 21.544  1.00 17.66 ? 365 VAL B CA  1 
ATOM   5659 C  C   . VAL B 1 387 ? 52.582  65.045 23.060  1.00 21.45 ? 365 VAL B C   1 
ATOM   5660 O  O   . VAL B 1 387 ? 52.782  66.036 23.765  1.00 22.73 ? 365 VAL B O   1 
ATOM   5661 C  CB  . VAL B 1 387 ? 51.429  65.810 20.960  1.00 22.35 ? 365 VAL B CB  1 
ATOM   5662 C  CG1 . VAL B 1 387 ? 51.582  66.023 19.457  1.00 22.21 ? 365 VAL B CG1 1 
ATOM   5663 C  CG2 . VAL B 1 387 ? 50.184  64.997 21.265  1.00 21.77 ? 365 VAL B CG2 1 
ATOM   5664 N  N   . ALA B 1 388 ? 52.288  63.846 23.556  1.00 15.03 ? 366 ALA B N   1 
ATOM   5665 C  CA  . ALA B 1 388 ? 52.248  63.596 24.991  1.00 18.11 ? 366 ALA B CA  1 
ATOM   5666 C  C   . ALA B 1 388 ? 52.511  62.128 25.290  1.00 17.64 ? 366 ALA B C   1 
ATOM   5667 O  O   . ALA B 1 388 ? 51.984  61.244 24.615  1.00 18.03 ? 366 ALA B O   1 
ATOM   5668 C  CB  . ALA B 1 388 ? 50.903  64.035 25.578  1.00 17.49 ? 366 ALA B CB  1 
ATOM   5669 N  N   . SER B 1 389 ? 53.323  61.872 26.307  1.00 17.50 ? 367 SER B N   1 
ATOM   5670 C  CA  . SER B 1 389 ? 53.620  60.509 26.726  1.00 17.19 ? 367 SER B CA  1 
ATOM   5671 C  C   . SER B 1 389 ? 53.418  60.394 28.230  1.00 18.62 ? 367 SER B C   1 
ATOM   5672 O  O   . SER B 1 389 ? 53.708  61.336 28.973  1.00 19.86 ? 367 SER B O   1 
ATOM   5673 C  CB  . SER B 1 389 ? 55.056  60.128 26.351  1.00 18.76 ? 367 SER B CB  1 
ATOM   5674 O  OG  . SER B 1 389 ? 55.245  60.154 24.944  1.00 17.35 ? 367 SER B OG  1 
ATOM   5675 N  N   . PHE B 1 390 ? 52.937  59.237 28.678  1.00 16.06 ? 368 PHE B N   1 
ATOM   5676 C  CA  . PHE B 1 390 ? 52.617  59.039 30.087  1.00 14.49 ? 368 PHE B CA  1 
ATOM   5677 C  C   . PHE B 1 390 ? 53.133  57.693 30.580  1.00 16.06 ? 368 PHE B C   1 
ATOM   5678 O  O   . PHE B 1 390 ? 53.007  56.684 29.886  1.00 18.72 ? 368 PHE B O   1 
ATOM   5679 C  CB  . PHE B 1 390 ? 51.098  59.115 30.282  1.00 12.83 ? 368 PHE B CB  1 
ATOM   5680 C  CG  . PHE B 1 390 ? 50.494  60.394 29.777  1.00 13.73 ? 368 PHE B CG  1 
ATOM   5681 C  CD1 . PHE B 1 390 ? 50.083  60.504 28.460  1.00 11.71 ? 368 PHE B CD1 1 
ATOM   5682 C  CD2 . PHE B 1 390 ? 50.356  61.489 30.617  1.00 18.35 ? 368 PHE B CD2 1 
ATOM   5683 C  CE1 . PHE B 1 390 ? 49.531  61.674 27.984  1.00 16.16 ? 368 PHE B CE1 1 
ATOM   5684 C  CE2 . PHE B 1 390 ? 49.805  62.666 30.142  1.00 16.68 ? 368 PHE B CE2 1 
ATOM   5685 C  CZ  . PHE B 1 390 ? 49.394  62.756 28.826  1.00 15.10 ? 368 PHE B CZ  1 
ATOM   5686 N  N   . SER B 1 391 ? 53.726  57.677 31.771  1.00 18.54 ? 369 SER B N   1 
ATOM   5687 C  CA  . SER B 1 391 ? 54.173  56.427 32.379  1.00 18.37 ? 369 SER B CA  1 
ATOM   5688 C  C   . SER B 1 391 ? 54.170  56.529 33.901  1.00 21.28 ? 369 SER B C   1 
ATOM   5689 O  O   . SER B 1 391 ? 54.622  55.618 34.591  1.00 24.84 ? 369 SER B O   1 
ATOM   5690 C  CB  . SER B 1 391 ? 55.556  56.014 31.860  1.00 22.15 ? 369 SER B CB  1 
ATOM   5691 O  OG  . SER B 1 391 ? 56.544  56.961 32.217  1.00 25.57 ? 369 SER B OG  1 
ATOM   5692 O  OXT . SER B 1 391 ? 53.706  57.516 34.481  1.00 21.54 ? 369 SER B OXT 1 
HETATM 5693 MG MG  . MG  C 2 .   ? 11.591  36.184 40.830  1.00 9.80  ? 401 MG  A MG  1 
HETATM 5694 MG MG  . MG  D 2 .   ? 24.432  43.005 55.996  1.00 13.69 ? 402 MG  A MG  1 
HETATM 5695 MG MG  . MG  E 2 .   ? 32.351  12.287 15.197  1.00 23.43 ? 403 MG  A MG  1 
HETATM 5696 I  I   . IOD F 3 .   ? 30.063  51.106 41.719  0.35 26.51 ? 404 IOD A I   1 
HETATM 5697 I  I   . IOD G 3 .   ? 17.803  12.189 25.768  0.31 34.14 ? 405 IOD A I   1 
HETATM 5698 I  I   . IOD H 3 .   ? 39.323  19.539 29.260  0.25 35.15 ? 406 IOD A I   1 
HETATM 5699 I  I   . IOD I 3 .   ? 12.934  29.899 30.606  0.36 23.33 ? 407 IOD A I   1 
HETATM 5700 I  I   . IOD J 3 .   ? 36.513  18.297 31.786  0.26 37.47 ? 408 IOD A I   1 
HETATM 5701 I  I   . IOD K 3 .   ? 11.301  19.772 35.175  0.29 23.17 ? 409 IOD A I   1 
HETATM 5702 I  I   . IOD L 3 .   ? 14.295  13.455 23.323  0.27 34.28 ? 410 IOD A I   1 
HETATM 5703 C  C1  . GOL M 4 .   ? 33.866  29.141 45.628  1.00 21.01 ? 411 GOL A C1  1 
HETATM 5704 O  O1  . GOL M 4 .   ? 32.695  29.913 45.435  1.00 19.07 ? 411 GOL A O1  1 
HETATM 5705 C  C2  . GOL M 4 .   ? 34.621  29.090 44.298  1.00 21.06 ? 411 GOL A C2  1 
HETATM 5706 O  O2  . GOL M 4 .   ? 35.120  30.372 44.000  1.00 18.69 ? 411 GOL A O2  1 
HETATM 5707 C  C3  . GOL M 4 .   ? 35.816  28.152 44.388  1.00 21.85 ? 411 GOL A C3  1 
HETATM 5708 O  O3  . GOL M 4 .   ? 36.404  28.065 43.108  1.00 14.98 ? 411 GOL A O3  1 
HETATM 5709 N  N   . PBE N 5 .   ? 14.865  32.589 42.280  1.00 34.55 ? 412 PBE A N   1 
HETATM 5710 C  CD  . PBE N 5 .   ? 15.088  31.162 42.239  1.00 32.02 ? 412 PBE A CD  1 
HETATM 5711 C  CA  . PBE N 5 .   ? 13.751  32.859 41.383  1.00 18.00 ? 412 PBE A CA  1 
HETATM 5712 C  CB  . PBE N 5 .   ? 12.936  31.635 41.312  1.00 21.50 ? 412 PBE A CB  1 
HETATM 5713 C  CG  . PBE N 5 .   ? 13.864  30.536 41.649  1.00 26.60 ? 412 PBE A CG  1 
HETATM 5714 C  CE  . PBE N 5 .   ? 16.055  33.277 41.828  1.00 36.09 ? 412 PBE A CE  1 
HETATM 5715 C  CF  . PBE N 5 .   ? 14.590  32.967 43.662  1.00 35.02 ? 412 PBE A CF  1 
HETATM 5716 C  C   . PBE N 5 .   ? 12.944  34.099 41.442  1.00 18.14 ? 412 PBE A C   1 
HETATM 5717 O  O   . PBE N 5 .   ? 11.734  34.053 41.089  1.00 22.89 ? 412 PBE A O   1 
HETATM 5718 O  OXT . PBE N 5 .   ? 13.401  35.231 41.767  1.00 13.38 ? 412 PBE A OXT 1 
HETATM 5719 MG MG  . MG  O 2 .   ? 25.176  60.291 8.291   1.00 9.28  ? 401 MG  B MG  1 
HETATM 5720 MG MG  . MG  P 2 .   ? 25.828  45.903 -7.145  1.00 22.15 ? 402 MG  B MG  1 
HETATM 5721 I  I   . IOD Q 3 .   ? 21.767  36.792 7.300   0.34 24.23 ? 403 IOD B I   1 
HETATM 5722 I  I   . IOD R 3 .   ? 39.112  68.903 14.061  0.26 27.59 ? 404 IOD B I   1 
HETATM 5723 I  I   . IOD S 3 .   ? 46.114  69.403 25.878  0.32 34.14 ? 405 IOD B I   1 
HETATM 5724 I  I   . IOD T 3 .   ? 31.231  62.430 18.574  0.30 18.45 ? 406 IOD B I   1 
HETATM 5725 N  N   . PBE U 5 .   ? 29.811  59.286 6.734   1.00 40.53 ? 407 PBE B N   1 
HETATM 5726 C  CD  . PBE U 5 .   ? 31.099  59.896 6.492   1.00 36.99 ? 407 PBE B CD  1 
HETATM 5727 C  CA  . PBE U 5 .   ? 29.068  60.166 7.622   1.00 26.12 ? 407 PBE B CA  1 
HETATM 5728 C  CB  . PBE U 5 .   ? 29.812  61.424 7.805   1.00 32.55 ? 407 PBE B CB  1 
HETATM 5729 C  CG  . PBE U 5 .   ? 31.189  61.113 7.357   1.00 35.86 ? 407 PBE B CG  1 
HETATM 5730 C  CE  . PBE U 5 .   ? 29.990  58.002 7.383   1.00 42.00 ? 407 PBE B CE  1 
HETATM 5731 C  CF  . PBE U 5 .   ? 29.151  59.066 5.451   1.00 43.96 ? 407 PBE B CF  1 
HETATM 5732 C  C   . PBE U 5 .   ? 27.588  60.252 7.633   1.00 25.36 ? 407 PBE B C   1 
HETATM 5733 O  O   . PBE U 5 .   ? 26.857  59.251 7.392   1.00 14.52 ? 407 PBE B O   1 
HETATM 5734 O  OXT . PBE U 5 .   ? 27.015  61.338 7.952   1.00 28.13 ? 407 PBE B OXT 1 
HETATM 5735 O  O   . HOH V 6 .   ? 16.087  51.668 39.442  1.00 9.03  ? 501 HOH A O   1 
HETATM 5736 O  O   . HOH V 6 .   ? -6.032  48.772 51.929  1.00 7.55  ? 502 HOH A O   1 
HETATM 5737 O  O   . HOH V 6 .   ? 9.759   36.661 40.046  1.00 9.09  ? 503 HOH A O   1 
HETATM 5738 O  O   . HOH V 6 .   ? 13.733  55.687 26.891  1.00 9.70  ? 504 HOH A O   1 
HETATM 5739 O  O   . HOH V 6 .   ? 15.498  39.209 21.653  1.00 9.68  ? 505 HOH A O   1 
HETATM 5740 O  O   . HOH V 6 .   ? 24.558  26.146 42.982  1.00 11.95 ? 506 HOH A O   1 
HETATM 5741 O  O   . HOH V 6 .   ? 21.768  32.666 46.878  1.00 11.20 ? 507 HOH A O   1 
HETATM 5742 O  O   . HOH V 6 .   ? 26.543  50.035 29.097  1.00 10.33 ? 508 HOH A O   1 
HETATM 5743 O  O   . HOH V 6 .   ? 17.705  37.096 24.399  1.00 8.69  ? 509 HOH A O   1 
HETATM 5744 O  O   . HOH V 6 .   ? 23.652  33.894 24.692  1.00 9.23  ? 510 HOH A O   1 
HETATM 5745 O  O   . HOH V 6 .   ? 26.683  34.191 11.637  1.00 12.91 ? 511 HOH A O   1 
HETATM 5746 O  O   . HOH V 6 .   ? -1.495  38.486 37.654  1.00 9.96  ? 512 HOH A O   1 
HETATM 5747 O  O   . HOH V 6 .   ? 17.102  20.016 33.071  1.00 9.90  ? 513 HOH A O   1 
HETATM 5748 O  O   . HOH V 6 .   ? 24.393  46.157 34.562  1.00 8.79  ? 514 HOH A O   1 
HETATM 5749 O  O   . HOH V 6 .   ? -2.535  36.833 33.449  1.00 10.20 ? 515 HOH A O   1 
HETATM 5750 O  O   . HOH V 6 .   ? 1.344   42.538 61.248  1.00 13.94 ? 516 HOH A O   1 
HETATM 5751 O  O   . HOH V 6 .   ? 11.904  20.873 23.909  1.00 10.51 ? 517 HOH A O   1 
HETATM 5752 O  O   . HOH V 6 .   ? -6.627  47.390 45.454  1.00 9.32  ? 518 HOH A O   1 
HETATM 5753 O  O   . HOH V 6 .   ? 11.738  50.605 47.789  1.00 12.31 ? 519 HOH A O   1 
HETATM 5754 O  O   . HOH V 6 .   ? 39.270  27.392 39.710  1.00 13.36 ? 520 HOH A O   1 
HETATM 5755 O  O   . HOH V 6 .   ? -6.038  38.031 48.131  1.00 12.24 ? 521 HOH A O   1 
HETATM 5756 O  O   . HOH V 6 .   ? 37.167  30.970 36.883  1.00 14.97 ? 522 HOH A O   1 
HETATM 5757 O  O   . HOH V 6 .   ? 24.049  41.434 38.921  1.00 12.30 ? 523 HOH A O   1 
HETATM 5758 O  O   . HOH V 6 .   ? -1.839  35.784 38.254  1.00 13.76 ? 524 HOH A O   1 
HETATM 5759 O  O   . HOH V 6 .   ? 15.330  47.844 50.471  1.00 12.20 ? 525 HOH A O   1 
HETATM 5760 O  O   . HOH V 6 .   ? -3.818  44.159 55.112  1.00 13.01 ? 526 HOH A O   1 
HETATM 5761 O  O   . HOH V 6 .   ? 16.346  45.099 45.597  1.00 11.00 ? 527 HOH A O   1 
HETATM 5762 O  O   . HOH V 6 .   ? -4.490  41.508 37.123  1.00 10.73 ? 528 HOH A O   1 
HETATM 5763 O  O   . HOH V 6 .   ? 26.951  46.544 34.961  1.00 10.03 ? 529 HOH A O   1 
HETATM 5764 O  O   . HOH V 6 .   ? 19.557  26.359 35.282  1.00 12.49 ? 530 HOH A O   1 
HETATM 5765 O  O   . HOH V 6 .   ? 6.848   31.645 37.727  1.00 12.41 ? 531 HOH A O   1 
HETATM 5766 O  O   . HOH V 6 .   ? 27.163  21.153 42.075  1.00 14.29 ? 532 HOH A O   1 
HETATM 5767 O  O   . HOH V 6 .   ? 1.940   52.663 46.069  1.00 13.12 ? 533 HOH A O   1 
HETATM 5768 O  O   . HOH V 6 .   ? 20.577  30.329 47.940  1.00 11.24 ? 534 HOH A O   1 
HETATM 5769 O  O   . HOH V 6 .   ? 10.079  25.847 34.633  1.00 13.56 ? 535 HOH A O   1 
HETATM 5770 O  O   . HOH V 6 .   ? 36.290  25.286 33.861  1.00 13.37 ? 536 HOH A O   1 
HETATM 5771 O  O   . HOH V 6 .   ? 22.579  42.547 55.210  1.00 13.14 ? 537 HOH A O   1 
HETATM 5772 O  O   . HOH V 6 .   ? -0.660  42.901 59.237  1.00 17.50 ? 538 HOH A O   1 
HETATM 5773 O  O   . HOH V 6 .   ? 13.126  32.573 26.933  1.00 13.65 ? 539 HOH A O   1 
HETATM 5774 O  O   . HOH V 6 .   ? 30.015  23.708 45.314  1.00 13.66 ? 540 HOH A O   1 
HETATM 5775 O  O   . HOH V 6 .   ? 27.310  25.195 43.359  1.00 12.49 ? 541 HOH A O   1 
HETATM 5776 O  O   . HOH V 6 .   ? -3.144  37.502 45.384  1.00 15.88 ? 542 HOH A O   1 
HETATM 5777 O  O   . HOH V 6 .   ? 33.179  44.673 34.109  1.00 12.55 ? 543 HOH A O   1 
HETATM 5778 O  O   . HOH V 6 .   ? 17.229  21.214 13.632  1.00 15.85 ? 544 HOH A O   1 
HETATM 5779 O  O   . HOH V 6 .   ? 17.818  31.264 48.701  1.00 12.91 ? 545 HOH A O   1 
HETATM 5780 O  O   . HOH V 6 .   ? 39.041  28.546 42.238  1.00 15.75 ? 546 HOH A O   1 
HETATM 5781 O  O   . HOH V 6 .   ? 13.803  39.619 33.824  1.00 12.18 ? 547 HOH A O   1 
HETATM 5782 O  O   . HOH V 6 .   ? 29.937  42.969 40.501  1.00 12.89 ? 548 HOH A O   1 
HETATM 5783 O  O   . HOH V 6 .   ? 25.365  42.236 54.281  1.00 14.87 ? 549 HOH A O   1 
HETATM 5784 O  O   . HOH V 6 .   ? 16.282  35.372 22.676  1.00 14.75 ? 550 HOH A O   1 
HETATM 5785 O  O   . HOH V 6 .   ? 33.033  14.262 15.258  1.00 19.59 ? 551 HOH A O   1 
HETATM 5786 O  O   . HOH V 6 .   ? 28.148  48.309 30.413  1.00 14.52 ? 552 HOH A O   1 
HETATM 5787 O  O   . HOH V 6 .   ? 15.042  46.854 47.366  1.00 12.37 ? 553 HOH A O   1 
HETATM 5788 O  O   . HOH V 6 .   ? 41.006  38.342 36.332  1.00 17.23 ? 554 HOH A O   1 
HETATM 5789 O  O   . HOH V 6 .   ? 0.547   52.563 34.567  1.00 15.00 ? 555 HOH A O   1 
HETATM 5790 O  O   . HOH V 6 .   ? -1.725  36.728 47.567  1.00 15.70 ? 556 HOH A O   1 
HETATM 5791 O  O   . HOH V 6 .   ? 10.600  23.184 25.998  1.00 13.39 ? 557 HOH A O   1 
HETATM 5792 O  O   . HOH V 6 .   ? 15.944  31.786 21.053  1.00 13.95 ? 558 HOH A O   1 
HETATM 5793 O  O   . HOH V 6 .   ? 4.828   38.783 30.102  1.00 17.08 ? 559 HOH A O   1 
HETATM 5794 O  O   . HOH V 6 .   ? 13.290  31.068 24.494  1.00 13.55 ? 560 HOH A O   1 
HETATM 5795 O  O   . HOH V 6 .   ? 9.609   33.078 32.127  1.00 16.74 ? 561 HOH A O   1 
HETATM 5796 O  O   . HOH V 6 .   ? 23.680  11.090 32.494  1.00 17.77 ? 562 HOH A O   1 
HETATM 5797 O  O   . HOH V 6 .   ? 22.126  41.110 62.020  1.00 17.28 ? 563 HOH A O   1 
HETATM 5798 O  O   . HOH V 6 .   ? 22.971  45.498 52.287  1.00 18.01 ? 564 HOH A O   1 
HETATM 5799 O  O   . HOH V 6 .   ? 22.705  30.221 39.787  1.00 13.97 ? 565 HOH A O   1 
HETATM 5800 O  O   . HOH V 6 .   ? 38.180  35.181 43.658  1.00 18.94 ? 566 HOH A O   1 
HETATM 5801 O  O   . HOH V 6 .   ? 15.794  35.943 39.072  1.00 14.97 ? 567 HOH A O   1 
HETATM 5802 O  O   . HOH V 6 .   ? 12.323  17.708 16.646  1.00 23.48 ? 568 HOH A O   1 
HETATM 5803 O  O   . HOH V 6 .   ? 14.184  27.193 32.997  1.00 14.50 ? 569 HOH A O   1 
HETATM 5804 O  O   . HOH V 6 .   ? 13.850  29.675 27.657  1.00 17.36 ? 570 HOH A O   1 
HETATM 5805 O  O   . HOH V 6 .   ? 26.632  21.628 46.614  1.00 17.08 ? 571 HOH A O   1 
HETATM 5806 O  O   . HOH V 6 .   ? 28.870  22.810 47.752  1.00 17.16 ? 572 HOH A O   1 
HETATM 5807 O  O   . HOH V 6 .   ? 21.717  27.694 40.937  1.00 16.01 ? 573 HOH A O   1 
HETATM 5808 O  O   . HOH V 6 .   ? 2.557   40.506 28.397  1.00 14.51 ? 574 HOH A O   1 
HETATM 5809 O  O   . HOH V 6 .   ? 36.150  32.351 11.246  1.00 20.85 ? 575 HOH A O   1 
HETATM 5810 O  O   . HOH V 6 .   ? 23.908  56.281 30.175  1.00 15.57 ? 576 HOH A O   1 
HETATM 5811 O  O   . HOH V 6 .   ? 22.773  41.094 46.947  1.00 13.61 ? 577 HOH A O   1 
HETATM 5812 O  O   . HOH V 6 .   ? 29.944  43.703 43.207  1.00 21.11 ? 578 HOH A O   1 
HETATM 5813 O  O   . HOH V 6 .   ? 7.282   32.142 33.478  1.00 16.11 ? 579 HOH A O   1 
HETATM 5814 O  O   . HOH V 6 .   ? 14.181  49.715 47.661  1.00 19.74 ? 580 HOH A O   1 
HETATM 5815 O  O   . HOH V 6 .   ? 16.805  26.405 32.961  1.00 12.79 ? 581 HOH A O   1 
HETATM 5816 O  O   . HOH V 6 .   ? 8.985   40.363 63.223  1.00 19.89 ? 582 HOH A O   1 
HETATM 5817 O  O   . HOH V 6 .   ? 15.102  31.487 17.964  1.00 16.33 ? 583 HOH A O   1 
HETATM 5818 O  O   . HOH V 6 .   ? 26.240  22.684 44.146  1.00 15.84 ? 584 HOH A O   1 
HETATM 5819 O  O   . HOH V 6 .   ? 13.458  14.267 26.487  1.00 16.64 ? 585 HOH A O   1 
HETATM 5820 O  O   . HOH V 6 .   ? 21.868  47.995 43.581  1.00 17.09 ? 586 HOH A O   1 
HETATM 5821 O  O   . HOH V 6 .   ? 32.724  22.835 46.074  1.00 18.56 ? 587 HOH A O   1 
HETATM 5822 O  O   . HOH V 6 .   ? 35.926  42.020 45.571  1.00 22.70 ? 588 HOH A O   1 
HETATM 5823 O  O   . HOH V 6 .   ? 13.209  30.151 34.513  1.00 23.07 ? 589 HOH A O   1 
HETATM 5824 O  O   . HOH V 6 .   ? 10.959  31.816 30.185  1.00 17.91 ? 590 HOH A O   1 
HETATM 5825 O  O   . HOH V 6 .   ? 34.615  16.623 42.332  1.00 21.05 ? 591 HOH A O   1 
HETATM 5826 O  O   . HOH V 6 .   ? 39.810  24.259 47.279  1.00 17.42 ? 592 HOH A O   1 
HETATM 5827 O  O   . HOH V 6 .   ? 11.735  32.198 33.811  1.00 17.38 ? 593 HOH A O   1 
HETATM 5828 O  O   . HOH V 6 .   ? 20.055  19.955 14.204  1.00 20.16 ? 594 HOH A O   1 
HETATM 5829 O  O   . HOH V 6 .   ? 23.461  43.685 57.695  1.00 17.05 ? 595 HOH A O   1 
HETATM 5830 O  O   . HOH V 6 .   ? 16.244  39.582 42.053  1.00 18.39 ? 596 HOH A O   1 
HETATM 5831 O  O   . HOH V 6 .   ? 26.063  31.419 12.442  1.00 17.41 ? 597 HOH A O   1 
HETATM 5832 O  O   . HOH V 6 .   ? 18.127  38.688 20.994  1.00 18.11 ? 598 HOH A O   1 
HETATM 5833 O  O   . HOH V 6 .   ? 27.857  44.967 44.624  1.00 17.02 ? 599 HOH A O   1 
HETATM 5834 O  O   . HOH V 6 .   ? 24.566  41.259 57.047  1.00 20.69 ? 600 HOH A O   1 
HETATM 5835 O  O   . HOH V 6 .   ? 35.725  29.518 12.057  1.00 21.90 ? 601 HOH A O   1 
HETATM 5836 O  O   . HOH V 6 .   ? 30.797  29.400 15.457  1.00 20.02 ? 602 HOH A O   1 
HETATM 5837 O  O   . HOH V 6 .   ? 24.254  44.820 55.029  1.00 20.94 ? 603 HOH A O   1 
HETATM 5838 O  O   . HOH V 6 .   ? 17.497  50.052 56.752  1.00 23.73 ? 604 HOH A O   1 
HETATM 5839 O  O   . HOH V 6 .   ? 26.858  19.591 11.985  1.00 20.54 ? 605 HOH A O   1 
HETATM 5840 O  O   . HOH V 6 .   ? 26.657  31.252 22.352  1.00 22.10 ? 606 HOH A O   1 
HETATM 5841 O  O   . HOH V 6 .   ? -2.260  42.164 56.556  1.00 20.56 ? 607 HOH A O   1 
HETATM 5842 O  O   . HOH V 6 .   ? 19.570  34.324 14.705  1.00 18.14 ? 608 HOH A O   1 
HETATM 5843 O  O   . HOH V 6 .   ? 41.437  35.837 33.146  1.00 18.47 ? 609 HOH A O   1 
HETATM 5844 O  O   . HOH V 6 .   ? 6.352   33.159 45.074  1.00 17.03 ? 610 HOH A O   1 
HETATM 5845 O  O   . HOH V 6 .   ? 8.596   33.801 51.916  1.00 16.34 ? 611 HOH A O   1 
HETATM 5846 O  O   . HOH V 6 .   ? 18.383  20.638 45.045  1.00 19.67 ? 612 HOH A O   1 
HETATM 5847 O  O   . HOH V 6 .   ? 15.225  30.750 15.343  1.00 17.52 ? 613 HOH A O   1 
HETATM 5848 O  O   . HOH V 6 .   ? 32.671  31.713 48.021  1.00 16.64 ? 614 HOH A O   1 
HETATM 5849 O  O   . HOH V 6 .   ? 21.952  33.207 61.698  1.00 23.40 ? 615 HOH A O   1 
HETATM 5850 O  O   . HOH V 6 .   ? 6.868   46.504 59.986  1.00 21.18 ? 616 HOH A O   1 
HETATM 5851 O  O   . HOH V 6 .   ? 23.512  42.886 60.223  1.00 20.45 ? 617 HOH A O   1 
HETATM 5852 O  O   . HOH V 6 .   ? 26.459  32.488 53.687  1.00 24.96 ? 618 HOH A O   1 
HETATM 5853 O  O   . HOH V 6 .   ? 9.559   41.740 22.125  1.00 18.01 ? 619 HOH A O   1 
HETATM 5854 O  O   . HOH V 6 .   ? 27.691  29.527 11.118  1.00 25.95 ? 620 HOH A O   1 
HETATM 5855 O  O   . HOH V 6 .   ? 3.791   56.742 35.290  1.00 23.47 ? 621 HOH A O   1 
HETATM 5856 O  O   . HOH V 6 .   ? 11.565  53.033 55.496  1.00 20.21 ? 622 HOH A O   1 
HETATM 5857 O  O   . HOH V 6 .   ? 12.367  27.164 35.442  1.00 15.87 ? 623 HOH A O   1 
HETATM 5858 O  O   . HOH V 6 .   ? 32.011  52.496 38.423  1.00 30.18 ? 624 HOH A O   1 
HETATM 5859 O  O   A HOH V 6 .   ? 33.489  28.081 51.036  0.49 16.66 ? 625 HOH A O   1 
HETATM 5860 O  O   B HOH V 6 .   ? 34.048  28.656 52.770  0.51 20.21 ? 625 HOH A O   1 
HETATM 5861 O  O   . HOH V 6 .   ? 0.504   30.440 55.087  1.00 23.27 ? 626 HOH A O   1 
HETATM 5862 O  O   . HOH V 6 .   ? 0.611   47.816 26.834  1.00 27.19 ? 627 HOH A O   1 
HETATM 5863 O  O   . HOH V 6 .   ? 26.085  15.473 13.007  1.00 22.94 ? 628 HOH A O   1 
HETATM 5864 O  O   . HOH V 6 .   ? -3.108  48.767 56.470  1.00 23.66 ? 629 HOH A O   1 
HETATM 5865 O  O   . HOH V 6 .   ? 3.414   42.261 26.491  1.00 26.84 ? 630 HOH A O   1 
HETATM 5866 O  O   . HOH V 6 .   ? 34.987  22.474 32.738  1.00 18.61 ? 631 HOH A O   1 
HETATM 5867 O  O   . HOH V 6 .   ? 7.125   39.070 28.447  1.00 20.66 ? 632 HOH A O   1 
HETATM 5868 O  O   . HOH V 6 .   ? 37.869  31.442 44.341  1.00 24.47 ? 633 HOH A O   1 
HETATM 5869 O  O   . HOH V 6 .   ? 38.278  31.525 15.938  1.00 24.14 ? 634 HOH A O   1 
HETATM 5870 O  O   . HOH V 6 .   ? 19.794  39.748 61.834  1.00 16.69 ? 635 HOH A O   1 
HETATM 5871 O  O   . HOH V 6 .   ? 3.045   51.660 31.949  1.00 23.54 ? 636 HOH A O   1 
HETATM 5872 O  O   . HOH V 6 .   ? 40.718  40.960 40.165  1.00 20.53 ? 637 HOH A O   1 
HETATM 5873 O  O   . HOH V 6 .   ? 26.234  43.679 56.740  1.00 21.18 ? 638 HOH A O   1 
HETATM 5874 O  O   . HOH V 6 .   ? 25.609  13.937 15.309  1.00 19.34 ? 639 HOH A O   1 
HETATM 5875 O  O   . HOH V 6 .   ? 20.858  17.312 47.256  1.00 23.14 ? 640 HOH A O   1 
HETATM 5876 O  O   . HOH V 6 .   ? -7.436  42.283 48.397  1.00 17.39 ? 641 HOH A O   1 
HETATM 5877 O  O   . HOH V 6 .   ? 14.457  20.427 36.257  1.00 23.49 ? 642 HOH A O   1 
HETATM 5878 O  O   . HOH V 6 .   ? 16.708  33.534 19.005  1.00 22.89 ? 643 HOH A O   1 
HETATM 5879 O  O   . HOH V 6 .   ? -7.249  35.587 47.431  1.00 30.85 ? 644 HOH A O   1 
HETATM 5880 O  O   . HOH V 6 .   ? 10.796  28.067 23.972  1.00 25.02 ? 645 HOH A O   1 
HETATM 5881 O  O   . HOH V 6 .   ? 37.288  33.828 20.243  1.00 21.05 ? 646 HOH A O   1 
HETATM 5882 O  O   . HOH V 6 .   ? 18.911  13.861 17.611  1.00 26.16 ? 647 HOH A O   1 
HETATM 5883 O  O   . HOH V 6 .   ? 17.700  41.233 62.787  1.00 19.55 ? 648 HOH A O   1 
HETATM 5884 O  O   . HOH V 6 .   ? 16.385  48.280 52.984  1.00 24.06 ? 649 HOH A O   1 
HETATM 5885 O  O   . HOH V 6 .   ? 32.794  30.249 11.898  1.00 23.65 ? 650 HOH A O   1 
HETATM 5886 O  O   . HOH V 6 .   ? 24.206  43.437 46.506  1.00 17.26 ? 651 HOH A O   1 
HETATM 5887 O  O   . HOH V 6 .   ? 2.850   33.244 61.700  1.00 24.10 ? 652 HOH A O   1 
HETATM 5888 O  O   . HOH V 6 .   ? 34.419  18.228 14.045  1.00 29.38 ? 653 HOH A O   1 
HETATM 5889 O  O   . HOH V 6 .   ? -4.575  44.041 35.310  1.00 25.85 ? 654 HOH A O   1 
HETATM 5890 O  O   . HOH V 6 .   ? 23.004  16.393 45.498  1.00 22.05 ? 655 HOH A O   1 
HETATM 5891 O  O   . HOH V 6 .   ? 39.070  25.265 34.256  1.00 25.85 ? 656 HOH A O   1 
HETATM 5892 O  O   . HOH V 6 .   ? 29.449  13.971 48.652  1.00 22.12 ? 657 HOH A O   1 
HETATM 5893 O  O   . HOH V 6 .   ? 11.296  28.850 26.883  1.00 22.58 ? 658 HOH A O   1 
HETATM 5894 O  O   . HOH V 6 .   ? 19.479  14.775 24.599  1.00 22.43 ? 659 HOH A O   1 
HETATM 5895 O  O   . HOH V 6 .   ? 10.812  31.772 27.553  1.00 29.19 ? 660 HOH A O   1 
HETATM 5896 O  O   . HOH V 6 .   ? 19.094  38.900 18.737  1.00 22.39 ? 661 HOH A O   1 
HETATM 5897 O  O   . HOH V 6 .   ? 13.721  53.257 57.060  1.00 29.98 ? 662 HOH A O   1 
HETATM 5898 O  O   . HOH V 6 .   ? -0.604  51.334 45.011  1.00 17.72 ? 663 HOH A O   1 
HETATM 5899 O  O   . HOH V 6 .   ? 38.558  26.898 45.799  1.00 24.76 ? 664 HOH A O   1 
HETATM 5900 O  O   . HOH V 6 .   ? 28.578  52.937 34.206  1.00 22.80 ? 665 HOH A O   1 
HETATM 5901 O  O   . HOH V 6 .   ? 35.566  13.609 35.426  1.00 27.48 ? 666 HOH A O   1 
HETATM 5902 O  O   . HOH V 6 .   ? 26.012  27.775 51.360  1.00 25.22 ? 667 HOH A O   1 
HETATM 5903 O  O   . HOH V 6 .   ? 22.134  26.676 11.585  1.00 22.33 ? 668 HOH A O   1 
HETATM 5904 O  O   . HOH V 6 .   ? 21.963  30.698 60.949  1.00 24.13 ? 669 HOH A O   1 
HETATM 5905 O  O   . HOH V 6 .   ? 17.370  21.456 11.248  1.00 26.90 ? 670 HOH A O   1 
HETATM 5906 O  O   . HOH V 6 .   ? 39.887  32.467 17.882  1.00 30.34 ? 671 HOH A O   1 
HETATM 5907 O  O   . HOH V 6 .   ? 19.746  29.717 59.569  1.00 27.42 ? 672 HOH A O   1 
HETATM 5908 O  O   . HOH V 6 .   ? 17.025  23.923 10.327  1.00 24.47 ? 673 HOH A O   1 
HETATM 5909 O  O   . HOH V 6 .   ? 35.655  47.402 39.688  1.00 24.24 ? 674 HOH A O   1 
HETATM 5910 O  O   . HOH V 6 .   ? -1.878  34.964 44.673  1.00 22.37 ? 675 HOH A O   1 
HETATM 5911 O  O   . HOH V 6 .   ? 15.195  37.674 41.265  1.00 22.64 ? 676 HOH A O   1 
HETATM 5912 O  O   . HOH V 6 .   ? 28.684  31.295 55.629  1.00 27.71 ? 677 HOH A O   1 
HETATM 5913 O  O   . HOH V 6 .   ? 15.003  53.250 31.577  1.00 20.63 ? 678 HOH A O   1 
HETATM 5914 O  O   . HOH V 6 .   ? 43.929  26.990 30.167  1.00 26.74 ? 679 HOH A O   1 
HETATM 5915 O  O   . HOH V 6 .   ? 38.245  47.333 39.540  1.00 33.33 ? 680 HOH A O   1 
HETATM 5916 O  O   . HOH V 6 .   ? 5.853   33.840 52.777  1.00 25.80 ? 681 HOH A O   1 
HETATM 5917 O  O   . HOH V 6 .   ? 25.220  22.722 50.344  1.00 25.30 ? 682 HOH A O   1 
HETATM 5918 O  O   . HOH V 6 .   ? 25.231  48.272 46.752  1.00 32.13 ? 683 HOH A O   1 
HETATM 5919 O  O   . HOH V 6 .   ? -1.829  50.889 55.465  1.00 25.55 ? 684 HOH A O   1 
HETATM 5920 O  O   . HOH V 6 .   ? 25.323  46.198 51.252  1.00 29.18 ? 685 HOH A O   1 
HETATM 5921 O  O   . HOH V 6 .   ? -2.858  38.145 58.194  1.00 28.52 ? 686 HOH A O   1 
HETATM 5922 O  O   . HOH V 6 .   ? 36.701  26.184 12.895  1.00 37.31 ? 687 HOH A O   1 
HETATM 5923 O  O   A HOH V 6 .   ? 23.180  11.105 38.085  0.52 19.77 ? 688 HOH A O   1 
HETATM 5924 O  O   B HOH V 6 .   ? 22.581  10.355 36.250  0.48 14.78 ? 688 HOH A O   1 
HETATM 5925 O  O   . HOH V 6 .   ? 2.746   53.370 48.686  1.00 26.46 ? 689 HOH A O   1 
HETATM 5926 O  O   . HOH V 6 .   ? 34.823  45.756 43.274  1.00 25.93 ? 690 HOH A O   1 
HETATM 5927 O  O   . HOH V 6 .   ? 22.821  50.975 44.698  1.00 26.22 ? 691 HOH A O   1 
HETATM 5928 O  O   . HOH V 6 .   ? 0.492   54.568 49.997  1.00 26.90 ? 692 HOH A O   1 
HETATM 5929 O  O   . HOH V 6 .   ? 26.588  40.629 58.680  1.00 32.40 ? 693 HOH A O   1 
HETATM 5930 O  O   . HOH V 6 .   ? 2.563   51.467 29.180  1.00 36.04 ? 694 HOH A O   1 
HETATM 5931 O  O   . HOH V 6 .   ? 10.003  39.149 22.075  1.00 33.08 ? 695 HOH A O   1 
HETATM 5932 O  O   . HOH V 6 .   ? 27.899  43.353 49.444  1.00 24.81 ? 696 HOH A O   1 
HETATM 5933 O  O   . HOH V 6 .   ? 38.879  43.137 40.745  1.00 34.17 ? 697 HOH A O   1 
HETATM 5934 O  O   . HOH V 6 .   ? 14.857  29.595 32.662  1.00 27.51 ? 698 HOH A O   1 
HETATM 5935 O  O   . HOH V 6 .   ? 14.258  41.363 42.347  1.00 30.01 ? 699 HOH A O   1 
HETATM 5936 O  O   . HOH V 6 .   ? 19.652  36.990 17.345  1.00 30.19 ? 700 HOH A O   1 
HETATM 5937 O  O   . HOH V 6 .   ? 27.381  43.490 52.934  1.00 26.55 ? 701 HOH A O   1 
HETATM 5938 O  O   . HOH V 6 .   ? 11.930  38.351 20.218  1.00 28.80 ? 702 HOH A O   1 
HETATM 5939 O  O   . HOH V 6 .   ? 22.529  31.162 22.888  1.00 25.96 ? 703 HOH A O   1 
HETATM 5940 O  O   . HOH V 6 .   ? 20.195  32.507 12.700  1.00 25.23 ? 704 HOH A O   1 
HETATM 5941 O  O   . HOH V 6 .   ? 38.882  44.953 38.580  1.00 27.68 ? 705 HOH A O   1 
HETATM 5942 O  O   . HOH V 6 .   ? 21.026  19.230 11.638  1.00 29.98 ? 706 HOH A O   1 
HETATM 5943 O  O   . HOH V 6 .   ? 31.507  37.502 24.319  1.00 29.90 ? 707 HOH A O   1 
HETATM 5944 O  O   . HOH V 6 .   ? -8.088  39.960 51.677  1.00 49.19 ? 708 HOH A O   1 
HETATM 5945 O  O   . HOH V 6 .   ? 27.105  20.378 50.512  1.00 32.01 ? 709 HOH A O   1 
HETATM 5946 O  O   . HOH V 6 .   ? 25.208  16.395 42.644  1.00 33.36 ? 710 HOH A O   1 
HETATM 5947 O  O   . HOH V 6 .   ? 25.986  44.291 47.847  1.00 26.88 ? 711 HOH A O   1 
HETATM 5948 O  O   . HOH V 6 .   ? 38.641  22.451 39.792  1.00 28.33 ? 712 HOH A O   1 
HETATM 5949 O  O   . HOH V 6 .   ? 29.800  38.632 55.048  1.00 35.85 ? 713 HOH A O   1 
HETATM 5950 O  O   . HOH V 6 .   ? 23.961  55.710 35.150  1.00 31.75 ? 714 HOH A O   1 
HETATM 5951 O  O   . HOH V 6 .   ? 3.899   22.955 41.658  1.00 24.78 ? 715 HOH A O   1 
HETATM 5952 O  O   . HOH V 6 .   ? -5.928  32.928 47.091  1.00 34.66 ? 716 HOH A O   1 
HETATM 5953 O  O   . HOH V 6 .   ? 14.103  35.830 21.069  1.00 35.38 ? 717 HOH A O   1 
HETATM 5954 O  O   . HOH V 6 .   ? 17.561  46.985 56.311  1.00 22.47 ? 718 HOH A O   1 
HETATM 5955 O  O   . HOH V 6 .   ? 37.864  42.766 43.576  1.00 27.21 ? 719 HOH A O   1 
HETATM 5956 O  O   . HOH V 6 .   ? 41.971  26.374 39.577  1.00 27.79 ? 720 HOH A O   1 
HETATM 5957 O  O   . HOH V 6 .   ? 22.445  21.190 9.981   1.00 43.07 ? 721 HOH A O   1 
HETATM 5958 O  O   . HOH V 6 .   ? 12.533  52.771 33.887  1.00 29.23 ? 722 HOH A O   1 
HETATM 5959 O  O   . HOH V 6 .   ? 24.783  47.303 55.838  1.00 35.97 ? 723 HOH A O   1 
HETATM 5960 O  O   . HOH V 6 .   ? 30.600  27.936 13.285  1.00 36.72 ? 724 HOH A O   1 
HETATM 5961 O  O   . HOH V 6 .   ? 29.228  30.438 23.487  1.00 24.54 ? 725 HOH A O   1 
HETATM 5962 O  O   . HOH V 6 .   ? 9.245   35.636 64.128  1.00 26.16 ? 726 HOH A O   1 
HETATM 5963 O  O   . HOH V 6 .   ? 26.169  10.945 16.523  1.00 28.26 ? 727 HOH A O   1 
HETATM 5964 O  O   . HOH V 6 .   ? 29.975  9.607  33.438  1.00 31.18 ? 728 HOH A O   1 
HETATM 5965 O  O   . HOH V 6 .   ? 28.083  16.531 50.543  1.00 30.46 ? 729 HOH A O   1 
HETATM 5966 O  O   . HOH V 6 .   ? 2.035   53.200 56.476  1.00 35.18 ? 730 HOH A O   1 
HETATM 5967 O  O   . HOH V 6 .   ? 31.792  30.658 22.550  1.00 30.03 ? 731 HOH A O   1 
HETATM 5968 O  O   . HOH V 6 .   ? 32.495  34.701 49.887  1.00 27.94 ? 732 HOH A O   1 
HETATM 5969 O  O   . HOH V 6 .   ? 34.996  12.108 24.816  1.00 29.89 ? 733 HOH A O   1 
HETATM 5970 O  O   A HOH V 6 .   ? 27.272  40.610 24.232  0.50 13.28 ? 734 HOH A O   1 
HETATM 5971 O  O   B HOH V 6 .   ? 27.550  42.480 23.516  0.50 23.83 ? 734 HOH A O   1 
HETATM 5972 O  O   . HOH V 6 .   ? 23.998  22.796 10.680  1.00 31.86 ? 735 HOH A O   1 
HETATM 5973 O  O   . HOH V 6 .   ? 22.284  49.407 52.770  1.00 29.62 ? 736 HOH A O   1 
HETATM 5974 O  O   . HOH V 6 .   ? 37.353  36.279 46.236  1.00 28.27 ? 737 HOH A O   1 
HETATM 5975 O  O   . HOH V 6 .   ? -1.020  47.380 29.622  1.00 33.07 ? 738 HOH A O   1 
HETATM 5976 O  O   . HOH V 6 .   ? 23.702  31.263 11.008  1.00 26.60 ? 739 HOH A O   1 
HETATM 5977 O  O   . HOH V 6 .   ? 19.859  16.035 49.851  1.00 37.54 ? 740 HOH A O   1 
HETATM 5978 O  O   . HOH V 6 .   ? 15.125  12.503 27.998  1.00 37.67 ? 741 HOH A O   1 
HETATM 5979 O  O   . HOH V 6 .   ? -1.186  50.141 30.002  1.00 40.64 ? 742 HOH A O   1 
HETATM 5980 O  O   . HOH V 6 .   ? 9.623   51.804 58.140  1.00 30.25 ? 743 HOH A O   1 
HETATM 5981 O  O   . HOH V 6 .   ? 36.511  41.032 27.958  1.00 23.64 ? 744 HOH A O   1 
HETATM 5982 O  O   . HOH V 6 .   ? 14.264  18.600 12.048  1.00 39.01 ? 745 HOH A O   1 
HETATM 5983 O  O   . HOH V 6 .   ? 13.094  17.676 49.400  1.00 28.30 ? 746 HOH A O   1 
HETATM 5984 O  O   . HOH V 6 .   ? 40.227  25.301 36.601  1.00 38.48 ? 747 HOH A O   1 
HETATM 5985 O  O   . HOH V 6 .   ? 43.464  18.831 46.401  1.00 32.05 ? 748 HOH A O   1 
HETATM 5986 O  O   . HOH V 6 .   ? 35.987  14.418 42.583  1.00 35.07 ? 749 HOH A O   1 
HETATM 5987 O  O   . HOH V 6 .   ? 20.972  11.169 39.598  1.00 35.74 ? 750 HOH A O   1 
HETATM 5988 O  O   . HOH V 6 .   ? 10.652  30.462 23.460  1.00 31.92 ? 751 HOH A O   1 
HETATM 5989 O  O   . HOH V 6 .   ? 21.444  9.322  33.976  1.00 26.87 ? 752 HOH A O   1 
HETATM 5990 O  O   . HOH V 6 .   ? 16.159  29.691 10.141  1.00 49.45 ? 753 HOH A O   1 
HETATM 5991 O  O   . HOH V 6 .   ? -0.865  31.996 58.443  1.00 42.27 ? 754 HOH A O   1 
HETATM 5992 O  O   . HOH V 6 .   ? 7.175   37.952 64.083  1.00 40.73 ? 755 HOH A O   1 
HETATM 5993 O  O   . HOH V 6 .   ? 15.467  11.791 30.325  1.00 39.13 ? 756 HOH A O   1 
HETATM 5994 O  O   . HOH V 6 .   ? 23.064  7.507  32.674  1.00 44.49 ? 757 HOH A O   1 
HETATM 5995 O  O   . HOH V 6 .   ? 20.462  10.406 37.117  1.00 48.97 ? 758 HOH A O   1 
HETATM 5996 O  O   . HOH V 6 .   ? 18.204  31.678 11.277  1.00 42.82 ? 759 HOH A O   1 
HETATM 5997 O  O   . HOH V 6 .   ? 12.618  55.362 30.287  1.00 30.61 ? 760 HOH A O   1 
HETATM 5998 O  O   . HOH V 6 .   ? 43.045  21.385 46.790  1.00 33.10 ? 761 HOH A O   1 
HETATM 5999 O  O   A HOH V 6 .   ? 6.625   23.007 38.921  0.50 24.44 ? 762 HOH A O   1 
HETATM 6000 O  O   B HOH V 6 .   ? 5.185   21.998 39.305  0.50 25.47 ? 762 HOH A O   1 
HETATM 6001 O  O   . HOH V 6 .   ? 24.954  52.952 35.833  1.00 36.17 ? 763 HOH A O   1 
HETATM 6002 O  O   . HOH V 6 .   ? 26.280  39.201 61.340  1.00 25.20 ? 764 HOH A O   1 
HETATM 6003 O  O   . HOH V 6 .   ? 44.174  28.537 39.237  1.00 40.55 ? 765 HOH A O   1 
HETATM 6004 O  O   . HOH V 6 .   ? -9.811  41.473 48.224  1.00 16.07 ? 766 HOH A O   1 
HETATM 6005 O  O   . HOH V 6 .   ? 16.971  50.381 54.538  1.00 19.78 ? 767 HOH A O   1 
HETATM 6006 O  O   . HOH V 6 .   ? 40.219  21.498 17.869  1.00 21.69 ? 768 HOH A O   1 
HETATM 6007 O  O   . HOH V 6 .   ? 23.918  29.862 52.696  1.00 27.49 ? 769 HOH A O   1 
HETATM 6008 O  O   . HOH V 6 .   ? 16.689  40.237 65.057  1.00 35.37 ? 770 HOH A O   1 
HETATM 6009 O  O   . HOH V 6 .   ? 24.895  46.287 49.063  1.00 33.95 ? 771 HOH A O   1 
HETATM 6010 O  O   . HOH V 6 .   ? 22.604  48.920 46.075  1.00 33.33 ? 772 HOH A O   1 
HETATM 6011 O  O   . HOH V 6 .   ? 32.703  34.222 55.280  1.00 33.84 ? 773 HOH A O   1 
HETATM 6012 O  O   . HOH V 6 .   ? 9.359   26.967 50.718  1.00 27.85 ? 774 HOH A O   1 
HETATM 6013 O  O   . HOH V 6 .   ? 5.830   40.535 26.653  1.00 34.01 ? 775 HOH A O   1 
HETATM 6014 O  O   . HOH V 6 .   ? 14.335  15.474 14.538  1.00 32.16 ? 776 HOH A O   1 
HETATM 6015 O  O   . HOH V 6 .   ? 42.343  24.464 31.941  1.00 37.83 ? 777 HOH A O   1 
HETATM 6016 O  O   . HOH V 6 .   ? 40.753  23.701 33.679  1.00 32.77 ? 778 HOH A O   1 
HETATM 6017 O  O   . HOH V 6 .   ? 13.486  33.158 22.066  1.00 30.42 ? 779 HOH A O   1 
HETATM 6018 O  O   . HOH V 6 .   ? 2.658   28.213 35.797  1.00 34.70 ? 780 HOH A O   1 
HETATM 6019 O  O   . HOH V 6 .   ? -1.389  52.977 36.304  1.00 43.75 ? 781 HOH A O   1 
HETATM 6020 O  O   . HOH V 6 .   ? 7.076   54.979 25.860  1.00 38.24 ? 782 HOH A O   1 
HETATM 6021 O  O   . HOH V 6 .   ? -0.885  53.623 53.337  1.00 39.46 ? 783 HOH A O   1 
HETATM 6022 O  O   . HOH V 6 .   ? 31.661  10.426 14.543  1.00 29.72 ? 784 HOH A O   1 
HETATM 6023 O  O   A HOH V 6 .   ? 31.508  43.142 45.378  0.51 17.82 ? 785 HOH A O   1 
HETATM 6024 O  O   B HOH V 6 .   ? 32.313  44.961 44.873  0.49 18.77 ? 785 HOH A O   1 
HETATM 6025 O  O   . HOH V 6 .   ? 4.619   48.897 25.354  1.00 49.84 ? 786 HOH A O   1 
HETATM 6026 O  O   . HOH V 6 .   ? 38.338  38.474 47.201  1.00 37.72 ? 787 HOH A O   1 
HETATM 6027 O  O   . HOH V 6 .   ? 30.686  41.463 26.880  1.00 33.57 ? 788 HOH A O   1 
HETATM 6028 O  O   . HOH V 6 .   ? 5.308   32.529 31.793  1.00 36.26 ? 789 HOH A O   1 
HETATM 6029 O  O   . HOH V 6 .   ? 25.952  55.928 32.049  1.00 35.42 ? 790 HOH A O   1 
HETATM 6030 O  O   . HOH V 6 .   ? 28.103  16.568 53.477  1.00 43.57 ? 791 HOH A O   1 
HETATM 6031 O  O   . HOH V 6 .   ? 42.918  34.031 38.733  1.00 35.50 ? 792 HOH A O   1 
HETATM 6032 O  O   . HOH V 6 .   ? 23.325  53.439 44.202  1.00 38.75 ? 793 HOH A O   1 
HETATM 6033 O  O   . HOH V 6 .   ? 0.099   32.435 31.629  1.00 36.49 ? 794 HOH A O   1 
HETATM 6034 O  O   . HOH V 6 .   ? 29.398  25.727 51.504  1.00 32.07 ? 795 HOH A O   1 
HETATM 6035 O  O   . HOH V 6 .   ? 19.284  27.305 53.328  1.00 43.23 ? 796 HOH A O   1 
HETATM 6036 O  O   . HOH V 6 .   ? 28.237  14.274 12.563  1.00 39.09 ? 797 HOH A O   1 
HETATM 6037 O  O   . HOH V 6 .   ? 33.908  15.906 13.264  1.00 39.04 ? 798 HOH A O   1 
HETATM 6038 O  O   . HOH V 6 .   ? 36.111  17.473 40.025  1.00 41.33 ? 799 HOH A O   1 
HETATM 6039 O  O   . HOH V 6 .   ? 37.673  18.878 41.757  1.00 29.87 ? 800 HOH A O   1 
HETATM 6040 O  O   . HOH V 6 .   ? 1.035   29.782 48.636  1.00 34.18 ? 801 HOH A O   1 
HETATM 6041 O  O   . HOH V 6 .   ? 32.194  39.616 25.423  1.00 33.22 ? 802 HOH A O   1 
HETATM 6042 O  O   . HOH V 6 .   ? 30.809  27.935 52.112  1.00 41.55 ? 803 HOH A O   1 
HETATM 6043 O  O   . HOH V 6 .   ? 11.268  53.813 35.943  1.00 44.99 ? 804 HOH A O   1 
HETATM 6044 O  O   . HOH V 6 .   ? 3.466   35.348 31.712  1.00 44.90 ? 805 HOH A O   1 
HETATM 6045 O  O   . HOH V 6 .   ? 34.697  31.070 49.393  1.00 38.85 ? 806 HOH A O   1 
HETATM 6046 O  O   . HOH V 6 .   ? 17.292  17.596 53.495  1.00 46.91 ? 807 HOH A O   1 
HETATM 6047 O  O   . HOH V 6 .   ? -4.142  33.439 44.758  1.00 47.33 ? 808 HOH A O   1 
HETATM 6048 O  O   . HOH V 6 .   ? 37.882  14.519 26.064  1.00 47.46 ? 809 HOH A O   1 
HETATM 6049 O  O   . HOH V 6 .   ? 27.736  7.865  24.889  1.00 41.61 ? 810 HOH A O   1 
HETATM 6050 O  O   . HOH V 6 .   ? 8.092   31.346 64.697  1.00 41.48 ? 811 HOH A O   1 
HETATM 6051 O  O   . HOH V 6 .   ? 20.548  12.427 15.720  1.00 39.91 ? 812 HOH A O   1 
HETATM 6052 O  O   . HOH V 6 .   ? 6.360   54.585 27.969  1.00 38.54 ? 813 HOH A O   1 
HETATM 6053 O  O   . HOH V 6 .   ? 25.686  24.863 52.299  1.00 48.89 ? 814 HOH A O   1 
HETATM 6054 O  O   . HOH V 6 .   ? 23.162  14.047 45.228  1.00 42.75 ? 815 HOH A O   1 
HETATM 6055 O  O   . HOH V 6 .   ? 43.078  35.325 35.705  1.00 47.37 ? 816 HOH A O   1 
HETATM 6056 O  O   . HOH V 6 .   ? 3.449   26.369 44.460  1.00 30.05 ? 817 HOH A O   1 
HETATM 6057 O  O   . HOH V 6 .   ? 6.400   49.304 59.146  1.00 38.08 ? 818 HOH A O   1 
HETATM 6058 O  O   . HOH V 6 .   ? 23.281  45.459 61.595  1.00 39.40 ? 819 HOH A O   1 
HETATM 6059 O  O   . HOH V 6 .   ? 41.150  28.049 43.780  1.00 33.43 ? 820 HOH A O   1 
HETATM 6060 O  O   . HOH V 6 .   ? -6.970  35.615 55.989  1.00 43.63 ? 821 HOH A O   1 
HETATM 6061 O  O   . HOH V 6 .   ? -3.995  40.655 58.719  1.00 45.76 ? 822 HOH A O   1 
HETATM 6062 O  O   . HOH V 6 .   ? 35.914  9.450  24.409  1.00 48.86 ? 823 HOH A O   1 
HETATM 6063 O  O   . HOH V 6 .   ? 22.907  17.705 10.718  1.00 44.61 ? 824 HOH A O   1 
HETATM 6064 O  O   . HOH V 6 .   ? 22.033  12.667 42.986  1.00 40.34 ? 825 HOH A O   1 
HETATM 6065 O  O   . HOH V 6 .   ? -2.171  53.476 55.292  1.00 40.95 ? 826 HOH A O   1 
HETATM 6066 O  O   . HOH V 6 .   ? 0.534   33.894 61.257  1.00 39.11 ? 827 HOH A O   1 
HETATM 6067 O  O   . HOH V 6 .   ? 23.873  48.036 60.109  1.00 51.85 ? 828 HOH A O   1 
HETATM 6068 O  O   . HOH V 6 .   ? 40.601  41.703 44.904  1.00 50.04 ? 829 HOH A O   1 
HETATM 6069 O  O   . HOH V 6 .   ? 43.139  30.220 18.898  1.00 43.16 ? 830 HOH A O   1 
HETATM 6070 O  O   . HOH V 6 .   ? 0.920   56.920 41.904  1.00 37.02 ? 831 HOH A O   1 
HETATM 6071 O  O   . HOH V 6 .   ? 15.026  41.798 65.338  1.00 42.88 ? 832 HOH A O   1 
HETATM 6072 O  O   . HOH V 6 .   ? 31.291  35.434 57.235  1.00 36.54 ? 833 HOH A O   1 
HETATM 6073 O  O   . HOH V 6 .   ? 8.264   24.873 51.617  1.00 38.94 ? 834 HOH A O   1 
HETATM 6074 O  O   . HOH V 6 .   ? 22.602  6.050  29.465  1.00 37.27 ? 835 HOH A O   1 
HETATM 6075 O  O   . HOH V 6 .   ? 41.730  24.939 45.452  1.00 36.82 ? 836 HOH A O   1 
HETATM 6076 O  O   . HOH V 6 .   ? 15.091  45.427 63.708  1.00 46.72 ? 837 HOH A O   1 
HETATM 6077 O  O   . HOH V 6 .   ? 38.519  13.686 42.460  1.00 48.28 ? 838 HOH A O   1 
HETATM 6078 O  O   . HOH V 6 .   ? 9.516   18.023 42.911  1.00 24.85 ? 839 HOH A O   1 
HETATM 6079 O  O   . HOH V 6 .   ? 11.026  18.972 39.597  1.00 32.77 ? 840 HOH A O   1 
HETATM 6080 O  O   . HOH V 6 .   ? 38.158  14.796 20.205  1.00 37.87 ? 841 HOH A O   1 
HETATM 6081 O  O   . HOH V 6 .   ? 11.560  29.989 61.205  1.00 23.79 ? 842 HOH A O   1 
HETATM 6082 O  O   . HOH V 6 .   ? -8.033  39.206 49.409  1.00 21.55 ? 843 HOH A O   1 
HETATM 6083 O  O   . HOH V 6 .   ? 1.607   57.844 37.501  1.00 30.87 ? 844 HOH A O   1 
HETATM 6084 O  O   . HOH V 6 .   ? 29.209  39.306 22.082  1.00 20.30 ? 845 HOH A O   1 
HETATM 6085 O  O   . HOH V 6 .   ? 15.025  14.749 40.361  1.00 38.98 ? 846 HOH A O   1 
HETATM 6086 O  O   . HOH V 6 .   ? 22.164  49.189 49.976  1.00 24.46 ? 847 HOH A O   1 
HETATM 6087 O  O   . HOH V 6 .   ? 7.304   55.233 32.193  1.00 35.83 ? 848 HOH A O   1 
HETATM 6088 O  O   . HOH V 6 .   ? 31.008  15.715 45.402  1.00 33.55 ? 849 HOH A O   1 
HETATM 6089 O  O   . HOH V 6 .   ? 43.291  31.855 35.337  1.00 37.74 ? 850 HOH A O   1 
HETATM 6090 O  O   . HOH V 6 .   ? 34.265  11.675 15.656  1.00 25.58 ? 851 HOH A O   1 
HETATM 6091 O  O   . HOH V 6 .   ? 39.183  33.620 47.467  1.00 43.06 ? 852 HOH A O   1 
HETATM 6092 O  O   . HOH W 6 .   ? 40.861  63.145 37.897  1.00 27.45 ? 501 HOH B O   1 
HETATM 6093 O  O   . HOH W 6 .   ? 40.967  65.567 38.898  1.00 35.30 ? 502 HOH B O   1 
HETATM 6094 O  O   . HOH W 6 .   ? 23.214  44.186 14.519  1.00 7.70  ? 503 HOH B O   1 
HETATM 6095 O  O   . HOH W 6 .   ? 33.360  51.022 24.410  1.00 9.42  ? 504 HOH B O   1 
HETATM 6096 O  O   . HOH W 6 .   ? 27.600  54.540 24.750  1.00 8.97  ? 505 HOH B O   1 
HETATM 6097 O  O   . HOH W 6 .   ? 6.194   70.097 3.643   1.00 7.65  ? 506 HOH B O   1 
HETATM 6098 O  O   . HOH W 6 .   ? 5.319   68.793 -2.824  1.00 7.74  ? 507 HOH B O   1 
HETATM 6099 O  O   . HOH W 6 .   ? 16.477  70.264 11.546  1.00 9.46  ? 508 HOH B O   1 
HETATM 6100 O  O   . HOH W 6 .   ? 23.835  61.635 9.059   1.00 10.04 ? 509 HOH B O   1 
HETATM 6101 O  O   . HOH W 6 .   ? 10.177  72.799 9.733   1.00 8.76  ? 510 HOH B O   1 
HETATM 6102 O  O   . HOH W 6 .   ? 24.134  41.747 14.073  1.00 9.39  ? 511 HOH B O   1 
HETATM 6103 O  O   . HOH W 6 .   ? 20.987  40.343 20.042  1.00 9.82  ? 512 HOH B O   1 
HETATM 6104 O  O   . HOH W 6 .   ? 34.752  48.284 37.430  1.00 13.34 ? 513 HOH B O   1 
HETATM 6105 O  O   . HOH W 6 .   ? 12.334  71.209 12.098  1.00 9.77  ? 514 HOH B O   1 
HETATM 6106 O  O   . HOH W 6 .   ? 24.639  55.338 27.515  1.00 8.09  ? 515 HOH B O   1 
HETATM 6107 O  O   . HOH W 6 .   ? 41.814  63.718 16.141  1.00 9.99  ? 516 HOH B O   1 
HETATM 6108 O  O   . HOH W 6 .   ? 17.306  71.984 15.743  1.00 10.13 ? 517 HOH B O   1 
HETATM 6109 O  O   . HOH W 6 .   ? 14.564  74.399 1.055   1.00 11.45 ? 518 HOH B O   1 
HETATM 6110 O  O   . HOH W 6 .   ? 23.294  39.723 18.655  1.00 12.13 ? 519 HOH B O   1 
HETATM 6111 O  O   . HOH W 6 .   ? 39.172  44.662 0.414   1.00 10.63 ? 520 HOH B O   1 
HETATM 6112 O  O   . HOH W 6 .   ? 29.069  60.784 22.248  1.00 13.74 ? 521 HOH B O   1 
HETATM 6113 O  O   . HOH W 6 .   ? 17.671  51.840 1.651   1.00 11.32 ? 522 HOH B O   1 
HETATM 6114 O  O   . HOH W 6 .   ? 33.291  53.491 2.130   1.00 11.25 ? 523 HOH B O   1 
HETATM 6115 O  O   . HOH W 6 .   ? 27.070  47.026 10.066  1.00 11.22 ? 524 HOH B O   1 
HETATM 6116 O  O   . HOH W 6 .   ? 26.527  48.392 2.077   1.00 13.44 ? 525 HOH B O   1 
HETATM 6117 O  O   . HOH W 6 .   ? 12.852  52.755 1.346   1.00 10.74 ? 526 HOH B O   1 
HETATM 6118 O  O   . HOH W 6 .   ? 47.114  44.685 15.121  1.00 13.16 ? 527 HOH B O   1 
HETATM 6119 O  O   . HOH W 6 .   ? 40.361  54.402 6.091   1.00 11.18 ? 528 HOH B O   1 
HETATM 6120 O  O   . HOH W 6 .   ? 45.918  54.717 6.905   1.00 15.01 ? 529 HOH B O   1 
HETATM 6121 O  O   . HOH W 6 .   ? 46.626  41.138 9.231   1.00 12.11 ? 530 HOH B O   1 
HETATM 6122 O  O   . HOH W 6 .   ? 30.896  59.598 31.240  1.00 14.31 ? 531 HOH B O   1 
HETATM 6123 O  O   . HOH W 6 .   ? 45.157  51.159 3.786   1.00 11.84 ? 532 HOH B O   1 
HETATM 6124 O  O   . HOH W 6 .   ? 36.742  43.549 -0.919  1.00 10.75 ? 533 HOH B O   1 
HETATM 6125 O  O   . HOH W 6 .   ? 27.541  56.874 9.990   1.00 14.38 ? 534 HOH B O   1 
HETATM 6126 O  O   . HOH W 6 .   ? 10.268  68.225 22.286  1.00 11.17 ? 535 HOH B O   1 
HETATM 6127 O  O   . HOH W 6 .   ? 14.816  51.139 1.501   1.00 15.76 ? 536 HOH B O   1 
HETATM 6128 O  O   . HOH W 6 .   ? 18.571  71.930 10.921  1.00 13.71 ? 537 HOH B O   1 
HETATM 6129 O  O   . HOH W 6 .   ? 32.394  57.668 0.317   1.00 12.34 ? 538 HOH B O   1 
HETATM 6130 O  O   . HOH W 6 .   ? 33.344  67.062 14.485  1.00 13.01 ? 539 HOH B O   1 
HETATM 6131 O  O   . HOH W 6 .   ? 5.986   59.985 3.063   1.00 11.75 ? 540 HOH B O   1 
HETATM 6132 O  O   . HOH W 6 .   ? 28.736  41.131 8.555   1.00 12.57 ? 541 HOH B O   1 
HETATM 6133 O  O   . HOH W 6 .   ? 10.395  69.322 -6.028  1.00 12.76 ? 542 HOH B O   1 
HETATM 6134 O  O   . HOH W 6 .   ? 16.453  72.121 3.777   1.00 15.25 ? 543 HOH B O   1 
HETATM 6135 O  O   . HOH W 6 .   ? 17.781  71.385 1.471   1.00 17.01 ? 544 HOH B O   1 
HETATM 6136 O  O   . HOH W 6 .   ? 10.238  73.358 0.685   1.00 14.07 ? 545 HOH B O   1 
HETATM 6137 O  O   . HOH W 6 .   ? 19.987  51.619 3.417   1.00 12.90 ? 546 HOH B O   1 
HETATM 6138 O  O   . HOH W 6 .   ? 5.449   61.259 14.619  1.00 14.50 ? 547 HOH B O   1 
HETATM 6139 O  O   . HOH W 6 .   ? 38.493  67.867 25.255  1.00 11.29 ? 548 HOH B O   1 
HETATM 6140 O  O   . HOH W 6 .   ? 28.972  37.463 14.884  1.00 14.35 ? 549 HOH B O   1 
HETATM 6141 O  O   . HOH W 6 .   ? 34.660  55.800 1.056   1.00 12.12 ? 550 HOH B O   1 
HETATM 6142 O  O   . HOH W 6 .   ? 17.082  51.084 -1.413  1.00 14.59 ? 551 HOH B O   1 
HETATM 6143 O  O   . HOH W 6 .   ? 23.412  56.644 15.270  1.00 11.92 ? 552 HOH B O   1 
HETATM 6144 O  O   . HOH W 6 .   ? 26.490  53.302 28.134  1.00 16.84 ? 553 HOH B O   1 
HETATM 6145 O  O   . HOH W 6 .   ? 31.728  59.961 33.887  1.00 15.62 ? 554 HOH B O   1 
HETATM 6146 O  O   . HOH W 6 .   ? 31.237  58.753 28.108  1.00 15.96 ? 555 HOH B O   1 
HETATM 6147 O  O   . HOH W 6 .   ? 37.654  58.478 13.784  1.00 12.19 ? 556 HOH B O   1 
HETATM 6148 O  O   . HOH W 6 .   ? 45.660  40.581 6.586   1.00 16.19 ? 557 HOH B O   1 
HETATM 6149 O  O   . HOH W 6 .   ? 12.532  75.592 -0.303  1.00 19.32 ? 558 HOH B O   1 
HETATM 6150 O  O   . HOH W 6 .   ? 40.904  63.151 35.537  1.00 15.70 ? 559 HOH B O   1 
HETATM 6151 O  O   . HOH W 6 .   ? 45.000  69.804 22.756  1.00 15.09 ? 560 HOH B O   1 
HETATM 6152 O  O   . HOH W 6 .   ? 26.736  63.752 17.021  1.00 17.30 ? 561 HOH B O   1 
HETATM 6153 O  O   . HOH W 6 .   ? 26.615  66.757 11.345  1.00 12.42 ? 562 HOH B O   1 
HETATM 6154 O  O   . HOH W 6 .   ? 36.862  50.181 36.667  1.00 13.21 ? 563 HOH B O   1 
HETATM 6155 O  O   . HOH W 6 .   ? 42.540  52.515 5.561   1.00 16.16 ? 564 HOH B O   1 
HETATM 6156 O  O   . HOH W 6 .   ? 19.523  64.743 19.053  1.00 14.73 ? 565 HOH B O   1 
HETATM 6157 O  O   . HOH W 6 .   ? 35.981  67.747 23.212  1.00 13.61 ? 566 HOH B O   1 
HETATM 6158 O  O   . HOH W 6 .   ? 14.259  39.344 18.970  1.00 15.64 ? 567 HOH B O   1 
HETATM 6159 O  O   . HOH W 6 .   ? 33.329  64.344 13.622  1.00 15.67 ? 568 HOH B O   1 
HETATM 6160 O  O   . HOH W 6 .   ? 20.329  45.550 5.537   1.00 15.01 ? 569 HOH B O   1 
HETATM 6161 O  O   . HOH W 6 .   ? 41.267  45.374 3.658   1.00 14.52 ? 570 HOH B O   1 
HETATM 6162 O  O   . HOH W 6 .   ? 28.174  56.656 26.425  1.00 16.98 ? 571 HOH B O   1 
HETATM 6163 O  O   . HOH W 6 .   ? 35.969  53.947 9.195   1.00 11.03 ? 572 HOH B O   1 
HETATM 6164 O  O   . HOH W 6 .   ? 36.106  60.886 16.136  1.00 13.53 ? 573 HOH B O   1 
HETATM 6165 O  O   . HOH W 6 .   ? 41.043  40.943 37.537  1.00 18.15 ? 574 HOH B O   1 
HETATM 6166 O  O   . HOH W 6 .   ? 38.167  33.603 12.670  1.00 15.22 ? 575 HOH B O   1 
HETATM 6167 O  O   . HOH W 6 .   ? 30.404  61.468 24.637  1.00 14.56 ? 576 HOH B O   1 
HETATM 6168 O  O   . HOH W 6 .   ? 34.127  62.735 15.945  1.00 14.35 ? 577 HOH B O   1 
HETATM 6169 O  O   . HOH W 6 .   ? 16.775  65.875 20.746  1.00 14.65 ? 578 HOH B O   1 
HETATM 6170 O  O   . HOH W 6 .   ? 31.871  61.732 21.556  1.00 13.62 ? 579 HOH B O   1 
HETATM 6171 O  O   . HOH W 6 .   ? 24.489  54.474 7.044   1.00 17.00 ? 580 HOH B O   1 
HETATM 6172 O  O   . HOH W 6 .   ? 5.775   62.916 4.058   1.00 15.33 ? 581 HOH B O   1 
HETATM 6173 O  O   . HOH W 6 .   ? 5.817   58.921 0.475   1.00 21.78 ? 582 HOH B O   1 
HETATM 6174 O  O   . HOH W 6 .   ? 28.121  40.849 5.816   1.00 19.14 ? 583 HOH B O   1 
HETATM 6175 O  O   . HOH W 6 .   ? 25.324  64.302 -2.963  1.00 18.53 ? 584 HOH B O   1 
HETATM 6176 O  O   . HOH W 6 .   ? 28.621  62.214 15.274  1.00 16.82 ? 585 HOH B O   1 
HETATM 6177 O  O   . HOH W 6 .   ? 32.495  62.418 -3.596  1.00 18.71 ? 586 HOH B O   1 
HETATM 6178 O  O   . HOH W 6 .   ? 26.423  66.095 15.499  1.00 16.09 ? 587 HOH B O   1 
HETATM 6179 O  O   . HOH W 6 .   ? 25.141  47.688 -6.429  1.00 20.52 ? 588 HOH B O   1 
HETATM 6180 O  O   . HOH W 6 .   ? 19.017  72.576 4.533   1.00 19.73 ? 589 HOH B O   1 
HETATM 6181 O  O   . HOH W 6 .   ? 44.146  54.709 4.866   1.00 19.69 ? 590 HOH B O   1 
HETATM 6182 O  O   . HOH W 6 .   ? 31.013  54.176 34.516  1.00 18.59 ? 591 HOH B O   1 
HETATM 6183 O  O   . HOH W 6 .   ? 50.485  41.469 2.680   1.00 16.39 ? 592 HOH B O   1 
HETATM 6184 O  O   . HOH W 6 .   ? 49.497  47.144 -2.867  1.00 13.89 ? 593 HOH B O   1 
HETATM 6185 O  O   . HOH W 6 .   ? 38.789  56.049 37.562  1.00 19.23 ? 594 HOH B O   1 
HETATM 6186 O  O   . HOH W 6 .   ? 31.760  65.070 25.114  1.00 26.27 ? 595 HOH B O   1 
HETATM 6187 O  O   . HOH W 6 .   ? 19.426  59.040 26.997  1.00 18.81 ? 596 HOH B O   1 
HETATM 6188 O  O   . HOH W 6 .   ? 42.674  41.185 11.887  1.00 20.96 ? 597 HOH B O   1 
HETATM 6189 O  O   . HOH W 6 .   ? 14.402  65.778 -12.143 1.00 22.58 ? 598 HOH B O   1 
HETATM 6190 O  O   . HOH W 6 .   ? 47.075  55.454 37.203  1.00 18.80 ? 599 HOH B O   1 
HETATM 6191 O  O   . HOH W 6 .   ? 35.715  47.304 -9.121  1.00 22.13 ? 600 HOH B O   1 
HETATM 6192 O  O   . HOH W 6 .   ? 35.644  49.754 -4.992  1.00 18.33 ? 601 HOH B O   1 
HETATM 6193 O  O   . HOH W 6 .   ? 40.137  66.017 12.884  1.00 19.58 ? 602 HOH B O   1 
HETATM 6194 O  O   . HOH W 6 .   ? 37.738  55.943 8.118   1.00 14.60 ? 603 HOH B O   1 
HETATM 6195 O  O   . HOH W 6 .   ? 53.522  44.782 19.998  1.00 26.03 ? 604 HOH B O   1 
HETATM 6196 O  O   . HOH W 6 .   ? 3.727   56.319 13.876  1.00 18.14 ? 605 HOH B O   1 
HETATM 6197 O  O   . HOH W 6 .   ? 55.868  43.340 1.587   1.00 24.65 ? 606 HOH B O   1 
HETATM 6198 O  O   . HOH W 6 .   ? 40.988  47.187 33.650  1.00 21.11 ? 607 HOH B O   1 
HETATM 6199 O  O   . HOH W 6 .   ? 43.385  42.653 36.961  1.00 22.78 ? 608 HOH B O   1 
HETATM 6200 O  O   . HOH W 6 .   ? 53.738  49.901 6.114   1.00 25.29 ? 609 HOH B O   1 
HETATM 6201 O  O   . HOH W 6 .   ? 13.023  67.267 -10.053 1.00 19.42 ? 610 HOH B O   1 
HETATM 6202 O  O   . HOH W 6 .   ? 20.336  62.658 20.619  1.00 18.31 ? 611 HOH B O   1 
HETATM 6203 O  O   . HOH W 6 .   ? 45.102  55.046 2.222   1.00 20.08 ? 612 HOH B O   1 
HETATM 6204 O  O   . HOH W 6 .   ? 51.463  59.366 34.064  1.00 23.20 ? 613 HOH B O   1 
HETATM 6205 O  O   . HOH W 6 .   ? 7.644   59.439 17.282  1.00 23.43 ? 614 HOH B O   1 
HETATM 6206 O  O   . HOH W 6 .   ? 28.575  62.979 19.087  1.00 19.60 ? 615 HOH B O   1 
HETATM 6207 O  O   . HOH W 6 .   ? 31.690  43.537 26.805  1.00 20.94 ? 616 HOH B O   1 
HETATM 6208 O  O   . HOH W 6 .   ? 40.604  34.796 15.769  1.00 24.65 ? 617 HOH B O   1 
HETATM 6209 O  O   . HOH W 6 .   ? 25.966  42.160 4.402   1.00 19.85 ? 618 HOH B O   1 
HETATM 6210 O  O   . HOH W 6 .   ? 19.994  60.667 -14.308 1.00 21.92 ? 619 HOH B O   1 
HETATM 6211 O  O   . HOH W 6 .   ? 48.878  47.159 16.221  1.00 22.31 ? 620 HOH B O   1 
HETATM 6212 O  O   . HOH W 6 .   ? 35.776  55.111 -3.822  1.00 26.24 ? 621 HOH B O   1 
HETATM 6213 O  O   . HOH W 6 .   ? 41.554  69.440 32.795  1.00 22.05 ? 622 HOH B O   1 
HETATM 6214 O  O   . HOH W 6 .   ? 52.619  63.101 16.807  1.00 20.46 ? 623 HOH B O   1 
HETATM 6215 O  O   . HOH W 6 .   ? 40.519  39.425 28.635  1.00 22.06 ? 624 HOH B O   1 
HETATM 6216 O  O   . HOH W 6 .   ? 31.704  32.477 10.313  1.00 29.23 ? 625 HOH B O   1 
HETATM 6217 O  O   . HOH W 6 .   ? 54.889  53.053 33.947  1.00 23.81 ? 626 HOH B O   1 
HETATM 6218 O  O   . HOH W 6 .   ? 23.964  66.786 -4.313  1.00 21.55 ? 627 HOH B O   1 
HETATM 6219 O  O   . HOH W 6 .   ? 16.907  61.287 23.940  1.00 23.77 ? 628 HOH B O   1 
HETATM 6220 O  O   . HOH W 6 .   ? 48.294  69.242 18.935  1.00 26.17 ? 629 HOH B O   1 
HETATM 6221 O  O   . HOH W 6 .   ? 15.741  64.282 22.558  1.00 23.31 ? 630 HOH B O   1 
HETATM 6222 O  O   . HOH W 6 .   ? 41.389  44.964 37.103  1.00 21.50 ? 631 HOH B O   1 
HETATM 6223 O  O   . HOH W 6 .   ? 48.625  67.248 23.869  1.00 25.95 ? 632 HOH B O   1 
HETATM 6224 O  O   . HOH W 6 .   ? 37.925  47.897 -6.739  1.00 23.41 ? 633 HOH B O   1 
HETATM 6225 O  O   . HOH W 6 .   ? 27.210  42.821 -0.589  1.00 24.22 ? 634 HOH B O   1 
HETATM 6226 O  O   . HOH W 6 .   ? 23.797  72.989 -8.153  1.00 27.83 ? 635 HOH B O   1 
HETATM 6227 O  O   . HOH W 6 .   ? 47.975  60.850 3.570   1.00 27.06 ? 636 HOH B O   1 
HETATM 6228 O  O   . HOH W 6 .   ? 25.306  44.058 0.877   1.00 25.11 ? 637 HOH B O   1 
HETATM 6229 O  O   . HOH W 6 .   ? 42.845  41.107 0.726   1.00 20.67 ? 638 HOH B O   1 
HETATM 6230 O  O   . HOH W 6 .   ? 25.094  46.199 2.500   1.00 23.05 ? 639 HOH B O   1 
HETATM 6231 O  O   . HOH W 6 .   ? 32.864  36.626 3.132   1.00 25.67 ? 640 HOH B O   1 
HETATM 6232 O  O   . HOH W 6 .   ? 22.056  55.316 6.593   1.00 27.92 ? 641 HOH B O   1 
HETATM 6233 O  O   . HOH W 6 .   ? 27.870  33.906 9.235   1.00 23.66 ? 642 HOH B O   1 
HETATM 6234 O  O   . HOH W 6 .   ? 32.472  60.776 16.356  1.00 25.12 ? 643 HOH B O   1 
HETATM 6235 O  O   . HOH W 6 .   ? 50.304  58.181 36.320  1.00 23.34 ? 644 HOH B O   1 
HETATM 6236 O  O   . HOH W 6 .   ? 27.120  45.495 -5.566  1.00 22.35 ? 645 HOH B O   1 
HETATM 6237 O  O   . HOH W 6 .   ? 29.083  69.130 -9.187  1.00 29.24 ? 646 HOH B O   1 
HETATM 6238 O  O   . HOH W 6 .   ? 24.864  66.634 3.984   1.00 18.28 ? 647 HOH B O   1 
HETATM 6239 O  O   . HOH W 6 .   ? 41.845  62.503 4.112   1.00 22.75 ? 648 HOH B O   1 
HETATM 6240 O  O   . HOH W 6 .   ? 39.276  49.659 37.968  1.00 22.64 ? 649 HOH B O   1 
HETATM 6241 O  O   . HOH W 6 .   ? 26.056  51.568 -13.205 1.00 25.09 ? 650 HOH B O   1 
HETATM 6242 O  O   . HOH W 6 .   ? 12.838  69.106 -7.443  1.00 19.32 ? 651 HOH B O   1 
HETATM 6243 O  O   . HOH W 6 .   ? 35.865  32.964 8.742   1.00 22.30 ? 652 HOH B O   1 
HETATM 6244 O  O   . HOH W 6 .   ? 42.939  39.460 33.053  1.00 24.98 ? 653 HOH B O   1 
HETATM 6245 O  O   . HOH W 6 .   ? 32.933  54.580 36.605  1.00 25.55 ? 654 HOH B O   1 
HETATM 6246 O  O   . HOH W 6 .   ? 12.463  48.585 17.739  1.00 22.47 ? 655 HOH B O   1 
HETATM 6247 O  O   . HOH W 6 .   ? 45.300  52.867 0.129   1.00 27.35 ? 656 HOH B O   1 
HETATM 6248 O  O   . HOH W 6 .   ? 17.326  49.825 -3.815  1.00 23.83 ? 657 HOH B O   1 
HETATM 6249 O  O   . HOH W 6 .   ? 31.402  64.424 22.294  1.00 24.82 ? 658 HOH B O   1 
HETATM 6250 O  O   . HOH W 6 .   ? 1.519   57.686 11.575  1.00 25.60 ? 659 HOH B O   1 
HETATM 6251 O  O   . HOH W 6 .   ? 10.726  51.739 -6.341  1.00 20.92 ? 660 HOH B O   1 
HETATM 6252 O  O   . HOH W 6 .   ? 10.042  69.888 13.933  1.00 26.25 ? 661 HOH B O   1 
HETATM 6253 O  O   . HOH W 6 .   ? 57.777  60.856 24.442  1.00 27.34 ? 662 HOH B O   1 
HETATM 6254 O  O   . HOH W 6 .   ? 13.846  59.039 -10.777 1.00 25.64 ? 663 HOH B O   1 
HETATM 6255 O  O   . HOH W 6 .   ? 44.245  66.786 -3.371  1.00 39.69 ? 664 HOH B O   1 
HETATM 6256 O  O   . HOH W 6 .   ? 29.802  63.815 25.788  1.00 27.34 ? 665 HOH B O   1 
HETATM 6257 O  O   . HOH W 6 .   ? 24.133  61.973 -15.176 1.00 27.27 ? 666 HOH B O   1 
HETATM 6258 O  O   . HOH W 6 .   ? 30.129  57.188 30.182  1.00 29.61 ? 667 HOH B O   1 
HETATM 6259 O  O   . HOH W 6 .   ? 14.570  39.706 13.848  1.00 24.55 ? 668 HOH B O   1 
HETATM 6260 O  O   . HOH W 6 .   ? 51.564  62.314 35.014  1.00 33.13 ? 669 HOH B O   1 
HETATM 6261 O  O   . HOH W 6 .   ? 43.637  61.281 35.069  1.00 25.21 ? 670 HOH B O   1 
HETATM 6262 O  O   . HOH W 6 .   ? 29.556  44.556 24.831  1.00 24.95 ? 671 HOH B O   1 
HETATM 6263 O  O   . HOH W 6 .   ? 13.725  57.249 -12.944 1.00 33.34 ? 672 HOH B O   1 
HETATM 6264 O  O   . HOH W 6 .   ? 27.281  43.330 -4.182  1.00 32.76 ? 673 HOH B O   1 
HETATM 6265 O  O   . HOH W 6 .   ? 28.918  52.800 31.754  1.00 32.08 ? 674 HOH B O   1 
HETATM 6266 O  O   . HOH W 6 .   ? 28.319  63.307 21.570  1.00 24.96 ? 675 HOH B O   1 
HETATM 6267 O  O   . HOH W 6 .   ? 9.650   63.642 22.371  1.00 24.92 ? 676 HOH B O   1 
HETATM 6268 O  O   . HOH W 6 .   ? 36.513  50.388 26.661  1.00 26.71 ? 677 HOH B O   1 
HETATM 6269 O  O   . HOH W 6 .   ? 19.270  44.601 -3.600  1.00 30.74 ? 678 HOH B O   1 
HETATM 6270 O  O   . HOH W 6 .   ? 44.982  35.285 12.967  1.00 29.53 ? 679 HOH B O   1 
HETATM 6271 O  O   . HOH W 6 .   ? 25.711  56.635 7.844   1.00 21.42 ? 680 HOH B O   1 
HETATM 6272 O  O   . HOH W 6 .   ? 11.632  50.677 15.527  1.00 34.41 ? 681 HOH B O   1 
HETATM 6273 O  O   . HOH W 6 .   ? 46.470  42.445 2.858   1.00 24.73 ? 682 HOH B O   1 
HETATM 6274 O  O   . HOH W 6 .   ? 43.017  44.356 4.884   1.00 33.62 ? 683 HOH B O   1 
HETATM 6275 O  O   . HOH W 6 .   ? 17.675  40.048 13.474  1.00 28.26 ? 684 HOH B O   1 
HETATM 6276 O  O   . HOH W 6 .   ? 3.638   60.448 -0.952  1.00 25.40 ? 685 HOH B O   1 
HETATM 6277 O  O   . HOH W 6 .   ? 48.075  65.258 31.718  1.00 34.26 ? 686 HOH B O   1 
HETATM 6278 O  O   . HOH W 6 .   ? 41.614  67.469 36.349  1.00 31.38 ? 687 HOH B O   1 
HETATM 6279 O  O   . HOH W 6 .   ? 32.941  34.483 5.208   1.00 25.96 ? 688 HOH B O   1 
HETATM 6280 O  O   . HOH W 6 .   ? 36.026  52.453 38.092  1.00 28.94 ? 689 HOH B O   1 
HETATM 6281 O  O   . HOH W 6 .   ? 32.678  73.480 7.645   1.00 27.53 ? 690 HOH B O   1 
HETATM 6282 O  O   . HOH W 6 .   ? 46.436  43.546 36.441  1.00 43.23 ? 691 HOH B O   1 
HETATM 6283 O  O   . HOH W 6 .   ? 46.151  61.908 2.706   1.00 32.92 ? 692 HOH B O   1 
HETATM 6284 O  O   . HOH W 6 .   ? 33.237  52.584 -12.488 1.00 28.36 ? 693 HOH B O   1 
HETATM 6285 O  O   . HOH W 6 .   ? 38.662  61.960 38.661  1.00 27.12 ? 694 HOH B O   1 
HETATM 6286 O  O   . HOH W 6 .   ? 43.111  47.059 36.774  1.00 30.81 ? 695 HOH B O   1 
HETATM 6287 O  O   . HOH W 6 .   ? 41.505  49.041 36.319  1.00 31.87 ? 696 HOH B O   1 
HETATM 6288 O  O   . HOH W 6 .   ? 44.479  42.966 5.538   1.00 24.91 ? 697 HOH B O   1 
HETATM 6289 O  O   . HOH W 6 .   ? 19.659  65.440 23.553  1.00 40.32 ? 698 HOH B O   1 
HETATM 6290 O  O   . HOH W 6 .   ? 16.077  76.665 1.830   1.00 32.64 ? 699 HOH B O   1 
HETATM 6291 O  O   . HOH W 6 .   ? 52.479  55.571 0.362   1.00 39.14 ? 700 HOH B O   1 
HETATM 6292 O  O   . HOH W 6 .   ? 5.493   64.136 -6.334  1.00 22.99 ? 701 HOH B O   1 
HETATM 6293 O  O   . HOH W 6 .   ? 10.058  52.592 13.363  1.00 29.46 ? 702 HOH B O   1 
HETATM 6294 O  O   . HOH W 6 .   ? 17.158  75.002 4.794   1.00 43.63 ? 703 HOH B O   1 
HETATM 6295 O  O   . HOH W 6 .   ? 52.405  49.650 35.060  1.00 27.65 ? 704 HOH B O   1 
HETATM 6296 O  O   . HOH W 6 .   ? 21.299  65.300 17.034  1.00 51.18 ? 705 HOH B O   1 
HETATM 6297 O  O   . HOH W 6 .   ? 39.501  52.866 -2.512  1.00 28.21 ? 706 HOH B O   1 
HETATM 6298 O  O   . HOH W 6 .   ? 39.994  69.447 9.727   1.00 33.15 ? 707 HOH B O   1 
HETATM 6299 O  O   . HOH W 6 .   ? 23.847  58.690 29.068  1.00 29.69 ? 708 HOH B O   1 
HETATM 6300 O  O   . HOH W 6 .   ? 24.289  45.098 -6.023  1.00 33.02 ? 709 HOH B O   1 
HETATM 6301 O  O   . HOH W 6 .   ? 46.128  32.264 24.071  1.00 28.27 ? 710 HOH B O   1 
HETATM 6302 O  O   . HOH W 6 .   ? 45.665  46.373 37.434  1.00 36.07 ? 711 HOH B O   1 
HETATM 6303 O  O   . HOH W 6 .   ? 53.895  48.833 8.779   1.00 32.48 ? 712 HOH B O   1 
HETATM 6304 O  O   . HOH W 6 .   ? 52.726  63.422 12.789  1.00 41.31 ? 713 HOH B O   1 
HETATM 6305 O  O   . HOH W 6 .   ? 54.313  60.501 32.956  1.00 30.23 ? 714 HOH B O   1 
HETATM 6306 O  O   . HOH W 6 .   ? 49.026  36.135 11.091  1.00 32.95 ? 715 HOH B O   1 
HETATM 6307 O  O   . HOH W 6 .   ? 36.799  52.796 -3.569  1.00 32.84 ? 716 HOH B O   1 
HETATM 6308 O  O   . HOH W 6 .   ? 49.623  37.567 18.488  1.00 25.89 ? 717 HOH B O   1 
HETATM 6309 O  O   . HOH W 6 .   ? 20.320  62.811 25.572  1.00 52.12 ? 718 HOH B O   1 
HETATM 6310 O  O   . HOH W 6 .   ? 46.186  63.639 -0.164  1.00 34.91 ? 719 HOH B O   1 
HETATM 6311 O  O   . HOH W 6 .   ? 29.444  39.825 3.691   1.00 31.71 ? 720 HOH B O   1 
HETATM 6312 O  O   . HOH W 6 .   ? 52.060  64.034 10.436  1.00 37.00 ? 721 HOH B O   1 
HETATM 6313 O  O   . HOH W 6 .   ? 24.151  72.862 -5.643  1.00 40.92 ? 722 HOH B O   1 
HETATM 6314 O  O   . HOH W 6 .   ? 18.316  43.163 4.230   1.00 34.63 ? 723 HOH B O   1 
HETATM 6315 O  O   . HOH W 6 .   ? 48.634  62.013 5.469   1.00 35.47 ? 724 HOH B O   1 
HETATM 6316 O  O   . HOH W 6 .   ? 52.686  40.043 26.428  1.00 37.21 ? 725 HOH B O   1 
HETATM 6317 O  O   . HOH W 6 .   ? 47.589  40.904 4.792   1.00 27.01 ? 726 HOH B O   1 
HETATM 6318 O  O   . HOH W 6 .   ? 57.465  62.958 22.904  1.00 49.89 ? 727 HOH B O   1 
HETATM 6319 O  O   . HOH W 6 .   ? 28.878  57.354 -14.902 1.00 27.66 ? 728 HOH B O   1 
HETATM 6320 O  O   . HOH W 6 .   ? 18.860  49.753 -7.358  1.00 24.62 ? 729 HOH B O   1 
HETATM 6321 O  O   . HOH W 6 .   ? 2.110   58.601 7.191   1.00 27.41 ? 730 HOH B O   1 
HETATM 6322 O  O   . HOH W 6 .   ? 22.930  45.958 -3.212  1.00 29.84 ? 731 HOH B O   1 
HETATM 6323 O  O   . HOH W 6 .   ? 58.649  58.649 22.927  0.50 33.51 ? 732 HOH B O   1 
HETATM 6324 O  O   . HOH W 6 .   ? 47.539  64.460 24.559  1.00 23.85 ? 733 HOH B O   1 
HETATM 6325 O  O   . HOH W 6 .   ? 28.349  65.394 23.430  1.00 31.99 ? 734 HOH B O   1 
HETATM 6326 O  O   . HOH W 6 .   ? 21.532  62.786 -14.868 1.00 27.79 ? 735 HOH B O   1 
HETATM 6327 O  O   . HOH W 6 .   ? 54.798  64.413 27.015  1.00 40.00 ? 736 HOH B O   1 
HETATM 6328 O  O   . HOH W 6 .   ? 50.107  64.698 33.644  1.00 38.13 ? 737 HOH B O   1 
HETATM 6329 O  O   . HOH W 6 .   ? 58.428  56.337 27.453  1.00 41.09 ? 738 HOH B O   1 
HETATM 6330 O  O   . HOH W 6 .   ? 29.405  31.620 9.438   1.00 36.71 ? 739 HOH B O   1 
HETATM 6331 O  O   . HOH W 6 .   ? 45.571  55.960 39.460  1.00 39.08 ? 740 HOH B O   1 
HETATM 6332 O  O   . HOH W 6 .   ? 24.856  67.798 17.418  1.00 45.96 ? 741 HOH B O   1 
HETATM 6333 O  O   . HOH W 6 .   ? 3.795   62.239 -4.277  1.00 28.57 ? 742 HOH B O   1 
HETATM 6334 O  O   . HOH W 6 .   ? 26.720  52.318 30.396  1.00 28.09 ? 743 HOH B O   1 
HETATM 6335 O  O   . HOH W 6 .   ? 24.651  46.302 -8.801  1.00 30.40 ? 744 HOH B O   1 
HETATM 6336 O  O   . HOH W 6 .   ? 6.909   66.378 -7.494  1.00 27.11 ? 745 HOH B O   1 
HETATM 6337 O  O   . HOH W 6 .   ? 48.530  42.533 14.574  1.00 25.15 ? 746 HOH B O   1 
HETATM 6338 O  O   . HOH W 6 .   ? 51.350  38.502 25.116  1.00 30.07 ? 747 HOH B O   1 
HETATM 6339 O  O   . HOH W 6 .   ? 31.819  43.750 -6.039  1.00 39.80 ? 748 HOH B O   1 
HETATM 6340 O  O   . HOH W 6 .   ? 43.017  70.168 8.979   1.00 42.88 ? 749 HOH B O   1 
HETATM 6341 O  O   . HOH W 6 .   ? 21.862  65.829 22.768  1.00 50.11 ? 750 HOH B O   1 
HETATM 6342 O  O   . HOH W 6 .   ? 18.764  76.840 1.988   1.00 36.26 ? 751 HOH B O   1 
HETATM 6343 O  O   . HOH W 6 .   ? 14.252  78.476 2.987   1.00 31.19 ? 752 HOH B O   1 
HETATM 6344 O  O   . HOH W 6 .   ? 35.084  53.395 26.257  1.00 24.51 ? 753 HOH B O   1 
HETATM 6345 O  O   . HOH W 6 .   ? 6.757   54.304 17.293  1.00 30.01 ? 754 HOH B O   1 
HETATM 6346 O  O   . HOH W 6 .   ? 42.854  61.623 39.065  1.00 34.56 ? 755 HOH B O   1 
HETATM 6347 O  O   . HOH W 6 .   ? 44.541  61.161 37.542  1.00 33.74 ? 756 HOH B O   1 
HETATM 6348 O  O   . HOH W 6 .   ? 35.725  38.518 24.403  1.00 25.83 ? 757 HOH B O   1 
HETATM 6349 O  O   . HOH W 6 .   ? 53.029  52.593 5.570   1.00 41.24 ? 758 HOH B O   1 
HETATM 6350 O  O   . HOH W 6 .   ? 60.162  53.597 27.750  1.00 42.21 ? 759 HOH B O   1 
HETATM 6351 O  O   . HOH W 6 .   ? 21.764  60.297 26.838  1.00 33.96 ? 760 HOH B O   1 
HETATM 6352 O  O   . HOH W 6 .   ? 56.566  48.199 33.376  1.00 44.09 ? 761 HOH B O   1 
HETATM 6353 O  O   . HOH W 6 .   ? 49.297  58.791 6.627   1.00 28.43 ? 762 HOH B O   1 
HETATM 6354 O  O   . HOH W 6 .   ? 42.410  55.927 38.232  1.00 39.92 ? 763 HOH B O   1 
HETATM 6355 O  O   . HOH W 6 .   ? 34.463  49.867 -12.998 1.00 41.05 ? 764 HOH B O   1 
HETATM 6356 O  O   . HOH W 6 .   ? 51.122  37.549 11.819  1.00 51.20 ? 765 HOH B O   1 
HETATM 6357 O  O   . HOH W 6 .   ? 5.250   59.748 -7.402  1.00 42.55 ? 766 HOH B O   1 
HETATM 6358 O  O   . HOH W 6 .   ? 60.381  62.892 21.710  1.00 31.39 ? 767 HOH B O   1 
HETATM 6359 O  O   . HOH W 6 .   ? 19.561  36.976 14.798  1.00 24.68 ? 768 HOH B O   1 
HETATM 6360 O  O   . HOH W 6 .   ? 15.488  37.773 17.469  1.00 29.97 ? 769 HOH B O   1 
