data_4J2X
# 
_entry.id   4J2X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4J2X         
NDB   NA2232       
RCSB  RCSB077528   
WWPDB D_1000077528 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1TTU 'Crystal Structure of CSL bound to DNA'                                      unspecified 
PDB 2FO1 'Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA' unspecified 
PDB 3BRD 'CSL (Lag-1) bound to DNA with Lin-12 RAM peptide, P212121'                  unspecified 
PDB 3BRF 'CSL (Lag-1) bound to DNA with Link-12 RAM peptide, C2221'                   unspecified 
PDB 3BRG 'CSL (RBP-Jk) bound to DNA'                                                  unspecified 
PDB 3IAG 'CSL (RBP-Jk) bound to HES-1 nonconsensus site'                              unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4J2X 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Collins, K.J.' 1 
'Kovall, R.A.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Structure and Function of the CSL-KyoT2 Corepressor Complex: A Negative Regulator of Notch Signaling.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                70 
_citation.page_last                 81 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24290140 
_citation.pdbx_database_id_DOI      10.1016/j.str.2013.10.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Collins, K.J.' 1 
primary 'Yuan, Z.'      2 
primary 'Kovall, R.A.'  3 
# 
_cell.entry_id           4J2X 
_cell.length_a           62.157 
_cell.length_b           97.293 
_cell.length_c           144.102 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.17 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4J2X 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Recombining binding protein suppressor of hairless'    48224.992 2 ? R115T 'Core domain (UNP residues 53-474)' 
? 
2 polymer     man 'Four and a half LIM domains protein 1'                 2929.327  2 ? ?     'SEE REMARK 999'                    
? 
3 polymer     syn "5'-D(*AP*AP*TP*CP*TP*TP*TP*CP*CP*CP*AP*CP*AP*GP*T)-3'" 4503.949  2 ? ?     ?                                   
? 
4 polymer     syn "5'-D(*TP*TP*AP*CP*TP*GP*TP*GP*GP*GP*AP*AP*AP*GP*A)-3'" 4673.059  2 ? ?     ?                                   
? 
5 non-polymer syn 1,2-ETHANEDIOL                                          62.068    1 ? ?     ?                                   
? 
6 water       nat water                                                   18.015    8 ? ?     ?                                   
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CSL, CBF-1, Supressor of Hairless, Lag-1, J kappa-recombination signal-binding protein, RBP-J kappa' 
2 'FHL-1, KyoT, RBP-associated molecule 14-1, RAM14-1, Skeletal muscle LIM-protein 1, SLIM, SLIM-1'     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPLGSPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMETDGCSEQESQPCA
FIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCI
ASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPR
LIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGASWTIISTDKAEYTFY
EGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQP
VQVPVTLVRNDGVIYSTSLTFTYTPEP
;
;GPLGSPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMETDGCSEQESQPCA
FIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCI
ASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPR
LIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGASWTIISTDKAEYTFY
EGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQP
VQVPVTLVRNDGVIYSTSLTFTYTPEP
;
A,C ? 
2 'polypeptide(L)'        no no SGLVKAPVWWPMKDNPGTTTASTAKNAP SGLVKAPVWWPMKDNPGTTTASTAKNAP B,D ? 
3 polydeoxyribonucleotide no no '(DA)(DA)(DT)(DC)(DT)(DT)(DT)(DC)(DC)(DC)(DA)(DC)(DA)(DG)(DT)' AATCTTTCCCACAGT E,G ? 