HETATM 6361 O  O   . HOH W 6 .   ? 31.136  62.013 14.587  1.00 26.35 ? 770 HOH B O   1 
HETATM 6362 O  O   . HOH W 6 .   ? 16.136  65.911 24.878  1.00 27.19 ? 771 HOH B O   1 
HETATM 6363 O  O   . HOH W 6 .   ? 27.347  46.704 -8.293  1.00 29.72 ? 772 HOH B O   1 
HETATM 6364 O  O   . HOH W 6 .   ? 49.500  33.803 21.695  1.00 55.41 ? 773 HOH B O   1 
HETATM 6365 O  O   . HOH W 6 .   ? 34.087  42.604 24.654  1.00 35.61 ? 774 HOH B O   1 
HETATM 6366 O  O   . HOH W 6 .   ? 0.000   58.648 2.439   0.25 31.12 ? 775 HOH B O   1 
HETATM 6367 O  O   . HOH W 6 .   ? 28.651  35.536 5.743   1.00 23.70 ? 776 HOH B O   1 
HETATM 6368 O  O   . HOH W 6 .   ? 56.686  58.993 30.047  1.00 32.67 ? 777 HOH B O   1 
HETATM 6369 O  O   . HOH W 6 .   ? 50.888  47.162 -0.559  1.00 43.03 ? 778 HOH B O   1 
HETATM 6370 O  O   . HOH W 6 .   ? 46.438  51.058 38.711  1.00 32.07 ? 779 HOH B O   1 
HETATM 6371 O  O   . HOH W 6 .   ? 53.173  48.075 17.044  1.00 30.19 ? 780 HOH B O   1 
HETATM 6372 O  O   . HOH W 6 .   ? 8.652   70.183 -8.020  1.00 37.61 ? 781 HOH B O   1 
HETATM 6373 O  O   . HOH W 6 .   ? 26.068  43.983 -7.841  1.00 32.44 ? 782 HOH B O   1 
HETATM 6374 O  O   . HOH W 6 .   ? 27.521  72.119 13.319  1.00 28.00 ? 783 HOH B O   1 
HETATM 6375 O  O   . HOH W 6 .   ? 46.173  55.336 -1.283  1.00 37.45 ? 784 HOH B O   1 
HETATM 6376 O  O   . HOH W 6 .   ? 29.398  54.284 -15.280 1.00 37.93 ? 785 HOH B O   1 
HETATM 6377 O  O   . HOH W 6 .   ? 43.042  37.738 31.160  1.00 34.28 ? 786 HOH B O   1 
HETATM 6378 O  O   . HOH W 6 .   ? 22.689  75.801 -4.678  1.00 40.29 ? 787 HOH B O   1 
HETATM 6379 O  O   . HOH W 6 .   ? 56.887  56.798 21.043  1.00 31.63 ? 788 HOH B O   1 
HETATM 6380 O  O   . HOH W 6 .   ? 53.187  46.199 7.759   1.00 36.22 ? 789 HOH B O   1 
HETATM 6381 O  O   . HOH W 6 .   ? 10.649  54.194 -9.180  1.00 31.16 ? 790 HOH B O   1 
HETATM 6382 O  O   . HOH W 6 .   ? 33.863  36.359 20.961  1.00 28.00 ? 791 HOH B O   1 
HETATM 6383 O  O   . HOH W 6 .   ? 18.759  62.963 22.680  1.00 41.73 ? 792 HOH B O   1 
HETATM 6384 O  O   . HOH W 6 .   ? 4.096   59.019 15.597  1.00 43.90 ? 793 HOH B O   1 
HETATM 6385 O  O   . HOH W 6 .   ? 33.221  37.461 -0.627  1.00 35.15 ? 794 HOH B O   1 
HETATM 6386 O  O   . HOH W 6 .   ? 53.169  64.369 29.622  1.00 46.94 ? 795 HOH B O   1 
HETATM 6387 O  O   . HOH W 6 .   ? 36.927  54.556 38.824  1.00 49.04 ? 796 HOH B O   1 
HETATM 6388 O  O   . HOH W 6 .   ? 40.827  56.916 -4.400  1.00 35.08 ? 797 HOH B O   1 
HETATM 6389 O  O   . HOH W 6 .   ? 26.842  58.622 27.941  1.00 42.68 ? 798 HOH B O   1 
HETATM 6390 O  O   . HOH W 6 .   ? 21.666  68.843 -13.071 1.00 33.59 ? 799 HOH B O   1 
HETATM 6391 O  O   . HOH W 6 .   ? 47.580  68.839 21.373  1.00 38.98 ? 800 HOH B O   1 
HETATM 6392 O  O   . HOH W 6 .   ? 15.879  80.300 2.208   1.00 42.87 ? 801 HOH B O   1 
HETATM 6393 O  O   . HOH W 6 .   ? 57.849  52.347 24.564  1.00 40.35 ? 802 HOH B O   1 
HETATM 6394 O  O   . HOH W 6 .   ? 31.654  53.807 -14.738 1.00 37.76 ? 803 HOH B O   1 
HETATM 6395 O  O   . HOH W 6 .   ? 50.828  41.431 15.440  1.00 34.83 ? 804 HOH B O   1 
HETATM 6396 O  O   . HOH W 6 .   ? 57.187  48.188 28.901  1.00 36.99 ? 805 HOH B O   1 
HETATM 6397 O  O   . HOH W 6 .   ? 56.612  58.064 15.778  1.00 43.76 ? 806 HOH B O   1 
HETATM 6398 O  O   . HOH W 6 .   ? 56.524  64.789 25.521  1.00 43.31 ? 807 HOH B O   1 
HETATM 6399 O  O   . HOH W 6 .   ? 7.598   60.277 20.119  1.00 35.08 ? 808 HOH B O   1 
HETATM 6400 O  O   . HOH W 6 .   ? 50.974  39.781 17.518  1.00 37.03 ? 809 HOH B O   1 
HETATM 6401 O  O   . HOH W 6 .   ? 19.255  44.345 -1.075  1.00 37.22 ? 810 HOH B O   1 
HETATM 6402 O  O   . HOH W 6 .   ? 54.276  49.489 14.768  1.00 37.88 ? 811 HOH B O   1 
HETATM 6403 O  O   . HOH W 6 .   ? 28.669  60.221 27.058  1.00 34.20 ? 812 HOH B O   1 
HETATM 6404 O  O   . HOH W 6 .   ? 29.348  72.539 4.338   1.00 34.34 ? 813 HOH B O   1 
HETATM 6405 O  O   . HOH W 6 .   ? 49.560  42.776 12.185  1.00 50.95 ? 814 HOH B O   1 
HETATM 6406 O  O   . HOH W 6 .   ? 45.071  31.626 20.121  1.00 43.00 ? 815 HOH B O   1 
HETATM 6407 O  O   . HOH W 6 .   ? 53.381  55.239 37.482  1.00 44.27 ? 816 HOH B O   1 
HETATM 6408 O  O   . HOH W 6 .   ? 28.061  54.891 29.481  1.00 40.78 ? 817 HOH B O   1 
HETATM 6409 O  O   . HOH W 6 .   ? 11.012  55.877 -10.961 1.00 37.37 ? 818 HOH B O   1 
HETATM 6410 O  O   . HOH W 6 .   ? 33.973  73.185 9.734   1.00 38.67 ? 819 HOH B O   1 
HETATM 6411 O  O   A HOH W 6 .   ? 9.292   59.404 22.650  0.50 20.47 ? 820 HOH B O   1 
HETATM 6412 O  O   B HOH W 6 .   ? 7.754   58.413 22.060  0.50 22.94 ? 820 HOH B O   1 
HETATM 6413 O  O   . HOH W 6 .   ? 10.940  58.049 -10.190 1.00 37.58 ? 821 HOH B O   1 
HETATM 6414 O  O   . HOH W 6 .   ? 39.908  52.094 39.193  1.00 42.90 ? 822 HOH B O   1 
HETATM 6415 O  O   . HOH W 6 .   ? 20.837  77.755 -4.978  1.00 41.97 ? 823 HOH B O   1 
HETATM 6416 O  O   . HOH W 6 .   ? 49.764  34.989 17.667  1.00 44.33 ? 824 HOH B O   1 
HETATM 6417 O  O   . HOH W 6 .   ? 5.874   67.024 -9.823  1.00 40.70 ? 825 HOH B O   1 
HETATM 6418 O  O   . HOH W 6 .   ? 25.591  63.208 -16.946 1.00 48.27 ? 826 HOH B O   1 
HETATM 6419 O  O   . HOH W 6 .   ? 25.719  46.484 -11.590 1.00 40.00 ? 827 HOH B O   1 
HETATM 6420 O  O   . HOH W 6 .   ? 49.331  40.571 10.127  1.00 40.96 ? 828 HOH B O   1 
HETATM 6421 O  O   . HOH W 6 .   ? 24.914  72.596 0.359   1.00 37.11 ? 829 HOH B O   1 
HETATM 6422 O  O   . HOH W 6 .   ? 17.210  49.044 0.773   1.00 18.65 ? 830 HOH B O   1 
HETATM 6423 O  O   . HOH W 6 .   ? 54.476  41.442 3.693   1.00 34.22 ? 831 HOH B O   1 
HETATM 6424 O  O   . HOH W 6 .   ? 9.224   65.270 19.629  1.00 29.87 ? 832 HOH B O   1 
HETATM 6425 O  O   . HOH W 6 .   ? 4.307   66.390 13.521  1.00 25.51 ? 833 HOH B O   1 
HETATM 6426 O  O   . HOH W 6 .   ? 47.456  67.070 13.352  1.00 39.55 ? 834 HOH B O   1 
HETATM 6427 O  O   . HOH W 6 .   ? 27.499  65.251 -15.812 1.00 40.57 ? 835 HOH B O   1 
HETATM 6428 O  O   . HOH W 6 .   ? 27.258  60.642 -17.904 1.00 44.60 ? 836 HOH B O   1 
HETATM 6429 O  O   . HOH W 6 .   ? 26.359  48.915 -13.220 1.00 39.38 ? 837 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 23  ? 0.4907 0.5008 0.5995 0.0223  0.0603  0.0182  1   MET A N   
2    C CA  . MET A 23  ? 0.4636 0.4705 0.5759 0.0275  0.0508  0.0122  1   MET A CA  
3    C C   . MET A 23  ? 0.3599 0.3482 0.4364 0.0268  0.0441  0.0046  1   MET A C   
4    O O   . MET A 23  ? 0.3650 0.3449 0.4185 0.0212  0.0397  0.0050  1   MET A O   
5    C CB  . MET A 23  ? 0.4834 0.5011 0.6199 0.0255  0.0338  0.0169  1   MET A CB  
6    C CG  . MET A 23  ? 0.5059 0.5212 0.6473 0.0303  0.0246  0.0128  1   MET A CG  
7    S SD  . MET A 23  ? 0.7945 0.8171 0.9498 0.0267  0.0033  0.0172  1   MET A SD  
8    C CE  . MET A 23  ? 0.2454 0.2843 0.4440 0.0304  0.0037  0.0238  1   MET A CE  
9    N N   . LYS A 24  ? 0.2680 0.2492 0.3416 0.0322  0.0424  -0.0019 2   LYS A N   
10   C CA  . LYS A 24  ? 0.2280 0.1917 0.2711 0.0313  0.0361  -0.0089 2   LYS A CA  
11   C C   . LYS A 24  ? 0.1734 0.1352 0.2233 0.0336  0.0247  -0.0116 2   LYS A C   
12   O O   . LYS A 24  ? 0.1659 0.1343 0.2382 0.0385  0.0261  -0.0107 2   LYS A O   
13   C CB  . LYS A 24  ? 0.2916 0.2405 0.3111 0.0350  0.0501  -0.0157 2   LYS A CB  
14   C CG  . LYS A 24  ? 0.4322 0.3817 0.4417 0.0330  0.0649  -0.0127 2   LYS A CG  
15   C CD  . LYS A 24  ? 0.5310 0.4610 0.5066 0.0359  0.0762  -0.0208 2   LYS A CD  
16   C CE  . LYS A 24  ? 0.5966 0.5212 0.5790 0.0450  0.0828  -0.0290 2   LYS A CE  
17   N NZ  . LYS A 24  ? 0.6560 0.5557 0.6013 0.0465  0.0818  -0.0391 2   LYS A NZ  
18   N N   . ILE A 25  ? 0.1962 0.1491 0.2278 0.0298  0.0132  -0.0143 3   ILE A N   
19   C CA  . ILE A 25  ? 0.1757 0.1248 0.2098 0.0311  0.0040  -0.0166 3   ILE A CA  
20   C C   . ILE A 25  ? 0.1795 0.1154 0.2063 0.0363  0.0108  -0.0232 3   ILE A C   
21   O O   . ILE A 25  ? 0.2017 0.1229 0.2045 0.0362  0.0152  -0.0290 3   ILE A O   
22   C CB  . ILE A 25  ? 0.1569 0.1005 0.1749 0.0256  -0.0082 -0.0180 3   ILE A CB  
23   C CG1 . ILE A 25  ? 0.1449 0.1006 0.1710 0.0215  -0.0159 -0.0129 3   ILE A CG1 
24   C CG2 . ILE A 25  ? 0.1561 0.0957 0.1765 0.0261  -0.0157 -0.0197 3   ILE A CG2 
25   C CD1 . ILE A 25  ? 0.1412 0.0932 0.1551 0.0172  -0.0267 -0.0146 3   ILE A CD1 
26   N N   . ALA A 26  ? 0.1752 0.1144 0.2216 0.0410  0.0106  -0.0223 4   ALA A N   
27   C CA  . ALA A 26  ? 0.1923 0.1177 0.2348 0.0467  0.0153  -0.0288 4   ALA A CA  
28   C C   . ALA A 26  ? 0.1985 0.1144 0.2356 0.0443  0.0030  -0.0300 4   ALA A C   
29   O O   . ALA A 26  ? 0.2116 0.1104 0.2334 0.0456  0.0030  -0.0368 4   ALA A O   
30   C CB  . ALA A 26  ? 0.1922 0.1258 0.2620 0.0540  0.0230  -0.0271 4   ALA A CB  
31   N N   . GLU A 27  ? 0.1900 0.1164 0.2394 0.0407  -0.0073 -0.0234 5   GLU A N   
32   C CA  . GLU A 27  ? 0.1695 0.0897 0.2172 0.0378  -0.0176 -0.0224 5   GLU A CA  
33   C C   . GLU A 27  ? 0.1614 0.0915 0.2076 0.0313  -0.0268 -0.0174 5   GLU A C   
34   O O   . GLU A 27  ? 0.1545 0.0977 0.2082 0.0303  -0.0274 -0.0133 5   GLU A O   
35   C CB  . GLU A 27  ? 0.2095 0.1314 0.2765 0.0416  -0.0194 -0.0184 5   GLU A CB  
36   C CG  . GLU A 27  ? 0.2174 0.1320 0.2887 0.0486  -0.0101 -0.0229 5   GLU A CG  
37   C CD  . GLU A 27  ? 0.2982 0.2186 0.3872 0.0506  -0.0127 -0.0171 5   GLU A CD  
38   O OE1 . GLU A 27  ? 0.2542 0.1828 0.3493 0.0459  -0.0218 -0.0098 5   GLU A OE1 
39   O OE2 . GLU A 27  ? 0.3245 0.2407 0.4200 0.0570  -0.0059 -0.0203 5   GLU A OE2 
40   N N   . ILE A 28  ? 0.1607 0.0845 0.1984 0.0269  -0.0339 -0.0181 6   ILE A N   
41   C CA  . ILE A 28  ? 0.1483 0.0821 0.1873 0.0216  -0.0412 -0.0135 6   ILE A CA  
42   C C   . ILE A 28  ? 0.1689 0.0991 0.2128 0.0193  -0.0468 -0.0099 6   ILE A C   
43   O O   . ILE A 28  ? 0.1878 0.1050 0.2268 0.0184  -0.0483 -0.0130 6   ILE A O   
44   C CB  . ILE A 28  ? 0.1449 0.0777 0.1703 0.0173  -0.0440 -0.0170 6   ILE A CB  
45   C CG1 . ILE A 28  ? 0.1450 0.0810 0.1651 0.0186  -0.0392 -0.0188 6   ILE A CG1 
46   C CG2 . ILE A 28  ? 0.1642 0.1080 0.1935 0.0130  -0.0502 -0.0131 6   ILE A CG2 
47   C CD1 . ILE A 28  ? 0.1835 0.1153 0.1891 0.0148  -0.0429 -0.0221 6   ILE A CD1 
48   N N   . HIS A 29  ? 0.1400 0.0803 0.1925 0.0181  -0.0502 -0.0029 7   HIS A N   
49   C CA  . HIS A 29  ? 0.1382 0.0756 0.1945 0.0150  -0.0548 0.0026  7   HIS A CA  
50   C C   . HIS A 29  ? 0.1648 0.1131 0.2180 0.0097  -0.0578 0.0065  7   HIS A C   
51   O O   . HIS A 29  ? 0.1487 0.1079 0.2010 0.0102  -0.0577 0.0077  7   HIS A O   
52   C CB  . HIS A 29  ? 0.1414 0.0800 0.2080 0.0179  -0.0551 0.0080  7   HIS A CB  
53   C CG  . HIS A 29  ? 0.1499 0.0822 0.2210 0.0232  -0.0496 0.0035  7   HIS A CG  
54   N ND1 . HIS A 29  ? 0.1892 0.1092 0.2596 0.0241  -0.0490 0.0010  7   HIS A ND1 
55   C CD2 . HIS A 29  ? 0.1707 0.1074 0.2477 0.0283  -0.0438 0.0012  7   HIS A CD2 
56   C CE1 . HIS A 29  ? 0.1970 0.1136 0.2715 0.0302  -0.0426 -0.0034 7   HIS A CE1 
57   N NE2 . HIS A 29  ? 0.1735 0.1006 0.2530 0.0328  -0.0389 -0.0030 7   HIS A NE2 
58   N N   . VAL A 30  ? 0.1370 0.0821 0.1893 0.0048  -0.0601 0.0082  8   VAL A N   
59   C CA  . VAL A 30  ? 0.1383 0.0944 0.1893 -0.0001 -0.0607 0.0116  8   VAL A CA  
60   C C   . VAL A 30  ? 0.1426 0.0990 0.1971 -0.0035 -0.0621 0.0209  8   VAL A C   
61   O O   . VAL A 30  ? 0.1775 0.1230 0.2364 -0.0052 -0.0644 0.0236  8   VAL A O   
62   C CB  . VAL A 30  ? 0.1416 0.0963 0.1922 -0.0041 -0.0620 0.0072  8   VAL A CB  
63   C CG1 . VAL A 30  ? 0.1771 0.1454 0.2307 -0.0084 -0.0610 0.0107  8   VAL A CG1 
64   C CG2 . VAL A 30  ? 0.1554 0.1076 0.1996 -0.0013 -0.0617 -0.0010 8   VAL A CG2 
65   N N   . TYR A 31  ? 0.1339 0.1012 0.1845 -0.0046 -0.0611 0.0258  9   TYR A N   
66   C CA  . TYR A 31  ? 0.1573 0.1246 0.2068 -0.0083 -0.0620 0.0359  9   TYR A CA  
67   C C   . TYR A 31  ? 0.1601 0.1387 0.2061 -0.0135 -0.0578 0.0390  9   TYR A C   
68   O O   . TYR A 31  ? 0.1547 0.1435 0.1978 -0.0123 -0.0548 0.0334  9   TYR A O   
69   C CB  . TYR A 31  ? 0.1468 0.1150 0.1916 -0.0048 -0.0649 0.0401  9   TYR A CB  
70   C CG  . TYR A 31  ? 0.1502 0.1102 0.2027 0.0009  -0.0681 0.0379  9   TYR A CG  
71   C CD1 . TYR A 31  ? 0.1383 0.1011 0.1932 0.0056  -0.0663 0.0298  9   TYR A CD1 
72   C CD2 . TYR A 31  ? 0.1890 0.1396 0.2474 0.0015  -0.0719 0.0439  9   TYR A CD2 
73   C CE1 . TYR A 31  ? 0.1677 0.1265 0.2304 0.0102  -0.0653 0.0270  9   TYR A CE1 
74   C CE2 . TYR A 31  ? 0.1567 0.1045 0.2231 0.0063  -0.0706 0.0390  9   TYR A CE2 
75   C CZ  . TYR A 31  ? 0.2091 0.1615 0.2779 0.0106  -0.0668 0.0310  9   TYR A CZ  
76   O OH  . TYR A 31  ? 0.2364 0.1875 0.3144 0.0153  -0.0643 0.0276  9   TYR A OH  
77   N N   . ALA A 32  ? 0.1823 0.1591 0.2298 -0.0192 -0.0572 0.0482  10  ALA A N   
78   C CA  . ALA A 32  ? 0.1839 0.1727 0.2288 -0.0244 -0.0509 0.0529  10  ALA A CA  
79   C C   . ALA A 32  ? 0.1972 0.1858 0.2291 -0.0261 -0.0504 0.0630  10  ALA A C   
80   O O   . ALA A 32  ? 0.2645 0.2415 0.2965 -0.0274 -0.0557 0.0706  10  ALA A O   
81   C CB  . ALA A 32  ? 0.2119 0.1996 0.2700 -0.0313 -0.0500 0.0566  10  ALA A CB  
82   N N   . HIS A 33  ? 0.1794 0.1791 0.1990 -0.0260 -0.0445 0.0631  11  HIS A N   
83   C CA  . HIS A 33  ? 0.1972 0.1951 0.1984 -0.0271 -0.0447 0.0716  11  HIS A CA  
84   C C   . HIS A 33  ? 0.2074 0.2182 0.1967 -0.0297 -0.0340 0.0732  11  HIS A C   
85   O O   . HIS A 33  ? 0.2044 0.2263 0.1962 -0.0267 -0.0285 0.0638  11  HIS A O   
86   C CB  . HIS A 33  ? 0.1954 0.1884 0.1880 -0.0202 -0.0523 0.0667  11  HIS A CB  
87   C CG  . HIS A 33  ? 0.2291 0.2179 0.2010 -0.0206 -0.0559 0.0742  11  HIS A CG  
88   N ND1 . HIS A 33  ? 0.2718 0.2502 0.2385 -0.0249 -0.0605 0.0869  11  HIS A ND1 
89   C CD2 . HIS A 33  ? 0.2512 0.2425 0.2050 -0.0173 -0.0572 0.0707  11  HIS A CD2 
90   C CE1 . HIS A 33  ? 0.3203 0.2952 0.2652 -0.0244 -0.0646 0.0913  11  HIS A CE1 
91   N NE2 . HIS A 33  ? 0.3055 0.2878 0.2417 -0.0198 -0.0627 0.0812  11  HIS A NE2 
92   N N   . ASP A 34  ? 0.2294 0.2386 0.2057 -0.0353 -0.0304 0.0852  12  ASP A N   
93   C CA  . ASP A 34  ? 0.2430 0.2649 0.2071 -0.0379 -0.0175 0.0872  12  ASP A CA  
94   C C   . ASP A 34  ? 0.2592 0.2799 0.1938 -0.0337 -0.0173 0.0849  12  ASP A C   
95   O O   . ASP A 34  ? 0.3277 0.3355 0.2475 -0.0327 -0.0274 0.0896  12  ASP A O   
96   C CB  . ASP A 34  ? 0.3274 0.3492 0.2921 -0.0475 -0.0112 0.1023  12  ASP A CB  
97   C CG  . ASP A 34  ? 0.4393 0.4661 0.4336 -0.0526 -0.0090 0.1035  12  ASP A CG  
98   O OD1 . ASP A 34  ? 0.4224 0.4592 0.4332 -0.0494 -0.0064 0.0925  12  ASP A OD1 
99   O OD2 . ASP A 34  ? 0.5100 0.5293 0.5112 -0.0601 -0.0111 0.1157  12  ASP A OD2 
100  N N   . LEU A 35  ? 0.2983 0.3316 0.2250 -0.0311 -0.0063 0.0776  13  LEU A N   
101  C CA  . LEU A 35  ? 0.2946 0.3258 0.1906 -0.0269 -0.0054 0.0740  13  LEU A CA  
102  C C   . LEU A 35  ? 0.3067 0.3482 0.1860 -0.0297 0.0116  0.0774  13  LEU A C   
103  O O   . LEU A 35  ? 0.3018 0.3570 0.1864 -0.0257 0.0224  0.0674  13  LEU A O   
104  C CB  . LEU A 35  ? 0.2655 0.2996 0.1646 -0.0182 -0.0095 0.0579  13  LEU A CB  
105  C CG  . LEU A 35  ? 0.2426 0.2685 0.1569 -0.0146 -0.0241 0.0529  13  LEU A CG  
106  C CD1 . LEU A 35  ? 0.2273 0.2586 0.1470 -0.0074 -0.0254 0.0381  13  LEU A CD1 
107  C CD2 . LEU A 35  ? 0.2553 0.2662 0.1541 -0.0143 -0.0372 0.0591  13  LEU A CD2 
108  N N   . PRO A 36  ? 0.3382 0.3732 0.1973 -0.0364 0.0146  0.0918  14  PRO A N   
109  C CA  . PRO A 36  ? 0.3629 0.4076 0.2026 -0.0395 0.0328  0.0961  14  PRO A CA  
110  C C   . PRO A 36  ? 0.4083 0.4533 0.2186 -0.0315 0.0370  0.0838  14  PRO A C   
111  O O   . PRO A 36  ? 0.4043 0.4346 0.1939 -0.0273 0.0228  0.0799  14  PRO A O   
112  C CB  . PRO A 36  ? 0.4337 0.4650 0.2511 -0.0479 0.0300  0.1146  14  PRO A CB  
113  C CG  . PRO A 36  ? 0.3733 0.3937 0.2141 -0.0507 0.0138  0.1207  14  PRO A CG  
114  C CD  . PRO A 36  ? 0.3555 0.3742 0.2105 -0.0417 0.0020  0.1054  14  PRO A CD  
115  N N   . VAL A 37  ? 0.3873 0.4486 0.1975 -0.0293 0.0557  0.0775  15  VAL A N   
116  C CA  . VAL A 37  ? 0.4139 0.4749 0.1956 -0.0210 0.0611  0.0644  15  VAL A CA  
117  C C   . VAL A 37  ? 0.4538 0.5035 0.1879 -0.0241 0.0661  0.0731  15  VAL A C   
118  O O   . VAL A 37  ? 0.4763 0.5339 0.2025 -0.0305 0.0832  0.0840  15  VAL A O   
119  C CB  . VAL A 37  ? 0.4010 0.4838 0.2008 -0.0162 0.0805  0.0536  15  VAL A CB  
120  C CG1 . VAL A 37  ? 0.4235 0.5034 0.1931 -0.0064 0.0851  0.0384  15  VAL A CG1 
121  C CG2 . VAL A 37  ? 0.3584 0.4511 0.2034 -0.0138 0.0745  0.0459  15  VAL A CG2 
122  N N   . LYS A 38  ? 0.4705 0.5013 0.1727 -0.0200 0.0508  0.0688  16  LYS A N   
123  C CA  . LYS A 38  ? 0.5194 0.5348 0.1727 -0.0217 0.0527  0.0752  16  LYS A CA  
124  C C   . LYS A 38  ? 0.6002 0.6229 0.2345 -0.0172 0.0759  0.0665  16  LYS A C   
125  O O   . LYS A 38  ? 0.5929 0.6246 0.2313 -0.0092 0.0808  0.0494  16  LYS A O   
126  C CB  . LYS A 38  ? 0.5512 0.5446 0.1840 -0.0148 0.0295  0.0688  16  LYS A CB  
127  C CG  . LYS A 38  ? 0.5634 0.5438 0.2086 -0.0191 0.0089  0.0811  16  LYS A CG  
128  C CD  . LYS A 38  ? 0.5834 0.5531 0.2291 -0.0124 -0.0139 0.0724  16  LYS A CD  
129  C CE  . LYS A 38  ? 0.6702 0.6346 0.2841 -0.0080 -0.0172 0.0676  16  LYS A CE  
130  N NZ  . LYS A 38  ? 0.6425 0.5997 0.2646 -0.0041 -0.0385 0.0587  16  LYS A NZ  
131  N N   . ASP A 39  ? 0.6055 0.6240 0.2220 -0.0218 0.0903  0.0783  17  ASP A N   
132  C CA  . ASP A 39  ? 0.6673 0.6905 0.2660 -0.0198 0.1152  0.0720  17  ASP A CA  
133  C C   . ASP A 39  ? 0.6666 0.7208 0.3052 -0.0180 0.1322  0.0615  17  ASP A C   
134  O O   . ASP A 39  ? 0.6575 0.7173 0.2895 -0.0115 0.1443  0.0455  17  ASP A O   
135  C CB  . ASP A 39  ? 0.7641 0.7665 0.3225 -0.0133 0.1092  0.0577  17  ASP A CB  
136  C CG  . ASP A 39  ? 0.8535 0.8692 0.3955 -0.0083 0.0908  0.0726  17  ASP A CG  
137  O OD1 . ASP A 39  ? 0.8840 0.8938 0.4104 -0.0078 0.0715  0.0631  17  ASP A OD1 
138  O OD2 . ASP A 39  ? 0.8724 0.8787 0.4051 -0.0130 0.0978  0.0906  17  ASP A OD2 
139  N N   . GLY A 40  ? 0.6397 0.7138 0.3222 -0.0231 0.1318  0.0704  18  GLY A N   
140  C CA  . GLY A 40  ? 0.6050 0.7084 0.3313 -0.0194 0.1447  0.0624  18  GLY A CA  
141  C C   . GLY A 40  ? 0.6324 0.7504 0.3680 -0.0218 0.1719  0.0636  18  GLY A C   
142  O O   . GLY A 40  ? 0.5782 0.6836 0.2834 -0.0273 0.1823  0.0713  18  GLY A O   
143  N N   . PRO A 41  ? 0.5071 0.6511 0.2863 -0.0179 0.1831  0.0559  19  PRO A N   
144  C CA  . PRO A 41  ? 0.4910 0.6448 0.3067 -0.0120 0.1690  0.0464  19  PRO A CA  
145  C C   . PRO A 41  ? 0.4582 0.6074 0.2628 0.0020  0.1643  0.0242  19  PRO A C   
146  O O   . PRO A 41  ? 0.5027 0.6446 0.2733 0.0077  0.1744  0.0155  19  PRO A O   
147  C CB  . PRO A 41  ? 0.4445 0.6256 0.3120 -0.0151 0.1838  0.0493  19  PRO A CB  
148  C CG  . PRO A 41  ? 0.4911 0.6785 0.3463 -0.0151 0.2089  0.0478  19  PRO A CG  
149  C CD  . PRO A 41  ? 0.5288 0.6911 0.3297 -0.0207 0.2084  0.0565  19  PRO A CD  
150  N N   . TYR A 42  ? 0.4202 0.5676 0.2544 0.0065  0.1469  0.0148  20  TYR A N   
151  C CA  . TYR A 42  ? 0.4487 0.5939 0.2823 0.0191  0.1421  -0.0057 20  TYR A CA  
152  C C   . TYR A 42  ? 0.3933 0.5627 0.2738 0.0235  0.1537  -0.0135 20  TYR A C   
153  O O   . TYR A 42  ? 0.3605 0.5385 0.2816 0.0185  0.1469  -0.0079 20  TYR A O   
154  C CB  . TYR A 42  ? 0.4307 0.5572 0.2653 0.0209  0.1147  -0.0103 20  TYR A CB  
155  C CG  . TYR A 42  ? 0.4612 0.5809 0.2893 0.0328  0.1070  -0.0299 20  TYR A CG  
156  C CD1 . TYR A 42  ? 0.5032 0.6075 0.2864 0.0387  0.1060  -0.0383 20  TYR A CD1 
157  C CD2 . TYR A 42  ? 0.4354 0.5622 0.3012 0.0378  0.0994  -0.0397 20  TYR A CD2 
158  C CE1 . TYR A 42  ? 0.4600 0.5562 0.2380 0.0494  0.0976  -0.0563 20  TYR A CE1 
159  C CE2 . TYR A 42  ? 0.4351 0.5543 0.2960 0.0482  0.0914  -0.0567 20  TYR A CE2 
160  C CZ  . TYR A 42  ? 0.4159 0.5200 0.2339 0.0540  0.0905  -0.0651 20  TYR A CZ  
161  O OH  . TYR A 42  ? 0.4431 0.5380 0.2571 0.0640  0.0813  -0.0821 20  TYR A OH  
162  N N   . THR A 43  ? 0.4140 0.5933 0.2886 0.0333  0.1704  -0.0267 21  THR A N   
163  C CA  . THR A 43  ? 0.4311 0.6361 0.3510 0.0377  0.1849  -0.0330 21  THR A CA  
164  C C   . THR A 43  ? 0.4032 0.6070 0.3405 0.0503  0.1751  -0.0527 21  THR A C   
165  O O   . THR A 43  ? 0.4100 0.6008 0.3226 0.0594  0.1774  -0.0663 21  THR A O   
166  C CB  . THR A 43  ? 0.4716 0.6826 0.3841 0.0371  0.2114  -0.0319 21  THR A CB  
167  O OG1 . THR A 43  ? 0.4832 0.6923 0.3780 0.0242  0.2192  -0.0132 21  THR A OG1 
168  C CG2 . THR A 43  ? 0.4284 0.6633 0.3952 0.0397  0.2245  -0.0354 21  THR A CG2 
169  N N   . ILE A 44  ? 0.3609 0.5697 0.3408 0.0486  0.1610  -0.0524 22  ILE A N   
170  C CA  . ILE A 44  ? 0.3280 0.5380 0.3329 0.0590  0.1515  -0.0684 22  ILE A CA  
171  C C   . ILE A 44  ? 0.3371 0.5752 0.3907 0.0608  0.1671  -0.0692 22  ILE A C   
172  O O   . ILE A 44  ? 0.3131 0.5659 0.3882 0.0511  0.1760  -0.0550 22  ILE A O   
173  C CB  . ILE A 44  ? 0.2939 0.4893 0.3119 0.0551  0.1244  -0.0661 22  ILE A CB  
174  C CG1 . ILE A 44  ? 0.3008 0.4723 0.2776 0.0503  0.1105  -0.0603 22  ILE A CG1 
175  C CG2 . ILE A 44  ? 0.2987 0.4907 0.3347 0.0653  0.1124  -0.0819 22  ILE A CG2 
176  C CD1 . ILE A 44  ? 0.2703 0.4283 0.2583 0.0462  0.0867  -0.0572 22  ILE A CD1 
177  N N   . ALA A 45  ? 0.3231 0.5600 0.3943 0.0716  0.1671  -0.0821 23  ALA A N   
178  C CA  . ALA A 45  ? 0.3206 0.5765 0.4375 0.0738  0.1784  -0.0794 23  ALA A CA  
179  C C   . ALA A 45  ? 0.2840 0.5534 0.4459 0.0651  0.1669  -0.0694 23  ALA A C   
180  O O   . ALA A 45  ? 0.2828 0.5713 0.4794 0.0625  0.1759  -0.0603 23  ALA A O   
181  C CB  . ALA A 45  ? 0.3301 0.5803 0.4570 0.0875  0.1756  -0.0939 23  ALA A CB  
182  N N   . SER A 46  ? 0.2570 0.5161 0.4163 0.0608  0.1458  -0.0706 24  SER A N   
183  C CA  . SER A 46  ? 0.2257 0.4903 0.4225 0.0525  0.1317  -0.0626 24  SER A CA  
184  C C   . SER A 46  ? 0.2757 0.5321 0.4581 0.0386  0.1273  -0.0454 24  SER A C   
185  O O   . SER A 46  ? 0.2465 0.5048 0.4565 0.0304  0.1167  -0.0367 24  SER A O   
186  C CB  . SER A 46  ? 0.2053 0.4531 0.4070 0.0571  0.1069  -0.0715 24  SER A CB  
187  O OG  . SER A 46  ? 0.2083 0.4315 0.3673 0.0566  0.0948  -0.0724 24  SER A OG  
188  N N   . SER A 47  ? 0.2417 0.4874 0.3806 0.0362  0.1342  -0.0408 25  SER A N   
189  C CA  . SER A 47  ? 0.2394 0.4743 0.3623 0.0239  0.1282  -0.0249 25  SER A CA  
190  C C   . SER A 47  ? 0.3411 0.5701 0.4202 0.0215  0.1416  -0.0187 25  SER A C   
191  O O   . SER A 47  ? 0.2868 0.5018 0.3288 0.0284  0.1397  -0.0273 25  SER A O   
192  C CB  . SER A 47  ? 0.2381 0.4500 0.3508 0.0225  0.1029  -0.0259 25  SER A CB  
193  O OG  . SER A 47  ? 0.2596 0.4612 0.3621 0.0116  0.0964  -0.0115 25  SER A OG  
194  N N   . THR A 48  ? 0.3034 0.5418 0.3865 0.0114  0.1540  -0.0032 26  THR A N   
195  C CA  . THR A 48  ? 0.3115 0.5416 0.3517 0.0067  0.1642  0.0062  26  THR A CA  
196  C C   . THR A 48  ? 0.3215 0.5344 0.3522 -0.0043 0.1483  0.0208  26  THR A C   
197  O O   . THR A 48  ? 0.3128 0.5321 0.3750 -0.0130 0.1446  0.0312  26  THR A O   
198  C CB  . THR A 48  ? 0.3357 0.5884 0.3842 0.0025  0.1919  0.0149  26  THR A CB  
199  O OG1 . THR A 48  ? 0.3459 0.6152 0.4057 0.0138  0.2083  0.0004  26  THR A OG1 
200  C CG2 . THR A 48  ? 0.3717 0.6132 0.3711 -0.0029 0.2015  0.0258  26  THR A CG2 
201  N N   . VAL A 49  ? 0.3141 0.5049 0.3030 -0.0036 0.1378  0.0212  27  VAL A N   
202  C CA  . VAL A 49  ? 0.3048 0.4781 0.2864 -0.0121 0.1210  0.0332  27  VAL A CA  
203  C C   . VAL A 49  ? 0.3361 0.4966 0.2766 -0.0180 0.1244  0.0456  27  VAL A C   
204  O O   . VAL A 49  ? 0.3690 0.5217 0.2712 -0.0126 0.1287  0.0402  27  VAL A O   
205  C CB  . VAL A 49  ? 0.3534 0.5095 0.3337 -0.0070 0.0979  0.0239  27  VAL A CB  
206  C CG1 . VAL A 49  ? 0.3372 0.5025 0.3597 -0.0051 0.0909  0.0170  27  VAL A CG1 
207  C CG2 . VAL A 49  ? 0.3157 0.4617 0.2636 0.0030  0.0950  0.0106  27  VAL A CG2 
208  N N   . TRP A 50  ? 0.3455 0.5020 0.2937 -0.0290 0.1209  0.0622  28  TRP A N   
209  C CA  . TRP A 50  ? 0.3647 0.5074 0.2777 -0.0361 0.1213  0.0767  28  TRP A CA  
210  C C   . TRP A 50  ? 0.3857 0.5054 0.2896 -0.0378 0.0977  0.0804  28  TRP A C   
211  O O   . TRP A 50  ? 0.3915 0.4943 0.2594 -0.0388 0.0913  0.0859  28  TRP A O   
212  C CB  . TRP A 50  ? 0.4012 0.5555 0.3299 -0.0480 0.1352  0.0945  28  TRP A CB  
213  C CG  . TRP A 50  ? 0.4844 0.6590 0.4092 -0.0477 0.1620  0.0952  28  TRP A CG  
214  C CD1 . TRP A 50  ? 0.5233 0.6935 0.4073 -0.0495 0.1763  0.1015  28  TRP A CD1 
215  C CD2 . TRP A 50  ? 0.5283 0.7293 0.4919 -0.0451 0.1777  0.0888  28  TRP A CD2 
216  N NE1 . TRP A 50  ? 0.5988 0.7845 0.4941 -0.0479 0.1987  0.0959  28  TRP A NE1 
217  C CE2 . TRP A 50  ? 0.5763 0.7843 0.5218 -0.0451 0.2008  0.0891  28  TRP A CE2 
218  C CE3 . TRP A 50  ? 0.5409 0.7548 0.5528 -0.0427 0.1718  0.0809  28  TRP A CE3 
219  C CZ2 . TRP A 50  ? 0.6378 0.8672 0.6149 -0.0429 0.2185  0.0813  28  TRP A CZ2 
220  C CZ3 . TRP A 50  ? 0.5743 0.8150 0.6183 -0.0402 0.1907  0.0767  28  TRP A CZ3 
221  C CH2 . TRP A 50  ? 0.6094 0.8558 0.6366 -0.0403 0.2128  0.0755  28  TRP A CH2 
222  N N   . SER A 51  ? 0.3419 0.4607 0.2787 -0.0382 0.0847  0.0775  29  SER A N   
223  C CA  . SER A 51  ? 0.3589 0.4580 0.2923 -0.0383 0.0637  0.0787  29  SER A CA  
224  C C   . SER A 51  ? 0.3308 0.4316 0.2928 -0.0330 0.0529  0.0664  29  SER A C   
225  O O   . SER A 51  ? 0.2903 0.4060 0.2817 -0.0330 0.0592  0.0622  29  SER A O   
226  C CB  . SER A 51  ? 0.3417 0.4322 0.2811 -0.0489 0.0590  0.0961  29  SER A CB  
227  O OG  . SER A 51  ? 0.3366 0.4087 0.2749 -0.0477 0.0397  0.0962  29  SER A OG  
228  N N   . LEU A 52  ? 0.2706 0.3561 0.2245 -0.0286 0.0367  0.0612  30  LEU A N   
229  C CA  . LEU A 52  ? 0.2390 0.3243 0.2147 -0.0236 0.0269  0.0498  30  LEU A CA  
230  C C   . LEU A 52  ? 0.2524 0.3239 0.2389 -0.0266 0.0124  0.0543  30  LEU A C   
231  O O   . LEU A 52  ? 0.2337 0.2914 0.2043 -0.0280 0.0047  0.0611  30  LEU A O   
232  C CB  . LEU A 52  ? 0.2521 0.3341 0.2120 -0.0142 0.0222  0.0363  30  LEU A CB  
233  C CG  . LEU A 52  ? 0.2379 0.3325 0.1927 -0.0079 0.0340  0.0258  30  LEU A CG  
234  C CD1 . LEU A 52  ? 0.2219 0.3334 0.2102 -0.0075 0.0415  0.0211  30  LEU A CD1 
235  C CD2 . LEU A 52  ? 0.2719 0.3691 0.1990 -0.0094 0.0474  0.0313  30  LEU A CD2 
236  N N   A GLN A 53  ? 0.2102 0.2846 0.2235 -0.0272 0.0086  0.0502  31  GLN A N   
237  N N   B GLN A 53  ? 0.2081 0.2825 0.2214 -0.0271 0.0085  0.0501  31  GLN A N   
238  C CA  A GLN A 53  ? 0.2004 0.2613 0.2234 -0.0287 -0.0040 0.0519  31  GLN A CA  
239  C CA  B GLN A 53  ? 0.1983 0.2590 0.2211 -0.0288 -0.0040 0.0520  31  GLN A CA  
240  C C   A GLN A 53  ? 0.1677 0.2226 0.1893 -0.0213 -0.0133 0.0403  31  GLN A C   
241  C C   B GLN A 53  ? 0.1677 0.2224 0.1895 -0.0214 -0.0133 0.0404  31  GLN A C   
242  O O   A GLN A 53  ? 0.1543 0.2153 0.1891 -0.0183 -0.0137 0.0314  31  GLN A O   
243  O O   B GLN A 53  ? 0.1540 0.2148 0.1895 -0.0185 -0.0139 0.0316  31  GLN A O   
244  C CB  A GLN A 53  ? 0.2022 0.2670 0.2525 -0.0344 -0.0039 0.0544  31  GLN A CB  
245  C CB  B GLN A 53  ? 0.1999 0.2647 0.2500 -0.0345 -0.0039 0.0545  31  GLN A CB  
246  C CG  A GLN A 53  ? 0.2498 0.3029 0.3044 -0.0416 -0.0088 0.0660  31  GLN A CG  
247  C CG  B GLN A 53  ? 0.1892 0.2654 0.2476 -0.0421 0.0077  0.0650  31  GLN A CG  
248  C CD  A GLN A 53  ? 0.2429 0.2779 0.2910 -0.0383 -0.0212 0.0641  31  GLN A CD  
249  C CD  B GLN A 53  ? 0.3354 0.4242 0.4242 -0.0451 0.0105  0.0625  31  GLN A CD  
250  O OE1 A GLN A 53  ? 0.2238 0.2555 0.2722 -0.0322 -0.0268 0.0538  31  GLN A OE1 
251  O OE1 B GLN A 53  ? 0.3157 0.4214 0.4129 -0.0428 0.0204  0.0580  31  GLN A OE1 
252  N NE2 A GLN A 53  ? 0.2553 0.2786 0.2986 -0.0425 -0.0251 0.0745  31  GLN A NE2 
253  N NE2 B GLN A 53  ? 0.3205 0.4006 0.4268 -0.0500 0.0011  0.0652  31  GLN A NE2 
254  N N   . THR A 54  ? 0.1704 0.2133 0.1774 -0.0186 -0.0211 0.0412  32  THR A N   
255  C CA  . THR A 54  ? 0.1567 0.1945 0.1638 -0.0124 -0.0293 0.0318  32  THR A CA  
256  C C   . THR A 54  ? 0.1454 0.1732 0.1656 -0.0131 -0.0367 0.0318  32  THR A C   
257  O O   . THR A 54  ? 0.1508 0.1718 0.1759 -0.0175 -0.0381 0.0395  32  THR A O   
258  C CB  . THR A 54  ? 0.1658 0.1977 0.1526 -0.0084 -0.0341 0.0312  32  THR A CB  
259  O OG1 . THR A 54  ? 0.1528 0.1833 0.1424 -0.0028 -0.0401 0.0216  32  THR A OG1 
260  C CG2 . THR A 54  ? 0.1740 0.1940 0.1558 -0.0106 -0.0409 0.0406  32  THR A CG2 
261  N N   . THR A 55  ? 0.1321 0.1581 0.1572 -0.0088 -0.0412 0.0230  33  THR A N   
262  C CA  . THR A 55  ? 0.1242 0.1402 0.1580 -0.0084 -0.0469 0.0213  33  THR A CA  
263  C C   . THR A 55  ? 0.1198 0.1304 0.1479 -0.0033 -0.0520 0.0178  33  THR A C   
264  O O   . THR A 55  ? 0.1146 0.1297 0.1393 0.0001  -0.0528 0.0117  33  THR A O   
265  C CB  . THR A 55  ? 0.1152 0.1332 0.1608 -0.0091 -0.0472 0.0149  33  THR A CB  
266  O OG1 . THR A 55  ? 0.1194 0.1434 0.1749 -0.0145 -0.0433 0.0189  33  THR A OG1 
267  C CG2 . THR A 55  ? 0.1452 0.1506 0.1942 -0.0084 -0.0526 0.0123  33  THR A CG2 
268  N N   . LEU A 56  ? 0.1230 0.1242 0.1522 -0.0028 -0.0557 0.0221  34  LEU A N   
269  C CA  . LEU A 56  ? 0.1255 0.1230 0.1543 0.0018  -0.0600 0.0198  34  LEU A CA  
270  C C   . LEU A 56  ? 0.1322 0.1227 0.1696 0.0034  -0.0604 0.0156  34  LEU A C   
271  O O   . LEU A 56  ? 0.1355 0.1195 0.1773 0.0013  -0.0595 0.0165  34  LEU A O   
272  C CB  . LEU A 56  ? 0.1590 0.1517 0.1847 0.0023  -0.0643 0.0275  34  LEU A CB  
273  C CG  . LEU A 56  ? 0.1460 0.1415 0.1579 0.0003  -0.0650 0.0335  34  LEU A CG  
274  C CD1 . LEU A 56  ? 0.1880 0.1922 0.1900 0.0014  -0.0624 0.0274  34  LEU A CD1 
275  C CD2 . LEU A 56  ? 0.1826 0.1763 0.1926 -0.0051 -0.0615 0.0414  34  LEU A CD2 
276  N N   . VAL A 57  ? 0.1083 0.0991 0.1466 0.0068  -0.0610 0.0110  35  VAL A N   
277  C CA  . VAL A 57  ? 0.1235 0.1075 0.1668 0.0088  -0.0598 0.0072  35  VAL A CA  
278  C C   . VAL A 57  ? 0.1241 0.1073 0.1716 0.0116  -0.0582 0.0081  35  VAL A C   
279  O O   . VAL A 57  ? 0.1150 0.1035 0.1598 0.0116  -0.0574 0.0078  35  VAL A O   
280  C CB  . VAL A 57  ? 0.1843 0.1697 0.2237 0.0084  -0.0578 0.0005  35  VAL A CB  
281  C CG1 . VAL A 57  ? 0.2284 0.2058 0.2695 0.0106  -0.0571 -0.0029 35  VAL A CG1 
282  C CG2 . VAL A 57  ? 0.2107 0.1983 0.2495 0.0052  -0.0589 -0.0009 35  VAL A CG2 
283  N N   . LYS A 58  ? 0.1207 0.0969 0.1758 0.0142  -0.0576 0.0089  36  LYS A N   
284  C CA  . LYS A 58  ? 0.1130 0.0904 0.1764 0.0172  -0.0550 0.0092  36  LYS A CA  
285  C C   . LYS A 58  ? 0.1187 0.0913 0.1848 0.0205  -0.0507 0.0042  36  LYS A C   
286  O O   . LYS A 58  ? 0.1549 0.1173 0.2186 0.0217  -0.0488 0.0013  36  LYS A O   
287  C CB  . LYS A 58  ? 0.1168 0.0903 0.1876 0.0183  -0.0560 0.0139  36  LYS A CB  
288  C CG  . LYS A 58  ? 0.1401 0.1168 0.2228 0.0213  -0.0539 0.0148  36  LYS A CG  
289  C CD  . LYS A 58  ? 0.1726 0.1438 0.2634 0.0229  -0.0552 0.0183  36  LYS A CD  
290  C CE  . LYS A 58  ? 0.2586 0.2345 0.3630 0.0253  -0.0550 0.0203  36  LYS A CE  
291  N NZ  . LYS A 58  ? 0.2872 0.2571 0.4003 0.0272  -0.0568 0.0231  36  LYS A NZ  
292  N N   . ILE A 59  ? 0.1050 0.0834 0.1739 0.0214  -0.0485 0.0030  37  ILE A N   
293  C CA  . ILE A 59  ? 0.1104 0.0844 0.1810 0.0246  -0.0423 -0.0008 37  ILE A CA  
294  C C   . ILE A 59  ? 0.1241 0.1017 0.2116 0.0288  -0.0377 0.0018  37  ILE A C   
295  O O   . ILE A 59  ? 0.1370 0.1240 0.2323 0.0270  -0.0400 0.0059  37  ILE A O   
296  C CB  . ILE A 59  ? 0.1354 0.1136 0.1992 0.0220  -0.0424 -0.0027 37  ILE A CB  
297  C CG1 . ILE A 59  ? 0.1281 0.1035 0.1776 0.0182  -0.0467 -0.0058 37  ILE A CG1 
298  C CG2 . ILE A 59  ? 0.2277 0.2019 0.2894 0.0236  -0.0333 -0.0052 37  ILE A CG2 
299  C CD1 . ILE A 59  ? 0.2165 0.1947 0.2605 0.0160  -0.0486 -0.0074 37  ILE A CD1 
300  N N   . VAL A 60  ? 0.1202 0.0898 0.2105 0.0332  -0.0301 -0.0015 38  VAL A N   
301  C CA  . VAL A 60  ? 0.1242 0.0984 0.2323 0.0378  -0.0238 0.0002  38  VAL A CA  
302  C C   . VAL A 60  ? 0.1534 0.1268 0.2610 0.0405  -0.0120 -0.0037 38  VAL A C   
303  O O   . VAL A 60  ? 0.1544 0.1163 0.2431 0.0406  -0.0063 -0.0098 38  VAL A O   
304  C CB  . VAL A 60  ? 0.1353 0.1015 0.2458 0.0410  -0.0221 -0.0009 38  VAL A CB  
305  C CG1 . VAL A 60  ? 0.1411 0.1133 0.2709 0.0458  -0.0157 0.0004  38  VAL A CG1 
306  C CG2 . VAL A 60  ? 0.1525 0.1182 0.2588 0.0365  -0.0322 0.0036  38  VAL A CG2 
307  N N   . ALA A 61  ? 0.1261 0.1113 0.2516 0.0415  -0.0083 0.0002  39  ALA A N   
308  C CA  . ALA A 61  ? 0.1614 0.1483 0.2864 0.0428  0.0052  -0.0017 39  ALA A CA  
309  C C   . ALA A 61  ? 0.1489 0.1319 0.2839 0.0505  0.0178  -0.0055 39  ALA A C   
310  O O   . ALA A 61  ? 0.1607 0.1423 0.3073 0.0542  0.0140  -0.0052 39  ALA A O   
311  C CB  . ALA A 61  ? 0.1639 0.1658 0.3079 0.0404  0.0046  0.0049  39  ALA A CB  
312  N N   . ASP A 62  ? 0.1592 0.1743 0.2369 0.0416  0.0208  -0.0530 40  ASP A N   
313  C CA  . ASP A 62  ? 0.1864 0.2044 0.2717 0.0438  0.0237  -0.0592 40  ASP A CA  
314  C C   . ASP A 62  ? 0.2126 0.2371 0.3145 0.0465  0.0209  -0.0592 40  ASP A C   
315  O O   . ASP A 62  ? 0.2150 0.2386 0.3261 0.0499  0.0189  -0.0625 40  ASP A O   
316  C CB  . ASP A 62  ? 0.2891 0.3133 0.3686 0.0409  0.0327  -0.0647 40  ASP A CB  
317  C CG  . ASP A 62  ? 0.3919 0.4089 0.4557 0.0387  0.0353  -0.0667 40  ASP A CG  
318  O OD1 . ASP A 62  ? 0.3901 0.3980 0.4507 0.0406  0.0307  -0.0660 40  ASP A OD1 
319  O OD2 . ASP A 62  ? 0.4581 0.4785 0.5122 0.0346  0.0417  -0.0689 40  ASP A OD2 
320  N N   . SER A 63  ? 0.2068 0.2375 0.3126 0.0450  0.0205  -0.0557 41  SER A N   
321  C CA  . SER A 63  ? 0.2457 0.2831 0.3668 0.0470  0.0177  -0.0555 41  SER A CA  
322  C C   . SER A 63  ? 0.2392 0.2699 0.3659 0.0495  0.0080  -0.0506 41  SER A C   
323  O O   . SER A 63  ? 0.2335 0.2677 0.3731 0.0517  0.0043  -0.0508 41  SER A O   
324  C CB  . SER A 63  ? 0.2119 0.2575 0.3345 0.0439  0.0199  -0.0530 41  SER A CB  
325  O OG  . SER A 63  ? 0.2599 0.3003 0.3736 0.0421  0.0162  -0.0468 41  SER A OG  
326  N N   . GLY A 64  ? 0.1955 0.2167 0.3124 0.0489  0.0037  -0.0462 42  GLY A N   
327  C CA  . GLY A 64  ? 0.1810 0.1954 0.3008 0.0500  -0.0053 -0.0408 42  GLY A CA  
328  C C   . GLY A 64  ? 0.1809 0.1949 0.2960 0.0474  -0.0093 -0.0337 42  GLY A C   
329  O O   . GLY A 64  ? 0.1896 0.1972 0.3027 0.0470  -0.0164 -0.0283 42  GLY A O   
330  N N   . LEU A 65  ? 0.1282 0.1491 0.2412 0.0455  -0.0047 -0.0338 43  LEU A N   
331  C CA  . LEU A 65  ? 0.1356 0.1564 0.2437 0.0431  -0.0080 -0.0278 43  LEU A CA  
332  C C   . LEU A 65  ? 0.1405 0.1534 0.2358 0.0417  -0.0097 -0.0243 43  LEU A C   
333  O O   . LEU A 65  ? 0.1443 0.1545 0.2325 0.0416  -0.0055 -0.0273 43  LEU A O   
334  C CB  . LEU A 65  ? 0.1538 0.1834 0.2626 0.0411  -0.0023 -0.0295 43  LEU A CB  
335  C CG  . LEU A 65  ? 0.2035 0.2349 0.3108 0.0390  -0.0060 -0.0243 43  LEU A CG  
336  C CD1 . LEU A 65  ? 0.2238 0.2568 0.3406 0.0397  -0.0126 -0.0213 43  LEU A CD1 
337  C CD2 . LEU A 65  ? 0.1535 0.1927 0.2607 0.0366  0.0003  -0.0266 43  LEU A CD2 
338  N N   . ALA A 66  ? 0.1089 0.1182 0.2008 0.0403  -0.0159 -0.0181 44  ALA A N   
339  C CA  . ALA A 66  ? 0.1223 0.1248 0.2031 0.0388  -0.0180 -0.0147 44  ALA A CA  
340  C C   . ALA A 66  ? 0.1154 0.1194 0.1894 0.0366  -0.0190 -0.0107 44  ALA A C   
341  O O   . ALA A 66  ? 0.1523 0.1603 0.2297 0.0357  -0.0215 -0.0083 44  ALA A O   
342  C CB  . ALA A 66  ? 0.1615 0.1570 0.2429 0.0386  -0.0248 -0.0109 44  ALA A CB  
343  N N   . GLY A 67  ? 0.1326 0.1335 0.1949 0.0347  -0.0169 -0.0099 45  GLY A N   
344  C CA  . GLY A 67  ? 0.1031 0.1044 0.1550 0.0312  -0.0175 -0.0059 45  GLY A CA  
345  C C   . GLY A 67  ? 0.1078 0.1040 0.1518 0.0294  -0.0204 -0.0024 45  GLY A C   
346  O O   . GLY A 67  ? 0.1196 0.1116 0.1630 0.0302  -0.0203 -0.0037 45  GLY A O   
347  N N   . TRP A 68  ? 0.1114 0.1084 0.1492 0.0265  -0.0229 0.0016  46  TRP A N   
348  C CA  . TRP A 68  ? 0.0974 0.0914 0.1279 0.0239  -0.0251 0.0050  46  TRP A CA  
349  C C   . TRP A 68  ? 0.0983 0.0948 0.1192 0.0217  -0.0220 0.0049  46  TRP A C   
350  O O   . TRP A 68  ? 0.1020 0.1018 0.1204 0.0212  -0.0206 0.0043  46  TRP A O   
351  C CB  . TRP A 68  ? 0.1075 0.1002 0.1386 0.0217  -0.0313 0.0102  46  TRP A CB  
352  C CG  . TRP A 68  ? 0.1018 0.0897 0.1419 0.0236  -0.0363 0.0114  46  TRP A CG  
353  C CD1 . TRP A 68  ? 0.1333 0.1219 0.1844 0.0267  -0.0390 0.0104  46  TRP A CD1 
354  C CD2 . TRP A 68  ? 0.1081 0.0896 0.1479 0.0226  -0.0400 0.0138  46  TRP A CD2 
355  N NE1 . TRP A 68  ? 0.1362 0.1195 0.1921 0.0271  -0.0426 0.0111  46  TRP A NE1 
356  C CE2 . TRP A 68  ? 0.1357 0.1136 0.1853 0.0249  -0.0442 0.0136  46  TRP A CE2 
357  C CE3 . TRP A 68  ? 0.1114 0.0903 0.1434 0.0192  -0.0396 0.0157  46  TRP A CE3 
358  C CZ2 . TRP A 68  ? 0.1504 0.1212 0.2012 0.0239  -0.0480 0.0152  46  TRP A CZ2 
359  C CZ3 . TRP A 68  ? 0.1399 0.1114 0.1741 0.0184  -0.0444 0.0182  46  TRP A CZ3 
360  C CH2 . TRP A 68  ? 0.1408 0.1076 0.1843 0.0209  -0.0490 0.0180  46  TRP A CH2 
361  N N   . GLY A 69  ? 0.0930 0.0881 0.1095 0.0204  -0.0213 0.0052  47  GLY A N   
362  C CA  . GLY A 69  ? 0.1057 0.1038 0.1150 0.0186  -0.0190 0.0049  47  GLY A CA  
363  C C   . GLY A 69  ? 0.1082 0.1067 0.1140 0.0151  -0.0209 0.0081  47  GLY A C   
364  O O   . GLY A 69  ? 0.1166 0.1114 0.1246 0.0138  -0.0243 0.0110  47  GLY A O   
365  N N   . GLU A 70  ? 0.0988 0.1019 0.0995 0.0133  -0.0188 0.0075  48  GLU A N   
366  C CA  . GLU A 70  ? 0.0898 0.0955 0.0869 0.0090  -0.0195 0.0103  48  GLU A CA  
367  C C   . GLU A 70  ? 0.0871 0.0988 0.0820 0.0088  -0.0160 0.0073  48  GLU A C   
368  O O   . GLU A 70  ? 0.1020 0.1161 0.0962 0.0113  -0.0138 0.0040  48  GLU A O   
369  C CB  . GLU A 70  ? 0.0956 0.1028 0.0887 0.0056  -0.0218 0.0138  48  GLU A CB  
370  C CG  . GLU A 70  ? 0.1230 0.1341 0.1105 -0.0003 -0.0216 0.0167  48  GLU A CG  
371  C CD  . GLU A 70  ? 0.1247 0.1351 0.1065 -0.0048 -0.0250 0.0212  48  GLU A CD  
372  O OE1 . GLU A 70  ? 0.1104 0.1192 0.0925 -0.0031 -0.0269 0.0211  48  GLU A OE1 
373  O OE2 . GLU A 70  ? 0.1334 0.1449 0.1102 -0.0107 -0.0261 0.0251  48  GLU A OE2 
374  N N   . THR A 71  ? 0.0892 0.1033 0.0839 0.0058  -0.0158 0.0085  49  THR A N   
375  C CA  . THR A 71  ? 0.0876 0.1094 0.0820 0.0051  -0.0127 0.0057  49  THR A CA  
376  C C   . THR A 71  ? 0.0977 0.1244 0.0901 -0.0009 -0.0125 0.0087  49  THR A C   
377  O O   . THR A 71  ? 0.0985 0.1212 0.0917 -0.0038 -0.0151 0.0123  49  THR A O   
378  C CB  . THR A 71  ? 0.0874 0.1079 0.0855 0.0087  -0.0121 0.0024  49  THR A CB  
379  O OG1 . THR A 71  ? 0.1221 0.1507 0.1218 0.0088  -0.0098 -0.0007 49  THR A OG1 
380  C CG2 . THR A 71  ? 0.0992 0.1147 0.0994 0.0074  -0.0145 0.0044  49  THR A CG2 
381  N N   . CYS A 72  ? 0.0962 0.1316 0.0860 -0.0032 -0.0093 0.0071  50  CYS A N   
382  C CA  . CYS A 72  ? 0.1125 0.1541 0.0993 -0.0101 -0.0082 0.0099  50  CYS A CA  
383  C C   . CYS A 72  ? 0.0998 0.1537 0.0885 -0.0107 -0.0031 0.0049  50  CYS A C   
384  O O   . CYS A 72  ? 0.1255 0.1852 0.1104 -0.0114 -0.0001 0.0023  50  CYS A O   
385  C CB  . CYS A 72  ? 0.1335 0.1730 0.1124 -0.0146 -0.0098 0.0141  50  CYS A CB  
386  S SG  . CYS A 72  ? 0.1555 0.2004 0.1279 -0.0251 -0.0093 0.0194  50  CYS A SG  
387  N N   . PRO A 73  ? 0.1293 0.1877 0.1248 -0.0102 -0.0022 0.0031  51  PRO A N   
388  C CA  . PRO A 73  ? 0.1554 0.2270 0.1553 -0.0106 0.0024  -0.0019 51  PRO A CA  
389  C C   . PRO A 73  ? 0.1388 0.2196 0.1332 -0.0183 0.0061  -0.0005 51  PRO A C   
390  O O   . PRO A 73  ? 0.1636 0.2405 0.1521 -0.0249 0.0041  0.0059  51  PRO A O   
391  C CB  . PRO A 73  ? 0.1609 0.2343 0.1686 -0.0107 0.0011  -0.0019 51  PRO A CB  
392  C CG  . PRO A 73  ? 0.1453 0.2054 0.1528 -0.0067 -0.0036 0.0001  51  PRO A CG  
393  C CD  . PRO A 73  ? 0.1489 0.2001 0.1489 -0.0082 -0.0057 0.0045  51  PRO A CD  
394  N N   . VAL A 74  ? 0.1274 0.2196 0.1230 -0.0178 0.0113  -0.0064 52  VAL A N   
395  C CA  . VAL A 74  ? 0.1446 0.2465 0.1335 -0.0254 0.0158  -0.0061 52  VAL A CA  
396  C C   . VAL A 74  ? 0.1801 0.2954 0.1755 -0.0307 0.0197  -0.0070 52  VAL A C   
397  O O   . VAL A 74  ? 0.1815 0.3111 0.1823 -0.0303 0.0255  -0.0138 52  VAL A O   
398  C CB  . VAL A 74  ? 0.1730 0.2799 0.1580 -0.0227 0.0198  -0.0126 52  VAL A CB  
399  C CG1 . VAL A 74  ? 0.1800 0.2948 0.1762 -0.0151 0.0227  -0.0218 52  VAL A CG1 
400  C CG2 . VAL A 74  ? 0.1697 0.2853 0.1445 -0.0317 0.0244  -0.0118 52  VAL A CG2 
401  N N   . GLY A 75  ? 0.1814 0.2920 0.1771 -0.0355 0.0162  -0.0004 53  GLY A N   
402  C CA  . GLY A 75  ? 0.1736 0.2952 0.1769 -0.0404 0.0186  -0.0006 53  GLY A CA  
403  C C   . GLY A 75  ? 0.1659 0.2876 0.1822 -0.0327 0.0164  -0.0047 53  GLY A C   
404  O O   . GLY A 75  ? 0.1604 0.2771 0.1795 -0.0240 0.0149  -0.0090 53  GLY A O   
405  N N   . PRO A 76  ? 0.1123 0.2390 0.1361 -0.0365 0.0156  -0.0031 54  PRO A N   
406  C CA  . PRO A 76  ? 0.1075 0.2325 0.1424 -0.0300 0.0121  -0.0061 54  PRO A CA  
407  C C   . PRO A 76  ? 0.1072 0.2474 0.1548 -0.0252 0.0158  -0.0146 54  PRO A C   
408  O O   . PRO A 76  ? 0.0972 0.2361 0.1540 -0.0196 0.0121  -0.0170 54  PRO A O   
409  C CB  . PRO A 76  ? 0.1059 0.2299 0.1428 -0.0372 0.0092  -0.0005 54  PRO A CB  
410  C CG  . PRO A 76  ? 0.1206 0.2549 0.1529 -0.0477 0.0140  0.0024  54  PRO A CG  
411  C CD  . PRO A 76  ? 0.1184 0.2483 0.1386 -0.0476 0.0160  0.0031  54  PRO A CD  
412  N N   . THR A 77  ? 0.1011 0.2549 0.1491 -0.0270 0.0226  -0.0193 55  THR A N   
413  C CA  . THR A 77  ? 0.0981 0.2676 0.1601 -0.0219 0.0264  -0.0284 55  THR A CA  
414  C C   . THR A 77  ? 0.0962 0.2645 0.1577 -0.0135 0.0280  -0.0353 55  THR A C   
415  O O   . THR A 77  ? 0.1206 0.3000 0.1944 -0.0080 0.0302  -0.0435 55  THR A O   
416  C CB  . THR A 77  ? 0.1339 0.3244 0.2017 -0.0300 0.0339  -0.0310 55  THR A CB  
417  O OG1 . THR A 77  ? 0.1517 0.3429 0.2051 -0.0370 0.0388  -0.0287 55  THR A OG1 
418  C CG2 . THR A 77  ? 0.1052 0.2988 0.1779 -0.0374 0.0317  -0.0254 55  THR A CG2 
419  N N   . TYR A 78  ? 0.0990 0.2540 0.1474 -0.0125 0.0264  -0.0324 56  TYR A N   
420  C CA  . TYR A 78  ? 0.1194 0.2725 0.1665 -0.0054 0.0276  -0.0388 56  TYR A CA  
421  C C   . TYR A 78  ? 0.1485 0.2932 0.2036 0.0044  0.0219  -0.0416 56  TYR A C   
422  O O   . TYR A 78  ? 0.1554 0.3047 0.2182 0.0111  0.0227  -0.0493 56  TYR A O   
423  C CB  . TYR A 78  ? 0.1305 0.2715 0.1615 -0.0075 0.0268  -0.0344 56  TYR A CB  
424  C CG  . TYR A 78  ? 0.1136 0.2508 0.1423 -0.0008 0.0273  -0.0404 56  TYR A CG  
425  C CD1 . TYR A 78  ? 0.1198 0.2676 0.1463 -0.0020 0.0335  -0.0469 56  TYR A CD1 
426  C CD2 . TYR A 78  ? 0.1506 0.2733 0.1787 0.0061  0.0215  -0.0395 56  TYR A CD2 
427  C CE1 . TYR A 78  ? 0.1188 0.2606 0.1426 0.0039  0.0329  -0.0523 56  TYR A CE1 
428  C CE2 . TYR A 78  ? 0.2089 0.3272 0.2347 0.0116  0.0214  -0.0446 56  TYR A CE2 
429  C CZ  . TYR A 78  ? 0.1721 0.3003 0.1961 0.0107  0.0270  -0.0512 56  TYR A CZ  
430  O OH  . TYR A 78  ? 0.1668 0.2885 0.1882 0.0157  0.0260  -0.0560 56  TYR A OH  
431  N N   . ALA A 79  ? 0.1344 0.2663 0.1873 0.0049  0.0158  -0.0354 57  ALA A N   
432  C CA  . ALA A 79  ? 0.1293 0.2502 0.1856 0.0126  0.0097  -0.0363 57  ALA A CA  
433  C C   . ALA A 79  ? 0.1356 0.2514 0.1940 0.0106  0.0051  -0.0311 57  ALA A C   
434  O O   . ALA A 79  ? 0.1104 0.2283 0.1660 0.0035  0.0061  -0.0265 57  ALA A O   
435  C CB  . ALA A 79  ? 0.0878 0.1940 0.1328 0.0152  0.0076  -0.0340 57  ALA A CB  
436  N N   . PRO A 80  ? 0.1278 0.2361 0.1905 0.0163  -0.0006 -0.0319 58  PRO A N   
437  C CA  . PRO A 80  ? 0.0953 0.1983 0.1590 0.0141  -0.0053 -0.0276 58  PRO A CA  
438  C C   . PRO A 80  ? 0.0877 0.1759 0.1390 0.0116  -0.0072 -0.0214 58  PRO A C   
439  O O   . PRO A 80  ? 0.1338 0.2098 0.1810 0.0148  -0.0116 -0.0201 58  PRO A O   
440  C CB  . PRO A 80  ? 0.1543 0.2538 0.2251 0.0209  -0.0109 -0.0308 58  PRO A CB  
441  C CG  . PRO A 80  ? 0.2284 0.3243 0.2973 0.0267  -0.0102 -0.0346 58  PRO A CG  
442  C CD  . PRO A 80  ? 0.1545 0.2612 0.2230 0.0242  -0.0031 -0.0374 58  PRO A CD  
443  N N   . SER A 81  ? 0.0883 0.1779 0.1338 0.0056  -0.0040 -0.0179 59  SER A N   
444  C CA  . SER A 81  ? 0.1000 0.1768 0.1352 0.0034  -0.0057 -0.0125 59  SER A CA  
445  C C   . SER A 81  ? 0.0988 0.1794 0.1307 -0.0045 -0.0035 -0.0082 59  SER A C   
446  O O   . SER A 81  ? 0.1271 0.2202 0.1613 -0.0082 0.0008  -0.0097 59  SER A O   
447  C CB  . SER A 81  ? 0.1537 0.2240 0.1821 0.0071  -0.0048 -0.0134 59  SER A CB  
448  O OG  . SER A 81  ? 0.2215 0.3014 0.2497 0.0059  -0.0001 -0.0160 59  SER A OG  
449  N N   . HIS A 82  ? 0.1059 0.1758 0.1323 -0.0073 -0.0067 -0.0031 60  HIS A N   
450  C CA  . HIS A 82  ? 0.1011 0.1715 0.1236 -0.0152 -0.0063 0.0022  60  HIS A CA  
451  C C   . HIS A 82  ? 0.0989 0.1540 0.1150 -0.0155 -0.0106 0.0068  60  HIS A C   
452  O O   . HIS A 82  ? 0.0997 0.1459 0.1159 -0.0105 -0.0134 0.0056  60  HIS A O   
453  C CB  . HIS A 82  ? 0.0973 0.1771 0.1264 -0.0210 -0.0060 0.0029  60  HIS A CB  
454  C CG  . HIS A 82  ? 0.0958 0.1691 0.1290 -0.0201 -0.0109 0.0034  60  HIS A CG  
455  N ND1 . HIS A 82  ? 0.1603 0.2301 0.1971 -0.0133 -0.0133 -0.0004 60  HIS A ND1 
456  C CD2 . HIS A 82  ? 0.1009 0.1709 0.1347 -0.0259 -0.0140 0.0072  60  HIS A CD2 
457  C CE1 . HIS A 82  ? 0.0934 0.1580 0.1321 -0.0149 -0.0176 0.0008  60  HIS A CE1 
458  N NE2 . HIS A 82  ? 0.1289 0.1935 0.1664 -0.0223 -0.0181 0.0052  60  HIS A NE2 
459  N N   . ALA A 83  ? 0.1189 0.1712 0.1295 -0.0215 -0.0113 0.0121  61  ALA A N   
460  C CA  . ALA A 83  ? 0.1440 0.1820 0.1501 -0.0211 -0.0158 0.0160  61  ALA A CA  
461  C C   . ALA A 83  ? 0.1249 0.1538 0.1340 -0.0198 -0.0200 0.0161  61  ALA A C   
462  O O   . ALA A 83  ? 0.1191 0.1380 0.1273 -0.0148 -0.0222 0.0150  61  ALA A O   
463  C CB  . ALA A 83  ? 0.1429 0.1790 0.1430 -0.0284 -0.0171 0.0222  61  ALA A CB  
464  N N   . LEU A 84  ? 0.1124 0.1452 0.1250 -0.0247 -0.0209 0.0172  62  LEU A N   
465  C CA  . LEU A 84  ? 0.1209 0.1449 0.1357 -0.0240 -0.0252 0.0169  62  LEU A CA  
466  C C   . LEU A 84  ? 0.1294 0.1523 0.1464 -0.0167 -0.0249 0.0114  62  LEU A C   
467  O O   . LEU A 84  ? 0.1106 0.1230 0.1262 -0.0138 -0.0279 0.0101  62  LEU A O   
468  C CB  . LEU A 84  ? 0.1290 0.1589 0.1479 -0.0311 -0.0263 0.0188  62  LEU A CB  
469  C CG  . LEU A 84  ? 0.1751 0.2045 0.1909 -0.0402 -0.0275 0.0252  62  LEU A CG  
470  C CD1 . LEU A 84  ? 0.1809 0.2173 0.2017 -0.0474 -0.0282 0.0266  62  LEU A CD1 
471  C CD2 . LEU A 84  ? 0.2208 0.2331 0.2319 -0.0401 -0.0330 0.0290  62  LEU A CD2 
472  N N   . GLY A 85  ? 0.0997 0.1329 0.1196 -0.0139 -0.0214 0.0079  63  GLY A N   
473  C CA  . GLY A 85  ? 0.1046 0.1363 0.1257 -0.0075 -0.0218 0.0035  63  GLY A CA  
474  C C   . GLY A 85  ? 0.0931 0.1158 0.1089 -0.0023 -0.0215 0.0025  63  GLY A C   
475  O O   . GLY A 85  ? 0.0928 0.1087 0.1068 0.0014  -0.0232 0.0002  63  GLY A O   
476  N N   . ALA A 86  ? 0.0923 0.1157 0.1053 -0.0025 -0.0194 0.0041  64  ALA A N   
477  C CA  . ALA A 86  ? 0.0909 0.1067 0.1000 0.0017  -0.0192 0.0035  64  ALA A CA  
478  C C   . ALA A 86  ? 0.0950 0.0995 0.1026 0.0021  -0.0222 0.0043  64  ALA A C   
479  O O   . ALA A 86  ? 0.1160 0.1146 0.1219 0.0061  -0.0222 0.0017  64  ALA A O   
480  C CB  . ALA A 86  ? 0.1309 0.1493 0.1376 0.0004  -0.0175 0.0057  64  ALA A CB  
481  N N   . ARG A 87  ? 0.1006 0.1020 0.1088 -0.0023 -0.0247 0.0077  65  ARG A N   
482  C CA  . ARG A 87  ? 0.1240 0.1141 0.1316 -0.0016 -0.0279 0.0079  65  ARG A CA  
483  C C   . ARG A 87  ? 0.1333 0.1193 0.1409 -0.0003 -0.0292 0.0044  65  ARG A C   
484  O O   . ARG A 87  ? 0.1256 0.1032 0.1317 0.0028  -0.0300 0.0017  65  ARG A O   
485  C CB  . ARG A 87  ? 0.1438 0.1303 0.1519 -0.0070 -0.0312 0.0129  65  ARG A CB  
486  C CG  . ARG A 87  ? 0.1827 0.1721 0.1890 -0.0086 -0.0305 0.0165  65  ARG A CG  
487  C CD  . ARG A 87  ? 0.3596 0.3403 0.3655 -0.0118 -0.0353 0.0214  65  ARG A CD  
488  N NE  . ARG A 87  ? 0.4361 0.4200 0.4401 -0.0199 -0.0367 0.0265  65  ARG A NE  
489  C CZ  . ARG A 87  ? 0.3906 0.3824 0.3911 -0.0244 -0.0347 0.0299  65  ARG A CZ  
490  N NH1 . ARG A 87  ? 0.2950 0.2901 0.2934 -0.0326 -0.0356 0.0345  65  ARG A NH1 
491  N NH2 . ARG A 87  ? 0.3106 0.3071 0.3091 -0.0212 -0.0317 0.0284  65  ARG A NH2 
492  N N   . ALA A 88  ? 0.1067 0.0990 0.1160 -0.0025 -0.0295 0.0039  66  ALA A N   
493  C CA  . ALA A 88  ? 0.1198 0.1083 0.1283 -0.0016 -0.0315 0.0008  66  ALA A CA  
494  C C   . ALA A 88  ? 0.1060 0.0930 0.1109 0.0036  -0.0298 -0.0029 66  ALA A C   
495  O O   . ALA A 88  ? 0.1291 0.1084 0.1301 0.0051  -0.0309 -0.0057 66  ALA A O   
496  C CB  . ALA A 88  ? 0.1264 0.1231 0.1391 -0.0052 -0.0329 0.0014  66  ALA A CB  
497  N N   . ALA A 89  ? 0.0998 0.0937 0.1054 0.0058  -0.0270 -0.0030 67  ALA A N   
498  C CA  . ALA A 89  ? 0.0980 0.0899 0.0999 0.0099  -0.0257 -0.0058 67  ALA A CA  
499  C C   . ALA A 89  ? 0.0997 0.0841 0.0977 0.0121  -0.0241 -0.0069 67  ALA A C   
500  O O   . ALA A 89  ? 0.1148 0.0940 0.1081 0.0137  -0.0239 -0.0096 67  ALA A O   
501  C CB  . ALA A 89  ? 0.0978 0.0980 0.1019 0.0117  -0.0236 -0.0059 67  ALA A CB  
502  N N   . LEU A 90  ? 0.1028 0.0870 0.1030 0.0118  -0.0231 -0.0050 68  LEU A N   
503  C CA  . LEU A 90  ? 0.1044 0.0828 0.1038 0.0141  -0.0219 -0.0063 68  LEU A CA  
504  C C   . LEU A 90  ? 0.1438 0.1139 0.1419 0.0141  -0.0235 -0.0089 68  LEU A C   
505  O O   . LEU A 90  ? 0.1467 0.1126 0.1425 0.0164  -0.0216 -0.0124 68  LEU A O   
506  C CB  . LEU A 90  ? 0.0989 0.0786 0.1018 0.0137  -0.0219 -0.0033 68  LEU A CB  
507  C CG  . LEU A 90  ? 0.1112 0.0981 0.1140 0.0141  -0.0198 -0.0018 68  LEU A CG  
508  C CD1 . LEU A 90  ? 0.1357 0.1243 0.1405 0.0119  -0.0210 0.0021  68  LEU A CD1 
509  C CD2 . LEU A 90  ? 0.1476 0.1337 0.1488 0.0175  -0.0172 -0.0043 68  LEU A CD2 
510  N N   . ALA A 91  ? 0.1258 0.0936 0.1254 0.0110  -0.0268 -0.0075 69  ALA A N   
511  C CA  . ALA A 91  ? 0.1466 0.1056 0.1446 0.0107  -0.0290 -0.0105 69  ALA A CA  
512  C C   . ALA A 91  ? 0.1674 0.1243 0.1590 0.0115  -0.0282 -0.0145 69  ALA A C   
513  O O   . ALA A 91  ? 0.1790 0.1291 0.1671 0.0127  -0.0276 -0.0188 69  ALA A O   
514  C CB  . ALA A 91  ? 0.1363 0.0931 0.1369 0.0064  -0.0333 -0.0077 69  ALA A CB  
515  N N   . GLU A 92  ? 0.1439 0.1065 0.1338 0.0105  -0.0286 -0.0133 70  GLU A N   
516  C CA  . GLU A 92  ? 0.1454 0.1056 0.1284 0.0108  -0.0291 -0.0161 70  GLU A CA  
517  C C   . GLU A 92  ? 0.1629 0.1212 0.1406 0.0134  -0.0251 -0.0186 70  GLU A C   
518  O O   . GLU A 92  ? 0.1775 0.1300 0.1480 0.0132  -0.0245 -0.0222 70  GLU A O   
519  C CB  . GLU A 92  ? 0.1652 0.1321 0.1496 0.0098  -0.0313 -0.0140 70  GLU A CB  
520  C CG  . GLU A 92  ? 0.2174 0.1808 0.1943 0.0096  -0.0336 -0.0160 70  GLU A CG  
521  C CD  . GLU A 92  ? 0.3114 0.2670 0.2831 0.0072  -0.0367 -0.0185 70  GLU A CD  
522  O OE1 . GLU A 92  ? 0.3656 0.3206 0.3419 0.0050  -0.0390 -0.0179 70  GLU A OE1 
523  O OE2 . GLU A 92  ? 0.2697 0.2194 0.2318 0.0070  -0.0371 -0.0210 70  GLU A OE2 
524  N N   . MET A 93  ? 0.1420 0.1053 0.1227 0.0153  -0.0223 -0.0169 71  MET A N   
525  C CA  . MET A 93  ? 0.1195 0.0822 0.0959 0.0170  -0.0186 -0.0186 71  MET A CA  
526  C C   . MET A 93  ? 0.1437 0.1036 0.1215 0.0185  -0.0152 -0.0217 71  MET A C   
527  O O   . MET A 93  ? 0.1492 0.1070 0.1215 0.0188  -0.0120 -0.0249 71  MET A O   
528  C CB  . MET A 93  ? 0.1207 0.0898 0.1000 0.0182  -0.0174 -0.0159 71  MET A CB  
529  C CG  . MET A 93  ? 0.1348 0.1069 0.1131 0.0177  -0.0202 -0.0142 71  MET A CG  
530  S SD  . MET A 93  ? 0.1225 0.1005 0.1036 0.0196  -0.0186 -0.0124 71  MET A SD  
531  C CE  . MET A 93  ? 0.1324 0.1164 0.1217 0.0194  -0.0176 -0.0103 71  MET A CE  
532  N N   . ALA A 94  ? 0.1306 0.0905 0.1159 0.0194  -0.0160 -0.0208 72  ALA A N   
533  C CA  . ALA A 94  ? 0.1366 0.0951 0.1263 0.0218  -0.0133 -0.0237 72  ALA A CA  
534  C C   . ALA A 94  ? 0.1610 0.1146 0.1466 0.0225  -0.0105 -0.0300 72  ALA A C   
535  O O   . ALA A 94  ? 0.1619 0.1176 0.1481 0.0240  -0.0061 -0.0330 72  ALA A O   
536  C CB  . ALA A 94  ? 0.1471 0.1044 0.1453 0.0224  -0.0163 -0.0214 72  ALA A CB  
537  N N   . PRO A 95  ? 0.1539 0.1013 0.1351 0.0210  -0.0129 -0.0324 73  PRO A N   
538  C CA  . PRO A 95  ? 0.1865 0.1294 0.1628 0.0215  -0.0098 -0.0393 73  PRO A CA  
539  C C   . PRO A 95  ? 0.1770 0.1223 0.1439 0.0201  -0.0052 -0.0411 73  PRO A C   
540  O O   . PRO A 95  ? 0.1776 0.1230 0.1429 0.0209  -0.0001 -0.0466 73  PRO A O   
541  C CB  . PRO A 95  ? 0.1931 0.1290 0.1641 0.0191  -0.0142 -0.0404 73  PRO A CB  
542  C CG  . PRO A 95  ? 0.1674 0.1038 0.1462 0.0185  -0.0193 -0.0350 73  PRO A CG  
543  C CD  . PRO A 95  ? 0.1722 0.1169 0.1537 0.0187  -0.0183 -0.0296 73  PRO A CD  
544  N N   . GLY A 96  ? 0.1717 0.1191 0.1330 0.0180  -0.0070 -0.0365 74  GLY A N   
545  C CA  . GLY A 96  ? 0.1995 0.1475 0.1507 0.0158  -0.0042 -0.0369 74  GLY A CA  
546  C C   . GLY A 96  ? 0.1917 0.1458 0.1469 0.0169  0.0002  -0.0358 74  GLY A C   
547  O O   . GLY A 96  ? 0.1976 0.1521 0.1446 0.0146  0.0028  -0.0357 74  GLY A O   
548  N N   . LEU A 97  ? 0.1471 0.1052 0.1141 0.0199  0.0004  -0.0346 75  LEU A N   
549  C CA  . LEU A 97  ? 0.1527 0.1168 0.1247 0.0209  0.0037  -0.0333 75  LEU A CA  
550  C C   . LEU A 97  ? 0.1570 0.1238 0.1365 0.0230  0.0084  -0.0384 75  LEU A C   
551  O O   . LEU A 97  ? 0.1618 0.1341 0.1452 0.0233  0.0119  -0.0385 75  LEU A O   
552  C CB  . LEU A 97  ? 0.1343 0.1019 0.1138 0.0222  0.0002  -0.0279 75  LEU A CB  
553  C CG  . LEU A 97  ? 0.1408 0.1083 0.1155 0.0208  -0.0035 -0.0236 75  LEU A CG  
554  C CD1 . LEU A 97  ? 0.1516 0.1234 0.1340 0.0220  -0.0059 -0.0196 75  LEU A CD1 
555  C CD2 . LEU A 97  ? 0.1728 0.1402 0.1395 0.0188  -0.0020 -0.0229 75  LEU A CD2 
556  N N   . ILE A 98  ? 0.1474 0.1104 0.1299 0.0247  0.0080  -0.0429 76  ILE A N   
557  C CA  . ILE A 98  ? 0.1533 0.1189 0.1444 0.0276  0.0124  -0.0490 76  ILE A CA  
558  C C   . ILE A 98  ? 0.1707 0.1399 0.1544 0.0250  0.0195  -0.0535 76  ILE A C   
559  O O   . ILE A 98  ? 0.2097 0.1749 0.1798 0.0214  0.0207  -0.0551 76  ILE A O   
560  C CB  . ILE A 98  ? 0.1865 0.1458 0.1812 0.0299  0.0103  -0.0540 76  ILE A CB  
561  C CG1 . ILE A 98  ? 0.1673 0.1225 0.1681 0.0311  0.0030  -0.0486 76  ILE A CG1 
562  C CG2 . ILE A 98  ? 0.1808 0.1438 0.1848 0.0323  0.0145  -0.0580 76  ILE A CG2 
563  C CD1 . ILE A 98  ? 0.1641 0.1240 0.1769 0.0334  0.0009  -0.0442 76  ILE A CD1 
564  N N   . GLY A 99  ? 0.1671 0.1440 0.1591 0.0261  0.0240  -0.0551 77  GLY A N   
565  C CA  . GLY A 99  ? 0.1952 0.1770 0.1811 0.0228  0.0312  -0.0584 77  GLY A CA  
566  C C   . GLY A 99  ? 0.2082 0.1928 0.1874 0.0187  0.0319  -0.0530 77  GLY A C   
567  O O   . GLY A 99  ? 0.2336 0.2232 0.2089 0.0152  0.0379  -0.0551 77  GLY A O   
568  N N   . ALA A 100 ? 0.1847 0.1663 0.1625 0.0187  0.0257  -0.0459 78  ALA A N   
569  C CA  . ALA A 100 ? 0.1945 0.1772 0.1664 0.0155  0.0250  -0.0403 78  ALA A CA  
570  C C   . ALA A 100 ? 0.2003 0.1910 0.1832 0.0162  0.0274  -0.0396 78  ALA A C   
571  O O   . ALA A 100 ? 0.1739 0.1688 0.1704 0.0203  0.0272  -0.0414 78  ALA A O   
572  C CB  . ALA A 100 ? 0.1765 0.1544 0.1457 0.0161  0.0179  -0.0343 78  ALA A CB  
573  N N   . ASN A 101 ? 0.1685 0.1607 0.1454 0.0122  0.0289  -0.0366 79  ASN A N   
574  C CA  . ASN A 101 ? 0.1803 0.1798 0.1668 0.0120  0.0305  -0.0353 79  ASN A CA  
575  C C   . ASN A 101 ? 0.1472 0.1452 0.1378 0.0142  0.0241  -0.0296 79  ASN A C   
576  O O   . ASN A 101 ? 0.1748 0.1679 0.1566 0.0122  0.0207  -0.0254 79  ASN A O   
577  C CB  . ASN A 101 ? 0.1636 0.1645 0.1407 0.0057  0.0348  -0.0345 79  ASN A CB  
578  C CG  . ASN A 101 ? 0.1697 0.1789 0.1570 0.0046  0.0371  -0.0339 79  ASN A CG  
579  O OD1 . ASN A 101 ? 0.1446 0.1572 0.1442 0.0085  0.0340  -0.0326 79  ASN A OD1 
580  N ND2 . ASN A 101 ? 0.1834 0.1960 0.1651 -0.0015 0.0425  -0.0344 79  ASN A ND2 
581  N N   . PRO A 102 ? 0.1555 0.1575 0.1594 0.0182  0.0221  -0.0297 80  PRO A N   
582  C CA  . PRO A 102 ? 0.1590 0.1596 0.1651 0.0197  0.0163  -0.0247 80  PRO A CA  
583  C C   . PRO A 102 ? 0.1637 0.1671 0.1703 0.0173  0.0160  -0.0218 80  PRO A C   
584  O O   . PRO A 102 ? 0.1826 0.1852 0.1904 0.0183  0.0117  -0.0184 80  PRO A O   
585  C CB  . PRO A 102 ? 0.1623 0.1654 0.1811 0.0239  0.0140  -0.0257 80  PRO A CB  
586  C CG  . PRO A 102 ? 0.1588 0.1681 0.1866 0.0247  0.0190  -0.0308 80  PRO A CG  
587  C CD  . PRO A 102 ? 0.1391 0.1469 0.1565 0.0215  0.0246  -0.0344 80  PRO A CD  
588  N N   . LEU A 103 ? 0.1334 0.1403 0.1388 0.0138  0.0207  -0.0234 81  LEU A N   
589  C CA  . LEU A 103 ? 0.1050 0.1146 0.1114 0.0109  0.0204  -0.0208 81  LEU A CA  
590  C C   . LEU A 103 ? 0.1537 0.1562 0.1464 0.0069  0.0190  -0.0175 81  LEU A C   
591  O O   . LEU A 103 ? 0.1435 0.1465 0.1349 0.0034  0.0189  -0.0155 81  LEU A O   
592  C CB  . LEU A 103 ? 0.1050 0.1235 0.1195 0.0086  0.0262  -0.0240 81  LEU A CB  
593  C CG  . LEU A 103 ? 0.1131 0.1393 0.1435 0.0129  0.0277  -0.0281 81  LEU A CG  
594  C CD1 . LEU A 103 ? 0.1392 0.1755 0.1775 0.0101  0.0344  -0.0321 81  LEU A CD1 
595  C CD2 . LEU A 103 ? 0.1350 0.1623 0.1751 0.0163  0.0215  -0.0250 81  LEU A CD2 
596  N N   . GLN A 104 ? 0.1396 0.1352 0.1227 0.0073  0.0172  -0.0171 82  GLN A N   
597  C CA  . GLN A 104 ? 0.1166 0.1044 0.0869 0.0040  0.0147  -0.0141 82  GLN A CA  
598  C C   . GLN A 104 ? 0.1130 0.0954 0.0809 0.0075  0.0089  -0.0123 82  GLN A C   
599  O O   . GLN A 104 ? 0.1208 0.0994 0.0833 0.0081  0.0079  -0.0130 82  GLN A O   
600  C CB  . GLN A 104 ? 0.1273 0.1122 0.0870 -0.0001 0.0183  -0.0157 82  GLN A CB  
601  C CG  . GLN A 104 ? 0.1366 0.1283 0.0983 -0.0042 0.0253  -0.0183 82  GLN A CG  
602  C CD  . GLN A 104 ? 0.1692 0.1585 0.1188 -0.0087 0.0296  -0.0205 82  GLN A CD  
603  O OE1 . GLN A 104 ? 0.2012 0.1867 0.1463 -0.0067 0.0288  -0.0224 82  GLN A OE1 
604  N NE2 . GLN A 104 ? 0.1536 0.1450 0.0975 -0.0155 0.0342  -0.0202 82  GLN A NE2 
605  N N   . PRO A 105 ? 0.1365 0.1192 0.1087 0.0095  0.0052  -0.0104 83  PRO A N   
606  C CA  . PRO A 105 ? 0.1191 0.0996 0.0917 0.0132  0.0009  -0.0098 83  PRO A CA  
607  C C   . PRO A 105 ? 0.1342 0.1075 0.0979 0.0127  -0.0025 -0.0086 83  PRO A C   
608  O O   . PRO A 105 ? 0.1366 0.1094 0.1009 0.0152  -0.0047 -0.0090 83  PRO A O   
609  C CB  . PRO A 105 ? 0.1547 0.1372 0.1322 0.0144  -0.0015 -0.0086 83  PRO A CB  
610  C CG  . PRO A 105 ? 0.2422 0.2250 0.2192 0.0108  0.0001  -0.0078 83  PRO A CG  
611  C CD  . PRO A 105 ? 0.1502 0.1362 0.1278 0.0085  0.0051  -0.0094 83  PRO A CD  
612  N N   . LEU A 106 ? 0.1242 0.0920 0.0802 0.0092  -0.0035 -0.0069 84  LEU A N   
613  C CA  . LEU A 106 ? 0.1377 0.0976 0.0854 0.0088  -0.0081 -0.0054 84  LEU A CA  
614  C C   . LEU A 106 ? 0.1436 0.1013 0.0843 0.0069  -0.0067 -0.0062 84  LEU A C   
615  O O   . LEU A 106 ? 0.1319 0.0865 0.0702 0.0085  -0.0105 -0.0061 84  LEU A O   
616  C CB  . LEU A 106 ? 0.1481 0.1010 0.0892 0.0054  -0.0110 -0.0027 84  LEU A CB  
617  C CG  . LEU A 106 ? 0.1649 0.1081 0.0975 0.0048  -0.0173 -0.0005 84  LEU A CG  
618  C CD1 . LEU A 106 ? 0.1652 0.1094 0.1039 0.0105  -0.0216 -0.0019 84  LEU A CD1 
619  C CD2 . LEU A 106 ? 0.1825 0.1173 0.1097 0.0017  -0.0213 0.0024  84  LEU A CD2 
620  N N   . VAL A 107 ? 0.1345 0.0943 0.0722 0.0033  -0.0013 -0.0075 85  VAL A N   
621  C CA  . VAL A 107 ? 0.1432 0.1016 0.0740 0.0014  0.0009  -0.0094 85  VAL A CA  
622  C C   . VAL A 107 ? 0.1464 0.1082 0.0845 0.0060  0.0007  -0.0120 85  VAL A C   
623  O O   . VAL A 107 ? 0.1623 0.1204 0.0952 0.0060  -0.0015 -0.0126 85  VAL A O   
624  C CB  . VAL A 107 ? 0.1529 0.1153 0.0814 -0.0029 0.0082  -0.0117 85  VAL A CB  
625  C CG1 . VAL A 107 ? 0.1633 0.1247 0.0849 -0.0045 0.0112  -0.0150 85  VAL A CG1 
626  C CG2 . VAL A 107 ? 0.1637 0.1219 0.0830 -0.0091 0.0082  -0.0084 85  VAL A CG2 
627  N N   . LEU A 108 ? 0.1476 0.1160 0.0974 0.0094  0.0023  -0.0131 86  LEU A N   
628  C CA  . LEU A 108 ? 0.1223 0.0934 0.0790 0.0130  0.0016  -0.0147 86  LEU A CA  
629  C C   . LEU A 108 ? 0.1507 0.1192 0.1070 0.0150  -0.0040 -0.0129 86  LEU A C   
630  O O   . LEU A 108 ? 0.1446 0.1123 0.1009 0.0159  -0.0054 -0.0139 86  LEU A O   
631  C CB  . LEU A 108 ? 0.1172 0.0949 0.0855 0.0156  0.0034  -0.0154 86  LEU A CB  
632  C CG  . LEU A 108 ? 0.1440 0.1237 0.1195 0.0185  0.0028  -0.0168 86  LEU A CG  
633  C CD1 . LEU A 108 ? 0.1678 0.1463 0.1417 0.0181  0.0060  -0.0206 86  LEU A CD1 
634  C CD2 . LEU A 108 ? 0.1680 0.1530 0.1538 0.0205  0.0030  -0.0161 86  LEU A CD2 
635  N N   A ARG A 109 ? 0.1129 0.0805 0.0695 0.0157  -0.0071 -0.0107 87  ARG A N   
636  N N   B ARG A 109 ? 0.1353 0.1030 0.0920 0.0158  -0.0072 -0.0107 87  ARG A N   
637  C CA  A ARG A 109 ? 0.1113 0.0779 0.0692 0.0179  -0.0121 -0.0098 87  ARG A CA  
638  C CA  B ARG A 109 ? 0.1561 0.1227 0.1140 0.0179  -0.0121 -0.0098 87  ARG A CA  
639  C C   A ARG A 109 ? 0.1552 0.1158 0.1050 0.0164  -0.0155 -0.0094 87  ARG A C   
640  C C   B ARG A 109 ? 0.1556 0.1161 0.1054 0.0164  -0.0156 -0.0094 87  ARG A C   
641  O O   A ARG A 109 ? 0.1555 0.1168 0.1075 0.0178  -0.0183 -0.0098 87  ARG A O   
642  O O   B ARG A 109 ? 0.1552 0.1164 0.1072 0.0178  -0.0184 -0.0098 87  ARG A O   
643  C CB  A ARG A 109 ? 0.1619 0.1283 0.1219 0.0193  -0.0147 -0.0086 87  ARG A CB  
644  C CB  B ARG A 109 ? 0.1658 0.1323 0.1260 0.0193  -0.0147 -0.0086 87  ARG A CB  
645  C CG  A ARG A 109 ? 0.1973 0.1650 0.1615 0.0223  -0.0190 -0.0089 87  ARG A CG  
646  C CG  B ARG A 109 ? 0.2070 0.1715 0.1678 0.0215  -0.0202 -0.0083 87  ARG A CG  
647  C CD  A ARG A 109 ? 0.1850 0.1529 0.1523 0.0243  -0.0211 -0.0090 87  ARG A CD  
648  C CD  B ARG A 109 ? 0.2174 0.1858 0.1852 0.0245  -0.0214 -0.0092 87  ARG A CD  
649  N NE  A ARG A 109 ? 0.1277 0.0874 0.0884 0.0228  -0.0243 -0.0075 87  ARG A NE  
650  N NE  B ARG A 109 ? 0.2364 0.2128 0.2117 0.0264  -0.0200 -0.0105 87  ARG A NE  
651  C CZ  A ARG A 109 ? 0.1863 0.1396 0.1430 0.0229  -0.0296 -0.0066 87  ARG A CZ  
652  C CZ  B ARG A 109 ? 0.1419 0.1218 0.1220 0.0286  -0.0226 -0.0117 87  ARG A CZ  
653  N NH1 A ARG A 109 ? 0.2177 0.1729 0.1769 0.0246  -0.0320 -0.0073 87  ARG A NH1 
654  N NH1 B ARG A 109 ? 0.1795 0.1554 0.1590 0.0301  -0.0273 -0.0120 87  ARG A NH1 
655  N NH2 A ARG A 109 ? 0.2077 0.1524 0.1579 0.0210  -0.0330 -0.0045 87  ARG A NH2 
656  N NH2 B ARG A 109 ? 0.0943 0.0816 0.0802 0.0290  -0.0207 -0.0125 87  ARG A NH2 
657  N N   . ARG A 110 ? 0.1548 0.1093 0.0948 0.0128  -0.0156 -0.0083 88  ARG A N   
658  C CA  . ARG A 110 ? 0.1530 0.1007 0.0831 0.0105  -0.0194 -0.0075 88  ARG A CA  
659  C C   . ARG A 110 ? 0.1568 0.1054 0.0852 0.0098  -0.0172 -0.0101 88  ARG A C   
660  O O   . ARG A 110 ? 0.1647 0.1100 0.0897 0.0095  -0.0215 -0.0100 88  ARG A O   
661  C CB  . ARG A 110 ? 0.1534 0.0940 0.0713 0.0055  -0.0195 -0.0054 88  ARG A CB  
662  C CG  . ARG A 110 ? 0.1545 0.0911 0.0725 0.0057  -0.0235 -0.0024 88  ARG A CG  
663  C CD  . ARG A 110 ? 0.1772 0.1043 0.0809 -0.0002 -0.0259 0.0008  88  ARG A CD  
664  N NE  . ARG A 110 ? 0.1827 0.1055 0.0870 -0.0005 -0.0291 0.0035  88  ARG A NE  
665  C CZ  . ARG A 110 ? 0.1894 0.1119 0.0904 -0.0047 -0.0253 0.0048  88  ARG A CZ  
666  N NH1 . ARG A 110 ? 0.2170 0.1440 0.1141 -0.0088 -0.0177 0.0032  88  ARG A NH1 
667  N NH2 . ARG A 110 ? 0.1787 0.0964 0.0806 -0.0048 -0.0291 0.0071  88  ARG A NH2 
668  N N   . ARG A 111 ? 0.1497 0.1025 0.0810 0.0096  -0.0110 -0.0127 89  ARG A N   
669  C CA  . ARG A 111 ? 0.1405 0.0935 0.0711 0.0094  -0.0089 -0.0160 89  ARG A CA  
670  C C   . ARG A 111 ? 0.1652 0.1208 0.1044 0.0126  -0.0125 -0.0159 89  ARG A C   
671  O O   . ARG A 111 ? 0.1652 0.1179 0.1013 0.0119  -0.0150 -0.0169 89  ARG A O   
672  C CB  . ARG A 111 ? 0.1492 0.1066 0.0841 0.0095  -0.0020 -0.0193 89  ARG A CB  
673  C CG  . ARG A 111 ? 0.1597 0.1160 0.0931 0.0093  0.0002  -0.0237 89  ARG A CG  
674  C CD  . ARG A 111 ? 0.2729 0.2331 0.2088 0.0089  0.0074  -0.0280 89  ARG A CD  
675  N NE  . ARG A 111 ? 0.2945 0.2540 0.2326 0.0102  0.0094  -0.0331 89  ARG A NE  
676  C CZ  . ARG A 111 ? 0.3457 0.3070 0.2826 0.0093  0.0155  -0.0386 89  ARG A CZ  
677  N NH1 . ARG A 111 ? 0.2865 0.2462 0.2262 0.0112  0.0166  -0.0439 89  ARG A NH1 
678  N NH2 . ARG A 111 ? 0.3215 0.2862 0.2548 0.0063  0.0206  -0.0392 89  ARG A NH2 
679  N N   . MET A 112 ? 0.1450 0.1060 0.0942 0.0155  -0.0128 -0.0146 90  MET A N   
680  C CA  . MET A 112 ? 0.1474 0.1119 0.1044 0.0176  -0.0157 -0.0141 90  MET A CA  
681  C C   . MET A 112 ? 0.1561 0.1185 0.1109 0.0175  -0.0214 -0.0128 90  MET A C   
682  O O   . MET A 112 ? 0.1358 0.0989 0.0929 0.0174  -0.0240 -0.0133 90  MET A O   
683  C CB  . MET A 112 ? 0.1232 0.0940 0.0894 0.0199  -0.0146 -0.0129 90  MET A CB  
684  C CG  . MET A 112 ? 0.1226 0.0960 0.0936 0.0204  -0.0107 -0.0139 90  MET A CG  
685  S SD  . MET A 112 ? 0.1239 0.1040 0.1041 0.0221  -0.0107 -0.0120 90  MET A SD  
686  C CE  . MET A 112 ? 0.1370 0.1176 0.1154 0.0224  -0.0098 -0.0112 90  MET A CE  
687  N N   . ASP A 113 ? 0.1310 0.0905 0.0818 0.0174  -0.0240 -0.0112 91  ASP A N   
688  C CA  . ASP A 113 ? 0.1496 0.1068 0.0996 0.0179  -0.0306 -0.0101 91  ASP A CA  
689  C C   . ASP A 113 ? 0.1589 0.1101 0.1001 0.0150  -0.0333 -0.0104 91  ASP A C   
690  O O   . ASP A 113 ? 0.2057 0.1565 0.1485 0.0153  -0.0388 -0.0100 91  ASP A O   
691  C CB  . ASP A 113 ? 0.1507 0.1034 0.0970 0.0181  -0.0336 -0.0081 91  ASP A CB  
692  C CG  . ASP A 113 ? 0.2082 0.1662 0.1634 0.0214  -0.0325 -0.0083 91  ASP A CG  
693  O OD1 . ASP A 113 ? 0.1849 0.1508 0.1494 0.0235  -0.0303 -0.0096 91  ASP A OD1 
694  O OD2 . ASP A 113 ? 0.2159 0.1696 0.1681 0.0214  -0.0342 -0.0070 91  ASP A OD2 
695  N N   . GLY A 114 ? 0.1442 0.0912 0.0761 0.0120  -0.0293 -0.0117 92  GLY A N   
696  C CA  . GLY A 114 ? 0.1693 0.1101 0.0906 0.0086  -0.0311 -0.0128 92  GLY A CA  
697  C C   . GLY A 114 ? 0.1941 0.1372 0.1202 0.0091  -0.0306 -0.0154 92  GLY A C   
698  O O   . GLY A 114 ? 0.2214 0.1594 0.1396 0.0065  -0.0330 -0.0168 92  GLY A O   
699  N N   . LEU A 115 ? 0.1635 0.1134 0.1015 0.0119  -0.0280 -0.0159 93  LEU A N   
700  C CA  . LEU A 115 ? 0.1395 0.0910 0.0828 0.0120  -0.0278 -0.0177 93  LEU A CA  
701  C C   . LEU A 115 ? 0.1524 0.1096 0.1059 0.0133  -0.0319 -0.0159 93  LEU A C   
702  O O   . LEU A 115 ? 0.1575 0.1146 0.1135 0.0120  -0.0341 -0.0166 93  LEU A O   
703  C CB  . LEU A 115 ? 0.1462 0.1003 0.0947 0.0134  -0.0219 -0.0195 93  LEU A CB  
704  C CG  . LEU A 115 ? 0.1457 0.0965 0.0873 0.0124  -0.0166 -0.0224 93  LEU A CG  
705  C CD1 . LEU A 115 ? 0.1698 0.1250 0.1202 0.0147  -0.0119 -0.0236 93  LEU A CD1 
706  C CD2 . LEU A 115 ? 0.1859 0.1306 0.1190 0.0100  -0.0168 -0.0262 93  LEU A CD2 
707  N N   . LEU A 116 ? 0.1315 0.0940 0.0912 0.0154  -0.0326 -0.0139 94  LEU A N   
708  C CA  . LEU A 116 ? 0.1192 0.0895 0.0897 0.0166  -0.0351 -0.0129 94  LEU A CA  
709  C C   . LEU A 116 ? 0.1264 0.1001 0.1007 0.0191  -0.0372 -0.0119 94  LEU A C   
710  O O   . LEU A 116 ? 0.1205 0.0942 0.0939 0.0206  -0.0343 -0.0116 94  LEU A O   
711  C CB  . LEU A 116 ? 0.1119 0.0878 0.0899 0.0169  -0.0311 -0.0127 94  LEU A CB  
712  C CG  . LEU A 116 ? 0.1263 0.1116 0.1149 0.0169  -0.0321 -0.0117 94  LEU A CG  
713  C CD1 . LEU A 116 ? 0.1617 0.1478 0.1528 0.0146  -0.0366 -0.0118 94  LEU A CD1 
714  C CD2 . LEU A 116 ? 0.1160 0.1050 0.1088 0.0163  -0.0282 -0.0107 94  LEU A CD2 
715  N N   . CYS A 117 ? 0.1242 0.1008 0.1036 0.0198  -0.0425 -0.0118 95  CYS A N   
716  C CA  . CYS A 117 ? 0.1349 0.1151 0.1202 0.0230  -0.0452 -0.0118 95  CYS A CA  
717  C C   . CYS A 117 ? 0.1235 0.1148 0.1202 0.0248  -0.0414 -0.0128 95  CYS A C   
718  O O   . CYS A 117 ? 0.1150 0.1129 0.1177 0.0232  -0.0400 -0.0130 95  CYS A O   
719  C CB  . CYS A 117 ? 0.1221 0.1018 0.1101 0.0234  -0.0529 -0.0117 95  CYS A CB  
720  S SG  . CYS A 117 ? 0.1805 0.1655 0.1796 0.0283  -0.0575 -0.0127 95  CYS A SG  
721  N N   . GLY A 118 ? 0.1199 0.1128 0.1186 0.0276  -0.0399 -0.0135 96  GLY A N   
722  C CA  . GLY A 118 ? 0.1181 0.1215 0.1263 0.0292  -0.0364 -0.0151 96  GLY A CA  
723  C C   . GLY A 118 ? 0.0962 0.1017 0.1025 0.0269  -0.0306 -0.0141 96  GLY A C   
724  O O   . GLY A 118 ? 0.1201 0.1187 0.1188 0.0257  -0.0287 -0.0128 96  GLY A O   
725  N N   . HIS A 119 ? 0.0867 0.1021 0.1004 0.0258  -0.0280 -0.0147 97  HIS A N   
726  C CA  . HIS A 119 ? 0.0861 0.1031 0.0982 0.0231  -0.0238 -0.0130 97  HIS A CA  
727  C C   . HIS A 119 ? 0.1012 0.1146 0.1085 0.0242  -0.0209 -0.0126 97  HIS A C   
728  O O   . HIS A 119 ? 0.0907 0.0998 0.0938 0.0226  -0.0192 -0.0109 97  HIS A O   
729  C CB  . HIS A 119 ? 0.1058 0.1171 0.1142 0.0200  -0.0248 -0.0111 97  HIS A CB  
730  C CG  . HIS A 119 ? 0.0883 0.1033 0.1015 0.0180  -0.0278 -0.0112 97  HIS A CG  
731  N ND1 . HIS A 119 ? 0.0940 0.1065 0.1074 0.0190  -0.0324 -0.0122 97  HIS A ND1 
732  C CD2 . HIS A 119 ? 0.0877 0.1088 0.1059 0.0144  -0.0273 -0.0100 97  HIS A CD2 
733  C CE1 . HIS A 119 ? 0.0939 0.1113 0.1129 0.0165  -0.0346 -0.0120 97  HIS A CE1 
734  N NE2 . HIS A 119 ? 0.1091 0.1319 0.1312 0.0134  -0.0313 -0.0107 97  HIS A NE2 
735  N N   . ASN A 120 ? 0.0951 0.1103 0.1038 0.0271  -0.0208 -0.0146 98  ASN A N   
736  C CA  . ASN A 120 ? 0.0808 0.0931 0.0854 0.0279  -0.0186 -0.0145 98  ASN A CA  
737  C C   . ASN A 120 ? 0.0781 0.0939 0.0823 0.0253  -0.0152 -0.0128 98  ASN A C   
738  O O   . ASN A 120 ? 0.0879 0.0992 0.0881 0.0249  -0.0140 -0.0115 98  ASN A O   
739  C CB  . ASN A 120 ? 0.1054 0.1202 0.1130 0.0311  -0.0191 -0.0175 98  ASN A CB  
740  C CG  . ASN A 120 ? 0.1533 0.1596 0.1577 0.0334  -0.0231 -0.0178 98  ASN A CG  
741  O OD1 . ASN A 120 ? 0.1518 0.1503 0.1499 0.0320  -0.0243 -0.0155 98  ASN A OD1 
742  N ND2 . ASN A 120 ? 0.1251 0.1324 0.1335 0.0368  -0.0252 -0.0207 98  ASN A ND2 
743  N N   . TYR A 121 ? 0.0769 0.1009 0.0853 0.0232  -0.0138 -0.0128 99  TYR A N   
744  C CA  . TYR A 121 ? 0.0764 0.1032 0.0833 0.0200  -0.0114 -0.0106 99  TYR A CA  
745  C C   . TYR A 121 ? 0.1001 0.1200 0.1040 0.0181  -0.0123 -0.0072 99  TYR A C   
746  O O   . TYR A 121 ? 0.1165 0.1351 0.1182 0.0167  -0.0116 -0.0052 99  TYR A O   
747  C CB  . TYR A 121 ? 0.0899 0.1271 0.1007 0.0170  -0.0096 -0.0109 99  TYR A CB  
748  C CG  . TYR A 121 ? 0.1228 0.1619 0.1369 0.0139  -0.0109 -0.0092 99  TYR A CG  
749  C CD1 . TYR A 121 ? 0.1099 0.1505 0.1289 0.0156  -0.0131 -0.0112 99  TYR A CD1 
750  C CD2 . TYR A 121 ? 0.1630 0.2024 0.1755 0.0089  -0.0106 -0.0054 99  TYR A CD2 
751  C CE1 . TYR A 121 ? 0.1966 0.2391 0.2187 0.0123  -0.0146 -0.0097 99  TYR A CE1 
752  C CE2 . TYR A 121 ? 0.1772 0.2179 0.1926 0.0055  -0.0121 -0.0037 99  TYR A CE2 
753  C CZ  . TYR A 121 ? 0.1840 0.2266 0.2043 0.0072  -0.0139 -0.0060 99  TYR A CZ  
754  O OH  . TYR A 121 ? 0.1241 0.1680 0.1475 0.0033  -0.0158 -0.0044 99  TYR A OH  
755  N N   . ALA A 122 ? 0.0904 0.1054 0.0942 0.0183  -0.0143 -0.0071 100 ALA A N   
756  C CA  . ALA A 122 ? 0.1119 0.1198 0.1136 0.0173  -0.0150 -0.0053 100 ALA A CA  
757  C C   . ALA A 122 ? 0.0808 0.0825 0.0791 0.0198  -0.0144 -0.0064 100 ALA A C   
758  O O   . ALA A 122 ? 0.1061 0.1048 0.1041 0.0198  -0.0138 -0.0054 100 ALA A O   
759  C CB  . ALA A 122 ? 0.1257 0.1311 0.1281 0.0159  -0.0172 -0.0052 100 ALA A CB  
760  N N   . LYS A 123 ? 0.0837 0.0836 0.0798 0.0217  -0.0150 -0.0083 101 LYS A N   
761  C CA  . LYS A 123 ? 0.0829 0.0776 0.0750 0.0231  -0.0141 -0.0090 101 LYS A CA  
762  C C   . LYS A 123 ? 0.0943 0.0908 0.0872 0.0235  -0.0123 -0.0084 101 LYS A C   
763  O O   . LYS A 123 ? 0.0946 0.0881 0.0863 0.0236  -0.0110 -0.0084 101 LYS A O   
764  C CB  . LYS A 123 ? 0.0857 0.0778 0.0746 0.0243  -0.0159 -0.0103 101 LYS A CB  
765  C CG  . LYS A 123 ? 0.0901 0.0786 0.0766 0.0236  -0.0184 -0.0107 101 LYS A CG  
766  C CD  . LYS A 123 ? 0.1082 0.0938 0.0918 0.0247  -0.0217 -0.0112 101 LYS A CD  
767  C CE  . LYS A 123 ? 0.0995 0.0815 0.0803 0.0235  -0.0250 -0.0114 101 LYS A CE  
768  N NZ  . LYS A 123 ? 0.1387 0.1181 0.1181 0.0247  -0.0299 -0.0114 101 LYS A NZ  
769  N N   . ALA A 124 ? 0.0972 0.0992 0.0922 0.0235  -0.0122 -0.0083 102 ALA A N   
770  C CA  . ALA A 124 ? 0.0826 0.0861 0.0774 0.0235  -0.0112 -0.0079 102 ALA A CA  
771  C C   . ALA A 124 ? 0.1025 0.1051 0.0986 0.0221  -0.0109 -0.0057 102 ALA A C   
772  O O   . ALA A 124 ? 0.0850 0.0866 0.0811 0.0224  -0.0105 -0.0054 102 ALA A O   
773  C CB  . ALA A 124 ? 0.0851 0.0949 0.0809 0.0233  -0.0108 -0.0089 102 ALA A CB  
774  N N   . ALA A 125 ? 0.0996 0.1023 0.0974 0.0206  -0.0117 -0.0041 103 ALA A N   
775  C CA  . ALA A 125 ? 0.1072 0.1080 0.1073 0.0197  -0.0127 -0.0019 103 ALA A CA  
776  C C   . ALA A 125 ? 0.1142 0.1106 0.1159 0.0216  -0.0120 -0.0034 103 ALA A C   
777  O O   . ALA A 125 ? 0.1175 0.1135 0.1224 0.0220  -0.0124 -0.0027 103 ALA A O   
778  C CB  . ALA A 125 ? 0.1010 0.1013 0.1023 0.0174  -0.0145 0.0002  103 ALA A CB  
779  N N   . ILE A 126 ? 0.0870 0.0806 0.0866 0.0225  -0.0109 -0.0057 104 ILE A N   
780  C CA  . ILE A 126 ? 0.1098 0.1002 0.1096 0.0236  -0.0091 -0.0079 104 ILE A CA  
781  C C   . ILE A 126 ? 0.0935 0.0853 0.0923 0.0239  -0.0074 -0.0083 104 ILE A C   
782  O O   . ILE A 126 ? 0.1063 0.0988 0.1087 0.0243  -0.0060 -0.0090 104 ILE A O   
783  C CB  . ILE A 126 ? 0.0949 0.0815 0.0903 0.0235  -0.0085 -0.0101 104 ILE A CB  
784  C CG1 . ILE A 126 ? 0.1304 0.1146 0.1274 0.0229  -0.0104 -0.0100 104 ILE A CG1 
785  C CG2 . ILE A 126 ? 0.1188 0.1032 0.1124 0.0238  -0.0055 -0.0128 104 ILE A CG2 
786  C CD1 . ILE A 126 ? 0.1619 0.1437 0.1641 0.0239  -0.0105 -0.0109 104 ILE A CD1 
787  N N   . ASP A 127 ? 0.0804 0.0729 0.0752 0.0236  -0.0077 -0.0082 105 ASP A N   
788  C CA  . ASP A 127 ? 0.0804 0.0731 0.0736 0.0234  -0.0070 -0.0083 105 ASP A CA  
789  C C   . ASP A 127 ? 0.1106 0.1065 0.1084 0.0232  -0.0073 -0.0071 105 ASP A C   
790  O O   . ASP A 127 ? 0.0797 0.0761 0.0795 0.0228  -0.0061 -0.0075 105 ASP A O   
791  C CB  . ASP A 127 ? 0.0933 0.0856 0.0829 0.0238  -0.0086 -0.0086 105 ASP A CB  
792  C CG  . ASP A 127 ? 0.1365 0.1283 0.1248 0.0236  -0.0089 -0.0087 105 ASP A CG  
793  O OD1 . ASP A 127 ? 0.1179 0.1127 0.1086 0.0234  -0.0091 -0.0081 105 ASP A OD1 
794  O OD2 . ASP A 127 ? 0.1331 0.1206 0.1172 0.0233  -0.0095 -0.0091 105 ASP A OD2 
795  N N   . ILE A 128 ? 0.0801 0.0785 0.0795 0.0230  -0.0091 -0.0055 106 ILE A N   
796  C CA  . ILE A 128 ? 0.0767 0.0775 0.0789 0.0223  -0.0105 -0.0039 106 ILE A CA  
797  C C   . ILE A 128 ? 0.0838 0.0845 0.0926 0.0229  -0.0108 -0.0034 106 ILE A C   
798  O O   . ILE A 128 ? 0.0831 0.0856 0.0956 0.0227  -0.0112 -0.0032 106 ILE A O   
799  C CB  . ILE A 128 ? 0.0846 0.0879 0.0851 0.0209  -0.0123 -0.0020 106 ILE A CB  
800  C CG1 . ILE A 128 ? 0.1120 0.1173 0.1081 0.0209  -0.0115 -0.0037 106 ILE A CG1 
801  C CG2 . ILE A 128 ? 0.1126 0.1172 0.1152 0.0195  -0.0148 0.0005  106 ILE A CG2 
802  C CD1 . ILE A 128 ? 0.1069 0.1161 0.1010 0.0192  -0.0118 -0.0030 106 ILE A CD1 
803  N N   . ALA A 129 ? 0.0864 0.0850 0.0974 0.0236  -0.0109 -0.0037 107 ALA A N   
804  C CA  . ALA A 129 ? 0.0880 0.0861 0.1066 0.0250  -0.0113 -0.0044 107 ALA A CA  
805  C C   . ALA A 129 ? 0.1076 0.1073 0.1289 0.0258  -0.0078 -0.0075 107 ALA A C   
806  O O   . ALA A 129 ? 0.1107 0.1131 0.1399 0.0267  -0.0080 -0.0081 107 ALA A O   
807  C CB  . ALA A 129 ? 0.0870 0.0814 0.1067 0.0258  -0.0121 -0.0050 107 ALA A CB  
808  N N   . ALA A 130 ? 0.0796 0.0780 0.0944 0.0251  -0.0048 -0.0093 108 ALA A N   
809  C CA  . ALA A 130 ? 0.1220 0.1218 0.1372 0.0244  -0.0010 -0.0117 108 ALA A CA  
810  C C   . ALA A 130 ? 0.1032 0.1063 0.1203 0.0230  -0.0013 -0.0105 108 ALA A C   
811  O O   . ALA A 130 ? 0.1199 0.1269 0.1434 0.0227  0.0007  -0.0120 108 ALA A O   
812  C CB  . ALA A 130 ? 0.1480 0.1441 0.1540 0.0230  0.0012  -0.0130 108 ALA A CB  
813  N N   . TYR A 131 ? 0.0784 0.0805 0.0908 0.0221  -0.0037 -0.0084 109 TYR A N   
814  C CA  . TYR A 131 ? 0.0780 0.0823 0.0920 0.0207  -0.0048 -0.0073 109 TYR A CA  
815  C C   . TYR A 131 ? 0.0766 0.0851 0.1000 0.0214  -0.0071 -0.0063 109 TYR A C   
816  O O   . TYR A 131 ? 0.0768 0.0887 0.1054 0.0203  -0.0070 -0.0065 109 TYR A O   
817  C CB  . TYR A 131 ? 0.0896 0.0918 0.0969 0.0201  -0.0073 -0.0061 109 TYR A CB  
818  C CG  . TYR A 131 ? 0.1090 0.1072 0.1092 0.0191  -0.0062 -0.0070 109 TYR A CG  
819  C CD1 . TYR A 131 ? 0.1141 0.1115 0.1135 0.0169  -0.0060 -0.0069 109 TYR A CD1 
820  C CD2 . TYR A 131 ? 0.1184 0.1132 0.1132 0.0201  -0.0063 -0.0075 109 TYR A CD2 
821  C CE1 . TYR A 131 ? 0.1503 0.1424 0.1429 0.0156  -0.0061 -0.0071 109 TYR A CE1 
822  C CE2 . TYR A 131 ? 0.1181 0.1081 0.1069 0.0193  -0.0067 -0.0079 109 TYR A CE2 
823  C CZ  . TYR A 131 ? 0.1483 0.1364 0.1356 0.0170  -0.0068 -0.0075 109 TYR A CZ  
824  O OH  . TYR A 131 ? 0.1615 0.1433 0.1423 0.0159  -0.0082 -0.0072 109 TYR A OH  
825  N N   . ASP A 132 ? 0.0891 0.0969 0.1146 0.0228  -0.0099 -0.0049 110 ASP A N   
826  C CA  . ASP A 132 ? 0.0906 0.1009 0.1249 0.0235  -0.0136 -0.0033 110 ASP A CA  
827  C C   . ASP A 132 ? 0.0800 0.0939 0.1251 0.0252  -0.0113 -0.0062 110 ASP A C   
828  O O   . ASP A 132 ? 0.1109 0.1292 0.1643 0.0251  -0.0125 -0.0062 110 ASP A O   
829  C CB  . ASP A 132 ? 0.0878 0.0951 0.1213 0.0242  -0.0171 -0.0009 110 ASP A CB  
830  C CG  . ASP A 132 ? 0.0807 0.0887 0.1213 0.0243  -0.0227 0.0020  110 ASP A CG  
831  O OD1 . ASP A 132 ? 0.0927 0.1035 0.1357 0.0232  -0.0249 0.0031  110 ASP A OD1 
832  O OD2 . ASP A 132 ? 0.1137 0.1186 0.1571 0.0253  -0.0257 0.0035  110 ASP A OD2 
833  N N   A LEU A 133 ? 0.0776 0.0900 0.1226 0.0266  -0.0077 -0.0091 111 LEU A N   
834  N N   B LEU A 133 ? 0.0776 0.0900 0.1226 0.0266  -0.0078 -0.0091 111 LEU A N   
835  C CA  A LEU A 133 ? 0.0904 0.1068 0.1450 0.0282  -0.0042 -0.0132 111 LEU A CA  
836  C CA  B LEU A 133 ? 0.0882 0.1044 0.1428 0.0283  -0.0043 -0.0132 111 LEU A CA  
837  C C   A LEU A 133 ? 0.1152 0.1370 0.1713 0.0258  -0.0002 -0.0148 111 LEU A C   
838  C C   B LEU A 133 ? 0.1151 0.1368 0.1713 0.0259  -0.0003 -0.0148 111 LEU A C   
839  O O   A LEU A 133 ? 0.1086 0.1370 0.1765 0.0265  0.0007  -0.0168 111 LEU A O   
840  O O   B LEU A 133 ? 0.1094 0.1377 0.1776 0.0267  0.0006  -0.0168 111 LEU A O   
841  C CB  A LEU A 133 ? 0.1300 0.1428 0.1807 0.0294  -0.0008 -0.0164 111 LEU A CB  
842  C CB  B LEU A 133 ? 0.1381 0.1507 0.1885 0.0294  -0.0008 -0.0164 111 LEU A CB  
843  C CG  A LEU A 133 ? 0.1521 0.1677 0.2123 0.0320  0.0026  -0.0218 111 LEU A CG  
844  C CG  B LEU A 133 ? 0.1601 0.1757 0.2191 0.0316  0.0032  -0.0219 111 LEU A CG  
845  C CD1 A LEU A 133 ? 0.1553 0.1648 0.2103 0.0333  0.0032  -0.0239 111 LEU A CD1 
846  C CD1 B LEU A 133 ? 0.1520 0.1704 0.2261 0.0351  -0.0007 -0.0225 111 LEU A CD1 
847  C CD2 A LEU A 133 ? 0.0965 0.1178 0.1567 0.0298  0.0091  -0.0253 111 LEU A CD2 
848  C CD2 B LEU A 133 ? 0.1748 0.1844 0.2271 0.0325  0.0045  -0.0241 111 LEU A CD2 
849  N N   A MET A 134 ? 0.0952 0.1143 0.1399 0.0228  0.0019  -0.0140 112 MET A N   
850  N N   B MET A 134 ? 0.0934 0.1125 0.1383 0.0229  0.0018  -0.0139 112 MET A N   
851  C CA  A MET A 134 ? 0.1063 0.1287 0.1501 0.0193  0.0051  -0.0145 112 MET A CA  
852  C CA  B MET A 134 ? 0.1039 0.1264 0.1480 0.0195  0.0051  -0.0146 112 MET A CA  
853  C C   A MET A 134 ? 0.1042 0.1314 0.1562 0.0185  0.0018  -0.0128 112 MET A C   
854  C C   B MET A 134 ? 0.1049 0.1320 0.1566 0.0184  0.0018  -0.0127 112 MET A C   
855  O O   A MET A 134 ? 0.0963 0.1305 0.1573 0.0172  0.0042  -0.0145 112 MET A O   
856  O O   B MET A 134 ? 0.0956 0.1294 0.1554 0.0168  0.0044  -0.0144 112 MET A O   
857  C CB  A MET A 134 ? 0.1264 0.1427 0.1564 0.0165  0.0051  -0.0126 112 MET A CB  
858  C CB  B MET A 134 ? 0.1316 0.1480 0.1616 0.0167  0.0057  -0.0131 112 MET A CB  
859  C CG  A MET A 134 ? 0.1598 0.1713 0.1805 0.0162  0.0080  -0.0140 112 MET A CG  
860  C CG  B MET A 134 ? 0.1040 0.1216 0.1312 0.0123  0.0080  -0.0127 112 MET A CG  
861  S SD  A MET A 134 ? 0.2673 0.2712 0.2742 0.0136  0.0059  -0.0113 112 MET A SD  
862  S SD  B MET A 134 ? 0.3426 0.3516 0.3538 0.0094  0.0092  -0.0118 112 MET A SD  
863  C CE  A MET A 134 ? 0.3180 0.3244 0.3256 0.0087  0.0079  -0.0107 112 MET A CE  
864  C CE  B MET A 134 ? 0.1860 0.1889 0.1917 0.0130  0.0041  -0.0101 112 MET A CE  
865  N N   . GLY A 135 ? 0.0965 0.1205 0.1454 0.0190  -0.0037 -0.0095 113 GLY A N   
866  C CA  . GLY A 135 ? 0.0917 0.1190 0.1462 0.0178  -0.0078 -0.0076 113 GLY A CA  
867  C C   . GLY A 135 ? 0.0838 0.1178 0.1540 0.0200  -0.0095 -0.0086 113 GLY A C   
868  O O   . GLY A 135 ? 0.0837 0.1239 0.1628 0.0185  -0.0102 -0.0088 113 GLY A O   
869  N N   . LYS A 136 ? 0.0877 0.1204 0.1625 0.0236  -0.0107 -0.0092 114 LYS A N   
870  C CA  . LYS A 136 ? 0.0767 0.1148 0.1679 0.0266  -0.0131 -0.0106 114 LYS A CA  
871  C C   . LYS A 136 ? 0.0954 0.1419 0.1971 0.0268  -0.0067 -0.0157 114 LYS A C   
872  O O   . LYS A 136 ? 0.1296 0.1841 0.2462 0.0276  -0.0080 -0.0170 114 LYS A O   
873  C CB  . LYS A 136 ? 0.1077 0.1408 0.2008 0.0304  -0.0160 -0.0105 114 LYS A CB  
874  C CG  . LYS A 136 ? 0.1229 0.1492 0.2076 0.0297  -0.0226 -0.0052 114 LYS A CG  
875  C CD  . LYS A 136 ? 0.2087 0.2302 0.2978 0.0329  -0.0259 -0.0049 114 LYS A CD  
876  C CE  . LYS A 136 ? 0.2687 0.2834 0.3477 0.0311  -0.0314 0.0005  114 LYS A CE  
877  N NZ  . LYS A 136 ? 0.2514 0.2602 0.3313 0.0322  -0.0335 0.0010  114 LYS A NZ  
878  N N   . HIS A 137 ? 0.0873 0.1326 0.1813 0.0257  0.0002  -0.0187 115 HIS A N   
879  C CA  . HIS A 137 ? 0.0796 0.1330 0.1811 0.0248  0.0075  -0.0239 115 HIS A CA  
880  C C   . HIS A 137 ? 0.0929 0.1532 0.1973 0.0201  0.0093  -0.0232 115 HIS A C   
881  O O   . HIS A 137 ? 0.1266 0.1976 0.2458 0.0201  0.0122  -0.0267 115 HIS A O   
882  C CB  . HIS A 137 ? 0.1239 0.1729 0.2128 0.0235  0.0137  -0.0264 115 HIS A CB  
883  C CG  . HIS A 137 ? 0.1588 0.2158 0.2522 0.0216  0.0221  -0.0319 115 HIS A CG  
884  N ND1 . HIS A 137 ? 0.2091 0.2744 0.3188 0.0252  0.0249  -0.0378 115 HIS A ND1 
885  C CD2 . HIS A 137 ? 0.1971 0.2550 0.2806 0.0162  0.0283  -0.0327 115 HIS A CD2 
886  C CE1 . HIS A 137 ? 0.2231 0.2954 0.3325 0.0219  0.0335  -0.0425 115 HIS A CE1 
887  N NE2 . HIS A 137 ? 0.1985 0.2661 0.2914 0.0159  0.0355  -0.0390 115 HIS A NE2 
888  N N   . TYR A 138 ? 0.0830 0.1377 0.1744 0.0161  0.0076  -0.0191 116 TYR A N   
889  C CA  . TYR A 138 ? 0.0910 0.1503 0.1833 0.0109  0.0087  -0.0180 116 TYR A CA  
890  C C   . TYR A 138 ? 0.1166 0.1792 0.2182 0.0109  0.0018  -0.0154 116 TYR A C   
891  O O   . TYR A 138 ? 0.1652 0.2338 0.2722 0.0068  0.0021  -0.0151 116 TYR A O   
892  C CB  . TYR A 138 ? 0.1524 0.2030 0.2268 0.0065  0.0093  -0.0152 116 TYR A CB  
893  C CG  . TYR A 138 ? 0.2129 0.2600 0.2767 0.0049  0.0155  -0.0171 116 TYR A CG  
894  C CD1 . TYR A 138 ? 0.2871 0.3419 0.3567 0.0036  0.0226  -0.0214 116 TYR A CD1 
895  C CD2 . TYR A 138 ? 0.2563 0.2927 0.3043 0.0045  0.0139  -0.0148 116 TYR A CD2 
896  C CE1 . TYR A 138 ? 0.3214 0.3724 0.3793 0.0013  0.0279  -0.0229 116 TYR A CE1 
897  C CE2 . TYR A 138 ? 0.2686 0.3011 0.3063 0.0026  0.0184  -0.0160 116 TYR A CE2 
898  C CZ  . TYR A 138 ? 0.3004 0.3397 0.3421 0.0008  0.0253  -0.0198 116 TYR A CZ  
899  O OH  . TYR A 138 ? 0.3541 0.3888 0.3835 -0.0017 0.0293  -0.0208 116 TYR A OH  
900  N N   . GLY A 139 ? 0.0874 0.1460 0.1903 0.0148  -0.0048 -0.0132 117 GLY A N   
901  C CA  . GLY A 139 ? 0.1005 0.1607 0.2097 0.0145  -0.0125 -0.0102 117 GLY A CA  
902  C C   . GLY A 139 ? 0.1535 0.2068 0.2486 0.0106  -0.0157 -0.0067 117 GLY A C   
903  O O   . GLY A 139 ? 0.2158 0.2719 0.3145 0.0076  -0.0194 -0.0053 117 GLY A O   
904  N N   . VAL A 140 ? 0.0976 0.1421 0.1772 0.0107  -0.0145 -0.0059 118 VAL A N   
905  C CA  . VAL A 140 ? 0.1086 0.1461 0.1746 0.0077  -0.0165 -0.0039 118 VAL A CA  
906  C C   . VAL A 140 ? 0.1102 0.1404 0.1655 0.0100  -0.0195 -0.0023 118 VAL A C   
907  O O   . VAL A 140 ? 0.1272 0.1557 0.1814 0.0130  -0.0177 -0.0029 118 VAL A O   
908  C CB  . VAL A 140 ? 0.1694 0.2041 0.2273 0.0047  -0.0108 -0.0052 118 VAL A CB  
909  C CG1 . VAL A 140 ? 0.2771 0.3096 0.3309 0.0071  -0.0060 -0.0069 118 VAL A CG1 
910  C CG2 . VAL A 140 ? 0.2181 0.2446 0.2630 0.0023  -0.0133 -0.0038 118 VAL A CG2 
911  N N   A ARG A 141 ? 0.1207 0.1470 0.1683 0.0082  -0.0238 -0.0007 119 ARG A N   
912  N N   B ARG A 141 ? 0.1274 0.1537 0.1750 0.0082  -0.0239 -0.0007 119 ARG A N   
913  C CA  A ARG A 141 ? 0.1030 0.1236 0.1398 0.0095  -0.0256 0.0002  119 ARG A CA  
914  C CA  B ARG A 141 ? 0.0985 0.1190 0.1351 0.0095  -0.0256 0.0002  119 ARG A CA  
915  C C   A ARG A 141 ? 0.1029 0.1186 0.1303 0.0101  -0.0212 -0.0015 119 ARG A C   
916  C C   B ARG A 141 ? 0.1032 0.1189 0.1306 0.0101  -0.0211 -0.0016 119 ARG A C   
917  O O   A ARG A 141 ? 0.1127 0.1267 0.1377 0.0082  -0.0189 -0.0027 119 ARG A O   
918  O O   B ARG A 141 ? 0.1159 0.1299 0.1410 0.0083  -0.0188 -0.0027 119 ARG A O   
919  C CB  A ARG A 141 ? 0.1162 0.1345 0.1465 0.0071  -0.0306 0.0012  119 ARG A CB  
920  C CB  B ARG A 141 ? 0.0930 0.1111 0.1229 0.0069  -0.0305 0.0011  119 ARG A CB  
921  C CG  A ARG A 141 ? 0.1339 0.1557 0.1713 0.0064  -0.0366 0.0037  119 ARG A CG  
922  C CG  B ARG A 141 ? 0.1404 0.1623 0.1777 0.0058  -0.0364 0.0034  119 ARG A CG  
923  C CD  A ARG A 141 ? 0.1621 0.1805 0.1893 0.0040  -0.0415 0.0048  119 ARG A CD  
924  C CD  B ARG A 141 ? 0.1614 0.1813 0.1930 0.0022  -0.0404 0.0033  119 ARG A CD  
925  N NE  A ARG A 141 ? 0.1660 0.1831 0.1903 0.0008  -0.0430 0.0034  119 ARG A NE  
926  N NE  B ARG A 141 ? 0.1709 0.1880 0.1936 0.0012  -0.0452 0.0049  119 ARG A NE  
927  C CZ  A ARG A 141 ? 0.1662 0.1806 0.1823 -0.0019 -0.0475 0.0036  119 ARG A CZ  
928  C CZ  B ARG A 141 ? 0.1725 0.1868 0.1872 -0.0019 -0.0487 0.0043  119 ARG A CZ  
929  N NH1 A ARG A 141 ? 0.1610 0.1734 0.1746 -0.0048 -0.0492 0.0019  119 ARG A NH1 
930  N NH1 B ARG A 141 ? 0.1441 0.1574 0.1595 -0.0040 -0.0484 0.0023  119 ARG A NH1 
931  N NH2 A ARG A 141 ? 0.1741 0.1875 0.1836 -0.0022 -0.0506 0.0054  119 ARG A NH2 
932  N NH2 B ARG A 141 ? 0.1949 0.2072 0.2003 -0.0035 -0.0525 0.0055  119 ARG A NH2 
933  N N   . VAL A 142 ? 0.0890 0.1021 0.1111 0.0123  -0.0206 -0.0014 120 VAL A N   
934  C CA  . VAL A 142 ? 0.0898 0.0987 0.1043 0.0133  -0.0172 -0.0030 120 VAL A CA  
935  C C   . VAL A 142 ? 0.1034 0.1079 0.1102 0.0118  -0.0180 -0.0042 120 VAL A C   
936  O O   . VAL A 142 ? 0.1098 0.1107 0.1133 0.0115  -0.0159 -0.0052 120 VAL A O   
937  C CB  . VAL A 142 ? 0.1017 0.1096 0.1127 0.0154  -0.0172 -0.0025 120 VAL A CB  
938  C CG1 . VAL A 142 ? 0.1177 0.1217 0.1209 0.0163  -0.0152 -0.0042 120 VAL A CG1 
939  C CG2 . VAL A 142 ? 0.1120 0.1219 0.1300 0.0172  -0.0158 -0.0021 120 VAL A CG2 
940  N N   . ALA A 143 ? 0.1046 0.1085 0.1081 0.0107  -0.0214 -0.0042 121 ALA A N   
941  C CA  . ALA A 143 ? 0.0949 0.0940 0.0919 0.0095  -0.0226 -0.0063 121 ALA A CA  
942  C C   . ALA A 143 ? 0.1227 0.1195 0.1219 0.0070  -0.0222 -0.0061 121 ALA A C   
943  O O   . ALA A 143 ? 0.1346 0.1254 0.1285 0.0066  -0.0223 -0.0075 121 ALA A O   
944  C CB  . ALA A 143 ? 0.0994 0.0986 0.0926 0.0081  -0.0264 -0.0068 121 ALA A CB  
945  N N   . ASP A 144 ? 0.1242 0.1261 0.1317 0.0051  -0.0219 -0.0045 122 ASP A N   
946  C CA  . ASP A 144 ? 0.1383 0.1399 0.1486 0.0016  -0.0208 -0.0041 122 ASP A CA  
947  C C   . ASP A 144 ? 0.1583 0.1593 0.1682 0.0015  -0.0161 -0.0041 122 ASP A C   
948  O O   . ASP A 144 ? 0.2037 0.2045 0.2145 -0.0023 -0.0144 -0.0035 122 ASP A O   
949  C CB  . ASP A 144 ? 0.1337 0.1428 0.1546 -0.0007 -0.0223 -0.0030 122 ASP A CB  
950  C CG  . ASP A 144 ? 0.1311 0.1389 0.1504 -0.0026 -0.0278 -0.0028 122 ASP A CG  
951  O OD1 . ASP A 144 ? 0.1285 0.1292 0.1391 -0.0037 -0.0297 -0.0041 122 ASP A OD1 
952  O OD2 . ASP A 144 ? 0.1875 0.2011 0.2143 -0.0029 -0.0308 -0.0016 122 ASP A OD2 
953  N N   . LEU A 145 ? 0.1313 0.1319 0.1391 0.0049  -0.0140 -0.0046 123 LEU A N   
954  C CA  . LEU A 145 ? 0.1463 0.1445 0.1507 0.0047  -0.0103 -0.0048 123 LEU A CA  
955  C C   . LEU A 145 ? 0.1617 0.1513 0.1563 0.0059  -0.0120 -0.0052 123 LEU A C   
956  O O   . LEU A 145 ? 0.1961 0.1816 0.1859 0.0053  -0.0104 -0.0050 123 LEU A O   
957  C CB  . LEU A 145 ? 0.1310 0.1336 0.1396 0.0076  -0.0074 -0.0054 123 LEU A CB  
958  C CG  . LEU A 145 ? 0.2127 0.2237 0.2327 0.0071  -0.0054 -0.0057 123 LEU A CG  
959  C CD1 . LEU A 145 ? 0.2237 0.2372 0.2477 0.0107  -0.0036 -0.0068 123 LEU A CD1 
960  C CD2 . LEU A 145 ? 0.2370 0.2503 0.2585 0.0029  -0.0015 -0.0062 123 LEU A CD2 
961  N N   . LEU A 146 ? 0.1069 0.0941 0.0989 0.0076  -0.0154 -0.0063 124 LEU A N   
962  C CA  . LEU A 146 ? 0.1143 0.0947 0.0995 0.0098  -0.0174 -0.0078 124 LEU A CA  
963  C C   . LEU A 146 ? 0.1550 0.1284 0.1364 0.0081  -0.0210 -0.0086 124 LEU A C   
964  O O   . LEU A 146 ? 0.2094 0.1773 0.1867 0.0105  -0.0234 -0.0108 124 LEU A O   
965  C CB  . LEU A 146 ? 0.1451 0.1287 0.1304 0.0135  -0.0177 -0.0094 124 LEU A CB  
966  C CG  . LEU A 146 ? 0.1389 0.1273 0.1270 0.0153  -0.0151 -0.0086 124 LEU A CG  
967  C CD1 . LEU A 146 ? 0.1537 0.1458 0.1417 0.0173  -0.0157 -0.0095 124 LEU A CD1 
968  C CD2 . LEU A 146 ? 0.1468 0.1316 0.1320 0.0163  -0.0138 -0.0086 124 LEU A CD2 
969  N N   . GLY A 147 ? 0.1507 0.1245 0.1342 0.0039  -0.0216 -0.0072 125 GLY A N   
970  C CA  . GLY A 147 ? 0.1520 0.1181 0.1318 0.0016  -0.0255 -0.0078 125 GLY A CA  
971  C C   . GLY A 147 ? 0.1577 0.1269 0.1407 -0.0008 -0.0277 -0.0082 125 GLY A C   
972  O O   . GLY A 147 ? 0.1679 0.1319 0.1495 -0.0045 -0.0306 -0.0079 125 GLY A O   
973  N N   . GLY A 148 ? 0.1345 0.1114 0.1214 0.0009  -0.0270 -0.0086 126 GLY A N   
974  C CA  . GLY A 148 ? 0.1177 0.0981 0.1079 -0.0016 -0.0298 -0.0085 126 GLY A CA  
975  C C   . GLY A 148 ? 0.1367 0.1171 0.1225 0.0006  -0.0322 -0.0111 126 GLY A C   
976  O O   . GLY A 148 ? 0.1586 0.1346 0.1384 0.0035  -0.0323 -0.0142 126 GLY A O   
977  N N   . VAL A 149 ? 0.1389 0.1249 0.1282 -0.0010 -0.0342 -0.0099 127 VAL A N   
978  C CA  . VAL A 149 ? 0.1507 0.1372 0.1346 -0.0005 -0.0368 -0.0118 127 VAL A CA  
979  C C   . VAL A 149 ? 0.1693 0.1486 0.1463 -0.0020 -0.0402 -0.0155 127 VAL A C   
980  O O   . VAL A 149 ? 0.1768 0.1541 0.1557 -0.0058 -0.0434 -0.0148 127 VAL A O   
981  C CB  . VAL A 149 ? 0.1199 0.1131 0.1089 -0.0026 -0.0395 -0.0088 127 VAL A CB  
982  C CG1 . VAL A 149 ? 0.1334 0.1262 0.1142 -0.0032 -0.0425 -0.0103 127 VAL A CG1 
983  C CG2 . VAL A 149 ? 0.1536 0.1529 0.1500 -0.0005 -0.0368 -0.0059 127 VAL A CG2 
984  N N   . ALA A 150 ? 0.1457 0.1213 0.1154 0.0009  -0.0394 -0.0198 128 ALA A N   
985  C CA  . ALA A 150 ? 0.1653 0.1337 0.1283 0.0004  -0.0424 -0.0247 128 ALA A CA  
986  C C   . ALA A 150 ? 0.1719 0.1434 0.1289 -0.0013 -0.0444 -0.0267 128 ALA A C   
987  O O   . ALA A 150 ? 0.2226 0.1891 0.1743 -0.0033 -0.0479 -0.0302 128 ALA A O   
988  C CB  . ALA A 150 ? 0.1721 0.1353 0.1319 0.0049  -0.0406 -0.0294 128 ALA A CB  
989  N N   . ALA A 151 ? 0.1665 0.1454 0.1234 -0.0009 -0.0424 -0.0245 129 ALA A N   
990  C CA  . ALA A 151 ? 0.2016 0.1835 0.1512 -0.0033 -0.0444 -0.0252 129 ALA A CA  
991  C C   . ALA A 151 ? 0.1458 0.1348 0.0990 -0.0044 -0.0444 -0.0194 129 ALA A C   
992  O O   . ALA A 151 ? 0.1606 0.1528 0.1174 -0.0017 -0.0406 -0.0176 129 ALA A O   
993  C CB  . ALA A 151 ? 0.2359 0.2175 0.1767 -0.0011 -0.0413 -0.0315 129 ALA A CB  
994  N N   . GLU A 152 ? 0.1502 0.1408 0.1025 -0.0084 -0.0494 -0.0164 130 GLU A N   
995  C CA  . GLU A 152 ? 0.1675 0.1634 0.1231 -0.0095 -0.0511 -0.0107 130 GLU A CA  
996  C C   . GLU A 152 ? 0.1716 0.1694 0.1165 -0.0105 -0.0497 -0.0111 130 GLU A C   
997  O O   . GLU A 152 ? 0.2125 0.2138 0.1595 -0.0103 -0.0492 -0.0069 130 GLU A O   
998  C CB  . GLU A 152 ? 0.1838 0.1805 0.1428 -0.0134 -0.0582 -0.0071 130 GLU A CB  
999  C CG  . GLU A 152 ? 0.1945 0.1920 0.1664 -0.0133 -0.0594 -0.0056 130 GLU A CG  
1000 C CD  . GLU A 152 ? 0.1941 0.1968 0.1788 -0.0107 -0.0573 -0.0017 130 GLU A CD  
1001 O OE1 . GLU A 152 ? 0.2444 0.2493 0.2285 -0.0092 -0.0565 0.0007  130 GLU A OE1 
1002 O OE2 . GLU A 152 ? 0.2437 0.2482 0.2389 -0.0104 -0.0562 -0.0012 130 GLU A OE2 
1003 N N   . ARG A 153 ? 0.0941 0.2752 0.1813 0.0413  -0.0188 0.0000  131 ARG A N   
1004 C CA  . ARG A 153 ? 0.1094 0.2697 0.1873 0.0428  -0.0246 -0.0026 131 ARG A CA  
1005 C C   . ARG A 153 ? 0.1263 0.2722 0.1938 0.0372  -0.0226 -0.0032 131 ARG A C   
1006 O O   . ARG A 153 ? 0.1537 0.2994 0.2221 0.0268  -0.0217 0.0004  131 ARG A O   
1007 C CB  . ARG A 153 ? 0.1705 0.3297 0.2517 0.0366  -0.0316 0.0001  131 ARG A CB  
1008 C CG  . ARG A 153 ? 0.2096 0.3487 0.2801 0.0384  -0.0373 -0.0010 131 ARG A CG  
1009 C CD  . ARG A 153 ? 0.2916 0.4342 0.3651 0.0354  -0.0436 0.0016  131 ARG A CD  
1010 N NE  . ARG A 153 ? 0.4188 0.5463 0.4816 0.0308  -0.0484 0.0016  131 ARG A NE  
1011 C CZ  . ARG A 153 ? 0.5110 0.6370 0.5711 0.0204  -0.0501 0.0002  131 ARG A CZ  
1012 N NH1 . ARG A 153 ? 0.5434 0.6810 0.6126 0.0127  -0.0476 -0.0002 131 ARG A NH1 
1013 N NH2 . ARG A 153 ? 0.5143 0.6268 0.5633 0.0175  -0.0537 -0.0004 131 ARG A NH2 
1014 N N   A VAL A 154 ? 0.0926 0.2225 0.1496 0.0433  -0.0217 -0.0077 132 VAL A N   
1015 N N   B VAL A 154 ? 0.0925 0.2237 0.1497 0.0433  -0.0211 -0.0077 132 VAL A N   
1016 C CA  A VAL A 154 ? 0.1121 0.2281 0.1579 0.0390  -0.0190 -0.0086 132 VAL A CA  
1017 C CA  B VAL A 154 ? 0.0936 0.2102 0.1397 0.0379  -0.0189 -0.0080 132 VAL A CA  
1018 C C   A VAL A 154 ? 0.1134 0.2064 0.1500 0.0355  -0.0238 -0.0088 132 VAL A C   
1019 C C   B VAL A 154 ? 0.1127 0.2066 0.1498 0.0351  -0.0238 -0.0086 132 VAL A C   
1020 O O   A VAL A 154 ? 0.1443 0.2278 0.1794 0.0409  -0.0276 -0.0107 132 VAL A O   
1021 O O   B VAL A 154 ? 0.1437 0.2295 0.1801 0.0406  -0.0277 -0.0102 132 VAL A O   
1022 C CB  A VAL A 154 ? 0.1237 0.2403 0.1646 0.0476  -0.0152 -0.0148 132 VAL A CB  
1023 C CB  B VAL A 154 ? 0.1432 0.2612 0.1833 0.0444  -0.0141 -0.0130 132 VAL A CB  
1024 C CG1 A VAL A 154 ? 0.1543 0.2663 0.1859 0.0431  -0.0117 -0.0146 132 VAL A CG1 
1025 C CG1 B VAL A 154 ? 0.1406 0.2828 0.1869 0.0452  -0.0079 -0.0105 132 VAL A CG1 
1026 C CG2 A VAL A 154 ? 0.1301 0.2713 0.1803 0.0548  -0.0109 -0.0159 132 VAL A CG2 
1027 C CG2 B VAL A 154 ? 0.1196 0.2307 0.1590 0.0551  -0.0161 -0.0202 132 VAL A CG2 
1028 N N   . PRO A 155 ? 0.1021 0.1864 0.1331 0.0270  -0.0231 -0.0063 133 PRO A N   
1029 C CA  . PRO A 155 ? 0.0892 0.1544 0.1112 0.0246  -0.0267 -0.0065 133 PRO A CA  
1030 C C   . PRO A 155 ? 0.0995 0.1527 0.1142 0.0295  -0.0261 -0.0103 133 PRO A C   
1031 O O   . PRO A 155 ? 0.1021 0.1600 0.1156 0.0324  -0.0224 -0.0133 133 PRO A O   
1032 C CB  . PRO A 155 ? 0.1131 0.1738 0.1320 0.0161  -0.0246 -0.0037 133 PRO A CB  
1033 C CG  . PRO A 155 ? 0.1359 0.2092 0.1589 0.0158  -0.0189 -0.0017 133 PRO A CG  
1034 C CD  . PRO A 155 ? 0.1265 0.2177 0.1593 0.0205  -0.0185 -0.0024 133 PRO A CD  
1035 N N   . SER A 156 ? 0.1088 0.1478 0.1190 0.0303  -0.0298 -0.0101 134 SER A N   
1036 C CA  . SER A 156 ? 0.1003 0.1258 0.1045 0.0320  -0.0297 -0.0129 134 SER A CA  
1037 C C   . SER A 156 ? 0.1146 0.1297 0.1114 0.0254  -0.0301 -0.0098 134 SER A C   
1038 O O   . SER A 156 ? 0.1121 0.1296 0.1078 0.0206  -0.0303 -0.0067 134 SER A O   
1039 C CB  . SER A 156 ? 0.1165 0.1334 0.1237 0.0385  -0.0329 -0.0139 134 SER A CB  
1040 O OG  . SER A 156 ? 0.1156 0.1200 0.1198 0.0398  -0.0325 -0.0183 134 SER A OG  
1041 N N   . TYR A 157 ? 0.1060 0.1101 0.0983 0.0251  -0.0302 -0.0113 135 TYR A N   
1042 C CA  . TYR A 157 ? 0.1186 0.1143 0.1048 0.0201  -0.0307 -0.0078 135 TYR A CA  
1043 C C   . TYR A 157 ? 0.1234 0.1068 0.1090 0.0210  -0.0328 -0.0073 135 TYR A C   
1044 O O   . TYR A 157 ? 0.1395 0.1190 0.1288 0.0246  -0.0333 -0.0118 135 TYR A O   
1045 C CB  . TYR A 157 ? 0.1076 0.1064 0.0901 0.0162  -0.0272 -0.0079 135 TYR A CB  
1046 C CG  . TYR A 157 ? 0.1141 0.1136 0.0954 0.0171  -0.0259 -0.0121 135 TYR A CG  
1047 C CD1 . TYR A 157 ? 0.1070 0.0986 0.0857 0.0147  -0.0270 -0.0124 135 TYR A CD1 
1048 C CD2 . TYR A 157 ? 0.0991 0.1097 0.0821 0.0200  -0.0237 -0.0159 135 TYR A CD2 
1049 C CE1 . TYR A 157 ? 0.1533 0.1474 0.1314 0.0145  -0.0267 -0.0175 135 TYR A CE1 
1050 C CE2 . TYR A 157 ? 0.0990 0.1126 0.0795 0.0208  -0.0231 -0.0211 135 TYR A CE2 
1051 C CZ  . TYR A 157 ? 0.1075 0.1126 0.0857 0.0178  -0.0251 -0.0224 135 TYR A CZ  
1052 O OH  . TYR A 157 ? 0.1258 0.1358 0.1022 0.0178  -0.0254 -0.0289 135 TYR A OH  
1053 N N   . TYR A 158 ? 0.1222 0.0995 0.1037 0.0179  -0.0339 -0.0021 136 TYR A N   
1054 C CA  . TYR A 158 ? 0.1522 0.1181 0.1345 0.0176  -0.0355 0.0006  136 TYR A CA  
1055 C C   . TYR A 158 ? 0.1511 0.1144 0.1308 0.0125  -0.0336 0.0004  136 TYR A C   
1056 O O   . TYR A 158 ? 0.1530 0.1214 0.1277 0.0095  -0.0316 0.0024  136 TYR A O   
1057 C CB  . TYR A 158 ? 0.1483 0.1120 0.1287 0.0183  -0.0377 0.0085  136 TYR A CB  
1058 C CG  . TYR A 158 ? 0.2033 0.1550 0.1876 0.0191  -0.0393 0.0131  136 TYR A CG  
1059 C CD1 . TYR A 158 ? 0.2175 0.1631 0.2089 0.0249  -0.0414 0.0129  136 TYR A CD1 
1060 C CD2 . TYR A 158 ? 0.2374 0.1838 0.2198 0.0141  -0.0382 0.0181  136 TYR A CD2 
1061 C CE1 . TYR A 158 ? 0.2850 0.2167 0.2818 0.0256  -0.0427 0.0177  136 TYR A CE1 
1062 C CE2 . TYR A 158 ? 0.2138 0.1481 0.2018 0.0136  -0.0394 0.0235  136 TYR A CE2 
1063 C CZ  . TYR A 158 ? 0.2724 0.1980 0.2677 0.0193  -0.0417 0.0234  136 TYR A CZ  
1064 O OH  . TYR A 158 ? 0.3486 0.2594 0.3513 0.0190  -0.0428 0.0294  136 TYR A OH  
1065 N N   . ALA A 159 ? 0.1799 0.1355 0.1636 0.0115  -0.0345 -0.0025 137 ALA A N   
1066 C CA  . ALA A 159 ? 0.1860 0.1416 0.1690 0.0060  -0.0335 -0.0030 137 ALA A CA  
1067 C C   . ALA A 159 ? 0.1915 0.1369 0.1779 0.0025  -0.0348 0.0032  137 ALA A C   
1068 O O   . ALA A 159 ? 0.2457 0.1798 0.2386 0.0033  -0.0369 0.0020  137 ALA A O   
1069 C CB  . ALA A 159 ? 0.1893 0.1473 0.1746 0.0062  -0.0338 -0.0126 137 ALA A CB  
1070 N N   . THR A 160 ? 0.1743 0.1237 0.1570 -0.0013 -0.0330 0.0101  138 THR A N   
1071 C CA  . THR A 160 ? 0.1525 0.0952 0.1389 -0.0053 -0.0334 0.0180  138 THR A CA  
1072 C C   . THR A 160 ? 0.1984 0.1387 0.1917 -0.0116 -0.0340 0.0144  138 THR A C   
1073 O O   . THR A 160 ? 0.2376 0.1874 0.2293 -0.0135 -0.0331 0.0092  138 THR A O   
1074 C CB  . THR A 160 ? 0.1980 0.1487 0.1777 -0.0064 -0.0308 0.0268  138 THR A CB  
1075 O OG1 . THR A 160 ? 0.1875 0.1486 0.1638 -0.0083 -0.0281 0.0242  138 THR A OG1 
1076 C CG2 . THR A 160 ? 0.2503 0.2043 0.2233 -0.0010 -0.0313 0.0286  138 THR A CG2 
1077 N N   . GLY A 161 ? 0.2767 0.2047 0.2786 -0.0150 -0.0358 0.0175  139 GLY A N   
1078 C CA  . GLY A 161 ? 0.3080 0.2341 0.3180 -0.0229 -0.0368 0.0148  139 GLY A CA  
1079 C C   . GLY A 161 ? 0.2977 0.2358 0.3063 -0.0281 -0.0339 0.0239  139 GLY A C   
1080 O O   . GLY A 161 ? 0.3091 0.2532 0.3107 -0.0252 -0.0312 0.0324  139 GLY A O   
1081 N N   . ILE A 162 ? 0.2705 0.2140 0.2858 -0.0355 -0.0345 0.0214  140 ILE A N   
1082 C CA  . ILE A 162 ? 0.2852 0.2418 0.3015 -0.0404 -0.0315 0.0306  140 ILE A CA  
1083 C C   . ILE A 162 ? 0.3093 0.2589 0.3304 -0.0435 -0.0299 0.0444  140 ILE A C   
1084 O O   . ILE A 162 ? 0.3500 0.2833 0.3803 -0.0469 -0.0324 0.0459  140 ILE A O   
1085 C CB  . ILE A 162 ? 0.2739 0.2395 0.2989 -0.0485 -0.0333 0.0252  140 ILE A CB  
1086 C CG1 . ILE A 162 ? 0.2719 0.2476 0.2908 -0.0443 -0.0346 0.0136  140 ILE A CG1 
1087 C CG2 . ILE A 162 ? 0.3189 0.3004 0.3468 -0.0531 -0.0297 0.0356  140 ILE A CG2 
1088 C CD1 . ILE A 162 ? 0.2432 0.2294 0.2698 -0.0515 -0.0378 0.0063  140 ILE A CD1 
1089 N N   . GLY A 163 ? 0.2593 0.2210 0.2738 -0.0417 -0.0256 0.0545  141 GLY A N   
1090 C CA  . GLY A 163 ? 0.2695 0.2292 0.2864 -0.0438 -0.0234 0.0694  141 GLY A CA  
1091 C C   . GLY A 163 ? 0.2523 0.2316 0.2619 -0.0424 -0.0179 0.0779  141 GLY A C   
1092 O O   . GLY A 163 ? 0.2849 0.2776 0.2899 -0.0405 -0.0160 0.0724  141 GLY A O   
1093 N N   . GLN A 164 ? 0.2721 0.2555 0.2804 -0.0399 -0.0145 0.0860  142 GLN A N   
1094 C CA  . GLN A 164 ? 0.2530 0.2556 0.2542 -0.0365 -0.0089 0.0904  142 GLN A CA  
1095 C C   . GLN A 164 ? 0.2345 0.2422 0.2201 -0.0271 -0.0076 0.0837  142 GLN A C   
1096 O O   . GLN A 164 ? 0.2337 0.2319 0.2133 -0.0224 -0.0102 0.0805  142 GLN A O   
1097 C CB  . GLN A 164 ? 0.3210 0.3262 0.3251 -0.0371 -0.0061 0.1008  142 GLN A CB  
1098 C CG  . GLN A 164 ? 0.4322 0.4360 0.4523 -0.0467 -0.0061 0.1075  142 GLN A CG  
1099 C CD  . GLN A 164 ? 0.5501 0.5709 0.5755 -0.0514 -0.0039 0.1071  142 GLN A CD  
1100 O OE1 . GLN A 164 ? 0.5956 0.6137 0.6310 -0.0586 -0.0068 0.1026  142 GLN A OE1 
1101 N NE2 . GLN A 164 ? 0.5646 0.6043 0.5836 -0.0470 0.0012  0.1107  142 GLN A NE2 
1102 N N   . PRO A 165 ? 0.1801 0.2027 0.1605 -0.0242 -0.0037 0.0810  143 PRO A N   
1103 C CA  . PRO A 165 ? 0.1661 0.1911 0.1336 -0.0161 -0.0026 0.0724  143 PRO A CA  
1104 C C   . PRO A 165 ? 0.1752 0.1962 0.1328 -0.0107 -0.0033 0.0716  143 PRO A C   
1105 O O   . PRO A 165 ? 0.1852 0.1990 0.1366 -0.0070 -0.0060 0.0645  143 PRO A O   
1106 C CB  . PRO A 165 ? 0.1955 0.2369 0.1618 -0.0139 0.0027  0.0723  143 PRO A CB  
1107 C CG  . PRO A 165 ? 0.1838 0.2317 0.1634 -0.0215 0.0028  0.0778  143 PRO A CG  
1108 C CD  . PRO A 165 ? 0.2038 0.2411 0.1920 -0.0285 -0.0004 0.0849  143 PRO A CD  
1109 N N   . ASP A 166 ? 0.1970 0.2241 0.1538 -0.0106 -0.0011 0.0792  144 ASP A N   
1110 C CA  . ASP A 166 ? 0.1992 0.2254 0.1464 -0.0058 -0.0023 0.0793  144 ASP A CA  
1111 C C   . ASP A 166 ? 0.2137 0.2259 0.1635 -0.0058 -0.0072 0.0804  144 ASP A C   
1112 O O   . ASP A 166 ? 0.2437 0.2533 0.1857 -0.0013 -0.0099 0.0759  144 ASP A O   
1113 C CB  . ASP A 166 ? 0.2534 0.2913 0.2000 -0.0058 0.0010  0.0888  144 ASP A CB  
1114 C CG  . ASP A 166 ? 0.3601 0.4142 0.3041 -0.0043 0.0061  0.0877  144 ASP A CG  
1115 O OD1 . ASP A 166 ? 0.3656 0.4216 0.3033 -0.0006 0.0069  0.0780  144 ASP A OD1 
1116 O OD2 . ASP A 166 ? 0.4663 0.5314 0.4153 -0.0064 0.0095  0.0970  144 ASP A OD2 
1117 N N   . GLU A 167 ? 0.2127 0.2161 0.1744 -0.0110 -0.0085 0.0860  145 GLU A N   
1118 C CA  . GLU A 167 ? 0.1999 0.1885 0.1662 -0.0105 -0.0129 0.0869  145 GLU A CA  
1119 C C   . GLU A 167 ? 0.1722 0.1541 0.1360 -0.0078 -0.0165 0.0766  145 GLU A C   
1120 O O   . GLU A 167 ? 0.1955 0.1726 0.1561 -0.0031 -0.0195 0.0744  145 GLU A O   
1121 C CB  . GLU A 167 ? 0.2885 0.2670 0.2697 -0.0174 -0.0136 0.0932  145 GLU A CB  
1122 C CG  . GLU A 167 ? 0.4257 0.3861 0.4140 -0.0170 -0.0182 0.0903  145 GLU A CG  
1123 C CD  . GLU A 167 ? 0.5832 0.5316 0.5869 -0.0249 -0.0195 0.0916  145 GLU A CD  
1124 O OE1 . GLU A 167 ? 0.6079 0.5635 0.6168 -0.0316 -0.0175 0.0934  145 GLU A OE1 
1125 O OE2 . GLU A 167 ? 0.5983 0.5303 0.6093 -0.0242 -0.0225 0.0898  145 GLU A OE2 
1126 N N   . ILE A 168 ? 0.1643 0.1475 0.1300 -0.0106 -0.0163 0.0709  146 ILE A N   
1127 C CA  . ILE A 168 ? 0.1509 0.1292 0.1145 -0.0087 -0.0195 0.0616  146 ILE A CA  
1128 C C   . ILE A 168 ? 0.1609 0.1457 0.1132 -0.0025 -0.0190 0.0554  146 ILE A C   
1129 O O   . ILE A 168 ? 0.1602 0.1409 0.1113 0.0004  -0.0224 0.0503  146 ILE A O   
1130 C CB  . ILE A 168 ? 0.1589 0.1390 0.1260 -0.0131 -0.0194 0.0581  146 ILE A CB  
1131 C CG1 . ILE A 168 ? 0.1816 0.1543 0.1616 -0.0203 -0.0208 0.0612  146 ILE A CG1 
1132 C CG2 . ILE A 168 ? 0.1645 0.1418 0.1291 -0.0099 -0.0213 0.0464  146 ILE A CG2 
1133 C CD1 . ILE A 168 ? 0.1919 0.1480 0.1788 -0.0201 -0.0252 0.0586  146 ILE A CD1 
1134 N N   . ALA A 169 ? 0.1562 0.1510 0.1012 -0.0009 -0.0152 0.0552  147 ALA A N   
1135 C CA  . ALA A 169 ? 0.1869 0.1857 0.1213 0.0036  -0.0156 0.0487  147 ALA A CA  
1136 C C   . ALA A 169 ? 0.2049 0.2022 0.1359 0.0065  -0.0193 0.0502  147 ALA A C   
1137 O O   . ALA A 169 ? 0.1602 0.1573 0.0872 0.0088  -0.0225 0.0437  147 ALA A O   
1138 C CB  . ALA A 169 ? 0.1763 0.1853 0.1044 0.0043  -0.0113 0.0484  147 ALA A CB  
1139 N N   . ARG A 170 ? 0.1659 0.1633 0.0996 0.0060  -0.0191 0.0594  148 ARG A N   
1140 C CA  . ARG A 170 ? 0.1747 0.1714 0.1064 0.0092  -0.0226 0.0626  148 ARG A CA  
1141 C C   . ARG A 170 ? 0.1793 0.1674 0.1173 0.0112  -0.0266 0.0598  148 ARG A C   
1142 O O   . ARG A 170 ? 0.1952 0.1857 0.1298 0.0146  -0.0303 0.0559  148 ARG A O   
1143 C CB  . ARG A 170 ? 0.1883 0.1858 0.1234 0.0082  -0.0209 0.0746  148 ARG A CB  
1144 C CG  . ARG A 170 ? 0.3465 0.3504 0.2755 0.0120  -0.0231 0.0791  148 ARG A CG  
1145 C CD  . ARG A 170 ? 0.3997 0.4053 0.3327 0.0109  -0.0207 0.0924  148 ARG A CD  
1146 N NE  . ARG A 170 ? 0.5023 0.5200 0.4319 0.0086  -0.0158 0.0958  148 ARG A NE  
1147 C CZ  . ARG A 170 ? 0.5308 0.5632 0.4503 0.0113  -0.0148 0.0951  148 ARG A CZ  
1148 N NH1 . ARG A 170 ? 0.4129 0.4496 0.3248 0.0152  -0.0188 0.0909  148 ARG A NH1 
1149 N NH2 . ARG A 170 ? 0.6025 0.6467 0.5200 0.0100  -0.0098 0.0983  148 ARG A NH2 
1150 N N   . ILE A 171 ? 0.1737 0.1528 0.1220 0.0084  -0.0263 0.0611  149 ILE A N   
1151 C CA  . ILE A 171 ? 0.1760 0.1471 0.1317 0.0100  -0.0301 0.0577  149 ILE A CA  
1152 C C   . ILE A 171 ? 0.1828 0.1591 0.1353 0.0111  -0.0317 0.0478  149 ILE A C   
1153 O O   . ILE A 171 ? 0.1476 0.1248 0.1022 0.0143  -0.0349 0.0448  149 ILE A O   
1154 C CB  . ILE A 171 ? 0.2306 0.1889 0.1973 0.0055  -0.0306 0.0586  149 ILE A CB  
1155 C CG1 . ILE A 171 ? 0.2513 0.2029 0.2244 0.0039  -0.0292 0.0684  149 ILE A CG1 
1156 C CG2 . ILE A 171 ? 0.2235 0.1728 0.1962 0.0079  -0.0348 0.0518  149 ILE A CG2 
1157 C CD1 . ILE A 171 ? 0.3109 0.2503 0.2955 -0.0024 -0.0296 0.0682  149 ILE A CD1 
1158 N N   . ALA A 172 ? 0.1553 0.1354 0.1036 0.0084  -0.0292 0.0430  150 ALA A N   
1159 C CA  . ALA A 172 ? 0.1565 0.1402 0.1022 0.0086  -0.0300 0.0340  150 ALA A CA  
1160 C C   . ALA A 172 ? 0.1453 0.1382 0.0867 0.0115  -0.0321 0.0317  150 ALA A C   
1161 O O   . ALA A 172 ? 0.1657 0.1591 0.1103 0.0119  -0.0350 0.0267  150 ALA A O   
1162 C CB  . ALA A 172 ? 0.1473 0.1337 0.0888 0.0065  -0.0261 0.0307  150 ALA A CB  
1163 N N   . ALA A 173 ? 0.1484 0.1459 0.0808 0.0140  -0.0313 0.0341  151 ALA A N   
1164 C CA  . ALA A 173 ? 0.1520 0.1527 0.0783 0.0127  -0.0362 0.0310  151 ALA A CA  
1165 C C   . ALA A 173 ? 0.1590 0.1601 0.0906 0.0164  -0.0404 0.0338  151 ALA A C   
1166 O O   . ALA A 173 ? 0.1529 0.1615 0.0875 0.0141  -0.0444 0.0305  151 ALA A O   
1167 C CB  . ALA A 173 ? 0.1634 0.1704 0.0807 0.0129  -0.0346 0.0345  151 ALA A CB  
1168 N N   . GLU A 174 ? 0.1693 0.1660 0.1048 0.0201  -0.0392 0.0422  152 GLU A N   
1169 C CA  . GLU A 174 ? 0.1834 0.1793 0.1248 0.0245  -0.0427 0.0463  152 GLU A CA  
1170 C C   . GLU A 174 ? 0.1521 0.1534 0.1052 0.0250  -0.0432 0.0421  152 GLU A C   
1171 O O   . GLU A 174 ? 0.1539 0.1634 0.1114 0.0273  -0.0462 0.0414  152 GLU A O   
1172 C CB  . GLU A 174 ? 0.1792 0.1657 0.1263 0.0255  -0.0405 0.0563  152 GLU A CB  
1173 C CG  . GLU A 174 ? 0.2209 0.2092 0.1616 0.0240  -0.0391 0.0643  152 GLU A CG  
1174 C CD  . GLU A 174 ? 0.2913 0.2692 0.2395 0.0228  -0.0361 0.0738  152 GLU A CD  
1175 O OE1 . GLU A 174 ? 0.3298 0.2967 0.2884 0.0236  -0.0364 0.0740  152 GLU A OE1 
1176 O OE2 . GLU A 174 ? 0.2847 0.2658 0.2296 0.0205  -0.0334 0.0809  152 GLU A OE2 
1177 N N   . LYS A 175 ? 0.1439 0.1357 0.1011 0.0209  -0.0417 0.0378  153 LYS A N   
1178 C CA  . LYS A 175 ? 0.1376 0.1255 0.1015 0.0215  -0.0439 0.0312  153 LYS A CA  
1179 C C   . LYS A 175 ? 0.1526 0.1501 0.1147 0.0194  -0.0448 0.0234  153 LYS A C   
1180 O O   . LYS A 175 ? 0.1486 0.1502 0.1169 0.0213  -0.0471 0.0199  153 LYS A O   
1181 C CB  . LYS A 175 ? 0.1503 0.1252 0.1170 0.0196  -0.0425 0.0285  153 LYS A CB  
1182 C CG  . LYS A 175 ? 0.2208 0.1840 0.1927 0.0206  -0.0424 0.0351  153 LYS A CG  
1183 C CD  . LYS A 175 ? 0.2384 0.1994 0.2182 0.0270  -0.0447 0.0375  153 LYS A CD  
1184 C CE  . LYS A 175 ? 0.3335 0.2818 0.3191 0.0278  -0.0436 0.0449  153 LYS A CE  
1185 N NZ  . LYS A 175 ? 0.4386 0.3830 0.4328 0.0351  -0.0450 0.0462  153 LYS A NZ  
1186 N N   . VAL A 176 ? 0.1297 0.1309 0.0846 0.0156  -0.0429 0.0205  154 VAL A N   
1187 C CA  . VAL A 176 ? 0.1370 0.1458 0.0908 0.0129  -0.0443 0.0134  154 VAL A CA  
1188 C C   . VAL A 176 ? 0.1557 0.1767 0.1115 0.0140  -0.0487 0.0148  154 VAL A C   
1189 O O   . VAL A 176 ? 0.1516 0.1785 0.1132 0.0131  -0.0512 0.0104  154 VAL A O   
1190 C CB  . VAL A 176 ? 0.1479 0.1566 0.0932 0.0095  -0.0417 0.0096  154 VAL A CB  
1191 C CG1 . VAL A 176 ? 0.1927 0.2080 0.1368 0.0064  -0.0442 0.0019  154 VAL A CG1 
1192 C CG2 . VAL A 176 ? 0.1512 0.1496 0.0962 0.0082  -0.0378 0.0078  154 VAL A CG2 
1193 N N   . ALA A 177 ? 0.1593 0.1839 0.1111 0.0151  -0.0503 0.0220  155 ALA A N   
1194 C CA  . ALA A 177 ? 0.1526 0.1838 0.1041 0.0163  -0.0562 0.0234  155 ALA A CA  
1195 C C   . ALA A 177 ? 0.1473 0.1820 0.1105 0.0207  -0.0584 0.0263  155 ALA A C   
1196 O O   . ALA A 177 ? 0.1506 0.1946 0.1174 0.0214  -0.0625 0.0242  155 ALA A O   
1197 C CB  . ALA A 177 ? 0.1689 0.1981 0.1115 0.0193  -0.0573 0.0295  155 ALA A CB  
1198 N N   . GLU A 178 ? 0.1610 0.1887 0.1302 0.0248  -0.0551 0.0303  156 GLU A N   
1199 C CA  . GLU A 178 ? 0.1669 0.1952 0.1469 0.0307  -0.0564 0.0314  156 GLU A CA  
1200 C C   . GLU A 178 ? 0.2199 0.2538 0.2056 0.0294  -0.0566 0.0227  156 GLU A C   
1201 O O   . GLU A 178 ? 0.2290 0.2696 0.2242 0.0336  -0.0582 0.0227  156 GLU A O   
1202 C CB  . GLU A 178 ? 0.1698 0.1827 0.1531 0.0354  -0.0534 0.0347  156 GLU A CB  
1203 C CG  . GLU A 178 ? 0.2763 0.2856 0.2587 0.0391  -0.0526 0.0458  156 GLU A CG  
1204 C CD  . GLU A 178 ? 0.3594 0.3494 0.3470 0.0426  -0.0503 0.0474  156 GLU A CD  
1205 O OE1 . GLU A 178 ? 0.3503 0.3324 0.3432 0.0426  -0.0503 0.0398  156 GLU A OE1 
1206 O OE2 . GLU A 178 ? 0.4634 0.4452 0.4489 0.0454  -0.0489 0.0553  156 GLU A OE2 
1207 N N   . GLY A 179 ? 0.1517 0.1835 0.1329 0.0236  -0.0547 0.0160  157 GLY A N   
1208 C CA  . GLY A 179 ? 0.1262 0.1646 0.1137 0.0210  -0.0549 0.0093  157 GLY A CA  
1209 C C   . GLY A 179 ? 0.1173 0.1472 0.1057 0.0197  -0.0515 0.0050  157 GLY A C   
1210 O O   . GLY A 179 ? 0.1199 0.1561 0.1144 0.0162  -0.0498 0.0010  157 GLY A O   
1211 N N   . PHE A 180 ? 0.1199 0.1365 0.1037 0.0208  -0.0484 0.0068  158 PHE A N   
1212 C CA  . PHE A 180 ? 0.1111 0.1213 0.0957 0.0184  -0.0433 0.0034  158 PHE A CA  
1213 C C   . PHE A 180 ? 0.1356 0.1464 0.1168 0.0120  -0.0412 0.0003  158 PHE A C   
1214 O O   . PHE A 180 ? 0.1340 0.1414 0.1077 0.0096  -0.0418 0.0006  158 PHE A O   
1215 C CB  . PHE A 180 ? 0.1125 0.1100 0.0930 0.0194  -0.0414 0.0055  158 PHE A CB  
1216 C CG  . PHE A 180 ? 0.1150 0.1075 0.1011 0.0253  -0.0424 0.0067  158 PHE A CG  
1217 C CD1 . PHE A 180 ? 0.1193 0.1112 0.1106 0.0276  -0.0400 0.0016  158 PHE A CD1 
1218 C CD2 . PHE A 180 ? 0.1363 0.1246 0.1224 0.0289  -0.0455 0.0130  158 PHE A CD2 
1219 C CE1 . PHE A 180 ? 0.1264 0.1116 0.1231 0.0336  -0.0409 0.0007  158 PHE A CE1 
1220 C CE2 . PHE A 180 ? 0.1480 0.1284 0.1406 0.0348  -0.0462 0.0141  158 PHE A CE2 
1221 C CZ  . PHE A 180 ? 0.1311 0.1091 0.1293 0.0372  -0.0440 0.0069  158 PHE A CZ  
1222 N N   . PRO A 181 ? 0.1031 0.1184 0.0903 0.0098  -0.0385 -0.0022 159 PRO A N   
1223 C CA  . PRO A 181 ? 0.1346 0.1484 0.1211 0.0040  -0.0362 -0.0041 159 PRO A CA  
1224 C C   . PRO A 181 ? 0.1330 0.1370 0.1137 0.0033  -0.0319 -0.0033 159 PRO A C   
1225 O O   . PRO A 181 ? 0.1189 0.1193 0.0987 -0.0002 -0.0297 -0.0043 159 PRO A O   
1226 C CB  . PRO A 181 ? 0.1729 0.1968 0.1699 0.0024  -0.0344 -0.0045 159 PRO A CB  
1227 C CG  . PRO A 181 ? 0.1895 0.2180 0.1898 0.0084  -0.0336 -0.0036 159 PRO A CG  
1228 C CD  . PRO A 181 ? 0.1379 0.1617 0.1340 0.0131  -0.0373 -0.0028 159 PRO A CD  
1229 N N   . ARG A 182 ? 0.1259 0.1259 0.1040 0.0066  -0.0310 -0.0018 160 ARG A N   
1230 C CA  . ARG A 182 ? 0.1074 0.1018 0.0815 0.0061  -0.0275 -0.0009 160 ARG A CA  
1231 C C   . ARG A 182 ? 0.1247 0.1137 0.0954 0.0080  -0.0286 0.0006  160 ARG A C   
1232 O O   . ARG A 182 ? 0.1262 0.1147 0.0998 0.0109  -0.0309 0.0005  160 ARG A O   
1233 C CB  . ARG A 182 ? 0.0946 0.0944 0.0731 0.0066  -0.0242 -0.0011 160 ARG A CB  
1234 C CG  . ARG A 182 ? 0.1021 0.1000 0.0772 0.0065  -0.0211 0.0002  160 ARG A CG  
1235 C CD  . ARG A 182 ? 0.1319 0.1388 0.1104 0.0078  -0.0183 0.0005  160 ARG A CD  
1236 N NE  . ARG A 182 ? 0.1402 0.1490 0.1160 0.0077  -0.0154 0.0030  160 ARG A NE  
1237 C CZ  . ARG A 182 ? 0.1400 0.1545 0.1141 0.0096  -0.0153 0.0013  160 ARG A CZ  
1238 N NH1 . ARG A 182 ? 0.1633 0.1795 0.1381 0.0116  -0.0175 -0.0040 160 ARG A NH1 
1239 N NH2 . ARG A 182 ? 0.1200 0.1392 0.0921 0.0097  -0.0131 0.0045  160 ARG A NH2 
1240 N N   . LEU A 183 ? 0.1108 0.0956 0.0767 0.0065  -0.0268 0.0023  161 LEU A N   
1241 C CA  . LEU A 183 ? 0.1350 0.1153 0.0994 0.0067  -0.0274 0.0046  161 LEU A CA  
1242 C C   . LEU A 183 ? 0.1451 0.1265 0.1098 0.0053  -0.0247 0.0042  161 LEU A C   
1243 O O   . LEU A 183 ? 0.1443 0.1286 0.1074 0.0048  -0.0219 0.0046  161 LEU A O   
1244 C CB  . LEU A 183 ? 0.1506 0.1291 0.1093 0.0059  -0.0278 0.0085  161 LEU A CB  
1245 C CG  . LEU A 183 ? 0.2356 0.2157 0.1919 0.0073  -0.0310 0.0101  161 LEU A CG  
1246 C CD1 . LEU A 183 ? 0.2586 0.2394 0.2077 0.0069  -0.0304 0.0145  161 LEU A CD1 
1247 C CD2 . LEU A 183 ? 0.2787 0.2568 0.2402 0.0100  -0.0342 0.0118  161 LEU A CD2 
1248 N N   . GLN A 184 ? 0.1171 0.0963 0.0846 0.0050  -0.0259 0.0032  162 GLN A N   
1249 C CA  . GLN A 184 ? 0.1210 0.1034 0.0892 0.0030  -0.0245 0.0026  162 GLN A CA  
1250 C C   . GLN A 184 ? 0.1269 0.1047 0.0959 -0.0001 -0.0255 0.0061  162 GLN A C   
1251 O O   . GLN A 184 ? 0.1486 0.1190 0.1208 -0.0005 -0.0279 0.0066  162 GLN A O   
1252 C CB  . GLN A 184 ? 0.1155 0.1010 0.0869 0.0041  -0.0255 -0.0034 162 GLN A CB  
1253 C CG  . GLN A 184 ? 0.1164 0.1082 0.0882 0.0018  -0.0252 -0.0051 162 GLN A CG  
1254 C CD  . GLN A 184 ? 0.1617 0.1548 0.1361 0.0022  -0.0275 -0.0130 162 GLN A CD  
1255 O OE1 . GLN A 184 ? 0.2020 0.1866 0.1804 0.0001  -0.0302 -0.0161 162 GLN A OE1 
1256 N NE2 . GLN A 184 ? 0.1717 0.1757 0.1443 0.0050  -0.0262 -0.0165 162 GLN A NE2 
1257 N N   . ILE A 185 ? 0.1195 0.1022 0.0869 -0.0020 -0.0232 0.0094  163 ILE A N   
1258 C CA  . ILE A 185 ? 0.1357 0.1176 0.1050 -0.0057 -0.0232 0.0142  163 ILE A CA  
1259 C C   . ILE A 185 ? 0.1496 0.1368 0.1243 -0.0093 -0.0239 0.0118  163 ILE A C   
1260 O O   . ILE A 185 ? 0.1210 0.1179 0.0948 -0.0085 -0.0222 0.0111  163 ILE A O   
1261 C CB  . ILE A 185 ? 0.1508 0.1380 0.1151 -0.0047 -0.0197 0.0193  163 ILE A CB  
1262 C CG1 . ILE A 185 ? 0.1724 0.1565 0.1305 -0.0012 -0.0196 0.0191  163 ILE A CG1 
1263 C CG2 . ILE A 185 ? 0.1936 0.1828 0.1604 -0.0085 -0.0190 0.0259  163 ILE A CG2 
1264 C CD1 . ILE A 185 ? 0.1914 0.1693 0.1495 -0.0011 -0.0227 0.0215  163 ILE A CD1 
1265 N N   . LYS A 186 ? 0.1219 0.1029 0.1028 -0.0133 -0.0268 0.0104  164 LYS A N   
1266 C CA  . LYS A 186 ? 0.1133 0.1004 0.0999 -0.0181 -0.0284 0.0067  164 LYS A CA  
1267 C C   . LYS A 186 ? 0.1498 0.1447 0.1399 -0.0228 -0.0266 0.0139  164 LYS A C   
1268 O O   . LYS A 186 ? 0.1880 0.1784 0.1792 -0.0246 -0.0253 0.0214  164 LYS A O   
1269 C CB  . LYS A 186 ? 0.2012 0.1774 0.1944 -0.0211 -0.0325 0.0000  164 LYS A CB  
1270 C CG  . LYS A 186 ? 0.2728 0.2461 0.2630 -0.0154 -0.0337 -0.0085 164 LYS A CG  
1271 C CD  . LYS A 186 ? 0.2859 0.2504 0.2825 -0.0174 -0.0376 -0.0182 164 LYS A CD  
1272 C CE  . LYS A 186 ? 0.3063 0.2732 0.2991 -0.0108 -0.0379 -0.0276 164 LYS A CE  
1273 N NZ  . LYS A 186 ? 0.3570 0.3420 0.3431 -0.0085 -0.0358 -0.0286 164 LYS A NZ  
1274 N N   . ILE A 187 ? 0.1300 0.1390 0.1219 -0.0242 -0.0263 0.0125  165 ILE A N   
1275 C CA  . ILE A 187 ? 0.1333 0.1541 0.1299 -0.0281 -0.0244 0.0192  165 ILE A CA  
1276 C C   . ILE A 187 ? 0.1606 0.1925 0.1656 -0.0344 -0.0279 0.0148  165 ILE A C   
1277 O O   . ILE A 187 ? 0.1473 0.1779 0.1526 -0.0350 -0.0317 0.0056  165 ILE A O   
1278 C CB  . ILE A 187 ? 0.1013 0.1329 0.0918 -0.0216 -0.0196 0.0239  165 ILE A CB  
1279 C CG1 . ILE A 187 ? 0.1110 0.1513 0.0989 -0.0171 -0.0199 0.0195  165 ILE A CG1 
1280 C CG2 . ILE A 187 ? 0.1350 0.1568 0.1173 -0.0164 -0.0166 0.0268  165 ILE A CG2 
1281 C CD1 . ILE A 187 ? 0.1379 0.1897 0.1237 -0.0114 -0.0153 0.0248  165 ILE A CD1 
1282 N N   . GLY A 188 ? 0.1395 0.1843 0.1513 -0.0390 -0.0266 0.0209  166 GLY A N   
1283 C CA  . GLY A 188 ? 0.1804 0.2404 0.2010 -0.0454 -0.0302 0.0172  166 GLY A CA  
1284 C C   . GLY A 188 ? 0.1495 0.2053 0.1831 -0.0571 -0.0336 0.0171  166 GLY A C   
1285 O O   . GLY A 188 ? 0.1776 0.2160 0.2135 -0.0599 -0.0332 0.0205  166 GLY A O   
1286 N N   . GLY A 189 ? 0.1545 0.2269 0.1975 -0.0641 -0.0371 0.0139  167 GLY A N   
1287 C CA  . GLY A 189 ? 0.1708 0.2401 0.2287 -0.0771 -0.0411 0.0127  167 GLY A CA  
1288 C C   . GLY A 189 ? 0.1777 0.2533 0.2448 -0.0827 -0.0368 0.0266  167 GLY A C   
1289 O O   . GLY A 189 ? 0.1855 0.2529 0.2649 -0.0927 -0.0383 0.0287  167 GLY A O   
1290 N N   . ARG A 190 ? 0.1494 0.2391 0.2103 -0.0749 -0.0307 0.0359  168 ARG A N   
1291 C CA  . ARG A 190 ? 0.1335 0.2320 0.2000 -0.0774 -0.0251 0.0497  168 ARG A CA  
1292 C C   . ARG A 190 ? 0.1298 0.2490 0.1893 -0.0670 -0.0197 0.0543  168 ARG A C   
1293 O O   . ARG A 190 ? 0.1327 0.2536 0.1830 -0.0584 -0.0204 0.0479  168 ARG A O   
1294 C CB  . ARG A 190 ? 0.1642 0.2414 0.2246 -0.0752 -0.0219 0.0562  168 ARG A CB  
1295 C CG  . ARG A 190 ? 0.1563 0.2248 0.1991 -0.0621 -0.0191 0.0538  168 ARG A CG  
1296 C CD  . ARG A 190 ? 0.1759 0.2247 0.2125 -0.0599 -0.0175 0.0588  168 ARG A CD  
1297 N NE  . ARG A 190 ? 0.1844 0.2266 0.2058 -0.0487 -0.0160 0.0543  168 ARG A NE  
1298 C CZ  . ARG A 190 ? 0.2319 0.2593 0.2454 -0.0444 -0.0155 0.0561  168 ARG A CZ  
1299 N NH1 . ARG A 190 ? 0.2668 0.2840 0.2852 -0.0492 -0.0160 0.0635  168 ARG A NH1 
1300 N NH2 . ARG A 190 ? 0.2135 0.2370 0.2149 -0.0355 -0.0147 0.0511  168 ARG A NH2 
1301 N N   . PRO A 191 ? 0.1217 0.2569 0.1859 -0.0672 -0.0139 0.0657  169 PRO A N   
1302 C CA  . PRO A 191 ? 0.1128 0.2661 0.1708 -0.0557 -0.0083 0.0690  169 PRO A CA  
1303 C C   . PRO A 191 ? 0.1079 0.2456 0.1483 -0.0429 -0.0054 0.0654  169 PRO A C   
1304 O O   . PRO A 191 ? 0.1113 0.2308 0.1436 -0.0416 -0.0040 0.0664  169 PRO A O   
1305 C CB  . PRO A 191 ? 0.1428 0.3062 0.2039 -0.0554 -0.0027 0.0792  169 PRO A CB  
1306 C CG  . PRO A 191 ? 0.1416 0.3009 0.2156 -0.0686 -0.0066 0.0807  169 PRO A CG  
1307 C CD  . PRO A 191 ? 0.1361 0.2717 0.2098 -0.0750 -0.0121 0.0740  169 PRO A CD  
1308 N N   . VAL A 192 ? 0.1010 0.2466 0.1365 -0.0338 -0.0047 0.0618  170 VAL A N   
1309 C CA  . VAL A 192 ? 0.0976 0.2272 0.1190 -0.0235 -0.0031 0.0572  170 VAL A CA  
1310 C C   . VAL A 192 ? 0.0999 0.2239 0.1122 -0.0164 0.0034  0.0613  170 VAL A C   
1311 O O   . VAL A 192 ? 0.1132 0.2196 0.1146 -0.0114 0.0038  0.0571  170 VAL A O   
1312 C CB  . VAL A 192 ? 0.0921 0.2316 0.1121 -0.0155 -0.0036 0.0543  170 VAL A CB  
1313 C CG1 . VAL A 192 ? 0.1127 0.2718 0.1359 -0.0074 0.0024  0.0609  170 VAL A CG1 
1314 C CG2 . VAL A 192 ? 0.1052 0.2255 0.1134 -0.0085 -0.0037 0.0489  170 VAL A CG2 
1315 N N   . GLU A 193 ? 0.1030 0.2432 0.1197 -0.0161 0.0086  0.0690  171 GLU A N   
1316 C CA  . GLU A 193 ? 0.1085 0.2411 0.1165 -0.0082 0.0130  0.0684  171 GLU A CA  
1317 C C   . GLU A 193 ? 0.1131 0.2276 0.1143 -0.0124 0.0114  0.0683  171 GLU A C   
1318 O O   . GLU A 193 ? 0.1304 0.2343 0.1213 -0.0058 0.0134  0.0644  171 GLU A O   
1319 C CB  . GLU A 193 ? 0.1281 0.2788 0.1423 -0.0059 0.0170  0.0738  171 GLU A CB  
1320 C CG  . GLU A 193 ? 0.1662 0.3252 0.1908 -0.0172 0.0154  0.0814  171 GLU A CG  
1321 C CD  . GLU A 193 ? 0.2212 0.3989 0.2591 -0.0229 0.0130  0.0842  171 GLU A CD  
1322 O OE1 . GLU A 193 ? 0.2494 0.4393 0.2962 -0.0283 0.0136  0.0905  171 GLU A OE1 
1323 O OE2 . GLU A 193 ? 0.2002 0.3814 0.2397 -0.0217 0.0104  0.0801  171 GLU A OE2 
1324 N N   . ILE A 194 ? 0.1147 0.2255 0.1227 -0.0237 0.0075  0.0723  172 ILE A N   
1325 C CA  . ILE A 194 ? 0.1205 0.2129 0.1236 -0.0271 0.0053  0.0733  172 ILE A CA  
1326 C C   . ILE A 194 ? 0.1166 0.1907 0.1103 -0.0230 0.0017  0.0646  172 ILE A C   
1327 O O   . ILE A 194 ? 0.1371 0.1992 0.1216 -0.0196 0.0017  0.0638  172 ILE A O   
1328 C CB  . ILE A 194 ? 0.1414 0.2311 0.1575 -0.0402 0.0017  0.0792  172 ILE A CB  
1329 C CG1 . ILE A 194 ? 0.1703 0.2774 0.1970 -0.0436 0.0046  0.0864  172 ILE A CG1 
1330 C CG2 . ILE A 194 ? 0.1404 0.2100 0.1525 -0.0417 -0.0005 0.0811  172 ILE A CG2 
1331 C CD1 . ILE A 194 ? 0.2212 0.3259 0.2635 -0.0568 0.0005  0.0899  172 ILE A CD1 
1332 N N   . ASP A 195 ? 0.1099 0.1832 0.1066 -0.0227 -0.0016 0.0574  173 ASP A N   
1333 C CA  . ASP A 195 ? 0.1131 0.1721 0.1021 -0.0180 -0.0043 0.0491  173 ASP A CA  
1334 C C   . ASP A 195 ? 0.1046 0.1619 0.0828 -0.0084 -0.0001 0.0475  173 ASP A C   
1335 O O   . ASP A 195 ? 0.1201 0.1640 0.0907 -0.0057 -0.0013 0.0435  173 ASP A O   
1336 C CB  . ASP A 195 ? 0.1058 0.1697 0.0995 -0.0184 -0.0076 0.0433  173 ASP A CB  
1337 C CG  . ASP A 195 ? 0.1396 0.2033 0.1432 -0.0280 -0.0130 0.0409  173 ASP A CG  
1338 O OD1 . ASP A 195 ? 0.1895 0.2407 0.1954 -0.0334 -0.0152 0.0415  173 ASP A OD1 
1339 O OD2 . ASP A 195 ? 0.1580 0.2342 0.1672 -0.0299 -0.0154 0.0379  173 ASP A OD2 
1340 N N   . ILE A 196 ? 0.1041 0.1751 0.0827 -0.0032 0.0047  0.0499  174 ILE A N   
1341 C CA  . ILE A 196 ? 0.1061 0.1726 0.0774 0.0061  0.0086  0.0453  174 ILE A CA  
1342 C C   . ILE A 196 ? 0.1194 0.1798 0.0833 0.0071  0.0101  0.0447  174 ILE A C   
1343 O O   . ILE A 196 ? 0.1286 0.1784 0.0838 0.0112  0.0100  0.0393  174 ILE A O   
1344 C CB  . ILE A 196 ? 0.1062 0.1881 0.0824 0.0124  0.0132  0.0472  174 ILE A CB  
1345 C CG1 . ILE A 196 ? 0.1123 0.1997 0.0939 0.0133  0.0113  0.0474  174 ILE A CG1 
1346 C CG2 . ILE A 196 ? 0.1125 0.1896 0.0807 0.0218  0.0178  0.0432  174 ILE A CG2 
1347 C CD1 . ILE A 196 ? 0.1425 0.2496 0.1321 0.0184  0.0147  0.0517  174 ILE A CD1 
1348 N N   . GLU A 197 ? 0.1215 0.1898 0.0889 0.0030  0.0111  0.0507  175 GLU A N   
1349 C CA  . GLU A 197 ? 0.1532 0.2179 0.1136 0.0038  0.0120  0.0514  175 GLU A CA  
1350 C C   . GLU A 197 ? 0.1380 0.1867 0.0930 0.0014  0.0073  0.0489  175 GLU A C   
1351 O O   . GLU A 197 ? 0.1389 0.1821 0.0848 0.0049  0.0071  0.0452  175 GLU A O   
1352 C CB  . GLU A 197 ? 0.1407 0.2171 0.1080 -0.0011 0.0137  0.0604  175 GLU A CB  
1353 C CG  . GLU A 197 ? 0.1640 0.2390 0.1244 -0.0002 0.0146  0.0629  175 GLU A CG  
1354 C CD  . GLU A 197 ? 0.2744 0.3589 0.2432 -0.0061 0.0156  0.0736  175 GLU A CD  
1355 O OE1 . GLU A 197 ? 0.2951 0.3907 0.2749 -0.0102 0.0166  0.0783  175 GLU A OE1 
1356 O OE2 . GLU A 197 ? 0.2937 0.3753 0.2588 -0.0069 0.0152  0.0778  175 GLU A OE2 
1357 N N   . THR A 198 ? 0.1218 0.1646 0.0828 -0.0044 0.0031  0.0510  176 THR A N   
1358 C CA  . THR A 198 ? 0.1221 0.1507 0.0798 -0.0058 -0.0016 0.0490  176 THR A CA  
1359 C C   . THR A 198 ? 0.1564 0.1776 0.1066 -0.0004 -0.0025 0.0405  176 THR A C   
1360 O O   . THR A 198 ? 0.1313 0.1459 0.0751 0.0015  -0.0043 0.0379  176 THR A O   
1361 C CB  . THR A 198 ? 0.1351 0.1581 0.1013 -0.0127 -0.0063 0.0511  176 THR A CB  
1362 O OG1 . THR A 198 ? 0.1471 0.1749 0.1220 -0.0196 -0.0058 0.0597  176 THR A OG1 
1363 C CG2 . THR A 198 ? 0.1459 0.1539 0.1102 -0.0124 -0.0109 0.0475  176 THR A CG2 
1364 N N   . VAL A 199 ? 0.1131 0.1368 0.0651 0.0017  -0.0015 0.0370  177 VAL A N   
1365 C CA  . VAL A 199 ? 0.1168 0.1336 0.0637 0.0063  -0.0019 0.0304  177 VAL A CA  
1366 C C   . VAL A 199 ? 0.1217 0.1378 0.0598 0.0111  0.0007  0.0268  177 VAL A C   
1367 O O   . VAL A 199 ? 0.1455 0.1541 0.0780 0.0124  -0.0016 0.0220  177 VAL A O   
1368 C CB  . VAL A 199 ? 0.1170 0.1370 0.0690 0.0085  -0.0004 0.0288  177 VAL A CB  
1369 C CG1 . VAL A 199 ? 0.1487 0.1600 0.0975 0.0129  0.0002  0.0231  177 VAL A CG1 
1370 C CG2 . VAL A 199 ? 0.1336 0.1544 0.0931 0.0035  -0.0041 0.0292  177 VAL A CG2 
1371 N N   A ARG A 200 ? 0.1225 0.1480 0.0599 0.0138  0.0052  0.0285  178 ARG A N   
1372 N N   B ARG A 200 ? 0.1245 0.1500 0.0618 0.0137  0.0052  0.0286  178 ARG A N   
1373 C CA  A ARG A 200 ? 0.1315 0.1582 0.0596 0.0189  0.0079  0.0239  178 ARG A CA  
1374 C CA  B ARG A 200 ? 0.1315 0.1581 0.0596 0.0189  0.0078  0.0239  178 ARG A CA  
1375 C C   A ARG A 200 ? 0.1565 0.1815 0.0788 0.0165  0.0048  0.0237  178 ARG A C   
1376 C C   B ARG A 200 ? 0.1565 0.1815 0.0788 0.0164  0.0047  0.0237  178 ARG A C   
1377 O O   A ARG A 200 ? 0.1563 0.1780 0.0706 0.0190  0.0037  0.0170  178 ARG A O   
1378 O O   B ARG A 200 ? 0.1545 0.1760 0.0688 0.0189  0.0035  0.0170  178 ARG A O   
1379 C CB  A ARG A 200 ? 0.1363 0.1758 0.0657 0.0231  0.0136  0.0260  178 ARG A CB  
1380 C CB  B ARG A 200 ? 0.1362 0.1757 0.0657 0.0229  0.0135  0.0260  178 ARG A CB  
1381 C CG  A ARG A 200 ? 0.1568 0.1986 0.0902 0.0287  0.0173  0.0250  178 ARG A CG  
1382 C CG  B ARG A 200 ? 0.1584 0.2008 0.0930 0.0276  0.0169  0.0261  178 ARG A CG  
1383 C CD  A ARG A 200 ? 0.1787 0.2353 0.1150 0.0336  0.0229  0.0275  178 ARG A CD  