4 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DC)(DT)(DG)(DT)(DG)(DG)(DG)(DA)(DA)(DA)(DG)(DA)' TTACTGTGGGAAAGA F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   PRO n 
1 7   PRO n 
1 8   LYS n 
1 9   ARG n 
1 10  LEU n 
1 11  THR n 
1 12  ARG n 
1 13  GLU n 
1 14  ALA n 
1 15  MET n 
1 16  ARG n 
1 17  ASN n 
1 18  TYR n 
1 19  LEU n 
1 20  LYS n 
1 21  GLU n 
1 22  ARG n 
1 23  GLY n 
1 24  ASP n 
1 25  GLN n 
1 26  THR n 
1 27  VAL n 
1 28  LEU n 
1 29  ILE n 
1 30  LEU n 
1 31  HIS n 
1 32  ALA n 
1 33  LYS n 
1 34  VAL n 
1 35  ALA n 
1 36  GLN n 
1 37  LYS n 
1 38  SER n 
1 39  TYR n 
1 40  GLY n 
1 41  ASN n 
1 42  GLU n 
1 43  LYS n 
1 44  ARG n 
1 45  PHE n 
1 46  PHE n 
1 47  CYS n 
1 48  PRO n 
1 49  PRO n 
1 50  PRO n 
1 51  CYS n 
1 52  VAL n 
1 53  TYR n 
1 54  LEU n 
1 55  MET n 
1 56  GLY n 
1 57  SER n 
1 58  GLY n 
1 59  TRP n 
1 60  LYS n 
1 61  LYS n 
1 62  LYS n 
1 63  LYS n 
1 64  GLU n 
1 65  GLN n 
1 66  MET n 
1 67  GLU n 
1 68  THR n 
1 69  ASP n 
1 70  GLY n 
1 71  CYS n 
1 72  SER n 
1 73  GLU n 
1 74  GLN n 
1 75  GLU n 
1 76  SER n 
1 77  GLN n 
1 78  PRO n 
1 79  CYS n 
1 80  ALA n 
1 81  PHE n 
1 82  ILE n 
1 83  GLY n 
1 84  ILE n 
1 85  GLY n 
1 86  ASN n 
1 87  SER n 
1 88  ASP n 
1 89  GLN n 
1 90  GLU n 
1 91  MET n 
1 92  GLN n 
1 93  GLN n 
1 94  LEU n 
1 95  ASN n 
1 96  LEU n 
1 97  GLU n 
1 98  GLY n 
1 99  LYS n 
1 100 ASN n 
1 101 TYR n 
1 102 CYS n 
1 103 THR n 
1 104 ALA n 
1 105 LYS n 
1 106 THR n 
1 107 LEU n 
1 108 TYR n 
1 109 ILE n 
1 110 SER n 
1 111 ASP n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 ARG n 
1 116 LYS n 
1 117 HIS n 
1 118 PHE n 
1 119 MET n 
1 120 LEU n 
1 121 SER n 
1 122 VAL n 
1 123 LYS n 
1 124 MET n 
1 125 PHE n 
1 126 TYR n 
1 127 GLY n 
1 128 ASN n 
1 129 SER n 
1 130 ASP n 
1 131 ASP n 
1 132 ILE n 
1 133 GLY n 
1 134 VAL n 
1 135 PHE n 
1 136 LEU n 
1 137 SER n 
1 138 LYS n 
1 139 ARG n 
1 140 ILE n 
1 141 LYS n 
1 142 VAL n 
1 143 ILE n 
1 144 SER n 
1 145 LYS n 
1 146 PRO n 
1 147 SER n 
1 148 LYS n 
1 149 LYS n 
1 150 LYS n 
1 151 GLN n 
1 152 SER n 
1 153 LEU n 
1 154 LYS n 
1 155 ASN n 
1 156 ALA n 
1 157 ASP n 
1 158 LEU n 
1 159 CYS n 
1 160 ILE n 
1 161 ALA n 
1 162 SER n 
1 163 GLY n 
1 164 THR n 
1 165 LYS n 
1 166 VAL n 
1 167 ALA n 
1 168 LEU n 
1 169 PHE n 
1 170 ASN n 
1 171 ARG n 
1 172 LEU n 
1 173 ARG n 
1 174 SER n 
1 175 GLN n 
1 176 THR n 
1 177 VAL n 
1 178 SER n 
1 179 THR n 
1 180 ARG n 
1 181 TYR n 
1 182 LEU n 
1 183 HIS n 
1 184 VAL n 
1 185 GLU n 
1 186 GLY n 
1 187 GLY n 
1 188 ASN n 
1 189 PHE n 
1 190 HIS n 
1 191 ALA n 
1 192 SER n 
1 193 SER n 
1 194 GLN n 
1 195 GLN n 
1 196 TRP n 
1 197 GLY n 
1 198 ALA n 
1 199 PHE n 
1 200 TYR n 
1 201 ILE n 
1 202 HIS n 
1 203 LEU n 
1 204 LEU n 
1 205 ASP n 
1 206 ASP n 
1 207 ASP n 
1 208 GLU n 
1 209 SER n 
1 210 GLU n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 THR n 
1 216 VAL n 
1 217 ARG n 
1 218 ASP n 
1 219 GLY n 
1 220 TYR n 
1 221 ILE n 
1 222 HIS n 
1 223 TYR n 
1 224 GLY n 
1 225 GLN n 
1 226 THR n 
1 227 VAL n 
1 228 LYS n 
1 229 LEU n 
1 230 VAL n 
1 231 CYS n 
1 232 SER n 
1 233 VAL n 
1 234 THR n 
1 235 GLY n 
1 236 MET n 
1 237 ALA n 
1 238 LEU n 
1 239 PRO n 
1 240 ARG n 
1 241 LEU n 
1 242 ILE n 
1 243 ILE n 
1 244 ARG n 
1 245 LYS n 
1 246 VAL n 
1 247 ASP n 
1 248 LYS n 
1 249 GLN n 
1 250 THR n 
1 251 ALA n 
1 252 LEU n 
1 253 LEU n 
1 254 ASP n 
1 255 ALA n 
1 256 ASP n 
1 257 ASP n 
1 258 PRO n 
1 259 VAL n 
1 260 SER n 
1 261 GLN n 
1 262 LEU n 
1 263 HIS n 
1 264 LYS n 
1 265 CYS n 
1 266 ALA n 
1 267 PHE n 
1 268 TYR n 
1 269 LEU n 
1 270 LYS n 
1 271 ASP n 
1 272 THR n 
1 273 GLU n 
1 274 ARG n 
1 275 MET n 
1 276 TYR n 
1 277 LEU n 
1 278 CYS n 
1 279 LEU n 
1 280 SER n 
1 281 GLN n 
1 282 GLU n 
1 283 ARG n 
1 284 ILE n 
1 285 ILE n 
1 286 GLN n 
1 287 PHE n 
1 288 GLN n 
1 289 ALA n 
1 290 THR n 
1 291 PRO n 
1 292 CYS n 
1 293 PRO n 
1 294 LYS n 
1 295 GLU n 
1 296 GLN n 
1 297 ASN n 
1 298 LYS n 
1 299 GLU n 
1 300 MET n 
1 301 ILE n 
1 302 ASN n 
1 303 ASP n 
1 304 GLY n 
1 305 ALA n 
1 306 SER n 
1 307 TRP n 
1 308 THR n 
1 309 ILE n 
1 310 ILE n 
1 311 SER n 
1 312 THR n 
1 313 ASP n 
1 314 LYS n 
1 315 ALA n 
1 316 GLU n 
1 317 TYR n 
1 318 THR n 
1 319 PHE n 
1 320 TYR n 
1 321 GLU n 
1 322 GLY n 
1 323 MET n 
1 324 GLY n 
1 325 PRO n 
1 326 VAL n 
1 327 LEU n 
1 328 ALA n 
1 329 PRO n 
1 330 VAL n 
1 331 THR n 
1 332 PRO n 
1 333 VAL n 
1 334 PRO n 
1 335 VAL n 
1 336 VAL n 
1 337 GLU n 
1 338 SER n 
1 339 LEU n 
1 340 GLN n 
1 341 LEU n 
1 342 ASN n 
1 343 GLY n 
1 344 GLY n 
1 345 GLY n 
1 346 ASP n 
1 347 VAL n 
1 348 ALA n 
1 349 MET n 
1 350 LEU n 
1 351 GLU n 
1 352 LEU n 
1 353 THR n 
1 354 GLY n 
1 355 GLN n 
1 356 ASN n 
1 357 PHE n 
1 358 THR n 
1 359 PRO n 
1 360 ASN n 
1 361 LEU n 
1 362 ARG n 
1 363 VAL n 