1384 C CD  B ARG A 200 ? 0.1820 0.2369 0.1170 0.0340  0.0228  0.0265  178 ARG A CD  
1385 N NE  A ARG A 200 ? 0.2009 0.2603 0.1417 0.0404  0.0266  0.0275  178 ARG A NE  
1386 N NE  B ARG A 200 ? 0.2067 0.2617 0.1448 0.0413  0.0265  0.0253  178 ARG A NE  
1387 C CZ  A ARG A 200 ? 0.2392 0.3138 0.1881 0.0434  0.0301  0.0324  178 ARG A CZ  
1388 C CZ  B ARG A 200 ? 0.1967 0.2396 0.1294 0.0481  0.0285  0.0176  178 ARG A CZ  
1389 N NH1 A ARG A 200 ? 0.2318 0.3199 0.1846 0.0396  0.0305  0.0375  178 ARG A NH1 
1390 N NH1 B ARG A 200 ? 0.2171 0.2483 0.1407 0.0477  0.0264  0.0093  178 ARG A NH1 
1391 N NH2 A ARG A 200 ? 0.1378 0.2148 0.0913 0.0506  0.0332  0.0330  178 ARG A NH2 
1392 N NH2 B ARG A 200 ? 0.2054 0.2466 0.1451 0.0543  0.0313  0.0180  178 ARG A NH2 
1393 N N   . LYS A 201 ? 0.1389 0.1663 0.0654 0.0118  0.0034  0.0310  179 LYS A N   
1394 C CA  . LYS A 201 ? 0.1444 0.1707 0.0660 0.0105  0.0007  0.0330  179 LYS A CA  
1395 C C   . LYS A 201 ? 0.1414 0.1574 0.0616 0.0092  -0.0049 0.0295  179 LYS A C   
1396 O O   . LYS A 201 ? 0.1614 0.1778 0.0752 0.0104  -0.0073 0.0267  179 LYS A O   
1397 C CB  . LYS A 201 ? 0.1587 0.1900 0.0860 0.0070  0.0015  0.0429  179 LYS A CB  
1398 C CG  . LYS A 201 ? 0.2107 0.2563 0.1375 0.0090  0.0070  0.0461  179 LYS A CG  
1399 C CD  . LYS A 201 ? 0.2134 0.2657 0.1478 0.0047  0.0083  0.0569  179 LYS A CD  
1400 C CE  . LYS A 201 ? 0.2529 0.3219 0.1862 0.0076  0.0137  0.0601  179 LYS A CE  
1401 N NZ  . LYS A 201 ? 0.2867 0.3638 0.2277 0.0030  0.0152  0.0718  179 LYS A NZ  
1402 N N   . VAL A 202 ? 0.1326 0.1416 0.0592 0.0071  -0.0072 0.0295  180 VAL A N   
1403 C CA  . VAL A 202 ? 0.1293 0.1307 0.0558 0.0067  -0.0120 0.0259  180 VAL A CA  
1404 C C   . VAL A 202 ? 0.1556 0.1566 0.0766 0.0096  -0.0121 0.0171  180 VAL A C   
1405 O O   . VAL A 202 ? 0.1489 0.1493 0.0671 0.0096  -0.0157 0.0136  180 VAL A O   
1406 C CB  . VAL A 202 ? 0.1206 0.1170 0.0549 0.0049  -0.0136 0.0266  180 VAL A CB  
1407 C CG1 . VAL A 202 ? 0.1446 0.1345 0.0806 0.0052  -0.0172 0.0207  180 VAL A CG1 
1408 C CG2 . VAL A 202 ? 0.1219 0.1168 0.0631 0.0014  -0.0149 0.0335  180 VAL A CG2 
1409 N N   . TRP A 203 ? 0.1527 0.1534 0.0723 0.0126  -0.0083 0.0135  181 TRP A N   
1410 C CA  . TRP A 203 ? 0.1645 0.1598 0.0806 0.0150  -0.0081 0.0041  181 TRP A CA  
1411 C C   . TRP A 203 ? 0.1809 0.1813 0.0865 0.0170  -0.0090 -0.0009 181 TRP A C   
1412 O O   . TRP A 203 ? 0.1697 0.1663 0.0726 0.0163  -0.0125 -0.0086 181 TRP A O   
1413 C CB  . TRP A 203 ? 0.1571 0.1498 0.0770 0.0181  -0.0032 0.0020  181 TRP A CB  
1414 C CG  . TRP A 203 ? 0.1814 0.1651 0.1004 0.0200  -0.0026 -0.0073 181 TRP A CG  
1415 C CD1 . TRP A 203 ? 0.2172 0.1993 0.1318 0.0251  0.0013  -0.0136 181 TRP A CD1 
1416 C CD2 . TRP A 203 ? 0.1732 0.1479 0.0971 0.0167  -0.0060 -0.0117 181 TRP A CD2 
1417 N NE1 . TRP A 203 ? 0.2389 0.2091 0.1560 0.0244  0.0002  -0.0220 181 TRP A NE1 
1418 C CE2 . TRP A 203 ? 0.2037 0.1701 0.1269 0.0187  -0.0043 -0.0203 181 TRP A CE2 
1419 C CE3 . TRP A 203 ? 0.1920 0.1655 0.1218 0.0122  -0.0101 -0.0093 181 TRP A CE3 
1420 C CZ2 . TRP A 203 ? 0.2368 0.1934 0.1659 0.0150  -0.0067 -0.0256 181 TRP A CZ2 
1421 C CZ3 . TRP A 203 ? 0.2791 0.2457 0.2140 0.0095  -0.0120 -0.0141 181 TRP A CZ3 
1422 C CH2 . TRP A 203 ? 0.2100 0.1682 0.1451 0.0102  -0.0104 -0.0217 181 TRP A CH2 
1423 N N   . GLU A 204 ? 0.1519 0.1620 0.0551 0.0179  -0.0058 0.0033  182 GLU A N   
1424 C CA  . GLU A 204 ? 0.2338 0.2504 0.1291 0.0189  -0.0063 -0.0006 182 GLU A CA  
1425 C C   . GLU A 204 ? 0.2222 0.2391 0.1170 0.0155  -0.0124 0.0001  182 GLU A C   
1426 O O   . GLU A 204 ? 0.2089 0.2282 0.0978 0.0158  -0.0148 -0.0072 182 GLU A O   
1427 C CB  . GLU A 204 ? 0.2504 0.2779 0.1439 0.0204  -0.0020 0.0061  182 GLU A CB  
1428 C CG  . GLU A 204 ? 0.3806 0.4118 0.2728 0.0256  0.0041  0.0023  182 GLU A CG  
1429 C CD  . GLU A 204 ? 0.5176 0.5440 0.4028 0.0298  0.0044  -0.0114 182 GLU A CD  
1430 O OE1 . GLU A 204 ? 0.5873 0.6174 0.4655 0.0296  0.0021  -0.0168 182 GLU A OE1 
1431 O OE2 . GLU A 204 ? 0.4786 0.4963 0.3658 0.0332  0.0068  -0.0169 182 GLU A OE2 
1432 N N   . ARG A 205 ? 0.1721 0.1864 0.0734 0.0126  -0.0150 0.0082  183 ARG A N   
1433 C CA  . ARG A 205 ? 0.2076 0.2222 0.1095 0.0108  -0.0206 0.0099  183 ARG A CA  
1434 C C   . ARG A 205 ? 0.2248 0.2354 0.1305 0.0093  -0.0247 0.0026  183 ARG A C   
1435 O O   . ARG A 205 ? 0.2601 0.2745 0.1644 0.0084  -0.0290 -0.0002 183 ARG A O   
1436 C CB  . ARG A 205 ? 0.2320 0.2435 0.1400 0.0096  -0.0218 0.0205  183 ARG A CB  
1437 C CG  . ARG A 205 ? 0.2724 0.2886 0.1783 0.0105  -0.0186 0.0287  183 ARG A CG  
1438 C CD  . ARG A 205 ? 0.2985 0.3241 0.1966 0.0125  -0.0197 0.0294  183 ARG A CD  
1439 N NE  . ARG A 205 ? 0.3549 0.3815 0.2553 0.0129  -0.0209 0.0399  183 ARG A NE  
1440 C CZ  . ARG A 205 ? 0.3632 0.3911 0.2672 0.0122  -0.0172 0.0490  183 ARG A CZ  
1441 N NH1 . ARG A 205 ? 0.3340 0.3639 0.2398 0.0111  -0.0123 0.0489  183 ARG A NH1 
1442 N NH2 . ARG A 205 ? 0.3191 0.3470 0.2260 0.0125  -0.0183 0.0588  183 ARG A NH2 
1443 N N   . ILE A 206 ? 0.1962 0.1994 0.1072 0.0093  -0.0235 0.0000  184 ILE A N   
1444 C CA  . ILE A 206 ? 0.1818 0.1799 0.0983 0.0077  -0.0273 -0.0051 184 ILE A CA  
1445 C C   . ILE A 206 ? 0.2135 0.2051 0.1281 0.0072  -0.0273 -0.0159 184 ILE A C   
1446 O O   . ILE A 206 ? 0.2264 0.2152 0.1481 0.0040  -0.0301 -0.0200 184 ILE A O   
1447 C CB  . ILE A 206 ? 0.1812 0.1729 0.1059 0.0071  -0.0273 -0.0001 184 ILE A CB  
1448 C CG1 . ILE A 206 ? 0.1951 0.1810 0.1230 0.0072  -0.0222 -0.0004 184 ILE A CG1 
1449 C CG2 . ILE A 206 ? 0.2076 0.2030 0.1359 0.0074  -0.0276 0.0090  184 ILE A CG2 
1450 C CD1 . ILE A 206 ? 0.2102 0.1927 0.1475 0.0059  -0.0220 0.0023  184 ILE A CD1 
1451 N N   . ARG A 207 ? 0.1917 0.1813 0.1007 0.0097  -0.0230 -0.0201 185 ARG A N   
1452 C CA  . ARG A 207 ? 0.1906 0.1719 0.1013 0.0089  -0.0219 -0.0306 185 ARG A CA  
1453 C C   . ARG A 207 ? 0.2179 0.2029 0.1269 0.0055  -0.0276 -0.0394 185 ARG A C   
1454 O O   . ARG A 207 ? 0.2469 0.2432 0.1508 0.0052  -0.0291 -0.0379 185 ARG A O   
1455 C CB  . ARG A 207 ? 0.2233 0.2030 0.1272 0.0140  -0.0164 -0.0345 185 ARG A CB  
1456 C CG  . ARG A 207 ? 0.3341 0.3265 0.2277 0.0161  -0.0161 -0.0351 185 ARG A CG  
1457 C CD  . ARG A 207 ? 0.4492 0.4431 0.3379 0.0220  -0.0095 -0.0367 185 ARG A CD  
1458 N NE  . ARG A 207 ? 0.5456 0.5268 0.4353 0.0243  -0.0074 -0.0485 185 ARG A NE  
1459 C CZ  . ARG A 207 ? 0.6050 0.5832 0.4936 0.0307  -0.0011 -0.0507 185 ARG A CZ  
1460 N NH1 . ARG A 207 ? 0.6673 0.6312 0.5597 0.0327  0.0009  -0.0610 185 ARG A NH1 
1461 N NH2 . ARG A 207 ? 0.5761 0.5658 0.4624 0.0347  0.0034  -0.0418 185 ARG A NH2 
1462 N N   . GLY A 208 ? 0.2388 0.2150 0.1560 0.0013  -0.0294 -0.0462 186 GLY A N   
1463 C CA  . GLY A 208 ? 0.2421 0.2228 0.1617 -0.0040 -0.0340 -0.0539 186 GLY A CA  
1464 C C   . GLY A 208 ? 0.2294 0.2201 0.1553 -0.0076 -0.0392 -0.0486 186 GLY A C   
1465 O O   . GLY A 208 ? 0.2618 0.2579 0.1904 -0.0123 -0.0434 -0.0533 186 GLY A O   
1466 N N   . THR A 209 ? 0.1982 0.1909 0.1265 -0.0050 -0.0391 -0.0387 187 THR A N   
1467 C CA  . THR A 209 ? 0.1890 0.1912 0.1243 -0.0066 -0.0432 -0.0334 187 THR A CA  
1468 C C   . THR A 209 ? 0.1888 0.1861 0.1370 -0.0099 -0.0433 -0.0326 187 THR A C   
1469 O O   . THR A 209 ? 0.2316 0.2373 0.1871 -0.0107 -0.0465 -0.0293 187 THR A O   
1470 C CB  . THR A 209 ? 0.1852 0.1929 0.1178 -0.0020 -0.0423 -0.0224 187 THR A CB  
1471 O OG1 . THR A 209 ? 0.1828 0.1812 0.1166 0.0003  -0.0388 -0.0176 187 THR A OG1 
1472 C CG2 . THR A 209 ? 0.1753 0.1883 0.0972 0.0001  -0.0412 -0.0202 187 THR A CG2 
1473 N N   . GLY A 210 ? 0.2082 0.1935 0.1606 -0.0113 -0.0382 -0.0339 188 GLY A N   
1474 C CA  . GLY A 210 ? 0.2121 0.1945 0.1775 -0.0144 -0.0359 -0.0303 188 GLY A CA  
1475 C C   . GLY A 210 ? 0.2538 0.2391 0.2216 -0.0107 -0.0333 -0.0212 188 GLY A C   
1476 O O   . GLY A 210 ? 0.3551 0.3428 0.3324 -0.0123 -0.0317 -0.0177 188 GLY A O   
1477 N N   . THR A 211 ? 0.1732 0.1589 0.1324 -0.0060 -0.0326 -0.0176 189 THR A N   
1478 C CA  . THR A 211 ? 0.1266 0.1137 0.0877 -0.0029 -0.0309 -0.0109 189 THR A CA  
1479 C C   . THR A 211 ? 0.1494 0.1302 0.1118 -0.0020 -0.0253 -0.0082 189 THR A C   
1480 O O   . THR A 211 ? 0.1502 0.1256 0.1076 -0.0010 -0.0227 -0.0091 189 THR A O   
1481 C CB  . THR A 211 ? 0.1139 0.1030 0.0672 0.0007  -0.0326 -0.0074 189 THR A CB  
1482 O OG1 . THR A 211 ? 0.1463 0.1431 0.0980 0.0009  -0.0379 -0.0084 189 THR A OG1 
1483 C CG2 . THR A 211 ? 0.1505 0.1387 0.1069 0.0030  -0.0313 -0.0022 189 THR A CG2 
1484 N N   . ARG A 212 ? 0.1197 0.1033 0.0885 -0.0017 -0.0236 -0.0048 190 ARG A N   
1485 C CA  . ARG A 212 ? 0.1022 0.0834 0.0716 -0.0004 -0.0190 -0.0013 190 ARG A CA  
1486 C C   . ARG A 212 ? 0.1118 0.0936 0.0762 0.0024  -0.0187 0.0010  190 ARG A C   
1487 O O   . ARG A 212 ? 0.1097 0.0935 0.0730 0.0032  -0.0216 0.0011  190 ARG A O   
1488 C CB  . ARG A 212 ? 0.1825 0.1690 0.1598 -0.0011 -0.0169 0.0015  190 ARG A CB  
1489 C CG  . ARG A 212 ? 0.2391 0.2235 0.2235 -0.0052 -0.0159 0.0011  190 ARG A CG  
1490 C CD  . ARG A 212 ? 0.2467 0.2376 0.2390 -0.0058 -0.0122 0.0068  190 ARG A CD  
1491 N NE  . ARG A 212 ? 0.2238 0.2263 0.2168 -0.0034 -0.0131 0.0075  190 ARG A NE  
1492 C CZ  . ARG A 212 ? 0.2805 0.2902 0.2778 -0.0043 -0.0159 0.0051  190 ARG A CZ  
1493 N NH1 . ARG A 212 ? 0.3100 0.3181 0.3111 -0.0083 -0.0189 0.0021  190 ARG A NH1 
1494 N NH2 . ARG A 212 ? 0.2473 0.2667 0.2453 -0.0006 -0.0160 0.0050  190 ARG A NH2 
1495 N N   . LEU A 213 ? 0.1272 0.1075 0.0899 0.0038  -0.0153 0.0033  191 LEU A N   
1496 C CA  . LEU A 213 ? 0.1368 0.1190 0.0962 0.0050  -0.0151 0.0055  191 LEU A CA  
1497 C C   . LEU A 213 ? 0.1127 0.1003 0.0749 0.0060  -0.0130 0.0082  191 LEU A C   
1498 O O   . LEU A 213 ? 0.1313 0.1200 0.0955 0.0073  -0.0099 0.0106  191 LEU A O   
1499 C CB  . LEU A 213 ? 0.1478 0.1275 0.1019 0.0062  -0.0133 0.0056  191 LEU A CB  
1500 C CG  . LEU A 213 ? 0.1523 0.1360 0.1044 0.0067  -0.0125 0.0090  191 LEU A CG  
1501 C CD1 . LEU A 213 ? 0.2034 0.1871 0.1547 0.0049  -0.0159 0.0102  191 LEU A CD1 
1502 C CD2 . LEU A 213 ? 0.1750 0.1588 0.1222 0.0090  -0.0094 0.0091  191 LEU A CD2 
1503 N N   . ALA A 214 ? 0.1064 0.0973 0.0690 0.0055  -0.0150 0.0078  192 ALA A N   
1504 C CA  . ALA A 214 ? 0.0873 0.0857 0.0515 0.0059  -0.0142 0.0089  192 ALA A CA  
1505 C C   . ALA A 214 ? 0.0869 0.0860 0.0505 0.0041  -0.0154 0.0097  192 ALA A C   
1506 O O   . ALA A 214 ? 0.1432 0.1368 0.1063 0.0024  -0.0175 0.0092  192 ALA A O   
1507 C CB  . ALA A 214 ? 0.1249 0.1279 0.0913 0.0062  -0.0159 0.0056  192 ALA A CB  
1508 N N   . VAL A 215 ? 0.0858 0.0928 0.0505 0.0043  -0.0140 0.0120  193 VAL A N   
1509 C CA  . VAL A 215 ? 0.1001 0.1108 0.0666 0.0015  -0.0150 0.0132  193 VAL A CA  
1510 C C   . VAL A 215 ? 0.1040 0.1243 0.0736 -0.0001 -0.0172 0.0105  193 VAL A C   
1511 O O   . VAL A 215 ? 0.1153 0.1457 0.0848 0.0024  -0.0158 0.0122  193 VAL A O   
1512 C CB  . VAL A 215 ? 0.1102 0.1252 0.0759 0.0034  -0.0114 0.0181  193 VAL A CB  
1513 C CG1 . VAL A 215 ? 0.1183 0.1417 0.0880 -0.0002 -0.0122 0.0204  193 VAL A CG1 
1514 C CG2 . VAL A 215 ? 0.1271 0.1336 0.0883 0.0048  -0.0098 0.0185  193 VAL A CG2 
1515 N N   . ASP A 216 ? 0.0904 0.1075 0.0628 -0.0041 -0.0208 0.0061  194 ASP A N   
1516 C CA  . ASP A 216 ? 0.0928 0.1179 0.0674 -0.0058 -0.0238 0.0002  194 ASP A CA  
1517 C C   . ASP A 216 ? 0.0960 0.1281 0.0760 -0.0114 -0.0260 0.0002  194 ASP A C   
1518 O O   . ASP A 216 ? 0.1011 0.1248 0.0855 -0.0162 -0.0277 0.0001  194 ASP A O   
1519 C CB  . ASP A 216 ? 0.1060 0.1216 0.0813 -0.0060 -0.0266 -0.0071 194 ASP A CB  
1520 C CG  . ASP A 216 ? 0.1241 0.1487 0.0994 -0.0058 -0.0292 -0.0156 194 ASP A CG  
1521 O OD1 . ASP A 216 ? 0.1193 0.1577 0.0950 -0.0075 -0.0302 -0.0163 194 ASP A OD1 
1522 O OD2 . ASP A 216 ? 0.1345 0.1540 0.1092 -0.0034 -0.0302 -0.0220 194 ASP A OD2 
1523 N N   . GLY A 217 ? 0.1263 0.1271 0.0976 -0.0018 -0.0114 0.0087  195 GLY A N   
1524 C CA  . GLY A 217 ? 0.1260 0.1268 0.0998 -0.0031 -0.0102 0.0089  195 GLY A CA  
1525 C C   . GLY A 217 ? 0.1361 0.1350 0.1127 -0.0038 -0.0104 0.0085  195 GLY A C   
1526 O O   . GLY A 217 ? 0.1587 0.1575 0.1380 -0.0052 -0.0093 0.0084  195 GLY A O   
1527 N N   . ASN A 218 ? 0.1036 0.1013 0.0800 -0.0030 -0.0117 0.0080  196 ASN A N   
1528 C CA  . ASN A 218 ? 0.1306 0.1265 0.1095 -0.0035 -0.0120 0.0072  196 ASN A CA  
1529 C C   . ASN A 218 ? 0.1188 0.1162 0.1013 -0.0049 -0.0117 0.0053  196 ASN A C   
1530 O O   . ASN A 218 ? 0.1394 0.1353 0.1246 -0.0061 -0.0108 0.0052  196 ASN A O   
1531 C CB  . ASN A 218 ? 0.2066 0.1992 0.1855 -0.0035 -0.0110 0.0093  196 ASN A CB  
1532 C CG  . ASN A 218 ? 0.2562 0.2477 0.2322 -0.0018 -0.0120 0.0105  196 ASN A CG  
1533 O OD1 . ASN A 218 ? 0.2282 0.2195 0.2015 -0.0010 -0.0115 0.0125  196 ASN A OD1 
1534 N ND2 . ASN A 218 ? 0.2341 0.2254 0.2107 -0.0011 -0.0133 0.0092  196 ASN A ND2 
1535 N N   . ARG A 219 ? 0.1105 0.1110 0.0931 -0.0045 -0.0124 0.0038  197 ARG A N   
1536 C CA  . ARG A 219 ? 0.0785 0.0815 0.0642 -0.0053 -0.0127 0.0017  197 ARG A CA  
1537 C C   . ARG A 219 ? 0.0953 0.0996 0.0834 -0.0068 -0.0112 0.0018  197 ARG A C   
1538 O O   . ARG A 219 ? 0.1375 0.1443 0.1289 -0.0076 -0.0114 -0.0002 197 ARG A O   
1539 C CB  . ARG A 219 ? 0.0867 0.0887 0.0747 -0.0057 -0.0134 0.0000  197 ARG A CB  
1540 C CG  . ARG A 219 ? 0.1002 0.1014 0.0863 -0.0043 -0.0148 -0.0005 197 ARG A CG  
1541 C CD  . ARG A 219 ? 0.1193 0.1204 0.1079 -0.0046 -0.0155 -0.0028 197 ARG A CD  
1542 N NE  . ARG A 219 ? 0.1878 0.1855 0.1785 -0.0058 -0.0145 -0.0025 197 ARG A NE  
1543 C CZ  . ARG A 219 ? 0.2480 0.2459 0.2427 -0.0075 -0.0139 -0.0042 197 ARG A CZ  
1544 N NH1 . ARG A 219 ? 0.2557 0.2576 0.2526 -0.0081 -0.0144 -0.0066 197 ARG A NH1 
1545 N NH2 . ARG A 219 ? 0.2464 0.2404 0.2432 -0.0084 -0.0127 -0.0038 197 ARG A NH2 
1546 N N   . SER A 220 ? 0.1093 0.1125 0.0959 -0.0071 -0.0097 0.0039  198 SER A N   
1547 C CA  . SER A 220 ? 0.1206 0.1242 0.1098 -0.0087 -0.0078 0.0043  198 SER A CA  
1548 C C   . SER A 220 ? 0.1425 0.1495 0.1319 -0.0088 -0.0071 0.0042  198 SER A C   
1549 O O   . SER A 220 ? 0.1421 0.1503 0.1344 -0.0103 -0.0055 0.0041  198 SER A O   
1550 C CB  . SER A 220 ? 0.1656 0.1655 0.1536 -0.0092 -0.0061 0.0070  198 SER A CB  
1551 O OG  . SER A 220 ? 0.1702 0.1701 0.1541 -0.0080 -0.0057 0.0090  198 SER A OG  
1552 N N   . LEU A 221 ? 0.0940 0.1024 0.0805 -0.0073 -0.0080 0.0041  199 LEU A N   
1553 C CA  . LEU A 221 ? 0.0950 0.1063 0.0815 -0.0071 -0.0071 0.0040  199 LEU A CA  
1554 C C   . LEU A 221 ? 0.0819 0.0969 0.0711 -0.0067 -0.0081 0.0019  199 LEU A C   
1555 O O   . LEU A 221 ? 0.0938 0.1092 0.0822 -0.0054 -0.0097 0.0009  199 LEU A O   
1556 C CB  . LEU A 221 ? 0.0898 0.1008 0.0723 -0.0056 -0.0073 0.0049  199 LEU A CB  
1557 C CG  . LEU A 221 ? 0.1345 0.1426 0.1134 -0.0053 -0.0070 0.0068  199 LEU A CG  
1558 C CD1 . LEU A 221 ? 0.1543 0.1631 0.1301 -0.0040 -0.0073 0.0067  199 LEU A CD1 
1559 C CD2 . LEU A 221 ? 0.1406 0.1480 0.1197 -0.0064 -0.0049 0.0085  199 LEU A CD2 
1560 N N   . PRO A 222 ? 0.0791 0.0971 0.0714 -0.0075 -0.0070 0.0012  200 PRO A N   
1561 C CA  . PRO A 222 ? 0.0750 0.0972 0.0692 -0.0065 -0.0080 -0.0006 200 PRO A CA  
1562 C C   . PRO A 222 ? 0.1094 0.1316 0.1002 -0.0045 -0.0081 0.0002  200 PRO A C   
1563 O O   . PRO A 222 ? 0.0921 0.1122 0.0803 -0.0045 -0.0070 0.0016  200 PRO A O   
1564 C CB  . PRO A 222 ? 0.1059 0.1312 0.1040 -0.0078 -0.0065 -0.0012 200 PRO A CB  
1565 C CG  . PRO A 222 ? 0.1758 0.1983 0.1750 -0.0100 -0.0048 -0.0002 200 PRO A CG  
1566 C CD  . PRO A 222 ? 0.1034 0.1214 0.0978 -0.0093 -0.0048 0.0020  200 PRO A CD  
1567 N N   A SER A 223 ? 0.0985 0.1231 0.0897 -0.0028 -0.0092 -0.0008 201 SER A N   
1568 N N   B SER A 223 ? 0.0981 0.1227 0.0892 -0.0028 -0.0092 -0.0008 201 SER A N   
1569 C CA  A SER A 223 ? 0.0944 0.1186 0.0830 -0.0009 -0.0090 -0.0002 201 SER A CA  
1570 C CA  B SER A 223 ? 0.0900 0.1140 0.0785 -0.0009 -0.0090 -0.0001 201 SER A CA  
1571 C C   A SER A 223 ? 0.0883 0.1130 0.0767 -0.0012 -0.0071 0.0004  201 SER A C   
1572 C C   B SER A 223 ? 0.0829 0.1076 0.0713 -0.0012 -0.0071 0.0004  201 SER A C   
1573 O O   A SER A 223 ? 0.1020 0.1248 0.0876 -0.0005 -0.0065 0.0011  201 SER A O   
1574 O O   B SER A 223 ? 0.1110 0.1339 0.0967 -0.0005 -0.0065 0.0010  201 SER A O   
1575 C CB  A SER A 223 ? 0.0945 0.1218 0.0842 0.0012  -0.0100 -0.0010 201 SER A CB  
1576 C CB  B SER A 223 ? 0.0981 0.1249 0.0874 0.0012  -0.0101 -0.0009 201 SER A CB  
1577 O OG  A SER A 223 ? 0.0843 0.1112 0.0735 0.0017  -0.0116 -0.0016 201 SER A OG  
1578 O OG  B SER A 223 ? 0.0999 0.1312 0.0927 0.0014  -0.0101 -0.0021 201 SER A OG  
1579 N N   . ARG A 224 ? 0.0783 0.1059 0.0699 -0.0023 -0.0062 -0.0001 202 ARG A N   
1580 C CA  . ARG A 224 ? 0.0744 0.1029 0.0661 -0.0028 -0.0042 0.0004  202 ARG A CA  
1581 C C   . ARG A 224 ? 0.0852 0.1101 0.0731 -0.0034 -0.0032 0.0018  202 ARG A C   
1582 O O   . ARG A 224 ? 0.0945 0.1193 0.0803 -0.0026 -0.0021 0.0021  202 ARG A O   
1583 C CB  . ARG A 224 ? 0.0998 0.1311 0.0957 -0.0046 -0.0031 -0.0002 202 ARG A CB  
1584 C CG  . ARG A 224 ? 0.1111 0.1433 0.1072 -0.0054 -0.0006 0.0005  202 ARG A CG  
1585 C CD  . ARG A 224 ? 0.1040 0.1379 0.1042 -0.0077 0.0008  0.0003  202 ARG A CD  
1586 N NE  . ARG A 224 ? 0.0990 0.1290 0.0981 -0.0093 0.0013  0.0017  202 ARG A NE  
1587 C CZ  . ARG A 224 ? 0.0928 0.1228 0.0956 -0.0114 0.0021  0.0014  202 ARG A CZ  
1588 N NH1 . ARG A 224 ? 0.1144 0.1486 0.1227 -0.0125 0.0025  -0.0005 202 ARG A NH1 
1589 N NH2 . ARG A 224 ? 0.0986 0.1243 0.0998 -0.0125 0.0027  0.0030  202 ARG A NH2 
1590 N N   . ASP A 225 ? 0.0924 0.1147 0.0793 -0.0045 -0.0035 0.0027  203 ASP A N   
1591 C CA  . ASP A 225 ? 0.0791 0.0986 0.0624 -0.0049 -0.0026 0.0042  203 ASP A CA  
1592 C C   . ASP A 225 ? 0.1073 0.1246 0.0871 -0.0037 -0.0039 0.0043  203 ASP A C   
1593 O O   . ASP A 225 ? 0.1161 0.1325 0.0928 -0.0034 -0.0033 0.0049  203 ASP A O   
1594 C CB  . ASP A 225 ? 0.0934 0.1111 0.0776 -0.0066 -0.0020 0.0054  203 ASP A CB  
1595 C CG  . ASP A 225 ? 0.0826 0.1022 0.0702 -0.0081 0.0000  0.0056  203 ASP A CG  
1596 O OD1 . ASP A 225 ? 0.1042 0.1267 0.0927 -0.0078 0.0011  0.0051  203 ASP A OD1 
1597 O OD2 . ASP A 225 ? 0.1221 0.1404 0.1119 -0.0096 0.0007  0.0062  203 ASP A OD2 
1598 N N   . ALA A 226 ? 0.0940 0.1108 0.0744 -0.0030 -0.0056 0.0035  204 ALA A N   
1599 C CA  . ALA A 226 ? 0.1067 0.1216 0.0845 -0.0019 -0.0065 0.0034  204 ALA A CA  
1600 C C   . ALA A 226 ? 0.0953 0.1110 0.0722 -0.0008 -0.0058 0.0027  204 ALA A C   
1601 O O   . ALA A 226 ? 0.0945 0.1091 0.0690 -0.0005 -0.0056 0.0025  204 ALA A O   
1602 C CB  . ALA A 226 ? 0.1093 0.1236 0.0880 -0.0013 -0.0081 0.0028  204 ALA A CB  
1603 N N   . LEU A 227 ? 0.1113 0.1293 0.0906 -0.0002 -0.0053 0.0020  205 LEU A N   
1604 C CA  . LEU A 227 ? 0.0753 0.0941 0.0544 0.0009  -0.0042 0.0014  205 LEU A CA  
1605 C C   . LEU A 227 ? 0.0880 0.1069 0.0652 0.0003  -0.0028 0.0014  205 LEU A C   
1606 O O   . LEU A 227 ? 0.1051 0.1232 0.0806 0.0009  -0.0023 0.0006  205 LEU A O   
1607 C CB  . LEU A 227 ? 0.0961 0.1178 0.0782 0.0018  -0.0039 0.0009  205 LEU A CB  
1608 C CG  . LEU A 227 ? 0.1101 0.1324 0.0935 0.0033  -0.0051 0.0008  205 LEU A CG  
1609 C CD1 . LEU A 227 ? 0.1001 0.1264 0.0868 0.0040  -0.0051 0.0003  205 LEU A CD1 
1610 C CD2 . LEU A 227 ? 0.1206 0.1408 0.1027 0.0049  -0.0048 0.0007  205 LEU A CD2 
1611 N N   . ARG A 228 ? 0.0861 0.1062 0.0638 -0.0009 -0.0020 0.0022  206 ARG A N   
1612 C CA  . ARG A 228 ? 0.0904 0.1111 0.0660 -0.0013 -0.0004 0.0025  206 ARG A CA  
1613 C C   . ARG A 228 ? 0.0935 0.1122 0.0652 -0.0013 -0.0009 0.0028  206 ARG A C   
1614 O O   . ARG A 228 ? 0.1031 0.1223 0.0726 -0.0008 -0.0002 0.0019  206 ARG A O   
1615 C CB  . ARG A 228 ? 0.0926 0.1145 0.0696 -0.0026 0.0009  0.0036  206 ARG A CB  
1616 C CG  . ARG A 228 ? 0.0999 0.1223 0.0741 -0.0030 0.0027  0.0044  206 ARG A CG  
1617 C CD  . ARG A 228 ? 0.0871 0.1105 0.0632 -0.0044 0.0044  0.0058  206 ARG A CD  
1618 N NE  . ARG A 228 ? 0.0962 0.1199 0.0692 -0.0045 0.0064  0.0071  206 ARG A NE  
1619 C CZ  . ARG A 228 ? 0.1225 0.1466 0.0964 -0.0057 0.0085  0.0087  206 ARG A CZ  
1620 N NH1 . ARG A 228 ? 0.1310 0.1555 0.1096 -0.0071 0.0088  0.0089  206 ARG A NH1 
1621 N NH2 . ARG A 228 ? 0.1250 0.1494 0.0953 -0.0055 0.0104  0.0102  206 ARG A NH2 
1622 N N   . LEU A 229 ? 0.0821 0.0989 0.0531 -0.0017 -0.0022 0.0037  207 LEU A N   
1623 C CA  . LEU A 229 ? 0.0871 0.1026 0.0547 -0.0015 -0.0030 0.0041  207 LEU A CA  
1624 C C   . LEU A 229 ? 0.1080 0.1234 0.0747 -0.0006 -0.0036 0.0022  207 LEU A C   
1625 O O   . LEU A 229 ? 0.1058 0.1219 0.0698 -0.0003 -0.0034 0.0015  207 LEU A O   
1626 C CB  . LEU A 229 ? 0.1010 0.1145 0.0688 -0.0018 -0.0044 0.0053  207 LEU A CB  
1627 C CG  . LEU A 229 ? 0.1437 0.1560 0.1088 -0.0013 -0.0056 0.0055  207 LEU A CG  
1628 C CD1 . LEU A 229 ? 0.1541 0.1673 0.1155 -0.0009 -0.0049 0.0065  207 LEU A CD1 
1629 C CD2 . LEU A 229 ? 0.1390 0.1493 0.1050 -0.0016 -0.0067 0.0067  207 LEU A CD2 
1630 N N   . SER A 230 ? 0.0909 0.1055 0.0597 -0.0002 -0.0042 0.0013  208 SER A N   
1631 C CA  . SER A 230 ? 0.0920 0.1060 0.0606 0.0005  -0.0043 -0.0005 208 SER A CA  
1632 C C   . SER A 230 ? 0.1036 0.1189 0.0722 0.0009  -0.0027 -0.0019 208 SER A C   
1633 O O   . SER A 230 ? 0.1105 0.1260 0.0777 0.0010  -0.0025 -0.0036 208 SER A O   
1634 C CB  . SER A 230 ? 0.1090 0.1216 0.0798 0.0010  -0.0050 -0.0006 208 SER A CB  
1635 O OG  . SER A 230 ? 0.0992 0.1108 0.0703 0.0015  -0.0046 -0.0022 208 SER A OG  
1636 N N   . ARG A 231 ? 0.0989 0.1153 0.0694 0.0011  -0.0016 -0.0016 209 ARG A N   
1637 C CA  . ARG A 231 ? 0.0899 0.1076 0.0609 0.0017  0.0001  -0.0030 209 ARG A CA  
1638 C C   . ARG A 231 ? 0.0959 0.1151 0.0641 0.0013  0.0009  -0.0037 209 ARG A C   
1639 O O   . ARG A 231 ? 0.1254 0.1450 0.0931 0.0017  0.0019  -0.0057 209 ARG A O   
1640 C CB  . ARG A 231 ? 0.0978 0.1172 0.0715 0.0020  0.0010  -0.0022 209 ARG A CB  
1641 C CG  . ARG A 231 ? 0.1039 0.1248 0.0787 0.0028  0.0028  -0.0035 209 ARG A CG  
1642 C CD  . ARG A 231 ? 0.0898 0.1130 0.0676 0.0032  0.0034  -0.0028 209 ARG A CD  
1643 N NE  . ARG A 231 ? 0.0895 0.1147 0.0671 0.0019  0.0039  -0.0017 209 ARG A NE  
1644 C CZ  . ARG A 231 ? 0.0816 0.1075 0.0609 0.0011  0.0032  -0.0004 209 ARG A CZ  
1645 N NH1 . ARG A 231 ? 0.0929 0.1183 0.0740 0.0015  0.0016  -0.0002 209 ARG A NH1 
1646 N NH2 . ARG A 231 ? 0.0843 0.1116 0.0637 -0.0002 0.0042  0.0005  209 ARG A NH2 
1647 N N   . GLU A 232 ? 0.0864 0.1063 0.0526 0.0006  0.0007  -0.0020 210 GLU A N   
1648 C CA  . GLU A 232 ? 0.0897 0.1113 0.0525 0.0005  0.0016  -0.0021 210 GLU A CA  
1649 C C   . GLU A 232 ? 0.1241 0.1456 0.0838 0.0008  0.0004  -0.0034 210 GLU A C   
1650 O O   . GLU A 232 ? 0.1437 0.1672 0.1005 0.0011  0.0010  -0.0043 210 GLU A O   
1651 C CB  . GLU A 232 ? 0.1143 0.1365 0.0761 -0.0001 0.0022  0.0005  210 GLU A CB  
1652 C CG  . GLU A 232 ? 0.1007 0.1242 0.0655 -0.0005 0.0038  0.0012  210 GLU A CG  
1653 C CD  . GLU A 232 ? 0.1345 0.1586 0.0984 -0.0014 0.0052  0.0035  210 GLU A CD  
1654 O OE1 . GLU A 232 ? 0.1392 0.1628 0.0995 -0.0013 0.0050  0.0049  210 GLU A OE1 
1655 O OE2 . GLU A 232 ? 0.1281 0.1535 0.0952 -0.0020 0.0065  0.0040  210 GLU A OE2 
1656 N N   . CYS A 233 ? 0.1317 0.1515 0.0921 0.0007  -0.0013 -0.0035 211 CYS A N   
1657 C CA  . CYS A 233 ? 0.1257 0.1460 0.0836 0.0010  -0.0027 -0.0045 211 CYS A CA  
1658 C C   . CYS A 233 ? 0.1009 0.1203 0.0606 0.0010  -0.0036 -0.0071 211 CYS A C   
1659 O O   . CYS A 233 ? 0.1137 0.1325 0.0732 0.0009  -0.0051 -0.0070 211 CYS A O   
1660 C CB  . CYS A 233 ? 0.1066 0.1259 0.0632 0.0009  -0.0041 -0.0019 211 CYS A CB  
1661 S SG  . CYS A 233 ? 0.1396 0.1595 0.0941 0.0008  -0.0028 0.0014  211 CYS A SG  
1662 N N   . PRO A 234 ? 0.0942 0.1133 0.0559 0.0010  -0.0023 -0.0094 212 PRO A N   
1663 C CA  . PRO A 234 ? 0.1064 0.1241 0.0704 0.0009  -0.0026 -0.0117 212 PRO A CA  
1664 C C   . PRO A 234 ? 0.1267 0.1461 0.0891 0.0006  -0.0038 -0.0141 212 PRO A C   
1665 O O   . PRO A 234 ? 0.1161 0.1345 0.0805 0.0003  -0.0045 -0.0154 212 PRO A O   
1666 C CB  . PRO A 234 ? 0.1419 0.1589 0.1081 0.0011  -0.0005 -0.0137 212 PRO A CB  
1667 C CG  . PRO A 234 ? 0.1612 0.1807 0.1251 0.0014  0.0005  -0.0136 212 PRO A CG  
1668 C CD  . PRO A 234 ? 0.1259 0.1459 0.0882 0.0013  -0.0003 -0.0101 212 PRO A CD  
1669 N N   . GLU A 235 ? 0.1161 0.1386 0.0750 0.0009  -0.0040 -0.0147 213 GLU A N   
1670 C CA  . GLU A 235 ? 0.1364 0.1618 0.0934 0.0011  -0.0053 -0.0172 213 GLU A CA  
1671 C C   . GLU A 235 ? 0.1428 0.1690 0.0978 0.0015  -0.0075 -0.0152 213 GLU A C   
1672 O O   . GLU A 235 ? 0.1664 0.1954 0.1200 0.0018  -0.0090 -0.0171 213 GLU A O   
1673 C CB  . GLU A 235 ? 0.1460 0.1748 0.0996 0.0016  -0.0046 -0.0187 213 GLU A CB  
1674 C CG  . GLU A 235 ? 0.2164 0.2468 0.1655 0.0025  -0.0047 -0.0152 213 GLU A CG  
1675 C CD  . GLU A 235 ? 0.2761 0.3047 0.2257 0.0023  -0.0029 -0.0121 213 GLU A CD  
1676 O OE1 . GLU A 235 ? 0.2239 0.2500 0.1773 0.0018  -0.0020 -0.0120 213 GLU A OE1 
1677 O OE2 . GLU A 235 ? 0.4405 0.4705 0.3869 0.0029  -0.0023 -0.0097 213 GLU A OE2 
1678 N N   . ILE A 236 ? 0.1021 0.1261 0.0572 0.0015  -0.0077 -0.0115 214 ILE A N   
1679 C CA  . ILE A 236 ? 0.1189 0.1430 0.0724 0.0020  -0.0095 -0.0093 214 ILE A CA  
1680 C C   . ILE A 236 ? 0.1046 0.1260 0.0616 0.0015  -0.0102 -0.0092 214 ILE A C   
1681 O O   . ILE A 236 ? 0.1188 0.1375 0.0781 0.0011  -0.0094 -0.0078 214 ILE A O   
1682 C CB  . ILE A 236 ? 0.1190 0.1423 0.0702 0.0025  -0.0091 -0.0053 214 ILE A CB  
1683 C CG1 . ILE A 236 ? 0.1726 0.1983 0.1204 0.0030  -0.0077 -0.0052 214 ILE A CG1 
1684 C CG2 . ILE A 236 ? 0.1141 0.1374 0.0635 0.0033  -0.0108 -0.0032 214 ILE A CG2 
1685 C CD1 . ILE A 236 ? 0.1734 0.1984 0.1187 0.0034  -0.0069 -0.0012 214 ILE A CD1 
1686 N N   . PRO A 237 ? 0.0898 0.1125 0.0474 0.0016  -0.0118 -0.0107 215 PRO A N   
1687 C CA  . PRO A 237 ? 0.1020 0.1224 0.0632 0.0010  -0.0121 -0.0112 215 PRO A CA  
1688 C C   . PRO A 237 ? 0.1301 0.1487 0.0913 0.0014  -0.0131 -0.0082 215 PRO A C   
1689 O O   . PRO A 237 ? 0.1855 0.2045 0.1478 0.0015  -0.0144 -0.0087 215 PRO A O   
1690 C CB  . PRO A 237 ? 0.1176 0.1408 0.0799 0.0008  -0.0131 -0.0147 215 PRO A CB  
1691 C CG  . PRO A 237 ? 0.1382 0.1652 0.0963 0.0019  -0.0145 -0.0147 215 PRO A CG  
1692 C CD  . PRO A 237 ? 0.1205 0.1473 0.0757 0.0023  -0.0132 -0.0129 215 PRO A CD  
1693 N N   . PHE A 238 ? 0.0848 0.1015 0.0453 0.0014  -0.0125 -0.0054 216 PHE A N   
1694 C CA  . PHE A 238 ? 0.0940 0.1087 0.0552 0.0016  -0.0132 -0.0030 216 PHE A CA  
1695 C C   . PHE A 238 ? 0.0861 0.0984 0.0505 0.0010  -0.0127 -0.0033 216 PHE A C   
1696 O O   . PHE A 238 ? 0.0982 0.1099 0.0641 0.0007  -0.0114 -0.0045 216 PHE A O   
1697 C CB  . PHE A 238 ? 0.0957 0.1094 0.0552 0.0017  -0.0127 -0.0001 216 PHE A CB  
1698 C CG  . PHE A 238 ? 0.0841 0.0974 0.0442 0.0012  -0.0110 0.0002  216 PHE A CG  
1699 C CD1 . PHE A 238 ? 0.0979 0.1095 0.0607 0.0007  -0.0104 0.0005  216 PHE A CD1 
1700 C CD2 . PHE A 238 ? 0.1161 0.1311 0.0738 0.0013  -0.0100 0.0002  216 PHE A CD2 
1701 C CE1 . PHE A 238 ? 0.1031 0.1148 0.0666 0.0004  -0.0090 0.0007  216 PHE A CE1 
1702 C CE2 . PHE A 238 ? 0.1098 0.1248 0.0684 0.0009  -0.0084 0.0005  216 PHE A CE2 
1703 C CZ  . PHE A 238 ? 0.1253 0.1386 0.0870 0.0004  -0.0079 0.0007  216 PHE A CZ  
1704 N N   . VAL A 239 ? 0.0874 0.0984 0.0527 0.0012  -0.0136 -0.0022 217 VAL A N   
1705 C CA  . VAL A 239 ? 0.0984 0.1072 0.0658 0.0010  -0.0130 -0.0016 217 VAL A CA  
1706 C C   . VAL A 239 ? 0.0992 0.1071 0.0659 0.0010  -0.0130 0.0006  217 VAL A C   
1707 O O   . VAL A 239 ? 0.0980 0.1060 0.0630 0.0012  -0.0136 0.0019  217 VAL A O   
1708 C CB  . VAL A 239 ? 0.1047 0.1127 0.0737 0.0012  -0.0138 -0.0021 217 VAL A CB  
1709 C CG1 . VAL A 239 ? 0.1254 0.1342 0.0960 0.0009  -0.0133 -0.0045 217 VAL A CG1 
1710 C CG2 . VAL A 239 ? 0.1548 0.1630 0.1228 0.0017  -0.0153 -0.0010 217 VAL A CG2 
1711 N N   . LEU A 240 ? 0.0844 0.0915 0.0526 0.0008  -0.0123 0.0010  218 LEU A N   
1712 C CA  . LEU A 240 ? 0.1090 0.1156 0.0775 0.0005  -0.0121 0.0025  218 LEU A CA  
1713 C C   . LEU A 240 ? 0.0983 0.1036 0.0681 0.0006  -0.0130 0.0028  218 LEU A C   
1714 O O   . LEU A 240 ? 0.1035 0.1086 0.0745 0.0010  -0.0129 0.0022  218 LEU A O   
1715 C CB  . LEU A 240 ? 0.1356 0.1429 0.1051 0.0004  -0.0110 0.0023  218 LEU A CB  
1716 C CG  . LEU A 240 ? 0.1597 0.1674 0.1302 -0.0002 -0.0106 0.0033  218 LEU A CG  
1717 C CD1 . LEU A 240 ? 0.1772 0.1846 0.1461 -0.0007 -0.0104 0.0047  218 LEU A CD1 
1718 C CD2 . LEU A 240 ? 0.1773 0.1865 0.1488 -0.0001 -0.0094 0.0028  218 LEU A CD2 
1719 N N   . GLU A 241 ? 0.0757 0.0801 0.0449 0.0006  -0.0137 0.0039  219 GLU A N   
1720 C CA  . GLU A 241 ? 0.0755 0.0787 0.0460 0.0007  -0.0145 0.0039  219 GLU A CA  
1721 C C   . GLU A 241 ? 0.0888 0.0915 0.0608 0.0001  -0.0142 0.0043  219 GLU A C   
1722 O O   . GLU A 241 ? 0.0926 0.0950 0.0645 -0.0005 -0.0136 0.0054  219 GLU A O   
1723 C CB  . GLU A 241 ? 0.0965 0.0988 0.0660 0.0012  -0.0153 0.0047  219 GLU A CB  
1724 C CG  . GLU A 241 ? 0.1080 0.1089 0.0788 0.0015  -0.0161 0.0046  219 GLU A CG  
1725 C CD  . GLU A 241 ? 0.2367 0.2369 0.2067 0.0022  -0.0169 0.0054  219 GLU A CD  
1726 O OE1 . GLU A 241 ? 0.2595 0.2610 0.2279 0.0028  -0.0172 0.0056  219 GLU A OE1 
1727 O OE2 . GLU A 241 ? 0.1736 0.1722 0.1447 0.0024  -0.0172 0.0058  219 GLU A OE2 
1728 N N   . GLN A 242 ? 0.0873 0.0901 0.0607 0.0003  -0.0146 0.0034  220 GLN A N   
1729 C CA  . GLN A 242 ? 0.0918 0.0950 0.0671 -0.0002 -0.0146 0.0031  220 GLN A CA  
1730 C C   . GLN A 242 ? 0.0921 0.0961 0.0682 -0.0012 -0.0136 0.0036  220 GLN A C   
1731 O O   . GLN A 242 ? 0.0985 0.1016 0.0758 -0.0021 -0.0133 0.0041  220 GLN A O   
1732 C CB  . GLN A 242 ? 0.0792 0.0807 0.0554 -0.0004 -0.0153 0.0030  220 GLN A CB  
1733 C CG  . GLN A 242 ? 0.0867 0.0889 0.0652 -0.0009 -0.0155 0.0017  220 GLN A CG  
1734 C CD  . GLN A 242 ? 0.1467 0.1505 0.1251 0.0002  -0.0163 0.0005  220 GLN A CD  
1735 O OE1 . GLN A 242 ? 0.1076 0.1108 0.0848 0.0011  -0.0166 0.0005  220 GLN A OE1 
1736 N NE2 . GLN A 242 ? 0.1328 0.1390 0.1127 0.0002  -0.0164 -0.0007 220 GLN A NE2 
1737 N N   . PRO A 243 ? 0.0878 0.0935 0.0636 -0.0010 -0.0130 0.0035  221 PRO A N   
1738 C CA  . PRO A 243 ? 0.1065 0.1131 0.0830 -0.0019 -0.0118 0.0040  221 PRO A CA  
1739 C C   . PRO A 243 ? 0.1175 0.1255 0.0971 -0.0027 -0.0118 0.0031  221 PRO A C   
1740 O O   . PRO A 243 ? 0.1120 0.1197 0.0930 -0.0040 -0.0109 0.0037  221 PRO A O   
1741 C CB  . PRO A 243 ? 0.0954 0.1037 0.0712 -0.0013 -0.0112 0.0036  221 PRO A CB  
1742 C CG  . PRO A 243 ? 0.0885 0.0968 0.0641 -0.0001 -0.0119 0.0028  221 PRO A CG  
1743 C CD  . PRO A 243 ? 0.0893 0.0957 0.0641 0.0000  -0.0128 0.0030  221 PRO A CD  
1744 N N   . CYS A 244 ? 0.0831 0.0926 0.0638 -0.0020 -0.0127 0.0018  222 CYS A N   
1745 C CA  . CYS A 244 ? 0.0837 0.0955 0.0674 -0.0025 -0.0131 0.0005  222 CYS A CA  
1746 C C   . CYS A 244 ? 0.0950 0.1061 0.0797 -0.0026 -0.0142 -0.0007 222 CYS A C   
1747 O O   . CYS A 244 ? 0.1046 0.1137 0.0874 -0.0018 -0.0148 -0.0003 222 CYS A O   
1748 C CB  . CYS A 244 ? 0.0744 0.0894 0.0585 -0.0012 -0.0133 -0.0003 222 CYS A CB  
1749 S SG  . CYS A 244 ? 0.1223 0.1382 0.1057 -0.0009 -0.0118 0.0006  222 CYS A SG  
1750 N N   . ASN A 245 ? 0.0908 0.1038 0.0786 -0.0035 -0.0145 -0.0023 223 ASN A N   
1751 C CA  . ASN A 245 ? 0.0975 0.1099 0.0867 -0.0038 -0.0154 -0.0039 223 ASN A CA  
1752 C C   . ASN A 245 ? 0.1203 0.1340 0.1078 -0.0020 -0.0169 -0.0048 223 ASN A C   
1753 O O   . ASN A 245 ? 0.1676 0.1793 0.1541 -0.0016 -0.0174 -0.0050 223 ASN A O   
1754 C CB  . ASN A 245 ? 0.1078 0.1225 0.1014 -0.0055 -0.0153 -0.0060 223 ASN A CB  
1755 C CG  . ASN A 245 ? 0.1526 0.1666 0.1481 -0.0060 -0.0161 -0.0081 223 ASN A CG  
1756 O OD1 . ASN A 245 ? 0.1764 0.1865 0.1709 -0.0062 -0.0159 -0.0072 223 ASN A OD1 
1757 N ND2 . ASN A 245 ? 0.1523 0.1704 0.1506 -0.0062 -0.0171 -0.0110 223 ASN A ND2 
1758 N N   . THR A 246 ? 0.0984 0.1157 0.0856 -0.0006 -0.0173 -0.0053 224 THR A N   
1759 C CA  . THR A 246 ? 0.1005 0.1195 0.0860 0.0015  -0.0184 -0.0060 224 THR A CA  
1760 C C   . THR A 246 ? 0.1062 0.1242 0.0886 0.0032  -0.0179 -0.0041 224 THR A C   
1761 O O   . THR A 246 ? 0.1105 0.1279 0.0925 0.0031  -0.0169 -0.0028 224 THR A O   
1762 C CB  . THR A 246 ? 0.1247 0.1489 0.1120 0.0023  -0.0195 -0.0081 224 THR A CB  
1763 O OG1 . THR A 246 ? 0.1093 0.1359 0.0972 0.0028  -0.0190 -0.0073 224 THR A OG1 
1764 C CG2 . THR A 246 ? 0.1431 0.1687 0.1343 0.0003  -0.0200 -0.0107 224 THR A CG2 
1765 N N   . LEU A 247 ? 0.1027 0.1202 0.0830 0.0048  -0.0183 -0.0040 225 LEU A N   
1766 C CA  . LEU A 247 ? 0.1038 0.1204 0.0817 0.0065  -0.0175 -0.0023 225 LEU A CA  
1767 C C   . LEU A 247 ? 0.1153 0.1349 0.0933 0.0080  -0.0173 -0.0019 225 LEU A C   
1768 O O   . LEU A 247 ? 0.1179 0.1363 0.0949 0.0088  -0.0161 -0.0005 225 LEU A O   
1769 C CB  . LEU A 247 ? 0.0977 0.1137 0.0737 0.0079  -0.0177 -0.0023 225 LEU A CB  
1770 C CG  . LEU A 247 ? 0.1203 0.1348 0.0941 0.0095  -0.0165 -0.0006 225 LEU A CG  
1771 C CD1 . LEU A 247 ? 0.1551 0.1665 0.1290 0.0083  -0.0153 0.0005  225 LEU A CD1 
1772 C CD2 . LEU A 247 ? 0.1314 0.1452 0.1037 0.0105  -0.0165 -0.0006 225 LEU A CD2 
1773 N N   . GLU A 248 ? 0.1208 0.1445 0.1003 0.0085  -0.0184 -0.0035 226 GLU A N   
1774 C CA  . GLU A 248 ? 0.1104 0.1376 0.0903 0.0102  -0.0184 -0.0032 226 GLU A CA  
1775 C C   . GLU A 248 ? 0.1124 0.1389 0.0937 0.0091  -0.0172 -0.0024 226 GLU A C   
1776 O O   . GLU A 248 ? 0.1442 0.1710 0.1248 0.0107  -0.0163 -0.0012 226 GLU A O   
1777 C CB  . GLU A 248 ? 0.1297 0.1622 0.1114 0.0108  -0.0201 -0.0055 226 GLU A CB  
1778 C CG  . GLU A 248 ? 0.1387 0.1730 0.1184 0.0127  -0.0212 -0.0062 226 GLU A CG  
1779 C CD  . GLU A 248 ? 0.1890 0.2223 0.1654 0.0156  -0.0202 -0.0038 226 GLU A CD  
1780 O OE1 . GLU A 248 ? 0.2370 0.2727 0.2135 0.0175  -0.0198 -0.0028 226 GLU A OE1 
1781 O OE2 . GLU A 248 ? 0.2247 0.2547 0.1989 0.0159  -0.0193 -0.0027 226 GLU A OE2 
1782 N N   . GLU A 249 ? 0.0954 0.1208 0.0786 0.0065  -0.0170 -0.0031 227 GLU A N   
1783 C CA  . GLU A 249 ? 0.0850 0.1099 0.0693 0.0055  -0.0158 -0.0024 227 GLU A CA  
1784 C C   . GLU A 249 ? 0.1317 0.1528 0.1136 0.0058  -0.0145 -0.0007 227 GLU A C   
1785 O O   . GLU A 249 ? 0.1201 0.1413 0.1019 0.0063  -0.0134 0.0001  227 GLU A O   
1786 C CB  . GLU A 249 ? 0.0902 0.1143 0.0767 0.0027  -0.0155 -0.0031 227 GLU A CB  
1787 C CG  . GLU A 249 ? 0.0997 0.1278 0.0899 0.0018  -0.0164 -0.0052 227 GLU A CG  
1788 C CD  . GLU A 249 ? 0.1372 0.1631 0.1294 -0.0009 -0.0158 -0.0057 227 GLU A CD  
1789 O OE1 . GLU A 249 ? 0.1294 0.1541 0.1223 -0.0023 -0.0144 -0.0048 227 GLU A OE1 
1790 O OE2 . GLU A 249 ? 0.1144 0.1396 0.1073 -0.0015 -0.0167 -0.0070 227 GLU A OE2 
1791 N N   . ILE A 250 ? 0.1270 0.1450 0.1072 0.0053  -0.0146 -0.0003 228 ILE A N   
1792 C CA  . ILE A 250 ? 0.1241 0.1389 0.1024 0.0054  -0.0135 0.0009  228 ILE A CA  
1793 C C   . ILE A 250 ? 0.1346 0.1495 0.1119 0.0076  -0.0127 0.0016  228 ILE A C   
1794 O O   . ILE A 250 ? 0.1478 0.1614 0.1249 0.0078  -0.0114 0.0022  228 ILE A O   
1795 C CB  . ILE A 250 ? 0.1134 0.1255 0.0906 0.0047  -0.0140 0.0009  228 ILE A CB  
1796 C CG1 . ILE A 250 ? 0.1398 0.1511 0.1178 0.0027  -0.0143 0.0007  228 ILE A CG1 
1797 C CG2 . ILE A 250 ? 0.1594 0.1690 0.1351 0.0049  -0.0130 0.0016  228 ILE A CG2 
1798 C CD1 . ILE A 250 ? 0.1784 0.1874 0.1558 0.0022  -0.0149 0.0007  228 ILE A CD1 
1799 N N   . ALA A 251 ? 0.1013 0.1177 0.0781 0.0094  -0.0133 0.0017  229 ALA A N   
1800 C CA  . ALA A 251 ? 0.1506 0.1668 0.1264 0.0118  -0.0122 0.0029  229 ALA A CA  
1801 C C   . ALA A 251 ? 0.1638 0.1819 0.1408 0.0128  -0.0115 0.0032  229 ALA A C   
1802 O O   . ALA A 251 ? 0.1585 0.1749 0.1350 0.0141  -0.0099 0.0043  229 ALA A O   
1803 C CB  . ALA A 251 ? 0.1452 0.1631 0.1197 0.0138  -0.0130 0.0031  229 ALA A CB  
1804 N N   . ALA A 252 ? 0.1254 0.1469 0.1042 0.0121  -0.0125 0.0021  230 ALA A N   
1805 C CA  . ALA A 252 ? 0.1685 0.1925 0.1489 0.0129  -0.0120 0.0022  230 ALA A CA  
1806 C C   . ALA A 252 ? 0.1888 0.2106 0.1696 0.0117  -0.0104 0.0024  230 ALA A C   
1807 O O   . ALA A 252 ? 0.2208 0.2430 0.2022 0.0131  -0.0092 0.0029  230 ALA A O   
1808 C CB  . ALA A 252 ? 0.1948 0.2235 0.1777 0.0122  -0.0134 0.0006  230 ALA A CB  
1809 N N   . ILE A 253 ? 0.1637 0.1831 0.1441 0.0093  -0.0103 0.0020  231 ILE A N   
1810 C CA  . ILE A 253 ? 0.1620 0.1799 0.1424 0.0082  -0.0089 0.0019  231 ILE A CA  
1811 C C   . ILE A 253 ? 0.1374 0.1517 0.1162 0.0084  -0.0078 0.0023  231 ILE A C   
1812 O O   . ILE A 253 ? 0.1283 0.1416 0.1071 0.0079  -0.0065 0.0020  231 ILE A O   
1813 C CB  . ILE A 253 ? 0.1941 0.2118 0.1747 0.0056  -0.0093 0.0015  231 ILE A CB  
1814 C CG1 . ILE A 253 ? 0.1828 0.1977 0.1617 0.0047  -0.0100 0.0016  231 ILE A CG1 
1815 C CG2 . ILE A 253 ? 0.3330 0.3538 0.3158 0.0049  -0.0101 0.0008  231 ILE A CG2 
1816 C CD1 . ILE A 253 ? 0.2891 0.3031 0.2676 0.0027  -0.0100 0.0016  231 ILE A CD1 
1817 N N   A ARG A 254 ? 0.1254 0.1379 0.1031 0.0089  -0.0081 0.0027  232 ARG A N   
1818 N N   B ARG A 254 ? 0.1268 0.1393 0.1045 0.0089  -0.0081 0.0027  232 ARG A N   
1819 C CA  A ARG A 254 ? 0.1356 0.1449 0.1124 0.0086  -0.0072 0.0027  232 ARG A CA  
1820 C CA  B ARG A 254 ? 0.1100 0.1192 0.0868 0.0085  -0.0071 0.0027  232 ARG A CA  
1821 C C   A ARG A 254 ? 0.1278 0.1356 0.1052 0.0094  -0.0052 0.0027  232 ARG A C   
1822 C C   B ARG A 254 ? 0.1255 0.1333 0.1029 0.0094  -0.0051 0.0027  232 ARG A C   
1823 O O   A ARG A 254 ? 0.1434 0.1495 0.1206 0.0082  -0.0044 0.0017  232 ARG A O   
1824 O O   B ARG A 254 ? 0.1407 0.1468 0.1180 0.0082  -0.0043 0.0017  232 ARG A O   
1825 C CB  A ARG A 254 ? 0.1786 0.1867 0.1545 0.0096  -0.0075 0.0034  232 ARG A CB  
1826 C CB  B ARG A 254 ? 0.1841 0.1919 0.1600 0.0093  -0.0074 0.0033  232 ARG A CB  
1827 C CG  A ARG A 254 ? 0.2673 0.2724 0.2430 0.0090  -0.0064 0.0032  232 ARG A CG  
1828 C CG  B ARG A 254 ? 0.2867 0.2915 0.2624 0.0086  -0.0064 0.0030  232 ARG A CG  
1829 C CD  A ARG A 254 ? 0.2965 0.3005 0.2715 0.0102  -0.0062 0.0041  232 ARG A CD  
1830 C CD  B ARG A 254 ? 0.2984 0.3020 0.2735 0.0097  -0.0062 0.0038  232 ARG A CD  
1831 N NE  A ARG A 254 ? 0.2912 0.2924 0.2668 0.0097  -0.0046 0.0038  232 ARG A NE  
1832 N NE  B ARG A 254 ? 0.3188 0.3235 0.2935 0.0120  -0.0059 0.0051  232 ARG A NE  
1833 C CZ  A ARG A 254 ? 0.2747 0.2740 0.2512 0.0106  -0.0024 0.0042  232 ARG A CZ  
1834 C CZ  B ARG A 254 ? 0.3544 0.3581 0.3294 0.0138  -0.0040 0.0062  232 ARG A CZ  
1835 N NH1 A ARG A 254 ? 0.2080 0.2047 0.1855 0.0098  -0.0009 0.0036  232 ARG A NH1 
1836 N NH1 B ARG A 254 ? 0.4490 0.4542 0.4232 0.0164  -0.0040 0.0076  232 ARG A NH1 
1837 N NH2 A ARG A 254 ? 0.3578 0.3576 0.3343 0.0123  -0.0016 0.0052  232 ARG A NH2 
1838 N NH2 B ARG A 254 ? 0.3840 0.3851 0.3601 0.0133  -0.0021 0.0058  232 ARG A NH2 
1839 N N   . GLY A 255 ? 0.1353 0.1438 0.1133 0.0115  -0.0043 0.0035  233 GLY A N   
1840 C CA  . GLY A 255 ? 0.1046 0.1113 0.0835 0.0125  -0.0021 0.0036  233 GLY A CA  
1841 C C   . GLY A 255 ? 0.1398 0.1474 0.1195 0.0116  -0.0015 0.0023  233 GLY A C   
1842 O O   . GLY A 255 ? 0.2043 0.2100 0.1847 0.0118  0.0004  0.0017  233 GLY A O   
1843 N N   . ARG A 256 ? 0.0919 0.1023 0.0716 0.0104  -0.0028 0.0019  234 ARG A N   
1844 C CA  . ARG A 256 ? 0.1238 0.1356 0.1041 0.0095  -0.0021 0.0009  234 ARG A CA  
1845 C C   . ARG A 256 ? 0.1476 0.1588 0.1264 0.0073  -0.0025 0.0000  234 ARG A C   
1846 O O   . ARG A 256 ? 0.2158 0.2283 0.1945 0.0064  -0.0020 -0.0007 234 ARG A O   
1847 C CB  . ARG A 256 ? 0.1501 0.1658 0.1317 0.0098  -0.0029 0.0012  234 ARG A CB  
1848 C CG  . ARG A 256 ? 0.1721 0.1894 0.1549 0.0125  -0.0029 0.0022  234 ARG A CG  
1849 C CD  . ARG A 256 ? 0.2012 0.2230 0.1855 0.0126  -0.0044 0.0021  234 ARG A CD  
1850 N NE  . ARG A 256 ? 0.1897 0.2142 0.1759 0.0121  -0.0037 0.0014  234 ARG A NE  
1851 C CZ  . ARG A 256 ? 0.2146 0.2430 0.2027 0.0112  -0.0047 0.0008  234 ARG A CZ  
1852 N NH1 . ARG A 256 ? 0.1965 0.2263 0.1849 0.0107  -0.0064 0.0007  234 ARG A NH1 
1853 N NH2 . ARG A 256 ? 0.2481 0.2790 0.2382 0.0108  -0.0036 0.0002  234 ARG A NH2 
1854 N N   . VAL A 257 ? 0.1360 0.1455 0.1137 0.0065  -0.0034 0.0000  235 VAL A N   
1855 C CA  . VAL A 257 ? 0.1282 0.1374 0.1044 0.0047  -0.0041 -0.0007 235 VAL A CA  
1856 C C   . VAL A 257 ? 0.1052 0.1122 0.0812 0.0044  -0.0035 -0.0019 235 VAL A C   
1857 O O   . VAL A 257 ? 0.1735 0.1788 0.1499 0.0049  -0.0035 -0.0016 235 VAL A O   
1858 C CB  . VAL A 257 ? 0.1116 0.1212 0.0872 0.0040  -0.0059 0.0001  235 VAL A CB  
1859 C CG1 . VAL A 257 ? 0.1129 0.1218 0.0868 0.0027  -0.0066 -0.0002 235 VAL A CG1 
1860 C CG2 . VAL A 257 ? 0.1458 0.1577 0.1222 0.0037  -0.0062 0.0008  235 VAL A CG2 
1861 N N   . GLN A 258 ? 0.1450 0.1523 0.1204 0.0037  -0.0028 -0.0035 236 GLN A N   
1862 C CA  . GLN A 258 ? 0.1523 0.1580 0.1281 0.0033  -0.0021 -0.0053 236 GLN A CA  
1863 C C   . GLN A 258 ? 0.1036 0.1098 0.0782 0.0021  -0.0036 -0.0060 236 GLN A C   
1864 O O   . GLN A 258 ? 0.1317 0.1372 0.1071 0.0016  -0.0033 -0.0078 236 GLN A O   
1865 C CB  . GLN A 258 ? 0.1865 0.1926 0.1628 0.0032  -0.0005 -0.0073 236 GLN A CB  
1866 C CG  . GLN A 258 ? 0.2760 0.2809 0.2542 0.0047  0.0013  -0.0068 236 GLN A CG  
1867 C CD  . GLN A 258 ? 0.4236 0.4284 0.4028 0.0046  0.0032  -0.0092 236 GLN A CD  
1868 O OE1 . GLN A 258 ? 0.4363 0.4430 0.4139 0.0038  0.0029  -0.0106 236 GLN A OE1 
1869 N NE2 . GLN A 258 ? 0.4610 0.4632 0.4425 0.0057  0.0052  -0.0095 236 GLN A NE2 
1870 N N   . HIS A 259 ? 0.1045 0.1118 0.0774 0.0018  -0.0052 -0.0046 237 HIS A N   
1871 C CA  . HIS A 259 ? 0.1028 0.1104 0.0747 0.0012  -0.0067 -0.0047 237 HIS A CA  
1872 C C   . HIS A 259 ? 0.0797 0.0858 0.0526 0.0015  -0.0073 -0.0037 237 HIS A C   
1873 O O   . HIS A 259 ? 0.1150 0.1206 0.0884 0.0022  -0.0072 -0.0023 237 HIS A O   
1874 C CB  . HIS A 259 ? 0.0775 0.0866 0.0471 0.0009  -0.0078 -0.0034 237 HIS A CB  
1875 C CG  . HIS A 259 ? 0.0796 0.0905 0.0474 0.0007  -0.0073 -0.0043 237 HIS A CG  
1876 N ND1 . HIS A 259 ? 0.0843 0.0960 0.0520 0.0008  -0.0060 -0.0041 237 HIS A ND1 
1877 C CD2 . HIS A 259 ? 0.0821 0.0947 0.0480 0.0005  -0.0079 -0.0055 237 HIS A CD2 
1878 C CE1 . HIS A 259 ? 0.0938 0.1073 0.0594 0.0007  -0.0057 -0.0050 237 HIS A CE1 
1879 N NE2 . HIS A 259 ? 0.1016 0.1158 0.0659 0.0006  -0.0069 -0.0059 237 HIS A NE2 
1880 N N   . GLY A 260 ? 0.0904 0.0962 0.0636 0.0012  -0.0080 -0.0045 238 GLY A N   
1881 C CA  . GLY A 260 ? 0.0915 0.0962 0.0653 0.0014  -0.0086 -0.0036 238 GLY A CA  
1882 C C   . GLY A 260 ? 0.1050 0.1101 0.0777 0.0016  -0.0099 -0.0018 238 GLY A C   
1883 O O   . GLY A 260 ? 0.1087 0.1148 0.0799 0.0012  -0.0106 -0.0013 238 GLY A O   
1884 N N   . ILE A 261 ? 0.0890 0.0932 0.0624 0.0022  -0.0100 -0.0008 239 ILE A N   
1885 C CA  . ILE A 261 ? 0.0738 0.0783 0.0467 0.0022  -0.0111 0.0004  239 ILE A CA  
1886 C C   . ILE A 261 ? 0.0985 0.1022 0.0716 0.0024  -0.0120 0.0005  239 ILE A C   
1887 O O   . ILE A 261 ? 0.1080 0.1110 0.0818 0.0030  -0.0114 0.0003  239 ILE A O   
1888 C CB  . ILE A 261 ? 0.0802 0.0852 0.0538 0.0030  -0.0107 0.0010  239 ILE A CB  
1889 C CG1 . ILE A 261 ? 0.1309 0.1370 0.1045 0.0028  -0.0098 0.0010  239 ILE A CG1 
1890 C CG2 . ILE A 261 ? 0.1136 0.1191 0.0873 0.0028  -0.0119 0.0016  239 ILE A CG2 
1891 C CD1 . ILE A 261 ? 0.1940 0.2012 0.1687 0.0039  -0.0093 0.0014  239 ILE A CD1 
1892 N N   . TYR A 262 ? 0.0882 0.0920 0.0607 0.0020  -0.0132 0.0009  240 TYR A N   
1893 C CA  . TYR A 262 ? 0.0710 0.0740 0.0438 0.0023  -0.0140 0.0010  240 TYR A CA  
1894 C C   . TYR A 262 ? 0.0821 0.0849 0.0552 0.0024  -0.0146 0.0015  240 TYR A C   
1895 O O   . TYR A 262 ? 0.1157 0.1189 0.0888 0.0019  -0.0147 0.0020  240 TYR A O   
1896 C CB  . TYR A 262 ? 0.0857 0.0889 0.0579 0.0021  -0.0150 0.0009  240 TYR A CB  
1897 C CG  . TYR A 262 ? 0.0944 0.0984 0.0670 0.0021  -0.0148 -0.0003 240 TYR A CG  
1898 C CD1 . TYR A 262 ? 0.1012 0.1054 0.0744 0.0019  -0.0136 -0.0013 240 TYR A CD1 
1899 C CD2 . TYR A 262 ? 0.0725 0.0772 0.0450 0.0023  -0.0159 -0.0006 240 TYR A CD2 
1900 C CE1 . TYR A 262 ? 0.1104 0.1155 0.0845 0.0015  -0.0134 -0.0029 240 TYR A CE1 
1901 C CE2 . TYR A 262 ? 0.1034 0.1095 0.0765 0.0022  -0.0159 -0.0022 240 TYR A CE2 
1902 C CZ  . TYR A 262 ? 0.1051 0.1115 0.0793 0.0016  -0.0147 -0.0035 240 TYR A CZ  
1903 O OH  . TYR A 262 ? 0.1007 0.1087 0.0762 0.0012  -0.0146 -0.0056 240 TYR A OH  
1904 N N   . LEU A 263 ? 0.0768 0.0793 0.0504 0.0030  -0.0149 0.0013  241 LEU A N   
1905 C CA  . LEU A 263 ? 0.0835 0.0860 0.0576 0.0030  -0.0157 0.0012  241 LEU A CA  
1906 C C   . LEU A 263 ? 0.1063 0.1076 0.0805 0.0028  -0.0165 0.0013  241 LEU A C   
1907 O O   . LEU A 263 ? 0.1274 0.1284 0.1015 0.0031  -0.0166 0.0012  241 LEU A O   
1908 C CB  . LEU A 263 ? 0.0808 0.0839 0.0550 0.0040  -0.0155 0.0007  241 LEU A CB  
1909 C CG  . LEU A 263 ? 0.1149 0.1192 0.0888 0.0048  -0.0147 0.0010  241 LEU A CG  
1910 C CD1 . LEU A 263 ? 0.1398 0.1449 0.1132 0.0062  -0.0146 0.0008  241 LEU A CD1 
1911 C CD2 . LEU A 263 ? 0.1194 0.1250 0.0938 0.0044  -0.0148 0.0010  241 LEU A CD2 
1912 N N   . ASP A 264 ? 0.0760 0.0768 0.0510 0.0023  -0.0169 0.0014  242 ASP A N   
1913 C CA  . ASP A 264 ? 0.0765 0.0756 0.0519 0.0023  -0.0174 0.0015  242 ASP A CA  
1914 C C   . ASP A 264 ? 0.0965 0.0956 0.0734 0.0021  -0.0177 0.0004  242 ASP A C   
1915 O O   . ASP A 264 ? 0.0804 0.0800 0.0573 0.0029  -0.0180 -0.0006 242 ASP A O   
1916 C CB  . ASP A 264 ? 0.1032 0.1013 0.0782 0.0018  -0.0173 0.0029  242 ASP A CB  
1917 C CG  . ASP A 264 ? 0.1460 0.1421 0.1215 0.0022  -0.0177 0.0035  242 ASP A CG  
1918 O OD1 . ASP A 264 ? 0.1627 0.1582 0.1391 0.0026  -0.0181 0.0025  242 ASP A OD1 
1919 O OD2 . ASP A 264 ? 0.1485 0.1436 0.1232 0.0022  -0.0175 0.0050  242 ASP A OD2 
1920 N N   . GLU A 265 ? 0.0968 0.0954 0.0749 0.0012  -0.0176 0.0004  243 GLU A N   
1921 C CA  . GLU A 265 ? 0.1047 0.1036 0.0848 0.0008  -0.0179 -0.0012 243 GLU A CA  
1922 C C   . GLU A 265 ? 0.1034 0.1049 0.0833 0.0015  -0.0184 -0.0028 243 GLU A C   
1923 O O   . GLU A 265 ? 0.1254 0.1273 0.1061 0.0018  -0.0189 -0.0045 243 GLU A O   
1924 C CB  . GLU A 265 ? 0.0820 0.0805 0.0641 -0.0007 -0.0173 -0.0013 243 GLU A CB  
1925 C CG  . GLU A 265 ? 0.1104 0.1057 0.0929 -0.0013 -0.0165 0.0004  243 GLU A CG  
1926 C CD  . GLU A 265 ? 0.1384 0.1335 0.1191 -0.0013 -0.0158 0.0026  243 GLU A CD  
1927 O OE1 . GLU A 265 ? 0.1071 0.1038 0.0858 -0.0006 -0.0161 0.0029  243 GLU A OE1 
1928 O OE2 . GLU A 265 ? 0.1914 0.1847 0.1726 -0.0021 -0.0148 0.0040  243 GLU A OE2 
1929 N N   . SER A 266 ? 0.0735 0.0767 0.0521 0.0021  -0.0181 -0.0023 244 SER A N   
1930 C CA  . SER A 266 ? 0.1028 0.1087 0.0808 0.0032  -0.0184 -0.0032 244 SER A CA  
1931 C C   . SER A 266 ? 0.1243 0.1298 0.1009 0.0046  -0.0184 -0.0034 244 SER A C   
1932 O O   . SER A 266 ? 0.1391 0.1466 0.1150 0.0057  -0.0187 -0.0043 244 SER A O   
1933 C CB  . SER A 266 ? 0.1301 0.1375 0.1073 0.0037  -0.0178 -0.0023 244 SER A CB  
1934 O OG  . SER A 266 ? 0.1287 0.1378 0.1075 0.0029  -0.0179 -0.0028 244 SER A OG  
1935 N N   . GLY A 267 ? 0.1144 0.1178 0.0906 0.0045  -0.0181 -0.0025 245 GLY A N   
1936 C CA  . GLY A 267 ? 0.1253 0.1285 0.1006 0.0056  -0.0179 -0.0026 245 GLY A CA  
1937 C C   . GLY A 267 ? 0.1280 0.1308 0.1039 0.0059  -0.0185 -0.0040 245 GLY A C   
1938 O O   . GLY A 267 ? 0.1284 0.1296 0.1049 0.0058  -0.0185 -0.0039 245 GLY A O   
1939 N N   . GLU A 268 ? 0.1209 0.1255 0.0970 0.0063  -0.0190 -0.0055 246 GLU A N   
1940 C CA  . GLU A 268 ? 0.1290 0.1334 0.1062 0.0062  -0.0196 -0.0074 246 GLU A CA  
1941 C C   . GLU A 268 ? 0.1508 0.1556 0.1267 0.0077  -0.0194 -0.0080 246 GLU A C   
1942 O O   . GLU A 268 ? 0.1457 0.1497 0.1226 0.0077  -0.0197 -0.0095 246 GLU A O   
1943 C CB  . GLU A 268 ? 0.1788 0.1857 0.1568 0.0060  -0.0204 -0.0095 246 GLU A CB  
1944 C CG  . GLU A 268 ? 0.2589 0.2655 0.2392 0.0042  -0.0205 -0.0095 246 GLU A CG  
1945 C CD  . GLU A 268 ? 0.4109 0.4205 0.3927 0.0039  -0.0213 -0.0120 246 GLU A CD  
1946 O OE1 . GLU A 268 ? 0.4775 0.4902 0.4588 0.0044  -0.0216 -0.0120 246 GLU A OE1 
1947 O OE2 . GLU A 268 ? 0.4882 0.4973 0.4722 0.0031  -0.0217 -0.0143 246 GLU A OE2 
1948 N N   . ASP A 269 ? 0.1209 0.1269 0.0948 0.0089  -0.0186 -0.0069 247 ASP A N   
1949 C CA  . ASP A 269 ? 0.1131 0.1197 0.0858 0.0103  -0.0180 -0.0073 247 ASP A CA  
1950 C C   . ASP A 269 ? 0.1275 0.1341 0.0987 0.0111  -0.0165 -0.0053 247 ASP A C   
1951 O O   . ASP A 269 ? 0.0949 0.1012 0.0660 0.0107  -0.0161 -0.0039 247 ASP A O   
1952 C CB  . ASP A 269 ? 0.1394 0.1487 0.1109 0.0115  -0.0186 -0.0093 247 ASP A CB  
1953 C CG  . ASP A 269 ? 0.1801 0.1922 0.1504 0.0121  -0.0191 -0.0092 247 ASP A CG  
1954 O OD1 . ASP A 269 ? 0.1619 0.1740 0.1313 0.0125  -0.0183 -0.0071 247 ASP A OD1 
1955 O OD2 . ASP A 269 ? 0.2936 0.3083 0.2641 0.0123  -0.0202 -0.0115 247 ASP A OD2 
1956 N N   . LEU A 270 ? 0.1022 0.1089 0.0726 0.0122  -0.0155 -0.0052 248 LEU A N   
1957 C CA  . LEU A 270 ? 0.1128 0.1191 0.0823 0.0129  -0.0136 -0.0033 248 LEU A CA  
1958 C C   . LEU A 270 ? 0.1152 0.1229 0.0826 0.0141  -0.0130 -0.0021 248 LEU A C   
1959 O O   . LEU A 270 ? 0.0875 0.0942 0.0549 0.0141  -0.0117 -0.0004 248 LEU A O   
1960 C CB  . LEU A 270 ? 0.1093 0.1157 0.0786 0.0138  -0.0123 -0.0035 248 LEU A CB  
1961 C CG  . LEU A 270 ? 0.1210 0.1262 0.0912 0.0136  -0.0102 -0.0020 248 LEU A CG  
1962 C CD1 . LEU A 270 ? 0.1634 0.1672 0.1364 0.0118  -0.0109 -0.0023 248 LEU A CD1 
1963 C CD2 . LEU A 270 ? 0.1156 0.1214 0.0854 0.0147  -0.0086 -0.0020 248 LEU A CD2 
1964 N N   . SER A 271 ? 0.0999 0.1101 0.0656 0.0153  -0.0140 -0.0031 249 SER A N   
1965 C CA  . SER A 271 ? 0.0980 0.1102 0.0616 0.0170  -0.0136 -0.0019 249 SER A CA  
1966 C C   . SER A 271 ? 0.0932 0.1047 0.0580 0.0160  -0.0139 -0.0011 249 SER A C   
1967 O O   . SER A 271 ? 0.1002 0.1116 0.0641 0.0170  -0.0127 0.0009  249 SER A O   
1968 C CB  . SER A 271 ? 0.1165 0.1324 0.0785 0.0184  -0.0152 -0.0038 249 SER A CB  
1969 O OG  . SER A 271 ? 0.1230 0.1410 0.0837 0.0200  -0.0147 -0.0025 249 SER A OG  
1970 N N   . THR A 272 ? 0.0958 0.1069 0.0628 0.0140  -0.0154 -0.0024 250 THR A N   
1971 C CA  . THR A 272 ? 0.0885 0.0991 0.0566 0.0130  -0.0156 -0.0017 250 THR A CA  
1972 C C   . THR A 272 ? 0.0925 0.1003 0.0613 0.0122  -0.0141 -0.0001 250 THR A C   
1973 O O   . THR A 272 ? 0.1037 0.1113 0.0724 0.0124  -0.0133 0.0011  250 THR A O   
1974 C CB  . THR A 272 ? 0.1177 0.1282 0.0879 0.0111  -0.0172 -0.0033 250 THR A CB  
1975 O OG1 . THR A 272 ? 0.1627 0.1759 0.1329 0.0116  -0.0185 -0.0053 250 THR A OG1 
1976 C CG2 . THR A 272 ? 0.1539 0.1643 0.1252 0.0101  -0.0172 -0.0025 250 THR A CG2 
1977 N N   . VAL A 273 ? 0.0963 0.1024 0.0659 0.0115  -0.0136 -0.0002 251 VAL A N   
1978 C CA  . VAL A 273 ? 0.1001 0.1043 0.0707 0.0107  -0.0122 0.0007  251 VAL A CA  
1979 C C   . VAL A 273 ? 0.0955 0.0993 0.0651 0.0121  -0.0101 0.0023  251 VAL A C   
1980 O O   . VAL A 273 ? 0.0926 0.0952 0.0630 0.0117  -0.0089 0.0031  251 VAL A O   
1981 C CB  . VAL A 273 ? 0.0984 0.1016 0.0704 0.0100  -0.0123 0.0000  251 VAL A CB  
1982 C CG1 . VAL A 273 ? 0.1063 0.1082 0.0797 0.0093  -0.0107 0.0005  251 VAL A CG1 
1983 C CG2 . VAL A 273 ? 0.1265 0.1293 0.0995 0.0088  -0.0141 -0.0010 251 VAL A CG2 
1984 N N   . ILE A 274 ? 0.0857 0.0905 0.0535 0.0139  -0.0094 0.0027  252 ILE A N   
1985 C CA  . ILE A 274 ? 0.0903 0.0945 0.0567 0.0156  -0.0070 0.0047  252 ILE A CA  
1986 C C   . ILE A 274 ? 0.0808 0.0856 0.0464 0.0167  -0.0069 0.0058  252 ILE A C   
1987 O O   . ILE A 274 ? 0.0835 0.0866 0.0494 0.0172  -0.0048 0.0075  252 ILE A O   
1988 C CB  . ILE A 274 ? 0.0826 0.0882 0.0467 0.0176  -0.0064 0.0050  252 ILE A CB  
1989 C CG1 . ILE A 274 ? 0.0821 0.0869 0.0476 0.0166  -0.0059 0.0040  252 ILE A CG1 
1990 C CG2 . ILE A 274 ? 0.1133 0.1186 0.0753 0.0200  -0.0039 0.0075  252 ILE A CG2 
1991 C CD1 . ILE A 274 ? 0.0867 0.0933 0.0501 0.0181  -0.0062 0.0033  252 ILE A CD1 
1992 N N   . ARG A 275 ? 0.0908 0.0981 0.0557 0.0170  -0.0091 0.0049  253 ARG A N   
1993 C CA  . ARG A 275 ? 0.0887 0.0971 0.0532 0.0179  -0.0092 0.0057  253 ARG A CA  
1994 C C   . ARG A 275 ? 0.1002 0.1064 0.0669 0.0161  -0.0087 0.0058  253 ARG A C   
1995 O O   . ARG A 275 ? 0.1107 0.1159 0.0774 0.0169  -0.0071 0.0073  253 ARG A O   
1996 C CB  . ARG A 275 ? 0.0902 0.1021 0.0546 0.0179  -0.0118 0.0040  253 ARG A CB  
1997 C CG  . ARG A 275 ? 0.1140 0.1278 0.0784 0.0191  -0.0120 0.0047  253 ARG A CG  
1998 C CD  . ARG A 275 ? 0.1294 0.1467 0.0948 0.0184  -0.0145 0.0026  253 ARG A CD  
1999 N NE  . ARG A 275 ? 0.1749 0.1940 0.1411 0.0191  -0.0145 0.0031  253 ARG A NE  
2000 C CZ  . ARG A 275 ? 0.2220 0.2439 0.1903 0.0181  -0.0160 0.0014  253 ARG A CZ  
2001 N NH1 . ARG A 275 ? 0.2461 0.2689 0.2158 0.0163  -0.0175 -0.0008 253 ARG A NH1 
2002 N NH2 . ARG A 275 ? 0.2391 0.2628 0.2080 0.0191  -0.0160 0.0020  253 ARG A NH2 
2003 N N   . ALA A 276 ? 0.0866 0.0922 0.0550 0.0137  -0.0099 0.0043  254 ALA A N   
2004 C CA  . ALA A 276 ? 0.0975 0.1017 0.0676 0.0121  -0.0096 0.0042  254 ALA A CA  
2005 C C   . ALA A 276 ? 0.1008 0.1025 0.0718 0.0119  -0.0073 0.0049  254 ALA A C   
2006 O O   . ALA A 276 ? 0.1219 0.1226 0.0936 0.0118  -0.0062 0.0053  254 ALA A O   
2007 C CB  . ALA A 276 ? 0.0764 0.0805 0.0476 0.0100  -0.0113 0.0027  254 ALA A CB  
2008 N N   . ALA A 277 ? 0.0915 0.0922 0.0628 0.0118  -0.0064 0.0049  255 ALA A N   
2009 C CA  . ALA A 277 ? 0.0967 0.0950 0.0696 0.0112  -0.0041 0.0052  255 ALA A CA  
2010 C C   . ALA A 277 ? 0.1072 0.1042 0.0793 0.0132  -0.0015 0.0072  255 ALA A C   
2011 O O   . ALA A 277 ? 0.1208 0.1158 0.0944 0.0129  0.0004  0.0076  255 ALA A O   
2012 C CB  . ALA A 277 ? 0.1146 0.1126 0.0886 0.0104  -0.0038 0.0044  255 ALA A CB  
2013 N N   . GLY A 278 ? 0.1106 0.1088 0.0803 0.0153  -0.0014 0.0085  256 GLY A N   
2014 C CA  . GLY A 278 ? 0.1052 0.1023 0.0736 0.0178  0.0011  0.0110  256 GLY A CA  
2015 C C   . GLY A 278 ? 0.1058 0.1030 0.0738 0.0190  0.0013  0.0120  256 GLY A C   
2016 O O   . GLY A 278 ? 0.1498 0.1447 0.1179 0.0204  0.0039  0.0139  256 GLY A O   
2017 N N   . GLN A 279 ? 0.1151 0.1148 0.0830 0.0185  -0.0014 0.0107  257 GLN A N   
2018 C CA  . GLN A 279 ? 0.1432 0.1436 0.1110 0.0196  -0.0014 0.0114  257 GLN A CA  
2019 C C   . GLN A 279 ? 0.1511 0.1503 0.1214 0.0174  -0.0014 0.0101  257 GLN A C   
2020 O O   . GLN A 279 ? 0.1562 0.1560 0.1269 0.0181  -0.0014 0.0104  257 GLN A O   
2021 C CB  . GLN A 279 ? 0.1314 0.1361 0.0976 0.0208  -0.0041 0.0109  257 GLN A CB  
2022 C CG  . GLN A 279 ? 0.1381 0.1449 0.1015 0.0235  -0.0042 0.0121  257 GLN A CG  
2023 C CD  . GLN A 279 ? 0.1716 0.1832 0.1338 0.0247  -0.0069 0.0111  257 GLN A CD  
2024 O OE1 . GLN A 279 ? 0.2173 0.2305 0.1812 0.0234  -0.0085 0.0096  257 GLN A OE1 
2025 N NE2 . GLN A 279 ? 0.1716 0.1858 0.1313 0.0272  -0.0073 0.0116  257 GLN A NE2 
2026 N N   . GLY A 280 ? 0.1168 0.1145 0.0887 0.0149  -0.0015 0.0085  258 GLY A N   
2027 C CA  . GLY A 280 ? 0.1119 0.1087 0.0857 0.0129  -0.0015 0.0071  258 GLY A CA  
2028 C C   . GLY A 280 ? 0.1225 0.1218 0.0961 0.0121  -0.0038 0.0061  258 GLY A C   
2029 O O   . GLY A 280 ? 0.1725 0.1717 0.1469 0.0117  -0.0034 0.0056  258 GLY A O   
2030 N N   . LEU A 281 ? 0.0979 0.0993 0.0705 0.0118  -0.0060 0.0056  259 LEU A N   
2031 C CA  . LEU A 281 ? 0.1048 0.1085 0.0776 0.0111  -0.0079 0.0047  259 LEU A CA  
2032 C C   . LEU A 281 ? 0.1357 0.1389 0.1092 0.0087  -0.0088 0.0034  259 LEU A C   
2033 O O   . LEU A 281 ? 0.1305 0.1351 0.1043 0.0079  -0.0098 0.0030  259 LEU A O   
2034 C CB  . LEU A 281 ? 0.1193 0.1255 0.0911 0.0118  -0.0097 0.0045  259 LEU A CB  
2035 C CG  . LEU A 281 ? 0.1148 0.1226 0.0852 0.0145  -0.0094 0.0057  259 LEU A CG  
2036 C CD1 . LEU A 281 ? 0.1256 0.1364 0.0954 0.0147  -0.0115 0.0046  259 LEU A CD1 
2037 C CD2 . LEU A 281 ? 0.1529 0.1615 0.1235 0.0160  -0.0085 0.0067  259 LEU A CD2 
2038 N N   . CYS A 282 ? 0.0885 0.0901 0.0626 0.0078  -0.0083 0.0029  260 CYS A N   
2039 C CA  . CYS A 282 ? 0.0851 0.0867 0.0596 0.0060  -0.0092 0.0018  260 CYS A CA  
2040 C C   . CYS A 282 ? 0.1170 0.1173 0.0925 0.0053  -0.0081 0.0009  260 CYS A C   
2041 O O   . CYS A 282 ? 0.1366 0.1356 0.1129 0.0059  -0.0065 0.0012  260 CYS A O   
2042 C CB  . CYS A 282 ? 0.0988 0.1012 0.0728 0.0055  -0.0110 0.0016  260 CYS A CB  
2043 S SG  . CYS A 282 ? 0.1187 0.1203 0.0927 0.0060  -0.0111 0.0015  260 CYS A SG  
2044 N N   . ASP A 283 ? 0.0759 0.0767 0.0516 0.0040  -0.0089 -0.0001 261 ASP A N   
2045 C CA  . ASP A 283 ? 0.0931 0.0936 0.0702 0.0031  -0.0082 -0.0016 261 ASP A CA  
2046 C C   . ASP A 283 ? 0.0951 0.0965 0.0724 0.0026  -0.0097 -0.0023 261 ASP A C   
2047 O O   . ASP A 283 ? 0.1174 0.1195 0.0960 0.0018  -0.0096 -0.0038 261 ASP A O   
2048 C CB  . ASP A 283 ? 0.0950 0.0961 0.0721 0.0024  -0.0079 -0.0027 261 ASP A CB  
2049 C CG  . ASP A 283 ? 0.0846 0.0849 0.0618 0.0032  -0.0064 -0.0020 261 ASP A CG  
2050 O OD1 . ASP A 283 ? 0.1375 0.1361 0.1161 0.0037  -0.0045 -0.0020 261 ASP A OD1 
2051 O OD2 . ASP A 283 ? 0.1041 0.1054 0.0803 0.0034  -0.0070 -0.0014 261 ASP A OD2 
2052 N N   . GLY A 284 ? 0.0826 0.0843 0.0588 0.0030  -0.0110 -0.0013 262 GLY A N   
2053 C CA  . GLY A 284 ? 0.1141 0.1165 0.0905 0.0028  -0.0124 -0.0017 262 GLY A CA  
2054 C C   . GLY A 284 ? 0.0861 0.0883 0.0614 0.0032  -0.0137 -0.0007 262 GLY A C   
2055 O O   . GLY A 284 ? 0.0777 0.0797 0.0522 0.0034  -0.0136 0.0001  262 GLY A O   
2056 N N   . PHE A 285 ? 0.0818 0.0843 0.0572 0.0032  -0.0148 -0.0008 263 PHE A N   
2057 C CA  . PHE A 285 ? 0.0798 0.0817 0.0547 0.0036  -0.0158 -0.0001 263 PHE A CA  
2058 C C   . PHE A 285 ? 0.0963 0.0984 0.0709 0.0036  -0.0171 0.0002  263 PHE A C   
2059 O O   . PHE A 285 ? 0.1119 0.1149 0.0869 0.0038  -0.0175 -0.0004 263 PHE A O   
2060 C CB  . PHE A 285 ? 0.0913 0.0928 0.0669 0.0042  -0.0157 -0.0004 263 PHE A CB  
2061 C CG  . PHE A 285 ? 0.0701 0.0714 0.0455 0.0047  -0.0145 -0.0002 263 PHE A CG  
2062 C CD1 . PHE A 285 ? 0.0894 0.0907 0.0656 0.0048  -0.0130 -0.0005 263 PHE A CD1 
2063 C CD2 . PHE A 285 ? 0.0954 0.0968 0.0700 0.0052  -0.0147 0.0001  263 PHE A CD2 
2064 C CE1 . PHE A 285 ? 0.1244 0.1253 0.1001 0.0057  -0.0116 0.0001  263 PHE A CE1 
2065 C CE2 . PHE A 285 ? 0.1039 0.1057 0.0780 0.0061  -0.0137 0.0004  263 PHE A CE2 
2066 C CZ  . PHE A 285 ? 0.0871 0.0885 0.0615 0.0065  -0.0121 0.0007  263 PHE A CZ  
2067 N N   . GLY A 286 ? 0.0979 0.0990 0.0718 0.0035  -0.0176 0.0012  264 GLY A N   
2068 C CA  . GLY A 286 ? 0.0841 0.0845 0.0580 0.0040  -0.0185 0.0018  264 GLY A CA  
2069 C C   . GLY A 286 ? 0.1702 0.1695 0.1452 0.0044  -0.0186 0.0014  264 GLY A C   
2070 O O   . GLY A 286 ? 0.1760 0.1747 0.1512 0.0040  -0.0183 0.0013  264 GLY A O   
2071 N N   . MET A 287 ? 0.0938 0.0933 0.0697 0.0051  -0.0190 0.0008  265 MET A N   
2072 C CA  . MET A 287 ? 0.1279 0.1266 0.1047 0.0055  -0.0189 0.0002  265 MET A CA  
2073 C C   . MET A 287 ? 0.1130 0.1105 0.0906 0.0063  -0.0196 0.0004  265 MET A C   
2074 O O   . MET A 287 ? 0.1184 0.1165 0.0963 0.0070  -0.0202 0.0007  265 MET A O   
2075 C CB  . MET A 287 ? 0.1324 0.1323 0.1098 0.0059  -0.0183 -0.0008 265 MET A CB  
2076 C CG  . MET A 287 ? 0.1056 0.1051 0.0834 0.0065  -0.0181 -0.0016 265 MET A CG  
2077 S SD  . MET A 287 ? 0.1197 0.1188 0.0968 0.0063  -0.0181 -0.0020 265 MET A SD  
2078 C CE  . MET A 287 ? 0.1174 0.1179 0.0934 0.0063  -0.0170 -0.0017 265 MET A CE  
2079 N N   . LYS A 288 ? 0.0996 0.0955 0.0777 0.0061  -0.0196 0.0001  266 LYS A N   
2080 C CA  . LYS A 288 ? 0.1010 0.0950 0.0803 0.0068  -0.0199 0.0003  266 LYS A CA  
2081 C C   . LYS A 288 ? 0.0948 0.0890 0.0752 0.0076  -0.0199 -0.0013 266 LYS A C   
2082 O O   . LYS A 288 ? 0.1093 0.1041 0.0896 0.0073  -0.0196 -0.0026 266 LYS A O   
2083 C CB  . LYS A 288 ? 0.1049 0.0966 0.0847 0.0061  -0.0196 0.0008  266 LYS A CB  
2084 C CG  . LYS A 288 ? 0.1388 0.1300 0.1174 0.0057  -0.0194 0.0028  266 LYS A CG  
2085 C CD  . LYS A 288 ? 0.1700 0.1590 0.1496 0.0046  -0.0187 0.0033  266 LYS A CD  
2086 C CE  . LYS A 288 ? 0.1991 0.1876 0.1772 0.0044  -0.0182 0.0056  266 LYS A CE  
2087 N NZ  . LYS A 288 ? 0.1978 0.1890 0.1743 0.0039  -0.0182 0.0055  266 LYS A NZ  
2088 N N   . LEU A 289 ? 0.0978 0.0919 0.0791 0.0087  -0.0202 -0.0012 267 LEU A N   
2089 C CA  . LEU A 289 ? 0.1102 0.1047 0.0926 0.0096  -0.0201 -0.0027 267 LEU A CA  
2090 C C   . LEU A 289 ? 0.1050 0.0979 0.0881 0.0095  -0.0198 -0.0041 267 LEU A C   
2091 O O   . LEU A 289 ? 0.1178 0.1119 0.1008 0.0097  -0.0194 -0.0057 267 LEU A O   
2092 C CB  . LEU A 289 ? 0.1146 0.1093 0.0983 0.0110  -0.0206 -0.0022 267 LEU A CB  
2093 C CG  . LEU A 289 ? 0.2165 0.2121 0.2018 0.0122  -0.0204 -0.0036 267 LEU A CG  
2094 C CD1 . LEU A 289 ? 0.2860 0.2839 0.2709 0.0117  -0.0196 -0.0047 267 LEU A CD1 
2095 C CD2 . LEU A 289 ? 0.1710 0.1676 0.1576 0.0136  -0.0211 -0.0029 267 LEU A CD2 
2096 N N   . THR A 290 ? 0.1036 0.0939 0.0875 0.0091  -0.0199 -0.0037 268 THR A N   
2097 C CA  . THR A 290 ? 0.1100 0.0989 0.0952 0.0087  -0.0196 -0.0056 268 THR A CA  
2098 C C   . THR A 290 ? 0.1213 0.1119 0.1057 0.0076  -0.0195 -0.0069 268 THR A C   
2099 O O   . THR A 290 ? 0.1407 0.1322 0.1254 0.0077  -0.0195 -0.0091 268 THR A O   
2100 C CB  . THR A 290 ? 0.1177 0.1029 0.1047 0.0085  -0.0193 -0.0049 268 THR A CB  
2101 O OG1 . THR A 290 ? 0.1152 0.0997 0.1015 0.0075  -0.0191 -0.0029 268 THR A OG1 
2102 C CG2 . THR A 290 ? 0.1397 0.1232 0.1277 0.0102  -0.0193 -0.0039 268 THR A CG2 
2103 N N   . ARG A 291 ? 0.0881 0.0796 0.0712 0.0067  -0.0195 -0.0056 269 ARG A N   
2104 C CA  . ARG A 291 ? 0.0802 0.0738 0.0625 0.0060  -0.0196 -0.0067 269 ARG A CA  
2105 C C   . ARG A 291 ? 0.1270 0.1232 0.1078 0.0069  -0.0195 -0.0076 269 ARG A C   
2106 O O   . ARG A 291 ? 0.1000 0.0980 0.0805 0.0071  -0.0196 -0.0093 269 ARG A O   
2107 C CB  . ARG A 291 ? 0.1087 0.1028 0.0901 0.0051  -0.0194 -0.0050 269 ARG A CB  
2108 C CG  . ARG A 291 ? 0.1021 0.0987 0.0830 0.0046  -0.0195 -0.0059 269 ARG A CG  
2109 C CD  . ARG A 291 ? 0.1149 0.1117 0.0952 0.0036  -0.0192 -0.0044 269 ARG A CD  
2110 N NE  . ARG A 291 ? 0.1064 0.1035 0.0852 0.0041  -0.0190 -0.0027 269 ARG A NE  
2111 C CZ  . ARG A 291 ? 0.1029 0.0989 0.0813 0.0037  -0.0188 -0.0011 269 ARG A CZ  
2112 N NH1 . ARG A 291 ? 0.1355 0.1323 0.1128 0.0041  -0.0187 -0.0002 269 ARG A NH1 
2113 N NH2 . ARG A 291 ? 0.1203 0.1147 0.0997 0.0029  -0.0186 -0.0004 269 ARG A NH2 
2114 N N   A ILE A 292 ? 0.1043 0.1012 0.0843 0.0077  -0.0192 -0.0065 270 ILE A N   
2115 N N   B ILE A 292 ? 0.1001 0.0969 0.0801 0.0077  -0.0192 -0.0065 270 ILE A N   
2116 C CA  A ILE A 292 ? 0.0983 0.0973 0.0769 0.0086  -0.0186 -0.0069 270 ILE A CA  
2117 C CA  B ILE A 292 ? 0.1020 0.1009 0.0806 0.0086  -0.0186 -0.0069 270 ILE A CA  
2118 C C   A ILE A 292 ? 0.0981 0.0974 0.0770 0.0096  -0.0184 -0.0086 270 ILE A C   
2119 C C   B ILE A 292 ? 0.0994 0.0987 0.0784 0.0096  -0.0184 -0.0086 270 ILE A C   
2120 O O   A ILE A 292 ? 0.1036 0.1047 0.0811 0.0105  -0.0178 -0.0092 270 ILE A O   
2121 O O   B ILE A 292 ? 0.1039 0.1050 0.0814 0.0105  -0.0178 -0.0092 270 ILE A O   
2122 C CB  A ILE A 292 ? 0.0998 0.0993 0.0779 0.0087  -0.0179 -0.0054 270 ILE A CB  
2123 C CB  B ILE A 292 ? 0.0892 0.0886 0.0675 0.0087  -0.0179 -0.0054 270 ILE A CB  
2124 C CG1 A ILE A 292 ? 0.1139 0.1152 0.0904 0.0093  -0.0169 -0.0053 270 ILE A CG1 
2125 C CG1 B ILE A 292 ? 0.1158 0.1168 0.0925 0.0092  -0.0168 -0.0051 270 ILE A CG1 
2126 C CG2 A ILE A 292 ? 0.0879 0.0871 0.0674 0.0093  -0.0178 -0.0055 270 ILE A CG2 
2127 C CG2 B ILE A 292 ? 0.0983 0.0973 0.0781 0.0093  -0.0179 -0.0055 270 ILE A CG2 
2128 C CD1 A ILE A 292 ? 0.1280 0.1294 0.1044 0.0090  -0.0160 -0.0040 270 ILE A CD1 
2129 C CD1 B ILE A 292 ? 0.0761 0.0779 0.0515 0.0089  -0.0168 -0.0046 270 ILE A CD1 
2130 N N   . GLY A 293 ? 0.0914 0.0888 0.0721 0.0097  -0.0188 -0.0093 271 GLY A N   
2131 C CA  . GLY A 293 ? 0.0881 0.0856 0.0695 0.0106  -0.0186 -0.0113 271 GLY A CA  
2132 C C   . GLY A 293 ? 0.1115 0.1086 0.0941 0.0117  -0.0182 -0.0110 271 GLY A C   
2133 O O   . GLY A 293 ? 0.1599 0.1575 0.1429 0.0127  -0.0178 -0.0127 271 GLY A O   
2134 N N   . GLY A 294 ? 0.1094 0.1060 0.0926 0.0116  -0.0183 -0.0092 272 GLY A N   
2135 C CA  . GLY A 294 ? 0.1075 0.1044 0.0924 0.0127  -0.0182 -0.0091 272 GLY A CA  
2136 C C   . GLY A 294 ? 0.1023 0.1014 0.0870 0.0127  -0.0176 -0.0083 272 GLY A C   
2137 O O   . GLY A 294 ? 0.1171 0.1171 0.1005 0.0119  -0.0172 -0.0075 272 GLY A O   
2138 N N   . LEU A 295 ? 0.0790 0.0791 0.0656 0.0136  -0.0174 -0.0085 273 LEU A N   
2139 C CA  . LEU A 295 ? 0.0774 0.0798 0.0650 0.0135  -0.0169 -0.0080 273 LEU A CA  
2140 C C   . LEU A 295 ? 0.0911 0.0950 0.0779 0.0133  -0.0151 -0.0084 273 LEU A C   
2141 O O   . LEU A 295 ? 0.1154 0.1204 0.1024 0.0125  -0.0144 -0.0078 273 LEU A O   
2142 C CB  . LEU A 295 ? 0.0816 0.0852 0.0720 0.0146  -0.0173 -0.0084 273 LEU A CB  
2143 C CG  . LEU A 295 ? 0.0908 0.0931 0.0818 0.0152  -0.0189 -0.0074 273 LEU A CG  
2144 C CD1 . LEU A 295 ? 0.1082 0.1113 0.1018 0.0170  -0.0193 -0.0079 273 LEU A CD1 
2145 C CD2 . LEU A 295 ? 0.1017 0.1055 0.0923 0.0144  -0.0196 -0.0063 273 LEU A CD2 
2146 N N   . GLN A 296 ? 0.0928 0.0967 0.0787 0.0140  -0.0143 -0.0095 274 GLN A N   
2147 C CA  . GLN A 296 ? 0.0857 0.0910 0.0703 0.0142  -0.0124 -0.0095 274 GLN A CA  
2148 C C   . GLN A 296 ? 0.1158 0.1207 0.0980 0.0134  -0.0122 -0.0082 274 GLN A C   
2149 O O   . GLN A 296 ? 0.1169 0.1226 0.0992 0.0130  -0.0106 -0.0073 274 GLN A O   
2150 C CB  . GLN A 296 ? 0.1203 0.1259 0.1035 0.0154  -0.0119 -0.0109 274 GLN A CB  
2151 C CG  . GLN A 296 ? 0.1203 0.1277 0.1024 0.0162  -0.0096 -0.0108 274 GLN A CG  
2152 C CD  . GLN A 296 ? 0.1569 0.1644 0.1357 0.0162  -0.0088 -0.0096 274 GLN A CD  
2153 O OE1 . GLN A 296 ? 0.1313 0.1383 0.1082 0.0161  -0.0101 -0.0098 274 GLN A OE1 
2154 N NE2 . GLN A 296 ? 0.1516 0.1599 0.1299 0.0164  -0.0064 -0.0084 274 GLN A NE2 
2155 N N   . GLN A 297 ? 0.1025 0.1062 0.0833 0.0130  -0.0135 -0.0082 275 GLN A N   
2156 C CA  . GLN A 297 ? 0.0792 0.0828 0.0580 0.0124  -0.0134 -0.0071 275 GLN A CA  
2157 C C   . GLN A 297 ? 0.1003 0.1034 0.0801 0.0112  -0.0137 -0.0059 275 GLN A C   
2158 O O   . GLN A 297 ? 0.1107 0.1140 0.0897 0.0108  -0.0128 -0.0049 275 GLN A O   
2159 C CB  . GLN A 297 ? 0.1024 0.1055 0.0798 0.0123  -0.0148 -0.0078 275 GLN A CB  
2160 C CG  . GLN A 297 ? 0.1018 0.1061 0.0776 0.0135  -0.0144 -0.0093 275 GLN A CG  
2161 C CD  . GLN A 297 ? 0.1107 0.1167 0.0838 0.0144  -0.0132 -0.0084 275 GLN A CD  
2162 O OE1 . GLN A 297 ? 0.1219 0.1284 0.0935 0.0143  -0.0137 -0.0079 275 GLN A OE1 
2163 N NE2 . GLN A 297 ? 0.1166 0.1234 0.0890 0.0154  -0.0113 -0.0080 275 GLN A NE2 
2164 N N   . MET A 298 ? 0.1015 0.1041 0.0831 0.0109  -0.0149 -0.0061 276 MET A N   
2165 C CA  . MET A 298 ? 0.0896 0.0923 0.0720 0.0100  -0.0154 -0.0052 276 MET A CA  
2166 C C   . MET A 298 ? 0.1046 0.1087 0.0885 0.0096  -0.0140 -0.0053 276 MET A C   
2167 O O   . MET A 298 ? 0.1056 0.1099 0.0895 0.0087  -0.0137 -0.0048 276 MET A O   
2168 C CB  . MET A 298 ? 0.0944 0.0967 0.0781 0.0102  -0.0170 -0.0052 276 MET A CB  
2169 C CG  . MET A 298 ? 0.1542 0.1567 0.1378 0.0095  -0.0178 -0.0043 276 MET A CG  
2170 S SD  . MET A 298 ? 0.1496 0.1503 0.1309 0.0086  -0.0182 -0.0033 276 MET A SD  
2171 C CE  . MET A 298 ? 0.2164 0.2180 0.1976 0.0080  -0.0189 -0.0025 276 MET A CE  
2172 N N   . ALA A 299 ? 0.1001 0.1053 0.0855 0.0103  -0.0130 -0.0060 277 ALA A N   
2173 C CA  . ALA A 299 ? 0.1050 0.1116 0.0926 0.0097  -0.0113 -0.0063 277 ALA A CA  
2174 C C   . ALA A 299 ? 0.1035 0.1093 0.0896 0.0094  -0.0092 -0.0053 277 ALA A C   
2175 O O   . ALA A 299 ? 0.1088 0.1148 0.0963 0.0084  -0.0081 -0.0052 277 ALA A O   
2176 C CB  . ALA A 299 ? 0.1179 0.1260 0.1077 0.0105  -0.0103 -0.0073 277 ALA A CB  
2177 N N   . ALA A 300 ? 0.0943 0.0994 0.0776 0.0103  -0.0087 -0.0047 278 ALA A N   
2178 C CA  . ALA A 300 ? 0.0757 0.0801 0.0571 0.0106  -0.0069 -0.0034 278 ALA A CA  
2179 C C   . ALA A 300 ? 0.0871 0.0905 0.0677 0.0097  -0.0077 -0.0027 278 ALA A C   
2180 O O   . ALA A 300 ? 0.0884 0.0912 0.0691 0.0093  -0.0060 -0.0018 278 ALA A O   
2181 C CB  . ALA A 300 ? 0.0886 0.0932 0.0668 0.0121  -0.0068 -0.0032 278 ALA A CB  
2182 N N   . PHE A 301 ? 0.0990 0.1022 0.0789 0.0094  -0.0100 -0.0031 279 PHE A N   
2183 C CA  . PHE A 301 ? 0.0888 0.0914 0.0681 0.0086  -0.0108 -0.0025 279 PHE A CA  
2184 C C   . PHE A 301 ? 0.0850 0.0879 0.0666 0.0074  -0.0103 -0.0028 279 PHE A C   
2185 O O   . PHE A 301 ? 0.0934 0.0957 0.0748 0.0069  -0.0093 -0.0023 279 PHE A O   
2186 C CB  . PHE A 301 ? 0.0740 0.0763 0.0528 0.0084  -0.0131 -0.0029 279 PHE A CB  
2187 C CG  . PHE A 301 ? 0.0966 0.0985 0.0753 0.0074  -0.0139 -0.0024 279 PHE A CG  
2188 C CD1 . PHE A 301 ? 0.1184 0.1200 0.0956 0.0072  -0.0137 -0.0017 279 PHE A CD1 
2189 C CD2 . PHE A 301 ? 0.1386 0.1410 0.1186 0.0068  -0.0149 -0.0028 279 PHE A CD2 
2190 C CE1 . PHE A 301 ? 0.1350 0.1365 0.1122 0.0063  -0.0142 -0.0014 279 PHE A CE1 
2191 C CE2 . PHE A 301 ? 0.1489 0.1513 0.1284 0.0061  -0.0156 -0.0024 279 PHE A CE2 
2192 C CZ  . PHE A 301 ? 0.1166 0.1184 0.0948 0.0057  -0.0151 -0.0018 279 PHE A CZ  
2193 N N   . ARG A 302 ? 0.0829 0.0869 0.0668 0.0071  -0.0109 -0.0039 280 ARG A N   
2194 C CA  . ARG A 302 ? 0.0869 0.0921 0.0733 0.0061  -0.0106 -0.0048 280 ARG A CA  
2195 C C   . ARG A 302 ? 0.0719 0.0766 0.0599 0.0055  -0.0078 -0.0048 280 ARG A C   
2196 O O   . ARG A 302 ? 0.1034 0.1080 0.0925 0.0045  -0.0071 -0.0053 280 ARG A O   
2197 C CB  . ARG A 302 ? 0.0852 0.0924 0.0741 0.0063  -0.0117 -0.0061 280 ARG A CB  
2198 C CG  . ARG A 302 ? 0.1078 0.1172 0.1001 0.0053  -0.0113 -0.0076 280 ARG A CG  
2199 C CD  . ARG A 302 ? 0.0900 0.1018 0.0854 0.0057  -0.0114 -0.0089 280 ARG A CD  
2200 N NE  . ARG A 302 ? 0.0757 0.0867 0.0717 0.0060  -0.0091 -0.0086 280 ARG A NE  
2201 C CZ  . ARG A 302 ? 0.1129 0.1251 0.1102 0.0069  -0.0090 -0.0091 280 ARG A CZ  
2202 N NH1 . ARG A 302 ? 0.0994 0.1135 0.0979 0.0077  -0.0112 -0.0099 280 ARG A NH1 
2203 N NH2 . ARG A 302 ? 0.1040 0.1156 0.1016 0.0073  -0.0067 -0.0088 280 ARG A NH2 
2204 N N   . ASP A 303 ? 0.0797 0.0841 0.0677 0.0062  -0.0060 -0.0044 281 ASP A N   
2205 C CA  . ASP A 303 ? 0.0745 0.0780 0.0640 0.0059  -0.0028 -0.0039 281 ASP A CA  
2206 C C   . ASP A 303 ? 0.0933 0.0947 0.0806 0.0061  -0.0016 -0.0024 281 ASP A C   
2207 O O   . ASP A 303 ? 0.1022 0.1025 0.0915 0.0053  0.0006  -0.0023 281 ASP A O   
2208 C CB  . ASP A 303 ? 0.0892 0.0930 0.0788 0.0069  -0.0010 -0.0034 281 ASP A CB  
2209 C CG  . ASP A 303 ? 0.1494 0.1554 0.1420 0.0066  -0.0017 -0.0051 281 ASP A CG  
2210 O OD1 . ASP A 303 ? 0.1824 0.1900 0.1781 0.0055  -0.0027 -0.0067 281 ASP A OD1 
2211 O OD2 . ASP A 303 ? 0.1639 0.1705 0.1560 0.0077  -0.0012 -0.0050 281 ASP A OD2 
2212 N N   . ILE A 304 ? 0.0886 0.0895 0.0724 0.0072  -0.0030 -0.0012 282 ILE A N   
2213 C CA  . ILE A 304 ? 0.0839 0.0834 0.0657 0.0077  -0.0023 0.0002  282 ILE A CA  
2214 C C   . ILE A 304 ? 0.1127 0.1119 0.0959 0.0063  -0.0029 -0.0006 282 ILE A C   
2215 O O   . ILE A 304 ? 0.1268 0.1246 0.1108 0.0060  -0.0009 -0.0002 282 ILE A O   
2216 C CB  . ILE A 304 ? 0.0876 0.0875 0.0658 0.0090  -0.0041 0.0010  282 ILE A CB  
2217 C CG1 . ILE A 304 ? 0.0984 0.0988 0.0747 0.0107  -0.0031 0.0018  282 ILE A CG1 
2218 C CG2 . ILE A 304 ? 0.1069 0.1061 0.0835 0.0094  -0.0040 0.0021  282 ILE A CG2 
2219 C CD1 . ILE A 304 ? 0.1454 0.1470 0.1190 0.0118  -0.0052 0.0015  282 ILE A CD1 
2220 N N   . CYS A 305 ? 0.0826 0.0831 0.0660 0.0055  -0.0054 -0.0018 283 CYS A N   
2221 C CA  . CYS A 305 ? 0.0905 0.0912 0.0748 0.0044  -0.0061 -0.0027 283 CYS A CA  
2222 C C   . CYS A 305 ? 0.0892 0.0902 0.0770 0.0031  -0.0044 -0.0043 283 CYS A C   
2223 O O   . CYS A 305 ? 0.1153 0.1156 0.1039 0.0023  -0.0036 -0.0048 283 CYS A O   
2224 C CB  . CYS A 305 ? 0.0879 0.0901 0.0715 0.0041  -0.0090 -0.0034 283 CYS A CB  
2225 S SG  . CYS A 305 ? 0.0960 0.0977 0.0763 0.0050  -0.0107 -0.0021 283 CYS A SG  
2226 N N   . GLU A 306 ? 0.1039 0.1060 0.0942 0.0028  -0.0039 -0.0053 284 GLU A N   
2227 C CA  . GLU A 306 ? 0.0808 0.0837 0.0753 0.0013  -0.0023 -0.0072 284 GLU A CA  
2228 C C   . GLU A 306 ? 0.1096 0.1098 0.1054 0.0010  0.0013  -0.0064 284 GLU A C   
2229 O O   . GLU A 306 ? 0.1080 0.1078 0.1066 -0.0003 0.0027  -0.0079 284 GLU A O   
2230 C CB  . GLU A 306 ? 0.0868 0.0920 0.0843 0.0010  -0.0025 -0.0086 284 GLU A CB  
2231 C CG  . GLU A 306 ? 0.0911 0.0981 0.0936 -0.0007 -0.0013 -0.0114 284 GLU A CG  
2232 C CD  . GLU A 306 ? 0.1543 0.1649 0.1600 -0.0009 -0.0023 -0.0132 284 GLU A CD  
2233 O OE1 . GLU A 306 ? 0.1156 0.1269 0.1195 0.0004  -0.0039 -0.0123 284 GLU A OE1 
2234 O OE2 . GLU A 306 ? 0.2007 0.2135 0.2111 -0.0025 -0.0015 -0.0159 284 GLU A OE2 
2235 N N   . ALA A 307 ? 0.0907 0.0889 0.0842 0.0025  0.0029  -0.0040 285 ALA A N   
2236 C CA  . ALA A 307 ? 0.0851 0.0804 0.0792 0.0028  0.0065  -0.0024 285 ALA A CA  
2237 C C   . ALA A 307 ? 0.1038 0.0974 0.0968 0.0028  0.0066  -0.0020 285 ALA A C   
2238 O O   . ALA A 307 ? 0.1140 0.1051 0.1089 0.0025  0.0097  -0.0016 285 ALA A O   
2239 C CB  . ALA A 307 ? 0.0995 0.0936 0.0904 0.0049  0.0078  0.0003  285 ALA A CB  
2240 N N   . ARG A 308 ? 0.1104 0.1052 0.1007 0.0031  0.0037  -0.0021 286 ARG A N   
2241 C CA  . ARG A 308 ? 0.1078 0.1013 0.0970 0.0033  0.0038  -0.0017 286 ARG A CA  
2242 C C   . ARG A 308 ? 0.1101 0.1053 0.1004 0.0018  0.0019  -0.0041 286 ARG A C   
2243 O O   . ARG A 308 ? 0.1229 0.1177 0.1119 0.0020  0.0014  -0.0039 286 ARG A O   
2244 C CB  . ARG A 308 ? 0.1432 0.1367 0.1282 0.0052  0.0024  0.0005  286 ARG A CB  
2245 C CG  . ARG A 308 ? 0.1416 0.1334 0.1250 0.0072  0.0046  0.0031  286 ARG A CG  
2246 C CD  . ARG A 308 ? 0.1457 0.1346 0.1307 0.0074  0.0080  0.0041  286 ARG A CD  
2247 N NE  . ARG A 308 ? 0.1511 0.1384 0.1341 0.0097  0.0103  0.0070  286 ARG A NE  
2248 C CZ  . ARG A 308 ? 0.1251 0.1126 0.1047 0.0120  0.0099  0.0091  286 ARG A CZ  
2249 N NH1 . ARG A 308 ? 0.1250 0.1115 0.1026 0.0144  0.0120  0.0119  286 ARG A NH1 
2250 N NH2 . ARG A 308 ? 0.1474 0.1363 0.1258 0.0120  0.0075  0.0085  286 ARG A NH2 
2251 N N   . ALA A 309 ? 0.1007 0.0981 0.0934 0.0005  0.0008  -0.0064 287 ALA A N   
2252 C CA  . ALA A 309 ? 0.1072 0.1070 0.1005 -0.0007 -0.0012 -0.0088 287 ALA A CA  
2253 C C   . ALA A 309 ? 0.0995 0.1000 0.0890 0.0001  -0.0037 -0.0077 287 ALA A C   
2254 O O   . ALA A 309 ? 0.1210 0.1217 0.1099 -0.0003 -0.0041 -0.0084 287 ALA A O   
2255 C CB  . ALA A 309 ? 0.1228 0.1218 0.1192 -0.0020 0.0007  -0.0109 287 ALA A CB  
2256 N N   . LEU A 310 ? 0.0928 0.0935 0.0799 0.0012  -0.0052 -0.0060 288 LEU A N   
2257 C CA  . LEU A 310 ? 0.0829 0.0842 0.0669 0.0018  -0.0074 -0.0050 288 LEU A CA  
2258 C C   . LEU A 310 ? 0.1063 0.1099 0.0900 0.0016  -0.0099 -0.0058 288 LEU A C   
2259 O O   . LEU A 310 ? 0.1111 0.1150 0.0949 0.0021  -0.0106 -0.0054 288 LEU A O   
2260 C CB  . LEU A 310 ? 0.0822 0.0823 0.0639 0.0031  -0.0074 -0.0028 288 LEU A CB  
2261 C CG  . LEU A 310 ? 0.0825 0.0808 0.0638 0.0039  -0.0053 -0.0015 288 LEU A CG  
2262 C CD1 . LEU A 310 ? 0.1073 0.1054 0.0866 0.0055  -0.0054 0.0002  288 LEU A CD1 
2263 C CD2 . LEU A 310 ? 0.1664 0.1645 0.1469 0.0038  -0.0054 -0.0015 288 LEU A CD2 
2264 N N   . PRO A 311 ? 0.0714 0.0766 0.0547 0.0011  -0.0111 -0.0069 289 PRO A N   
2265 C CA  . PRO A 311 ? 0.0712 0.0787 0.0540 0.0013  -0.0133 -0.0073 289 PRO A CA  
2266 C C   . PRO A 311 ? 0.0859 0.0923 0.0662 0.0023  -0.0146 -0.0052 289 PRO A C   
2267 O O   . PRO A 311 ? 0.0944 0.0993 0.0731 0.0025  -0.0143 -0.0038 289 PRO A O   
2268 C CB  . PRO A 311 ? 0.0721 0.0813 0.0539 0.0009  -0.0141 -0.0084 289 PRO A CB  
2269 C CG  . PRO A 311 ? 0.1085 0.1166 0.0919 0.0000  -0.0119 -0.0097 289 PRO A CG  
2270 C CD  . PRO A 311 ? 0.0740 0.0792 0.0571 0.0005  -0.0104 -0.0077 289 PRO A CD  
2271 N N   . HIS A 312 ? 0.1091 0.1166 0.0896 0.0029  -0.0161 -0.0052 290 HIS A N   
2272 C CA  . HIS A 312 ? 0.0937 0.1000 0.0726 0.0037  -0.0170 -0.0035 290 HIS A CA  
2273 C C   . HIS A 312 ? 0.0719 0.0795 0.0506 0.0045  -0.0187 -0.0033 290 HIS A C   
2274 O O   . HIS A 312 ? 0.0952 0.1052 0.0756 0.0047  -0.0193 -0.0047 290 HIS A O   
2275 C CB  . HIS A 312 ? 0.1139 0.1186 0.0932 0.0041  -0.0162 -0.0030 290 HIS A CB  
2276 C CG  . HIS A 312 ? 0.0917 0.0974 0.0733 0.0044  -0.0159 -0.0040 290 HIS A CG  
2277 N ND1 . HIS A 312 ? 0.0940 0.1002 0.0761 0.0052  -0.0171 -0.0039 290 HIS A ND1 
2278 C CD2 . HIS A 312 ? 0.0999 0.1060 0.0836 0.0039  -0.0144 -0.0050 290 HIS A CD2 
2279 C CE1 . HIS A 312 ? 0.1226 0.1298 0.1069 0.0053  -0.0165 -0.0050 290 HIS A CE1 
2280 N NE2 . HIS A 312 ? 0.1102 0.1174 0.0957 0.0044  -0.0147 -0.0057 290 HIS A NE2 
2281 N N   . SER A 313 ? 0.1099 0.1161 0.0870 0.0051  -0.0195 -0.0017 291 SER A N   
2282 C CA  . SER A 313 ? 0.0945 0.1012 0.0714 0.0063  -0.0209 -0.0010 291 SER A CA  
2283 C C   . SER A 313 ? 0.1290 0.1342 0.1072 0.0069  -0.0208 -0.0009 291 SER A C   
2284 O O   . SER A 313 ? 0.1168 0.1206 0.0954 0.0064  -0.0198 -0.0011 291 SER A O   
2285 C CB  . SER A 313 ? 0.1081 0.1137 0.0826 0.0066  -0.0213 0.0008  291 SER A CB  
2286 O OG  . SER A 313 ? 0.1416 0.1446 0.1157 0.0060  -0.0205 0.0017  291 SER A OG  
2287 N N   . CYS A 314 ? 0.1011 0.1067 0.0798 0.0081  -0.0218 -0.0005 292 CYS A N   
2288 C CA  . CYS A 314 ? 0.0983 0.1024 0.0782 0.0089  -0.0218 -0.0004 292 CYS A CA  
2289 C C   . CYS A 314 ? 0.1069 0.1091 0.0858 0.0100  -0.0225 0.0013  292 CYS A C   
2290 O O   . CYS A 314 ? 0.1294 0.1329 0.1085 0.0114  -0.0236 0.0019  292 CYS A O   
2291 C CB  . CYS A 314 ? 0.1115 0.1180 0.0939 0.0096  -0.0221 -0.0018 292 CYS A CB  
2292 S SG  . CYS A 314 ? 0.1514 0.1594 0.1357 0.0084  -0.0205 -0.0038 292 CYS A SG  
2293 N N   . ASP A 315 ? 0.1062 0.1055 0.0843 0.0094  -0.0219 0.0022  293 ASP A N   
2294 C CA  . ASP A 315 ? 0.1272 0.1243 0.1044 0.0100  -0.0221 0.0042  293 ASP A CA  
2295 C C   . ASP A 315 ? 0.1523 0.1463 0.1309 0.0101  -0.0216 0.0040  293 ASP A C   
2296 O O   . ASP A 315 ? 0.1326 0.1268 0.1125 0.0098  -0.0213 0.0023  293 ASP A O   
2297 C CB  . ASP A 315 ? 0.1568 0.1532 0.1323 0.0088  -0.0215 0.0052  293 ASP A CB  
2298 C CG  . ASP A 315 ? 0.1359 0.1351 0.1099 0.0085  -0.0218 0.0050  293 ASP A CG  
2299 O OD1 . ASP A 315 ? 0.1256 0.1273 0.0995 0.0096  -0.0227 0.0046  293 ASP A OD1 
2300 O OD2 . ASP A 315 ? 0.1517 0.1509 0.1248 0.0073  -0.0211 0.0049  293 ASP A OD2 
2301 N N   . ASP A 316 ? 0.1321 0.1234 0.1106 0.0106  -0.0213 0.0058  294 ASP A N   
2302 C CA  . ASP A 316 ? 0.1646 0.1527 0.1446 0.0099  -0.0205 0.0053  294 ASP A CA  
2303 C C   . ASP A 316 ? 0.2069 0.1925 0.1863 0.0091  -0.0195 0.0071  294 ASP A C   
2304 O O   . ASP A 316 ? 0.2042 0.1905 0.1816 0.0094  -0.0195 0.0090  294 ASP A O   
2305 C CB  . ASP A 316 ? 0.1435 0.1299 0.1254 0.0112  -0.0205 0.0047  294 ASP A CB  
2306 C CG  . ASP A 316 ? 0.1545 0.1402 0.1381 0.0102  -0.0201 0.0023  294 ASP A CG  
2307 O OD1 . ASP A 316 ? 0.1834 0.1663 0.1681 0.0093  -0.0193 0.0020  294 ASP A OD1 
2308 O OD2 . ASP A 316 ? 0.1627 0.1507 0.1464 0.0103  -0.0204 0.0006  294 ASP A OD2 
2309 N N   . ALA A 317 ? 0.1597 0.1424 0.1410 0.0081  -0.0186 0.0064  295 ALA A N   
2310 C CA  . ALA A 317 ? 0.2019 0.1821 0.1835 0.0071  -0.0174 0.0080  295 ALA A CA  
2311 C C   . ALA A 317 ? 0.1847 0.1621 0.1656 0.0087  -0.0168 0.0111  295 ALA A C   
2312 O O   . ALA A 317 ? 0.1841 0.1608 0.1634 0.0085  -0.0159 0.0134  295 ALA A O   
2313 C CB  . ALA A 317 ? 0.1767 0.1548 0.1612 0.0055  -0.0165 0.0059  295 ALA A CB  
2314 N N   . TRP A 318 ? 0.1600 0.1360 0.1420 0.0105  -0.0171 0.0112  296 TRP A N   
2315 C CA  . TRP A 318 ? 0.1372 0.1104 0.1188 0.0126  -0.0165 0.0143  296 TRP A CA  
2316 C C   . TRP A 318 ? 0.1403 0.1129 0.1235 0.0144  -0.0172 0.0133  296 TRP A C   
2317 O O   . TRP A 318 ? 0.1568 0.1311 0.1414 0.0138  -0.0179 0.0103  296 TRP A O   
2318 C CB  . TRP A 318 ? 0.1885 0.1567 0.1718 0.0115  -0.0143 0.0157  296 TRP A CB  
2319 C CG  . TRP A 318 ? 0.1917 0.1574 0.1732 0.0135  -0.0132 0.0200  296 TRP A CG  
2320 C CD1 . TRP A 318 ? 0.2001 0.1620 0.1825 0.0157  -0.0124 0.0222  296 TRP A CD1 
2321 C CD2 . TRP A 318 ? 0.1936 0.1603 0.1719 0.0136  -0.0127 0.0228  296 TRP A CD2 
2322 N NE1 . TRP A 318 ? 0.2239 0.1845 0.2035 0.0174  -0.0114 0.0264  296 TRP A NE1 
2323 C CE2 . TRP A 318 ? 0.2301 0.1938 0.2071 0.0161  -0.0116 0.0268  296 TRP A CE2 
2324 C CE3 . TRP A 318 ? 0.2214 0.1914 0.1976 0.0119  -0.0129 0.0223  296 TRP A CE3 
2325 C CZ2 . TRP A 318 ? 0.2706 0.2346 0.2440 0.0170  -0.0107 0.0303  296 TRP A CZ2 
2326 C CZ3 . TRP A 318 ? 0.2742 0.2446 0.2472 0.0127  -0.0121 0.0255  296 TRP A CZ3 
2327 C CH2 . TRP A 318 ? 0.2385 0.2060 0.2099 0.0152  -0.0110 0.0295  296 TRP A CH2 
2328 N N   . GLY A 319 ? 0.1469 0.1172 0.1300 0.0169  -0.0169 0.0160  297 GLY A N   
2329 C CA  . GLY A 319 ? 0.1253 0.0945 0.1105 0.0189  -0.0173 0.0153  297 GLY A CA  
2330 C C   . GLY A 319 ? 0.1629 0.1348 0.1465 0.0221  -0.0187 0.0172  297 GLY A C   
2331 O O   . GLY A 319 ? 0.1720 0.1477 0.1528 0.0227  -0.0198 0.0184  297 GLY A O   
2332 N N   . GLY A 320 ? 0.1372 0.1074 0.1229 0.0243  -0.0187 0.0172  298 GLY A N   
2333 C CA  . GLY A 320 ? 0.1571 0.1296 0.1420 0.0279  -0.0200 0.0192  298 GLY A CA  
2334 C C   . GLY A 320 ? 0.1496 0.1278 0.1352 0.0285  -0.0220 0.0165  298 GLY A C   
2335 O O   . GLY A 320 ? 0.1288 0.1103 0.1142 0.0262  -0.0226 0.0139  298 GLY A O   
2336 N N   . ASP A 321 ? 0.1323 0.1117 0.1190 0.0317  -0.0228 0.0173  299 ASP A N   
2337 C CA  . ASP A 321 ? 0.1154 0.1010 0.1030 0.0327  -0.0247 0.0151  299 ASP A CA  
2338 C C   . ASP A 321 ? 0.1160 0.1031 0.1060 0.0304  -0.0246 0.0111  299 ASP A C   
2339 O O   . ASP A 321 ? 0.1169 0.1091 0.1070 0.0298  -0.0257 0.0092  299 ASP A O   
2340 C CB  . ASP A 321 ? 0.1325 0.1188 0.1217 0.0367  -0.0255 0.0164  299 ASP A CB  
2341 C CG  . ASP A 321 ? 0.1446 0.1325 0.1310 0.0398  -0.0264 0.0202  299 ASP A CG  
2342 O OD1 . ASP A 321 ? 0.1616 0.1527 0.1449 0.0390  -0.0273 0.0208  299 ASP A OD1 
2343 O OD2 . ASP A 321 ? 0.1514 0.1373 0.1386 0.0433  -0.0263 0.0225  299 ASP A OD2 
2344 N N   . ILE A 322 ? 0.1205 0.1031 0.1123 0.0292  -0.0231 0.0098  300 ILE A N   
2345 C CA  . ILE A 322 ? 0.1043 0.0885 0.0979 0.0276  -0.0229 0.0062  300 ILE A CA  
2346 C C   . ILE A 322 ? 0.1115 0.0978 0.1033 0.0245  -0.0229 0.0048  300 ILE A C   
2347 O O   . ILE A 322 ? 0.0961 0.0868 0.0882 0.0239  -0.0235 0.0030  300 ILE A O   
2348 C CB  . ILE A 322 ? 0.1114 0.0909 0.1075 0.0274  -0.0214 0.0048  300 ILE A CB  
2349 C CG1 . ILE A 322 ? 0.1182 0.0958 0.1165 0.0307  -0.0212 0.0060  300 ILE A CG1 
2350 C CG2 . ILE A 322 ? 0.1115 0.0930 0.1086 0.0257  -0.0211 0.0011  300 ILE A CG2 
2351 C CD1 . ILE A 322 ? 0.1481 0.1194 0.1485 0.0307  -0.0194 0.0055  300 ILE A CD1 
2352 N N   . ILE A 323 ? 0.1003 0.0837 0.0907 0.0226  -0.0221 0.0056  301 ILE A N   
2353 C CA  . ILE A 323 ? 0.1039 0.0893 0.0926 0.0201  -0.0221 0.0045  301 ILE A CA  
2354 C C   . ILE A 323 ? 0.0945 0.0842 0.0813 0.0203  -0.0233 0.0054  301 ILE A C   
2355 O O   . ILE A 323 ? 0.1061 0.0991 0.0926 0.0190  -0.0236 0.0038  301 ILE A O   
2356 C CB  . ILE A 323 ? 0.1023 0.0842 0.0903 0.0180  -0.0210 0.0048  301 ILE A CB  
2357 C CG1 . ILE A 323 ? 0.1176 0.1020 0.1041 0.0157  -0.0211 0.0036  301 ILE A CG1 
2358 C CG2 . ILE A 323 ? 0.1417 0.1210 0.1284 0.0187  -0.0206 0.0081  301 ILE A CG2 
2359 C CD1 . ILE A 323 ? 0.0984 0.0847 0.0857 0.0149  -0.0210 0.0007  301 ILE A CD1 
2360 N N   . ALA A 324 ? 0.0976 0.0873 0.0832 0.0222  -0.0239 0.0080  302 ALA A N   
2361 C CA  . ALA A 324 ? 0.0964 0.0907 0.0802 0.0226  -0.0252 0.0086  302 ALA A CA  
2362 C C   . ALA A 324 ? 0.0985 0.0978 0.0842 0.0231  -0.0263 0.0062  302 ALA A C   
2363 O O   . ALA A 324 ? 0.1194 0.1224 0.1046 0.0219  -0.0268 0.0049  302 ALA A O   
2364 C CB  . ALA A 324 ? 0.1063 0.1002 0.0882 0.0252  -0.0258 0.0118  302 ALA A CB  
2365 N N   . ALA A 325 ? 0.0946 0.0939 0.0828 0.0249  -0.0264 0.0056  303 ALA A N   
2366 C CA  . ALA A 325 ? 0.1013 0.1056 0.0920 0.0254  -0.0272 0.0033  303 ALA A CA  
2367 C C   . ALA A 325 ? 0.0966 0.1015 0.0882 0.0227  -0.0261 0.0008  303 ALA A C   
2368 O O   . ALA A 325 ? 0.0864 0.0953 0.0790 0.0219  -0.0264 -0.0009 303 ALA A O   
2369 C CB  . ALA A 325 ? 0.1011 0.1053 0.0944 0.0280  -0.0274 0.0032  303 ALA A CB  
2370 N N   . ALA A 326 ? 0.0881 0.0890 0.0794 0.0215  -0.0248 0.0004  304 ALA A N   
2371 C CA  . ALA A 326 ? 0.0870 0.0883 0.0784 0.0194  -0.0237 -0.0016 304 ALA A CA  
2372 C C   . ALA A 326 ? 0.1107 0.1138 0.1003 0.0176  -0.0238 -0.0015 304 ALA A C   
2373 O O   . ALA A 326 ? 0.1038 0.1095 0.0943 0.0165  -0.0233 -0.0031 304 ALA A O   
2374 C CB  . ALA A 326 ? 0.0967 0.0939 0.0876 0.0186  -0.0226 -0.0020 304 ALA A CB  
2375 N N   . CYS A 327 ? 0.1033 0.1048 0.0906 0.0172  -0.0242 0.0002  305 CYS A N   
2376 C CA  . CYS A 327 ? 0.0984 0.1014 0.0840 0.0156  -0.0242 0.0003  305 CYS A CA  
2377 C C   . CYS A 327 ? 0.1046 0.1123 0.0910 0.0160  -0.0251 -0.0006 305 CYS A C   
2378 O O   . CYS A 327 ? 0.0949 0.1045 0.0815 0.0144  -0.0247 -0.0019 305 CYS A O   
2379 C CB  . CYS A 327 ? 0.1130 0.1135 0.0960 0.0153  -0.0242 0.0024  305 CYS A CB  
2380 S SG  . CYS A 327 ? 0.1258 0.1215 0.1085 0.0141  -0.0229 0.0028  305 CYS A SG  
2381 N N   . THR A 328 ? 0.1043 0.1139 0.0915 0.0181  -0.0264 0.0000  306 THR A N   
2382 C CA  . THR A 328 ? 0.1025 0.1173 0.0909 0.0187  -0.0276 -0.0012 306 THR A CA  
2383 C C   . THR A 328 ? 0.0826 0.1002 0.0745 0.0178  -0.0269 -0.0039 306 THR A C   
2384 O O   . THR A 328 ? 0.0938 0.1149 0.0870 0.0166  -0.0270 -0.0057 306 THR A O   
2385 C CB  . THR A 328 ? 0.1020 0.1186 0.0903 0.0217  -0.0293 0.0002  306 THR A CB  
2386 O OG1 . THR A 328 ? 0.1092 0.1229 0.0941 0.0225  -0.0295 0.0031  306 THR A OG1 
2387 C CG2 . THR A 328 ? 0.1100 0.1330 0.0996 0.0223  -0.0309 -0.0015 306 THR A CG2 
2388 N N   . HIS A 329 ? 0.0857 0.1016 0.0793 0.0183  -0.0261 -0.0043 307 HIS A N   
2389 C CA  . HIS A 329 ? 0.0864 0.1046 0.0832 0.0176  -0.0250 -0.0065 307 HIS A CA  
2390 C C   . HIS A 329 ? 0.0785 0.0960 0.0749 0.0150  -0.0233 -0.0074 307 HIS A C   
2391 O O   . HIS A 329 ? 0.0956 0.1162 0.0944 0.0140  -0.0226 -0.0092 307 HIS A O   
2392 C CB  . HIS A 329 ? 0.0812 0.0978 0.0796 0.0188  -0.0243 -0.0067 307 HIS A CB  
2393 C CG  . HIS A 329 ? 0.0829 0.1022 0.0837 0.0213  -0.0256 -0.0068 307 HIS A CG  
2394 N ND1 . HIS A 329 ? 0.1091 0.1330 0.1138 0.0216  -0.0256 -0.0089 307 HIS A ND1 
2395 C CD2 . HIS A 329 ? 0.0991 0.1173 0.0993 0.0237  -0.0269 -0.0051 307 HIS A CD2 
2396 C CE1 . HIS A 329 ? 0.1263 0.1522 0.1326 0.0242  -0.0270 -0.0085 307 HIS A CE1 
2397 N NE2 . HIS A 329 ? 0.0972 0.1196 0.1006 0.0257  -0.0278 -0.0061 307 HIS A NE2 
2398 N N   . ILE A 330 ? 0.0941 0.1076 0.0878 0.0142  -0.0224 -0.0063 308 ILE A N   
2399 C CA  . ILE A 330 ? 0.0914 0.1043 0.0844 0.0122  -0.0209 -0.0069 308 ILE A CA  
2400 C C   . ILE A 330 ? 0.0985 0.1134 0.0911 0.0111  -0.0214 -0.0071 308 ILE A C   
2401 O O   . ILE A 330 ? 0.0956 0.1119 0.0897 0.0098  -0.0202 -0.0084 308 ILE A O   
2402 C CB  . ILE A 330 ? 0.1160 0.1251 0.1064 0.0117  -0.0200 -0.0059 308 ILE A CB  
2403 C CG1 . ILE A 330 ? 0.1304 0.1392 0.1202 0.0102  -0.0183 -0.0062 308 ILE A CG1 
2404 C CG2 . ILE A 330 ? 0.1202 0.1270 0.1080 0.0118  -0.0211 -0.0043 308 ILE A CG2 
2405 C CD1 . ILE A 330 ? 0.1286 0.1386 0.1204 0.0101  -0.0165 -0.0074 308 ILE A CD1 
2406 N N   . GLY A 331 ? 0.0889 0.1039 0.0796 0.0119  -0.0230 -0.0060 309 GLY A N   
2407 C CA  . GLY A 331 ? 0.0994 0.1166 0.0894 0.0112  -0.0237 -0.0065 309 GLY A CA  
2408 C C   . GLY A 331 ? 0.1121 0.1341 0.1055 0.0109  -0.0240 -0.0089 309 GLY A C   
2409 O O   . GLY A 331 ? 0.1063 0.1299 0.1004 0.0094  -0.0235 -0.0104 309 GLY A O   
2410 N N   . ALA A 332 ? 0.0757 0.1001 0.0717 0.0123  -0.0247 -0.0097 310 ALA A N   
2411 C CA  . ALA A 332 ? 0.0738 0.1034 0.0738 0.0121  -0.0251 -0.0123 310 ALA A CA  
2412 C C   . ALA A 332 ? 0.0934 0.1231 0.0967 0.0099  -0.0227 -0.0142 310 ALA A C   
2413 O O   . ALA A 332 ? 0.1100 0.1439 0.1171 0.0091  -0.0225 -0.0168 310 ALA A O   
2414 C CB  . ALA A 332 ? 0.0914 0.1236 0.0936 0.0143  -0.0265 -0.0124 310 ALA A CB  
2415 N N   . THR A 333 ? 0.0905 0.1159 0.0923 0.0092  -0.0206 -0.0130 311 THR A N   
2416 C CA  . THR A 333 ? 0.0976 0.1225 0.1019 0.0075  -0.0179 -0.0141 311 THR A CA  
2417 C C   . THR A 333 ? 0.1005 0.1235 0.1036 0.0057  -0.0165 -0.0141 311 THR A C   
2418 O O   . THR A 333 ? 0.1067 0.1291 0.1120 0.0043  -0.0140 -0.0149 311 THR A O   
2419 C CB  . THR A 333 ? 0.0897 0.1114 0.0930 0.0080  -0.0163 -0.0128 311 THR A CB  
2420 O OG1 . THR A 333 ? 0.1050 0.1227 0.1040 0.0081  -0.0162 -0.0108 311 THR A OG1 
2421 C CG2 . THR A 333 ? 0.0760 0.0991 0.0806 0.0099  -0.0174 -0.0128 311 THR A CG2 
2422 N N   . VAL A 334 ? 0.0938 0.1157 0.0935 0.0058  -0.0179 -0.0131 312 VAL A N   
2423 C CA  . VAL A 334 ? 0.1008 0.1207 0.0990 0.0044  -0.0167 -0.0128 312 VAL A CA  
2424 C C   . VAL A 334 ? 0.0704 0.0934 0.0717 0.0030  -0.0164 -0.0155 312 VAL A C   
2425 O O   . VAL A 334 ? 0.1016 0.1287 0.1043 0.0034  -0.0184 -0.0172 312 VAL A O   
2426 C CB  . VAL A 334 ? 0.0706 0.0884 0.0643 0.0051  -0.0181 -0.0109 312 VAL A CB  
2427 C CG1 . VAL A 334 ? 0.0876 0.1039 0.0801 0.0038  -0.0170 -0.0109 312 VAL A CG1 
2428 C CG2 . VAL A 334 ? 0.0884 0.1030 0.0798 0.0061  -0.0181 -0.0087 312 VAL A CG2 
2429 N N   . GLN A 335 ? 0.0842 0.1054 0.0867 0.0014  -0.0139 -0.0161 313 GLN A N   
2430 C CA  . GLN A 335 ? 0.0936 0.1172 0.0994 -0.0002 -0.0133 -0.0190 313 GLN A CA  
2431 C C   . GLN A 335 ? 0.0976 0.1232 0.1007 0.0002  -0.0158 -0.0195 313 GLN A C   
2432 O O   . GLN A 335 ? 0.0973 0.1203 0.0963 0.0007  -0.0163 -0.0174 313 GLN A O   
2433 C CB  . GLN A 335 ? 0.1253 0.1453 0.1319 -0.0017 -0.0101 -0.0188 313 GLN A CB  
2434 C CG  . GLN A 335 ? 0.1825 0.2045 0.1938 -0.0037 -0.0087 -0.0223 313 GLN A CG  
2435 C CD  . GLN A 335 ? 0.2453 0.2631 0.2573 -0.0049 -0.0052 -0.0217 313 GLN A CD  
2436 O OE1 . GLN A 335 ? 0.2616 0.2757 0.2696 -0.0041 -0.0047 -0.0190 313 GLN A OE1 
2437 N NE2 . GLN A 335 ? 0.2744 0.2928 0.2918 -0.0067 -0.0027 -0.0243 313 GLN A NE2 
2438 N N   . PRO A 336 ? 0.0891 0.1198 0.0946 0.0001  -0.0176 -0.0224 314 PRO A N   
2439 C CA  . PRO A 336 ? 0.0805 0.1137 0.0828 0.0010  -0.0201 -0.0225 314 PRO A CA  
2440 C C   . PRO A 336 ? 0.1091 0.1398 0.1087 0.0002  -0.0193 -0.0222 314 PRO A C   
2441 O O   . PRO A 336 ? 0.1226 0.1527 0.1178 0.0013  -0.0207 -0.0203 314 PRO A O   
2442 C CB  . PRO A 336 ? 0.1444 0.1840 0.1507 0.0007  -0.0215 -0.0265 314 PRO A CB  
2443 C CG  . PRO A 336 ? 0.1377 0.1784 0.1482 0.0008  -0.0208 -0.0270 314 PRO A CG  
2444 C CD  . PRO A 336 ? 0.1174 0.1524 0.1283 -0.0004 -0.0175 -0.0252 314 PRO A CD  
2445 N N   . ARG A 337 ? 0.0873 0.1163 0.0896 -0.0017 -0.0167 -0.0238 315 ARG A N   
2446 C CA  . ARG A 337 ? 0.1258 0.1526 0.1259 -0.0024 -0.0158 -0.0237 315 ARG A CA  
2447 C C   . ARG A 337 ? 0.1132 0.1352 0.1090 -0.0016 -0.0152 -0.0197 315 ARG A C   
2448 O O   . ARG A 337 ? 0.1466 0.1672 0.1398 -0.0017 -0.0150 -0.0191 315 ARG A O   
2449 C CB  . ARG A 337 ? 0.1910 0.2167 0.1954 -0.0045 -0.0129 -0.0263 315 ARG A CB  
2450 C CG  . ARG A 337 ? 0.2485 0.2694 0.2541 -0.0050 -0.0099 -0.0242 315 ARG A CG  
2451 C CD  . ARG A 337 ? 0.3758 0.3945 0.3851 -0.0068 -0.0067 -0.0261 315 ARG A CD  
2452 N NE  . ARG A 337 ? 0.4163 0.4301 0.4256 -0.0066 -0.0036 -0.0233 315 ARG A NE  
2453 C CZ  . ARG A 337 ? 0.3437 0.3534 0.3521 -0.0068 -0.0013 -0.0220 315 ARG A CZ  
2454 N NH1 . ARG A 337 ? 0.3583 0.3682 0.3661 -0.0073 -0.0016 -0.0235 315 ARG A NH1 
2455 N NH2 . ARG A 337 ? 0.3627 0.3684 0.3709 -0.0062 0.0013  -0.0193 315 ARG A NH2 
2456 N N   . LEU A 338 ? 0.1098 0.1296 0.1050 -0.0007 -0.0149 -0.0174 316 LEU A N   
2457 C CA  . LEU A 338 ? 0.0998 0.1157 0.0912 0.0001  -0.0146 -0.0141 316 LEU A CA  
2458 C C   . LEU A 338 ? 0.0989 0.1152 0.0872 0.0016  -0.0169 -0.0121 316 LEU A C   
2459 O O   . LEU A 338 ? 0.1095 0.1230 0.0951 0.0022  -0.0168 -0.0097 316 LEU A O   
2460 C CB  . LEU A 338 ? 0.0900 0.1028 0.0826 0.0000  -0.0124 -0.0128 316 LEU A CB  
2461 C CG  . LEU A 338 ? 0.1043 0.1155 0.0998 -0.0013 -0.0093 -0.0138 316 LEU A CG  
2462 C CD1 . LEU A 338 ? 0.1403 0.1486 0.1359 -0.0007 -0.0073 -0.0119 316 LEU A CD1 
2463 C CD2 . LEU A 338 ? 0.1273 0.1368 0.1212 -0.0017 -0.0086 -0.0137 316 LEU A CD2 
2464 N N   . ASN A 339 ? 0.0836 0.1034 0.0724 0.0024  -0.0189 -0.0131 317 ASN A N   
2465 C CA  . ASN A 339 ? 0.0887 0.1083 0.0749 0.0041  -0.0207 -0.0109 317 ASN A CA  
2466 C C   . ASN A 339 ? 0.1089 0.1287 0.0914 0.0047  -0.0219 -0.0096 317 ASN A C   
2467 O O   . ASN A 339 ? 0.1249 0.1482 0.1068 0.0051  -0.0233 -0.0108 317 ASN A O   
2468 C CB  . ASN A 339 ? 0.0946 0.1179 0.0831 0.0051  -0.0223 -0.0121 317 ASN A CB  
2469 C CG  . ASN A 339 ? 0.1024 0.1246 0.0891 0.0070  -0.0236 -0.0097 317 ASN A CG  
2470 O OD1 . ASN A 339 ? 0.1307 0.1500 0.1143 0.0075  -0.0237 -0.0073 317 ASN A OD1 
2471 N ND2 . ASN A 339 ? 0.1169 0.1415 0.1061 0.0079  -0.0244 -0.0105 317 ASN A ND2 
2472 N N   . GLU A 340 ? 0.0860 0.1023 0.0660 0.0048  -0.0214 -0.0072 318 GLU A N   
2473 C CA  . GLU A 340 ? 0.0768 0.0929 0.0533 0.0053  -0.0220 -0.0056 318 GLU A CA  
2474 C C   . GLU A 340 ? 0.1394 0.1558 0.1141 0.0071  -0.0236 -0.0037 318 GLU A C   
2475 O O   . GLU A 340 ? 0.1673 0.1837 0.1391 0.0078  -0.0241 -0.0021 318 GLU A O   
2476 C CB  . GLU A 340 ? 0.0876 0.1001 0.0627 0.0046  -0.0207 -0.0040 318 GLU A CB  
2477 C CG  . GLU A 340 ? 0.0930 0.1051 0.0692 0.0032  -0.0190 -0.0055 318 GLU A CG  
2478 C CD  . GLU A 340 ? 0.1269 0.1409 0.1018 0.0028  -0.0191 -0.0066 318 GLU A CD  
2479 O OE1 . GLU A 340 ? 0.1494 0.1664 0.1233 0.0035  -0.0205 -0.0073 318 GLU A OE1 
2480 O OE2 . GLU A 340 ? 0.1018 0.1145 0.0766 0.0020  -0.0177 -0.0069 318 GLU A OE2 
2481 N N   . GLY A 341 ? 0.1036 0.1205 0.0802 0.0080  -0.0243 -0.0038 319 GLY A N   
2482 C CA  . GLY A 341 ? 0.1025 0.1199 0.0779 0.0100  -0.0257 -0.0021 319 GLY A CA  
2483 C C   . GLY A 341 ? 0.1056 0.1195 0.0815 0.0106  -0.0254 -0.0003 319 GLY A C   
2484 O O   . GLY A 341 ? 0.1240 0.1349 0.1004 0.0095  -0.0241 -0.0001 319 GLY A O   
2485 N N   . VAL A 342 ? 0.1091 0.1235 0.0848 0.0126  -0.0265 0.0009  320 VAL A N   
2486 C CA  . VAL A 342 ? 0.1021 0.1129 0.0783 0.0134  -0.0262 0.0026  320 VAL A CA  
2487 C C   . VAL A 342 ? 0.1285 0.1371 0.1018 0.0147  -0.0263 0.0055  320 VAL A C   
2488 O O   . VAL A 342 ? 0.1471 0.1581 0.1190 0.0167  -0.0275 0.0066  320 VAL A O   
2489 C CB  . VAL A 342 ? 0.1299 0.1426 0.1086 0.0150  -0.0271 0.0017  320 VAL A CB  
2490 C CG1 . VAL A 342 ? 0.1152 0.1242 0.0943 0.0162  -0.0268 0.0034  320 VAL A CG1 
2491 C CG2 . VAL A 342 ? 0.1418 0.1562 0.1235 0.0136  -0.0265 -0.0011 320 VAL A CG2 
2492 N N   . TRP A 343 ? 0.1203 0.1249 0.0928 0.0136  -0.0250 0.0069  321 TRP A N   
2493 C CA  . TRP A 343 ? 0.1237 0.1255 0.0941 0.0146  -0.0246 0.0098  321 TRP A CA  
2494 C C   . TRP A 343 ? 0.1301 0.1289 0.1021 0.0160  -0.0244 0.0111  321 TRP A C   
2495 O O   . TRP A 343 ? 0.1525 0.1494 0.1268 0.0152  -0.0239 0.0098  321 TRP A O   
2496 C CB  . TRP A 343 ? 0.1367 0.1358 0.1063 0.0126  -0.0230 0.0104  321 TRP A CB  
2497 C CG  . TRP A 343 ? 0.1108 0.1074 0.0785 0.0132  -0.0221 0.0135  321 TRP A CG  
2498 C CD1 . TRP A 343 ? 0.1401 0.1378 0.1047 0.0136  -0.0219 0.0151  321 TRP A CD1 
2499 C CD2 . TRP A 343 ? 0.1466 0.1387 0.1153 0.0137  -0.0211 0.0154  321 TRP A CD2 
2500 N NE1 . TRP A 343 ? 0.1609 0.1551 0.1245 0.0143  -0.0206 0.0182  321 TRP A NE1 
2501 C CE2 . TRP A 343 ? 0.1405 0.1310 0.1068 0.0143  -0.0201 0.0183  321 TRP A CE2 
2502 C CE3 . TRP A 343 ? 0.1584 0.1476 0.1299 0.0136  -0.0208 0.0147  321 TRP A CE3 
2503 C CZ2 . TRP A 343 ? 0.1932 0.1791 0.1602 0.0147  -0.0185 0.0208  321 TRP A CZ2 
2504 C CZ3 . TRP A 343 ? 0.1531 0.1377 0.1254 0.0140  -0.0194 0.0167  321 TRP A CZ3 
2505 C CH2 . TRP A 343 ? 0.1802 0.1631 0.1504 0.0144  -0.0182 0.0198  321 TRP A CH2 
2506 N N   . VAL A 344 ? 0.1090 0.1072 0.0794 0.0183  -0.0248 0.0137  322 VAL A N   
2507 C CA  . VAL A 344 ? 0.1217 0.1163 0.0936 0.0199  -0.0243 0.0153  322 VAL A CA  
2508 C C   . VAL A 344 ? 0.1322 0.1232 0.1019 0.0209  -0.0231 0.0190  322 VAL A C   
2509 O O   . VAL A 344 ? 0.1290 0.1218 0.0955 0.0214  -0.0232 0.0206  322 VAL A O   
2510 C CB  . VAL A 344 ? 0.1280 0.1254 0.1010 0.0226  -0.0259 0.0150  322 VAL A CB  
2511 C CG1 . VAL A 344 ? 0.1643 0.1650 0.1399 0.0215  -0.0267 0.0114  322 VAL A CG1 
2512 C CG2 . VAL A 344 ? 0.1525 0.1538 0.1226 0.0249  -0.0273 0.0166  322 VAL A CG2 
2513 N N   . ALA A 345 ? 0.1082 0.0942 0.0797 0.0212  -0.0217 0.0203  323 ALA A N   
2514 C CA  . ALA A 345 ? 0.1236 0.1053 0.0938 0.0220  -0.0200 0.0239  323 ALA A CA  
2515 C C   . ALA A 345 ? 0.1671 0.1487 0.1355 0.0258  -0.0204 0.0272  323 ALA A C   
2516 O O   . ALA A 345 ? 0.1754 0.1534 0.1423 0.0269  -0.0187 0.0308  323 ALA A O   
2517 C CB  . ALA A 345 ? 0.1328 0.1089 0.1064 0.0203  -0.0180 0.0234  323 ALA A CB  
2518 N N   . GLN A 346 ? 0.1452 0.1310 0.1139 0.0279  -0.0225 0.0261  324 GLN A N   
2519 C CA  . GLN A 346 ? 0.1336 0.1203 0.1008 0.0320  -0.0234 0.0290  324 GLN A CA  
2520 C C   . GLN A 346 ? 0.1461 0.1326 0.1092 0.0338  -0.0225 0.0331  324 GLN A C   
2521 O O   . GLN A 346 ? 0.1964 0.1799 0.1596 0.0360  -0.0214 0.0363  324 GLN A O   
2522 C CB  . GLN A 346 ? 0.1396 0.1330 0.1074 0.0336  -0.0261 0.0265  324 GLN A CB  
2523 C CG  . GLN A 346 ? 0.1717 0.1671 0.1400 0.0367  -0.0267 0.0284  324 GLN A CG  
2524 C CD  . GLN A 346 ? 0.2274 0.2286 0.1935 0.0370  -0.0276 0.0286  324 GLN A CD  
2525 O OE1 . GLN A 346 ? 0.1985 0.2031 0.1632 0.0348  -0.0281 0.0266  324 GLN A OE1 
2526 N NE2 . GLN A 346 ? 0.2554 0.2575 0.2210 0.0398  -0.0279 0.0307  324 GLN A NE2 
2527 N N   . PRO A 347 ? 0.1403 0.1300 0.1009 0.0319  -0.0226 0.0325  325 PRO A N   
2528 C CA  . PRO A 347 ? 0.2184 0.2080 0.1758 0.0328  -0.0214 0.0357  325 PRO A CA  
2529 C C   . PRO A 347 ? 0.2302 0.2125 0.1872 0.0331  -0.0184 0.0398  325 PRO A C   
2530 O O   . PRO A 347 ? 0.2804 0.2617 0.2354 0.0345  -0.0172 0.0430  325 PRO A O   
2531 C CB  . PRO A 347 ? 0.2407 0.2343 0.1960 0.0304  -0.0218 0.0337  325 PRO A CB  
2532 C CG  . PRO A 347 ? 0.2501 0.2482 0.2077 0.0291  -0.0239 0.0293  325 PRO A CG  
2533 C CD  . PRO A 347 ? 0.1877 0.1819 0.1482 0.0294  -0.0239 0.0288  325 PRO A CD  
2534 N N   . TYR A 348 ? 0.2075 0.1846 0.1667 0.0315  -0.0171 0.0393  326 TYR A N   
2535 C CA  . TYR A 348 ? 0.2191 0.1892 0.1796 0.0304  -0.0137 0.0420  326 TYR A CA  
2536 C C   . TYR A 348 ? 0.2167 0.1812 0.1808 0.0317  -0.0126 0.0429  326 TYR A C   
2537 O O   . TYR A 348 ? 0.2514 0.2096 0.2176 0.0307  -0.0096 0.0446  326 TYR A O   
2538 C CB  . TYR A 348 ? 0.2136 0.1823 0.1765 0.0258  -0.0125 0.0391  326 TYR A CB  
2539 C CG  . TYR A 348 ? 0.2577 0.2316 0.2179 0.0241  -0.0135 0.0373  326 TYR A CG  
2540 C CD1 . TYR A 348 ? 0.3040 0.2778 0.2610 0.0239  -0.0118 0.0400  326 TYR A CD1 
2541 C CD2 . TYR A 348 ? 0.2215 0.2002 0.1826 0.0227  -0.0159 0.0331  326 TYR A CD2 
2542 C CE1 . TYR A 348 ? 0.2787 0.2571 0.2334 0.0224  -0.0127 0.0382  326 TYR A CE1 
2543 C CE2 . TYR A 348 ? 0.2749 0.2578 0.2339 0.0212  -0.0166 0.0315  326 TYR A CE2 
2544 C CZ  . TYR A 348 ? 0.3116 0.2944 0.2674 0.0211  -0.0151 0.0339  326 TYR A CZ  
2545 O OH  . TYR A 348 ? 0.2785 0.2655 0.2325 0.0196  -0.0157 0.0320  326 TYR A OH  
2546 N N   . ILE A 349 ? 0.1872 0.1543 0.1525 0.0339  -0.0148 0.0414  327 ILE A N   
2547 C CA  . ILE A 349 ? 0.1810 0.1434 0.1500 0.0353  -0.0140 0.0416  327 ILE A CA  
2548 C C   . ILE A 349 ? 0.2186 0.1818 0.1862 0.0397  -0.0146 0.0449  327 ILE A C   
2549 O O   . ILE A 349 ? 0.2170 0.1870 0.1837 0.0410  -0.0172 0.0435  327 ILE A O   
2550 C CB  . ILE A 349 ? 0.1850 0.1498 0.1578 0.0336  -0.0158 0.0365  327 ILE A CB  
2551 C CG1 . ILE A 349 ? 0.1754 0.1391 0.1504 0.0290  -0.0149 0.0330  327 ILE A CG1 
2552 C CG2 . ILE A 349 ? 0.2074 0.1683 0.1838 0.0356  -0.0152 0.0366  327 ILE A CG2 
2553 C CD1 . ILE A 349 ? 0.1868 0.1537 0.1645 0.0273  -0.0166 0.0282  327 ILE A CD1 
2554 N N   . ALA A 350 ? 0.2224 0.1794 0.1913 0.0408  -0.0119 0.0482  328 ALA A N   
2555 C CA  . ALA A 350 ? 0.2786 0.2367 0.2466 0.0439  -0.0122 0.0508  328 ALA A CA  
2556 C C   . ALA A 350 ? 0.2849 0.2451 0.2556 0.0464  -0.0142 0.0491  328 ALA A C   
2557 O O   . ALA A 350 ? 0.3517 0.3171 0.3211 0.0488  -0.0161 0.0496  328 ALA A O   
2558 C CB  . ALA A 350 ? 0.2926 0.2430 0.2612 0.0443  -0.0085 0.0547  328 ALA A CB  
2559 N N   . GLN A 351 ? 0.2165 0.1728 0.1911 0.0458  -0.0136 0.0470  329 GLN A N   
2560 C CA  . GLN A 351 ? 0.2117 0.1687 0.1895 0.0483  -0.0148 0.0457  329 GLN A CA  
2561 C C   . GLN A 351 ? 0.2210 0.1820 0.2005 0.0475  -0.0171 0.0411  329 GLN A C   
2562 O O   . GLN A 351 ? 0.2263 0.1841 0.2083 0.0445  -0.0161 0.0382  329 GLN A O   
2563 C CB  . GLN A 351 ? 0.2876 0.2358 0.2691 0.0489  -0.0118 0.0472  329 GLN A CB  
2564 C CG  . GLN A 351 ? 0.4101 0.3579 0.3954 0.0512  -0.0125 0.0456  329 GLN A CG  
2565 C CD  . GLN A 351 ? 0.5417 0.4806 0.5306 0.0517  -0.0093 0.0470  329 GLN A CD  
2566 O OE1 . GLN A 351 ? 0.6061 0.5393 0.5983 0.0496  -0.0073 0.0450  329 GLN A OE1 
2567 N NE2 . GLN A 351 ? 0.4975 0.4352 0.4858 0.0544  -0.0086 0.0504  329 GLN A NE2 
2568 N N   . PRO A 352 ? 0.1906 0.1595 0.1698 0.0487  -0.0200 0.0394  330 PRO A N   
2569 C CA  . PRO A 352 ? 0.1983 0.1711 0.1794 0.0479  -0.0220 0.0349  330 PRO A CA  
2570 C C   . PRO A 352 ? 0.1864 0.1559 0.1720 0.0492  -0.0214 0.0333  330 PRO A C   
2571 O O   . PRO A 352 ? 0.2105 0.1769 0.1976 0.0520  -0.0204 0.0358  330 PRO A O   
2572 C CB  . PRO A 352 ? 0.1855 0.1675 0.1656 0.0487  -0.0247 0.0337  330 PRO A CB  
2573 C CG  . PRO A 352 ? 0.1894 0.1716 0.1682 0.0513  -0.0243 0.0375  330 PRO A CG  
2574 C CD  . PRO A 352 ? 0.2090 0.1837 0.1859 0.0506  -0.0215 0.0411  330 PRO A CD  
2575 N N   . TYR A 353 ? 0.1723 0.1428 0.1608 0.0460  -0.0216 0.0286  331 TYR A N   
2576 C CA  . TYR A 353 ? 0.1560 0.1241 0.1488 0.0467  -0.0210 0.0263  331 TYR A CA  
2577 C C   . TYR A 353 ? 0.1651 0.1388 0.1592 0.0503  -0.0231 0.0259  331 TYR A C   
2578 O O   . TYR A 353 ? 0.1717 0.1431 0.1688 0.0529  -0.0225 0.0260  331 TYR A O   
2579 C CB  . TYR A 353 ? 0.1519 0.1202 0.1469 0.0425  -0.0206 0.0215  331 TYR A CB  
2580 C CG  . TYR A 353 ? 0.1861 0.1508 0.1801 0.0385  -0.0190 0.0209  331 TYR A CG  
2581 C CD1 . TYR A 353 ? 0.1894 0.1485 0.1823 0.0384  -0.0171 0.0243  331 TYR A CD1 
2582 C CD2 . TYR A 353 ? 0.1410 0.1080 0.1355 0.0349  -0.0194 0.0170  331 TYR A CD2 
2583 C CE1 . TYR A 353 ? 0.1773 0.1337 0.1699 0.0347  -0.0156 0.0235  331 TYR A CE1 
2584 C CE2 . TYR A 353 ? 0.1854 0.1498 0.1793 0.0314  -0.0181 0.0163  331 TYR A CE2 
2585 C CZ  . TYR A 353 ? 0.1726 0.1319 0.1657 0.0313  -0.0163 0.0194  331 TYR A CZ  
2586 O OH  . TYR A 353 ? 0.1821 0.1393 0.1751 0.0278  -0.0151 0.0185  331 TYR A OH  
2587 N N   . ASP A 354 ? 0.1537 0.1350 0.1459 0.0505  -0.0255 0.0251  332 ASP A N   
2588 C CA  . ASP A 354 ? 0.1340 0.1222 0.1279 0.0532  -0.0277 0.0239  332 ASP A CA  
2589 C C   . ASP A 354 ? 0.1366 0.1296 0.1279 0.0540  -0.0287 0.0265  332 ASP A C   
2590 O O   . ASP A 354 ? 0.1519 0.1494 0.1408 0.0519  -0.0298 0.0256  332 ASP A O   
2591 C CB  . ASP A 354 ? 0.1370 0.1309 0.1326 0.0505  -0.0290 0.0192  332 ASP A CB  
2592 C CG  . ASP A 354 ? 0.1440 0.1452 0.1424 0.0526  -0.0309 0.0174  332 ASP A CG  
2593 O OD1 . ASP A 354 ? 0.1294 0.1329 0.1279 0.0550  -0.0313 0.0196  332 ASP A OD1 
2594 O OD2 . ASP A 354 ? 0.1645 0.1693 0.1655 0.0510  -0.0314 0.0136  332 ASP A OD2 
2595 N N   . GLU A 355 ? 0.1430 0.1348 0.1348 0.0569  -0.0282 0.0295  333 GLU A N   
2596 C CA  . GLU A 355 ? 0.1631 0.1584 0.1518 0.0582  -0.0290 0.0322  333 GLU A CA  
2597 C C   . GLU A 355 ? 0.1799 0.1848 0.1688 0.0580  -0.0317 0.0294  333 GLU A C   
2598 O O   . GLU A 355 ? 0.2047 0.2134 0.1904 0.0576  -0.0326 0.0301  333 GLU A O   
2599 C CB  . GLU A 355 ? 0.1811 0.1728 0.1706 0.0617  -0.0280 0.0358  333 GLU A CB  
2600 C CG  . GLU A 355 ? 0.2150 0.2086 0.2089 0.0643  -0.0287 0.0343  333 GLU A CG  
2601 C CD  . GLU A 355 ? 0.2994 0.2870 0.2946 0.0674  -0.0271 0.0378  333 GLU A CD  
2602 O OE1 . GLU A 355 ? 0.3189 0.2987 0.3130 0.0670  -0.0247 0.0405  333 GLU A OE1 
2603 O OE2 . GLU A 355 ? 0.2826 0.2734 0.2803 0.0703  -0.0280 0.0377  333 GLU A OE2 
2604 N N   . GLU A 356 ? 0.1508 0.1596 0.1437 0.0582  -0.0327 0.0260  334 GLU A N   
2605 C CA  . GLU A 356 ? 0.1367 0.1544 0.1306 0.0580  -0.0349 0.0230  334 GLU A CA  
2606 C C   . GLU A 356 ? 0.1347 0.1560 0.1283 0.0543  -0.0355 0.0195  334 GLU A C   
2607 O O   . GLU A 356 ? 0.1545 0.1814 0.1466 0.0533  -0.0368 0.0182  334 GLU A O   
2608 C CB  . GLU A 356 ? 0.1529 0.1736 0.1517 0.0599  -0.0355 0.0210  334 GLU A CB  
2609 C CG  . GLU A 356 ? 0.2732 0.2928 0.2730 0.0639  -0.0354 0.0239  334 GLU A CG  
2610 C CD  . GLU A 356 ? 0.4343 0.4567 0.4392 0.0657  -0.0358 0.0216  334 GLU A CD  
2611 O OE1 . GLU A 356 ? 0.4569 0.4853 0.4644 0.0641  -0.0369 0.0177  334 GLU A OE1 
2612 O OE2 . GLU A 356 ? 0.5352 0.5536 0.5419 0.0685  -0.0348 0.0238  334 GLU A OE2 
2613 N N   . ASN A 357 ? 0.1252 0.1431 0.1202 0.0524  -0.0346 0.0177  335 ASN A N   
2614 C CA  . ASN A 357 ? 0.1186 0.1401 0.1141 0.0491  -0.0352 0.0139  335 ASN A CA  
2615 C C   . ASN A 357 ? 0.1201 0.1367 0.1130 0.0464  -0.0342 0.0141  335 ASN A C   
2616 O O   . ASN A 357 ? 0.1425 0.1610 0.1361 0.0437  -0.0344 0.0111  335 ASN A O   
2617 C CB  . ASN A 357 ? 0.1429 0.1672 0.1433 0.0492  -0.0355 0.0104  335 ASN A CB  
2618 C CG  . ASN A 357 ? 0.1656 0.1965 0.1689 0.0512  -0.0368 0.0094  335 ASN A CG  
2619 O OD1 . ASN A 357 ? 0.2041 0.2403 0.2063 0.0510  -0.0381 0.0090  335 ASN A OD1 
2620 N ND2 . ASN A 357 ? 0.2015 0.2321 0.2085 0.0533  -0.0365 0.0087  335 ASN A ND2 
2621 N N   . GLY A 358 ? 0.1523 0.1627 0.1423 0.0470  -0.0329 0.0176  336 GLY A N   
2622 C CA  . GLY A 358 ? 0.1332 0.1389 0.1205 0.0445  -0.0319 0.0180  336 GLY A CA  
2623 C C   . GLY A 358 ? 0.1530 0.1631 0.1380 0.0418  -0.0325 0.0168  336 GLY A C   
2624 O O   . GLY A 358 ? 0.1666 0.1823 0.1511 0.0421  -0.0336 0.0164  336 GLY A O   
2625 N N   . ILE A 359 ? 0.1366 0.1437 0.1201 0.0392  -0.0319 0.0161  337 ILE A N   
2626 C CA  . ILE A 359 ? 0.1381 0.1486 0.1196 0.0365  -0.0322 0.0147  337 ILE A CA  
2627 C C   . ILE A 359 ? 0.1563 0.1664 0.1341 0.0367  -0.0317 0.0177  337 ILE A C   
2628 O O   . ILE A 359 ? 0.1823 0.1869 0.1580 0.0375  -0.0304 0.0210  337 ILE A O   
2629 C CB  . ILE A 359 ? 0.1049 0.1118 0.0865 0.0327  -0.0307 0.0130  337 ILE A CB  
2630 C CG1 . ILE A 359 ? 0.1731 0.1811 0.1587 0.0312  -0.0304 0.0095  337 ILE A CG1 
2631 C CG2 . ILE A 359 ? 0.1431 0.1527 0.1222 0.0305  -0.0311 0.0122  337 ILE A CG2 
2632 C CD1 . ILE A 359 ? 0.1570 0.1720 0.1444 0.0308  -0.0319 0.0066  337 ILE A CD1 
2633 N N   . ARG A 360 ? 0.1173 0.1332 0.0943 0.0361  -0.0327 0.0165  338 ARG A N   
2634 C CA  . ARG A 360 ? 0.1498 0.1660 0.1231 0.0366  -0.0324 0.0190  338 ARG A CA  
2635 C C   . ARG A 360 ? 0.1598 0.1800 0.1320 0.0339  -0.0328 0.0165  338 ARG A C   
2636 O O   . ARG A 360 ? 0.1569 0.1819 0.1315 0.0329  -0.0338 0.0130  338 ARG A O   
2637 C CB  . ARG A 360 ? 0.1445 0.1639 0.1177 0.0396  -0.0334 0.0204  338 ARG A CB  
2638 C CG  . ARG A 360 ? 0.2026 0.2184 0.1774 0.0426  -0.0330 0.0228  338 ARG A CG  
2639 C CD  . ARG A 360 ? 0.1876 0.2074 0.1625 0.0458  -0.0341 0.0239  338 ARG A CD  
2640 N NE  . ARG A 360 ? 0.1869 0.2135 0.1651 0.0459  -0.0360 0.0202  338 ARG A NE  
2641 C CZ  . ARG A 360 ? 0.2267 0.2541 0.2088 0.0471  -0.0364 0.0189  338 ARG A CZ  
2642 N NH1 . ARG A 360 ? 0.1887 0.2103 0.1721 0.0484  -0.0352 0.0208  338 ARG A NH1 
2643 N NH2 . ARG A 360 ? 0.2532 0.2872 0.2383 0.0470  -0.0379 0.0154  338 ARG A NH2 
2644 N N   . ILE A 361 ? 0.1247 0.1427 0.0934 0.0328  -0.0317 0.0181  339 ILE A N   
2645 C CA  . ILE A 361 ? 0.1338 0.1557 0.1014 0.0307  -0.0321 0.0159  339 ILE A CA  
2646 C C   . ILE A 361 ? 0.1706 0.1972 0.1366 0.0325  -0.0332 0.0160  339 ILE A C   
2647 O O   . ILE A 361 ? 0.1901 0.2155 0.1538 0.0349  -0.0329 0.0193  339 ILE A O   
2648 C CB  . ILE A 361 ? 0.1474 0.1657 0.1120 0.0288  -0.0305 0.0173  339 ILE A CB  
2649 C CG1 . ILE A 361 ? 0.1613 0.1747 0.1270 0.0274  -0.0295 0.0173  339 ILE A CG1 
2650 C CG2 . ILE A 361 ? 0.2162 0.2384 0.1800 0.0266  -0.0308 0.0144  339 ILE A CG2 
2651 C CD1 . ILE A 361 ? 0.1982 0.2084 0.1614 0.0255  -0.0280 0.0184  339 ILE A CD1 
2652 N N   . ALA A 362 ? 0.1384 0.1706 0.1060 0.0315  -0.0343 0.0123  340 ALA A N   
2653 C CA  . ALA A 362 ? 0.2022 0.2396 0.1684 0.0331  -0.0355 0.0116  340 ALA A CA  
2654 C C   . ALA A 362 ? 0.1638 0.2047 0.1299 0.0307  -0.0356 0.0082  340 ALA A C   
2655 O O   . ALA A 362 ? 0.1796 0.2225 0.1491 0.0287  -0.0359 0.0046  340 ALA A O   
2656 C CB  . ALA A 362 ? 0.2853 0.3270 0.2546 0.0351  -0.0371 0.0102  340 ALA A CB  
2657 N N   . GLY A 363 ? 0.1861 0.2278 0.1485 0.0310  -0.0354 0.0091  341 GLY A N   
2658 C CA  . GLY A 363 ? 0.1665 0.2113 0.1286 0.0290  -0.0354 0.0059  341 GLY A CA  
2659 C C   . GLY A 363 ? 0.1428 0.1843 0.1062 0.0257  -0.0341 0.0046  341 GLY A C   
2660 O O   . GLY A 363 ? 0.1800 0.2241 0.1455 0.0237  -0.0342 0.0009  341 GLY A O   
2661 N N   . GLY A 364 ? 0.1586 0.1944 0.1207 0.0253  -0.0328 0.0076  342 GLY A N   
2662 C CA  . GLY A 364 ? 0.1324 0.1649 0.0952 0.0226  -0.0316 0.0067  342 GLY A CA  
2663 C C   . GLY A 364 ? 0.1591 0.1919 0.1262 0.0212  -0.0318 0.0041  342 GLY A C   
2664 O O   . GLY A 364 ? 0.1431 0.1741 0.1112 0.0189  -0.0310 0.0027  342 GLY A O   
2665 N N   . HIS A 365 ? 0.1220 0.1570 0.0917 0.0227  -0.0330 0.0035  343 HIS A N   
2666 C CA  . HIS A 365 ? 0.1443 0.1802 0.1183 0.0217  -0.0332 0.0009  343 HIS A CA  
2667 C C   . HIS A 365 ? 0.1280 0.1621 0.1032 0.0238  -0.0336 0.0028  343 HIS A C   
2668 O O   . HIS A 365 ? 0.1397 0.1727 0.1129 0.0261  -0.0339 0.0058  343 HIS A O   
2669 C CB  . HIS A 365 ? 0.1397 0.1815 0.1165 0.0213  -0.0342 -0.0031 343 HIS A CB  
2670 C CG  . HIS A 365 ? 0.1604 0.2037 0.1370 0.0190  -0.0336 -0.0057 343 HIS A CG  
2671 N ND1 . HIS A 365 ? 0.1513 0.1953 0.1245 0.0192  -0.0336 -0.0050 343 HIS A ND1 
2672 C CD2 . HIS A 365 ? 0.1603 0.2044 0.1398 0.0166  -0.0330 -0.0090 343 HIS A CD2 
2673 C CE1 . HIS A 365 ? 0.1814 0.2265 0.1554 0.0171  -0.0329 -0.0079 343 HIS A CE1 
2674 N NE2 . HIS A 365 ? 0.1695 0.2146 0.1473 0.0154  -0.0326 -0.0103 343 HIS A NE2 
2675 N N   . ILE A 366 ? 0.1141 0.1480 0.0928 0.0231  -0.0336 0.0010  344 ILE A N   
2676 C CA  . ILE A 366 ? 0.1072 0.1394 0.0874 0.0251  -0.0339 0.0024  344 ILE A CA  
2677 C C   . ILE A 366 ? 0.1232 0.1599 0.1080 0.0252  -0.0347 -0.0008 344 ILE A C   
2678 O O   . ILE A 366 ? 0.1421 0.1800 0.1293 0.0231  -0.0343 -0.0037 344 ILE A O   
2679 C CB  . ILE A 366 ? 0.0941 0.1205 0.0739 0.0245  -0.0328 0.0037  344 ILE A CB  
2680 C CG1 . ILE A 366 ? 0.1375 0.1595 0.1133 0.0242  -0.0318 0.0068  344 ILE A CG1 
2681 C CG2 . ILE A 366 ? 0.1429 0.1675 0.1245 0.0267  -0.0332 0.0047  344 ILE A CG2 
2682 C CD1 . ILE A 366 ? 0.1272 0.1439 0.1024 0.0230  -0.0308 0.0073  344 ILE A CD1 
2683 N N   . ASP A 367 ? 0.1209 0.1600 0.1070 0.0278  -0.0358 -0.0003 345 ASP A N   
2684 C CA  . ASP A 367 ? 0.1300 0.1734 0.1209 0.0281  -0.0365 -0.0032 345 ASP A CA  
2685 C C   . ASP A 367 ? 0.1093 0.1495 0.1024 0.0284  -0.0359 -0.0030 345 ASP A C   
2686 O O   . ASP A 367 ? 0.1397 0.1752 0.1310 0.0301  -0.0356 -0.0001 345 ASP A O   
2687 C CB  . ASP A 367 ? 0.1379 0.1854 0.1295 0.0310  -0.0379 -0.0027 345 ASP A CB  
2688 C CG  . ASP A 367 ? 0.2577 0.3098 0.2480 0.0308  -0.0387 -0.0039 345 ASP A CG  
2689 O OD1 . ASP A 367 ? 0.2745 0.3287 0.2656 0.0283  -0.0385 -0.0069 345 ASP A OD1 
2690 O OD2 . ASP A 367 ? 0.3491 0.4027 0.3374 0.0334  -0.0396 -0.0020 345 ASP A OD2 
2691 N N   . LEU A 368 ? 0.0942 0.1366 0.0911 0.0269  -0.0357 -0.0063 346 LEU A N   
2692 C CA  . LEU A 368 ? 0.1064 0.1466 0.1057 0.0274  -0.0352 -0.0066 346 LEU A CA  
2693 C C   . LEU A 368 ? 0.1246 0.1665 0.1262 0.0304  -0.0360 -0.0060 346 LEU A C   
2694 O O   . LEU A 368 ? 0.1232 0.1706 0.1273 0.0311  -0.0369 -0.0076 346 LEU A O   
2695 C CB  . LEU A 368 ? 0.0987 0.1405 0.1018 0.0244  -0.0337 -0.0100 346 LEU A CB  
2696 C CG  . LEU A 368 ? 0.1231 0.1612 0.1282 0.0234  -0.0315 -0.0101 346 LEU A CG  
2697 C CD1 . LEU A 368 ? 0.1217 0.1527 0.1230 0.0224  -0.0300 -0.0079 346 LEU A CD1 
2698 C CD2 . LEU A 368 ? 0.1562 0.1969 0.1654 0.0209  -0.0300 -0.0133 346 LEU A CD2 
2699 N N   . PRO A 369 ? 0.1289 0.1660 0.1300 0.0320  -0.0354 -0.0038 347 PRO A N   
2700 C CA  . PRO A 369 ? 0.1164 0.1549 0.1200 0.0353  -0.0362 -0.0034 347 PRO A CA  
2701 C C   . PRO A 369 ? 0.1162 0.1601 0.1253 0.0348  -0.0361 -0.0069 347 PRO A C   
2702 O O   . PRO A 369 ? 0.1182 0.1619 0.1291 0.0316  -0.0345 -0.0092 347 PRO A O   
2703 C CB  . PRO A 369 ? 0.1319 0.1628 0.1344 0.0356  -0.0344 -0.0013 347 PRO A CB  
2704 C CG  . PRO A 369 ? 0.1273 0.1533 0.1253 0.0337  -0.0336 0.0006  347 PRO A CG  
2705 C CD  . PRO A 369 ? 0.1175 0.1469 0.1155 0.0307  -0.0336 -0.0017 347 PRO A CD  
2706 N N   . LYS A 370 ? 0.1180 0.1659 0.1298 0.0373  -0.0371 -0.0072 348 LYS A N   
2707 C CA  . LYS A 370 ? 0.1114 0.1653 0.1289 0.0370  -0.0372 -0.0107 348 LYS A CA  
2708 C C   . LYS A 370 ? 0.1610 0.2130 0.1819 0.0377  -0.0357 -0.0114 348 LYS A C   
2709 O O   . LYS A 370 ? 0.1995 0.2547 0.2247 0.0361  -0.0346 -0.0143 348 LYS A O   
2710 C CB  . LYS A 370 ? 0.1963 0.2556 0.2153 0.0391  -0.0385 -0.0108 348 LYS A CB  
2711 C CG  . LYS A 370 ? 0.2714 0.3324 0.2867 0.0388  -0.0396 -0.0099 348 LYS A CG  
2712 C CD  . LYS A 370 ? 0.3939 0.4580 0.4101 0.0353  -0.0394 -0.0130 348 LYS A CD  
2713 C CE  . LYS A 370 ? 0.4455 0.5121 0.4585 0.0353  -0.0405 -0.0126 348 LYS A CE  
2714 N NZ  . LYS A 370 ? 0.4404 0.5101 0.4547 0.0321  -0.0402 -0.0160 348 LYS A NZ  
2715 N N   . GLY A 371 ? 0.1431 0.1890 0.1617 0.0395  -0.0351 -0.0087 349 GLY A N   
2716 C CA  . GLY A 371 ? 0.1831 0.2267 0.2045 0.0403  -0.0335 -0.0093 349 GLY A CA  
2717 C C   . GLY A 371 ? 0.1369 0.1767 0.1584 0.0370  -0.0308 -0.0107 349 GLY A C   
2718 O O   . GLY A 371 ? 0.1612 0.1989 0.1801 0.0340  -0.0300 -0.0107 349 GLY A O   
2719 N N   . PRO A 372 ? 0.1128 0.1519 0.1372 0.0376  -0.0293 -0.0119 350 PRO A N   
2720 C CA  . PRO A 372 ? 0.1094 0.1451 0.1333 0.0348  -0.0266 -0.0132 350 PRO A CA  
2721 C C   . PRO A 372 ? 0.1284 0.1566 0.1476 0.0340  -0.0258 -0.0112 350 PRO A C   
2722 O O   . PRO A 372 ? 0.1368 0.1618 0.1540 0.0359  -0.0269 -0.0089 350 PRO A O   
2723 C CB  . PRO A 372 ? 0.1491 0.1862 0.1771 0.0365  -0.0254 -0.0147 350 PRO A CB  
2724 C CG  . PRO A 372 ? 0.2239 0.2619 0.2531 0.0405  -0.0273 -0.0133 350 PRO A CG  
2725 C CD  . PRO A 372 ? 0.1449 0.1865 0.1730 0.0411  -0.0299 -0.0122 350 PRO A CD  
2726 N N   . GLY A 373 ? 0.1061 0.1317 0.1238 0.0314  -0.0238 -0.0121 351 GLY A N   
2727 C CA  . GLY A 373 ? 0.1039 0.1234 0.1176 0.0302  -0.0232 -0.0107 351 GLY A CA  
2728 C C   . GLY A 373 ? 0.1033 0.1219 0.1138 0.0294  -0.0246 -0.0088 351 GLY A C   
2729 O O   . GLY A 373 ? 0.1152 0.1375 0.1260 0.0281  -0.0252 -0.0093 351 GLY A O   
2730 N N   . LEU A 374 ? 0.0894 0.1030 0.0972 0.0299  -0.0249 -0.0068 352 LEU A N   
2731 C CA  . LEU A 374 ? 0.0898 0.1023 0.0945 0.0294  -0.0260 -0.0047 352 LEU A CA  
2732 C C   . LEU A 374 ? 0.1213 0.1373 0.1265 0.0319  -0.0280 -0.0033 352 LEU A C   
2733 O O   . LEU A 374 ? 0.1087 0.1255 0.1114 0.0316  -0.0291 -0.0019 352 LEU A O   
2734 C CB  . LEU A 374 ? 0.1194 0.1254 0.1215 0.0292  -0.0253 -0.0029 352 LEU A CB  
2735 C CG  . LEU A 374 ? 0.1155 0.1184 0.1163 0.0267  -0.0237 -0.0041 352 LEU A CG  
2736 C CD1 . LEU A 374 ? 0.1378 0.1349 0.1374 0.0268  -0.0232 -0.0029 352 LEU A CD1 
2737 C CD2 . LEU A 374 ? 0.1218 0.1263 0.1205 0.0241  -0.0237 -0.0043 352 LEU A CD2 
2738 N N   . GLY A 375 ? 0.1006 0.1189 0.1089 0.0347  -0.0285 -0.0037 353 GLY A N   
2739 C CA  . GLY A 375 ? 0.0958 0.1181 0.1048 0.0377  -0.0306 -0.0024 353 GLY A CA  
2740 C C   . GLY A 375 ? 0.1526 0.1703 0.1591 0.0403  -0.0310 0.0011  353 GLY A C   
2741 O O   . GLY A 375 ? 0.1595 0.1800 0.1653 0.0430  -0.0328 0.0029  353 GLY A O   
2742 N N   . ILE A 376 ? 0.1511 0.1619 0.1564 0.0395  -0.0293 0.0020  354 ILE A N   
2743 C CA  . ILE A 376 ? 0.1691 0.1741 0.1725 0.0412  -0.0289 0.0053  354 ILE A CA  
2744 C C   . ILE A 376 ? 0.1857 0.1869 0.1918 0.0432  -0.0277 0.0051  354 ILE A C   
2745 O O   . ILE A 376 ? 0.2357 0.2357 0.2437 0.0416  -0.0264 0.0024  354 ILE A O   
2746 C CB  . ILE A 376 ? 0.2844 0.2841 0.2847 0.0381  -0.0276 0.0059  354 ILE A CB  
2747 C CG1 . ILE A 376 ? 0.3401 0.3431 0.3377 0.0361  -0.0285 0.0061  354 ILE A CG1 
2748 C CG2 . ILE A 376 ? 0.2955 0.2886 0.2946 0.0395  -0.0265 0.0090  354 ILE A CG2 
2749 C CD1 . ILE A 376 ? 0.2576 0.2638 0.2533 0.0385  -0.0302 0.0085  354 ILE A CD1 
2750 N N   . THR A 377 ? 0.1411 0.1401 0.1473 0.0468  -0.0280 0.0080  355 THR A N   
2751 C CA  . THR A 377 ? 0.1815 0.1754 0.1902 0.0488  -0.0265 0.0082  355 THR A CA  
2752 C C   . THR A 377 ? 0.1938 0.1805 0.2004 0.0497  -0.0253 0.0118  355 THR A C   
2753 O O   . THR A 377 ? 0.2007 0.1874 0.2059 0.0529  -0.0261 0.0154  355 THR A O   
2754 C CB  . THR A 377 ? 0.3031 0.3009 0.3149 0.0529  -0.0276 0.0083  355 THR A CB  
2755 O OG1 . THR A 377 ? 0.3543 0.3591 0.3686 0.0519  -0.0285 0.0048  355 THR A OG1 
2756 C CG2 . THR A 377 ? 0.3068 0.2990 0.3214 0.0550  -0.0259 0.0083  355 THR A CG2 
2757 N N   . PRO A 378 ? 0.1928 0.1735 0.1992 0.0468  -0.0234 0.0109  356 PRO A N   
2758 C CA  . PRO A 378 ? 0.2052 0.1788 0.2102 0.0471  -0.0218 0.0142  356 PRO A CA  
2759 C C   . PRO A 378 ? 0.1733 0.1421 0.1807 0.0509  -0.0206 0.0162  356 PRO A C   
2760 O O   . PRO A 378 ? 0.2159 0.1849 0.2267 0.0521  -0.0203 0.0138  356 PRO A O   
2761 C CB  . PRO A 378 ? 0.2504 0.2201 0.2557 0.0429  -0.0201 0.0115  356 PRO A CB  
2762 C CG  . PRO A 378 ? 0.2702 0.2453 0.2758 0.0405  -0.0211 0.0075  356 PRO A CG  
2763 C CD  . PRO A 378 ? 0.2198 0.2002 0.2274 0.0434  -0.0224 0.0069  356 PRO A CD  
2764 N N   . ASP A 379 ? 0.2190 0.1836 0.2248 0.0529  -0.0198 0.0206  357 ASP A N   
2765 C CA  . ASP A 379 ? 0.2443 0.2025 0.2524 0.0562  -0.0180 0.0229  357 ASP A CA  
2766 C C   . ASP A 379 ? 0.2480 0.1984 0.2580 0.0531  -0.0151 0.0214  357 ASP A C   
2767 O O   . ASP A 379 ? 0.2300 0.1760 0.2383 0.0513  -0.0137 0.0236  357 ASP A O   
2768 C CB  . ASP A 379 ? 0.2573 0.2142 0.2626 0.0599  -0.0180 0.0287  357 ASP A CB  
2769 C CG  . ASP A 379 ? 0.3246 0.2761 0.3332 0.0624  -0.0160 0.0310  357 ASP A CG  
2770 O OD1 . ASP A 379 ? 0.2958 0.2424 0.3081 0.0627  -0.0144 0.0286  357 ASP A OD1 
2771 O OD2 . ASP A 379 ? 0.3576 0.3095 0.3648 0.0642  -0.0161 0.0350  357 ASP A OD2 
2772 N N   A GLU A 380 ? 0.2650 0.2140 0.2789 0.0524  -0.0143 0.0175  358 GLU A N   
2773 N N   B GLU A 380 ? 0.2669 0.2158 0.2807 0.0524  -0.0143 0.0175  358 GLU A N   
2774 C CA  A GLU A 380 ? 0.3065 0.2492 0.3227 0.0492  -0.0119 0.0147  358 GLU A CA  
2775 C CA  B GLU A 380 ? 0.3024 0.2452 0.3186 0.0492  -0.0119 0.0147  358 GLU A CA  
2776 C C   A GLU A 380 ? 0.3302 0.2642 0.3478 0.0503  -0.0091 0.0180  358 GLU A C   
2777 C C   B GLU A 380 ? 0.3291 0.2630 0.3467 0.0502  -0.0091 0.0180  358 GLU A C   
2778 O O   A GLU A 380 ? 0.3238 0.2528 0.3424 0.0469  -0.0071 0.0167  358 GLU A O   
2779 O O   B GLU A 380 ? 0.3256 0.2546 0.3443 0.0470  -0.0071 0.0167  358 GLU A O   
2780 C CB  A GLU A 380 ? 0.3200 0.2634 0.3399 0.0494  -0.0116 0.0100  358 GLU A CB  
2781 C CB  B GLU A 380 ? 0.3195 0.2630 0.3392 0.0490  -0.0116 0.0098  358 GLU A CB  
2782 C CG  A GLU A 380 ? 0.3283 0.2672 0.3506 0.0460  -0.0096 0.0059  358 GLU A CG  
2783 C CG  B GLU A 380 ? 0.3188 0.2708 0.3375 0.0482  -0.0139 0.0069  358 GLU A CG  
2784 C CD  A GLU A 380 ? 0.3105 0.2519 0.3354 0.0460  -0.0098 0.0010  358 GLU A CD  
2785 C CD  B GLU A 380 ? 0.3245 0.2777 0.3466 0.0489  -0.0135 0.0028  358 GLU A CD  
2786 O OE1 A GLU A 380 ? 0.3053 0.2422 0.3333 0.0448  -0.0079 -0.0022 358 GLU A OE1 
2787 O OE1 B GLU A 380 ? 0.3233 0.2720 0.3477 0.0473  -0.0117 -0.0002 358 GLU A OE1 
2788 O OE2 A GLU A 380 ? 0.3212 0.2693 0.3452 0.0471  -0.0116 0.0002  358 GLU A OE2 
2789 O OE2 B GLU A 380 ? 0.3377 0.2966 0.3604 0.0511  -0.0150 0.0023  358 GLU A OE2 
2790 N N   . SER A 381 ? 0.3160 0.2481 0.3337 0.0549  -0.0088 0.0223  359 SER A N   
2791 C CA  . SER A 381 ? 0.3647 0.2879 0.3837 0.0565  -0.0057 0.0262  359 SER A CA  
2792 C C   . SER A 381 ? 0.3396 0.2602 0.3555 0.0541  -0.0046 0.0293  359 SER A C   
2793 O O   . SER A 381 ? 0.3996 0.3127 0.4172 0.0530  -0.0017 0.0308  359 SER A O   
2794 C CB  . SER A 381 ? 0.3473 0.2715 0.3664 0.0610  -0.0065 0.0298  359 SER A CB  
2795 O OG  . SER A 381 ? 0.3742 0.3044 0.3889 0.0622  -0.0087 0.0335  359 SER A OG  
2796 N N   . LEU A 382 ? 0.2798 0.2070 0.2914 0.0527  -0.0070 0.0297  360 LEU A N   
2797 C CA  . LEU A 382 ? 0.2712 0.1969 0.2798 0.0503  -0.0061 0.0322  360 LEU A CA  
2798 C C   . LEU A 382 ? 0.3283 0.2505 0.3393 0.0450  -0.0043 0.0283  360 LEU A C   
2799 O O   . LEU A 382 ? 0.2977 0.2157 0.3081 0.0430  -0.0023 0.0304  360 LEU A O   
2800 C CB  . LEU A 382 ? 0.2279 0.1621 0.2316 0.0499  -0.0092 0.0327  360 LEU A CB  
2801 C CG  . LEU A 382 ? 0.3039 0.2428 0.3046 0.0548  -0.0113 0.0366  360 LEU A CG  
2802 C CD1 . LEU A 382 ? 0.2981 0.2454 0.2946 0.0537  -0.0143 0.0359  360 LEU A CD1 
2803 C CD2 . LEU A 382 ? 0.3601 0.2952 0.3598 0.0558  -0.0095 0.0413  360 LEU A CD2 
2804 N N   . PHE A 383 ? 0.3377 0.2620 0.3513 0.0428  -0.0051 0.0227  361 PHE A N   
2805 C CA  . PHE A 383 ? 0.3140 0.2371 0.3293 0.0379  -0.0042 0.0184  361 PHE A CA  
2806 C C   . PHE A 383 ? 0.3897 0.3049 0.4103 0.0369  -0.0010 0.0166  361 PHE A C   
2807 O O   . PHE A 383 ? 0.4251 0.3382 0.4476 0.0329  0.0003  0.0137  361 PHE A O   
2808 C CB  . PHE A 383 ? 0.3285 0.2583 0.3436 0.0362  -0.0066 0.0132  361 PHE A CB  
2809 C CG  . PHE A 383 ? 0.3129 0.2507 0.3238 0.0366  -0.0095 0.0141  361 PHE A CG  
2810 C CD1 . PHE A 383 ? 0.3266 0.2657 0.3337 0.0367  -0.0100 0.0180  361 PHE A CD1 
2811 C CD2 . PHE A 383 ? 0.3104 0.2541 0.3212 0.0369  -0.0115 0.0109  361 PHE A CD2 
2812 C CE1 . PHE A 383 ? 0.2718 0.2182 0.2754 0.0369  -0.0126 0.0183  361 PHE A CE1 
2813 C CE2 . PHE A 383 ? 0.2550 0.2057 0.2626 0.0371  -0.0139 0.0114  361 PHE A CE2 
2814 C CZ  . PHE A 383 ? 0.2634 0.2154 0.2674 0.0371  -0.0146 0.0150  361 PHE A CZ  
2815 N N   . GLY A 384 ? 0.3334 0.2443 0.3566 0.0405  0.0003  0.0180  362 GLY A N   
2816 C CA  . GLY A 384 ? 0.3311 0.2347 0.3598 0.0397  0.0032  0.0154  362 GLY A CA  
2817 C C   . GLY A 384 ? 0.3412 0.2483 0.3722 0.0383  0.0019  0.0088  362 GLY A C   
2818 O O   . GLY A 384 ? 0.3320 0.2468 0.3602 0.0380  -0.0009 0.0069  362 GLY A O   
2819 N N   . PRO A 385 ? 0.3152 0.2168 0.3514 0.0375  0.0043  0.0052  363 PRO A N   
2820 C CA  . PRO A 385 ? 0.2746 0.1796 0.3128 0.0361  0.0033  -0.0015 363 PRO A CA  
2821 C C   . PRO A 385 ? 0.2455 0.1557 0.2819 0.0316  0.0018  -0.0054 363 PRO A C   
2822 O O   . PRO A 385 ? 0.2333 0.1425 0.2688 0.0289  0.0023  -0.0040 363 PRO A O   
2823 C CB  . PRO A 385 ? 0.3212 0.2180 0.3655 0.0358  0.0066  -0.0042 363 PRO A CB  
2824 C CG  . PRO A 385 ? 0.3953 0.2856 0.4400 0.0351  0.0092  0.0003  363 PRO A CG  
2825 C CD  . PRO A 385 ? 0.3557 0.2479 0.3960 0.0381  0.0080  0.0071  363 PRO A CD  
2826 N N   . PRO A 386 ? 0.2437 0.1597 0.2794 0.0309  -0.0001 -0.0101 364 PRO A N   
2827 C CA  . PRO A 386 ? 0.2240 0.1451 0.2577 0.0271  -0.0015 -0.0138 364 PRO A CA  
2828 C C   . PRO A 386 ? 0.2496 0.1662 0.2870 0.0235  0.0005  -0.0170 364 PRO A C   
2829 O O   . PRO A 386 ? 0.2448 0.1553 0.2871 0.0239  0.0029  -0.0187 364 PRO A O   
2830 C CB  . PRO A 386 ? 0.2254 0.1517 0.2589 0.0276  -0.0029 -0.0185 364 PRO A CB  
2831 C CG  . PRO A 386 ? 0.2769 0.2029 0.3107 0.0319  -0.0030 -0.0162 364 PRO A CG  
2832 C CD  . PRO A 386 ? 0.2553 0.1737 0.2919 0.0338  -0.0008 -0.0122 364 PRO A CD  
2833 N N   . VAL A 387 ? 0.2002 0.1199 0.2358 0.0202  -0.0003 -0.0178 365 VAL A N   
2834 C CA  . VAL A 387 ? 0.2156 0.1326 0.2551 0.0166  0.0013  -0.0217 365 VAL A CA  
2835 C C   . VAL A 387 ? 0.2426 0.1640 0.2831 0.0151  0.0002  -0.0288 365 VAL A C   
2836 O O   . VAL A 387 ? 0.2312 0.1505 0.2760 0.0125  0.0015  -0.0335 365 VAL A O   
2837 C CB  . VAL A 387 ? 0.2076 0.1261 0.2453 0.0137  0.0011  -0.0197 365 VAL A CB  
2838 C CG1 . VAL A 387 ? 0.2738 0.1875 0.3107 0.0151  0.0026  -0.0129 365 VAL A CG1 