1 364 TRP n 
1 365 PHE n 
1 366 GLY n 
1 367 ASP n 
1 368 VAL n 
1 369 GLU n 
1 370 ALA n 
1 371 GLU n 
1 372 THR n 
1 373 MET n 
1 374 TYR n 
1 375 ARG n 
1 376 CYS n 
1 377 GLY n 
1 378 GLU n 
1 379 SER n 
1 380 MET n 
1 381 LEU n 
1 382 CYS n 
1 383 VAL n 
1 384 VAL n 
1 385 PRO n 
1 386 ASP n 
1 387 ILE n 
1 388 SER n 
1 389 ALA n 
1 390 PHE n 
1 391 ARG n 
1 392 GLU n 
1 393 GLY n 
1 394 TRP n 
1 395 ARG n 
1 396 TRP n 
1 397 VAL n 
1 398 ARG n 
1 399 GLN n 
1 400 PRO n 
1 401 VAL n 
1 402 GLN n 
1 403 VAL n 
1 404 PRO n 
1 405 VAL n 
1 406 THR n 
1 407 LEU n 
1 408 VAL n 
1 409 ARG n 
1 410 ASN n 
1 411 ASP n 
1 412 GLY n 
1 413 VAL n 
1 414 ILE n 
1 415 TYR n 
1 416 SER n 
1 417 THR n 
1 418 SER n 
1 419 LEU n 
1 420 THR n 
1 421 PHE n 
1 422 THR n 
1 423 TYR n 
1 424 THR n 
1 425 PRO n 
1 426 GLU n 
1 427 PRO n 
2 1   SER n 
2 2   GLY n 
2 3   LEU n 
2 4   VAL n 
2 5   LYS n 
2 6   ALA n 
2 7   PRO n 
2 8   VAL n 
2 9   TRP n 
2 10  TRP n 
2 11  PRO n 
2 12  MET n 
2 13  LYS n 
2 14  ASP n 
2 15  ASN n 
2 16  PRO n 
2 17  GLY n 
2 18  THR n 
2 19  THR n 
2 20  THR n 
2 21  ALA n 
2 22  SER n 
2 23  THR n 
2 24  ALA n 
2 25  LYS n 
2 26  ASN n 
2 27  ALA n 
2 28  PRO n 
3 1   DA  n 
3 2   DA  n 
3 3   DT  n 
3 4   DC  n 
3 5   DT  n 
3 6   DT  n 
3 7   DT  n 
3 8   DC  n 
3 9   DC  n 
3 10  DC  n 
3 11  DA  n 
3 12  DC  n 
3 13  DA  n 
3 14  DG  n 
3 15  DT  n 
4 1   DT  n 
4 2   DT  n 
4 3   DA  n 
4 4   DC  n 
4 5   DT  n 
4 6   DG  n 
4 7   DT  n 
4 8   DG  n 
4 9   DG  n 
4 10  DG  n 
4 11  DA  n 
4 12  DA  n 
4 13  DA  n 
4 14  DG  n 
4 15  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? mouse ? 'Igkjrb1, Igkrsbp, RBP-Jk, Rbpj, Rbpsuh' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? PGEX-6P1 ? ? 
2 1 sample ? ? ? mouse ? Fhl1                                     ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? Pet28B+  ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'Homo sapiens' human 9606 ? 
4 1 sample ? ? 'Homo sapiens' human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SUH_MOUSE  P31266 1 
;PPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIG
NSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTK
VALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRK
VDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGASWTIISTDKAEYTFYEGMGP
VLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPV
TLVRNDGVIYSTSLTFTYTPEP
;
53  ? 