2839 C CG2 . VAL A 387 ? 0.1948 0.1217 0.2272 0.0132  -0.0021 -0.0199 365 VAL A CG2 
2840 N N   . ALA A 388 ? 0.1950 0.1226 0.2317 0.0167  -0.0021 -0.0296 366 ALA A N   
2841 C CA  . ALA A 388 ? 0.1901 0.1222 0.2269 0.0160  -0.0031 -0.0358 366 ALA A CA  
2842 C C   . ALA A 388 ? 0.1959 0.1321 0.2298 0.0191  -0.0044 -0.0353 366 ALA A C   
2843 O O   . ALA A 388 ? 0.1924 0.1315 0.2226 0.0206  -0.0058 -0.0310 366 ALA A O   
2844 C CB  . ALA A 388 ? 0.2090 0.1470 0.2433 0.0131  -0.0048 -0.0383 366 ALA A CB  
2845 N N   . SER A 389 ? 0.1786 0.1150 0.2146 0.0201  -0.0039 -0.0399 367 SER A N   
2846 C CA  . SER A 389 ? 0.1936 0.1339 0.2274 0.0229  -0.0048 -0.0400 367 SER A CA  
2847 C C   . SER A 389 ? 0.1821 0.1274 0.2150 0.0222  -0.0054 -0.0461 367 SER A C   
2848 O O   . SER A 389 ? 0.2076 0.1512 0.2435 0.0206  -0.0046 -0.0511 367 SER A O   
2849 C CB  . SER A 389 ? 0.1675 0.1026 0.2050 0.0260  -0.0032 -0.0388 367 SER A CB  
2850 O OG  . SER A 389 ? 0.2046 0.1362 0.2419 0.0275  -0.0029 -0.0327 367 SER A OG  
2851 N N   . PHE A 390 ? 0.1650 0.1166 0.1939 0.0234  -0.0069 -0.0456 368 PHE A N   
2852 C CA  . PHE A 390 ? 0.1636 0.1206 0.1904 0.0230  -0.0075 -0.0506 368 PHE A CA  
2853 C C   . PHE A 390 ? 0.1645 0.1244 0.1902 0.0260  -0.0073 -0.0506 368 PHE A C   
2854 O O   . PHE A 390 ? 0.1925 0.1537 0.2167 0.0276  -0.0078 -0.0462 368 PHE A O   
2855 C CB  . PHE A 390 ? 0.1803 0.1427 0.2026 0.0211  -0.0091 -0.0500 368 PHE A CB  
2856 C CG  . PHE A 390 ? 0.1709 0.1311 0.1943 0.0182  -0.0093 -0.0497 368 PHE A CG  
2857 C CD1 . PHE A 390 ? 0.2092 0.1699 0.2345 0.0161  -0.0092 -0.0549 368 PHE A CD1 
2858 C CD2 . PHE A 390 ? 0.1891 0.1471 0.2120 0.0177  -0.0096 -0.0443 368 PHE A CD2 
2859 C CE1 . PHE A 390 ? 0.1787 0.1377 0.2056 0.0134  -0.0093 -0.0548 368 PHE A CE1 
2860 C CE2 . PHE A 390 ? 0.1898 0.1459 0.2139 0.0151  -0.0095 -0.0440 368 PHE A CE2 
2861 C CZ  . PHE A 390 ? 0.2013 0.1579 0.2277 0.0128  -0.0093 -0.0492 368 PHE A CZ  
2862 N N   . SER A 391 ? 0.1689 0.1300 0.1956 0.0267  -0.0066 -0.0558 369 SER A N   
2863 C CA  . SER A 391 ? 0.1920 0.1560 0.2182 0.0294  -0.0061 -0.0564 369 SER A CA  
2864 C C   . SER A 391 ? 0.2242 0.1931 0.2483 0.0292  -0.0060 -0.0620 369 SER A C   
2865 O O   . SER A 391 ? 0.2342 0.2055 0.2581 0.0314  -0.0052 -0.0637 369 SER A O   
2866 C CB  . SER A 391 ? 0.2760 0.2345 0.3071 0.0317  -0.0045 -0.0563 369 SER A CB  
2867 O OG  . SER A 391 ? 0.3130 0.2744 0.3437 0.0345  -0.0042 -0.0554 369 SER A OG  
2868 O OXT . SER A 391 ? 0.2395 0.2104 0.2621 0.0271  -0.0067 -0.0649 369 SER A OXT 
2869 N N   . MET B 23  ? 0.3626 0.3152 0.5243 0.0665  -0.0923 0.0397  1   MET B N   
2870 C CA  . MET B 23  ? 0.3560 0.3272 0.5300 0.0621  -0.0915 0.0206  1   MET B CA  
2871 C C   . MET B 23  ? 0.3044 0.2885 0.4641 0.0586  -0.0928 0.0182  1   MET B C   
2872 O O   . MET B 23  ? 0.2757 0.2533 0.4166 0.0544  -0.0892 0.0280  1   MET B O   
2873 C CB  . MET B 23  ? 0.3641 0.3321 0.5556 0.0536  -0.0809 0.0092  1   MET B CB  
2874 C CG  . MET B 23  ? 0.3964 0.3810 0.5991 0.0489  -0.0784 -0.0095 1   MET B CG  
2875 S SD  . MET B 23  ? 0.5501 0.5335 0.7654 0.0386  -0.0658 -0.0215 1   MET B SD  
2876 C CE  . MET B 23  ? 0.3017 0.2770 0.5361 0.0411  -0.0660 -0.0222 1   MET B CE  
2877 N N   . LYS B 24  ? 0.2451 0.2476 0.4100 0.0576  -0.0945 0.0039  2   LYS B N   
2878 C CA  . LYS B 24  ? 0.2260 0.2430 0.3794 0.0535  -0.0948 -0.0009 2   LYS B CA  
2879 C C   . LYS B 24  ? 0.1550 0.1836 0.3197 0.0460  -0.0871 -0.0186 2   LYS B C   
2880 O O   . LYS B 24  ? 0.1535 0.1842 0.3325 0.0463  -0.0853 -0.0284 2   LYS B O   
2881 C CB  . LYS B 24  ? 0.2598 0.2882 0.3999 0.0609  -0.1050 0.0023  2   LYS B CB  
2882 C CG  . LYS B 24  ? 0.3294 0.3463 0.4514 0.0685  -0.1121 0.0218  2   LYS B CG  
2883 C CD  . LYS B 24  ? 0.4305 0.4608 0.5424 0.0777  -0.1223 0.0231  2   LYS B CD  
2884 C CE  . LYS B 24  ? 0.5186 0.5707 0.6234 0.0735  -0.1229 0.0117  2   LYS B CE  
2885 N NZ  . LYS B 24  ? 0.5595 0.6278 0.6632 0.0812  -0.1314 0.0072  2   LYS B NZ  
2886 N N   . ILE B 25  ? 0.1403 0.1754 0.2972 0.0387  -0.0818 -0.0223 3   ILE B N   
2887 C CA  . ILE B 25  ? 0.1248 0.1686 0.2865 0.0316  -0.0732 -0.0365 3   ILE B CA  
2888 C C   . ILE B 25  ? 0.1334 0.1895 0.2955 0.0346  -0.0767 -0.0443 3   ILE B C   
2889 O O   . ILE B 25  ? 0.1409 0.2052 0.2919 0.0374  -0.0827 -0.0409 3   ILE B O   
2890 C CB  . ILE B 25  ? 0.1184 0.1641 0.2692 0.0233  -0.0661 -0.0371 3   ILE B CB  
2891 C CG1 . ILE B 25  ? 0.1095 0.1414 0.2559 0.0187  -0.0592 -0.0313 3   ILE B CG1 
2892 C CG2 . ILE B 25  ? 0.1394 0.1901 0.2905 0.0175  -0.0564 -0.0486 3   ILE B CG2 
2893 C CD1 . ILE B 25  ? 0.1181 0.1493 0.2498 0.0106  -0.0516 -0.0312 3   ILE B CD1 
2894 N N   . ALA B 26  ? 0.1276 0.1852 0.3025 0.0337  -0.0727 -0.0555 4   ALA B N   
2895 C CA  . ALA B 26  ? 0.1324 0.2009 0.3114 0.0361  -0.0750 -0.0650 4   ALA B CA  
2896 C C   . ALA B 26  ? 0.1292 0.2014 0.3076 0.0286  -0.0640 -0.0751 4   ALA B C   
2897 O O   . ALA B 26  ? 0.1235 0.2050 0.3000 0.0290  -0.0646 -0.0807 4   ALA B O   
2898 C CB  . ALA B 26  ? 0.1410 0.2086 0.3362 0.0408  -0.0787 -0.0713 4   ALA B CB  
2899 N N   . GLU B 27  ? 0.1324 0.1967 0.3121 0.0226  -0.0537 -0.0772 5   GLU B N   
2900 C CA  . GLU B 27  ? 0.1191 0.1840 0.2974 0.0167  -0.0422 -0.0847 5   GLU B CA  
2901 C C   . GLU B 27  ? 0.0954 0.1525 0.2641 0.0112  -0.0337 -0.0792 5   GLU B C   
2902 O O   . GLU B 27  ? 0.1326 0.1833 0.3015 0.0112  -0.0342 -0.0746 5   GLU B O   
2903 C CB  . GLU B 27  ? 0.1475 0.2121 0.3400 0.0162  -0.0369 -0.0966 5   GLU B CB  
2904 C CG  . GLU B 27  ? 0.1505 0.2221 0.3553 0.0220  -0.0457 -0.1038 5   GLU B CG  
2905 C CD  . GLU B 27  ? 0.2319 0.3024 0.4518 0.0206  -0.0401 -0.1166 5   GLU B CD  
2906 O OE1 . GLU B 27  ? 0.1704 0.2353 0.3902 0.0153  -0.0290 -0.1195 5   GLU B OE1 
2907 O OE2 . GLU B 27  ? 0.2414 0.3176 0.4733 0.0251  -0.0471 -0.1242 5   GLU B OE2 
2908 N N   . ILE B 28  ? 0.1395 0.1974 0.3008 0.0070  -0.0260 -0.0801 6   ILE B N   
2909 C CA  . ILE B 28  ? 0.1222 0.1736 0.2744 0.0025  -0.0174 -0.0759 6   ILE B CA  
2910 C C   . ILE B 28  ? 0.1154 0.1672 0.2705 -0.0005 -0.0067 -0.0825 6   ILE B C   
2911 O O   . ILE B 28  ? 0.1357 0.1919 0.2932 -0.0010 -0.0053 -0.0870 6   ILE B O   
2912 C CB  . ILE B 28  ? 0.1165 0.1666 0.2545 0.0003  -0.0193 -0.0674 6   ILE B CB  
2913 C CG1 . ILE B 28  ? 0.1187 0.1674 0.2544 0.0025  -0.0285 -0.0604 6   ILE B CG1 
2914 C CG2 . ILE B 28  ? 0.1306 0.1746 0.2596 -0.0038 -0.0109 -0.0641 6   ILE B CG2 
2915 C CD1 . ILE B 28  ? 0.1065 0.1553 0.2292 0.0000  -0.0306 -0.0535 6   ILE B CD1 
2916 N N   . HIS B 29  ? 0.1043 0.1524 0.2602 -0.0027 0.0012  -0.0836 7   HIS B N   
2917 C CA  . HIS B 29  ? 0.0943 0.1424 0.2526 -0.0065 0.0120  -0.0885 7   HIS B CA  
2918 C C   . HIS B 29  ? 0.1062 0.1495 0.2536 -0.0105 0.0192  -0.0828 7   HIS B C   
2919 O O   . HIS B 29  ? 0.1082 0.1494 0.2508 -0.0105 0.0186  -0.0793 7   HIS B O   
2920 C CB  . HIS B 29  ? 0.1185 0.1687 0.2858 -0.0076 0.0148  -0.0942 7   HIS B CB  
2921 C CG  . HIS B 29  ? 0.1157 0.1707 0.2954 -0.0035 0.0074  -0.1011 7   HIS B CG  
2922 N ND1 . HIS B 29  ? 0.1372 0.1969 0.3240 -0.0040 0.0083  -0.1079 7   HIS B ND1 
2923 C CD2 . HIS B 29  ? 0.1129 0.1683 0.3001 0.0012  -0.0015 -0.1031 7   HIS B CD2 
2924 C CE1 . HIS B 29  ? 0.1424 0.2064 0.3401 0.0005  0.0000  -0.1143 7   HIS B CE1 
2925 N NE2 . HIS B 29  ? 0.1238 0.1846 0.3221 0.0039  -0.0063 -0.1113 7   HIS B NE2 
2926 N N   . VAL B 30  ? 0.1184 0.1595 0.2623 -0.0140 0.0255  -0.0823 8   VAL B N   
2927 C CA  . VAL B 30  ? 0.1114 0.1465 0.2455 -0.0178 0.0320  -0.0772 8   VAL B CA  
2928 C C   . VAL B 30  ? 0.1402 0.1706 0.2755 -0.0233 0.0436  -0.0802 8   VAL B C   
2929 O O   . VAL B 30  ? 0.1515 0.1820 0.2936 -0.0249 0.0473  -0.0845 8   VAL B O   
2930 C CB  . VAL B 30  ? 0.1090 0.1422 0.2366 -0.0181 0.0299  -0.0722 8   VAL B CB  
2931 C CG1 . VAL B 30  ? 0.1256 0.1512 0.2433 -0.0219 0.0355  -0.0664 8   VAL B CG1 
2932 C CG2 . VAL B 30  ? 0.1211 0.1574 0.2436 -0.0146 0.0185  -0.0679 8   VAL B CG2 
2933 N N   . TYR B 31  ? 0.1048 0.1302 0.2330 -0.0268 0.0497  -0.0786 9   TYR B N   
2934 C CA  . TYR B 31  ? 0.1179 0.1360 0.2447 -0.0331 0.0620  -0.0816 9   TYR B CA  
2935 C C   . TYR B 31  ? 0.1686 0.1774 0.2821 -0.0370 0.0706  -0.0734 9   TYR B C   
2936 O O   . TYR B 31  ? 0.1539 0.1638 0.2588 -0.0357 0.0669  -0.0678 9   TYR B O   
2937 C CB  . TYR B 31  ? 0.1459 0.1678 0.2745 -0.0350 0.0628  -0.0862 9   TYR B CB  
2938 C CG  . TYR B 31  ? 0.1340 0.1653 0.2744 -0.0304 0.0541  -0.0909 9   TYR B CG  
2939 C CD1 . TYR B 31  ? 0.1469 0.1842 0.2894 -0.0236 0.0429  -0.0884 9   TYR B CD1 
2940 C CD2 . TYR B 31  ? 0.1979 0.2311 0.3481 -0.0330 0.0582  -0.0979 9   TYR B CD2 
2941 C CE1 . TYR B 31  ? 0.1445 0.1875 0.2979 -0.0193 0.0361  -0.0924 9   TYR B CE1 
2942 C CE2 . TYR B 31  ? 0.1869 0.2277 0.3483 -0.0286 0.0505  -0.1026 9   TYR B CE2 
2943 C CZ  . TYR B 31  ? 0.1759 0.2209 0.3385 -0.0215 0.0396  -0.0995 9   TYR B CZ  
2944 O OH  . TYR B 31  ? 0.2106 0.2607 0.3847 -0.0172 0.0325  -0.1041 9   TYR B OH  
2945 N N   . ALA B 32  ? 0.2054 0.2055 0.3168 -0.0408 0.0821  -0.0718 10  ALA B N   
2946 C CA  . ALA B 32  ? 0.2165 0.2064 0.3113 -0.0427 0.0927  -0.0614 10  ALA B CA  
2947 C C   . ALA B 32  ? 0.2902 0.2782 0.3741 -0.0450 0.1033  -0.0611 10  ALA B C   
2948 O O   . ALA B 32  ? 0.3296 0.3184 0.4232 -0.0483 0.1075  -0.0684 10  ALA B O   
2949 C CB  . ALA B 32  ? 0.2565 0.2360 0.3543 -0.0439 0.0987  -0.0579 10  ALA B CB  
2950 N N   . HIS B 33  ? 0.1956 0.1811 0.2576 -0.0426 0.1074  -0.0536 11  HIS B N   
2951 C CA  . HIS B 33  ? 0.2256 0.2107 0.2721 -0.0434 0.1159  -0.0534 11  HIS B CA  
2952 C C   . HIS B 33  ? 0.2564 0.2310 0.2714 -0.0400 0.1231  -0.0406 11  HIS B C   
2953 O O   . HIS B 33  ? 0.2633 0.2355 0.2665 -0.0337 0.1110  -0.0344 11  HIS B O   
2954 C CB  . HIS B 33  ? 0.2162 0.2156 0.2682 -0.0412 0.1072  -0.0633 11  HIS B CB  
2955 C CG  . HIS B 33  ? 0.2290 0.2316 0.2677 -0.0419 0.1140  -0.0656 11  HIS B CG  
2956 N ND1 . HIS B 33  ? 0.2867 0.2875 0.3301 -0.0473 0.1238  -0.0687 11  HIS B ND1 
2957 C CD2 . HIS B 33  ? 0.2184 0.2273 0.2402 -0.0377 0.1115  -0.0668 11  HIS B CD2 
2958 C CE1 . HIS B 33  ? 0.3458 0.3520 0.3751 -0.0467 0.1278  -0.0707 11  HIS B CE1 
2959 N NE2 . HIS B 33  ? 0.2941 0.3057 0.3102 -0.0407 0.1199  -0.0699 11  HIS B NE2 
2960 N N   . ASP B 34  ? 0.3039 0.2706 0.3036 -0.0420 0.1351  -0.0350 12  ASP B N   
2961 C CA  . ASP B 34  ? 0.3628 0.3175 0.3286 -0.0375 0.1410  -0.0206 12  ASP B CA  
2962 C C   . ASP B 34  ? 0.4133 0.3766 0.3542 -0.0329 0.1394  -0.0223 12  ASP B C   
2963 O O   . ASP B 34  ? 0.4414 0.4165 0.3903 -0.0358 0.1406  -0.0326 12  ASP B O   
2964 C CB  . ASP B 34  ? 0.4348 0.3738 0.3953 -0.0410 0.1541  -0.0110 12  ASP B CB  
2965 C CG  . ASP B 34  ? 0.4650 0.3927 0.4438 -0.0430 0.1547  -0.0074 12  ASP B CG  
2966 O OD1 . ASP B 34  ? 0.4358 0.3589 0.4116 -0.0390 0.1481  -0.0012 12  ASP B OD1 
2967 O OD2 . ASP B 34  ? 0.4851 0.4093 0.4820 -0.0484 0.1616  -0.0121 12  ASP B OD2 
2968 N N   . LEU B 35  ? 0.3863 0.3448 0.3002 -0.0243 0.1310  -0.0122 13  LEU B N   
2969 C CA  . LEU B 35  ? 0.3117 0.2798 0.2004 -0.0184 0.1271  -0.0142 13  LEU B CA  
2970 C C   . LEU B 35  ? 0.3690 0.3246 0.2201 -0.0111 0.1295  0.0023  13  LEU B C   
2971 O O   . LEU B 35  ? 0.4883 0.4415 0.3288 -0.0025 0.1159  0.0082  13  LEU B O   
2972 C CB  . LEU B 35  ? 0.3578 0.3394 0.2551 -0.0126 0.1075  -0.0233 13  LEU B CB  
2973 C CG  . LEU B 35  ? 0.2939 0.2883 0.2240 -0.0164 0.0997  -0.0382 13  LEU B CG  
2974 C CD1 . LEU B 35  ? 0.2779 0.2784 0.2111 -0.0099 0.0817  -0.0410 13  LEU B CD1 
2975 C CD2 . LEU B 35  ? 0.2817 0.2902 0.2188 -0.0200 0.1056  -0.0517 13  LEU B CD2 
2976 N N   . PRO B 36  ? 0.4005 0.3493 0.2336 -0.0138 0.1448  0.0098  14  PRO B N   
2977 C CA  . PRO B 36  ? 0.4141 0.3511 0.2120 -0.0057 0.1448  0.0272  14  PRO B CA  
2978 C C   . PRO B 36  ? 0.4783 0.4295 0.2478 0.0042  0.1336  0.0244  14  PRO B C   
2979 O O   . PRO B 36  ? 0.4638 0.4346 0.2376 0.0021  0.1324  0.0097  14  PRO B O   
2980 C CB  . PRO B 36  ? 0.4480 0.3775 0.2441 -0.0126 0.1606  0.0341  14  PRO B CB  
2981 C CG  . PRO B 36  ? 0.4283 0.3726 0.2514 -0.0220 0.1666  0.0171  14  PRO B CG  
2982 C CD  . PRO B 36  ? 0.3834 0.3355 0.2352 -0.0236 0.1571  0.0039  14  PRO B CD  
2983 N N   . VAL B 37  ? 0.4876 0.4306 0.2320 0.0151  0.1242  0.0371  15  VAL B N   
2984 C CA  . VAL B 37  ? 0.5393 0.4981 0.2611 0.0253  0.1100  0.0325  15  VAL B CA  
2985 C C   . VAL B 37  ? 0.5788 0.5450 0.2754 0.0251  0.1156  0.0361  15  VAL B C   
2986 O O   . VAL B 37  ? 0.6132 0.5646 0.2906 0.0267  0.1216  0.0531  15  VAL B O   
2987 C CB  . VAL B 37  ? 0.5385 0.4903 0.2480 0.0383  0.0935  0.0413  15  VAL B CB  
2988 C CG1 . VAL B 37  ? 0.6360 0.5644 0.3311 0.0414  0.0983  0.0629  15  VAL B CG1 
2989 C CG2 . VAL B 37  ? 0.5132 0.4848 0.2063 0.0475  0.0779  0.0331  15  VAL B CG2 
2990 N N   . LYS B 38  ? 0.5181 0.5073 0.2159 0.0227  0.1140  0.0194  16  LYS B N   
2991 C CA  . LYS B 38  ? 0.5524 0.5517 0.2254 0.0217  0.1188  0.0199  16  LYS B CA  
2992 C C   . LYS B 38  ? 0.6499 0.6445 0.2921 0.0334  0.1062  0.0310  16  LYS B C   
2993 O O   . LYS B 38  ? 0.6856 0.6860 0.3305 0.0424  0.0891  0.0252  16  LYS B O   
2994 C CB  . LYS B 38  ? 0.5664 0.5906 0.2491 0.0167  0.1178  -0.0031 16  LYS B CB  
2995 C CG  . LYS B 38  ? 0.5602 0.5957 0.2781 0.0091  0.1274  -0.0153 16  LYS B CG  
2996 C CD  . LYS B 38  ? 0.6173 0.6728 0.3413 0.0158  0.1286  -0.0298 16  LYS B CD  
2997 C CE  . LYS B 38  ? 0.6586 0.6978 0.3647 0.0156  0.1183  -0.0434 16  LYS B CE  
2998 N NZ  . LYS B 38  ? 0.6721 0.7301 0.3953 0.0173  0.1173  -0.0603 16  LYS B NZ  
2999 N N   . ASP B 39  ? 0.7050 0.6898 0.3207 0.0339  0.1141  0.0467  17  ASP B N   
3000 C CA  . ASP B 39  ? 0.7434 0.7226 0.3290 0.0459  0.1027  0.0591  17  ASP B CA  
3001 C C   . ASP B 39  ? 0.7184 0.6832 0.3108 0.0563  0.0899  0.0688  17  ASP B C   
3002 O O   . ASP B 39  ? 0.7226 0.6927 0.3043 0.0681  0.0730  0.0687  17  ASP B O   
3003 C CB  . ASP B 39  ? 0.8102 0.8118 0.3832 0.0506  0.0908  0.0436  17  ASP B CB  
3004 C CG  . ASP B 39  ? 0.9164 0.9304 0.4791 0.0403  0.1041  0.0340  17  ASP B CG  
3005 O OD1 . ASP B 39  ? 0.9688 0.9749 0.5095 0.0365  0.1168  0.0476  17  ASP B OD1 
3006 O OD2 . ASP B 39  ? 0.9327 0.9627 0.5106 0.0360  0.1024  0.0127  17  ASP B OD2 
3007 N N   . GLY B 40  ? 0.6886 0.6358 0.3009 0.0515  0.0981  0.0760  18  GLY B N   
3008 C CA  . GLY B 40  ? 0.6536 0.5858 0.2746 0.0594  0.0883  0.0846  18  GLY B CA  
3009 C C   . GLY B 40  ? 0.6757 0.5893 0.2743 0.0681  0.0862  0.1055  18  GLY B C   
3010 O O   . GLY B 40  ? 0.6750 0.5851 0.2501 0.0670  0.0944  0.1150  18  GLY B O   
3011 N N   . PRO B 41  ? 0.7154 0.6169 0.3218 0.0765  0.0756  0.1125  19  PRO B N   
3012 C CA  . PRO B 41  ? 0.6534 0.5585 0.2870 0.0765  0.0676  0.1016  19  PRO B CA  
3013 C C   . PRO B 41  ? 0.6500 0.5782 0.2851 0.0854  0.0473  0.0857  19  PRO B C   
3014 O O   . PRO B 41  ? 0.6440 0.5848 0.2602 0.0927  0.0383  0.0835  19  PRO B O   
3015 C CB  . PRO B 41  ? 0.6821 0.5634 0.3225 0.0811  0.0662  0.1169  19  PRO B CB  
3016 C CG  . PRO B 41  ? 0.7399 0.6147 0.3532 0.0912  0.0610  0.1310  19  PRO B CG  
3017 C CD  . PRO B 41  ? 0.7551 0.6375 0.3461 0.0859  0.0717  0.1317  19  PRO B CD  
3018 N N   . TYR B 42  ? 0.5975 0.5315 0.2567 0.0841  0.0407  0.0740  20  TYR B N   
3019 C CA  . TYR B 42  ? 0.6007 0.5553 0.2689 0.0916  0.0215  0.0580  20  TYR B CA  
3020 C C   . TYR B 42  ? 0.6087 0.5526 0.2849 0.1003  0.0095  0.0643  20  TYR B C   
3021 O O   . TYR B 42  ? 0.5392 0.4682 0.2303 0.0965  0.0143  0.0692  20  TYR B O   
3022 C CB  . TYR B 42  ? 0.6160 0.5863 0.3080 0.0832  0.0224  0.0387  20  TYR B CB  
3023 C CG  . TYR B 42  ? 0.6205 0.6138 0.3274 0.0881  0.0046  0.0196  20  TYR B CG  
3024 C CD1 . TYR B 42  ? 0.6125 0.6257 0.3137 0.0904  -0.0013 0.0084  20  TYR B CD1 
3025 C CD2 . TYR B 42  ? 0.5898 0.5847 0.3191 0.0892  -0.0051 0.0120  20  TYR B CD2 
3026 C CE1 . TYR B 42  ? 0.5891 0.6220 0.3095 0.0934  -0.0154 -0.0094 20  TYR B CE1 
3027 C CE2 . TYR B 42  ? 0.5682 0.5835 0.3165 0.0915  -0.0193 -0.0059 20  TYR B CE2 
3028 C CZ  . TYR B 42  ? 0.5687 0.6023 0.3138 0.0935  -0.0237 -0.0163 20  TYR B CZ  
3029 O OH  . TYR B 42  ? 0.5906 0.6426 0.3585 0.0950  -0.0354 -0.0337 20  TYR B OH  
3030 N N   . THR B 43  ? 0.6270 0.5788 0.2947 0.1119  -0.0056 0.0634  21  THR B N   
3031 C CA  . THR B 43  ? 0.6474 0.5884 0.3219 0.1208  -0.0166 0.0702  21  THR B CA  
3032 C C   . THR B 43  ? 0.6244 0.5839 0.3213 0.1253  -0.0340 0.0517  21  THR B C   
3033 O O   . THR B 43  ? 0.6354 0.6149 0.3315 0.1309  -0.0450 0.0394  21  THR B O   
3034 C CB  . THR B 43  ? 0.7175 0.6494 0.3686 0.1311  -0.0203 0.0853  21  THR B CB  
3035 O OG1 . THR B 43  ? 0.7694 0.6817 0.4033 0.1255  -0.0028 0.1033  21  THR B OG1 
3036 C CG2 . THR B 43  ? 0.6763 0.5974 0.3386 0.1398  -0.0315 0.0910  21  THR B CG2 
3037 N N   . ILE B 44  ? 0.5371 0.4895 0.2555 0.1219  -0.0353 0.0495  22  ILE B N   
3038 C CA  . ILE B 44  ? 0.5408 0.5069 0.2839 0.1248  -0.0503 0.0336  22  ILE B CA  
3039 C C   . ILE B 44  ? 0.5816 0.5317 0.3294 0.1324  -0.0565 0.0446  22  ILE B C   
3040 O O   . ILE B 44  ? 0.5403 0.4670 0.2818 0.1310  -0.0466 0.0623  22  ILE B O   
3041 C CB  . ILE B 44  ? 0.5298 0.5004 0.3005 0.1120  -0.0456 0.0219  22  ILE B CB  
3042 C CG1 . ILE B 44  ? 0.5020 0.4786 0.2684 0.1018  -0.0327 0.0179  22  ILE B CG1 
3043 C CG2 . ILE B 44  ? 0.4804 0.4705 0.2757 0.1128  -0.0594 0.0017  22  ILE B CG2 
3044 C CD1 . ILE B 44  ? 0.4377 0.4219 0.2375 0.0875  -0.0281 0.0044  22  ILE B CD1 
3045 N N   . ALA B 45  ? 0.5826 0.5449 0.3443 0.1394  -0.0714 0.0334  23  ALA B N   
3046 C CA  . ALA B 45  ? 0.5898 0.5391 0.3576 0.1469  -0.0780 0.0420  23  ALA B CA  
3047 C C   . ALA B 45  ? 0.5528 0.4847 0.3399 0.1408  -0.0723 0.0480  23  ALA B C   
3048 O O   . ALA B 45  ? 0.5777 0.4914 0.3678 0.1443  -0.0712 0.0609  23  ALA B O   
3049 C CB  . ALA B 45  ? 0.5791 0.5470 0.3629 0.1537  -0.0938 0.0252  23  ALA B CB  
3050 N N   . SER B 46  ? 0.5104 0.4489 0.3145 0.1297  -0.0674 0.0377  24  SER B N   
3051 C CA  . SER B 46  ? 0.4887 0.4163 0.3215 0.1174  -0.0582 0.0384  24  SER B CA  
3052 C C   . SER B 46  ? 0.4729 0.3869 0.3024 0.1053  -0.0390 0.0487  24  SER B C   
3053 O O   . SER B 46  ? 0.4617 0.3660 0.3133 0.0956  -0.0305 0.0503  24  SER B O   
3054 C CB  . SER B 46  ? 0.4687 0.4148 0.3323 0.1084  -0.0631 0.0176  24  SER B CB  
3055 O OG  . SER B 46  ? 0.4383 0.3988 0.3003 0.1009  -0.0590 0.0077  24  SER B OG  
3056 N N   . SER B 47  ? 0.4777 0.3929 0.2818 0.1056  -0.0322 0.0539  25  SER B N   
3057 C CA  . SER B 47  ? 0.4403 0.3447 0.2432 0.0937  -0.0135 0.0613  25  SER B CA  
3058 C C   . SER B 47  ? 0.4853 0.3867 0.2535 0.0973  -0.0055 0.0712  25  SER B C   
3059 O O   . SER B 47  ? 0.4677 0.3872 0.2233 0.1000  -0.0109 0.0615  25  SER B O   
3060 C CB  . SER B 47  ? 0.4540 0.3728 0.2828 0.0797  -0.0095 0.0453  25  SER B CB  
3061 O OG  . SER B 47  ? 0.4999 0.4088 0.3338 0.0683  0.0074  0.0507  25  SER B OG  
3062 N N   . THR B 48  ? 0.5560 0.4349 0.3102 0.0966  0.0083  0.0898  26  THR B N   
3063 C CA  . THR B 48  ? 0.6119 0.4858 0.3339 0.0971  0.0202  0.1002  26  THR B CA  
3064 C C   . THR B 48  ? 0.5854 0.4533 0.3221 0.0808  0.0403  0.0996  26  THR B C   
3065 O O   . THR B 48  ? 0.5161 0.3677 0.2726 0.0738  0.0498  0.1056  26  THR B O   
3066 C CB  . THR B 48  ? 0.6955 0.5523 0.3979 0.1050  0.0220  0.1189  26  THR B CB  
3067 O OG1 . THR B 48  ? 0.7236 0.5910 0.4180 0.1185  0.0027  0.1160  26  THR B OG1 
3068 C CG2 . THR B 48  ? 0.7099 0.5655 0.3894 0.1005  0.0356  0.1260  26  THR B CG2 
3069 N N   . VAL B 49  ? 0.6004 0.4825 0.3295 0.0749  0.0463  0.0909  27  VAL B N   
3070 C CA  . VAL B 49  ? 0.5735 0.4544 0.3206 0.0597  0.0633  0.0862  27  VAL B CA  
3071 C C   . VAL B 49  ? 0.6326 0.5115 0.3531 0.0568  0.0790  0.0922  27  VAL B C   
3072 O O   . VAL B 49  ? 0.6592 0.5524 0.3570 0.0629  0.0731  0.0883  27  VAL B O   
3073 C CB  . VAL B 49  ? 0.5428 0.4456 0.3188 0.0519  0.0565  0.0648  27  VAL B CB  
3074 C CG1 . VAL B 49  ? 0.5460 0.4490 0.3393 0.0380  0.0725  0.0596  27  VAL B CG1 
3075 C CG2 . VAL B 49  ? 0.4185 0.3231 0.2224 0.0522  0.0441  0.0585  27  VAL B CG2 
3076 N N   . TRP B 50  ? 0.5829 0.4471 0.3119 0.0462  0.0984  0.0989  28  TRP B N   
3077 C CA  . TRP B 50  ? 0.6059 0.4740 0.3257 0.0388  0.1122  0.0987  28  TRP B CA  
3078 C C   . TRP B 50  ? 0.5860 0.4658 0.3289 0.0259  0.1225  0.0829  28  TRP B C   
3079 O O   . TRP B 50  ? 0.6240 0.5146 0.3611 0.0206  0.1302  0.0770  28  TRP B O   
3080 C CB  . TRP B 50  ? 0.6021 0.4491 0.3187 0.0359  0.1250  0.1149  28  TRP B CB  
3081 C CG  . TRP B 50  ? 0.7298 0.5664 0.4214 0.0485  0.1160  0.1305  28  TRP B CG  
3082 C CD1 . TRP B 50  ? 0.8077 0.6468 0.4682 0.0541  0.1151  0.1384  28  TRP B CD1 
3083 C CD2 . TRP B 50  ? 0.7825 0.6053 0.4797 0.0569  0.1060  0.1395  28  TRP B CD2 
3084 N NE1 . TRP B 50  ? 0.8573 0.6848 0.5034 0.0659  0.1049  0.1520  28  TRP B NE1 
3085 C CE2 . TRP B 50  ? 0.8571 0.6746 0.5265 0.0680  0.0991  0.1525  28  TRP B CE2 
3086 C CE3 . TRP B 50  ? 0.7780 0.5936 0.5025 0.0560  0.1021  0.1369  28  TRP B CE3 
3087 C CZ2 . TRP B 50  ? 0.8829 0.6881 0.5524 0.0783  0.0880  0.1626  28  TRP B CZ2 
3088 C CZ3 . TRP B 50  ? 0.8146 0.6184 0.5395 0.0659  0.0915  0.1464  28  TRP B CZ3 
3089 C CH2 . TRP B 50  ? 0.8537 0.6524 0.5519 0.0770  0.0844  0.1589  28  TRP B CH2 
3090 N N   . SER B 51  ? 0.5526 0.4338 0.3279 0.0201  0.1200  0.0739  29  SER B N   
3091 C CA  . SER B 51  ? 0.5291 0.4259 0.3329 0.0091  0.1237  0.0561  29  SER B CA  
3092 C C   . SER B 51  ? 0.4863 0.3921 0.3234 0.0072  0.1100  0.0445  29  SER B C   
3093 O O   . SER B 51  ? 0.4762 0.3722 0.3216 0.0102  0.1039  0.0505  29  SER B O   
3094 C CB  . SER B 51  ? 0.5844 0.4714 0.4005 -0.0025 0.1452  0.0578  29  SER B CB  
3095 O OG  . SER B 51  ? 0.5948 0.4969 0.4407 -0.0118 0.1472  0.0402  29  SER B OG  
3096 N N   . LEU B 52  ? 0.4371 0.3612 0.2932 0.0022  0.1057  0.0280  30  LEU B N   
3097 C CA  . LEU B 52  ? 0.3892 0.3230 0.2732 0.0009  0.0925  0.0173  30  LEU B CA  
3098 C C   . LEU B 52  ? 0.3648 0.3034 0.2802 -0.0096 0.0991  0.0072  30  LEU B C   
3099 O O   . LEU B 52  ? 0.3539 0.2983 0.2735 -0.0153 0.1091  0.0008  30  LEU B O   
3100 C CB  . LEU B 52  ? 0.3349 0.2863 0.2153 0.0063  0.0779  0.0067  30  LEU B CB  
3101 C CG  . LEU B 52  ? 0.3386 0.2915 0.1964 0.0177  0.0653  0.0112  30  LEU B CG  
3102 C CD1 . LEU B 52  ? 0.3389 0.2805 0.2015 0.0218  0.0580  0.0192  30  LEU B CD1 
3103 C CD2 . LEU B 52  ? 0.4028 0.3521 0.2257 0.0236  0.0716  0.0199  30  LEU B CD2 
3104 N N   . GLN B 53  ? 0.2555 0.1933 0.1936 -0.0116 0.0929  0.0047  31  GLN B N   
3105 C CA  . GLN B 53  ? 0.2330 0.1777 0.2010 -0.0198 0.0960  -0.0057 31  GLN B CA  
3106 C C   . GLN B 53  ? 0.2051 0.1648 0.1870 -0.0185 0.0813  -0.0164 31  GLN B C   
3107 O O   . GLN B 53  ? 0.1927 0.1527 0.1791 -0.0155 0.0704  -0.0157 31  GLN B O   
3108 C CB  . GLN B 53  ? 0.2477 0.1823 0.2323 -0.0233 0.1002  -0.0021 31  GLN B CB  
3109 C CG  . GLN B 53  ? 0.3547 0.2705 0.3273 -0.0239 0.1144  0.0107  31  GLN B CG  
3110 C CD  . GLN B 53  ? 0.5031 0.4089 0.4922 -0.0252 0.1150  0.0142  31  GLN B CD  
3111 O OE1 . GLN B 53  ? 0.5616 0.4697 0.5768 -0.0325 0.1214  0.0067  31  GLN B OE1 
3112 N NE2 . GLN B 53  ? 0.5280 0.4243 0.5038 -0.0178 0.1077  0.0241  31  GLN B NE2 
3113 N N   . THR B 54  ? 0.1969 0.1682 0.1862 -0.0209 0.0818  -0.0263 32  THR B N   
3114 C CA  . THR B 54  ? 0.1738 0.1572 0.1766 -0.0197 0.0691  -0.0353 32  THR B CA  
3115 C C   . THR B 54  ? 0.1549 0.1430 0.1847 -0.0248 0.0684  -0.0419 32  THR B C   
3116 O O   . THR B 54  ? 0.1586 0.1443 0.1994 -0.0299 0.0786  -0.0434 32  THR B O   
3117 C CB  . THR B 54  ? 0.1750 0.1690 0.1735 -0.0184 0.0681  -0.0432 32  THR B CB  
3118 O OG1 . THR B 54  ? 0.1560 0.1586 0.1657 -0.0162 0.0556  -0.0498 32  THR B OG1 
3119 C CG2 . THR B 54  ? 0.1765 0.1752 0.1880 -0.0243 0.0790  -0.0507 32  THR B CG2 
3120 N N   . THR B 55  ? 0.1365 0.1314 0.1767 -0.0232 0.0564  -0.0461 33  THR B N   
3121 C CA  . THR B 55  ? 0.1244 0.1254 0.1873 -0.0263 0.0533  -0.0520 33  THR B CA  
3122 C C   . THR B 55  ? 0.1095 0.1201 0.1816 -0.0248 0.0458  -0.0592 33  THR B C   
3123 O O   . THR B 55  ? 0.1060 0.1177 0.1712 -0.0212 0.0378  -0.0584 33  THR B O   
3124 C CB  . THR B 55  ? 0.1113 0.1103 0.1777 -0.0257 0.0461  -0.0486 33  THR B CB  
3125 O OG1 . THR B 55  ? 0.1220 0.1114 0.1838 -0.0271 0.0535  -0.0426 33  THR B OG1 
3126 C CG2 . THR B 55  ? 0.1419 0.1493 0.2288 -0.0278 0.0414  -0.0550 33  THR B CG2 
3127 N N   . LEU B 56  ? 0.1151 0.1322 0.2044 -0.0273 0.0488  -0.0668 34  LEU B N   
3128 C CA  . LEU B 56  ? 0.1014 0.1264 0.2026 -0.0254 0.0421  -0.0736 34  LEU B CA  
3129 C C   . LEU B 56  ? 0.1322 0.1623 0.2458 -0.0220 0.0339  -0.0722 34  LEU B C   
3130 O O   . LEU B 56  ? 0.1197 0.1494 0.2371 -0.0223 0.0361  -0.0720 34  LEU B O   
3131 C CB  . LEU B 56  ? 0.1031 0.1336 0.2123 -0.0276 0.0494  -0.0812 34  LEU B CB  
3132 C CG  . LEU B 56  ? 0.1635 0.1918 0.2561 -0.0285 0.0595  -0.0813 34  LEU B CG  
3133 C CD1 . LEU B 56  ? 0.1897 0.2159 0.2633 -0.0240 0.0543  -0.0773 34  LEU B CD1 
3134 C CD2 . LEU B 56  ? 0.2206 0.2418 0.3050 -0.0324 0.0722  -0.0768 34  LEU B CD2 
3135 N N   . VAL B 57  ? 0.0987 0.1315 0.2144 -0.0173 0.0248  -0.0707 35  VAL B N   
3136 C CA  . VAL B 57  ? 0.1072 0.1415 0.2290 -0.0129 0.0172  -0.0687 35  VAL B CA  
3137 C C   . VAL B 57  ? 0.0977 0.1355 0.2317 -0.0092 0.0139  -0.0733 35  VAL B C   
3138 O O   . VAL B 57  ? 0.0767 0.1146 0.2111 -0.0084 0.0129  -0.0738 35  VAL B O   
3139 C CB  . VAL B 57  ? 0.1685 0.1986 0.2804 -0.0115 0.0096  -0.0612 35  VAL B CB  
3140 C CG1 . VAL B 57  ? 0.2408 0.2722 0.3582 -0.0081 0.0019  -0.0598 35  VAL B CG1 
3141 C CG2 . VAL B 57  ? 0.1688 0.1960 0.2713 -0.0143 0.0120  -0.0576 35  VAL B CG2 
3142 N N   . LYS B 58  ? 0.1053 0.1457 0.2503 -0.0067 0.0121  -0.0777 36  LYS B N   
3143 C CA  . LYS B 58  ? 0.1095 0.1509 0.2656 -0.0032 0.0067  -0.0808 36  LYS B CA  
3144 C C   . LYS B 58  ? 0.1051 0.1444 0.2646 0.0009  -0.0035 -0.0782 36  LYS B C   
3145 O O   . LYS B 58  ? 0.1133 0.1551 0.2726 0.0008  -0.0052 -0.0791 36  LYS B O   
3146 C CB  . LYS B 58  ? 0.1166 0.1619 0.2808 -0.0050 0.0111  -0.0879 36  LYS B CB  
3147 C CG  . LYS B 58  ? 0.1186 0.1649 0.2952 -0.0019 0.0059  -0.0924 36  LYS B CG  
3148 C CD  . LYS B 58  ? 0.1503 0.2007 0.3357 -0.0038 0.0096  -0.1004 36  LYS B CD  
3149 C CE  . LYS B 58  ? 0.2379 0.2895 0.4364 -0.0017 0.0053  -0.1061 36  LYS B CE  
3150 N NZ  . LYS B 58  ? 0.2234 0.2798 0.4313 -0.0043 0.0093  -0.1150 36  LYS B NZ  
3151 N N   . ILE B 59  ? 0.0992 0.1345 0.2609 0.0033  -0.0103 -0.0743 37  ILE B N   
3152 C CA  . ILE B 59  ? 0.1190 0.1532 0.2843 0.0061  -0.0210 -0.0703 37  ILE B CA  
3153 C C   . ILE B 59  ? 0.0919 0.1256 0.2738 0.0098  -0.0264 -0.0758 37  ILE B C   
3154 O O   . ILE B 59  ? 0.0936 0.1231 0.2835 0.0101  -0.0250 -0.0787 37  ILE B O   
3155 C CB  . ILE B 59  ? 0.1167 0.1460 0.2759 0.0056  -0.0256 -0.0614 37  ILE B CB  
3156 C CG1 . ILE B 59  ? 0.1094 0.1382 0.2513 0.0013  -0.0210 -0.0568 37  ILE B CG1 
3157 C CG2 . ILE B 59  ? 0.2299 0.2604 0.3944 0.0094  -0.0369 -0.0558 37  ILE B CG2 
3158 C CD1 . ILE B 59  ? 0.1917 0.2148 0.3273 -0.0003 -0.0239 -0.0498 37  ILE B CD1 
3159 N N   . VAL B 60  ? 0.1094 0.1481 0.2966 0.0127  -0.0328 -0.0779 38  VAL B N   
3160 C CA  . VAL B 60  ? 0.1151 0.1542 0.3175 0.0168  -0.0395 -0.0823 38  VAL B CA  
3161 C C   . VAL B 60  ? 0.1348 0.1744 0.3375 0.0231  -0.0517 -0.0728 38  VAL B C   
3162 O O   . VAL B 60  ? 0.1309 0.1765 0.3249 0.0252  -0.0564 -0.0689 38  VAL B O   
3163 C CB  . VAL B 60  ? 0.1215 0.1670 0.3314 0.0170  -0.0375 -0.0935 38  VAL B CB  
3164 C CG1 . VAL B 60  ? 0.1437 0.1897 0.3705 0.0206  -0.0439 -0.0996 38  VAL B CG1 
3165 C CG2 . VAL B 60  ? 0.1499 0.1952 0.3569 0.0116  -0.0242 -0.1006 38  VAL B CG2 
3166 N N   . ALA B 61  ? 0.1225 0.1559 0.3345 0.0264  -0.0565 -0.0689 39  ALA B N   
3167 C CA  . ALA B 61  ? 0.1329 0.1636 0.3439 0.0343  -0.0673 -0.0577 39  ALA B CA  
3168 C C   . ALA B 61  ? 0.1445 0.1821 0.3624 0.0408  -0.0753 -0.0619 39  ALA B C   
3169 O O   . ALA B 61  ? 0.1815 0.2242 0.4095 0.0385  -0.0721 -0.0748 39  ALA B O   
3170 C CB  . ALA B 61  ? 0.1545 0.1734 0.3733 0.0357  -0.0676 -0.0513 39  ALA B CB  
3171 N N   . ASP B 62  ? 0.1879 0.2251 0.3997 0.0491  -0.0856 -0.0511 40  ASP B N   
3172 C CA  . ASP B 62  ? 0.2169 0.2604 0.4348 0.0572  -0.0949 -0.0537 40  ASP B CA  
3173 C C   . ASP B 62  ? 0.2258 0.2651 0.4637 0.0581  -0.0947 -0.0614 40  ASP B C   
3174 O O   . ASP B 62  ? 0.2458 0.2927 0.4947 0.0607  -0.0982 -0.0718 40  ASP B O   
3175 C CB  . ASP B 62  ? 0.3286 0.3688 0.5343 0.0672  -0.1057 -0.0375 40  ASP B CB  
3176 C CG  . ASP B 62  ? 0.4717 0.5210 0.6581 0.0676  -0.1086 -0.0325 40  ASP B CG  
3177 O OD1 . ASP B 62  ? 0.5255 0.5867 0.7116 0.0623  -0.1046 -0.0440 40  ASP B OD1 
3178 O OD2 . ASP B 62  ? 0.5482 0.5917 0.7191 0.0729  -0.1143 -0.0170 40  ASP B OD2 
3179 N N   . SER B 63  ? 0.2052 0.2330 0.4489 0.0555  -0.0905 -0.0571 41  SER B N   
3180 C CA  . SER B 63  ? 0.2373 0.2614 0.5008 0.0555  -0.0901 -0.0641 41  SER B CA  
3181 C C   . SER B 63  ? 0.2446 0.2761 0.5193 0.0472  -0.0821 -0.0823 41  SER B C   
3182 O O   . SER B 63  ? 0.2512 0.2837 0.5435 0.0470  -0.0827 -0.0918 41  SER B O   
3183 C CB  . SER B 63  ? 0.2401 0.2514 0.5071 0.0535  -0.0860 -0.0561 41  SER B CB  
3184 O OG  . SER B 63  ? 0.2370 0.2483 0.4995 0.0439  -0.0756 -0.0602 41  SER B OG  
3185 N N   . GLY B 64  ? 0.1714 0.2073 0.4353 0.0405  -0.0743 -0.0866 42  GLY B N   
3186 C CA  . GLY B 64  ? 0.1664 0.2064 0.4363 0.0325  -0.0647 -0.1016 42  GLY B CA  
3187 C C   . GLY B 64  ? 0.1791 0.2143 0.4457 0.0246  -0.0546 -0.1023 42  GLY B C   
3188 O O   . GLY B 64  ? 0.1688 0.2068 0.4332 0.0183  -0.0449 -0.1113 42  GLY B O   
3189 N N   . LEU B 65  ? 0.1800 0.2084 0.4450 0.0256  -0.0561 -0.0920 43  LEU B N   
3190 C CA  . LEU B 65  ? 0.1561 0.1820 0.4185 0.0186  -0.0476 -0.0928 43  LEU B CA  
3191 C C   . LEU B 65  ? 0.1557 0.1821 0.3992 0.0149  -0.0409 -0.0910 43  LEU B C   
3192 O O   . LEU B 65  ? 0.1462 0.1725 0.3787 0.0182  -0.0444 -0.0834 43  LEU B O   
3193 C CB  . LEU B 65  ? 0.1329 0.1513 0.3986 0.0211  -0.0506 -0.0820 43  LEU B CB  
3194 C CG  . LEU B 65  ? 0.1552 0.1743 0.4247 0.0148  -0.0432 -0.0844 43  LEU B CG  
3195 C CD1 . LEU B 65  ? 0.1920 0.2184 0.4742 0.0123  -0.0388 -0.0953 43  LEU B CD1 
3196 C CD2 . LEU B 65  ? 0.2160 0.2256 0.4872 0.0182  -0.0454 -0.0728 43  LEU B CD2 
3197 N N   . ALA B 66  ? 0.1209 0.1521 0.3535 0.0106  -0.0293 -0.0927 44  ALA B N   
3198 C CA  . ALA B 66  ? 0.1045 0.1368 0.3178 0.0085  -0.0219 -0.0896 44  ALA B CA  
3199 C C   . ALA B 66  ? 0.1000 0.1306 0.3029 0.0063  -0.0164 -0.0853 44  ALA B C   
3200 O O   . ALA B 66  ? 0.1250 0.1609 0.3363 0.0042  -0.0151 -0.0870 44  ALA B O   
3201 C CB  . ALA B 66  ? 0.1351 0.1741 0.3443 0.0061  -0.0137 -0.0962 44  ALA B CB  
3202 N N   . GLY B 67  ? 0.0928 0.1237 0.2831 0.0069  -0.0139 -0.0798 45  GLY B N   
3203 C CA  . GLY B 67  ? 0.1131 0.1461 0.2951 0.0048  -0.0090 -0.0771 45  GLY B CA  
3204 C C   . GLY B 67  ? 0.0998 0.1361 0.2677 0.0017  -0.0024 -0.0776 45  GLY B C   
3205 O O   . GLY B 67  ? 0.0841 0.1201 0.2487 0.0017  -0.0026 -0.0770 45  GLY B O   
3206 N N   . TRP B 68  ? 0.0931 0.1329 0.2540 -0.0012 0.0032  -0.0794 46  TRP B N   
3207 C CA  . TRP B 68  ? 0.0794 0.1220 0.2289 -0.0049 0.0096  -0.0802 46  TRP B CA  
3208 C C   . TRP B 68  ? 0.0776 0.1163 0.2126 -0.0062 0.0089  -0.0756 46  TRP B C   
3209 O O   . TRP B 68  ? 0.0780 0.1162 0.2130 -0.0052 0.0069  -0.0757 46  TRP B O   
3210 C CB  . TRP B 68  ? 0.1041 0.1535 0.2548 -0.0093 0.0165  -0.0874 46  TRP B CB  
3211 C CG  . TRP B 68  ? 0.0885 0.1406 0.2481 -0.0102 0.0187  -0.0915 46  TRP B CG  
3212 C CD1 . TRP B 68  ? 0.0991 0.1539 0.2719 -0.0084 0.0161  -0.0955 46  TRP B CD1 
3213 C CD2 . TRP B 68  ? 0.1028 0.1553 0.2603 -0.0134 0.0240  -0.0925 46  TRP B CD2 
3214 N NE1 . TRP B 68  ? 0.1209 0.1789 0.2999 -0.0102 0.0190  -0.0995 46  TRP B NE1 
3215 C CE2 . TRP B 68  ? 0.1189 0.1753 0.2887 -0.0133 0.0242  -0.0977 46  TRP B CE2 
3216 C CE3 . TRP B 68  ? 0.1120 0.1616 0.2597 -0.0167 0.0289  -0.0899 46  TRP B CE3 
3217 C CZ2 . TRP B 68  ? 0.1384 0.1950 0.3103 -0.0182 0.0281  -0.1008 46  TRP B CZ2 
3218 C CZ3 . TRP B 68  ? 0.1405 0.1900 0.2906 -0.0198 0.0345  -0.0922 46  TRP B CZ3 
3219 C CH2 . TRP B 68  ? 0.1387 0.1865 0.2971 -0.0203 0.0335  -0.0993 46  TRP B CH2 
3220 N N   . GLY B 69  ? 0.0772 0.1125 0.1999 -0.0086 0.0105  -0.0718 47  GLY B N   
3221 C CA  . GLY B 69  ? 0.0778 0.1087 0.1851 -0.0102 0.0099  -0.0681 47  GLY B CA  
3222 C C   . GLY B 69  ? 0.0853 0.1148 0.1824 -0.0140 0.0163  -0.0701 47  GLY B C   
3223 O O   . GLY B 69  ? 0.1050 0.1361 0.2071 -0.0164 0.0221  -0.0731 47  GLY B O   
3224 N N   . GLU B 70  ? 0.0867 0.1119 0.1691 -0.0140 0.0159  -0.0691 48  GLU B N   
3225 C CA  . GLU B 70  ? 0.0968 0.1184 0.1641 -0.0149 0.0227  -0.0675 48  GLU B CA  
3226 C C   . GLU B 70  ? 0.0985 0.1154 0.1518 -0.0128 0.0187  -0.0614 48  GLU B C   
3227 O O   . GLU B 70  ? 0.0949 0.1133 0.1477 -0.0107 0.0125  -0.0630 48  GLU B O   
3228 C CB  . GLU B 70  ? 0.1076 0.1337 0.1677 -0.0139 0.0283  -0.0731 48  GLU B CB  
3229 C CG  . GLU B 70  ? 0.1235 0.1452 0.1627 -0.0135 0.0357  -0.0677 48  GLU B CG  
3230 C CD  . GLU B 70  ? 0.1369 0.1642 0.1680 -0.0134 0.0431  -0.0733 48  GLU B CD  
3231 O OE1 . GLU B 70  ? 0.1335 0.1694 0.1735 -0.0127 0.0409  -0.0829 48  GLU B OE1 
3232 O OE2 . GLU B 70  ? 0.1563 0.1790 0.1718 -0.0142 0.0520  -0.0683 48  GLU B OE2 
3233 N N   . THR B 71  ? 0.1048 0.1159 0.1490 -0.0135 0.0229  -0.0552 49  THR B N   
3234 C CA  . THR B 71  ? 0.1093 0.1157 0.1403 -0.0105 0.0195  -0.0499 49  THR B CA  
3235 C C   . THR B 71  ? 0.1255 0.1246 0.1422 -0.0098 0.0271  -0.0435 49  THR B C   
3236 O O   . THR B 71  ? 0.1279 0.1233 0.1501 -0.0135 0.0347  -0.0414 49  THR B O   
3237 C CB  . THR B 71  ? 0.0978 0.1029 0.1370 -0.0120 0.0138  -0.0477 49  THR B CB  
3238 O OG1 . THR B 71  ? 0.1138 0.1155 0.1427 -0.0088 0.0099  -0.0445 49  THR B OG1 
3239 C CG2 . THR B 71  ? 0.1280 0.1309 0.1764 -0.0158 0.0182  -0.0457 49  THR B CG2 
3240 N N   . CYS B 72  ? 0.1384 0.1357 0.1372 -0.0046 0.0254  -0.0406 50  CYS B N   
3241 C CA  . CYS B 72  ? 0.1594 0.1483 0.1406 -0.0026 0.0329  -0.0326 50  CYS B CA  
3242 C C   . CYS B 72  ? 0.1703 0.1545 0.1358 0.0043  0.0267  -0.0268 50  CYS B C   
3243 O O   . CYS B 72  ? 0.1801 0.1693 0.1314 0.0101  0.0222  -0.0288 50  CYS B O   
3244 C CB  . CYS B 72  ? 0.1729 0.1662 0.1432 -0.0022 0.0396  -0.0356 50  CYS B CB  
3245 S SG  . CYS B 72  ? 0.2039 0.1854 0.1503 -0.0010 0.0524  -0.0243 50  CYS B SG  
3246 N N   . PRO B 73  ? 0.1693 0.1451 0.1388 0.0042  0.0259  -0.0208 51  PRO B N   
3247 C CA  . PRO B 73  ? 0.1813 0.1517 0.1379 0.0115  0.0198  -0.0151 51  PRO B CA  
3248 C C   . PRO B 73  ? 0.2179 0.1814 0.1496 0.0173  0.0247  -0.0066 51  PRO B C   
3249 O O   . PRO B 73  ? 0.2291 0.1867 0.1559 0.0136  0.0364  -0.0020 51  PRO B O   
3250 C CB  . PRO B 73  ? 0.1761 0.1379 0.1454 0.0085  0.0215  -0.0107 51  PRO B CB  
3251 C CG  . PRO B 73  ? 0.1535 0.1225 0.1441 0.0007  0.0225  -0.0182 51  PRO B CG  
3252 C CD  . PRO B 73  ? 0.1646 0.1382 0.1537 -0.0022 0.0287  -0.0214 51  PRO B CD  
3253 N N   . VAL B 74  ? 0.2226 0.1875 0.1384 0.0264  0.0161  -0.0049 52  VAL B N   
3254 C CA  . VAL B 74  ? 0.2636 0.2231 0.1516 0.0336  0.0192  0.0037  52  VAL B CA  
3255 C C   . VAL B 74  ? 0.3056 0.2471 0.1853 0.0377  0.0221  0.0182  52  VAL B C   
3256 O O   . VAL B 74  ? 0.3337 0.2721 0.2009 0.0475  0.0133  0.0230  52  VAL B O   
3257 C CB  . VAL B 74  ? 0.2772 0.2507 0.1507 0.0424  0.0080  -0.0037 52  VAL B CB  
3258 C CG1 . VAL B 74  ? 0.2525 0.2299 0.1329 0.0488  -0.0059 -0.0078 52  VAL B CG1 
3259 C CG2 . VAL B 74  ? 0.3089 0.2790 0.1503 0.0498  0.0118  0.0049  52  VAL B CG2 
3260 N N   . GLY B 75  ? 0.2775 0.2073 0.1667 0.0302  0.0345  0.0242  53  GLY B N   
3261 C CA  . GLY B 75  ? 0.2997 0.2117 0.1897 0.0321  0.0385  0.0360  53  GLY B CA  
3262 C C   . GLY B 75  ? 0.3359 0.2508 0.2522 0.0293  0.0312  0.0293  53  GLY B C   
3263 O O   . GLY B 75  ? 0.3404 0.2698 0.2677 0.0283  0.0215  0.0177  53  GLY B O   
3264 N N   . PRO B 76  ? 0.2686 0.1695 0.1958 0.0276  0.0367  0.0361  54  PRO B N   
3265 C CA  . PRO B 76  ? 0.2452 0.1502 0.1983 0.0241  0.0311  0.0284  54  PRO B CA  
3266 C C   . PRO B 76  ? 0.2470 0.1527 0.1993 0.0330  0.0177  0.0280  54  PRO B C   
3267 O O   . PRO B 76  ? 0.2282 0.1388 0.2015 0.0300  0.0131  0.0204  54  PRO B O   
3268 C CB  . PRO B 76  ? 0.2527 0.1430 0.2197 0.0184  0.0440  0.0344  54  PRO B CB  
3269 C CG  . PRO B 76  ? 0.2887 0.1613 0.2322 0.0237  0.0528  0.0501  54  PRO B CG  
3270 C CD  . PRO B 76  ? 0.2952 0.1769 0.2149 0.0264  0.0513  0.0495  54  PRO B CD  
3271 N N   . THR B 77  ? 0.2698 0.1721 0.1988 0.0440  0.0114  0.0349  55  THR B N   
3272 C CA  . THR B 77  ? 0.2739 0.1768 0.2039 0.0536  -0.0017 0.0339  55  THR B CA  
3273 C C   . THR B 77  ? 0.2638 0.1850 0.1886 0.0589  -0.0154 0.0226  55  THR B C   
3274 O O   . THR B 77  ? 0.2637 0.1888 0.1933 0.0662  -0.0269 0.0183  55  THR B O   
3275 C CB  . THR B 77  ? 0.3338 0.2182 0.2446 0.0650  -0.0017 0.0502  55  THR B CB  
3276 O OG1 . THR B 77  ? 0.3355 0.2178 0.2156 0.0701  0.0014  0.0586  55  THR B OG1 
3277 C CG2 . THR B 77  ? 0.3294 0.1940 0.2529 0.0603  0.0108  0.0601  55  THR B CG2 
3278 N N   . TYR B 78  ? 0.2563 0.1889 0.1735 0.0555  -0.0139 0.0166  56  TYR B N   
3279 C CA  . TYR B 78  ? 0.2483 0.1984 0.1625 0.0602  -0.0256 0.0047  56  TYR B CA  
3280 C C   . TYR B 78  ? 0.2317 0.1934 0.1719 0.0543  -0.0314 -0.0092 56  TYR B C   
3281 O O   . TYR B 78  ? 0.2342 0.2058 0.1786 0.0600  -0.0425 -0.0181 56  TYR B O   
3282 C CB  . TYR B 78  ? 0.2481 0.2072 0.1507 0.0572  -0.0211 0.0009  56  TYR B CB  
3283 C CG  . TYR B 78  ? 0.2391 0.2170 0.1425 0.0608  -0.0316 -0.0134 56  TYR B CG  
3284 C CD1 . TYR B 78  ? 0.2886 0.2728 0.1717 0.0726  -0.0401 -0.0141 56  TYR B CD1 
3285 C CD2 . TYR B 78  ? 0.3047 0.2941 0.2294 0.0526  -0.0326 -0.0263 56  TYR B CD2 
3286 C CE1 . TYR B 78  ? 0.3099 0.3130 0.1970 0.0756  -0.0493 -0.0295 56  TYR B CE1 
3287 C CE2 . TYR B 78  ? 0.2891 0.2946 0.2176 0.0551  -0.0406 -0.0400 56  TYR B CE2 
3288 C CZ  . TYR B 78  ? 0.3062 0.3192 0.2174 0.0663  -0.0488 -0.0426 56  TYR B CZ  
3289 O OH  . TYR B 78  ? 0.2606 0.2913 0.1786 0.0687  -0.0564 -0.0586 56  TYR B OH  
3290 N N   . ALA B 79  ? 0.1989 0.1599 0.1559 0.0431  -0.0237 -0.0114 57  ALA B N   
3291 C CA  . ALA B 79  ? 0.1932 0.1647 0.1719 0.0362  -0.0269 -0.0230 57  ALA B CA  
3292 C C   . ALA B 79  ? 0.1988 0.1637 0.1930 0.0279  -0.0193 -0.0203 57  ALA B C   
3293 O O   . ALA B 79  ? 0.1733 0.1272 0.1632 0.0264  -0.0107 -0.0113 57  ALA B O   
3294 C CB  . ALA B 79  ? 0.1785 0.1614 0.1588 0.0313  -0.0263 -0.0310 57  ALA B CB  
3295 N N   . PRO B 80  ? 0.1796 0.1520 0.1921 0.0223  -0.0218 -0.0289 58  PRO B N   
3296 C CA  . PRO B 80  ? 0.1652 0.1346 0.1930 0.0147  -0.0154 -0.0286 58  PRO B CA  
3297 C C   . PRO B 80  ? 0.1529 0.1250 0.1829 0.0070  -0.0082 -0.0286 58  PRO B C   
3298 O O   . PRO B 80  ? 0.1476 0.1283 0.1885 0.0005  -0.0084 -0.0351 58  PRO B O   
3299 C CB  . PRO B 80  ? 0.1595 0.1389 0.2027 0.0116  -0.0210 -0.0389 58  PRO B CB  
3300 C CG  . PRO B 80  ? 0.2177 0.2067 0.2558 0.0135  -0.0271 -0.0454 58  PRO B CG  
3301 C CD  . PRO B 80  ? 0.2016 0.1858 0.2221 0.0229  -0.0302 -0.0399 58  PRO B CD  
3302 N N   . SER B 81  ? 0.1372 0.1017 0.1562 0.0080  -0.0016 -0.0213 59  SER B N   
3303 C CA  . SER B 81  ? 0.1307 0.0983 0.1514 0.0021  0.0047  -0.0221 59  SER B CA  
3304 C C   . SER B 81  ? 0.1487 0.1050 0.1601 0.0030  0.0142  -0.0134 59  SER B C   
3305 O O   . SER B 81  ? 0.1796 0.1273 0.1753 0.0098  0.0142  -0.0060 59  SER B O   
3306 C CB  . SER B 81  ? 0.2020 0.1786 0.2161 0.0031  0.0002  -0.0270 59  SER B CB  
3307 O OG  . SER B 81  ? 0.2599 0.2346 0.2569 0.0106  -0.0025 -0.0241 59  SER B OG  
3308 N N   . HIS B 82  ? 0.1440 0.1003 0.1650 -0.0036 0.0226  -0.0144 60  HIS B N   
3309 C CA  . HIS B 82  ? 0.1612 0.1071 0.1759 -0.0045 0.0340  -0.0074 60  HIS B CA  
3310 C C   . HIS B 82  ? 0.1514 0.1038 0.1777 -0.0117 0.0407  -0.0130 60  HIS B C   
3311 O O   . HIS B 82  ? 0.1326 0.0957 0.1728 -0.0153 0.0361  -0.0210 60  HIS B O   
3312 C CB  . HIS B 82  ? 0.1749 0.1070 0.1943 -0.0039 0.0400  -0.0004 60  HIS B CB  
3313 C CG  . HIS B 82  ? 0.1844 0.1195 0.2287 -0.0104 0.0426  -0.0069 60  HIS B CG  
3314 N ND1 . HIS B 82  ? 0.2347 0.1814 0.2918 -0.0121 0.0339  -0.0156 60  HIS B ND1 
3315 C CD2 . HIS B 82  ? 0.1659 0.0945 0.2249 -0.0156 0.0535  -0.0067 60  HIS B CD2 
3316 C CE1 . HIS B 82  ? 0.1347 0.0833 0.2120 -0.0176 0.0385  -0.0209 60  HIS B CE1 
3317 N NE2 . HIS B 82  ? 0.1873 0.1252 0.2677 -0.0198 0.0503  -0.0163 60  HIS B NE2 
3318 N N   . ALA B 83  ? 0.1659 0.1121 0.1856 -0.0132 0.0513  -0.0091 61  ALA B N   
3319 C CA  . ALA B 83  ? 0.1575 0.1113 0.1889 -0.0193 0.0572  -0.0160 61  ALA B CA  
3320 C C   . ALA B 83  ? 0.1466 0.1052 0.2028 -0.0253 0.0594  -0.0230 61  ALA B C   
3321 O O   . ALA B 83  ? 0.1278 0.0986 0.1963 -0.0279 0.0553  -0.0315 61  ALA B O   
3322 C CB  . ALA B 83  ? 0.1892 0.1355 0.2102 -0.0206 0.0702  -0.0113 61  ALA B CB  
3323 N N   . LEU B 84  ? 0.1511 0.1007 0.2154 -0.0269 0.0654  -0.0199 62  LEU B N   
3324 C CA  . LEU B 84  ? 0.1430 0.0999 0.2313 -0.0317 0.0668  -0.0284 62  LEU B CA  
3325 C C   . LEU B 84  ? 0.1272 0.0984 0.2195 -0.0293 0.0528  -0.0342 62  LEU B C   
3326 O O   . LEU B 84  ? 0.1099 0.0957 0.2105 -0.0282 0.0482  -0.0410 62  LEU B O   
3327 C CB  . LEU B 84  ? 0.1522 0.0994 0.2464 -0.0311 0.0740  -0.0241 62  LEU B CB  
3328 C CG  . LEU B 84  ? 0.1739 0.1086 0.2647 -0.0329 0.0889  -0.0186 62  LEU B CG  
3329 C CD1 . LEU B 84  ? 0.1891 0.1127 0.2859 -0.0316 0.0952  -0.0134 62  LEU B CD1 
3330 C CD2 . LEU B 84  ? 0.2616 0.2080 0.3636 -0.0353 0.0924  -0.0289 62  LEU B CD2 
3331 N N   . GLY B 85  ? 0.1195 0.0859 0.2022 -0.0266 0.0459  -0.0307 63  GLY B N   
3332 C CA  . GLY B 85  ? 0.1037 0.0824 0.1887 -0.0253 0.0345  -0.0355 63  GLY B CA  
3333 C C   . GLY B 85  ? 0.1341 0.1239 0.2152 -0.0247 0.0284  -0.0387 63  GLY B C   
3334 O O   . GLY B 85  ? 0.1022 0.1035 0.1846 -0.0228 0.0221  -0.0410 63  GLY B O   
3335 N N   . ALA B 86  ? 0.0987 0.0843 0.1707 -0.0242 0.0302  -0.0369 64  ALA B N   
3336 C CA  . ALA B 86  ? 0.0899 0.0842 0.1621 -0.0242 0.0254  -0.0408 64  ALA B CA  
3337 C C   . ALA B 86  ? 0.0844 0.0881 0.1670 -0.0243 0.0266  -0.0441 64  ALA B C   
3338 O O   . ALA B 86  ? 0.0915 0.1032 0.1741 -0.0217 0.0199  -0.0451 64  ALA B O   
3339 C CB  . ALA B 86  ? 0.1418 0.1326 0.2013 -0.0215 0.0281  -0.0382 64  ALA B CB  
3340 N N   . ARG B 87  ? 0.0928 0.0933 0.1823 -0.0265 0.0357  -0.0453 65  ARG B N   
3341 C CA  . ARG B 87  ? 0.1018 0.1105 0.2010 -0.0253 0.0365  -0.0506 65  ARG B CA  
3342 C C   . ARG B 87  ? 0.0897 0.1050 0.1928 -0.0228 0.0312  -0.0528 65  ARG B C   
3343 O O   . ARG B 87  ? 0.1175 0.1403 0.2238 -0.0207 0.0267  -0.0567 65  ARG B O   
3344 C CB  . ARG B 87  ? 0.1253 0.1284 0.2311 -0.0283 0.0484  -0.0529 65  ARG B CB  
3345 C CG  . ARG B 87  ? 0.1553 0.1527 0.2549 -0.0313 0.0544  -0.0513 65  ARG B CG  
3346 C CD  . ARG B 87  ? 0.3202 0.3150 0.4257 -0.0338 0.0652  -0.0552 65  ARG B CD  
3347 N NE  . ARG B 87  ? 0.3847 0.3659 0.4856 -0.0368 0.0775  -0.0492 65  ARG B NE  
3348 C CZ  . ARG B 87  ? 0.3800 0.3511 0.4667 -0.0391 0.0863  -0.0411 65  ARG B CZ  
3349 N NH1 . ARG B 87  ? 0.2914 0.2483 0.3711 -0.0401 0.0976  -0.0333 65  ARG B NH1 
3350 N NH2 . ARG B 87  ? 0.2796 0.2545 0.3525 -0.0360 0.0807  -0.0398 65  ARG B NH2 
3351 N N   . ALA B 88  ? 0.0846 0.0966 0.1874 -0.0232 0.0319  -0.0508 66  ALA B N   
3352 C CA  . ALA B 88  ? 0.0804 0.0988 0.1854 -0.0212 0.0274  -0.0536 66  ALA B CA  
3353 C C   . ALA B 88  ? 0.0985 0.1223 0.1940 -0.0193 0.0182  -0.0516 66  ALA B C   
3354 O O   . ALA B 88  ? 0.0862 0.1168 0.1827 -0.0180 0.0146  -0.0547 66  ALA B O   
3355 C CB  . ALA B 88  ? 0.0902 0.1038 0.1977 -0.0219 0.0300  -0.0520 66  ALA B CB  
3356 N N   . ALA B 89  ? 0.0716 0.0916 0.1582 -0.0193 0.0150  -0.0467 67  ALA B N   
3357 C CA  . ALA B 89  ? 0.0674 0.0904 0.1453 -0.0180 0.0080  -0.0441 67  ALA B CA  
3358 C C   . ALA B 89  ? 0.0800 0.1070 0.1589 -0.0171 0.0052  -0.0451 67  ALA B C   
3359 O O   . ALA B 89  ? 0.0809 0.1122 0.1571 -0.0165 0.0005  -0.0447 67  ALA B O   
3360 C CB  . ALA B 89  ? 0.0757 0.0936 0.1461 -0.0181 0.0061  -0.0405 67  ALA B CB  
3361 N N   . LEU B 90  ? 0.0875 0.1130 0.1712 -0.0173 0.0083  -0.0467 68  LEU B N   
3362 C CA  . LEU B 90  ? 0.0810 0.1103 0.1686 -0.0158 0.0055  -0.0486 68  LEU B CA  
3363 C C   . LEU B 90  ? 0.0998 0.1360 0.1949 -0.0148 0.0045  -0.0536 68  LEU B C   
3364 O O   . LEU B 90  ? 0.1013 0.1423 0.1972 -0.0133 -0.0014 -0.0542 68  LEU B O   
3365 C CB  . LEU B 90  ? 0.0831 0.1103 0.1755 -0.0163 0.0098  -0.0505 68  LEU B CB  
3366 C CG  . LEU B 90  ? 0.0907 0.1132 0.1757 -0.0167 0.0090  -0.0472 68  LEU B CG  
3367 C CD1 . LEU B 90  ? 0.1087 0.1289 0.1971 -0.0187 0.0157  -0.0502 68  LEU B CD1 
3368 C CD2 . LEU B 90  ? 0.0851 0.1085 0.1676 -0.0146 0.0024  -0.0452 68  LEU B CD2 
3369 N N   . ALA B 91  ? 0.0735 0.1101 0.1750 -0.0157 0.0100  -0.0579 69  ALA B N   
3370 C CA  . ALA B 91  ? 0.0997 0.1435 0.2096 -0.0146 0.0095  -0.0648 69  ALA B CA  
3371 C C   . ALA B 91  ? 0.1030 0.1524 0.2070 -0.0140 0.0033  -0.0639 69  ALA B C   
3372 O O   . ALA B 91  ? 0.1309 0.1886 0.2385 -0.0124 -0.0011 -0.0683 69  ALA B O   
3373 C CB  . ALA B 91  ? 0.1363 0.1780 0.2554 -0.0160 0.0178  -0.0701 69  ALA B CB  
3374 N N   . GLU B 92  ? 0.0823 0.1280 0.1777 -0.0152 0.0031  -0.0589 70  GLU B N   
3375 C CA  . GLU B 92  ? 0.0778 0.1287 0.1671 -0.0155 -0.0014 -0.0580 70  GLU B CA  
3376 C C   . GLU B 92  ? 0.1025 0.1570 0.1860 -0.0152 -0.0085 -0.0544 70  GLU B C   
3377 O O   . GLU B 92  ? 0.1279 0.1911 0.2105 -0.0149 -0.0132 -0.0564 70  GLU B O   
3378 C CB  . GLU B 92  ? 0.1350 0.1804 0.2177 -0.0168 0.0004  -0.0540 70  GLU B CB  
3379 C CG  . GLU B 92  ? 0.1613 0.2118 0.2379 -0.0177 -0.0028 -0.0536 70  GLU B CG  
3380 C CD  . GLU B 92  ? 0.2718 0.3295 0.3550 -0.0174 -0.0008 -0.0610 70  GLU B CD  
3381 O OE1 . GLU B 92  ? 0.3033 0.3579 0.3944 -0.0170 0.0046  -0.0648 70  GLU B OE1 
3382 O OE2 . GLU B 92  ? 0.2372 0.3044 0.3190 -0.0175 -0.0044 -0.0640 70  GLU B OE2 
3383 N N   . MET B 93  ? 0.0701 0.1183 0.1503 -0.0153 -0.0095 -0.0495 71  MET B N   
3384 C CA  . MET B 93  ? 0.0717 0.1218 0.1480 -0.0152 -0.0159 -0.0458 71  MET B CA  
3385 C C   . MET B 93  ? 0.1289 0.1845 0.2132 -0.0124 -0.0207 -0.0485 71  MET B C   
3386 O O   . MET B 93  ? 0.0948 0.1565 0.1780 -0.0112 -0.0282 -0.0468 71  MET B O   
3387 C CB  . MET B 93  ? 0.0692 0.1104 0.1404 -0.0162 -0.0148 -0.0408 71  MET B CB  
3388 C CG  . MET B 93  ? 0.0677 0.1043 0.1307 -0.0181 -0.0122 -0.0381 71  MET B CG  
3389 S SD  . MET B 93  ? 0.0835 0.1118 0.1416 -0.0184 -0.0118 -0.0341 71  MET B SD  
3390 C CE  . MET B 93  ? 0.1124 0.1368 0.1755 -0.0164 -0.0077 -0.0360 71  MET B CE  
3391 N N   . ALA B 94  ? 0.1040 0.1579 0.1970 -0.0108 -0.0169 -0.0527 72  ALA B N   
3392 C CA  . ALA B 94  ? 0.0954 0.1529 0.1976 -0.0075 -0.0212 -0.0557 72  ALA B CA  
3393 C C   . ALA B 94  ? 0.0980 0.1669 0.2032 -0.0043 -0.0296 -0.0584 72  ALA B C   
3394 O O   . ALA B 94  ? 0.1132 0.1844 0.2208 -0.0009 -0.0373 -0.0558 72  ALA B O   
3395 C CB  . ALA B 94  ? 0.0903 0.1455 0.2022 -0.0071 -0.0144 -0.0617 72  ALA B CB  
3396 N N   . PRO B 95  ? 0.0943 0.1708 0.2001 -0.0044 -0.0287 -0.0636 73  PRO B N   
3397 C CA  . PRO B 95  ? 0.1042 0.1934 0.2117 -0.0003 -0.0374 -0.0667 73  PRO B CA  
3398 C C   . PRO B 95  ? 0.0991 0.1920 0.1958 0.0009  -0.0465 -0.0585 73  PRO B C   
3399 O O   . PRO B 95  ? 0.1577 0.2580 0.2549 0.0065  -0.0561 -0.0573 73  PRO B O   
3400 C CB  . PRO B 95  ? 0.1256 0.2213 0.2337 -0.0017 -0.0335 -0.0736 73  PRO B CB  
3401 C CG  . PRO B 95  ? 0.1228 0.2088 0.2358 -0.0049 -0.0225 -0.0762 73  PRO B CG  
3402 C CD  . PRO B 95  ? 0.0855 0.1601 0.1914 -0.0072 -0.0206 -0.0672 73  PRO B CD  
3403 N N   . GLY B 96  ? 0.0951 0.1827 0.1822 -0.0036 -0.0438 -0.0530 74  GLY B N   
3404 C CA  . GLY B 96  ? 0.1140 0.2050 0.1903 -0.0032 -0.0513 -0.0461 74  GLY B CA  
3405 C C   . GLY B 96  ? 0.1199 0.2037 0.1984 -0.0005 -0.0565 -0.0394 74  GLY B C   
3406 O O   . GLY B 96  ? 0.1360 0.2171 0.2028 0.0010  -0.0613 -0.0308 74  GLY B O   
3407 N N   . LEU B 97  ? 0.1067 0.1825 0.1964 0.0002  -0.0526 -0.0413 75  LEU B N   
3408 C CA  . LEU B 97  ? 0.0976 0.1641 0.1932 0.0027  -0.0561 -0.0358 75  LEU B CA  
3409 C C   . LEU B 97  ? 0.1356 0.2045 0.2416 0.0108  -0.0637 -0.0360 75  LEU B C   
3410 O O   . LEU B 97  ? 0.1245 0.1824 0.2314 0.0144  -0.0657 -0.0284 75  LEU B O   
3411 C CB  . LEU B 97  ? 0.0874 0.1429 0.1872 -0.0021 -0.0460 -0.0379 75  LEU B CB  
3412 C CG  . LEU B 97  ? 0.0878 0.1376 0.1772 -0.0084 -0.0390 -0.0362 75  LEU B CG  
3413 C CD1 . LEU B 97  ? 0.1236 0.1638 0.2137 -0.0101 -0.0301 -0.0377 75  LEU B CD1 
3414 C CD2 . LEU B 97  ? 0.1014 0.1443 0.1802 -0.0092 -0.0408 -0.0273 75  LEU B CD2 
3415 N N   . ILE B 98  ? 0.1146 0.1671 0.1821 0.0157  -0.0538 -0.0534 76  ILE B N   
3416 C CA  . ILE B 98  ? 0.1141 0.1701 0.1865 0.0175  -0.0563 -0.0539 76  ILE B CA  
3417 C C   . ILE B 98  ? 0.1097 0.1645 0.1728 0.0216  -0.0598 -0.0527 76  ILE B C   
3418 O O   . ILE B 98  ? 0.1700 0.2229 0.2255 0.0230  -0.0621 -0.0536 76  ILE B O   
3419 C CB  . ILE B 98  ? 0.1301 0.1889 0.2106 0.0164  -0.0586 -0.0573 76  ILE B CB  
3420 C CG1 . ILE B 98  ? 0.1034 0.1629 0.1928 0.0123  -0.0549 -0.0578 76  ILE B CG1 
3421 C CG2 . ILE B 98  ? 0.1687 0.2315 0.2543 0.0184  -0.0613 -0.0578 76  ILE B CG2 
3422 C CD1 . ILE B 98  ? 0.1506 0.2117 0.2455 0.0108  -0.0506 -0.0554 76  ILE B CD1 
3423 N N   . GLY B 99  ? 0.1343 0.1902 0.1977 0.0235  -0.0600 -0.0506 77  GLY B N   
3424 C CA  . GLY B 99  ? 0.1931 0.2474 0.2478 0.0274  -0.0631 -0.0488 77  GLY B CA  
3425 C C   . GLY B 99  ? 0.2017 0.2523 0.2476 0.0284  -0.0612 -0.0451 77  GLY B C   
3426 O O   . GLY B 99  ? 0.2166 0.2656 0.2558 0.0315  -0.0630 -0.0426 77  GLY B O   
3427 N N   . ALA B 100 ? 0.1617 0.2108 0.2075 0.0257  -0.0575 -0.0445 78  ALA B N   
3428 C CA  . ALA B 100 ? 0.1422 0.1879 0.1805 0.0262  -0.0555 -0.0410 78  ALA B CA  
3429 C C   . ALA B 100 ? 0.1556 0.2015 0.1970 0.0273  -0.0545 -0.0386 78  ALA B C   
3430 O O   . ALA B 100 ? 0.1452 0.1941 0.1958 0.0265  -0.0537 -0.0398 78  ALA B O   
3431 C CB  . ALA B 100 ? 0.1378 0.1822 0.1762 0.0231  -0.0521 -0.0414 78  ALA B CB  
3432 N N   . ASN B 101 ? 0.1443 0.1868 0.1779 0.0291  -0.0543 -0.0350 79  ASN B N   
3433 C CA  . ASN B 101 ? 0.1533 0.1949 0.1893 0.0303  -0.0532 -0.0325 79  ASN B CA  
3434 C C   . ASN B 101 ? 0.1529 0.1935 0.1923 0.0271  -0.0483 -0.0319 79  ASN B C   
3435 O O   . ASN B 101 ? 0.1623 0.1990 0.1951 0.0254  -0.0452 -0.0299 79  ASN B O   
3436 C CB  . ASN B 101 ? 0.2039 0.2413 0.2299 0.0333  -0.0548 -0.0284 79  ASN B CB  
3437 C CG  . ASN B 101 ? 0.1935 0.2285 0.2213 0.0348  -0.0538 -0.0256 79  ASN B CG  
3438 O OD1 . ASN B 101 ? 0.1607 0.1965 0.1957 0.0332  -0.0509 -0.0264 79  ASN B OD1 
3439 N ND2 . ASN B 101 ? 0.2121 0.2434 0.2326 0.0378  -0.0558 -0.0221 79  ASN B ND2 
3440 N N   . PRO B 102 ? 0.1346 0.1781 0.1835 0.0262  -0.0466 -0.0332 80  PRO B N   
3441 C CA  . PRO B 102 ? 0.1591 0.2012 0.2106 0.0229  -0.0411 -0.0326 80  PRO B CA  
3442 C C   . PRO B 102 ? 0.1936 0.2304 0.2399 0.0234  -0.0381 -0.0289 80  PRO B C   
3443 O O   . PRO B 102 ? 0.1837 0.2189 0.2311 0.0211  -0.0338 -0.0282 80  PRO B O   
3444 C CB  . PRO B 102 ? 0.1465 0.1941 0.2100 0.0224  -0.0406 -0.0353 80  PRO B CB  
3445 C CG  . PRO B 102 ? 0.1518 0.2013 0.2170 0.0259  -0.0445 -0.0355 80  PRO B CG  
3446 C CD  . PRO B 102 ? 0.1388 0.1863 0.1957 0.0277  -0.0485 -0.0350 80  PRO B CD  
3447 N N   . LEU B 103 ? 0.1150 0.1489 0.1558 0.0263  -0.0406 -0.0265 81  LEU B N   
3448 C CA  . LEU B 103 ? 0.0889 0.1173 0.1255 0.0268  -0.0384 -0.0231 81  LEU B CA  
3449 C C   . LEU B 103 ? 0.1229 0.1464 0.1498 0.0256  -0.0370 -0.0199 81  LEU B C   
3450 O O   . LEU B 103 ? 0.1344 0.1530 0.1570 0.0260  -0.0358 -0.0166 81  LEU B O   
3451 C CB  . LEU B 103 ? 0.1143 0.1418 0.1510 0.0306  -0.0418 -0.0219 81  LEU B CB  
3452 C CG  . LEU B 103 ? 0.1406 0.1735 0.1870 0.0326  -0.0437 -0.0249 81  LEU B CG  
3453 C CD1 . LEU B 103 ? 0.1707 0.2022 0.2159 0.0369  -0.0477 -0.0234 81  LEU B CD1 
3454 C CD2 . LEU B 103 ? 0.1923 0.2264 0.2456 0.0311  -0.0396 -0.0261 81  LEU B CD2 
3455 N N   . GLN B 104 ? 0.1278 0.1527 0.1518 0.0242  -0.0371 -0.0209 82  GLN B N   
3456 C CA  . GLN B 104 ? 0.1080 0.1292 0.1230 0.0235  -0.0358 -0.0182 82  GLN B CA  
3457 C C   . GLN B 104 ? 0.0953 0.1173 0.1107 0.0202  -0.0327 -0.0196 82  GLN B C   
3458 O O   . GLN B 104 ? 0.1224 0.1464 0.1365 0.0200  -0.0339 -0.0216 82  GLN B O   
3459 C CB  . GLN B 104 ? 0.1148 0.1367 0.1237 0.0261  -0.0397 -0.0177 82  GLN B CB  
3460 C CG  . GLN B 104 ? 0.1284 0.1495 0.1362 0.0297  -0.0433 -0.0160 82  GLN B CG  
3461 C CD  . GLN B 104 ? 0.1566 0.1787 0.1579 0.0325  -0.0474 -0.0159 82  GLN B CD  
3462 O OE1 . GLN B 104 ? 0.1850 0.2108 0.1868 0.0324  -0.0491 -0.0192 82  GLN B OE1 
3463 N NE2 . GLN B 104 ? 0.1489 0.1676 0.1439 0.0352  -0.0490 -0.0119 82  GLN B NE2 
3464 N N   . PRO B 105 ? 0.1129 0.1329 0.1301 0.0179  -0.0288 -0.0188 83  PRO B N   
3465 C CA  . PRO B 105 ? 0.1332 0.1541 0.1521 0.0150  -0.0258 -0.0203 83  PRO B CA  
3466 C C   . PRO B 105 ? 0.1201 0.1398 0.1323 0.0143  -0.0252 -0.0195 83  PRO B C   
3467 O O   . PRO B 105 ? 0.1117 0.1331 0.1255 0.0129  -0.0246 -0.0219 83  PRO B O   
3468 C CB  . PRO B 105 ? 0.1481 0.1664 0.1683 0.0135  -0.0222 -0.0188 83  PRO B CB  
3469 C CG  . PRO B 105 ? 0.2343 0.2516 0.2565 0.0155  -0.0234 -0.0179 83  PRO B CG  
3470 C CD  . PRO B 105 ? 0.1796 0.1965 0.1978 0.0182  -0.0272 -0.0167 83  PRO B CD  
3471 N N   . LEU B 106 ? 0.1028 0.1196 0.1078 0.0153  -0.0252 -0.0162 84  LEU B N   
3472 C CA  . LEU B 106 ? 0.1295 0.1457 0.1280 0.0149  -0.0244 -0.0154 84  LEU B CA  
3473 C C   . LEU B 106 ? 0.1065 0.1253 0.1024 0.0169  -0.0279 -0.0177 84  LEU B C   
3474 O O   . LEU B 106 ? 0.1165 0.1365 0.1107 0.0163  -0.0275 -0.0196 84  LEU B O   
3475 C CB  . LEU B 106 ? 0.1120 0.1248 0.1043 0.0151  -0.0229 -0.0108 84  LEU B CB  
3476 C CG  . LEU B 106 ? 0.1281 0.1407 0.1135 0.0150  -0.0214 -0.0093 84  LEU B CG  
3477 C CD1 . LEU B 106 ? 0.1169 0.1307 0.1043 0.0129  -0.0192 -0.0118 84  LEU B CD1 
3478 C CD2 . LEU B 106 ? 0.1445 0.1540 0.1258 0.0145  -0.0193 -0.0045 84  LEU B CD2 
3479 N N   . VAL B 107 ? 0.0977 0.1174 0.0933 0.0195  -0.0314 -0.0176 85  VAL B N   
3480 C CA  . VAL B 107 ? 0.0992 0.1217 0.0927 0.0218  -0.0354 -0.0202 85  VAL B CA  
3481 C C   . VAL B 107 ? 0.1059 0.1316 0.1067 0.0203  -0.0364 -0.0251 85  VAL B C   
3482 O O   . VAL B 107 ? 0.1200 0.1472 0.1189 0.0206  -0.0380 -0.0279 85  VAL B O   
3483 C CB  . VAL B 107 ? 0.1043 0.1272 0.0971 0.0250  -0.0394 -0.0193 85  VAL B CB  
3484 C CG1 . VAL B 107 ? 0.1172 0.1434 0.1082 0.0275  -0.0441 -0.0225 85  VAL B CG1 
3485 C CG2 . VAL B 107 ? 0.1142 0.1332 0.0995 0.0263  -0.0384 -0.0140 85  VAL B CG2 
3486 N N   . LEU B 108 ? 0.1140 0.1408 0.1234 0.0187  -0.0352 -0.0261 86  LEU B N   
3487 C CA  . LEU B 108 ? 0.1128 0.1426 0.1303 0.0168  -0.0354 -0.0301 86  LEU B CA  
3488 C C   . LEU B 108 ? 0.1319 0.1605 0.1483 0.0143  -0.0325 -0.0310 86  LEU B C   
3489 O O   . LEU B 108 ? 0.1173 0.1477 0.1367 0.0136  -0.0340 -0.0346 86  LEU B O   
3490 C CB  . LEU B 108 ? 0.1180 0.1492 0.1443 0.0157  -0.0339 -0.0303 86  LEU B CB  
3491 C CG  . LEU B 108 ? 0.1626 0.1980 0.1991 0.0141  -0.0345 -0.0341 86  LEU B CG  
3492 C CD1 . LEU B 108 ? 0.1992 0.2383 0.2382 0.0162  -0.0399 -0.0371 86  LEU B CD1 
3493 C CD2 . LEU B 108 ? 0.1714 0.2079 0.2151 0.0133  -0.0319 -0.0334 86  LEU B CD2 
3494 N N   A ARG B 109 ? 0.1008 0.1263 0.1134 0.0131  -0.0286 -0.0280 87  ARG B N   
3495 N N   B ARG B 109 ? 0.1013 0.1267 0.1139 0.0130  -0.0286 -0.0280 87  ARG B N   
3496 C CA  A ARG B 109 ? 0.0933 0.1174 0.1045 0.0110  -0.0259 -0.0285 87  ARG B CA  
3497 C CA  B ARG B 109 ? 0.0959 0.1201 0.1072 0.0110  -0.0259 -0.0286 87  ARG B CA  
3498 C C   A ARG B 109 ? 0.1192 0.1434 0.1240 0.0125  -0.0278 -0.0300 87  ARG B C   
3499 C C   B ARG B 109 ? 0.1174 0.1417 0.1223 0.0125  -0.0278 -0.0300 87  ARG B C   
3500 O O   A ARG B 109 ? 0.1174 0.1420 0.1238 0.0115  -0.0278 -0.0328 87  ARG B O   
3501 O O   B ARG B 109 ? 0.1182 0.1427 0.1246 0.0114  -0.0278 -0.0328 87  ARG B O   
3502 C CB  A ARG B 109 ? 0.1152 0.1363 0.1235 0.0098  -0.0218 -0.0250 87  ARG B CB  
3503 C CB  B ARG B 109 ? 0.1170 0.1381 0.1253 0.0097  -0.0218 -0.0250 87  ARG B CB  
3504 C CG  A ARG B 109 ? 0.1610 0.1809 0.1688 0.0078  -0.0190 -0.0255 87  ARG B CG  
3505 C CG  B ARG B 109 ? 0.1602 0.1801 0.1665 0.0081  -0.0192 -0.0254 87  ARG B CG  
3506 C CD  A ARG B 109 ? 0.1584 0.1759 0.1643 0.0065  -0.0152 -0.0223 87  ARG B CD  
3507 C CD  B ARG B 109 ? 0.1573 0.1749 0.1632 0.0064  -0.0153 -0.0225 87  ARG B CD  
3508 N NE  A ARG B 109 ? 0.1224 0.1385 0.1214 0.0077  -0.0150 -0.0192 87  ARG B NE  
3509 N NE  B ARG B 109 ? 0.1811 0.1976 0.1846 0.0054  -0.0132 -0.0228 87  ARG B NE  
3510 C CZ  A ARG B 109 ? 0.1707 0.1867 0.1638 0.0085  -0.0148 -0.0187 87  ARG B CZ  
3511 C CZ  B ARG B 109 ? 0.1308 0.1472 0.1384 0.0037  -0.0119 -0.0247 87  ARG B CZ  
3512 N NH1 A ARG B 109 ? 0.2035 0.2204 0.1965 0.0084  -0.0151 -0.0215 87  ARG B NH1 
3513 N NH1 B ARG B 109 ? 0.0723 0.0899 0.0869 0.0026  -0.0122 -0.0264 87  ARG B NH1 
3514 N NH2 A ARG B 109 ? 0.1343 0.1494 0.1219 0.0094  -0.0142 -0.0153 87  ARG B NH2 
3515 N NH2 B ARG B 109 ? 0.1643 0.1796 0.1694 0.0032  -0.0102 -0.0248 87  ARG B NH2 
3516 N N   . ARG B 110 ? 0.1036 0.1273 0.1011 0.0150  -0.0294 -0.0280 88  ARG B N   
3517 C CA  . ARG B 110 ? 0.1188 0.1430 0.1093 0.0170  -0.0312 -0.0293 88  ARG B CA  
3518 C C   . ARG B 110 ? 0.1180 0.1448 0.1118 0.0180  -0.0356 -0.0342 88  ARG B C   
3519 O O   . ARG B 110 ? 0.1416 0.1686 0.1329 0.0184  -0.0366 -0.0372 88  ARG B O   
3520 C CB  . ARG B 110 ? 0.1232 0.1466 0.1049 0.0197  -0.0319 -0.0257 88  ARG B CB  
3521 C CG  . ARG B 110 ? 0.1214 0.1422 0.0995 0.0187  -0.0277 -0.0209 88  ARG B CG  
3522 C CD  . ARG B 110 ? 0.1857 0.2059 0.1543 0.0212  -0.0279 -0.0175 88  ARG B CD  
3523 N NE  . ARG B 110 ? 0.1395 0.1574 0.1066 0.0199  -0.0243 -0.0126 88  ARG B NE  
3524 C CZ  . ARG B 110 ? 0.1136 0.1296 0.0800 0.0205  -0.0246 -0.0089 88  ARG B CZ  
3525 N NH1 . ARG B 110 ? 0.1491 0.1655 0.1156 0.0227  -0.0283 -0.0093 88  ARG B NH1 
3526 N NH2 . ARG B 110 ? 0.1053 0.1189 0.0710 0.0189  -0.0214 -0.0049 88  ARG B NH2 
3527 N N   . ARG B 111 ? 0.1167 0.1456 0.1165 0.0184  -0.0384 -0.0353 89  ARG B N   
3528 C CA  . ARG B 111 ? 0.1004 0.1323 0.1048 0.0191  -0.0429 -0.0401 89  ARG B CA  
3529 C C   . ARG B 111 ? 0.1074 0.1391 0.1191 0.0159  -0.0411 -0.0430 89  ARG B C   
3530 O O   . ARG B 111 ? 0.1348 0.1662 0.1469 0.0159  -0.0423 -0.0456 89  ARG B O   
3531 C CB  . ARG B 111 ? 0.1004 0.1346 0.1107 0.0200  -0.0454 -0.0400 89  ARG B CB  
3532 C CG  . ARG B 111 ? 0.1044 0.1406 0.1195 0.0206  -0.0484 -0.0433 89  ARG B CG  
3533 C CD  . ARG B 111 ? 0.1731 0.2114 0.1917 0.0224  -0.0510 -0.0427 89  ARG B CD  
3534 N NE  . ARG B 111 ? 0.2202 0.2608 0.2447 0.0225  -0.0538 -0.0460 89  ARG B NE  
3535 C CZ  . ARG B 111 ? 0.2338 0.2760 0.2583 0.0251  -0.0572 -0.0462 89  ARG B CZ  
3536 N NH1 . ARG B 111 ? 0.2392 0.2836 0.2696 0.0250  -0.0597 -0.0495 89  ARG B NH1 
3537 N NH2 . ARG B 111 ? 0.2452 0.2866 0.2637 0.0278  -0.0581 -0.0431 89  ARG B NH2 
3538 N N   . MET B 112 ? 0.1103 0.1412 0.1272 0.0131  -0.0374 -0.0415 90  MET B N   
3539 C CA  . MET B 112 ? 0.1190 0.1494 0.1423 0.0101  -0.0355 -0.0437 90  MET B CA  
3540 C C   . MET B 112 ? 0.1110 0.1388 0.1280 0.0101  -0.0345 -0.0446 90  MET B C   
3541 O O   . MET B 112 ? 0.1006 0.1277 0.1207 0.0092  -0.0348 -0.0471 90  MET B O   
3542 C CB  . MET B 112 ? 0.0940 0.1236 0.1224 0.0075  -0.0309 -0.0410 90  MET B CB  
3543 C CG  . MET B 112 ? 0.1003 0.1332 0.1377 0.0070  -0.0317 -0.0415 90  MET B CG  
3544 S SD  . MET B 112 ? 0.0955 0.1279 0.1395 0.0040  -0.0263 -0.0393 90  MET B SD  
3545 C CE  . MET B 112 ? 0.1395 0.1691 0.1758 0.0054  -0.0238 -0.0347 90  MET B CE  
3546 N N   . ASP B 113 ? 0.1012 0.1270 0.1097 0.0113  -0.0321 -0.0413 91  ASP B N   
3547 C CA  . ASP B 113 ? 0.1101 0.1340 0.1123 0.0119  -0.0310 -0.0419 91  ASP B CA  
3548 C C   . ASP B 113 ? 0.1332 0.1577 0.1320 0.0142  -0.0345 -0.0451 91  ASP B C   
3549 O O   . ASP B 113 ? 0.1484 0.1712 0.1455 0.0142  -0.0337 -0.0467 91  ASP B O   
3550 C CB  . ASP B 113 ? 0.1211 0.1436 0.1149 0.0130  -0.0280 -0.0375 91  ASP B CB  
3551 C CG  . ASP B 113 ? 0.1729 0.1939 0.1696 0.0107  -0.0236 -0.0339 91  ASP B CG  
3552 O OD1 . ASP B 113 ? 0.1385 0.1590 0.1422 0.0082  -0.0221 -0.0348 91  ASP B OD1 
3553 O OD2 . ASP B 113 ? 0.2082 0.2283 0.1997 0.0113  -0.0216 -0.0301 91  ASP B OD2 
3554 N N   . GLY B 114 ? 0.1196 0.1459 0.1175 0.0162  -0.0378 -0.0453 92  GLY B N   
3555 C CA  . GLY B 114 ? 0.1291 0.1557 0.1238 0.0185  -0.0407 -0.0475 92  GLY B CA  
3556 C C   . GLY B 114 ? 0.1302 0.1571 0.1336 0.0169  -0.0425 -0.0512 92  GLY B C   
3557 O O   . GLY B 114 ? 0.1767 0.2035 0.1784 0.0185  -0.0449 -0.0538 92  GLY B O   
3558 N N   . LEU B 115 ? 0.1172 0.1444 0.1298 0.0138  -0.0411 -0.0514 93  LEU B N   
3559 C CA  . LEU B 115 ? 0.1199 0.1475 0.1416 0.0119  -0.0422 -0.0542 93  LEU B CA  
3560 C C   . LEU B 115 ? 0.1026 0.1277 0.1282 0.0091  -0.0394 -0.0548 93  LEU B C   
3561 O O   . LEU B 115 ? 0.1133 0.1376 0.1438 0.0081  -0.0404 -0.0572 93  LEU B O   
3562 C CB  . LEU B 115 ? 0.1059 0.1364 0.1363 0.0106  -0.0428 -0.0538 93  LEU B CB  
3563 C CG  . LEU B 115 ? 0.1052 0.1383 0.1333 0.0134  -0.0461 -0.0535 93  LEU B CG  
3564 C CD1 . LEU B 115 ? 0.1320 0.1678 0.1681 0.0121  -0.0455 -0.0523 93  LEU B CD1 
3565 C CD2 . LEU B 115 ? 0.1440 0.1779 0.1724 0.0151  -0.0501 -0.0567 93  LEU B CD2 