2 UNP FHL1_MOUSE P97447 2 GLVKAPVWWPMKDNPGTTTASTAKNAP 168 ? 
3 PDB 4J2X       4J2X   3 AATCTTTCCCACAGT 1   ? 
4 PDB 4J2X       4J2X   4 TTACTGTGGGAAAGA 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4J2X A 6 ? 427 ? P31266 53  ? 474 ? 53  474 
2 2 4J2X B 2 ? 28  ? P97447 168 ? 194 ? 184 210 
3 1 4J2X C 6 ? 427 ? P31266 53  ? 474 ? 53  474 
4 2 4J2X D 2 ? 28  ? P97447 168 ? 194 ? 184 210 
5 3 4J2X E 1 ? 15  ? 4J2X   1   ? 15  ? 1   15  
6 3 4J2X G 1 ? 15  ? 4J2X   1   ? 15  ? 1   15  
7 4 4J2X F 1 ? 15  ? 4J2X   1   ? 15  ? 1   15  
8 4 4J2X H 1 ? 15  ? 4J2X   1   ? 15  ? 1   15  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4J2X GLY A 1  ? UNP P31266 ?   ?   'EXPRESSION TAG'      48  1  
1 4J2X PRO A 2  ? UNP P31266 ?   ?   'EXPRESSION TAG'      49  2  
1 4J2X LEU A 3  ? UNP P31266 ?   ?   'EXPRESSION TAG'      50  3  
1 4J2X GLY A 4  ? UNP P31266 ?   ?   'EXPRESSION TAG'      51  4  
1 4J2X SER A 5  ? UNP P31266 ?   ?   'EXPRESSION TAG'      52  5  
1 4J2X THR A 68 ? UNP P31266 ARG 115 'ENGINEERED MUTATION' 115 6  
2 4J2X SER B 1  ? UNP P97447 ?   ?   'EXPRESSION TAG'      183 7  
3 4J2X GLY C 1  ? UNP P31266 ?   ?   'EXPRESSION TAG'      48  8  
3 4J2X PRO C 2  ? UNP P31266 ?   ?   'EXPRESSION TAG'      49  9  
3 4J2X LEU C 3  ? UNP P31266 ?   ?   'EXPRESSION TAG'      50  10 
3 4J2X GLY C 4  ? UNP P31266 ?   ?   'EXPRESSION TAG'      51  11 
3 4J2X SER C 5  ? UNP P31266 ?   ?   'EXPRESSION TAG'      52  12 
3 4J2X THR C 68 ? UNP P31266 ARG 115 'ENGINEERED MUTATION' 115 13 
4 4J2X SER D 1  ? UNP P97447 ?   ?   'EXPRESSION TAG'      183 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4J2X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.71 
_exptl_crystal.density_percent_sol   66.85 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.pdbx_details    '21% PEG3350, 0.1 M HEPES, pH 7.1, 0.25 M ammonium acetate, MICROBATCH, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-03-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'diamond(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
# 
_reflns.entry_id                     4J2X 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             40.3 
_reflns.d_resolution_high            2.85 
_reflns.number_obs                   37773 
_reflns.number_all                   37773 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            0.053 
_reflns.pdbx_Rsym_value              0.053 
_reflns.pdbx_netI_over_sigmaI        13.9 
_reflns.B_iso_Wilson_estimate        105.45 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.85 
_reflns_shell.d_res_low              2.93 
_reflns_shell.percent_possible_all   93.96 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.375 
_reflns_shell.meanI_over_sigI_obs    1.82 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4J2X 
_refine.ls_number_reflns_obs                     37773 
_refine.ls_number_reflns_all                     37773 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.30 
_refine.ls_d_res_high                            2.85 
_refine.ls_percent_reflns_obs                    93.96 
_refine.ls_R_factor_obs                          0.1905 
_refine.ls_R_factor_all                          0.1905 
_refine.ls_R_factor_R_work                       0.1884 
_refine.ls_R_factor_R_free                       0.2308 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  1898 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9485 
_refine.correlation_coeff_Fo_to_Fc_free          0.9198 
_refine.B_iso_mean                               108.71 
_refine.aniso_B[1][1]                            -1.6996 
_refine.aniso_B[2][2]                            13.7749 
_refine.aniso_B[3][3]                            -12.0753 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            9.2332 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3IAG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.687 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.3100 
_refine.pdbx_overall_SU_R_Blow_DPI               0.6110 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.3010 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.entry_id                        4J2X 
_refine_analyze.Luzzati_coordinate_error_obs    0.560 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6913 
_refine_hist.pdbx_number_atoms_nucleic_acid   1218 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               8143 
_refine_hist.d_res_high                       2.85 
_refine_hist.d_res_low                        40.30 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' t_dihedral_angle_d        3205  ?      ? 2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' t_trig_c_planes           178   ?      ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_gen_planes              1075  ?      ? 5.000  HARMONIC     
'X-RAY DIFFRACTION' t_it                      8456  ?      ? 20.000 HARMONIC     
'X-RAY DIFFRACTION' t_nbd                     ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_improper_torsion        ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_pseud_angle             ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_chiral_improper_torsion 1084  ?      ? 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_sum_occupancies         ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_distance        ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_angle           ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_torsion         ?     ?      ? ?      ?            