3566 N N   . LEU B 116 ? 0.1004 0.1239 0.1235 0.0080  -0.0358 -0.0524 94  LEU B N   
3567 C CA  . LEU B 116 ? 0.1018 0.1227 0.1283 0.0055  -0.0328 -0.0523 94  LEU B CA  
3568 C C   . LEU B 116 ? 0.0932 0.1123 0.1131 0.0057  -0.0296 -0.0500 94  LEU B C   
3569 O O   . LEU B 116 ? 0.0958 0.1160 0.1139 0.0058  -0.0284 -0.0477 94  LEU B O   
3570 C CB  . LEU B 116 ? 0.0903 0.1121 0.1271 0.0023  -0.0312 -0.0517 94  LEU B CB  
3571 C CG  . LEU B 116 ? 0.0947 0.1136 0.1356 -0.0005 -0.0278 -0.0511 94  LEU B CG  
3572 C CD1 . LEU B 116 ? 0.1325 0.1490 0.1744 -0.0006 -0.0292 -0.0535 94  LEU B CD1 
3573 C CD2 . LEU B 116 ? 0.1189 0.1393 0.1690 -0.0033 -0.0257 -0.0497 94  LEU B CD2 
3574 N N   . CYS B 117 ? 0.0975 0.1138 0.1139 0.0060  -0.0284 -0.0507 95  CYS B N   
3575 C CA  . CYS B 117 ? 0.0928 0.1075 0.1038 0.0062  -0.0251 -0.0486 95  CYS B CA  
3576 C C   . CYS B 117 ? 0.1049 0.1180 0.1217 0.0031  -0.0219 -0.0472 95  CYS B C   
3577 O O   . CYS B 117 ? 0.1088 0.1206 0.1326 0.0010  -0.0216 -0.0481 95  CYS B O   
3578 C CB  . CYS B 117 ? 0.0968 0.1094 0.1022 0.0080  -0.0251 -0.0499 95  CYS B CB  
3579 S SG  . CYS B 117 ? 0.1631 0.1738 0.1628 0.0084  -0.0209 -0.0477 95  CYS B SG  
3580 N N   . GLY B 118 ? 0.0931 0.1062 0.1071 0.0029  -0.0188 -0.0438 96  GLY B N   
3581 C CA  . GLY B 118 ? 0.1061 0.1175 0.1242 0.0004  -0.0151 -0.0412 96  GLY B CA  
3582 C C   . GLY B 118 ? 0.0923 0.1052 0.1184 -0.0017 -0.0149 -0.0408 96  GLY B C   
3583 O O   . GLY B 118 ? 0.1008 0.1164 0.1280 -0.0011 -0.0167 -0.0408 96  GLY B O   
3584 N N   . HIS B 119 ? 0.0907 0.1019 0.1225 -0.0041 -0.0126 -0.0403 97  HIS B N   
3585 C CA  . HIS B 119 ? 0.0699 0.0828 0.1100 -0.0063 -0.0117 -0.0398 97  HIS B CA  
3586 C C   . HIS B 119 ? 0.0667 0.0818 0.1057 -0.0058 -0.0103 -0.0369 97  HIS B C   
3587 O O   . HIS B 119 ? 0.0697 0.0878 0.1135 -0.0059 -0.0116 -0.0375 97  HIS B O   
3588 C CB  . HIS B 119 ? 0.0899 0.1048 0.1364 -0.0068 -0.0154 -0.0435 97  HIS B CB  
3589 C CG  . HIS B 119 ? 0.0811 0.0933 0.1288 -0.0072 -0.0163 -0.0452 97  HIS B CG  
3590 N ND1 . HIS B 119 ? 0.0915 0.1021 0.1328 -0.0050 -0.0185 -0.0470 97  HIS B ND1 
3591 C CD2 . HIS B 119 ? 0.0896 0.1001 0.1438 -0.0093 -0.0152 -0.0451 97  HIS B CD2 
3592 C CE1 . HIS B 119 ? 0.1057 0.1138 0.1499 -0.0058 -0.0189 -0.0484 97  HIS B CE1 
3593 N NE2 . HIS B 119 ? 0.1192 0.1271 0.1713 -0.0085 -0.0170 -0.0472 97  HIS B NE2 
3594 N N   . ASN B 120 ? 0.0721 0.0857 0.1051 -0.0050 -0.0079 -0.0339 98  ASN B N   
3595 C CA  . ASN B 120 ? 0.0620 0.0768 0.0936 -0.0045 -0.0066 -0.0313 98  ASN B CA  
3596 C C   . ASN B 120 ? 0.0754 0.0918 0.1141 -0.0061 -0.0048 -0.0307 98  ASN B C   
3597 O O   . ASN B 120 ? 0.0711 0.0898 0.1113 -0.0054 -0.0054 -0.0301 98  ASN B O   
3598 C CB  . ASN B 120 ? 0.0898 0.1025 0.1154 -0.0041 -0.0040 -0.0283 98  ASN B CB  
3599 C CG  . ASN B 120 ? 0.1212 0.1339 0.1398 -0.0021 -0.0054 -0.0277 98  ASN B CG  
3600 O OD1 . ASN B 120 ? 0.1228 0.1372 0.1403 -0.0007 -0.0082 -0.0289 98  ASN B OD1 
3601 N ND2 . ASN B 120 ? 0.0991 0.1102 0.1130 -0.0019 -0.0034 -0.0257 98  ASN B ND2 
3602 N N   . TYR B 121 ? 0.0661 0.0813 0.1090 -0.0081 -0.0026 -0.0306 99  TYR B N   
3603 C CA  . TYR B 121 ? 0.0981 0.1149 0.1473 -0.0095 -0.0002 -0.0295 99  TYR B CA  
3604 C C   . TYR B 121 ? 0.0888 0.1096 0.1452 -0.0098 -0.0024 -0.0316 99  TYR B C   
3605 O O   . TYR B 121 ? 0.0827 0.1061 0.1432 -0.0100 -0.0008 -0.0306 99  TYR B O   
3606 C CB  . TYR B 121 ? 0.0810 0.0956 0.1333 -0.0116 0.0026  -0.0288 99  TYR B CB  
3607 C CG  . TYR B 121 ? 0.1588 0.1728 0.2170 -0.0133 0.0009  -0.0313 99  TYR B CG  
3608 C CD1 . TYR B 121 ? 0.3443 0.3576 0.4006 -0.0124 -0.0028 -0.0343 99  TYR B CD1 
3609 C CD2 . TYR B 121 ? 0.1929 0.2072 0.2586 -0.0157 0.0031  -0.0308 99  TYR B CD2 
3610 C CE1 . TYR B 121 ? 0.0666 0.0790 0.1288 -0.0139 -0.0048 -0.0372 99  TYR B CE1 
3611 C CE2 . TYR B 121 ? 0.1813 0.1945 0.2523 -0.0172 0.0017  -0.0327 99  TYR B CE2 
3612 C CZ  . TYR B 121 ? 0.1968 0.2088 0.2654 -0.0161 -0.0022 -0.0356 99  TYR B CZ  
3613 O OH  . TYR B 121 ? 0.2240 0.2346 0.2968 -0.0170 -0.0035 -0.0368 99  TYR B OH  
3614 N N   . ALA B 122 ? 0.0602 0.0819 0.1183 -0.0095 -0.0061 -0.0346 100 ALA B N   
3615 C CA  . ALA B 122 ? 0.0728 0.0987 0.1381 -0.0096 -0.0089 -0.0369 100 ALA B CA  
3616 C C   . ALA B 122 ? 0.0881 0.1160 0.1493 -0.0069 -0.0114 -0.0369 100 ALA B C   
3617 O O   . ALA B 122 ? 0.0628 0.0941 0.1287 -0.0064 -0.0119 -0.0369 100 ALA B O   
3618 C CB  . ALA B 122 ? 0.0896 0.1152 0.1579 -0.0102 -0.0121 -0.0403 100 ALA B CB  
3619 N N   . LYS B 123 ? 0.1007 0.1263 0.1533 -0.0050 -0.0129 -0.0366 101 LYS B N   
3620 C CA  . LYS B 123 ? 0.0632 0.0898 0.1110 -0.0024 -0.0150 -0.0358 101 LYS B CA  
3621 C C   . LYS B 123 ? 0.0732 0.1001 0.1211 -0.0021 -0.0124 -0.0330 101 LYS B C   
3622 O O   . LYS B 123 ? 0.0845 0.1135 0.1332 -0.0004 -0.0142 -0.0329 101 LYS B O   
3623 C CB  . LYS B 123 ? 0.0654 0.0892 0.1036 -0.0009 -0.0158 -0.0350 101 LYS B CB  
3624 C CG  . LYS B 123 ? 0.0694 0.0932 0.1064 -0.0003 -0.0191 -0.0383 101 LYS B CG  
3625 C CD  . LYS B 123 ? 0.0977 0.1193 0.1251 0.0015  -0.0192 -0.0374 101 LYS B CD  
3626 C CE  . LYS B 123 ? 0.0880 0.1096 0.1134 0.0026  -0.0226 -0.0411 101 LYS B CE  
3627 N NZ  . LYS B 123 ? 0.0930 0.1125 0.1094 0.0041  -0.0217 -0.0402 101 LYS B NZ  
3628 N N   . ALA B 124 ? 0.0581 0.0829 0.1051 -0.0034 -0.0084 -0.0309 102 ALA B N   
3629 C CA  . ALA B 124 ? 0.0583 0.0830 0.1050 -0.0030 -0.0060 -0.0287 102 ALA B CA  
3630 C C   . ALA B 124 ? 0.0715 0.1001 0.1260 -0.0029 -0.0059 -0.0296 102 ALA B C   
3631 O O   . ALA B 124 ? 0.0714 0.1007 0.1254 -0.0013 -0.0058 -0.0286 102 ALA B O   
3632 C CB  . ALA B 124 ? 0.0639 0.0860 0.1087 -0.0044 -0.0020 -0.0268 102 ALA B CB  
3633 N N   . ALA B 125 ? 0.0680 0.0993 0.1301 -0.0045 -0.0061 -0.0315 103 ALA B N   
3634 C CA  . ALA B 125 ? 0.0615 0.0974 0.1322 -0.0045 -0.0058 -0.0324 103 ALA B CA  
3635 C C   . ALA B 125 ? 0.0960 0.1346 0.1676 -0.0021 -0.0099 -0.0338 103 ALA B C   
3636 O O   . ALA B 125 ? 0.0872 0.1286 0.1625 -0.0008 -0.0096 -0.0336 103 ALA B O   
3637 C CB  . ALA B 125 ? 0.0744 0.1127 0.1538 -0.0072 -0.0051 -0.0339 103 ALA B CB  
3638 N N   . ILE B 126 ? 0.0585 0.0965 0.1269 -0.0013 -0.0139 -0.0353 104 ILE B N   
3639 C CA  . ILE B 126 ? 0.0697 0.1097 0.1373 0.0014  -0.0182 -0.0363 104 ILE B CA  
3640 C C   . ILE B 126 ? 0.1156 0.1530 0.1762 0.0037  -0.0177 -0.0337 104 ILE B C   
3641 O O   . ILE B 126 ? 0.0846 0.1238 0.1472 0.0057  -0.0192 -0.0336 104 ILE B O   
3642 C CB  . ILE B 126 ? 0.0808 0.1202 0.1448 0.0021  -0.0224 -0.0384 104 ILE B CB  
3643 C CG1 . ILE B 126 ? 0.1068 0.1490 0.1790 0.0001  -0.0239 -0.0417 104 ILE B CG1 
3644 C CG2 . ILE B 126 ? 0.0813 0.1218 0.1419 0.0053  -0.0267 -0.0387 104 ILE B CG2 
3645 C CD1 . ILE B 126 ? 0.1443 0.1907 0.2243 0.0007  -0.0255 -0.0429 104 ILE B CD1 
3646 N N   . ASP B 127 ? 0.0607 0.0936 0.1134 0.0033  -0.0158 -0.0315 105 ASP B N   
3647 C CA  . ASP B 127 ? 0.0630 0.0928 0.1093 0.0049  -0.0151 -0.0288 105 ASP B CA  
3648 C C   . ASP B 127 ? 0.0912 0.1219 0.1414 0.0053  -0.0129 -0.0281 105 ASP B C   
3649 O O   . ASP B 127 ? 0.0711 0.1014 0.1203 0.0075  -0.0142 -0.0273 105 ASP B O   
3650 C CB  . ASP B 127 ? 0.0605 0.0862 0.0998 0.0037  -0.0129 -0.0270 105 ASP B CB  
3651 C CG  . ASP B 127 ? 0.1099 0.1323 0.1440 0.0044  -0.0114 -0.0242 105 ASP B CG  
3652 O OD1 . ASP B 127 ? 0.0847 0.1069 0.1212 0.0042  -0.0091 -0.0236 105 ASP B OD1 
3653 O OD2 . ASP B 127 ? 0.1110 0.1310 0.1386 0.0052  -0.0124 -0.0225 105 ASP B OD2 
3654 N N   . ILE B 128 ? 0.0806 0.1123 0.1351 0.0034  -0.0094 -0.0283 106 ILE B N   
3655 C CA  . ILE B 128 ? 0.0774 0.1100 0.1349 0.0041  -0.0068 -0.0277 106 ILE B CA  
3656 C C   . ILE B 128 ? 0.0600 0.0973 0.1246 0.0058  -0.0087 -0.0294 106 ILE B C   
3657 O O   . ILE B 128 ? 0.0574 0.0944 0.1218 0.0080  -0.0087 -0.0289 106 ILE B O   
3658 C CB  . ILE B 128 ? 0.0537 0.0866 0.1137 0.0018  -0.0024 -0.0273 106 ILE B CB  
3659 C CG1 . ILE B 128 ? 0.0747 0.1028 0.1271 0.0008  -0.0007 -0.0255 106 ILE B CG1 
3660 C CG2 . ILE B 128 ? 0.0695 0.1047 0.1335 0.0029  0.0003  -0.0272 106 ILE B CG2 
3661 C CD1 . ILE B 128 ? 0.0973 0.1252 0.1514 -0.0015 0.0028  -0.0251 106 ILE B CD1 
3662 N N   . ALA B 129 ? 0.0566 0.0979 0.1276 0.0051  -0.0107 -0.0315 107 ALA B N   
3663 C CA  . ALA B 129 ? 0.0841 0.1306 0.1627 0.0068  -0.0129 -0.0333 107 ALA B CA  
3664 C C   . ALA B 129 ? 0.0996 0.1447 0.1739 0.0100  -0.0170 -0.0330 107 ALA B C   
3665 O O   . ALA B 129 ? 0.0797 0.1272 0.1577 0.0124  -0.0179 -0.0334 107 ALA B O   
3666 C CB  . ALA B 129 ? 0.0574 0.1083 0.1436 0.0051  -0.0148 -0.0358 107 ALA B CB  
3667 N N   . ALA B 130 ? 0.0877 0.1291 0.1542 0.0103  -0.0193 -0.0321 108 ALA B N   
3668 C CA  . ALA B 130 ? 0.1102 0.1495 0.1714 0.0133  -0.0228 -0.0310 108 ALA B CA  
3669 C C   . ALA B 130 ? 0.1207 0.1564 0.1785 0.0147  -0.0210 -0.0288 108 ALA B C   
3670 O O   . ALA B 130 ? 0.0848 0.1207 0.1435 0.0175  -0.0231 -0.0286 108 ALA B O   
3671 C CB  . ALA B 130 ? 0.1494 0.1856 0.2024 0.0131  -0.0248 -0.0301 108 ALA B CB  
3672 N N   . TYR B 131 ? 0.0644 0.0966 0.1183 0.0130  -0.0173 -0.0272 109 TYR B N   
3673 C CA  . TYR B 131 ? 0.0651 0.0937 0.1161 0.0142  -0.0158 -0.0256 109 TYR B CA  
3674 C C   . TYR B 131 ? 0.0773 0.1090 0.1351 0.0157  -0.0146 -0.0270 109 TYR B C   
3675 O O   . TYR B 131 ? 0.0950 0.1248 0.1520 0.0182  -0.0155 -0.0265 109 TYR B O   
3676 C CB  . TYR B 131 ? 0.0632 0.0880 0.1093 0.0120  -0.0123 -0.0240 109 TYR B CB  
3677 C CG  . TYR B 131 ? 0.0649 0.0853 0.1031 0.0115  -0.0134 -0.0218 109 TYR B CG  
3678 C CD1 . TYR B 131 ? 0.1062 0.1223 0.1399 0.0130  -0.0145 -0.0197 109 TYR B CD1 
3679 C CD2 . TYR B 131 ? 0.0859 0.1063 0.1214 0.0097  -0.0132 -0.0217 109 TYR B CD2 
3680 C CE1 . TYR B 131 ? 0.1434 0.1560 0.1705 0.0124  -0.0151 -0.0173 109 TYR B CE1 
3681 C CE2 . TYR B 131 ? 0.0814 0.0985 0.1100 0.0094  -0.0138 -0.0196 109 TYR B CE2 
3682 C CZ  . TYR B 131 ? 0.1258 0.1393 0.1503 0.0107  -0.0146 -0.0173 109 TYR B CZ  
3683 O OH  . TYR B 131 ? 0.1637 0.1743 0.1819 0.0102  -0.0149 -0.0148 109 TYR B OH  
3684 N N   . ASP B 132 ? 0.0620 0.0986 0.1268 0.0143  -0.0124 -0.0287 110 ASP B N   
3685 C CA  . ASP B 132 ? 0.0927 0.1336 0.1649 0.0158  -0.0110 -0.0302 110 ASP B CA  
3686 C C   . ASP B 132 ? 0.1000 0.1434 0.1759 0.0189  -0.0151 -0.0313 110 ASP B C   
3687 O O   . ASP B 132 ? 0.0887 0.1321 0.1660 0.0217  -0.0152 -0.0315 110 ASP B O   
3688 C CB  . ASP B 132 ? 0.0588 0.1049 0.1384 0.0134  -0.0081 -0.0315 110 ASP B CB  
3689 C CG  . ASP B 132 ? 0.0584 0.1092 0.1451 0.0146  -0.0052 -0.0325 110 ASP B CG  
3690 O OD1 . ASP B 132 ? 0.0716 0.1201 0.1556 0.0168  -0.0038 -0.0321 110 ASP B OD1 
3691 O OD2 . ASP B 132 ? 0.0912 0.1480 0.1866 0.0134  -0.0041 -0.0338 110 ASP B OD2 
3692 N N   . LEU B 133 ? 0.1006 0.1463 0.1779 0.0187  -0.0187 -0.0321 111 LEU B N   
3693 C CA  . LEU B 133 ? 0.0835 0.1319 0.1640 0.0218  -0.0232 -0.0331 111 LEU B CA  
3694 C C   . LEU B 133 ? 0.1251 0.1678 0.1985 0.0247  -0.0255 -0.0311 111 LEU B C   
3695 O O   . LEU B 133 ? 0.1468 0.1907 0.2234 0.0279  -0.0273 -0.0315 111 LEU B O   
3696 C CB  . LEU B 133 ? 0.1304 0.1813 0.2119 0.0208  -0.0268 -0.0344 111 LEU B CB  
3697 C CG  . LEU B 133 ? 0.2208 0.2764 0.3078 0.0230  -0.0312 -0.0363 111 LEU B CG  
3698 C CD1 . LEU B 133 ? 0.2606 0.3203 0.3555 0.0229  -0.0288 -0.0374 111 LEU B CD1 
3699 C CD2 . LEU B 133 ? 0.2433 0.3004 0.3305 0.0209  -0.0335 -0.0379 111 LEU B CD2 
3700 N N   . MET B 134 ? 0.0904 0.1271 0.1547 0.0236  -0.0253 -0.0287 112 MET B N   
3701 C CA  . MET B 134 ? 0.0970 0.1278 0.1545 0.0258  -0.0271 -0.0262 112 MET B CA  
3702 C C   . MET B 134 ? 0.1047 0.1334 0.1637 0.0273  -0.0251 -0.0261 112 MET B C   
3703 O O   . MET B 134 ? 0.1259 0.1525 0.1846 0.0305  -0.0275 -0.0255 112 MET B O   
3704 C CB  . MET B 134 ? 0.1526 0.1778 0.2011 0.0237  -0.0261 -0.0236 112 MET B CB  
3705 C CG  . MET B 134 ? 0.2094 0.2356 0.2544 0.0227  -0.0281 -0.0234 112 MET B CG  
3706 S SD  . MET B 134 ? 0.2721 0.2930 0.3082 0.0199  -0.0256 -0.0206 112 MET B SD  
3707 C CE  . MET B 134 ? 0.1780 0.1925 0.2087 0.0219  -0.0265 -0.0171 112 MET B CE  
3708 N N   . GLY B 135 ? 0.0839 0.1126 0.1439 0.0254  -0.0208 -0.0267 113 GLY B N   
3709 C CA  . GLY B 135 ? 0.0810 0.1076 0.1417 0.0269  -0.0188 -0.0270 113 GLY B CA  
3710 C C   . GLY B 135 ? 0.1076 0.1390 0.1760 0.0302  -0.0197 -0.0292 113 GLY B C   
3711 O O   . GLY B 135 ? 0.1130 0.1417 0.1812 0.0332  -0.0207 -0.0293 113 GLY B O   
3712 N N   . LYS B 136 ? 0.0850 0.1237 0.1608 0.0295  -0.0194 -0.0311 114 LYS B N   
3713 C CA  . LYS B 136 ? 0.0764 0.1208 0.1607 0.0325  -0.0203 -0.0333 114 LYS B CA  
3714 C C   . LYS B 136 ? 0.1236 0.1664 0.2067 0.0356  -0.0253 -0.0327 114 LYS B C   
3715 O O   . LYS B 136 ? 0.1274 0.1700 0.2121 0.0383  -0.0258 -0.0330 114 LYS B O   
3716 C CB  . LYS B 136 ? 0.1075 0.1590 0.1986 0.0299  -0.0189 -0.0346 114 LYS B CB  
3717 C CG  . LYS B 136 ? 0.0906 0.1440 0.1836 0.0270  -0.0135 -0.0349 114 LYS B CG  
3718 C CD  . LYS B 136 ? 0.2132 0.2730 0.3135 0.0248  -0.0125 -0.0359 114 LYS B CD  
3719 C CE  . LYS B 136 ? 0.2286 0.2900 0.3304 0.0213  -0.0076 -0.0355 114 LYS B CE  
3720 N NZ  . LYS B 136 ? 0.2361 0.3034 0.3457 0.0194  -0.0069 -0.0362 114 LYS B NZ  
3721 N N   . HIS B 137 ? 0.1042 0.1454 0.1835 0.0353  -0.0289 -0.0315 115 HIS B N   
3722 C CA  . HIS B 137 ? 0.1131 0.1530 0.1906 0.0383  -0.0337 -0.0306 115 HIS B CA  
3723 C C   . HIS B 137 ? 0.1379 0.1704 0.2100 0.0411  -0.0349 -0.0285 115 HIS B C   
3724 O O   . HIS B 137 ? 0.1459 0.1773 0.2184 0.0439  -0.0371 -0.0282 115 HIS B O   
3725 C CB  . HIS B 137 ? 0.1416 0.1815 0.2151 0.0372  -0.0370 -0.0298 115 HIS B CB  
3726 C CG  . HIS B 137 ? 0.2119 0.2499 0.2818 0.0401  -0.0418 -0.0284 115 HIS B CG  
3727 N ND1 . HIS B 137 ? 0.2152 0.2571 0.2896 0.0417  -0.0439 -0.0298 115 HIS B ND1 
3728 C CD2 . HIS B 137 ? 0.2462 0.2786 0.3081 0.0417  -0.0447 -0.0255 115 HIS B CD2 
3729 C CE1 . HIS B 137 ? 0.2860 0.3248 0.3552 0.0443  -0.0479 -0.0280 115 HIS B CE1 
3730 N NE2 . HIS B 137 ? 0.2617 0.2947 0.3230 0.0443  -0.0484 -0.0252 115 HIS B NE2 
3731 N N   . TYR B 138 ? 0.1325 0.1587 0.1977 0.0390  -0.0326 -0.0265 116 TYR B N   
3732 C CA  . TYR B 138 ? 0.1364 0.1547 0.1960 0.0407  -0.0335 -0.0242 116 TYR B CA  
3733 C C   . TYR B 138 ? 0.1488 0.1655 0.2110 0.0421  -0.0309 -0.0258 116 TYR B C   
3734 O O   . TYR B 138 ? 0.1935 0.2039 0.2529 0.0442  -0.0322 -0.0247 116 TYR B O   
3735 C CB  . TYR B 138 ? 0.1854 0.1976 0.2364 0.0376  -0.0325 -0.0211 116 TYR B CB  
3736 C CG  . TYR B 138 ? 0.2134 0.2257 0.2597 0.0367  -0.0350 -0.0191 116 TYR B CG  
3737 C CD1 . TYR B 138 ? 0.2652 0.2775 0.3108 0.0399  -0.0395 -0.0181 116 TYR B CD1 
3738 C CD2 . TYR B 138 ? 0.2262 0.2385 0.2685 0.0331  -0.0331 -0.0183 116 TYR B CD2 
3739 C CE1 . TYR B 138 ? 0.2786 0.2911 0.3191 0.0395  -0.0418 -0.0163 116 TYR B CE1 
3740 C CE2 . TYR B 138 ? 0.2656 0.2781 0.3032 0.0327  -0.0352 -0.0167 116 TYR B CE2 
3741 C CZ  . TYR B 138 ? 0.2961 0.3087 0.3325 0.0359  -0.0395 -0.0158 116 TYR B CZ  
3742 O OH  . TYR B 138 ? 0.2911 0.3040 0.3220 0.0358  -0.0416 -0.0143 116 TYR B OH  
3743 N N   . GLY B 139 ? 0.1360 0.1581 0.2033 0.0408  -0.0272 -0.0284 117 GLY B N   
3744 C CA  . GLY B 139 ? 0.1356 0.1568 0.2047 0.0421  -0.0242 -0.0301 117 GLY B CA  
3745 C C   . GLY B 139 ? 0.1867 0.2012 0.2489 0.0398  -0.0219 -0.0288 117 GLY B C   
3746 O O   . GLY B 139 ? 0.2415 0.2509 0.3017 0.0416  -0.0217 -0.0292 117 GLY B O   
3747 N N   A VAL B 140 ? 0.1496 0.1643 0.2084 0.0358  -0.0203 -0.0275 118 VAL B N   
3748 N N   B VAL B 140 ? 0.1441 0.1589 0.2029 0.0358  -0.0203 -0.0275 118 VAL B N   
3749 C CA  A VAL B 140 ? 0.1572 0.1659 0.2094 0.0333  -0.0185 -0.0260 118 VAL B CA  
3750 C CA  B VAL B 140 ? 0.1623 0.1711 0.2143 0.0332  -0.0186 -0.0259 118 VAL B CA  
3751 C C   A VAL B 140 ? 0.1421 0.1545 0.1945 0.0300  -0.0146 -0.0268 118 VAL B C   
3752 C C   B VAL B 140 ? 0.1419 0.1545 0.1945 0.0300  -0.0145 -0.0268 118 VAL B C   
3753 O O   A VAL B 140 ? 0.1329 0.1510 0.1889 0.0286  -0.0140 -0.0272 118 VAL B O   
3754 O O   B VAL B 140 ? 0.1309 0.1492 0.1870 0.0286  -0.0139 -0.0273 118 VAL B O   
3755 C CB  A VAL B 140 ? 0.1758 0.1793 0.2219 0.0319  -0.0211 -0.0227 118 VAL B CB  
3756 C CB  B VAL B 140 ? 0.1554 0.1600 0.2017 0.0314  -0.0210 -0.0226 118 VAL B CB  
3757 C CG1 A VAL B 140 ? 0.1499 0.1578 0.1964 0.0303  -0.0222 -0.0220 118 VAL B CG1 
3758 C CG1 B VAL B 140 ? 0.1982 0.1969 0.2385 0.0288  -0.0195 -0.0209 118 VAL B CG1 
3759 C CG2 A VAL B 140 ? 0.2153 0.2133 0.2556 0.0291  -0.0194 -0.0211 118 VAL B CG2 
3760 C CG2 B VAL B 140 ? 0.1910 0.1924 0.2368 0.0345  -0.0251 -0.0212 118 VAL B CG2 
3761 N N   . ARG B 141 ? 0.1332 0.1424 0.1822 0.0289  -0.0120 -0.0269 119 ARG B N   
3762 C CA  . ARG B 141 ? 0.1089 0.1206 0.1570 0.0258  -0.0084 -0.0271 119 ARG B CA  
3763 C C   . ARG B 141 ? 0.0925 0.1026 0.1365 0.0226  -0.0091 -0.0248 119 ARG B C   
3764 O O   . ARG B 141 ? 0.1295 0.1346 0.1691 0.0223  -0.0114 -0.0227 119 ARG B O   
3765 C CB  . ARG B 141 ? 0.1661 0.1746 0.2111 0.0260  -0.0059 -0.0280 119 ARG B CB  
3766 C CG  . ARG B 141 ? 0.1537 0.1654 0.2028 0.0291  -0.0039 -0.0308 119 ARG B CG  
3767 C CD  . ARG B 141 ? 0.1750 0.1852 0.2206 0.0288  -0.0007 -0.0318 119 ARG B CD  
3768 N NE  . ARG B 141 ? 0.1372 0.1399 0.1776 0.0297  -0.0026 -0.0319 119 ARG B NE  
3769 C CZ  . ARG B 141 ? 0.1041 0.1040 0.1406 0.0300  -0.0010 -0.0332 119 ARG B CZ  
3770 N NH1 . ARG B 141 ? 0.1311 0.1240 0.1637 0.0306  -0.0033 -0.0334 119 ARG B NH1 
3771 N NH2 . ARG B 141 ? 0.1015 0.1055 0.1378 0.0297  0.0029  -0.0341 119 ARG B NH2 
3772 N N   . VAL B 142 ? 0.0711 0.0854 0.1167 0.0202  -0.0069 -0.0250 120 VAL B N   
3773 C CA  . VAL B 142 ? 0.0906 0.1039 0.1325 0.0174  -0.0074 -0.0232 120 VAL B CA  
3774 C C   . VAL B 142 ? 0.0852 0.0926 0.1206 0.0160  -0.0071 -0.0214 120 VAL B C   
3775 O O   . VAL B 142 ? 0.1047 0.1095 0.1363 0.0150  -0.0088 -0.0193 120 VAL B O   
3776 C CB  . VAL B 142 ? 0.0651 0.0832 0.1100 0.0151  -0.0050 -0.0239 120 VAL B CB  
3777 C CG1 . VAL B 142 ? 0.0865 0.1026 0.1267 0.0124  -0.0048 -0.0223 120 VAL B CG1 
3778 C CG2 . VAL B 142 ? 0.0997 0.1232 0.1510 0.0159  -0.0067 -0.0253 120 VAL B CG2 
3779 N N   . ALA B 143 ? 0.0775 0.0830 0.1115 0.0160  -0.0049 -0.0221 121 ALA B N   
3780 C CA  . ALA B 143 ? 0.0889 0.0891 0.1175 0.0147  -0.0050 -0.0207 121 ALA B CA  
3781 C C   . ALA B 143 ? 0.1251 0.1204 0.1515 0.0156  -0.0081 -0.0191 121 ALA B C   
3782 O O   . ALA B 143 ? 0.1115 0.1034 0.1341 0.0138  -0.0088 -0.0169 121 ALA B O   
3783 C CB  . ALA B 143 ? 0.0874 0.0864 0.1148 0.0152  -0.0027 -0.0222 121 ALA B CB  
3784 N N   . ASP B 144 ? 0.0964 0.0913 0.1254 0.0184  -0.0100 -0.0199 122 ASP B N   
3785 C CA  . ASP B 144 ? 0.1104 0.1000 0.1375 0.0195  -0.0130 -0.0180 122 ASP B CA  
3786 C C   . ASP B 144 ? 0.1976 0.1879 0.2232 0.0188  -0.0150 -0.0154 122 ASP B C   
3787 O O   . ASP B 144 ? 0.3126 0.2984 0.3351 0.0184  -0.0167 -0.0128 122 ASP B O   
3788 C CB  . ASP B 144 ? 0.1035 0.0920 0.1337 0.0231  -0.0146 -0.0197 122 ASP B CB  
3789 C CG  . ASP B 144 ? 0.1349 0.1198 0.1644 0.0240  -0.0136 -0.0217 122 ASP B CG  
3790 O OD1 . ASP B 144 ? 0.1309 0.1121 0.1569 0.0219  -0.0131 -0.0208 122 ASP B OD1 
3791 O OD2 . ASP B 144 ? 0.1846 0.1708 0.2173 0.0270  -0.0134 -0.0242 122 ASP B OD2 
3792 N N   . LEU B 145 ? 0.1145 0.1103 0.1423 0.0185  -0.0146 -0.0162 123 LEU B N   
3793 C CA  . LEU B 145 ? 0.1158 0.1127 0.1414 0.0179  -0.0163 -0.0142 123 LEU B CA  
3794 C C   . LEU B 145 ? 0.1446 0.1403 0.1657 0.0148  -0.0148 -0.0124 123 LEU B C   
3795 O O   . LEU B 145 ? 0.1852 0.1807 0.2032 0.0143  -0.0160 -0.0103 123 LEU B O   
3796 C CB  . LEU B 145 ? 0.1179 0.1210 0.1476 0.0185  -0.0168 -0.0162 123 LEU B CB  
3797 C CG  . LEU B 145 ? 0.1894 0.1946 0.2239 0.0217  -0.0189 -0.0177 123 LEU B CG  
3798 C CD1 . LEU B 145 ? 0.2147 0.2269 0.2547 0.0218  -0.0190 -0.0201 123 LEU B CD1 
3799 C CD2 . LEU B 145 ? 0.2519 0.2537 0.2836 0.0239  -0.0225 -0.0154 123 LEU B CD2 
3800 N N   . LEU B 146 ? 0.1018 0.0970 0.1226 0.0131  -0.0122 -0.0132 124 LEU B N   
3801 C CA  . LEU B 146 ? 0.0738 0.0687 0.0913 0.0104  -0.0106 -0.0118 124 LEU B CA  
3802 C C   . LEU B 146 ? 0.1282 0.1180 0.1428 0.0094  -0.0106 -0.0100 124 LEU B C   
3803 O O   . LEU B 146 ? 0.1378 0.1272 0.1502 0.0072  -0.0092 -0.0090 124 LEU B O   
3804 C CB  . LEU B 146 ? 0.1133 0.1115 0.1325 0.0091  -0.0079 -0.0139 124 LEU B CB  
3805 C CG  . LEU B 146 ? 0.1025 0.1058 0.1253 0.0094  -0.0077 -0.0156 124 LEU B CG  
3806 C CD1 . LEU B 146 ? 0.1436 0.1493 0.1685 0.0081  -0.0046 -0.0172 124 LEU B CD1 
3807 C CD2 . LEU B 146 ? 0.1416 0.1461 0.1621 0.0085  -0.0089 -0.0145 124 LEU B CD2 
3808 N N   . GLY B 147 ? 0.1396 0.1254 0.1546 0.0109  -0.0124 -0.0095 125 GLY B N   
3809 C CA  . GLY B 147 ? 0.1276 0.1082 0.1407 0.0097  -0.0127 -0.0078 125 GLY B CA  
3810 C C   . GLY B 147 ? 0.1175 0.0945 0.1321 0.0110  -0.0131 -0.0098 125 GLY B C   
3811 O O   . GLY B 147 ? 0.1287 0.1005 0.1427 0.0106  -0.0145 -0.0085 125 GLY B O   
3812 N N   . GLY B 148 ? 0.1154 0.0954 0.1323 0.0124  -0.0119 -0.0130 126 GLY B N   
3813 C CA  . GLY B 148 ? 0.1078 0.0851 0.1260 0.0143  -0.0122 -0.0154 126 GLY B CA  
3814 C C   . GLY B 148 ? 0.0943 0.0733 0.1121 0.0138  -0.0097 -0.0179 126 GLY B C   
3815 O O   . GLY B 148 ? 0.1264 0.1062 0.1421 0.0115  -0.0083 -0.0173 126 GLY B O   
3816 N N   . VAL B 149 ? 0.1081 0.0876 0.1276 0.0165  -0.0093 -0.0208 127 VAL B N   
3817 C CA  . VAL B 149 ? 0.1294 0.1101 0.1479 0.0168  -0.0069 -0.0233 127 VAL B CA  
3818 C C   . VAL B 149 ? 0.1376 0.1129 0.1529 0.0158  -0.0080 -0.0236 127 VAL B C   
3819 O O   . VAL B 149 ? 0.1612 0.1316 0.1767 0.0172  -0.0103 -0.0245 127 VAL B O   
3820 C CB  . VAL B 149 ? 0.1033 0.0859 0.1244 0.0203  -0.0061 -0.0263 127 VAL B CB  
3821 C CG1 . VAL B 149 ? 0.1159 0.0994 0.1348 0.0209  -0.0036 -0.0287 127 VAL B CG1 
3822 C CG2 . VAL B 149 ? 0.1464 0.1351 0.1716 0.0210  -0.0051 -0.0262 127 VAL B CG2 
3823 N N   . ALA B 150 ? 0.1021 0.0784 0.1150 0.0135  -0.0066 -0.0230 128 ALA B N   
3824 C CA  . ALA B 150 ? 0.1112 0.0835 0.1215 0.0124  -0.0076 -0.0236 128 ALA B CA  
3825 C C   . ALA B 150 ? 0.1550 0.1278 0.1634 0.0144  -0.0062 -0.0270 128 ALA B C   
3826 O O   . ALA B 150 ? 0.1744 0.1431 0.1809 0.0148  -0.0078 -0.0287 128 ALA B O   
3827 C CB  . ALA B 150 ? 0.1410 0.1144 0.1498 0.0091  -0.0071 -0.0212 128 ALA B CB  
3828 N N   . ALA B 151 ? 0.1436 0.1214 0.1525 0.0157  -0.0033 -0.0279 129 ALA B N   
3829 C CA  . ALA B 151 ? 0.1761 0.1553 0.1829 0.0179  -0.0013 -0.0307 129 ALA B CA  
3830 C C   . ALA B 151 ? 0.1403 0.1247 0.1499 0.0199  0.0015  -0.0314 129 ALA B C   
3831 O O   . ALA B 151 ? 0.1676 0.1562 0.1796 0.0184  0.0031  -0.0296 129 ALA B O   
3832 C CB  . ALA B 151 ? 0.2080 0.1884 0.2112 0.0161  0.0003  -0.0301 129 ALA B CB  
3833 N N   . GLU B 152 ? 0.1365 0.1208 0.1461 0.0233  0.0021  -0.0343 130 GLU B N   
3834 C CA  . GLU B 152 ? 0.1239 0.1138 0.1367 0.0254  0.0051  -0.0352 130 GLU B CA  
3835 C C   . GLU B 152 ? 0.1334 0.1280 0.1446 0.0247  0.0092  -0.0347 130 GLU B C   
3836 O O   . GLU B 152 ? 0.1924 0.1924 0.2075 0.0248  0.0119  -0.0340 130 GLU B O   
3837 C CB  . GLU B 152 ? 0.1597 0.1484 0.1723 0.0289  0.0048  -0.0375 130 GLU B CB  
3838 C CG  . GLU B 152 ? 0.1879 0.1732 0.2036 0.0301  0.0013  -0.0377 130 GLU B CG  
3839 C CD  . GLU B 152 ? 0.1446 0.1343 0.1664 0.0306  0.0015  -0.0369 130 GLU B CD  
3840 O OE1 . GLU B 152 ? 0.1790 0.1752 0.2036 0.0307  0.0047  -0.0367 130 GLU B OE1 
3841 O OE2 . GLU B 152 ? 0.1984 0.1851 0.2225 0.0311  -0.0017 -0.0363 130 GLU B OE2 
3842 N N   . ARG B 153 ? 0.1093 0.1016 0.1150 0.0241  0.0095  -0.0349 131 ARG B N   
3843 C CA  . ARG B 153 ? 0.1076 0.1035 0.1109 0.0235  0.0133  -0.0340 131 ARG B CA  
3844 C C   . ARG B 153 ? 0.1428 0.1368 0.1434 0.0202  0.0122  -0.0318 131 ARG B C   
3845 O O   . ARG B 153 ? 0.1618 0.1513 0.1593 0.0196  0.0092  -0.0323 131 ARG B O   
3846 C CB  . ARG B 153 ? 0.1523 0.1473 0.1503 0.0259  0.0147  -0.0353 131 ARG B CB  
3847 C CG  . ARG B 153 ? 0.1681 0.1670 0.1638 0.0258  0.0192  -0.0338 131 ARG B CG  
3848 C CD  . ARG B 153 ? 0.1800 0.1769 0.1691 0.0275  0.0200  -0.0349 131 ARG B CD  
3849 N NE  . ARG B 153 ? 0.1612 0.1570 0.1504 0.0302  0.0193  -0.0372 131 ARG B NE  
3850 C CZ  . ARG B 153 ? 0.1580 0.1574 0.1493 0.0321  0.0225  -0.0373 131 ARG B CZ  
3851 N NH1 . ARG B 153 ? 0.1264 0.1308 0.1201 0.0314  0.0268  -0.0351 131 ARG B NH1 
3852 N NH2 . ARG B 153 ? 0.1580 0.1561 0.1492 0.0347  0.0216  -0.0396 131 ARG B NH2 
3853 N N   . VAL B 154 ? 0.1002 0.0977 0.1024 0.0181  0.0145  -0.0294 132 VAL B N   
3854 C CA  . VAL B 154 ? 0.1114 0.1075 0.1114 0.0152  0.0136  -0.0273 132 VAL B CA  
3855 C C   . VAL B 154 ? 0.1144 0.1118 0.1102 0.0152  0.0165  -0.0265 132 VAL B C   
3856 O O   . VAL B 154 ? 0.1210 0.1217 0.1171 0.0166  0.0200  -0.0266 132 VAL B O   
3857 C CB  . VAL B 154 ? 0.1792 0.1771 0.1836 0.0125  0.0132  -0.0250 132 VAL B CB  
3858 C CG1 . VAL B 154 ? 0.1874 0.1833 0.1946 0.0126  0.0100  -0.0253 132 VAL B CG1 
3859 C CG2 . VAL B 154 ? 0.1433 0.1462 0.1518 0.0125  0.0165  -0.0243 132 VAL B CG2 
3860 N N   . PRO B 155 ? 0.1220 0.1171 0.1141 0.0138  0.0151  -0.0257 133 PRO B N   
3861 C CA  . PRO B 155 ? 0.1062 0.1023 0.0942 0.0139  0.0176  -0.0246 133 PRO B CA  
3862 C C   . PRO B 155 ? 0.1012 0.1005 0.0924 0.0120  0.0205  -0.0219 133 PRO B C   
3863 O O   . PRO B 155 ? 0.1037 0.1038 0.0995 0.0100  0.0195  -0.0209 133 PRO B O   
3864 C CB  . PRO B 155 ? 0.1265 0.1194 0.1110 0.0127  0.0147  -0.0243 133 PRO B CB  
3865 C CG  . PRO B 155 ? 0.1282 0.1198 0.1169 0.0106  0.0118  -0.0238 133 PRO B CG  
3866 C CD  . PRO B 155 ? 0.1289 0.1206 0.1209 0.0120  0.0113  -0.0254 133 PRO B CD  
3867 N N   . SER B 156 ? 0.0947 0.0959 0.0836 0.0127  0.0240  -0.0208 134 SER B N   
3868 C CA  . SER B 156 ? 0.0858 0.0889 0.0772 0.0106  0.0264  -0.0181 134 SER B CA  
3869 C C   . SER B 156 ? 0.1096 0.1108 0.0955 0.0104  0.0267  -0.0165 134 SER B C   
3870 O O   . SER B 156 ? 0.1198 0.1187 0.1005 0.0117  0.0248  -0.0177 134 SER B O   
3871 C CB  . SER B 156 ? 0.0833 0.0903 0.0779 0.0113  0.0307  -0.0174 134 SER B CB  
3872 O OG  . SER B 156 ? 0.0984 0.1071 0.0973 0.0088  0.0324  -0.0151 134 SER B OG  
3873 N N   . TYR B 157 ? 0.0887 0.0908 0.0761 0.0087  0.0288  -0.0140 135 TYR B N   
3874 C CA  . TYR B 157 ? 0.0832 0.0836 0.0654 0.0089  0.0295  -0.0122 135 TYR B CA  
3875 C C   . TYR B 157 ? 0.1003 0.1023 0.0839 0.0082  0.0337  -0.0095 135 TYR B C   
3876 O O   . TYR B 157 ? 0.1169 0.1212 0.1070 0.0066  0.0351  -0.0090 135 TYR B O   
3877 C CB  . TYR B 157 ? 0.0899 0.0882 0.0718 0.0072  0.0263  -0.0117 135 TYR B CB  
3878 C CG  . TYR B 157 ? 0.1065 0.1054 0.0938 0.0046  0.0262  -0.0104 135 TYR B CG  
3879 C CD1 . TYR B 157 ? 0.0923 0.0908 0.0798 0.0036  0.0281  -0.0081 135 TYR B CD1 
3880 C CD2 . TYR B 157 ? 0.0886 0.0881 0.0804 0.0034  0.0241  -0.0116 135 TYR B CD2 
3881 C CE1 . TYR B 157 ? 0.0888 0.0876 0.0811 0.0015  0.0277  -0.0074 135 TYR B CE1 
3882 C CE2 . TYR B 157 ? 0.0794 0.0795 0.0755 0.0014  0.0238  -0.0108 135 TYR B CE2 
3883 C CZ  . TYR B 157 ? 0.0931 0.0929 0.0895 0.0005  0.0255  -0.0089 135 TYR B CZ  
3884 O OH  . TYR B 157 ? 0.1213 0.1213 0.1217 -0.0013 0.0250  -0.0086 135 TYR B OH  
3885 N N   . TYR B 158 ? 0.1040 0.1053 0.0825 0.0093  0.0347  -0.0077 136 TYR B N   
3886 C CA  . TYR B 158 ? 0.1156 0.1182 0.0957 0.0084  0.0378  -0.0046 136 TYR B CA  
3887 C C   . TYR B 158 ? 0.1351 0.1350 0.1147 0.0069  0.0376  -0.0024 136 TYR B C   
3888 O O   . TYR B 158 ? 0.1254 0.1228 0.0997 0.0079  0.0358  -0.0024 136 TYR B O   
3889 C CB  . TYR B 158 ? 0.1333 0.1368 0.1081 0.0106  0.0395  -0.0037 136 TYR B CB  
3890 C CG  . TYR B 158 ? 0.1628 0.1680 0.1404 0.0095  0.0431  -0.0005 136 TYR B CG  
3891 C CD1 . TYR B 158 ? 0.2047 0.2136 0.1881 0.0089  0.0452  -0.0007 136 TYR B CD1 
3892 C CD2 . TYR B 158 ? 0.2841 0.2870 0.2590 0.0090  0.0442  0.0026  136 TYR B CD2 
3893 C CE1 . TYR B 158 ? 0.2736 0.2841 0.2602 0.0076  0.0484  0.0022  136 TYR B CE1 
3894 C CE2 . TYR B 158 ? 0.2689 0.2729 0.2468 0.0078  0.0475  0.0057  136 TYR B CE2 
3895 C CZ  . TYR B 158 ? 0.3291 0.3369 0.3129 0.0070  0.0496  0.0054  136 TYR B CZ  
3896 O OH  . TYR B 158 ? 0.4455 0.4545 0.4328 0.0056  0.0528  0.0084  136 TYR B OH  
3897 N N   . ALA B 159 ? 0.1088 0.1093 0.0942 0.0046  0.0393  -0.0007 137 ALA B N   
3898 C CA  . ALA B 159 ? 0.0913 0.0890 0.0769 0.0032  0.0393  0.0013  137 ALA B CA  
3899 C C   . ALA B 159 ? 0.1577 0.1548 0.1424 0.0032  0.0421  0.0047  137 ALA B C   
3900 O O   . ALA B 159 ? 0.1954 0.1945 0.1851 0.0019  0.0443  0.0058  137 ALA B O   
3901 C CB  . ALA B 159 ? 0.1482 0.1463 0.1410 0.0006  0.0387  0.0004  137 ALA B CB  
3902 N N   . THR B 160 ? 0.1200 0.1143 0.0985 0.0045  0.0419  0.0065  138 THR B N   
3903 C CA  . THR B 160 ? 0.1258 0.1190 0.1029 0.0046  0.0446  0.0101  138 THR B CA  
3904 C C   . THR B 160 ? 0.1801 0.1709 0.1622 0.0022  0.0455  0.0121  138 THR B C   
3905 O O   . THR B 160 ? 0.2474 0.2365 0.2313 0.0012  0.0438  0.0110  138 THR B O   
3906 C CB  . THR B 160 ? 0.2009 0.1919 0.1692 0.0073  0.0439  0.0114  138 THR B CB  
3907 O OG1 . THR B 160 ? 0.2247 0.2128 0.1908 0.0075  0.0415  0.0112  138 THR B OG1 
3908 C CG2 . THR B 160 ? 0.2996 0.2927 0.2629 0.0097  0.0428  0.0091  138 THR B CG2 
3909 N N   . GLY B 161 ? 0.2865 0.2771 0.2709 0.0013  0.0483  0.0150  139 GLY B N   
3910 C CA  . GLY B 161 ? 0.3021 0.2896 0.2908 -0.0008 0.0491  0.0170  139 GLY B CA  
3911 C C   . GLY B 161 ? 0.2939 0.2771 0.2763 0.0008  0.0486  0.0194  139 GLY B C   
3912 O O   . GLY B 161 ? 0.3295 0.3124 0.3044 0.0035  0.0477  0.0195  139 GLY B O   
3913 N N   . ILE B 162 ? 0.3490 0.3285 0.3344 -0.0007 0.0488  0.0211  140 ILE B N   
3914 C CA  . ILE B 162 ? 0.3266 0.3017 0.3065 0.0010  0.0485  0.0237  140 ILE B CA  
3915 C C   . ILE B 162 ? 0.3541 0.3285 0.3312 0.0018  0.0511  0.0274  140 ILE B C   
3916 O O   . ILE B 162 ? 0.4227 0.3983 0.4053 -0.0002 0.0534  0.0287  140 ILE B O   
3917 C CB  . ILE B 162 ? 0.2860 0.2569 0.2702 -0.0007 0.0477  0.0241  140 ILE B CB  
3918 C CG1 . ILE B 162 ? 0.3144 0.2865 0.3007 -0.0014 0.0451  0.0203  140 ILE B CG1 
3919 C CG2 . ILE B 162 ? 0.2923 0.2584 0.2707 0.0014  0.0473  0.0270  140 ILE B CG2 
3920 C CD1 . ILE B 162 ? 0.3368 0.3063 0.3294 -0.0033 0.0433  0.0191  140 ILE B CD1 
3921 N N   . GLY B 163 ? 0.2761 0.2489 0.2449 0.0048  0.0506  0.0290  141 GLY B N   
3922 C CA  . GLY B 163 ? 0.3024 0.2747 0.2675 0.0059  0.0530  0.0326  141 GLY B CA  
3923 C C   . GLY B 163 ? 0.3133 0.2832 0.2692 0.0093  0.0517  0.0341  141 GLY B C   
3924 O O   . GLY B 163 ? 0.3355 0.3036 0.2883 0.0107  0.0488  0.0328  141 GLY B O   
3925 N N   . GLN B 164 ? 0.2929 0.2630 0.2442 0.0109  0.0537  0.0369  142 GLN B N   
3926 C CA  . GLN B 164 ? 0.2815 0.2496 0.2236 0.0144  0.0523  0.0384  142 GLN B CA  
3927 C C   . GLN B 164 ? 0.2282 0.1989 0.1650 0.0168  0.0493  0.0347  142 GLN B C   
3928 O O   . GLN B 164 ? 0.2266 0.2012 0.1644 0.0164  0.0497  0.0321  142 GLN B O   
3929 C CB  . GLN B 164 ? 0.3666 0.3351 0.3049 0.0155  0.0554  0.0418  142 GLN B CB  
3930 C CG  . GLN B 164 ? 0.3987 0.3627 0.3369 0.0151  0.0571  0.0465  142 GLN B CG  
3931 C CD  . GLN B 164 ? 0.4724 0.4371 0.4060 0.0164  0.0602  0.0499  142 GLN B CD  
3932 O OE1 . GLN B 164 ? 0.4622 0.4267 0.3872 0.0198  0.0592  0.0505  142 GLN B OE1 
3933 N NE2 . GLN B 164 ? 0.5300 0.4958 0.4694 0.0137  0.0639  0.0521  142 GLN B NE2 
3934 N N   . PRO B 165 ? 0.2268 0.1954 0.1582 0.0192  0.0460  0.0343  143 PRO B N   
3935 C CA  . PRO B 165 ? 0.2198 0.1906 0.1464 0.0214  0.0426  0.0306  143 PRO B CA  
3936 C C   . PRO B 165 ? 0.2048 0.1789 0.1271 0.0230  0.0431  0.0291  143 PRO B C   
3937 O O   . PRO B 165 ? 0.2320 0.2090 0.1553 0.0227  0.0417  0.0253  143 PRO B O   
3938 C CB  . PRO B 165 ? 0.2683 0.2361 0.1892 0.0241  0.0396  0.0317  143 PRO B CB  
3939 C CG  . PRO B 165 ? 0.2492 0.2131 0.1746 0.0225  0.0407  0.0346  143 PRO B CG  
3940 C CD  . PRO B 165 ? 0.2615 0.2254 0.1920 0.0198  0.0451  0.0370  143 PRO B CD  
3941 N N   A ASP B 166 ? 0.2351 0.2086 0.1526 0.0247  0.0451  0.0320  144 ASP B N   
3942 N N   B ASP B 166 ? 0.2349 0.2084 0.1523 0.0247  0.0450  0.0319  144 ASP B N   
3943 C CA  A ASP B 166 ? 0.2209 0.1972 0.1336 0.0266  0.0458  0.0308  144 ASP B CA  
3944 C CA  B ASP B 166 ? 0.2152 0.1917 0.1279 0.0266  0.0456  0.0305  144 ASP B CA  
3945 C C   A ASP B 166 ? 0.2211 0.2010 0.1392 0.0244  0.0487  0.0296  144 ASP B C   
3946 C C   B ASP B 166 ? 0.2208 0.2008 0.1389 0.0244  0.0488  0.0296  144 ASP B C   
3947 O O   A ASP B 166 ? 0.2090 0.1918 0.1253 0.0255  0.0481  0.0265  144 ASP B O   
3948 O O   B ASP B 166 ? 0.2104 0.1932 0.1265 0.0255  0.0483  0.0266  144 ASP B O   
3949 C CB  A ASP B 166 ? 0.2433 0.2181 0.1494 0.0289  0.0475  0.0345  144 ASP B CB  
3950 C CB  B ASP B 166 ? 0.2493 0.2243 0.1544 0.0294  0.0467  0.0337  144 ASP B CB  
3951 C CG  A ASP B 166 ? 0.3094 0.2817 0.2086 0.0321  0.0439  0.0348  144 ASP B CG  
3952 C CG  B ASP B 166 ? 0.2715 0.2442 0.1790 0.0280  0.0505  0.0388  144 ASP B CG  
3953 O OD1 A ASP B 166 ? 0.3947 0.3685 0.2888 0.0345  0.0407  0.0316  144 ASP B OD1 
3954 O OD1 B ASP B 166 ? 0.2843 0.2574 0.1996 0.0247  0.0530  0.0396  144 ASP B OD1 
3955 O OD2 A ASP B 166 ? 0.4013 0.3702 0.3005 0.0321  0.0440  0.0380  144 ASP B OD2 
3956 O OD2 B ASP B 166 ? 0.3179 0.2882 0.2194 0.0302  0.0509  0.0419  144 ASP B OD2 
3957 N N   . GLU B 167 ? 0.2000 0.1795 0.1252 0.0214  0.0518  0.0319  145 GLU B N   
3958 C CA  . GLU B 167 ? 0.2442 0.2274 0.1756 0.0191  0.0545  0.0308  145 GLU B CA  
3959 C C   . GLU B 167 ? 0.1885 0.1738 0.1242 0.0180  0.0520  0.0263  145 GLU B C   
3960 O O   . GLU B 167 ? 0.1805 0.1693 0.1172 0.0181  0.0525  0.0238  145 GLU B O   
3961 C CB  . GLU B 167 ? 0.2803 0.2626 0.2190 0.0160  0.0578  0.0342  145 GLU B CB  
3962 C CG  . GLU B 167 ? 0.3950 0.3816 0.3405 0.0138  0.0606  0.0332  145 GLU B CG  
3963 C CD  . GLU B 167 ? 0.5137 0.5038 0.4549 0.0157  0.0628  0.0331  145 GLU B CD  
3964 O OE1 . GLU B 167 ? 0.5483 0.5372 0.4814 0.0185  0.0632  0.0348  145 GLU B OE1 
3965 O OE2 . GLU B 167 ? 0.5586 0.5529 0.5046 0.0146  0.0643  0.0312  145 GLU B OE2 
3966 N N   . ILE B 168 ? 0.1745 0.1576 0.1124 0.0170  0.0493  0.0253  146 ILE B N   
3967 C CA  . ILE B 168 ? 0.1669 0.1517 0.1085 0.0160  0.0469  0.0212  146 ILE B CA  
3968 C C   . ILE B 168 ? 0.1815 0.1677 0.1170 0.0187  0.0440  0.0178  146 ILE B C   
3969 O O   . ILE B 168 ? 0.1484 0.1373 0.0863 0.0183  0.0432  0.0145  146 ILE B O   
3970 C CB  . ILE B 168 ? 0.1429 0.1250 0.0875 0.0146  0.0448  0.0211  146 ILE B CB  
3971 C CG1 . ILE B 168 ? 0.2204 0.2009 0.1718 0.0118  0.0475  0.0238  146 ILE B CG1 
3972 C CG2 . ILE B 168 ? 0.1277 0.1116 0.0752 0.0138  0.0422  0.0169  146 ILE B CG2 
3973 C CD1 . ILE B 168 ? 0.2382 0.2220 0.1970 0.0093  0.0499  0.0231  146 ILE B CD1 
3974 N N   . ALA B 169 ? 0.1767 0.1612 0.1048 0.0214  0.0422  0.0186  147 ALA B N   
3975 C CA  . ALA B 169 ? 0.1865 0.1720 0.1088 0.0240  0.0392  0.0153  147 ALA B CA  
3976 C C   . ALA B 169 ? 0.1975 0.1859 0.1185 0.0249  0.0412  0.0140  147 ALA B C   
3977 O O   . ALA B 169 ? 0.1900 0.1799 0.1103 0.0257  0.0392  0.0102  147 ALA B O   
3978 C CB  . ALA B 169 ? 0.2096 0.1928 0.1243 0.0269  0.0369  0.0164  147 ALA B CB  
3979 N N   . ARG B 170 ? 0.1785 0.1674 0.0991 0.0249  0.0452  0.0173  148 ARG B N   
3980 C CA  . ARG B 170 ? 0.1765 0.1686 0.0963 0.0257  0.0477  0.0165  148 ARG B CA  
3981 C C   . ARG B 170 ? 0.1757 0.1708 0.1029 0.0236  0.0484  0.0138  148 ARG B C   
3982 O O   . ARG B 170 ? 0.2013 0.1984 0.1274 0.0248  0.0477  0.0105  148 ARG B O   
3983 C CB  . ARG B 170 ? 0.2104 0.2027 0.1293 0.0257  0.0523  0.0210  148 ARG B CB  
3984 C CG  . ARG B 170 ? 0.2981 0.2941 0.2167 0.0265  0.0554  0.0203  148 ARG B CG  
3985 C CD  . ARG B 170 ? 0.4040 0.4007 0.3230 0.0260  0.0602  0.0249  148 ARG B CD  
3986 N NE  . ARG B 170 ? 0.4756 0.4728 0.4038 0.0222  0.0626  0.0270  148 ARG B NE  
3987 C CZ  . ARG B 170 ? 0.5386 0.5393 0.4743 0.0201  0.0640  0.0254  148 ARG B CZ  
3988 N NH1 . ARG B 170 ? 0.5528 0.5538 0.4969 0.0168  0.0658  0.0273  148 ARG B NH1 
3989 N NH2 . ARG B 170 ? 0.5726 0.5766 0.5077 0.0214  0.0636  0.0216  148 ARG B NH2 
3990 N N   . ILE B 171 ? 0.1734 0.1684 0.1082 0.0205  0.0497  0.0152  149 ILE B N   
3991 C CA  . ILE B 171 ? 0.1826 0.1804 0.1249 0.0184  0.0500  0.0128  149 ILE B CA  
3992 C C   . ILE B 171 ? 0.1981 0.1959 0.1401 0.0190  0.0460  0.0084  149 ILE B C   
3993 O O   . ILE B 171 ? 0.1796 0.1798 0.1237 0.0192  0.0458  0.0054  149 ILE B O   
3994 C CB  . ILE B 171 ? 0.2028 0.2002 0.1532 0.0151  0.0515  0.0150  149 ILE B CB  
3995 C CG1 . ILE B 171 ? 0.2573 0.2550 0.2091 0.0142  0.0556  0.0191  149 ILE B CG1 
3996 C CG2 . ILE B 171 ? 0.2092 0.2093 0.1673 0.0131  0.0511  0.0122  149 ILE B CG2 
3997 C CD1 . ILE B 171 ? 0.3126 0.3086 0.2716 0.0110  0.0567  0.0215  149 ILE B CD1 
3998 N N   . ALA B 172 ? 0.1620 0.1568 0.1012 0.0194  0.0428  0.0080  150 ALA B N   
3999 C CA  . ALA B 172 ? 0.1532 0.1476 0.0919 0.0198  0.0388  0.0040  150 ALA B CA  
4000 C C   . ALA B 172 ? 0.1469 0.1423 0.0808 0.0224  0.0375  0.0010  150 ALA B C   
4001 O O   . ALA B 172 ? 0.1754 0.1719 0.1116 0.0223  0.0361  -0.0024 150 ALA B O   
4002 C CB  . ALA B 172 ? 0.1678 0.1592 0.1037 0.0201  0.0357  0.0044  150 ALA B CB  
4003 N N   . ALA B 173 ? 0.1804 0.1753 0.1075 0.0248  0.0380  0.0022  151 ALA B N   
4004 C CA  . ALA B 173 ? 0.1898 0.1853 0.1116 0.0275  0.0368  -0.0006 151 ALA B CA  
4005 C C   . ALA B 173 ? 0.1580 0.1566 0.0832 0.0274  0.0395  -0.0020 151 ALA B C   
4006 O O   . ALA B 173 ? 0.1927 0.1917 0.1172 0.0286  0.0378  -0.0058 151 ALA B O   
4007 C CB  . ALA B 173 ? 0.2227 0.2172 0.1368 0.0302  0.0373  0.0015  151 ALA B CB  
4008 N N   A GLU B 174 ? 0.1680 0.1685 0.0971 0.0259  0.0438  0.0011  152 GLU B N   
4009 N N   B GLU B 174 ? 0.1686 0.1692 0.0978 0.0259  0.0438  0.0010  152 GLU B N   
4010 C CA  A GLU B 174 ? 0.1632 0.1674 0.0965 0.0256  0.0468  0.0002  152 GLU B CA  
4011 C CA  B GLU B 174 ? 0.1578 0.1620 0.0909 0.0257  0.0467  0.0000  152 GLU B CA  
4012 C C   A GLU B 174 ? 0.1613 0.1666 0.1011 0.0242  0.0451  -0.0032 152 GLU B C   
4013 C C   B GLU B 174 ? 0.1609 0.1661 0.1007 0.0242  0.0450  -0.0032 152 GLU B C   
4014 O O   A GLU B 174 ? 0.1672 0.1741 0.1076 0.0254  0.0451  -0.0062 152 GLU B O   
4015 O O   B GLU B 174 ? 0.1659 0.1728 0.1064 0.0254  0.0450  -0.0063 152 GLU B O   
4016 C CB  A GLU B 174 ? 0.1841 0.1902 0.1215 0.0238  0.0513  0.0044  152 GLU B CB  
4017 C CB  B GLU B 174 ? 0.1959 0.2021 0.1328 0.0241  0.0514  0.0041  152 GLU B CB  
4018 C CG  A GLU B 174 ? 0.2575 0.2680 0.2002 0.0232  0.0546  0.0037  152 GLU B CG  
4019 C CG  B GLU B 174 ? 0.2518 0.2572 0.1820 0.0258  0.0536  0.0074  152 GLU B CG  
4020 C CD  A GLU B 174 ? 0.3984 0.4108 0.3467 0.0208  0.0586  0.0078  152 GLU B CD  
4021 C CD  B GLU B 174 ? 0.3669 0.3745 0.3010 0.0242  0.0585  0.0114  152 GLU B CD  
4022 O OE1 A GLU B 174 ? 0.4737 0.4849 0.4181 0.0212  0.0608  0.0114  152 GLU B OE1 
4023 O OE1 B GLU B 174 ? 0.4439 0.4540 0.3863 0.0217  0.0600  0.0113  152 GLU B OE1 
4024 O OE2 A GLU B 174 ? 0.3617 0.3766 0.3183 0.0186  0.0594  0.0074  152 GLU B OE2 
4025 O OE2 B GLU B 174 ? 0.3751 0.3820 0.3041 0.0255  0.0607  0.0146  152 GLU B OE2 
4026 N N   . LYS B 175 ? 0.1437 0.1477 0.0880 0.0218  0.0436  -0.0026 153 LYS B N   
4027 C CA  . LYS B 175 ? 0.1376 0.1425 0.0882 0.0205  0.0420  -0.0053 153 LYS B CA  
4028 C C   . LYS B 175 ? 0.1482 0.1510 0.0958 0.0220  0.0379  -0.0094 153 LYS B C   
4029 O O   . LYS B 175 ? 0.1595 0.1634 0.1107 0.0221  0.0371  -0.0123 153 LYS B O   
4030 C CB  . LYS B 175 ? 0.1338 0.1377 0.0897 0.0176  0.0417  -0.0035 153 LYS B CB  
4031 C CG  . LYS B 175 ? 0.1761 0.1818 0.1367 0.0157  0.0454  0.0001  153 LYS B CG  
4032 C CD  . LYS B 175 ? 0.2135 0.2235 0.1794 0.0155  0.0479  -0.0007 153 LYS B CD  
4033 C CE  . LYS B 175 ? 0.2787 0.2906 0.2487 0.0137  0.0518  0.0030  153 LYS B CE  
4034 N NZ  . LYS B 175 ? 0.3450 0.3617 0.3209 0.0135  0.0541  0.0021  153 LYS B NZ  
4035 N N   . VAL B 176 ? 0.1597 0.1597 0.1012 0.0232  0.0352  -0.0097 154 VAL B N   
4036 C CA  . VAL B 176 ? 0.1850 0.1829 0.1232 0.0248  0.0311  -0.0135 154 VAL B CA  
4037 C C   . VAL B 176 ? 0.1741 0.1732 0.1099 0.0272  0.0319  -0.0159 154 VAL B C   
4038 O O   . VAL B 176 ? 0.1960 0.1944 0.1334 0.0277  0.0299  -0.0193 154 VAL B O   
4039 C CB  . VAL B 176 ? 0.1855 0.1808 0.1177 0.0259  0.0280  -0.0133 154 VAL B CB  
4040 C CG1 . VAL B 176 ? 0.2251 0.2186 0.1541 0.0277  0.0237  -0.0173 154 VAL B CG1 
4041 C CG2 . VAL B 176 ? 0.1819 0.1759 0.1170 0.0237  0.0267  -0.0117 154 VAL B CG2 
4042 N N   . ALA B 177 ? 0.1658 0.1664 0.0977 0.0287  0.0350  -0.0140 155 ALA B N   
4043 C CA  . ALA B 177 ? 0.1660 0.1680 0.0954 0.0311  0.0363  -0.0160 155 ALA B CA  
4044 C C   . ALA B 177 ? 0.2310 0.2358 0.1672 0.0303  0.0384  -0.0174 155 ALA B C   
4045 O O   . ALA B 177 ? 0.2343 0.2394 0.1699 0.0322  0.0381  -0.0204 155 ALA B O   
4046 C CB  . ALA B 177 ? 0.1983 0.2017 0.1224 0.0327  0.0396  -0.0132 155 ALA B CB  
4047 N N   . GLU B 178 ? 0.2038 0.2106 0.1469 0.0276  0.0405  -0.0152 156 GLU B N   
4048 C CA  . GLU B 178 ? 0.1961 0.2058 0.1465 0.0268  0.0420  -0.0165 156 GLU B CA  
4049 C C   . GLU B 178 ? 0.2408 0.2483 0.1940 0.0266  0.0382  -0.0200 156 GLU B C   
4050 O O   . GLU B 178 ? 0.2638 0.2728 0.2217 0.0269  0.0387  -0.0220 156 GLU B O   
4051 C CB  . GLU B 178 ? 0.2461 0.2586 0.2032 0.0240  0.0446  -0.0133 156 GLU B CB  
4052 C CG  . GLU B 178 ? 0.3108 0.3266 0.2683 0.0237  0.0491  -0.0100 156 GLU B CG  
4053 C CD  . GLU B 178 ? 0.3745 0.3929 0.3402 0.0208  0.0511  -0.0075 156 GLU B CD  
4054 O OE1 . GLU B 178 ? 0.3738 0.3929 0.3456 0.0196  0.0495  -0.0091 156 GLU B OE1 
4055 O OE2 . GLU B 178 ? 0.4393 0.4588 0.4054 0.0197  0.0541  -0.0038 156 GLU B OE2 
4056 N N   . GLY B 179 ? 0.1802 0.1840 0.1310 0.0261  0.0345  -0.0205 157 GLY B N   
4057 C CA  . GLY B 179 ? 0.1708 0.1719 0.1237 0.0258  0.0307  -0.0235 157 GLY B CA  
4058 C C   . GLY B 179 ? 0.1307 0.1308 0.0879 0.0233  0.0291  -0.0226 157 GLY B C   
4059 O O   . GLY B 179 ? 0.1528 0.1505 0.1118 0.0231  0.0260  -0.0248 157 GLY B O   
4060 N N   . PHE B 180 ? 0.1378 0.1393 0.0964 0.0215  0.0311  -0.0192 158 PHE B N   
4061 C CA  . PHE B 180 ? 0.1262 0.1265 0.0881 0.0194  0.0296  -0.0183 158 PHE B CA  
4062 C C   . PHE B 180 ? 0.1425 0.1390 0.1002 0.0196  0.0254  -0.0197 158 PHE B C   
4063 O O   . PHE B 180 ? 0.1647 0.1602 0.1169 0.0207  0.0246  -0.0192 158 PHE B O   
4064 C CB  . PHE B 180 ? 0.1146 0.1163 0.0780 0.0176  0.0323  -0.0144 158 PHE B CB  
4065 C CG  . PHE B 180 ? 0.1044 0.1096 0.0743 0.0163  0.0356  -0.0129 158 PHE B CG  
4066 C CD1 . PHE B 180 ? 0.1337 0.1394 0.1101 0.0145  0.0352  -0.0129 158 PHE B CD1 
4067 C CD2 . PHE B 180 ? 0.1178 0.1260 0.0876 0.0170  0.0389  -0.0114 158 PHE B CD2 
4068 C CE1 . PHE B 180 ? 0.1312 0.1404 0.1142 0.0132  0.0377  -0.0117 158 PHE B CE1 
4069 C CE2 . PHE B 180 ? 0.1526 0.1645 0.1291 0.0157  0.0417  -0.0101 158 PHE B CE2 
4070 C CZ  . PHE B 180 ? 0.1200 0.1324 0.1033 0.0139  0.0409  -0.0103 158 PHE B CZ  
4071 N N   . PRO B 181 ? 0.1435 0.1382 0.1041 0.0188  0.0226  -0.0215 159 PRO B N   
4072 C CA  . PRO B 181 ? 0.1659 0.1574 0.1238 0.0186  0.0183  -0.0230 159 PRO B CA  
4073 C C   . PRO B 181 ? 0.1533 0.1445 0.1116 0.0167  0.0178  -0.0205 159 PRO B C   
4074 O O   . PRO B 181 ? 0.1493 0.1387 0.1062 0.0162  0.0142  -0.0213 159 PRO B O   
4075 C CB  . PRO B 181 ? 0.1517 0.1419 0.1142 0.0180  0.0157  -0.0253 159 PRO B CB  
4076 C CG  . PRO B 181 ? 0.1574 0.1502 0.1258 0.0168  0.0186  -0.0238 159 PRO B CG  
4077 C CD  . PRO B 181 ? 0.1600 0.1556 0.1266 0.0182  0.0231  -0.0224 159 PRO B CD  
4078 N N   . ARG B 182 ? 0.1199 0.1129 0.0812 0.0151  0.0210  -0.0176 160 ARG B N   
4079 C CA  . ARG B 182 ? 0.0935 0.0862 0.0564 0.0130  0.0204  -0.0151 160 ARG B CA  
4080 C C   . ARG B 182 ? 0.1105 0.1045 0.0734 0.0127  0.0247  -0.0120 160 ARG B C   
4081 O O   . ARG B 182 ? 0.1064 0.1022 0.0718 0.0128  0.0279  -0.0116 160 ARG B O   
4082 C CB  . ARG B 182 ? 0.0868 0.0797 0.0563 0.0103  0.0185  -0.0152 160 ARG B CB  
4083 C CG  . ARG B 182 ? 0.0896 0.0825 0.0611 0.0082  0.0178  -0.0132 160 ARG B CG  
4084 C CD  . ARG B 182 ? 0.1136 0.1069 0.0908 0.0060  0.0160  -0.0135 160 ARG B CD  
4085 N NE  . ARG B 182 ? 0.1038 0.0972 0.0827 0.0043  0.0149  -0.0121 160 ARG B NE  
4086 C CZ  . ARG B 182 ? 0.1233 0.1176 0.1058 0.0028  0.0160  -0.0108 160 ARG B CZ  
4087 N NH1 . ARG B 182 ? 0.1532 0.1486 0.1386 0.0024  0.0182  -0.0106 160 ARG B NH1 
4088 N NH2 . ARG B 182 ? 0.1381 0.1325 0.1217 0.0017  0.0149  -0.0099 160 ARG B NH2 
4089 N N   . LEU B 183 ? 0.0995 0.0925 0.0601 0.0124  0.0246  -0.0099 161 LEU B N   
4090 C CA  . LEU B 183 ? 0.1250 0.1183 0.0861 0.0119  0.0283  -0.0066 161 LEU B CA  
4091 C C   . LEU B 183 ? 0.1358 0.1283 0.1007 0.0095  0.0271  -0.0051 161 LEU B C   
4092 O O   . LEU B 183 ? 0.1432 0.1349 0.1075 0.0093  0.0237  -0.0059 161 LEU B O   
4093 C CB  . LEU B 183 ? 0.1621 0.1547 0.1165 0.0140  0.0291  -0.0049 161 LEU B CB  
4094 C CG  . LEU B 183 ? 0.1995 0.1933 0.1503 0.0161  0.0295  -0.0062 161 LEU B CG  
4095 C CD1 . LEU B 183 ? 0.2262 0.2191 0.1706 0.0180  0.0298  -0.0042 161 LEU B CD1 
4096 C CD2 . LEU B 183 ? 0.1777 0.1743 0.1330 0.0155  0.0327  -0.0059 161 LEU B CD2 
4097 N N   . GLN B 184 ? 0.0895 0.0826 0.0588 0.0078  0.0298  -0.0032 162 GLN B N   
4098 C CA  . GLN B 184 ? 0.0933 0.0852 0.0656 0.0061  0.0290  -0.0018 162 GLN B CA  
4099 C C   . GLN B 184 ? 0.1403 0.1307 0.1107 0.0064  0.0320  0.0015  162 GLN B C   
4100 O O   . GLN B 184 ? 0.1568 0.1480 0.1290 0.0059  0.0356  0.0029  162 GLN B O   
4101 C CB  . GLN B 184 ? 0.1146 0.1079 0.0942 0.0037  0.0289  -0.0026 162 GLN B CB  
4102 C CG  . GLN B 184 ? 0.1536 0.1458 0.1363 0.0021  0.0280  -0.0017 162 GLN B CG  
4103 C CD  . GLN B 184 ? 0.2132 0.2066 0.2026 -0.0001 0.0286  -0.0022 162 GLN B CD  
4104 O OE1 . GLN B 184 ? 0.2796 0.2732 0.2719 -0.0009 0.0313  -0.0009 162 GLN B OE1 
4105 N NE2 . GLN B 184 ? 0.1774 0.1717 0.1694 -0.0009 0.0260  -0.0041 162 GLN B NE2 
4106 N N   . ILE B 185 ? 0.1191 0.1074 0.0861 0.0072  0.0307  0.0028  163 ILE B N   
4107 C CA  . ILE B 185 ? 0.0981 0.0842 0.0628 0.0077  0.0332  0.0062  163 ILE B CA  
4108 C C   . ILE B 185 ? 0.1234 0.1081 0.0936 0.0056  0.0331  0.0072  163 ILE B C   
4109 O O   . ILE B 185 ? 0.1259 0.1101 0.0968 0.0055  0.0301  0.0062  163 ILE B O   
4110 C CB  . ILE B 185 ? 0.1408 0.1252 0.0981 0.0104  0.0316  0.0071  163 ILE B CB  
4111 C CG1 . ILE B 185 ? 0.1550 0.1407 0.1066 0.0127  0.0310  0.0054  163 ILE B CG1 
4112 C CG2 . ILE B 185 ? 0.1936 0.1752 0.1480 0.0111  0.0343  0.0112  163 ILE B CG2 
4113 C CD1 . ILE B 185 ? 0.2304 0.2178 0.1824 0.0128  0.0341  0.0061  163 ILE B CD1 
4114 N N   . LYS B 186 ? 0.1256 0.1097 0.0997 0.0040  0.0363  0.0091  164 LYS B N   
4115 C CA  . LYS B 186 ? 0.1117 0.0939 0.0909 0.0021  0.0360  0.0097  164 LYS B CA  
4116 C C   . LYS B 186 ? 0.1273 0.1056 0.1028 0.0034  0.0363  0.0126  164 LYS B C   
4117 O O   . LYS B 186 ? 0.1827 0.1597 0.1536 0.0048  0.0387  0.0155  164 LYS B O   
4118 C CB  . LYS B 186 ? 0.1798 0.1628 0.1658 -0.0003 0.0387  0.0102  164 LYS B CB  
4119 C CG  . LYS B 186 ? 0.2813 0.2680 0.2718 -0.0015 0.0375  0.0069  164 LYS B CG  
4120 C CD  . LYS B 186 ? 0.3910 0.3786 0.3896 -0.0041 0.0385  0.0065  164 LYS B CD  
4121 C CE  . LYS B 186 ? 0.4055 0.3965 0.4079 -0.0048 0.0365  0.0031  164 LYS B CE  
4122 N NZ  . LYS B 186 ? 0.3283 0.3190 0.3289 -0.0043 0.0326  0.0010  164 LYS B NZ  
4123 N N   . ILE B 187 ? 0.1259 0.1026 0.1033 0.0031  0.0339  0.0119  165 ILE B N   
4124 C CA  . ILE B 187 ? 0.1435 0.1164 0.1179 0.0045  0.0337  0.0144  165 ILE B CA  
4125 C C   . ILE B 187 ? 0.1989 0.1693 0.1789 0.0030  0.0332  0.0142  165 ILE B C   
4126 O O   . ILE B 187 ? 0.1689 0.1408 0.1544 0.0010  0.0326  0.0118  165 ILE B O   
4127 C CB  . ILE B 187 ? 0.1589 0.1324 0.1281 0.0071  0.0304  0.0135  165 ILE B CB  
4128 C CG1 . ILE B 187 ? 0.1690 0.1449 0.1417 0.0064  0.0272  0.0101  165 ILE B CG1 
4129 C CG2 . ILE B 187 ? 0.1979 0.1731 0.1609 0.0090  0.0306  0.0136  165 ILE B CG2 
4130 C CD1 . ILE B 187 ? 0.1744 0.1507 0.1443 0.0085  0.0241  0.0096  165 ILE B CD1 
4131 N N   . GLY B 188 ? 0.1992 0.1655 0.1773 0.0042  0.0332  0.0166  166 GLY B N   
4132 C CA  . GLY B 188 ? 0.1817 0.1450 0.1642 0.0034  0.0322  0.0160  166 GLY B CA  
4133 C C   . GLY B 188 ? 0.2042 0.1631 0.1901 0.0018  0.0350  0.0187  166 GLY B C   
4134 O O   . GLY B 188 ? 0.2415 0.2003 0.2271 0.0009  0.0382  0.0213  166 GLY B O   
4135 N N   . GLY B 189 ? 0.2017 0.1570 0.1911 0.0015  0.0338  0.0182  167 GLY B N   
4136 C CA  . GLY B 189 ? 0.2270 0.1775 0.2207 -0.0004 0.0361  0.0206  167 GLY B CA  
4137 C C   . GLY B 189 ? 0.2272 0.1728 0.2164 0.0012  0.0381  0.0256  167 GLY B C   
4138 O O   . GLY B 189 ? 0.2404 0.1821 0.2327 -0.0005 0.0407  0.0286  167 GLY B O   
4139 N N   . ARG B 190 ? 0.2385 0.1844 0.2207 0.0045  0.0367  0.0265  168 ARG B N   
4140 C CA  . ARG B 190 ? 0.2189 0.1606 0.1953 0.0068  0.0380  0.0312  168 ARG B CA  
4141 C C   . ARG B 190 ? 0.2130 0.1557 0.1839 0.0105  0.0346  0.0301  168 ARG B C   
4142 O O   . ARG B 190 ? 0.2049 0.1519 0.1768 0.0107  0.0319  0.0261  168 ARG B O   
4143 C CB  . ARG B 190 ? 0.2114 0.1549 0.1838 0.0067  0.0415  0.0343  168 ARG B CB  
4144 C CG  . ARG B 190 ? 0.1993 0.1489 0.1673 0.0080  0.0402  0.0316  168 ARG B CG  
4145 C CD  . ARG B 190 ? 0.2025 0.1543 0.1667 0.0081  0.0435  0.0338  168 ARG B CD  
4146 N NE  . ARG B 190 ? 0.2232 0.1802 0.1842 0.0091  0.0419  0.0306  168 ARG B NE  
4147 C CZ  . ARG B 190 ? 0.2538 0.2144 0.2119 0.0096  0.0434  0.0306  168 ARG B CZ  
4148 N NH1 . ARG B 190 ? 0.2762 0.2369 0.2349 0.0090  0.0460  0.0331  168 ARG B NH1 
4149 N NH2 . ARG B 190 ? 0.2904 0.2548 0.2456 0.0106  0.0417  0.0275  168 ARG B NH2 
4150 N N   . PRO B 191 ? 0.2003 0.1391 0.1656 0.0133  0.0346  0.0338  169 PRO B N   
4151 C CA  . PRO B 191 ? 0.1891 0.1295 0.1496 0.0169  0.0311  0.0327  169 PRO B CA  
4152 C C   . PRO B 191 ? 0.2162 0.1632 0.1734 0.0176  0.0296  0.0301  169 PRO B C   
4153 O O   . PRO B 191 ? 0.1898 0.1385 0.1434 0.0172  0.0317  0.0313  169 PRO B O   
4154 C CB  . PRO B 191 ? 0.2643 0.1996 0.2184 0.0198  0.0321  0.0379  169 PRO B CB  
4155 C CG  . PRO B 191 ? 0.2799 0.2092 0.2382 0.0175  0.0352  0.0410  169 PRO B CG  
4156 C CD  . PRO B 191 ? 0.2424 0.1749 0.2063 0.0134  0.0376  0.0391  169 PRO B CD  
4157 N N   . VAL B 192 ? 0.1691 0.1197 0.1276 0.0185  0.0261  0.0264  170 VAL B N   
4158 C CA  . VAL B 192 ? 0.1540 0.1105 0.1110 0.0185  0.0245  0.0235  170 VAL B CA  
4159 C C   . VAL B 192 ? 0.1581 0.1156 0.1072 0.0212  0.0239  0.0252  170 VAL B C   
4160 O O   . VAL B 192 ? 0.1655 0.1268 0.1125 0.0209  0.0235  0.0234  170 VAL B O   
4161 C CB  . VAL B 192 ? 0.1482 0.1086 0.1091 0.0187  0.0211  0.0196  170 VAL B CB  
4162 C CG1 . VAL B 192 ? 0.1831 0.1432 0.1411 0.0222  0.0182  0.0201  170 VAL B CG1 
4163 C CG2 . VAL B 192 ? 0.1424 0.1084 0.1038 0.0174  0.0200  0.0165  170 VAL B CG2 
4164 N N   . GLU B 193 ? 0.1690 0.1226 0.1132 0.0241  0.0237  0.0286  171 GLU B N   
4165 C CA  . GLU B 193 ? 0.1794 0.1337 0.1153 0.0269  0.0231  0.0303  171 GLU B CA  
4166 C C   . GLU B 193 ? 0.1849 0.1397 0.1176 0.0257  0.0267  0.0316  171 GLU B C   
4167 O O   . GLU B 193 ? 0.1948 0.1524 0.1219 0.0273  0.0259  0.0307  171 GLU B O   
4168 C CB  . GLU B 193 ? 0.2269 0.1766 0.1575 0.0305  0.0225  0.0342  171 GLU B CB  
4169 C CG  . GLU B 193 ? 0.3035 0.2469 0.2346 0.0296  0.0263  0.0388  171 GLU B CG  
4170 C CD  . GLU B 193 ? 0.4648 0.4048 0.4025 0.0289  0.0254  0.0383  171 GLU B CD  
4171 O OE1 . GLU B 193 ? 0.5658 0.4996 0.5033 0.0293  0.0273  0.0422  171 GLU B OE1 
4172 O OE2 . GLU B 193 ? 0.3980 0.3415 0.3412 0.0281  0.0229  0.0341  171 GLU B OE2 
4173 N N   . ILE B 194 ? 0.1687 0.1211 0.1053 0.0230  0.0306  0.0334  172 ILE B N   
4174 C CA  . ILE B 194 ? 0.1616 0.1151 0.0963 0.0217  0.0345  0.0347  172 ILE B CA  
4175 C C   . ILE B 194 ? 0.1656 0.1247 0.1034 0.0199  0.0335  0.0300  172 ILE B C   
4176 O O   . ILE B 194 ? 0.1758 0.1375 0.1095 0.0206  0.0344  0.0295  172 ILE B O   
4177 C CB  . ILE B 194 ? 0.1853 0.1362 0.1260 0.0187  0.0382  0.0371  172 ILE B CB  
4178 C CG1 . ILE B 194 ? 0.2677 0.2134 0.2073 0.0200  0.0383  0.0408  172 ILE B CG1 
4179 C CG2 . ILE B 194 ? 0.1988 0.1529 0.1395 0.0175  0.0411  0.0374  172 ILE B CG2 
4180 C CD1 . ILE B 194 ? 0.3308 0.2736 0.2771 0.0169  0.0414  0.0430  172 ILE B CD1 
4181 N N   . ASP B 195 ? 0.1716 0.1324 0.1164 0.0178  0.0314  0.0266  173 ASP B N   
4182 C CA  . ASP B 195 ? 0.1468 0.1125 0.0945 0.0163  0.0301  0.0224  173 ASP B CA  
4183 C C   . ASP B 195 ? 0.1611 0.1295 0.1033 0.0188  0.0268  0.0204  173 ASP B C   
4184 O O   . ASP B 195 ? 0.1462 0.1175 0.0870 0.0186  0.0267  0.0184  173 ASP B O   
4185 C CB  . ASP B 195 ? 0.1643 0.1311 0.1195 0.0142  0.0281  0.0195  173 ASP B CB  
4186 C CG  . ASP B 195 ? 0.2000 0.1644 0.1614 0.0116  0.0306  0.0205  173 ASP B CG  
4187 O OD1 . ASP B 195 ? 0.2197 0.1834 0.1817 0.0102  0.0341  0.0223  173 ASP B OD1 
4188 O OD2 . ASP B 195 ? 0.2257 0.1891 0.1915 0.0109  0.0291  0.0192  173 ASP B OD2 
4189 N N   . ILE B 196 ? 0.1528 0.1204 0.0925 0.0212  0.0238  0.0208  174 ILE B N   
4190 C CA  . ILE B 196 ? 0.1391 0.1095 0.0744 0.0235  0.0201  0.0187  174 ILE B CA  
4191 C C   . ILE B 196 ? 0.1570 0.1268 0.0837 0.0259  0.0213  0.0202  174 ILE B C   
4192 O O   . ILE B 196 ? 0.1650 0.1377 0.0890 0.0266  0.0195  0.0175  174 ILE B O   
4193 C CB  . ILE B 196 ? 0.1303 0.1004 0.0657 0.0256  0.0166  0.0187  174 ILE B CB  
4194 C CG1 . ILE B 196 ? 0.1366 0.1085 0.0803 0.0233  0.0153  0.0163  174 ILE B CG1 
4195 C CG2 . ILE B 196 ? 0.1631 0.1360 0.0938 0.0281  0.0126  0.0169  174 ILE B CG2 
4196 C CD1 . ILE B 196 ? 0.1717 0.1428 0.1168 0.0252  0.0130  0.0169  174 ILE B CD1 
4197 N N   . GLU B 197 ? 0.1658 0.1319 0.0882 0.0272  0.0243  0.0245  175 GLU B N   
4198 C CA  . GLU B 197 ? 0.1686 0.1350 0.0848 0.0290  0.0255  0.0256  175 GLU B CA  
4199 C C   . GLU B 197 ? 0.1738 0.1431 0.0923 0.0269  0.0277  0.0236  175 GLU B C   
4200 O O   . GLU B 197 ? 0.1669 0.1384 0.0816 0.0283  0.0266  0.0217  175 GLU B O   
4201 C CB  . GLU B 197 ? 0.1912 0.1540 0.1060 0.0296  0.0282  0.0302  175 GLU B CB  
4202 C CG  . GLU B 197 ? 0.2363 0.1998 0.1453 0.0315  0.0292  0.0314  175 GLU B CG  
4203 C CD  . GLU B 197 ? 0.3924 0.3527 0.3010 0.0313  0.0328  0.0361  175 GLU B CD  
4204 O OE1 . GLU B 197 ? 0.3652 0.3220 0.2777 0.0300  0.0339  0.0385  175 GLU B OE1 
4205 O OE2 . GLU B 197 ? 0.4328 0.3939 0.3372 0.0324  0.0345  0.0373  175 GLU B OE2 
4206 N N   . THR B 198 ? 0.1587 0.1280 0.0837 0.0238  0.0305  0.0237  176 THR B N   
4207 C CA  . THR B 198 ? 0.1459 0.1182 0.0741 0.0218  0.0324  0.0217  176 THR B CA  
4208 C C   . THR B 198 ? 0.1350 0.1103 0.0624 0.0222  0.0293  0.0172  176 THR B C   
4209 O O   . THR B 198 ? 0.1545 0.1321 0.0800 0.0229  0.0291  0.0153  176 THR B O   
4210 C CB  . THR B 198 ? 0.1460 0.1179 0.0823 0.0182  0.0354  0.0222  176 THR B CB  
4211 O OG1 . THR B 198 ? 0.1877 0.1566 0.1254 0.0175  0.0383  0.0262  176 THR B OG1 
4212 C CG2 . THR B 198 ? 0.1594 0.1349 0.0992 0.0166  0.0368  0.0198  176 THR B CG2 
4213 N N   . VAL B 199 ? 0.1460 0.1216 0.0761 0.0216  0.0263  0.0153  177 VAL B N   
4214 C CA  . VAL B 199 ? 0.1330 0.1117 0.0645 0.0214  0.0227  0.0109  177 VAL B CA  
4215 C C   . VAL B 199 ? 0.1553 0.1344 0.0787 0.0247  0.0200  0.0097  177 VAL B C   
4216 O O   . VAL B 199 ? 0.1469 0.1278 0.0691 0.0250  0.0189  0.0067  177 VAL B O   
4217 C CB  . VAL B 199 ? 0.1445 0.1241 0.0823 0.0198  0.0195  0.0093  177 VAL B CB  
4218 C CG1 . VAL B 199 ? 0.1631 0.1456 0.1023 0.0195  0.0156  0.0054  177 VAL B CG1 
4219 C CG2 . VAL B 199 ? 0.1492 0.1286 0.0945 0.0166  0.0217  0.0096  177 VAL B CG2 
4220 N N   A ARG B 200 ? 0.1536 0.1310 0.0719 0.0273  0.0188  0.0119  178 ARG B N   
4221 N N   B ARG B 200 ? 0.1531 0.1305 0.0714 0.0273  0.0187  0.0119  178 ARG B N   
4222 C CA  A ARG B 200 ? 0.1539 0.1321 0.0664 0.0302  0.0154  0.0105  178 ARG B CA  
4223 C CA  B ARG B 200 ? 0.1544 0.1326 0.0668 0.0302  0.0154  0.0105  178 ARG B CA  
4224 C C   A ARG B 200 ? 0.1535 0.1321 0.0627 0.0310  0.0175  0.0106  178 ARG B C   
4225 C C   B ARG B 200 ? 0.1536 0.1323 0.0628 0.0310  0.0175  0.0106  178 ARG B C   
4226 O O   A ARG B 200 ? 0.1668 0.1471 0.0734 0.0322  0.0151  0.0075  178 ARG B O   
4227 O O   B ARG B 200 ? 0.1670 0.1473 0.0735 0.0322  0.0150  0.0075  178 ARG B O   
4228 C CB  A ARG B 200 ? 0.1486 0.1250 0.0574 0.0327  0.0136  0.0130  178 ARG B CB  
4229 C CB  B ARG B 200 ? 0.1627 0.1392 0.0715 0.0327  0.0135  0.0130  178 ARG B CB  
4230 C CG  A ARG B 200 ? 0.1658 0.1429 0.0786 0.0323  0.0104  0.0121  178 ARG B CG  
4231 C CG  B ARG B 200 ? 0.1608 0.1382 0.0730 0.0326  0.0096  0.0116  178 ARG B CG  
4232 C CD  A ARG B 200 ? 0.1938 0.1700 0.1021 0.0356  0.0071  0.0135  178 ARG B CD  
4233 C CD  B ARG B 200 ? 0.1936 0.1694 0.1020 0.0357  0.0075  0.0141  178 ARG B CD  
4234 N NE  A ARG B 200 ? 0.1899 0.1689 0.1048 0.0348  0.0030  0.0110  178 ARG B NE  
4235 N NE  B ARG B 200 ? 0.1868 0.1645 0.1019 0.0349  0.0041  0.0126  178 ARG B NE  
4236 C CZ  A ARG B 200 ? 0.2208 0.2033 0.1374 0.0346  -0.0012 0.0071  178 ARG B CZ  
4237 C CZ  B ARG B 200 ? 0.2310 0.2073 0.1464 0.0366  0.0030  0.0148  178 ARG B CZ  
4238 N NH1 A ARG B 200 ? 0.2619 0.2450 0.1737 0.0354  -0.0021 0.0048  178 ARG B NH1 
4239 N NH1 B ARG B 200 ? 0.2271 0.1993 0.1362 0.0390  0.0050  0.0190  178 ARG B NH1 
4240 N NH2 A ARG B 200 ? 0.1984 0.1837 0.1215 0.0337  -0.0044 0.0054  178 ARG B NH2 
4241 N NH2 B ARG B 200 ? 0.1882 0.1670 0.1102 0.0359  0.0001  0.0132  178 ARG B NH2 
4242 N N   . LYS B 201 ? 0.1512 0.1286 0.0610 0.0302  0.0220  0.0140  179 LYS B N   
4243 C CA  . LYS B 201 ? 0.1568 0.1351 0.0637 0.0310  0.0245  0.0144  179 LYS B CA  
4244 C C   . LYS B 201 ? 0.1674 0.1481 0.0777 0.0294  0.0252  0.0112  179 LYS B C   
4245 O O   . LYS B 201 ? 0.1828 0.1649 0.0897 0.0309  0.0249  0.0094  179 LYS B O   
4246 C CB  . LYS B 201 ? 0.1736 0.1500 0.0805 0.0306  0.0290  0.0192  179 LYS B CB  
4247 C CG  . LYS B 201 ? 0.2139 0.1876 0.1153 0.0332  0.0281  0.0223  179 LYS B CG  
4248 C CD  . LYS B 201 ? 0.2874 0.2589 0.1890 0.0327  0.0324  0.0271  179 LYS B CD  
4249 C CE  . LYS B 201 ? 0.3700 0.3392 0.2650 0.0359  0.0311  0.0298  179 LYS B CE  
4250 N NZ  . LYS B 201 ? 0.3952 0.3611 0.2911 0.0351  0.0348  0.0348  179 LYS B NZ  
4251 N N   . VAL B 202 ? 0.1440 0.1253 0.0610 0.0265  0.0262  0.0105  180 VAL B N   
4252 C CA  . VAL B 202 ? 0.1532 0.1368 0.0737 0.0251  0.0263  0.0072  180 VAL B CA  
4253 C C   . VAL B 202 ? 0.1663 0.1508 0.0843 0.0265  0.0217  0.0029  180 VAL B C   
4254 O O   . VAL B 202 ? 0.1621 0.1478 0.0787 0.0273  0.0214  0.0005  180 VAL B O   
4255 C CB  . VAL B 202 ? 0.1380 0.1220 0.0662 0.0219  0.0277  0.0070  180 VAL B CB  
4256 C CG1 . VAL B 202 ? 0.1493 0.1354 0.0809 0.0208  0.0267  0.0032  180 VAL B CG1 
4257 C CG2 . VAL B 202 ? 0.1409 0.1245 0.0728 0.0202  0.0322  0.0105  180 VAL B CG2 
4258 N N   . TRP B 203 ? 0.1664 0.1502 0.0839 0.0269  0.0181  0.0021  181 TRP B N   
4259 C CA  . TRP B 203 ? 0.1731 0.1577 0.0893 0.0278  0.0134  -0.0020 181 TRP B CA  
4260 C C   . TRP B 203 ? 0.1861 0.1708 0.0960 0.0307  0.0117  -0.0031 181 TRP B C   
4261 O O   . TRP B 203 ? 0.1852 0.1706 0.0945 0.0312  0.0093  -0.0067 181 TRP B O   
4262 C CB  . TRP B 203 ? 0.1811 0.1656 0.0985 0.0277  0.0098  -0.0025 181 TRP B CB  
4263 C CG  . TRP B 203 ? 0.2261 0.2117 0.1433 0.0282  0.0045  -0.0067 181 TRP B CG  
4264 C CD1 . TRP B 203 ? 0.2399 0.2259 0.1543 0.0301  0.0001  -0.0078 181 TRP B CD1 
4265 C CD2 . TRP B 203 ? 0.1984 0.1848 0.1192 0.0266  0.0030  -0.0104 181 TRP B CD2 
4266 N NE1 . TRP B 203 ? 0.2197 0.2068 0.1363 0.0295  -0.0041 -0.0120 181 TRP B NE1 
4267 C CE2 . TRP B 203 ? 0.2204 0.2075 0.1408 0.0274  -0.0024 -0.0136 181 TRP B CE2 
4268 C CE3 . TRP B 203 ? 0.2069 0.1935 0.1318 0.0247  0.0054  -0.0113 181 TRP B CE3 
4269 C CZ2 . TRP B 203 ? 0.2424 0.2297 0.1662 0.0261  -0.0052 -0.0175 181 TRP B CZ2 
4270 C CZ3 . TRP B 203 ? 0.2833 0.2702 0.2112 0.0237  0.0026  -0.0151 181 TRP B CZ3 
4271 C CH2 . TRP B 203 ? 0.2123 0.1993 0.1395 0.0243  -0.0026 -0.0181 181 TRP B CH2 
4272 N N   . GLU B 204 ? 0.1661 0.1497 0.0713 0.0327  0.0129  0.0001  182 GLU B N   
4273 C CA  . GLU B 204 ? 0.2229 0.2065 0.1215 0.0357  0.0116  -0.0007 182 GLU B CA  
4274 C C   . GLU B 204 ? 0.2574 0.2421 0.1555 0.0359  0.0139  -0.0023 182 GLU B C   
4275 O O   . GLU B 204 ? 0.2604 0.2454 0.1547 0.0378  0.0115  -0.0052 182 GLU B O   
4276 C CB  . GLU B 204 ? 0.2682 0.2503 0.1621 0.0376  0.0136  0.0036  182 GLU B CB  
4277 C CG  . GLU B 204 ? 0.4209 0.4029 0.3073 0.0411  0.0125  0.0032  182 GLU B CG  
4278 C CD  . GLU B 204 ? 0.6073 0.5877 0.4889 0.0431  0.0137  0.0074  182 GLU B CD  
4279 O OE1 . GLU B 204 ? 0.6137 0.5929 0.4968 0.0419  0.0181  0.0115  182 GLU B OE1 
4280 O OE2 . GLU B 204 ? 0.7012 0.6812 0.5778 0.0459  0.0102  0.0067  182 GLU B OE2 
4281 N N   . ARG B 205 ? 0.1870 0.1723 0.0891 0.0338  0.0183  -0.0006 183 ARG B N   
4282 C CA  . ARG B 205 ? 0.2190 0.2057 0.1209 0.0341  0.0207  -0.0019 183 ARG B CA  
4283 C C   . ARG B 205 ? 0.2460 0.2337 0.1523 0.0327  0.0190  -0.0061 183 ARG B C   
4284 O O   . ARG B 205 ? 0.3054 0.2939 0.2102 0.0339  0.0192  -0.0084 183 ARG B O   
4285 C CB  . ARG B 205 ? 0.2525 0.2399 0.1567 0.0328  0.0263  0.0019  183 ARG B CB  
4286 C CG  . ARG B 205 ? 0.3550 0.3410 0.2542 0.0344  0.0282  0.0062  183 ARG B CG  
4287 C CD  . ARG B 205 ? 0.4073 0.3943 0.3076 0.0337  0.0336  0.0095  183 ARG B CD  
4288 N NE  . ARG B 205 ? 0.4350 0.4241 0.3331 0.0351  0.0351  0.0076  183 ARG B NE  
4289 C CZ  . ARG B 205 ? 0.3922 0.3825 0.2887 0.0357  0.0394  0.0103  183 ARG B CZ  
4290 N NH1 . ARG B 205 ? 0.3670 0.3562 0.2640 0.0348  0.0425  0.0150  183 ARG B NH1 
4291 N NH2 . ARG B 205 ? 0.4171 0.4096 0.3115 0.0371  0.0406  0.0082  183 ARG B NH2 
4292 N N   . ILE B 206 ? 0.1885 0.1759 0.0999 0.0305  0.0172  -0.0071 184 ILE B N   