'X-RAY DIFFRACTION' t_ideal_dist_contact      8795  ?      ? 4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_bond_d                  8456  0.010  ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_angle_deg               11688 1.290  ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_omega_torsion           ?     3.230  ? ?      ?            
'X-RAY DIFFRACTION' t_other_torsion           ?     21.520 ? ?      ?            
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   19 
_refine_ls_shell.d_res_high                       2.85 
_refine_ls_shell.d_res_low                        2.93 
_refine_ls_shell.number_reflns_R_work             1444 
_refine_ls_shell.R_factor_R_work                  0.3816 
_refine_ls_shell.percent_reflns_obs               93.96 
_refine_ls_shell.R_factor_R_free                  0.4375 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.18 
_refine_ls_shell.number_reflns_R_free             63 
_refine_ls_shell.number_reflns_all                1507 
_refine_ls_shell.R_factor_all                     0.3840 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4J2X 
_struct.title                     'CSL (RBP-Jk) with corepressor KyoT2 bound to DNA' 
_struct.pdbx_descriptor           
'Recombining binding protein suppressor of hairless, Four and a half LIM domains protein 1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4J2X 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION/DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
;LIM domain containing protein, transcription factor corepressor, DNA binding, nucleus, TRANSCRIPTION-DNA BINDING PROTEIN-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 11  ? GLU A 21  ? THR A 58  GLU A 68  1 ? 11 
HELX_P HELX_P2  2  SER A 57  ? GLY A 70  ? SER A 104 GLY A 117 1 ? 14 
HELX_P HELX_P3  3  SER A 72  ? GLN A 77  ? SER A 119 GLN A 124 1 ? 6  
HELX_P HELX_P4  4  SER A 152 ? CYS A 159 ? SER A 199 CYS A 206 5 ? 8  
HELX_P HELX_P5  5  GLN A 175 ? THR A 179 ? GLN A 222 THR A 226 5 ? 5  
HELX_P HELX_P6  6  ASN A 302 ? SER A 306 ? ASN A 349 SER A 353 5 ? 5  
HELX_P HELX_P7  7  ASP A 386 ? PHE A 390 ? ASP A 433 PHE A 437 5 ? 5  
HELX_P HELX_P8  8  THR C 11  ? ARG C 22  ? THR C 58  ARG C 69  1 ? 12 
HELX_P HELX_P9  9  SER C 57  ? ASP C 69  ? SER C 104 ASP C 116 1 ? 13 
HELX_P HELX_P10 10 SER C 72  ? GLN C 77  ? SER C 119 GLN C 124 1 ? 6  
HELX_P HELX_P11 11 SER C 152 ? CYS C 159 ? SER C 199 CYS C 206 5 ? 8  
HELX_P HELX_P12 12 ASN C 302 ? SER C 306 ? ASN C 349 SER C 353 5 ? 5  
HELX_P HELX_P13 13 ASP C 386 ? PHE C 390 ? ASP C 433 PHE C 437 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? E DT 3  N3 ? ? ? 1_555 F DA 15 N1 ? ? E DT 3  F DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? E DT 3  O4 ? ? ? 1_555 F DA 15 N6 ? ? E DT 3  F DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? E DC 4  N3 ? ? ? 1_555 F DG 14 N1 ? ? E DC 4  F DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? E DC 4  N4 ? ? ? 1_555 F DG 14 O6 ? ? E DC 4  F DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? E DC 4  O2 ? ? ? 1_555 F DG 14 N2 ? ? E DC 4  F DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA 13 N1 ? ? E DT 5  F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA 13 N6 ? ? E DT 5  F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? E DT 6  N3 ? ? ? 1_555 F DA 12 N1 ? ? E DT 6  F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? E DT 6  O4 ? ? ? 1_555 F DA 12 N6 ? ? E DT 6  F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? E DT 7  N3 ? ? ? 1_555 F DA 11 N1 ? ? E DT 7  F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? E DT 7  O4 ? ? ? 1_555 F DA 11 N6 ? ? E DT 7  F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? E DC 8  N3 ? ? ? 1_555 F DG 10 N1 ? ? E DC 8  F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? E DC 8  N4 ? ? ? 1_555 F DG 10 O6 ? ? E DC 8  F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? E DC 8  O2 ? ? ? 1_555 F DG 10 N2 ? ? E DC 8  F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? E DC 9  N3 ? ? ? 1_555 F DG 9  N1 ? ? E DC 9  F DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? E DC 9  N4 ? ? ? 1_555 F DG 9  O6 ? ? E DC 9  F DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? E DC 9  O2 ? ? ? 1_555 F DG 9  N2 ? ? E DC 9  F DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? E DC 10 N3 ? ? ? 1_555 F DG 8  N1 ? ? E DC 10 F DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? E DC 10 N4 ? ? ? 1_555 F DG 8  O6 ? ? E DC 10 F DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? E DC 10 O2 ? ? ? 1_555 F DG 8  N2 ? ? E DC 10 F DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? E DA 11 N1 ? ? ? 1_555 F DT 7  N3 ? ? E DA 11 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? E DA 11 N6 ? ? ? 1_555 F DT 7  O4 ? ? E DA 11 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? E DC 12 N3 ? ? ? 1_555 F DG 6  N1 ? ? E DC 12 F DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? E DC 12 N4 ? ? ? 1_555 F DG 6  O6 ? ? E DC 12 F DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? E DC 12 O2 ? ? ? 1_555 F DG 6  N2 ? ? E DC 12 F DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? E DA 13 N1 ? ? ? 1_555 F DT 5  N3 ? ? E DA 13 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? E DA 13 N6 ? ? ? 1_555 F DT 5  O4 ? ? E DA 13 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? E DG 14 N1 ? ? ? 1_555 F DC 4  N3 ? ? E DG 14 F DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? E DG 14 N2 ? ? ? 1_555 F DC 4  O2 ? ? E DG 14 F DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? E DG 14 O6 ? ? ? 1_555 F DC 4  N4 ? ? E DG 14 F DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? E DT 15 N3 ? ? ? 1_555 F DA 3  N1 ? ? E DT 15 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? E DT 15 O4 ? ? ? 1_555 F DA 3  N6 ? ? E DT 15 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? G DT 3  N3 ? ? ? 1_555 H DA 15 N1 ? ? G DT 3  H DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? G DT 3  O4 ? ? ? 1_555 H DA 15 N6 ? ? G DT 3  H DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? G DC 4  N3 ? ? ? 1_555 H DG 14 N1 ? ? G DC 4  H DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? G DC 4  N4 ? ? ? 1_555 H DG 14 O6 ? ? G DC 4  H DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? G DC 4  O2 ? ? ? 1_555 H DG 14 N2 ? ? G DC 4  H DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? G DT 5  N3 ? ? ? 1_555 H DA 13 N1 ? ? G DT 5  H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? G DT 5  O4 ? ? ? 1_555 H DA 13 N6 ? ? G DT 5  H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? G DT 6  N3 ? ? ? 1_555 H DA 12 N1 ? ? G DT 6  H DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? G DT 6  O4 ? ? ? 1_555 H DA 12 N6 ? ? G DT 6  H DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? G DT 7  N3 ? ? ? 1_555 H DA 11 N1 ? ? G DT 7  H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? G DT 7  O4 ? ? ? 1_555 H DA 11 N6 ? ? G DT 7  H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? G DC 8  N3 ? ? ? 1_555 H DG 10 N1 ? ? G DC 8  H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? G DC 8  N4 ? ? ? 