4293 C CA  . ILE B 206 ? 0.2100 0.1980 0.1260 0.0290  0.0158  -0.0107 184 ILE B CA  
4294 C C   . ILE B 206 ? 0.2611 0.2482 0.1771 0.0292  0.0104  -0.0144 184 ILE B C   
4295 O O   . ILE B 206 ? 0.2489 0.2361 0.1683 0.0283  0.0088  -0.0175 184 ILE B O   
4296 C CB  . ILE B 206 ? 0.2184 0.2070 0.1414 0.0260  0.0183  -0.0096 184 ILE B CB  
4297 C CG1 . ILE B 206 ? 0.1966 0.1843 0.1218 0.0246  0.0163  -0.0087 184 ILE B CG1 
4298 C CG2 . ILE B 206 ? 0.2265 0.2162 0.1509 0.0254  0.0235  -0.0060 184 ILE B CG2 
4299 C CD1 . ILE B 206 ? 0.2337 0.2218 0.1657 0.0218  0.0175  -0.0088 184 ILE B CD1 
4300 N N   . ARG B 207 ? 0.2126 0.1991 0.1255 0.0304  0.0074  -0.0140 185 ARG B N   
4301 C CA  . ARG B 207 ? 0.2207 0.2068 0.1343 0.0305  0.0018  -0.0175 185 ARG B CA  
4302 C C   . ARG B 207 ? 0.2518 0.2376 0.1635 0.0319  -0.0003 -0.0212 185 ARG B C   
4303 O O   . ARG B 207 ? 0.2631 0.2489 0.1698 0.0343  0.0013  -0.0209 185 ARG B O   
4304 C CB  . ARG B 207 ? 0.2577 0.2437 0.1681 0.0319  -0.0010 -0.0164 185 ARG B CB  
4305 C CG  . ARG B 207 ? 0.3305 0.3162 0.2338 0.0351  -0.0006 -0.0152 185 ARG B CG  
4306 C CD  . ARG B 207 ? 0.4428 0.4285 0.3437 0.0366  -0.0038 -0.0142 185 ARG B CD  
4307 N NE  . ARG B 207 ? 0.5207 0.5070 0.4249 0.0358  -0.0093 -0.0178 185 ARG B NE  
4308 C CZ  . ARG B 207 ? 0.6085 0.5955 0.5132 0.0363  -0.0128 -0.0176 185 ARG B CZ  
4309 N NH1 . ARG B 207 ? 0.6046 0.5914 0.5063 0.0377  -0.0114 -0.0140 185 ARG B NH1 
4310 N NH2 . ARG B 207 ? 0.6357 0.6239 0.5447 0.0352  -0.0178 -0.0210 185 ARG B NH2 
4311 N N   . GLY B 208 ? 0.2582 0.2434 0.1740 0.0306  -0.0038 -0.0247 186 GLY B N   
4312 C CA  . GLY B 208 ? 0.2866 0.2709 0.2013 0.0318  -0.0063 -0.0284 186 GLY B CA  
4313 C C   . GLY B 208 ? 0.3426 0.3268 0.2589 0.0316  -0.0032 -0.0292 186 GLY B C   
4314 O O   . GLY B 208 ? 0.3683 0.3515 0.2835 0.0329  -0.0048 -0.0322 186 GLY B O   
4315 N N   . THR B 209 ? 0.2943 0.2794 0.2136 0.0300  0.0010  -0.0267 187 THR B N   
4316 C CA  . THR B 209 ? 0.2849 0.2704 0.2065 0.0298  0.0040  -0.0273 187 THR B CA  
4317 C C   . THR B 209 ? 0.2956 0.2804 0.2240 0.0272  0.0029  -0.0287 187 THR B C   
4318 O O   . THR B 209 ? 0.3473 0.3321 0.2784 0.0269  0.0047  -0.0296 187 THR B O   
4319 C CB  . THR B 209 ? 0.2616 0.2490 0.1826 0.0298  0.0097  -0.0236 187 THR B CB  
4320 O OG1 . THR B 209 ? 0.2156 0.2035 0.1402 0.0275  0.0113  -0.0208 187 THR B OG1 
4321 C CG2 . THR B 209 ? 0.2701 0.2580 0.1842 0.0324  0.0110  -0.0218 187 THR B CG2 
4322 N N   . GLY B 210 ? 0.2619 0.2461 0.1931 0.0254  -0.0001 -0.0289 188 GLY B N   
4323 C CA  . GLY B 210 ? 0.2808 0.2641 0.2183 0.0228  -0.0014 -0.0300 188 GLY B CA  
4324 C C   . GLY B 210 ? 0.3143 0.2989 0.2551 0.0213  0.0027  -0.0273 188 GLY B C   
4325 O O   . GLY B 210 ? 0.3425 0.3266 0.2884 0.0195  0.0023  -0.0280 188 GLY B O   
4326 N N   . THR B 211 ? 0.2303 0.2165 0.1686 0.0220  0.0065  -0.0243 189 THR B N   
4327 C CA  . THR B 211 ? 0.1751 0.1626 0.1168 0.0205  0.0105  -0.0215 189 THR B CA  
4328 C C   . THR B 211 ? 0.1790 0.1665 0.1241 0.0182  0.0094  -0.0199 189 THR B C   
4329 O O   . THR B 211 ? 0.2025 0.1899 0.1451 0.0186  0.0078  -0.0189 189 THR B O   
4330 C CB  . THR B 211 ? 0.1760 0.1651 0.1150 0.0215  0.0149  -0.0184 189 THR B CB  
4331 O OG1 . THR B 211 ? 0.1998 0.1895 0.1363 0.0234  0.0159  -0.0197 189 THR B OG1 
4332 C CG2 . THR B 211 ? 0.1589 0.1495 0.1028 0.0196  0.0188  -0.0158 189 THR B CG2 
4333 N N   . ARG B 212 ? 0.1462 0.1344 0.0983 0.0155  0.0099  -0.0192 190 ARG B N   
4334 C CA  . ARG B 212 ? 0.1563 0.1452 0.1130 0.0129  0.0091  -0.0173 190 ARG B CA  
4335 C C   . ARG B 212 ? 0.1602 0.1499 0.1167 0.0126  0.0126  -0.0139 190 ARG B C   
4336 O O   . ARG B 212 ? 0.1338 0.1241 0.0894 0.0133  0.0162  -0.0129 190 ARG B O   
4337 C CB  . ARG B 212 ? 0.2147 0.2040 0.1783 0.0103  0.0082  -0.0177 190 ARG B CB  
4338 C CG  . ARG B 212 ? 0.3537 0.3416 0.3187 0.0099  0.0041  -0.0204 190 ARG B CG  
4339 C CD  . ARG B 212 ? 0.4024 0.3905 0.3739 0.0071  0.0030  -0.0198 190 ARG B CD  
4340 N NE  . ARG B 212 ? 0.3226 0.3114 0.2970 0.0065  0.0056  -0.0190 190 ARG B NE  
4341 C CZ  . ARG B 212 ? 0.3870 0.3752 0.3614 0.0077  0.0063  -0.0206 190 ARG B CZ  
4342 N NH1 . ARG B 212 ? 0.4668 0.4532 0.4379 0.0097  0.0047  -0.0232 190 ARG B NH1 
4343 N NH2 . ARG B 212 ? 0.3775 0.3669 0.3552 0.0072  0.0084  -0.0198 190 ARG B NH2 
4344 N N   . LEU B 213 ? 0.1457 0.1357 0.1034 0.0116  0.0116  -0.0123 191 LEU B N   
4345 C CA  . LEU B 213 ? 0.1417 0.1317 0.0990 0.0115  0.0144  -0.0093 191 LEU B CA  
4346 C C   . LEU B 213 ? 0.1394 0.1301 0.1026 0.0090  0.0143  -0.0080 191 LEU B C   
4347 O O   . LEU B 213 ? 0.1317 0.1230 0.0973 0.0080  0.0115  -0.0088 191 LEU B O   
4348 C CB  . LEU B 213 ? 0.1634 0.1525 0.1147 0.0136  0.0134  -0.0083 191 LEU B CB  
4349 C CG  . LEU B 213 ? 0.1768 0.1650 0.1266 0.0140  0.0161  -0.0048 191 LEU B CG  
4350 C CD1 . LEU B 213 ? 0.1982 0.1862 0.1465 0.0145  0.0206  -0.0032 191 LEU B CD1 
4351 C CD2 . LEU B 213 ? 0.2055 0.1929 0.1495 0.0165  0.0142  -0.0041 191 LEU B CD2 
4352 N N   . ALA B 214 ? 0.0966 0.0874 0.0623 0.0080  0.0174  -0.0063 192 ALA B N   
4353 C CA  . ALA B 214 ? 0.0973 0.0884 0.0676 0.0061  0.0176  -0.0051 192 ALA B CA  
4354 C C   . ALA B 214 ? 0.1205 0.1102 0.0893 0.0066  0.0201  -0.0025 192 ALA B C   
4355 O O   . ALA B 214 ? 0.1374 0.1264 0.1037 0.0075  0.0228  -0.0012 192 ALA B O   
4356 C CB  . ALA B 214 ? 0.1343 0.1265 0.1100 0.0042  0.0183  -0.0059 192 ALA B CB  
4357 N N   . VAL B 215 ? 0.0948 0.0840 0.0653 0.0061  0.0193  -0.0015 193 VAL B N   
4358 C CA  . VAL B 215 ? 0.0850 0.0722 0.0550 0.0064  0.0213  0.0010  193 VAL B CA  
4359 C C   . VAL B 215 ? 0.1229 0.1101 0.0985 0.0044  0.0217  0.0009  193 VAL B C   
4360 O O   . VAL B 215 ? 0.1237 0.1120 0.1016 0.0039  0.0196  -0.0002 193 VAL B O   
4361 C CB  . VAL B 215 ? 0.1129 0.0990 0.0788 0.0084  0.0197  0.0021  193 VAL B CB  
4362 C CG1 . VAL B 215 ? 0.1757 0.1591 0.1415 0.0087  0.0216  0.0048  193 VAL B CG1 
4363 C CG2 . VAL B 215 ? 0.1128 0.0987 0.0723 0.0106  0.0192  0.0021  193 VAL B CG2 
4364 N N   . ASP B 216 ? 0.1192 0.1055 0.0974 0.0033  0.0244  0.0019  194 ASP B N   
4365 C CA  . ASP B 216 ? 0.1056 0.0922 0.0895 0.0013  0.0245  0.0012  194 ASP B CA  
4366 C C   . ASP B 216 ? 0.1004 0.0840 0.0854 0.0012  0.0257  0.0030  194 ASP B C   
4367 O O   . ASP B 216 ? 0.1119 0.0937 0.0968 0.0010  0.0283  0.0051  194 ASP B O   
4368 C CB  . ASP B 216 ? 0.1085 0.0965 0.0959 -0.0001 0.0263  0.0005  194 ASP B CB  
4369 C CG  . ASP B 216 ? 0.1375 0.1264 0.1305 -0.0019 0.0255  -0.0011 194 ASP B CG  
4370 O OD1 . ASP B 216 ? 0.1343 0.1220 0.1285 -0.0022 0.0244  -0.0012 194 ASP B OD1 
4371 O OD2 . ASP B 216 ? 0.1384 0.1292 0.1345 -0.0029 0.0258  -0.0023 194 ASP B OD2 
4372 N N   . GLY B 217 ? 0.1288 0.1120 0.1151 0.0013  0.0238  0.0023  195 GLY B N   
4373 C CA  . GLY B 217 ? 0.1596 0.1395 0.1471 0.0014  0.0245  0.0035  195 GLY B CA  
4374 C C   . GLY B 217 ? 0.1392 0.1183 0.1322 -0.0007 0.0254  0.0027  195 GLY B C   
4375 O O   . GLY B 217 ? 0.1675 0.1432 0.1622 -0.0009 0.0262  0.0038  195 GLY B O   
4376 N N   . ASN B 218 ? 0.1043 0.0862 0.1003 -0.0021 0.0251  0.0008  196 ASN B N   
4377 C CA  . ASN B 218 ? 0.1369 0.1187 0.1384 -0.0040 0.0254  -0.0005 196 ASN B CA  
4378 C C   . ASN B 218 ? 0.1556 0.1348 0.1591 -0.0040 0.0243  -0.0014 196 ASN B C   
4379 O O   . ASN B 218 ? 0.1299 0.1064 0.1370 -0.0052 0.0253  -0.0009 196 ASN B O   
4380 C CB  . ASN B 218 ? 0.2110 0.1920 0.2149 -0.0054 0.0283  0.0012  196 ASN B CB  
4381 C CG  . ASN B 218 ? 0.2271 0.2115 0.2306 -0.0055 0.0292  0.0010  196 ASN B CG  
4382 O OD1 . ASN B 218 ? 0.2461 0.2305 0.2461 -0.0045 0.0311  0.0029  196 ASN B OD1 
4383 N ND2 . ASN B 218 ? 0.2245 0.2118 0.2311 -0.0063 0.0278  -0.0015 196 ASN B ND2 
4384 N N   . ARG B 219 ? 0.1261 0.1063 0.1276 -0.0027 0.0222  -0.0026 197 ARG B N   
4385 C CA  . ARG B 219 ? 0.1160 0.0944 0.1189 -0.0021 0.0208  -0.0041 197 ARG B CA  
4386 C C   . ARG B 219 ? 0.1283 0.1023 0.1304 -0.0010 0.0214  -0.0024 197 ARG B C   
4387 O O   . ARG B 219 ? 0.1444 0.1162 0.1481 -0.0005 0.0205  -0.0037 197 ARG B O   
4388 C CB  . ARG B 219 ? 0.1188 0.0973 0.1265 -0.0038 0.0203  -0.0064 197 ARG B CB  
4389 C CG  . ARG B 219 ? 0.1047 0.0873 0.1134 -0.0046 0.0192  -0.0083 197 ARG B CG  
4390 C CD  . ARG B 219 ? 0.1413 0.1238 0.1541 -0.0057 0.0180  -0.0109 197 ARG B CD  
4391 N NE  . ARG B 219 ? 0.1822 0.1628 0.1997 -0.0077 0.0193  -0.0105 197 ARG B NE  
4392 C CZ  . ARG B 219 ? 0.2465 0.2239 0.2676 -0.0085 0.0189  -0.0115 197 ARG B CZ  
4393 N NH1 . ARG B 219 ? 0.2398 0.2152 0.2598 -0.0071 0.0173  -0.0132 197 ARG B NH1 
4394 N NH2 . ARG B 219 ? 0.2675 0.2437 0.2938 -0.0106 0.0203  -0.0108 197 ARG B NH2 
4395 N N   . SER B 220 ? 0.1014 0.0738 0.1007 -0.0004 0.0230  0.0006  198 SER B N   
4396 C CA  . SER B 220 ? 0.1040 0.0714 0.1030 0.0003  0.0240  0.0029  198 SER B CA  
4397 C C   . SER B 220 ? 0.1558 0.1219 0.1507 0.0031  0.0230  0.0041  198 SER B C   
4398 O O   . SER B 220 ? 0.1540 0.1153 0.1487 0.0040  0.0235  0.0058  198 SER B O   
4399 C CB  . SER B 220 ? 0.1615 0.1270 0.1604 -0.0009 0.0269  0.0059  198 SER B CB  
4400 O OG  . SER B 220 ? 0.1842 0.1513 0.1779 0.0005  0.0276  0.0078  198 SER B OG  
4401 N N   . LEU B 221 ? 0.1301 0.1000 0.1222 0.0045  0.0215  0.0033  199 LEU B N   
4402 C CA  . LEU B 221 ? 0.0909 0.0604 0.0796 0.0072  0.0203  0.0044  199 LEU B CA  
4403 C C   . LEU B 221 ? 0.0989 0.0693 0.0893 0.0085  0.0185  0.0022  199 LEU B C   
4404 O O   . LEU B 221 ? 0.1107 0.0850 0.1027 0.0079  0.0175  -0.0003 199 LEU B O   
4405 C CB  . LEU B 221 ? 0.1086 0.0820 0.0937 0.0080  0.0195  0.0047  199 LEU B CB  
4406 C CG  . LEU B 221 ? 0.1516 0.1256 0.1342 0.0071  0.0209  0.0061  199 LEU B CG  
4407 C CD1 . LEU B 221 ? 0.1734 0.1509 0.1527 0.0083  0.0192  0.0056  199 LEU B CD1 
4408 C CD2 . LEU B 221 ? 0.1676 0.1372 0.1476 0.0078  0.0230  0.0094  199 LEU B CD2 
4409 N N   . PRO B 222 ? 0.0942 0.0610 0.0841 0.0106  0.0181  0.0031  200 PRO B N   
4410 C CA  . PRO B 222 ? 0.0930 0.0619 0.0839 0.0126  0.0163  0.0010  200 PRO B CA  
4411 C C   . PRO B 222 ? 0.0955 0.0699 0.0845 0.0138  0.0150  0.0009  200 PRO B C   
4412 O O   . PRO B 222 ? 0.1037 0.0785 0.0898 0.0139  0.0150  0.0028  200 PRO B O   
4413 C CB  . PRO B 222 ? 0.0996 0.0631 0.0899 0.0150  0.0161  0.0026  200 PRO B CB  
4414 C CG  . PRO B 222 ? 0.1932 0.1513 0.1834 0.0133  0.0180  0.0051  200 PRO B CG  
4415 C CD  . PRO B 222 ? 0.1252 0.0864 0.1137 0.0114  0.0192  0.0062  200 PRO B CD  
4416 N N   . SER B 223 ? 0.0884 0.0668 0.0791 0.0146  0.0138  -0.0012 201 SER B N   
4417 C CA  . SER B 223 ? 0.0992 0.0831 0.0893 0.0154  0.0125  -0.0013 201 SER B CA  
4418 C C   . SER B 223 ? 0.0956 0.0787 0.0831 0.0177  0.0115  0.0008  201 SER B C   
4419 O O   . SER B 223 ? 0.1142 0.1003 0.1002 0.0176  0.0105  0.0014  201 SER B O   
4420 C CB  . SER B 223 ? 0.1376 0.1260 0.1303 0.0163  0.0118  -0.0035 201 SER B CB  
4421 O OG  . SER B 223 ? 0.1477 0.1344 0.1412 0.0190  0.0115  -0.0040 201 SER B OG  
4422 N N   . ARG B 224 ? 0.1080 0.0868 0.0949 0.0199  0.0115  0.0019  202 ARG B N   
4423 C CA  . ARG B 224 ? 0.1026 0.0795 0.0863 0.0224  0.0105  0.0043  202 ARG B CA  
4424 C C   . ARG B 224 ? 0.1348 0.1113 0.1146 0.0214  0.0108  0.0062  202 ARG B C   
4425 O O   . ARG B 224 ? 0.1095 0.0884 0.0869 0.0228  0.0092  0.0069  202 ARG B O   
4426 C CB  . ARG B 224 ? 0.1183 0.0885 0.1015 0.0241  0.0111  0.0058  202 ARG B CB  
4427 C CG  . ARG B 224 ? 0.1104 0.0777 0.0895 0.0268  0.0102  0.0089  202 ARG B CG  
4428 C CD  . ARG B 224 ? 0.1176 0.0769 0.0960 0.0277  0.0115  0.0112  202 ARG B CD  
4429 N NE  . ARG B 224 ? 0.1208 0.0765 0.0984 0.0247  0.0140  0.0127  202 ARG B NE  
4430 C CZ  . ARG B 224 ? 0.1287 0.0781 0.1079 0.0236  0.0156  0.0138  202 ARG B CZ  
4431 N NH1 . ARG B 224 ? 0.1268 0.0722 0.1081 0.0254  0.0149  0.0133  202 ARG B NH1 
4432 N NH2 . ARG B 224 ? 0.1527 0.1001 0.1318 0.0207  0.0180  0.0153  202 ARG B NH2 
4433 N N   . ASP B 225 ? 0.0984 0.0720 0.0777 0.0189  0.0129  0.0068  203 ASP B N   
4434 C CA  . ASP B 225 ? 0.1005 0.0731 0.0758 0.0183  0.0139  0.0088  203 ASP B CA  
4435 C C   . ASP B 225 ? 0.1042 0.0817 0.0795 0.0165  0.0133  0.0071  203 ASP B C   
4436 O O   . ASP B 225 ? 0.1044 0.0827 0.0759 0.0171  0.0128  0.0080  203 ASP B O   
4437 C CB  . ASP B 225 ? 0.1154 0.0829 0.0906 0.0166  0.0167  0.0106  203 ASP B CB  
4438 C CG  . ASP B 225 ? 0.1441 0.1057 0.1182 0.0185  0.0172  0.0132  203 ASP B CG  
4439 O OD1 . ASP B 225 ? 0.1306 0.0921 0.1026 0.0216  0.0154  0.0140  203 ASP B OD1 
4440 O OD2 . ASP B 225 ? 0.1598 0.1169 0.1355 0.0170  0.0193  0.0145  203 ASP B OD2 
4441 N N   . ALA B 226 ? 0.1039 0.0845 0.0832 0.0146  0.0132  0.0047  204 ALA B N   
4442 C CA  . ALA B 226 ? 0.0968 0.0818 0.0766 0.0131  0.0124  0.0031  204 ALA B CA  
4443 C C   . ALA B 226 ? 0.0982 0.0869 0.0773 0.0147  0.0098  0.0027  204 ALA B C   
4444 O O   . ALA B 226 ? 0.0985 0.0888 0.0755 0.0144  0.0088  0.0025  204 ALA B O   
4445 C CB  . ALA B 226 ? 0.1107 0.0979 0.0947 0.0111  0.0128  0.0010  204 ALA B CB  
4446 N N   . LEU B 227 ? 0.0846 0.0747 0.0658 0.0164  0.0087  0.0024  205 LEU B N   
4447 C CA  . LEU B 227 ? 0.0881 0.0821 0.0695 0.0181  0.0061  0.0021  205 LEU B CA  
4448 C C   . LEU B 227 ? 0.0930 0.0851 0.0695 0.0200  0.0048  0.0037  205 LEU B C   
4449 O O   . LEU B 227 ? 0.1066 0.1017 0.0822 0.0202  0.0027  0.0030  205 LEU B O   
4450 C CB  . LEU B 227 ? 0.0941 0.0896 0.0785 0.0203  0.0054  0.0017  205 LEU B CB  
4451 C CG  . LEU B 227 ? 0.1134 0.1121 0.1024 0.0192  0.0062  -0.0001 205 LEU B CG  
4452 C CD1 . LEU B 227 ? 0.1011 0.0995 0.0920 0.0218  0.0061  -0.0003 205 LEU B CD1 
4453 C CD2 . LEU B 227 ? 0.1129 0.1179 0.1049 0.0179  0.0049  -0.0012 205 LEU B CD2 
4454 N N   . ARG B 228 ? 0.0955 0.0825 0.0685 0.0215  0.0061  0.0058  206 ARG B N   
4455 C CA  . ARG B 228 ? 0.1018 0.0865 0.0691 0.0237  0.0052  0.0078  206 ARG B CA  
4456 C C   . ARG B 228 ? 0.1022 0.0870 0.0657 0.0224  0.0057  0.0077  206 ARG B C   
4457 O O   . ARG B 228 ? 0.1064 0.0928 0.0665 0.0239  0.0034  0.0075  206 ARG B O   
4458 C CB  . ARG B 228 ? 0.1080 0.0867 0.0726 0.0252  0.0070  0.0107  206 ARG B CB  
4459 C CG  . ARG B 228 ? 0.1155 0.0914 0.0732 0.0276  0.0067  0.0133  206 ARG B CG  
4460 C CD  . ARG B 228 ? 0.1222 0.0916 0.0776 0.0289  0.0088  0.0167  206 ARG B CD  
4461 N NE  . ARG B 228 ? 0.1301 0.0967 0.0781 0.0310  0.0090  0.0197  206 ARG B NE  
4462 C CZ  . ARG B 228 ? 0.1375 0.0982 0.0823 0.0323  0.0109  0.0234  206 ARG B CZ  
4463 N NH1 . ARG B 228 ? 0.1745 0.1313 0.1235 0.0315  0.0125  0.0242  206 ARG B NH1 
4464 N NH2 . ARG B 228 ? 0.1520 0.1104 0.0894 0.0345  0.0113  0.0264  206 ARG B NH2 
4465 N N   . LEU B 229 ? 0.0998 0.0832 0.0641 0.0199  0.0083  0.0076  207 LEU B N   
4466 C CA  . LEU B 229 ? 0.1101 0.0937 0.0713 0.0189  0.0090  0.0072  207 LEU B CA  
4467 C C   . LEU B 229 ? 0.1134 0.1015 0.0755 0.0184  0.0061  0.0046  207 LEU B C   
4468 O O   . LEU B 229 ? 0.1199 0.1083 0.0777 0.0196  0.0048  0.0043  207 LEU B O   
4469 C CB  . LEU B 229 ? 0.1475 0.1298 0.1112 0.0161  0.0121  0.0070  207 LEU B CB  
4470 C CG  . LEU B 229 ? 0.1426 0.1260 0.1048 0.0148  0.0129  0.0060  207 LEU B CG  
4471 C CD1 . LEU B 229 ? 0.1496 0.1311 0.1050 0.0167  0.0136  0.0077  207 LEU B CD1 
4472 C CD2 . LEU B 229 ? 0.1910 0.1737 0.1570 0.0122  0.0156  0.0057  207 LEU B CD2 
4473 N N   . SER B 230 ? 0.0941 0.0856 0.0619 0.0168  0.0052  0.0028  208 SER B N   
4474 C CA  . SER B 230 ? 0.1027 0.0982 0.0724 0.0160  0.0025  0.0006  208 SER B CA  
4475 C C   . SER B 230 ? 0.1200 0.1177 0.0887 0.0183  -0.0009 0.0004  208 SER B C   
4476 O O   . SER B 230 ? 0.0955 0.0943 0.0620 0.0187  -0.0033 -0.0009 208 SER B O   
4477 C CB  . SER B 230 ? 0.0819 0.0805 0.0579 0.0137  0.0027  -0.0007 208 SER B CB  
4478 O OG  . SER B 230 ? 0.1012 0.1035 0.0798 0.0126  0.0003  -0.0025 208 SER B OG  
4479 N N   . ARG B 231 ? 0.1150 0.1131 0.0851 0.0201  -0.0014 0.0014  209 ARG B N   
4480 C CA  . ARG B 231 ? 0.0955 0.0962 0.0655 0.0226  -0.0048 0.0011  209 ARG B CA  
4481 C C   . ARG B 231 ? 0.1238 0.1221 0.0865 0.0250  -0.0064 0.0019  209 ARG B C   
4482 O O   . ARG B 231 ? 0.1191 0.1202 0.0812 0.0262  -0.0100 0.0005  209 ARG B O   
4483 C CB  . ARG B 231 ? 0.0963 0.0968 0.0685 0.0246  -0.0045 0.0024  209 ARG B CB  
4484 C CG  . ARG B 231 ? 0.0990 0.1028 0.0722 0.0273  -0.0081 0.0022  209 ARG B CG  
4485 C CD  . ARG B 231 ? 0.1012 0.1043 0.0764 0.0296  -0.0075 0.0034  209 ARG B CD  
4486 N NE  . ARG B 231 ? 0.1064 0.1031 0.0759 0.0317  -0.0059 0.0060  209 ARG B NE  
4487 C CZ  . ARG B 231 ? 0.1063 0.0988 0.0762 0.0311  -0.0028 0.0071  209 ARG B CZ  
4488 N NH1 . ARG B 231 ? 0.1037 0.0978 0.0788 0.0288  -0.0011 0.0057  209 ARG B NH1 
4489 N NH2 . ARG B 231 ? 0.1136 0.1001 0.0787 0.0328  -0.0014 0.0098  209 ARG B NH2 
4490 N N   . GLU B 232 ? 0.1191 0.1125 0.0762 0.0258  -0.0037 0.0040  210 GLU B N   
4491 C CA  . GLU B 232 ? 0.1147 0.1056 0.0639 0.0286  -0.0046 0.0053  210 GLU B CA  
4492 C C   . GLU B 232 ? 0.1274 0.1187 0.0731 0.0278  -0.0052 0.0035  210 GLU B C   
4493 O O   . GLU B 232 ? 0.1596 0.1502 0.0988 0.0303  -0.0070 0.0035  210 GLU B O   
4494 C CB  . GLU B 232 ? 0.1253 0.1107 0.0699 0.0297  -0.0011 0.0088  210 GLU B CB  
4495 C CG  . GLU B 232 ? 0.1243 0.1080 0.0703 0.0318  -0.0013 0.0109  210 GLU B CG  
4496 C CD  . GLU B 232 ? 0.1765 0.1542 0.1173 0.0332  0.0017  0.0147  210 GLU B CD  
4497 O OE1 . GLU B 232 ? 0.1814 0.1569 0.1168 0.0330  0.0038  0.0160  210 GLU B OE1 
4498 O OE2 . GLU B 232 ? 0.1479 0.1231 0.0901 0.0345  0.0021  0.0166  210 GLU B OE2 
4499 N N   . CYS B 233 ? 0.1097 0.1022 0.0594 0.0246  -0.0039 0.0017  211 CYS B N   
4500 C CA  . CYS B 233 ? 0.1130 0.1051 0.0593 0.0240  -0.0039 0.0001  211 CYS B CA  
4501 C C   . CYS B 233 ? 0.1189 0.1144 0.0703 0.0217  -0.0063 -0.0032 211 CYS B C   
4502 O O   . CYS B 233 ? 0.1035 0.0984 0.0557 0.0197  -0.0047 -0.0043 211 CYS B O   
4503 C CB  . CYS B 233 ? 0.1216 0.1107 0.0666 0.0226  0.0007  0.0015  211 CYS B CB  
4504 S SG  . CYS B 233 ? 0.1645 0.1491 0.1040 0.0247  0.0043  0.0058  211 CYS B SG  
4505 N N   . PRO B 234 ? 0.1198 0.1187 0.0747 0.0219  -0.0102 -0.0047 212 PRO B N   
4506 C CA  . PRO B 234 ? 0.1278 0.1297 0.0883 0.0193  -0.0123 -0.0075 212 PRO B CA  
4507 C C   . PRO B 234 ? 0.1138 0.1142 0.0702 0.0194  -0.0136 -0.0098 212 PRO B C   
4508 O O   . PRO B 234 ? 0.1079 0.1090 0.0683 0.0169  -0.0140 -0.0116 212 PRO B O   
4509 C CB  . PRO B 234 ? 0.1273 0.1333 0.0920 0.0199  -0.0163 -0.0084 212 PRO B CB  
4510 C CG  . PRO B 234 ? 0.1681 0.1728 0.1267 0.0238  -0.0175 -0.0070 212 PRO B CG  
4511 C CD  . PRO B 234 ? 0.1495 0.1501 0.1041 0.0245  -0.0130 -0.0041 212 PRO B CD  
4512 N N   . GLU B 235 ? 0.1249 0.1232 0.0733 0.0225  -0.0144 -0.0097 213 GLU B N   
4513 C CA  . GLU B 235 ? 0.1221 0.1189 0.0656 0.0233  -0.0158 -0.0123 213 GLU B CA  
4514 C C   . GLU B 235 ? 0.1410 0.1350 0.0816 0.0227  -0.0116 -0.0117 213 GLU B C   
4515 O O   . GLU B 235 ? 0.1677 0.1606 0.1046 0.0234  -0.0123 -0.0140 213 GLU B O   
4516 C CB  . GLU B 235 ? 0.1630 0.1591 0.0983 0.0274  -0.0185 -0.0126 213 GLU B CB  
4517 C CG  . GLU B 235 ? 0.2350 0.2278 0.1618 0.0301  -0.0147 -0.0093 213 GLU B CG  
4518 C CD  . GLU B 235 ? 0.3141 0.3064 0.2421 0.0306  -0.0126 -0.0055 213 GLU B CD  
4519 O OE1 . GLU B 235 ? 0.2166 0.2112 0.1517 0.0291  -0.0137 -0.0053 213 GLU B OE1 
4520 O OE2 . GLU B 235 ? 0.4178 0.4071 0.3394 0.0327  -0.0096 -0.0025 213 GLU B OE2 
4521 N N   . ILE B 236 ? 0.1295 0.1227 0.0720 0.0215  -0.0073 -0.0089 214 ILE B N   
4522 C CA  . ILE B 236 ? 0.1448 0.1359 0.0858 0.0207  -0.0032 -0.0083 214 ILE B CA  
4523 C C   . ILE B 236 ? 0.1218 0.1141 0.0706 0.0172  -0.0023 -0.0091 214 ILE B C   
4524 O O   . ILE B 236 ? 0.1239 0.1174 0.0780 0.0155  -0.0015 -0.0078 214 ILE B O   
4525 C CB  . ILE B 236 ? 0.1671 0.1561 0.1049 0.0217  0.0010  -0.0046 214 ILE B CB  
4526 C CG1 . ILE B 236 ? 0.1694 0.1571 0.0993 0.0254  0.0001  -0.0031 214 ILE B CG1 
4527 C CG2 . ILE B 236 ? 0.1524 0.1400 0.0893 0.0209  0.0051  -0.0041 214 ILE B CG2 
4528 C CD1 . ILE B 236 ? 0.1900 0.1749 0.1161 0.0265  0.0044  0.0010  214 ILE B CD1 
4529 N N   . PRO B 237 ? 0.1072 0.0991 0.0564 0.0163  -0.0024 -0.0114 215 PRO B N   
4530 C CA  . PRO B 237 ? 0.1122 0.1051 0.0684 0.0132  -0.0025 -0.0123 215 PRO B CA  
4531 C C   . PRO B 237 ? 0.1381 0.1304 0.0967 0.0117  0.0016  -0.0108 215 PRO B C   
4532 O O   . PRO B 237 ? 0.1740 0.1659 0.1341 0.0106  0.0024  -0.0120 215 PRO B O   
4533 C CB  . PRO B 237 ? 0.1152 0.1074 0.0705 0.0133  -0.0050 -0.0156 215 PRO B CB  
4534 C CG  . PRO B 237 ? 0.1278 0.1182 0.0750 0.0164  -0.0037 -0.0159 215 PRO B CG  
4535 C CD  . PRO B 237 ? 0.1514 0.1418 0.0944 0.0184  -0.0033 -0.0135 215 PRO B CD  
4536 N N   . PHE B 238 ? 0.1165 0.1087 0.0759 0.0115  0.0039  -0.0082 216 PHE B N   
4537 C CA  . PHE B 238 ? 0.1068 0.0987 0.0696 0.0098  0.0071  -0.0071 216 PHE B CA  
4538 C C   . PHE B 238 ? 0.0845 0.0782 0.0537 0.0074  0.0063  -0.0074 216 PHE B C   
4539 O O   . PHE B 238 ? 0.1079 0.1032 0.0792 0.0071  0.0039  -0.0076 216 PHE B O   
4540 C CB  . PHE B 238 ? 0.1072 0.0977 0.0680 0.0106  0.0102  -0.0043 216 PHE B CB  
4541 C CG  . PHE B 238 ? 0.1095 0.1000 0.0702 0.0115  0.0091  -0.0028 216 PHE B CG  
4542 C CD1 . PHE B 238 ? 0.1024 0.0939 0.0682 0.0101  0.0090  -0.0025 216 PHE B CD1 
4543 C CD2 . PHE B 238 ? 0.1324 0.1218 0.0874 0.0141  0.0083  -0.0018 216 PHE B CD2 
4544 C CE1 . PHE B 238 ? 0.1199 0.1114 0.0856 0.0113  0.0081  -0.0012 216 PHE B CE1 
4545 C CE2 . PHE B 238 ? 0.1233 0.1126 0.0782 0.0153  0.0072  -0.0004 216 PHE B CE2 
4546 C CZ  . PHE B 238 ? 0.1108 0.1012 0.0714 0.0139  0.0071  -0.0002 216 PHE B CZ  
4547 N N   . VAL B 239 ? 0.0821 0.0758 0.0544 0.0058  0.0082  -0.0073 217 VAL B N   
4548 C CA  . VAL B 239 ? 0.1054 0.1004 0.0826 0.0040  0.0084  -0.0068 217 VAL B CA  
4549 C C   . VAL B 239 ? 0.1057 0.0997 0.0829 0.0042  0.0110  -0.0051 217 VAL B C   
4550 O O   . VAL B 239 ? 0.1103 0.1026 0.0852 0.0049  0.0132  -0.0042 217 VAL B O   
4551 C CB  . VAL B 239 ? 0.0909 0.0866 0.0717 0.0022  0.0084  -0.0079 217 VAL B CB  
4552 C CG1 . VAL B 239 ? 0.1204 0.1166 0.1018 0.0018  0.0057  -0.0094 217 VAL B CG1 
4553 C CG2 . VAL B 239 ? 0.1334 0.1279 0.1136 0.0023  0.0108  -0.0080 217 VAL B CG2 
4554 N N   . LEU B 240 ? 0.0854 0.0803 0.0653 0.0038  0.0108  -0.0045 218 LEU B N   
4555 C CA  . LEU B 240 ? 0.1043 0.0976 0.0846 0.0040  0.0127  -0.0031 218 LEU B CA  
4556 C C   . LEU B 240 ? 0.0943 0.0881 0.0785 0.0023  0.0139  -0.0037 218 LEU B C   
4557 O O   . LEU B 240 ? 0.0831 0.0788 0.0699 0.0015  0.0128  -0.0045 218 LEU B O   
4558 C CB  . LEU B 240 ? 0.1761 0.1701 0.1568 0.0051  0.0116  -0.0025 218 LEU B CB  
4559 C CG  . LEU B 240 ? 0.1937 0.1855 0.1746 0.0058  0.0131  -0.0012 218 LEU B CG  
4560 C CD1 . LEU B 240 ? 0.1865 0.1751 0.1642 0.0064  0.0151  0.0004  218 LEU B CD1 
4561 C CD2 . LEU B 240 ? 0.1546 0.1472 0.1352 0.0076  0.0114  -0.0007 218 LEU B CD2 
4562 N N   . GLU B 241 ? 0.0890 0.0813 0.0734 0.0018  0.0159  -0.0034 219 GLU B N   
4563 C CA  . GLU B 241 ? 0.0779 0.0709 0.0661 0.0002  0.0166  -0.0042 219 GLU B CA  
4564 C C   . GLU B 241 ? 0.1103 0.1018 0.1004 -0.0001 0.0177  -0.0037 219 GLU B C   
4565 O O   . GLU B 241 ? 0.1099 0.0991 0.0989 0.0004  0.0192  -0.0023 219 GLU B O   
4566 C CB  . GLU B 241 ? 0.1019 0.0947 0.0902 -0.0003 0.0181  -0.0045 219 GLU B CB  
4567 C CG  . GLU B 241 ? 0.1626 0.1563 0.1551 -0.0017 0.0186  -0.0054 219 GLU B CG  
4568 C CD  . GLU B 241 ? 0.2361 0.2302 0.2293 -0.0019 0.0202  -0.0057 219 GLU B CD  
4569 O OE1 . GLU B 241 ? 0.2827 0.2766 0.2728 -0.0009 0.0205  -0.0055 219 GLU B OE1 
4570 O OE2 . GLU B 241 ? 0.1394 0.1342 0.1365 -0.0030 0.0210  -0.0061 219 GLU B OE2 
4571 N N   . GLN B 242 ? 0.0918 0.0845 0.0845 -0.0008 0.0168  -0.0049 220 GLN B N   
4572 C CA  . GLN B 242 ? 0.0773 0.0687 0.0722 -0.0009 0.0172  -0.0052 220 GLN B CA  
4573 C C   . GLN B 242 ? 0.0821 0.0706 0.0755 0.0002  0.0181  -0.0037 220 GLN B C   
4574 O O   . GLN B 242 ? 0.0914 0.0773 0.0861 -0.0003 0.0195  -0.0030 220 GLN B O   
4575 C CB  . GLN B 242 ? 0.0819 0.0729 0.0799 -0.0024 0.0182  -0.0060 220 GLN B CB  
4576 C CG  . GLN B 242 ? 0.0925 0.0826 0.0932 -0.0027 0.0177  -0.0073 220 GLN B CG  
4577 C CD  . GLN B 242 ? 0.0960 0.0886 0.0969 -0.0025 0.0160  -0.0089 220 GLN B CD  
4578 O OE1 . GLN B 242 ? 0.0902 0.0851 0.0910 -0.0029 0.0153  -0.0094 220 GLN B OE1 
4579 N NE2 . GLN B 242 ? 0.1294 0.1214 0.1304 -0.0016 0.0154  -0.0098 220 GLN B NE2 
4580 N N   . PRO B 243 ? 0.0848 0.0738 0.0759 0.0017  0.0170  -0.0031 221 PRO B N   
4581 C CA  . PRO B 243 ? 0.1181 0.1041 0.1074 0.0032  0.0176  -0.0014 221 PRO B CA  
4582 C C   . PRO B 243 ? 0.1071 0.0907 0.0987 0.0033  0.0179  -0.0018 221 PRO B C   
4583 O O   . PRO B 243 ? 0.0985 0.0784 0.0899 0.0035  0.0192  -0.0003 221 PRO B O   
4584 C CB  . PRO B 243 ? 0.1129 0.1008 0.1001 0.0049  0.0158  -0.0012 221 PRO B CB  
4585 C CG  . PRO B 243 ? 0.1145 0.1064 0.1037 0.0040  0.0145  -0.0029 221 PRO B CG  
4586 C CD  . PRO B 243 ? 0.1144 0.1065 0.1046 0.0022  0.0152  -0.0036 221 PRO B CD  
4587 N N   . CYS B 244 ? 0.1005 0.0862 0.0941 0.0033  0.0168  -0.0037 222 CYS B N   
4588 C CA  . CYS B 244 ? 0.0932 0.0768 0.0886 0.0039  0.0167  -0.0048 222 CYS B CA  
4589 C C   . CYS B 244 ? 0.1173 0.1010 0.1156 0.0022  0.0167  -0.0068 222 CYS B C   
4590 O O   . CYS B 244 ? 0.1009 0.0871 0.0997 0.0009  0.0166  -0.0074 222 CYS B O   
4591 C CB  . CYS B 244 ? 0.1105 0.0967 0.1056 0.0057  0.0153  -0.0057 222 CYS B CB  
4592 S SG  . CYS B 244 ? 0.1264 0.1132 0.1187 0.0079  0.0147  -0.0037 222 CYS B SG  
4593 N N   . ASN B 245 ? 0.1167 0.0976 0.1169 0.0024  0.0166  -0.0080 223 ASN B N   
4594 C CA  . ASN B 245 ? 0.0921 0.0726 0.0953 0.0010  0.0162  -0.0101 223 ASN B CA  
4595 C C   . ASN B 245 ? 0.1627 0.1474 0.1657 0.0012  0.0149  -0.0123 223 ASN B C   
4596 O O   . ASN B 245 ? 0.1697 0.1561 0.1739 -0.0003 0.0146  -0.0132 223 ASN B O   
4597 C CB  . ASN B 245 ? 0.1159 0.0919 0.1213 0.0013  0.0160  -0.0111 223 ASN B CB  
4598 C CG  . ASN B 245 ? 0.1400 0.1154 0.1489 -0.0003 0.0153  -0.0136 223 ASN B CG  
4599 O OD1 . ASN B 245 ? 0.1869 0.1636 0.1980 -0.0023 0.0158  -0.0134 223 ASN B OD1 
4600 N ND2 . ASN B 245 ? 0.1691 0.1429 0.1789 0.0007  0.0139  -0.0163 223 ASN B ND2 
4601 N N   . THR B 246 ? 0.1132 0.0995 0.1145 0.0031  0.0142  -0.0131 224 THR B N   
4602 C CA  . THR B 246 ? 0.0940 0.0840 0.0946 0.0035  0.0133  -0.0149 224 THR B CA  
4603 C C   . THR B 246 ? 0.1066 0.1009 0.1055 0.0037  0.0134  -0.0135 224 THR B C   
4604 O O   . THR B 246 ? 0.1165 0.1112 0.1145 0.0043  0.0137  -0.0117 224 THR B O   
4605 C CB  . THR B 246 ? 0.1255 0.1151 0.1257 0.0056  0.0126  -0.0171 224 THR B CB  
4606 O OG1 . THR B 246 ? 0.1097 0.0995 0.1089 0.0076  0.0130  -0.0159 224 THR B OG1 
4607 C CG2 . THR B 246 ? 0.1326 0.1175 0.1349 0.0053  0.0121  -0.0190 224 THR B CG2 
4608 N N   . LEU B 247 ? 0.0946 0.0921 0.0930 0.0032  0.0129  -0.0142 225 LEU B N   
4609 C CA  . LEU B 247 ? 0.0739 0.0753 0.0712 0.0032  0.0129  -0.0129 225 LEU B CA  
4610 C C   . LEU B 247 ? 0.0872 0.0908 0.0840 0.0052  0.0132  -0.0127 225 LEU B C   
4611 O O   . LEU B 247 ? 0.1248 0.1309 0.1217 0.0053  0.0133  -0.0112 225 LEU B O   
4612 C CB  . LEU B 247 ? 0.0954 0.0993 0.0922 0.0026  0.0124  -0.0135 225 LEU B CB  
4613 C CG  . LEU B 247 ? 0.1221 0.1297 0.1182 0.0022  0.0125  -0.0118 225 LEU B CG  
4614 C CD1 . LEU B 247 ? 0.1396 0.1468 0.1364 0.0011  0.0125  -0.0100 225 LEU B CD1 
4615 C CD2 . LEU B 247 ? 0.1292 0.1381 0.1245 0.0016  0.0119  -0.0121 225 LEU B CD2 
4616 N N   . GLU B 248 ? 0.0915 0.0940 0.0880 0.0069  0.0131  -0.0146 226 GLU B N   
4617 C CA  . GLU B 248 ? 0.0956 0.1004 0.0919 0.0092  0.0135  -0.0147 226 GLU B CA  
4618 C C   . GLU B 248 ? 0.1150 0.1187 0.1121 0.0098  0.0136  -0.0130 226 GLU B C   
4619 O O   . GLU B 248 ? 0.1165 0.1238 0.1141 0.0108  0.0137  -0.0120 226 GLU B O   
4620 C CB  . GLU B 248 ? 0.1224 0.1256 0.1182 0.0113  0.0133  -0.0174 226 GLU B CB  
4621 C CG  . GLU B 248 ? 0.1336 0.1390 0.1278 0.0115  0.0131  -0.0191 226 GLU B CG  
4622 C CD  . GLU B 248 ? 0.2287 0.2400 0.2219 0.0119  0.0140  -0.0177 226 GLU B CD  
4623 O OE1 . GLU B 248 ? 0.2213 0.2352 0.2148 0.0138  0.0149  -0.0174 226 GLU B OE1 
4624 O OE2 . GLU B 248 ? 0.2507 0.2638 0.2432 0.0104  0.0140  -0.0168 226 GLU B OE2 
4625 N N   . GLU B 249 ? 0.1102 0.1091 0.1074 0.0093  0.0135  -0.0126 227 GLU B N   
4626 C CA  . GLU B 249 ? 0.1025 0.1000 0.0996 0.0100  0.0134  -0.0108 227 GLU B CA  
4627 C C   . GLU B 249 ? 0.1147 0.1151 0.1116 0.0088  0.0132  -0.0090 227 GLU B C   
4628 O O   . GLU B 249 ? 0.1054 0.1078 0.1024 0.0099  0.0127  -0.0080 227 GLU B O   
4629 C CB  . GLU B 249 ? 0.1014 0.0932 0.0984 0.0095  0.0137  -0.0103 227 GLU B CB  
4630 C CG  . GLU B 249 ? 0.1194 0.1070 0.1172 0.0109  0.0136  -0.0118 227 GLU B CG  
4631 C CD  . GLU B 249 ? 0.1266 0.1090 0.1253 0.0092  0.0141  -0.0111 227 GLU B CD  
4632 O OE1 . GLU B 249 ? 0.1279 0.1073 0.1257 0.0095  0.0146  -0.0088 227 GLU B OE1 
4633 O OE2 . GLU B 249 ? 0.1344 0.1158 0.1345 0.0077  0.0140  -0.0127 227 GLU B OE2 
4634 N N   . ILE B 250 ? 0.1083 0.1088 0.1050 0.0066  0.0133  -0.0088 228 ILE B N   
4635 C CA  . ILE B 250 ? 0.1004 0.1030 0.0968 0.0054  0.0128  -0.0075 228 ILE B CA  
4636 C C   . ILE B 250 ? 0.0901 0.0978 0.0878 0.0057  0.0124  -0.0073 228 ILE B C   
4637 O O   . ILE B 250 ? 0.1193 0.1289 0.1174 0.0058  0.0116  -0.0063 228 ILE B O   
4638 C CB  . ILE B 250 ? 0.1213 0.1230 0.1175 0.0033  0.0130  -0.0076 228 ILE B CB  
4639 C CG1 . ILE B 250 ? 0.1367 0.1341 0.1324 0.0029  0.0137  -0.0073 228 ILE B CG1 
4640 C CG2 . ILE B 250 ? 0.1434 0.1473 0.1396 0.0022  0.0123  -0.0067 228 ILE B CG2 
4641 C CD1 . ILE B 250 ? 0.1817 0.1785 0.1779 0.0011  0.0140  -0.0077 228 ILE B CD1 
4642 N N   . ALA B 251 ? 0.1046 0.1147 0.1028 0.0059  0.0129  -0.0082 229 ALA B N   
4643 C CA  . ALA B 251 ? 0.1425 0.1577 0.1421 0.0061  0.0130  -0.0076 229 ALA B CA  
4644 C C   . ALA B 251 ? 0.1096 0.1270 0.1106 0.0082  0.0129  -0.0074 229 ALA B C   
4645 O O   . ALA B 251 ? 0.1482 0.1698 0.1514 0.0079  0.0126  -0.0064 229 ALA B O   
4646 C CB  . ALA B 251 ? 0.1225 0.1397 0.1216 0.0065  0.0139  -0.0086 229 ALA B CB  
4647 N N   . ALA B 252 ? 0.1129 0.1274 0.1131 0.0101  0.0130  -0.0083 230 ALA B N   
4648 C CA  . ALA B 252 ? 0.1275 0.1437 0.1290 0.0125  0.0127  -0.0081 230 ALA B CA  
4649 C C   . ALA B 252 ? 0.1487 0.1647 0.1506 0.0125  0.0114  -0.0067 230 ALA B C   
4650 O O   . ALA B 252 ? 0.1969 0.2166 0.2009 0.0138  0.0107  -0.0063 230 ALA B O   
4651 C CB  . ALA B 252 ? 0.1617 0.1741 0.1622 0.0148  0.0130  -0.0095 230 ALA B CB  
4652 N N   . ILE B 253 ? 0.1451 0.1570 0.1449 0.0111  0.0109  -0.0061 231 ILE B N   
4653 C CA  . ILE B 253 ? 0.1220 0.1331 0.1209 0.0114  0.0095  -0.0049 231 ILE B CA  
4654 C C   . ILE B 253 ? 0.0951 0.1091 0.0950 0.0095  0.0085  -0.0045 231 ILE B C   
4655 O O   . ILE B 253 ? 0.1074 0.1221 0.1071 0.0100  0.0069  -0.0039 231 ILE B O   
4656 C CB  . ILE B 253 ? 0.1935 0.1986 0.1891 0.0114  0.0098  -0.0043 231 ILE B CB  
4657 C CG1 . ILE B 253 ? 0.2387 0.2423 0.2334 0.0088  0.0105  -0.0044 231 ILE B CG1 
4658 C CG2 . ILE B 253 ? 0.3691 0.3703 0.3642 0.0130  0.0107  -0.0046 231 ILE B CG2 
4659 C CD1 . ILE B 253 ? 0.3267 0.3254 0.3185 0.0086  0.0111  -0.0035 231 ILE B CD1 
4660 N N   . ARG B 254 ? 0.1073 0.1227 0.1081 0.0074  0.0091  -0.0047 232 ARG B N   
4661 C CA  . ARG B 254 ? 0.0919 0.1086 0.0933 0.0053  0.0080  -0.0044 232 ARG B CA  
4662 C C   . ARG B 254 ? 0.1194 0.1403 0.1238 0.0054  0.0063  -0.0040 232 ARG B C   
4663 O O   . ARG B 254 ? 0.1119 0.1320 0.1156 0.0047  0.0046  -0.0040 232 ARG B O   
4664 C CB  . ARG B 254 ? 0.1745 0.1921 0.1767 0.0034  0.0090  -0.0045 232 ARG B CB  
4665 C CG  . ARG B 254 ? 0.2782 0.2967 0.2816 0.0012  0.0079  -0.0040 232 ARG B CG  
4666 C CD  . ARG B 254 ? 0.3146 0.3342 0.3189 -0.0003 0.0089  -0.0037 232 ARG B CD  
4667 N NE  . ARG B 254 ? 0.3971 0.4204 0.4030 0.0004  0.0102  -0.0034 232 ARG B NE  
4668 C CZ  . ARG B 254 ? 0.4786 0.5066 0.4879 0.0001  0.0102  -0.0025 232 ARG B CZ  
4669 N NH1 . ARG B 254 ? 0.4930 0.5225 0.5050 -0.0011 0.0086  -0.0019 232 ARG B NH1 
4670 N NH2 . ARG B 254 ? 0.5572 0.5888 0.5675 0.0012  0.0118  -0.0022 232 ARG B NH2 
4671 N N   . GLY B 255 ? 0.0989 0.1242 0.1065 0.0063  0.0067  -0.0038 233 GLY B N   
4672 C CA  . GLY B 255 ? 0.0747 0.1049 0.0864 0.0062  0.0050  -0.0035 233 GLY B CA  
4673 C C   . GLY B 255 ? 0.0963 0.1256 0.1069 0.0081  0.0029  -0.0037 233 GLY B C   
4674 O O   . GLY B 255 ? 0.1207 0.1531 0.1342 0.0078  0.0007  -0.0037 233 GLY B O   
4675 N N   . ARG B 256 ? 0.0770 0.1018 0.0836 0.0101  0.0033  -0.0037 234 ARG B N   
4676 C CA  . ARG B 256 ? 0.0704 0.0938 0.0751 0.0124  0.0014  -0.0035 234 ARG B CA  
4677 C C   . ARG B 256 ? 0.1128 0.1313 0.1125 0.0120  0.0007  -0.0033 234 ARG B C   
4678 O O   . ARG B 256 ? 0.1745 0.1910 0.1712 0.0140  -0.0007 -0.0029 234 ARG B O   
4679 C CB  . ARG B 256 ? 0.1040 0.1257 0.1076 0.0153  0.0024  -0.0033 234 ARG B CB  
4680 C CG  . ARG B 256 ? 0.1130 0.1398 0.1212 0.0164  0.0033  -0.0037 234 ARG B CG  
4681 C CD  . ARG B 256 ? 0.1511 0.1747 0.1577 0.0186  0.0050  -0.0040 234 ARG B CD  
4682 N NE  . ARG B 256 ? 0.1372 0.1585 0.1424 0.0217  0.0037  -0.0036 234 ARG B NE  
4683 C CZ  . ARG B 256 ? 0.1617 0.1780 0.1646 0.0237  0.0046  -0.0035 234 ARG B CZ  
4684 N NH1 . ARG B 256 ? 0.1708 0.1839 0.1726 0.0227  0.0065  -0.0042 234 ARG B NH1 
4685 N NH2 . ARG B 256 ? 0.1889 0.2031 0.1905 0.0267  0.0032  -0.0027 234 ARG B NH2 
4686 N N   . VAL B 257 ? 0.0968 0.1135 0.0954 0.0096  0.0016  -0.0036 235 VAL B N   
4687 C CA  . VAL B 257 ? 0.1163 0.1286 0.1103 0.0093  0.0015  -0.0035 235 VAL B CA  
4688 C C   . VAL B 257 ? 0.0968 0.1105 0.0919 0.0073  -0.0002 -0.0044 235 VAL B C   
4689 O O   . VAL B 257 ? 0.1193 0.1345 0.1172 0.0051  0.0005  -0.0047 235 VAL B O   
4690 C CB  . VAL B 257 ? 0.0939 0.1023 0.0858 0.0084  0.0041  -0.0033 235 VAL B CB  
4691 C CG1 . VAL B 257 ? 0.1115 0.1166 0.0997 0.0077  0.0044  -0.0033 235 VAL B CG1 
4692 C CG2 . VAL B 257 ? 0.1226 0.1283 0.1131 0.0105  0.0054  -0.0025 235 VAL B CG2 
4693 N N   . GLN B 258 ? 0.1119 0.1251 0.1046 0.0082  -0.0026 -0.0049 236 GLN B N   
4694 C CA  . GLN B 258 ? 0.1116 0.1260 0.1058 0.0065  -0.0047 -0.0062 236 GLN B CA  
4695 C C   . GLN B 258 ? 0.1009 0.1114 0.0913 0.0057  -0.0041 -0.0068 236 GLN B C   
4696 O O   . GLN B 258 ? 0.1084 0.1191 0.0998 0.0043  -0.0059 -0.0081 236 GLN B O   
4697 C CB  . GLN B 258 ? 0.1456 0.1624 0.1404 0.0078  -0.0083 -0.0070 236 GLN B CB  
4698 C CG  . GLN B 258 ? 0.1874 0.2095 0.1882 0.0080  -0.0091 -0.0066 236 GLN B CG  
4699 C CD  . GLN B 258 ? 0.3084 0.3334 0.3106 0.0095  -0.0129 -0.0075 236 GLN B CD  
4700 O OE1 . GLN B 258 ? 0.3055 0.3288 0.3032 0.0123  -0.0141 -0.0073 236 GLN B OE1 
4701 N NE2 . GLN B 258 ? 0.3485 0.3779 0.3570 0.0075  -0.0149 -0.0084 236 GLN B NE2 
4702 N N   . HIS B 259 ? 0.0928 0.0998 0.0793 0.0064  -0.0016 -0.0060 237 HIS B N   
4703 C CA  . HIS B 259 ? 0.0888 0.0929 0.0728 0.0055  -0.0003 -0.0065 237 HIS B CA  
4704 C C   . HIS B 259 ? 0.0805 0.0851 0.0680 0.0034  0.0014  -0.0064 237 HIS B C   
4705 O O   . HIS B 259 ? 0.0971 0.1029 0.0869 0.0032  0.0028  -0.0056 237 HIS B O   
4706 C CB  . HIS B 259 ? 0.0875 0.0881 0.0664 0.0072  0.0018  -0.0055 237 HIS B CB  
4707 C CG  . HIS B 259 ? 0.1061 0.1055 0.0800 0.0096  0.0004  -0.0054 237 HIS B CG  
4708 N ND1 . HIS B 259 ? 0.0925 0.0923 0.0652 0.0116  -0.0005 -0.0043 237 HIS B ND1 
4709 C CD2 . HIS B 259 ? 0.0940 0.0918 0.0633 0.0106  -0.0004 -0.0063 237 HIS B CD2 
4710 C CE1 . HIS B 259 ? 0.0931 0.0916 0.0605 0.0138  -0.0019 -0.0044 237 HIS B CE1 
4711 N NE2 . HIS B 259 ? 0.0982 0.0955 0.0632 0.0132  -0.0018 -0.0057 237 HIS B NE2 
4712 N N   . GLY B 260 ? 0.0697 0.0733 0.0573 0.0020  0.0013  -0.0073 238 GLY B N   
4713 C CA  . GLY B 260 ? 0.0639 0.0675 0.0540 0.0003  0.0029  -0.0071 238 GLY B CA  
4714 C C   . GLY B 260 ? 0.0749 0.0770 0.0638 0.0009  0.0056  -0.0063 238 GLY B C   
4715 O O   . GLY B 260 ? 0.0846 0.0845 0.0701 0.0021  0.0066  -0.0060 238 GLY B O   
4716 N N   . ILE B 261 ? 0.0672 0.0705 0.0587 -0.0001 0.0067  -0.0059 239 ILE B N   
4717 C CA  . ILE B 261 ? 0.0722 0.0740 0.0634 0.0002  0.0088  -0.0056 239 ILE B CA  
4718 C C   . ILE B 261 ? 0.0701 0.0716 0.0626 -0.0012 0.0095  -0.0061 239 ILE B C   
4719 O O   . ILE B 261 ? 0.0987 0.1019 0.0931 -0.0022 0.0088  -0.0062 239 ILE B O   
4720 C CB  . ILE B 261 ? 0.0786 0.0820 0.0713 0.0007  0.0092  -0.0052 239 ILE B CB  
4721 C CG1 . ILE B 261 ? 0.1099 0.1132 0.1014 0.0025  0.0085  -0.0046 239 ILE B CG1 
4722 C CG2 . ILE B 261 ? 0.1357 0.1374 0.1287 0.0007  0.0109  -0.0054 239 ILE B CG2 
4723 C CD1 . ILE B 261 ? 0.1629 0.1686 0.1565 0.0034  0.0086  -0.0044 239 ILE B CD1 
4724 N N   . TYR B 262 ? 0.0720 0.0715 0.0635 -0.0011 0.0109  -0.0063 240 TYR B N   
4725 C CA  . TYR B 262 ? 0.0735 0.0729 0.0666 -0.0022 0.0115  -0.0069 240 TYR B CA  
4726 C C   . TYR B 262 ? 0.0873 0.0863 0.0817 -0.0023 0.0127  -0.0070 240 TYR B C   
4727 O O   . TYR B 262 ? 0.0951 0.0927 0.0889 -0.0016 0.0137  -0.0065 240 TYR B O   
4728 C CB  . TYR B 262 ? 0.0810 0.0788 0.0729 -0.0020 0.0122  -0.0073 240 TYR B CB  
4729 C CG  . TYR B 262 ? 0.0881 0.0859 0.0791 -0.0020 0.0107  -0.0079 240 TYR B CG  
4730 C CD1 . TYR B 262 ? 0.0655 0.0642 0.0565 -0.0021 0.0088  -0.0079 240 TYR B CD1 
4731 C CD2 . TYR B 262 ? 0.1029 0.0997 0.0933 -0.0017 0.0112  -0.0087 240 TYR B CD2 
4732 C CE1 . TYR B 262 ? 0.0685 0.0666 0.0590 -0.0022 0.0071  -0.0088 240 TYR B CE1 
4733 C CE2 . TYR B 262 ? 0.0635 0.0598 0.0530 -0.0015 0.0096  -0.0097 240 TYR B CE2 
4734 C CZ  . TYR B 262 ? 0.0704 0.0670 0.0599 -0.0018 0.0074  -0.0098 240 TYR B CZ  
4735 O OH  . TYR B 262 ? 0.1073 0.1028 0.0962 -0.0016 0.0056  -0.0110 240 TYR B OH  
4736 N N   . LEU B 263 ? 0.0725 0.0726 0.0688 -0.0030 0.0124  -0.0076 241 LEU B N   
4737 C CA  . LEU B 263 ? 0.0768 0.0764 0.0745 -0.0031 0.0131  -0.0083 241 LEU B CA  
4738 C C   . LEU B 263 ? 0.0742 0.0730 0.0733 -0.0038 0.0139  -0.0089 241 LEU B C   
4739 O O   . LEU B 263 ? 0.1158 0.1151 0.1150 -0.0040 0.0134  -0.0090 241 LEU B O   
4740 C CB  . LEU B 263 ? 0.0640 0.0655 0.0624 -0.0033 0.0122  -0.0089 241 LEU B CB  
4741 C CG  . LEU B 263 ? 0.1130 0.1163 0.1106 -0.0026 0.0119  -0.0083 241 LEU B CG  
4742 C CD1 . LEU B 263 ? 0.1628 0.1680 0.1605 -0.0025 0.0115  -0.0087 241 LEU B CD1 
4743 C CD2 . LEU B 263 ? 0.0927 0.0948 0.0899 -0.0016 0.0125  -0.0083 241 LEU B CD2 
4744 N N   . ASP B 264 ? 0.0595 0.0570 0.0602 -0.0040 0.0149  -0.0091 242 ASP B N   
4745 C CA  . ASP B 264 ? 0.0798 0.0773 0.0831 -0.0048 0.0157  -0.0098 242 ASP B CA  
4746 C C   . ASP B 264 ? 0.1069 0.1045 0.1128 -0.0052 0.0151  -0.0111 242 ASP B C   
4747 O O   . ASP B 264 ? 0.0797 0.0789 0.0862 -0.0053 0.0136  -0.0122 242 ASP B O   
4748 C CB  . ASP B 264 ? 0.1066 0.1025 0.1098 -0.0048 0.0178  -0.0086 242 ASP B CB  
4749 C CG  . ASP B 264 ? 0.1513 0.1480 0.1580 -0.0056 0.0190  -0.0091 242 ASP B CG  
4750 O OD1 . ASP B 264 ? 0.1160 0.1142 0.1257 -0.0062 0.0179  -0.0105 242 ASP B OD1 
4751 O OD2 . ASP B 264 ? 0.1320 0.1281 0.1385 -0.0056 0.0211  -0.0079 242 ASP B OD2 
4752 N N   . GLU B 265 ? 0.0861 0.0817 0.0934 -0.0055 0.0161  -0.0110 243 GLU B N   
4753 C CA  . GLU B 265 ? 0.0878 0.0829 0.0979 -0.0060 0.0152  -0.0127 243 GLU B CA  
4754 C C   . GLU B 265 ? 0.1040 0.1003 0.1124 -0.0051 0.0134  -0.0141 243 GLU B C   
4755 O O   . GLU B 265 ? 0.1106 0.1075 0.1206 -0.0052 0.0120  -0.0161 243 GLU B O   
4756 C CB  . GLU B 265 ? 0.0921 0.0840 0.1036 -0.0063 0.0165  -0.0122 243 GLU B CB  
4757 C CG  . GLU B 265 ? 0.1116 0.1027 0.1258 -0.0075 0.0186  -0.0108 243 GLU B CG  
4758 C CD  . GLU B 265 ? 0.1571 0.1472 0.1679 -0.0068 0.0205  -0.0083 243 GLU B CD  
4759 O OE1 . GLU B 265 ? 0.1147 0.1059 0.1217 -0.0057 0.0199  -0.0079 243 GLU B OE1 
4760 O OE2 . GLU B 265 ? 0.2416 0.2296 0.2534 -0.0073 0.0226  -0.0066 243 GLU B OE2 
4761 N N   . SER B 266 ? 0.0743 0.0711 0.0794 -0.0040 0.0133  -0.0132 244 SER B N   
4762 C CA  . SER B 266 ? 0.0710 0.0694 0.0744 -0.0030 0.0120  -0.0142 244 SER B CA  
4763 C C   . SER B 266 ? 0.1169 0.1177 0.1197 -0.0031 0.0109  -0.0146 244 SER B C   
4764 O O   . SER B 266 ? 0.1436 0.1458 0.1452 -0.0023 0.0098  -0.0156 244 SER B O   
4765 C CB  . SER B 266 ? 0.0909 0.0898 0.0918 -0.0019 0.0124  -0.0129 244 SER B CB  
4766 O OG  . SER B 266 ? 0.1148 0.1114 0.1158 -0.0012 0.0131  -0.0129 244 SER B OG  
4767 N N   . GLY B 267 ? 0.1018 0.1031 0.1053 -0.0039 0.0110  -0.0137 245 GLY B N   
4768 C CA  . GLY B 267 ? 0.1024 0.1055 0.1055 -0.0039 0.0098  -0.0137 245 GLY B CA  
4769 C C   . GLY B 267 ? 0.0962 0.0998 0.1015 -0.0041 0.0086  -0.0155 245 GLY B C   
4770 O O   . GLY B 267 ? 0.1083 0.1123 0.1157 -0.0046 0.0084  -0.0156 245 GLY B O   
4771 N N   . GLU B 268 ? 0.1038 0.1077 0.1087 -0.0034 0.0077  -0.0171 246 GLU B N   
4772 C CA  . GLU B 268 ? 0.1214 0.1255 0.1288 -0.0035 0.0062  -0.0194 246 GLU B CA  
4773 C C   . GLU B 268 ? 0.1090 0.1152 0.1153 -0.0028 0.0042  -0.0198 246 GLU B C   
4774 O O   . GLU B 268 ? 0.1204 0.1272 0.1293 -0.0030 0.0027  -0.0215 246 GLU B O   
4775 C CB  . GLU B 268 ? 0.1869 0.1899 0.1942 -0.0029 0.0055  -0.0215 246 GLU B CB  
4776 C CG  . GLU B 268 ? 0.2929 0.2932 0.3018 -0.0035 0.0071  -0.0212 246 GLU B CG  
4777 C CD  . GLU B 268 ? 0.4492 0.4478 0.4585 -0.0029 0.0062  -0.0236 246 GLU B CD  
4778 O OE1 . GLU B 268 ? 0.4745 0.4729 0.4867 -0.0034 0.0045  -0.0260 246 GLU B OE1 
4779 O OE2 . GLU B 268 ? 0.4957 0.4934 0.5026 -0.0017 0.0068  -0.0234 246 GLU B OE2 
4780 N N   . ASP B 269 ? 0.1290 0.1361 0.1314 -0.0020 0.0042  -0.0182 247 ASP B N   
4781 C CA  . ASP B 269 ? 0.0948 0.1035 0.0955 -0.0011 0.0025  -0.0180 247 ASP B CA  
4782 C C   . ASP B 269 ? 0.0904 0.0996 0.0880 -0.0009 0.0032  -0.0152 247 ASP B C   
4783 O O   . ASP B 269 ? 0.0936 0.1024 0.0906 -0.0014 0.0049  -0.0138 247 ASP B O   
4784 C CB  . ASP B 269 ? 0.1178 0.1274 0.1163 0.0003  0.0008  -0.0202 247 ASP B CB  
4785 C CG  . ASP B 269 ? 0.2027 0.2122 0.1982 0.0012  0.0018  -0.0204 247 ASP B CG  
4786 O OD1 . ASP B 269 ? 0.1372 0.1471 0.1309 0.0012  0.0035  -0.0182 247 ASP B OD1 
4787 O OD2 . ASP B 269 ? 0.2982 0.3074 0.2933 0.0021  0.0008  -0.0231 247 ASP B OD2 
4788 N N   . LEU B 270 ? 0.0854 0.0954 0.0814 -0.0003 0.0019  -0.0143 248 LEU B N   
4789 C CA  . LEU B 270 ? 0.0767 0.0868 0.0705 -0.0004 0.0026  -0.0113 248 LEU B CA  
4790 C C   . LEU B 270 ? 0.0823 0.0936 0.0729 0.0001  0.0039  -0.0102 248 LEU B C   
4791 O O   . LEU B 270 ? 0.0870 0.0984 0.0775 -0.0007 0.0052  -0.0080 248 LEU B O   
4792 C CB  . LEU B 270 ? 0.1125 0.1227 0.1050 0.0004  0.0008  -0.0103 248 LEU B CB  
4793 C CG  . LEU B 270 ? 0.1404 0.1496 0.1325 -0.0002 0.0012  -0.0073 248 LEU B CG  
4794 C CD1 . LEU B 270 ? 0.1628 0.1703 0.1585 -0.0013 0.0015  -0.0076 248 LEU B CD1 
4795 C CD2 . LEU B 270 ? 0.1259 0.1351 0.1156 0.0010  -0.0005 -0.0059 248 LEU B CD2 
4796 N N   . SER B 271 ? 0.0939 0.1064 0.0822 0.0015  0.0035  -0.0118 249 SER B N   
4797 C CA  . SER B 271 ? 0.0657 0.0799 0.0511 0.0024  0.0050  -0.0111 249 SER B CA  
4798 C C   . SER B 271 ? 0.0629 0.0767 0.0505 0.0014  0.0067  -0.0108 249 SER B C   
4799 O O   . SER B 271 ? 0.0876 0.1029 0.0745 0.0013  0.0082  -0.0088 249 SER B O   
4800 C CB  . SER B 271 ? 0.0935 0.1085 0.0763 0.0043  0.0040  -0.0139 249 SER B CB  
4801 O OG  . SER B 271 ? 0.1109 0.1279 0.0908 0.0056  0.0056  -0.0134 249 SER B OG  
4802 N N   . THR B 272 ? 0.0775 0.0894 0.0680 0.0008  0.0066  -0.0127 250 THR B N   
4803 C CA  . THR B 272 ? 0.0881 0.0993 0.0803 0.0002  0.0080  -0.0123 250 THR B CA  
4804 C C   . THR B 272 ? 0.0715 0.0825 0.0649 -0.0012 0.0086  -0.0099 250 THR B C   
4805 O O   . THR B 272 ? 0.0678 0.0797 0.0614 -0.0014 0.0097  -0.0087 250 THR B O   
4806 C CB  . THR B 272 ? 0.1098 0.1186 0.1044 -0.0002 0.0078  -0.0144 250 THR B CB  
4807 O OG1 . THR B 272 ? 0.1463 0.1550 0.1402 0.0010  0.0069  -0.0169 250 THR B OG1 
4808 C CG2 . THR B 272 ? 0.1097 0.1177 0.1053 -0.0004 0.0092  -0.0137 250 THR B CG2 
4809 N N   . VAL B 273 ? 0.0786 0.0886 0.0729 -0.0020 0.0077  -0.0094 251 VAL B N   
4810 C CA  . VAL B 273 ? 0.0806 0.0900 0.0760 -0.0031 0.0079  -0.0075 251 VAL B CA  
4811 C C   . VAL B 273 ? 0.0748 0.0860 0.0689 -0.0033 0.0083  -0.0051 251 VAL B C   
4812 O O   . VAL B 273 ? 0.0865 0.0980 0.0818 -0.0042 0.0089  -0.0038 251 VAL B O   
4813 C CB  . VAL B 273 ? 0.0772 0.0851 0.0738 -0.0035 0.0068  -0.0077 251 VAL B CB  
4814 C CG1 . VAL B 273 ? 0.0796 0.0864 0.0768 -0.0045 0.0066  -0.0059 251 VAL B CG1 
4815 C CG2 . VAL B 273 ? 0.0845 0.0912 0.0832 -0.0037 0.0069  -0.0096 251 VAL B CG2 
4816 N N   . ILE B 274 ? 0.0583 0.0709 0.0501 -0.0024 0.0081  -0.0046 252 ILE B N   
4817 C CA  . ILE B 274 ? 0.0617 0.0765 0.0523 -0.0025 0.0090  -0.0020 252 ILE B CA  
4818 C C   . ILE B 274 ? 0.0871 0.1044 0.0781 -0.0023 0.0107  -0.0017 252 ILE B C   
4819 O O   . ILE B 274 ? 0.0628 0.0816 0.0553 -0.0033 0.0115  0.0006  252 ILE B O   
4820 C CB  . ILE B 274 ? 0.0637 0.0795 0.0509 -0.0012 0.0086  -0.0014 252 ILE B CB  
4821 C CG1 . ILE B 274 ? 0.0708 0.0843 0.0581 -0.0015 0.0068  -0.0008 252 ILE B CG1 
4822 C CG2 . ILE B 274 ? 0.1183 0.1369 0.1036 -0.0010 0.0102  0.0015  252 ILE B CG2 
4823 C CD1 . ILE B 274 ? 0.1024 0.1164 0.0864 0.0003  0.0055  -0.0015 252 ILE B CD1 
4824 N N   . ARG B 275 ? 0.0782 0.0959 0.0684 -0.0009 0.0110  -0.0040 253 ARG B N   
4825 C CA  . ARG B 275 ? 0.0701 0.0899 0.0610 -0.0003 0.0124  -0.0041 253 ARG B CA  
4826 C C   . ARG B 275 ? 0.0564 0.0754 0.0504 -0.0016 0.0124  -0.0035 253 ARG B C   
4827 O O   . ARG B 275 ? 0.0790 0.1005 0.0746 -0.0020 0.0132  -0.0019 253 ARG B O   
4828 C CB  . ARG B 275 ? 0.0812 0.1002 0.0709 0.0014  0.0123  -0.0070 253 ARG B CB  
4829 C CG  . ARG B 275 ? 0.0904 0.1116 0.0808 0.0025  0.0136  -0.0072 253 ARG B CG  
4830 C CD  . ARG B 275 ? 0.1541 0.1734 0.1439 0.0041  0.0133  -0.0102 253 ARG B CD  
4831 N NE  . ARG B 275 ? 0.1869 0.2077 0.1776 0.0054  0.0144  -0.0104 253 ARG B NE  
4832 C CZ  . ARG B 275 ? 0.1845 0.2031 0.1754 0.0067  0.0142  -0.0126 253 ARG B CZ  
4833 N NH1 . ARG B 275 ? 0.2109 0.2259 0.2017 0.0065  0.0130  -0.0146 253 ARG B NH1 
4834 N NH2 . ARG B 275 ? 0.2563 0.2765 0.2482 0.0081  0.0151  -0.0126 253 ARG B NH2 
4835 N N   . ALA B 276 ? 0.0688 0.0846 0.0637 -0.0023 0.0114  -0.0047 254 ALA B N   
4836 C CA  . ALA B 276 ? 0.0773 0.0921 0.0742 -0.0031 0.0112  -0.0045 254 ALA B CA  
4837 C C   . ALA B 276 ? 0.0779 0.0933 0.0765 -0.0046 0.0108  -0.0025 254 ALA B C   
4838 O O   . ALA B 276 ? 0.0904 0.1071 0.0907 -0.0050 0.0108  -0.0018 254 ALA B O   
4839 C CB  . ALA B 276 ? 0.0883 0.0998 0.0853 -0.0032 0.0106  -0.0060 254 ALA B CB  
4840 N N   . ALA B 277 ? 0.0775 0.0918 0.0757 -0.0054 0.0101  -0.0017 255 ALA B N   
4841 C CA  . ALA B 277 ? 0.0661 0.0802 0.0662 -0.0069 0.0095  0.0001  255 ALA B CA  
4842 C C   . ALA B 277 ? 0.0729 0.0905 0.0741 -0.0075 0.0105  0.0024  255 ALA B C   
4843 O O   . ALA B 277 ? 0.1050 0.1237 0.1091 -0.0087 0.0103  0.0036  255 ALA B O   
4844 C CB  . ALA B 277 ? 0.0897 0.1012 0.0892 -0.0074 0.0084  0.0005  255 ALA B CB  
4845 N N   . GLY B 278 ? 0.0831 0.1028 0.0822 -0.0064 0.0117  0.0031  256 GLY B N   
4846 C CA  . GLY B 278 ? 0.0830 0.1064 0.0828 -0.0068 0.0132  0.0056  256 GLY B CA  
4847 C C   . GLY B 278 ? 0.0931 0.1202 0.0950 -0.0063 0.0144  0.0055  256 GLY B C   
4848 O O   . GLY B 278 ? 0.1114 0.1420 0.1160 -0.0073 0.0155  0.0078  256 GLY B O   
4849 N N   . GLN B 279 ? 0.0958 0.1224 0.0970 -0.0049 0.0142  0.0030  257 GLN B N   
4850 C CA  . GLN B 279 ? 0.1061 0.1360 0.1092 -0.0040 0.0152  0.0026  257 GLN B CA  
4851 C C   . GLN B 279 ? 0.0936 0.1222 0.0994 -0.0048 0.0137  0.0019  257 GLN B C   
4852 O O   . GLN B 279 ? 0.1311 0.1621 0.1387 -0.0039 0.0140  0.0015  257 GLN B O   
4853 C CB  . GLN B 279 ? 0.0689 0.0991 0.0692 -0.0014 0.0159  0.0005  257 GLN B CB  
4854 C CG  . GLN B 279 ? 0.1074 0.1396 0.1046 -0.0002 0.0173  0.0009  257 GLN B CG  
4855 C CD  . GLN B 279 ? 0.1881 0.2203 0.1826 0.0025  0.0177  -0.0017 257 GLN B CD  
4856 O OE1 . GLN B 279 ? 0.2093 0.2396 0.2045 0.0032  0.0171  -0.0037 257 GLN B OE1 
4857 N NE2 . GLN B 279 ? 0.1755 0.2096 0.1666 0.0040  0.0188  -0.0018 257 GLN B NE2 
4858 N N   . GLY B 280 ? 0.0799 0.1048 0.0857 -0.0061 0.0121  0.0016  258 GLY B N   
4859 C CA  . GLY B 280 ? 0.0978 0.1212 0.1052 -0.0066 0.0106  0.0008  258 GLY B CA  
4860 C C   . GLY B 280 ? 0.1116 0.1337 0.1174 -0.0048 0.0105  -0.0011 258 GLY B C   
4861 O O   . GLY B 280 ? 0.1680 0.1912 0.1753 -0.0044 0.0099  -0.0013 258 GLY B O   
4862 N N   . LEU B 281 ? 0.0724 0.0920 0.0754 -0.0038 0.0110  -0.0023 259 LEU B N   
4863 C CA  . LEU B 281 ? 0.0767 0.0947 0.0784 -0.0022 0.0112  -0.0038 259 LEU B CA  
4864 C C   . LEU B 281 ? 0.1012 0.1154 0.1018 -0.0025 0.0103  -0.0045 259 LEU B C   
4865 O O   . LEU B 281 ? 0.1089 0.1214 0.1085 -0.0013 0.0105  -0.0052 259 LEU B O   
4866 C CB  . LEU B 281 ? 0.0910 0.1081 0.0907 -0.0011 0.0121  -0.0049 259 LEU B CB  
4867 C CG  . LEU B 281 ? 0.0921 0.1127 0.0915 -0.0001 0.0133  -0.0047 259 LEU B CG  
4868 C CD1 . LEU B 281 ? 0.1294 0.1484 0.1265 0.0013  0.0136  -0.0065 259 LEU B CD1 
4869 C CD2 . LEU B 281 ? 0.1140 0.1383 0.1153 0.0010  0.0139  -0.0041 259 LEU B CD2 
4870 N N   . CYS B 282 ? 0.0992 0.1119 0.0998 -0.0038 0.0095  -0.0043 260 CYS B N   
4871 C CA  . CYS B 282 ? 0.0780 0.0876 0.0774 -0.0038 0.0089  -0.0050 260 CYS B CA  
4872 C C   . CYS B 282 ? 0.0844 0.0934 0.0845 -0.0050 0.0075  -0.0048 260 CYS B C   
4873 O O   . CYS B 282 ? 0.1104 0.1209 0.1123 -0.0061 0.0070  -0.0039 260 CYS B O   
4874 C CB  . CYS B 282 ? 0.0932 0.1003 0.0912 -0.0035 0.0097  -0.0059 260 CYS B CB  
4875 S SG  . CYS B 282 ? 0.1105 0.1175 0.1090 -0.0045 0.0095  -0.0059 260 CYS B SG  
4876 N N   . ASP B 283 ? 0.0709 0.0776 0.0695 -0.0046 0.0069  -0.0056 261 ASP B N   
4877 C CA  . ASP B 283 ? 0.0603 0.0659 0.0592 -0.0054 0.0053  -0.0060 261 ASP B CA  
4878 C C   . ASP B 283 ? 0.0701 0.0730 0.0677 -0.0053 0.0055  -0.0068 261 ASP B C   
4879 O O   . ASP B 283 ? 0.0969 0.0982 0.0943 -0.0055 0.0042  -0.0076 261 ASP B O   
4880 C CB  . ASP B 283 ? 0.0618 0.0673 0.0597 -0.0046 0.0040  -0.0065 261 ASP B CB  
4881 C CG  . ASP B 283 ? 0.0849 0.0935 0.0848 -0.0044 0.0036  -0.0058 261 ASP B CG  
4882 O OD1 . ASP B 283 ? 0.1236 0.1346 0.1268 -0.0057 0.0028  -0.0051 261 ASP B OD1 
4883 O OD2 . ASP B 283 ? 0.0793 0.0881 0.0777 -0.0029 0.0043  -0.0057 261 ASP B OD2 
4884 N N   . GLY B 284 ? 0.0686 0.0709 0.0656 -0.0050 0.0070  -0.0069 262 GLY B N   
4885 C CA  . GLY B 284 ? 0.0873 0.0879 0.0839 -0.0048 0.0074  -0.0077 262 GLY B CA  
4886 C C   . GLY B 284 ? 0.0633 0.0638 0.0598 -0.0044 0.0090  -0.0079 262 GLY B C   
4887 O O   . GLY B 284 ? 0.0645 0.0659 0.0611 -0.0042 0.0097  -0.0076 262 GLY B O   
4888 N N   . PHE B 285 ? 0.0666 0.0662 0.0634 -0.0042 0.0096  -0.0087 263 PHE B N   
4889 C CA  . PHE B 285 ? 0.0569 0.0567 0.0548 -0.0042 0.0109  -0.0090 263 PHE B CA  
4890 C C   . PHE B 285 ? 0.0782 0.0772 0.0763 -0.0037 0.0122  -0.0096 263 PHE B C   
4891 O O   . PHE B 285 ? 0.0855 0.0839 0.0832 -0.0033 0.0118  -0.0102 263 PHE B O   
4892 C CB  . PHE B 285 ? 0.0721 0.0729 0.0718 -0.0046 0.0101  -0.0093 263 PHE B CB  
4893 C CG  . PHE B 285 ? 0.0640 0.0660 0.0634 -0.0049 0.0093  -0.0085 263 PHE B CG  
4894 C CD1 . PHE B 285 ? 0.0865 0.0888 0.0858 -0.0054 0.0082  -0.0076 263 PHE B CD1 
4895 C CD2 . PHE B 285 ? 0.0933 0.0962 0.0928 -0.0047 0.0098  -0.0087 263 PHE B CD2 
4896 C CE1 . PHE B 285 ? 0.1184 0.1223 0.1176 -0.0057 0.0079  -0.0065 263 PHE B CE1 
4897 C CE2 . PHE B 285 ? 0.0823 0.0869 0.0812 -0.0047 0.0094  -0.0080 263 PHE B CE2 
4898 C CZ  . PHE B 285 ? 0.1014 0.1067 0.1002 -0.0052 0.0086  -0.0067 263 PHE B CZ  
4899 N N   . GLY B 286 ? 0.0754 0.0742 0.0743 -0.0038 0.0138  -0.0095 264 GLY B N   
4900 C CA  . GLY B 286 ? 0.0775 0.0765 0.0782 -0.0037 0.0153  -0.0100 264 GLY B CA  
4901 C C   . GLY B 286 ? 0.1136 0.1138 0.1177 -0.0044 0.0147  -0.0108 264 GLY B C   
4902 O O   . GLY B 286 ? 0.2019 0.2021 0.2071 -0.0049 0.0149  -0.0108 264 GLY B O   
4903 N N   . MET B 287 ? 0.0786 0.0798 0.0844 -0.0043 0.0137  -0.0116 265 MET B N   
4904 C CA  . MET B 287 ? 0.0581 0.0606 0.0665 -0.0047 0.0126  -0.0124 265 MET B CA  
4905 C C   . MET B 287 ? 0.0859 0.0898 0.0983 -0.0048 0.0133  -0.0134 265 MET B C   
4906 O O   . MET B 287 ? 0.1019 0.1063 0.1150 -0.0042 0.0138  -0.0136 265 MET B O   
4907 C CB  . MET B 287 ? 0.0961 0.0988 0.1034 -0.0044 0.0104  -0.0123 265 MET B CB  
4908 C CG  . MET B 287 ? 0.0965 0.1006 0.1055 -0.0044 0.0089  -0.0131 265 MET B CG  
4909 S SD  . MET B 287 ? 0.0956 0.1001 0.1045 -0.0048 0.0088  -0.0137 265 MET B SD  
4910 C CE  . MET B 287 ? 0.1044 0.1085 0.1093 -0.0046 0.0085  -0.0122 265 MET B CE  
4911 N N   . LYS B 288 ? 0.0767 0.0814 0.0921 -0.0055 0.0132  -0.0141 266 LYS B N   
4912 C CA  . LYS B 288 ? 0.0629 0.0696 0.0834 -0.0060 0.0137  -0.0151 266 LYS B CA  
4913 C C   . LYS B 288 ? 0.1029 0.1114 0.1254 -0.0056 0.0111  -0.0165 266 LYS B C   
4914 O O   . LYS B 288 ? 0.0856 0.0938 0.1068 -0.0056 0.0093  -0.0170 266 LYS B O   
4915 C CB  . LYS B 288 ? 0.0799 0.0863 0.1033 -0.0072 0.0152  -0.0151 266 LYS B CB  
4916 C CG  . LYS B 288 ? 0.1036 0.1083 0.1250 -0.0073 0.0180  -0.0134 266 LYS B CG  
4917 C CD  . LYS B 288 ? 0.1224 0.1262 0.1472 -0.0087 0.0197  -0.0129 266 LYS B CD  
4918 C CE  . LYS B 288 ? 0.1317 0.1341 0.1544 -0.0085 0.0228  -0.0107 266 LYS B CE  
4919 N NZ  . LYS B 288 ? 0.1803 0.1803 0.1969 -0.0075 0.0225  -0.0096 266 LYS B NZ  
4920 N N   . LEU B 289 ? 0.0748 0.0851 0.1003 -0.0050 0.0109  -0.0171 267 LEU B N   
4921 C CA  . LEU B 289 ? 0.0617 0.0738 0.0890 -0.0042 0.0082  -0.0183 267 LEU B CA  
4922 C C   . LEU B 289 ? 0.0974 0.1108 0.1277 -0.0049 0.0066  -0.0198 267 LEU B C   
4923 O O   . LEU B 289 ? 0.0870 0.1006 0.1155 -0.0042 0.0040  -0.0204 267 LEU B O   
4924 C CB  . LEU B 289 ? 0.0995 0.1135 0.1303 -0.0033 0.0086  -0.0188 267 LEU B CB  
4925 C CG  . LEU B 289 ? 0.1800 0.1958 0.2128 -0.0020 0.0059  -0.0199 267 LEU B CG  
4926 C CD1 . LEU B 289 ? 0.1899 0.2034 0.2175 -0.0012 0.0036  -0.0189 267 LEU B CD1 
4927 C CD2 . LEU B 289 ? 0.1132 0.1305 0.1488 -0.0007 0.0068  -0.0202 267 LEU B CD2 
4928 N N   . THR B 290 ? 0.0782 0.0926 0.1132 -0.0062 0.0081  -0.0205 268 THR B N   
4929 C CA  . THR B 290 ? 0.0605 0.0760 0.0991 -0.0070 0.0062  -0.0224 268 THR B CA  
4930 C C   . THR B 290 ? 0.0721 0.0851 0.1062 -0.0070 0.0051  -0.0226 268 THR B C   
4931 O O   . THR B 290 ? 0.0918 0.1055 0.1259 -0.0066 0.0024  -0.0243 268 THR B O   
4932 C CB  . THR B 290 ? 0.0752 0.0922 0.1209 -0.0088 0.0079  -0.0229 268 THR B CB  
4933 O OG1 . THR B 290 ? 0.1132 0.1278 0.1573 -0.0097 0.0112  -0.0211 268 THR B OG1 
4934 C CG2 . THR B 290 ? 0.0907 0.1113 0.1419 -0.0085 0.0085  -0.0233 268 THR B CG2 
4935 N N   . ARG B 291 ? 0.0531 0.0636 0.0832 -0.0073 0.0071  -0.0209 269 ARG B N   
4936 C CA  . ARG B 291 ? 0.0541 0.0626 0.0802 -0.0070 0.0063  -0.0211 269 ARG B CA  
4937 C C   . ARG B 291 ? 0.0767 0.0857 0.0982 -0.0055 0.0041  -0.0212 269 ARG B C   
4938 O O   . ARG B 291 ? 0.0824 0.0913 0.1023 -0.0050 0.0024  -0.0225 269 ARG B O   
4939 C CB  . ARG B 291 ? 0.0648 0.0709 0.0880 -0.0073 0.0088  -0.0192 269 ARG B CB  
4940 C CG  . ARG B 291 ? 0.0926 0.0970 0.1117 -0.0067 0.0082  -0.0193 269 ARG B CG  
4941 C CD  . ARG B 291 ? 0.0836 0.0858 0.1004 -0.0068 0.0104  -0.0174 269 ARG B CD  
4942 N NE  . ARG B 291 ? 0.0705 0.0729 0.0845 -0.0064 0.0113  -0.0156 269 ARG B NE  
4943 C CZ  . ARG B 291 ? 0.0628 0.0643 0.0766 -0.0066 0.0133  -0.0142 269 ARG B CZ  
4944 N NH1 . ARG B 291 ? 0.0825 0.0828 0.0988 -0.0074 0.0150  -0.0139 269 ARG B NH1 
4945 N NH2 . ARG B 291 ? 0.0946 0.0962 0.1057 -0.0061 0.0135  -0.0131 269 ARG B NH2 
4946 N N   . ILE B 292 ? 0.0711 0.0805 0.0906 -0.0048 0.0041  -0.0197 270 ILE B N   
4947 C CA  . ILE B 292 ? 0.0759 0.0854 0.0910 -0.0036 0.0025  -0.0191 270 ILE B CA  
4948 C C   . ILE B 292 ? 0.0954 0.1068 0.1117 -0.0026 -0.0003 -0.0206 270 ILE B C   
4949 O O   . ILE B 292 ? 0.0955 0.1071 0.1079 -0.0014 -0.0020 -0.0202 270 ILE B O   
4950 C CB  . ILE B 292 ? 0.0830 0.0916 0.0956 -0.0033 0.0033  -0.0169 270 ILE B CB  
4951 C CG1 . ILE B 292 ? 0.1278 0.1359 0.1356 -0.0026 0.0026  -0.0154 270 ILE B CG1 
4952 C CG2 . ILE B 292 ? 0.0849 0.0943 0.1001 -0.0028 0.0026  -0.0170 270 ILE B CG2 
4953 C CD1 . ILE B 292 ? 0.1715 0.1790 0.1770 -0.0029 0.0038  -0.0150 270 ILE B CD1 
4954 N N   . GLY B 293 ? 0.0767 0.0897 0.0985 -0.0031 -0.0009 -0.0221 271 GLY B N   
4955 C CA  . GLY B 293 ? 0.0646 0.0798 0.0884 -0.0021 -0.0039 -0.0240 271 GLY B CA  
4956 C C   . GLY B 293 ? 0.0920 0.1088 0.1181 -0.0011 -0.0050 -0.0237 271 GLY B C   
4957 O O   . GLY B 293 ? 0.1316 0.1502 0.1586 0.0001  -0.0079 -0.0249 271 GLY B O   
4958 N N   . GLY B 294 ? 0.0830 0.0992 0.1100 -0.0014 -0.0028 -0.0222 272 GLY B N   
4959 C CA  . GLY B 294 ? 0.0773 0.0948 0.1070 -0.0003 -0.0036 -0.0222 272 GLY B CA  
4960 C C   . GLY B 294 ? 0.0822 0.0974 0.1076 0.0007  -0.0034 -0.0200 272 GLY B C   
4961 O O   . GLY B 294 ? 0.0759 0.0887 0.0966 0.0003  -0.0024 -0.0184 272 GLY B O   
4962 N N   . LEU B 295 ? 0.0657 0.0817 0.0933 0.0021  -0.0044 -0.0201 273 LEU B N   
4963 C CA  . LEU B 295 ? 0.0596 0.0729 0.0842 0.0031  -0.0043 -0.0184 273 LEU B CA  
4964 C C   . LEU B 295 ? 0.1018 0.1129 0.1210 0.0038  -0.0062 -0.0165 273 LEU B C   
4965 O O   . LEU B 295 ? 0.0907 0.0989 0.1066 0.0035  -0.0054 -0.0146 273 LEU B O   
4966 C CB  . LEU B 295 ? 0.0585 0.0732 0.0873 0.0047  -0.0050 -0.0193 273 LEU B CB  
4967 C CG  . LEU B 295 ? 0.0748 0.0916 0.1086 0.0042  -0.0023 -0.0206 273 LEU B CG  
4968 C CD1 . LEU B 295 ? 0.0707 0.0902 0.1096 0.0062  -0.0034 -0.0219 273 LEU B CD1 
4969 C CD2 . LEU B 295 ? 0.0986 0.1125 0.1292 0.0038  0.0002  -0.0195 273 LEU B CD2 
4970 N N   . GLN B 296 ? 0.0835 0.0959 0.1017 0.0047  -0.0086 -0.0169 274 GLN B N   
4971 C CA  . GLN B 296 ? 0.0890 0.0996 0.1015 0.0055  -0.0100 -0.0147 274 GLN B CA  
4972 C C   . GLN B 296 ? 0.0965 0.1056 0.1051 0.0039  -0.0079 -0.0132 274 GLN B C   
4973 O O   . GLN B 296 ? 0.0950 0.1017 0.1002 0.0038  -0.0074 -0.0106 274 GLN B O   
4974 C CB  . GLN B 296 ? 0.1172 0.1299 0.1287 0.0069  -0.0129 -0.0157 274 GLN B CB  
4975 C CG  . GLN B 296 ? 0.1346 0.1456 0.1402 0.0085  -0.0146 -0.0131 274 GLN B CG  
4976 C CD  . GLN B 296 ? 0.1146 0.1247 0.1147 0.0077  -0.0132 -0.0114 274 GLN B CD  
4977 O OE1 . GLN B 296 ? 0.1296 0.1411 0.1295 0.0068  -0.0122 -0.0130 274 GLN B OE1 
4978 N NE2 . GLN B 296 ? 0.1212 0.1291 0.1170 0.0081  -0.0131 -0.0080 274 GLN B NE2 
4979 N N   . GLN B 297 ? 0.0678 0.0782 0.0772 0.0028  -0.0066 -0.0147 275 GLN B N   
4980 C CA  . GLN B 297 ? 0.0734 0.0827 0.0796 0.0016  -0.0047 -0.0136 275 GLN B CA  
4981 C C   . GLN B 297 ? 0.0735 0.0810 0.0804 0.0004  -0.0024 -0.0126 275 GLN B C   
4982 O O   . GLN B 297 ? 0.0818 0.0879 0.0858 -0.0003 -0.0014 -0.0108 275 GLN B O   
4983 C CB  . GLN B 297 ? 0.0635 0.0743 0.0705 0.0010  -0.0043 -0.0157 275 GLN B CB  
4984 C CG  . GLN B 297 ? 0.0726 0.0850 0.0774 0.0024  -0.0067 -0.0168 275 GLN B CG  
4985 C CD  . GLN B 297 ? 0.0864 0.0981 0.0850 0.0031  -0.0064 -0.0148 275 GLN B CD  
4986 O OE1 . GLN B 297 ? 0.1015 0.1132 0.0984 0.0025  -0.0048 -0.0149 275 GLN B OE1 
4987 N NE2 . GLN B 297 ? 0.1007 0.1121 0.0963 0.0044  -0.0077 -0.0128 275 GLN B NE2 
4988 N N   . MET B 298 ? 0.0710 0.0788 0.0818 0.0002  -0.0017 -0.0139 276 MET B N   
4989 C CA  . MET B 298 ? 0.0753 0.0814 0.0863 -0.0005 0.0002  -0.0133 276 MET B CA  
4990 C C   . MET B 298 ? 0.0820 0.0856 0.0909 -0.0002 -0.0005 -0.0115 276 MET B C   
4991 O O   . MET B 298 ? 0.0891 0.0910 0.0965 -0.0010 0.0005  -0.0106 276 MET B O   
4992 C CB  . MET B 298 ? 0.0687 0.0760 0.0840 -0.0004 0.0013  -0.0150 276 MET B CB  
4993 C CG  . MET B 298 ? 0.1478 0.1538 0.1627 -0.0010 0.0036  -0.0147 276 MET B CG  
4994 S SD  . MET B 298 ? 0.1268 0.1329 0.1406 -0.0025 0.0057  -0.0146 276 MET B SD  
4995 C CE  . MET B 298 ? 0.1476 0.1521 0.1602 -0.0025 0.0078  -0.0142 276 MET B CE  
4996 N N   . ALA B 299 ? 0.0971 0.1004 0.1063 0.0011  -0.0025 -0.0111 277 ALA B N   
4997 C CA  . ALA B 299 ? 0.0835 0.0837 0.0910 0.0014  -0.0034 -0.0091 277 ALA B CA  
4998 C C   . ALA B 299 ? 0.0784 0.0777 0.0824 0.0003  -0.0031 -0.0067 277 ALA B C   
4999 O O   . ALA B 299 ? 0.1019 0.0988 0.1052 -0.0006 -0.0027 -0.0053 277 ALA B O   
5000 C CB  . ALA B 299 ? 0.1116 0.1113 0.1199 0.0032  -0.0057 -0.0089 277 ALA B CB  
5001 N N   . ALA B 300 ? 0.0753 0.0765 0.0773 0.0005  -0.0033 -0.0064 278 ALA B N   
5002 C CA  . ALA B 300 ? 0.0755 0.0767 0.0743 -0.0004 -0.0025 -0.0041 278 ALA B CA  
5003 C C   . ALA B 300 ? 0.0804 0.0818 0.0795 -0.0019 -0.0005 -0.0043 278 ALA B C   
5004 O O   . ALA B 300 ? 0.0792 0.0797 0.0774 -0.0029 0.0002  -0.0023 278 ALA B O   
5005 C CB  . ALA B 300 ? 0.0987 0.1022 0.0947 0.0006  -0.0030 -0.0042 278 ALA B CB  
5006 N N   . PHE B 301 ? 0.0873 0.0898 0.0880 -0.0020 0.0004  -0.0066 279 PHE B N   
5007 C CA  . PHE B 301 ? 0.0901 0.0926 0.0912 -0.0031 0.0021  -0.0070 279 PHE B CA  
5008 C C   . PHE B 301 ? 0.0721 0.0724 0.0739 -0.0037 0.0022  -0.0064 279 PHE B C   
5009 O O   . PHE B 301 ? 0.0730 0.0729 0.0740 -0.0047 0.0028  -0.0053 279 PHE B O   
5010 C CB  . PHE B 301 ? 0.0552 0.0588 0.0582 -0.0030 0.0030  -0.0092 279 PHE B CB  
5011 C CG  . PHE B 301 ? 0.1064 0.1093 0.1097 -0.0038 0.0046  -0.0095 279 PHE B CG  
5012 C CD1 . PHE B 301 ? 0.1110 0.1144 0.1129 -0.0043 0.0056  -0.0090 279 PHE B CD1 
5013 C CD2 . PHE B 301 ? 0.1020 0.1038 0.1067 -0.0036 0.0051  -0.0104 279 PHE B CD2 
5014 C CE1 . PHE B 301 ? 0.1044 0.1070 0.1061 -0.0047 0.0068  -0.0091 279 PHE B CE1 
5015 C CE2 . PHE B 301 ? 0.0830 0.0842 0.0872 -0.0040 0.0065  -0.0105 279 PHE B CE2 
5016 C CZ  . PHE B 301 ? 0.1070 0.1085 0.1097 -0.0045 0.0072  -0.0098 279 PHE B CZ  
5017 N N   . ARG B 302 ? 0.0687 0.0676 0.0720 -0.0030 0.0013  -0.0072 280 ARG B N   
5018 C CA  . ARG B 302 ? 0.0732 0.0696 0.0770 -0.0032 0.0010  -0.0072 280 ARG B CA  
5019 C C   . ARG B 302 ? 0.0928 0.0873 0.0957 -0.0041 0.0001  -0.0049 280 ARG B C   
5020 O O   . ARG B 302 ? 0.0875 0.0807 0.