1_555 H DG 10 O6 ? ? G DC 8  H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? G DC 8  O2 ? ? ? 1_555 H DG 10 N2 ? ? G DC 8  H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? G DC 9  N3 ? ? ? 1_555 H DG 9  N1 ? ? G DC 9  H DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? G DC 9  N4 ? ? ? 1_555 H DG 9  O6 ? ? G DC 9  H DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? G DC 9  O2 ? ? ? 1_555 H DG 9  N2 ? ? G DC 9  H DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? G DC 10 N3 ? ? ? 1_555 H DG 8  N1 ? ? G DC 10 H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? G DC 10 N4 ? ? ? 1_555 H DG 8  O6 ? ? G DC 10 H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? G DC 10 O2 ? ? ? 1_555 H DG 8  N2 ? ? G DC 10 H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DT 7  N3 ? ? G DA 11 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? G DA 11 N6 ? ? ? 1_555 H DT 7  O4 ? ? G DA 11 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? G DC 12 N3 ? ? ? 1_555 H DG 6  N1 ? ? G DC 12 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? G DC 12 N4 ? ? ? 1_555 H DG 6  O6 ? ? G DC 12 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? G DC 12 O2 ? ? ? 1_555 H DG 6  N2 ? ? G DC 12 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? G DA 13 N1 ? ? ? 1_555 H DT 5  N3 ? ? G DA 13 H DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? G DA 13 N6 ? ? ? 1_555 H DT 5  O4 ? ? G DA 13 H DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? G DG 14 N1 ? ? ? 1_555 H DC 4  N3 ? ? G DG 14 H DC 4  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog61 hydrog ? ? G DT 15 N3 ? ? ? 1_555 H DA 3  N1 ? ? G DT 15 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? G DT 15 O4 ? ? ? 1_555 H DA 3  N6 ? ? G DT 15 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  CYS 47  A . ? CYS 94  A PRO 48  A ? PRO 95  A 1 0.62  
2  CYS 47  A . ? CYS 94  A PRO 48  A ? PRO 95  A 1 0.57  
3  GLY 85  A . ? GLY 132 A ASN 86  A ? ASN 133 A 1 -2.45 
4  THR 331 A . ? THR 378 A PRO 332 A ? PRO 379 A 1 -3.23 
5  ASN 342 A . ? ASN 389 A GLY 343 A ? GLY 390 A 1 -0.68 
6  GLY 343 A . ? GLY 390 A GLY 344 A ? GLY 391 A 1 3.97  
7  CYS 47  C . ? CYS 94  C PRO 48  C ? PRO 95  C 1 3.08  
8  THR 331 C . ? THR 378 C PRO 332 C ? PRO 379 C 1 -2.64 
9  ASN 342 C . ? ASN 389 C GLY 343 C ? GLY 390 C 1 -0.65 
10 GLY 343 C . ? GLY 390 C GLY 344 C ? GLY 391 C 1 -4.29 
11 ASP 14  D . ? ASP 196 D ASN 15  D ? ASN 197 D 1 4.58  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7  ? 
B ? 9  ? 
C ? 10 ? 
D ? 8  ? 
E ? 3  ? 
F ? 4  ? 
G ? 2  ? 
H ? 2  ? 
I ? 4  ? 
J ? 7  ? 
K ? 9  ? 
L ? 10 ? 
M ? 8  ? 
N ? 3  ? 
O ? 4  ? 
P ? 2  ? 
Q ? 2  ? 
R ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? anti-parallel 
A 5 6  ? anti-parallel 
A 6 7  ? anti-parallel 
B 1 2  ? anti-parallel 
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? anti-parallel 
B 5 6  ? anti-parallel 
B 6 7  ? anti-parallel 
B 7 8  ? anti-parallel 
B 8 9  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? anti-parallel 
C 4 5  ? anti-parallel 
C 5 6  ? anti-parallel 
C 6 7  ? anti-parallel 
C 7 8  ? anti-parallel 
C 8 9  ? anti-parallel 
C 9 10 ? anti-parallel 
D 1 2  ? anti-parallel 
D 2 3  ? anti-parallel 
D 3 4  ? anti-parallel 
D 4 5  ? anti-parallel 
D 5 6  ? anti-parallel 
D 6 7  ? anti-parallel 
D 7 8  ? anti-parallel 
E 1 2  ? parallel      
E 2 3  ? anti-parallel 
F 1 2  ? anti-parallel 
F 2 3  ? anti-parallel 
F 3 4  ? anti-parallel 
G 1 2  ? anti-parallel 
H 1 2  ? anti-parallel 
I 1 2  ? anti-parallel 
I 2 3  ? anti-parallel 
I 3 4  ? anti-parallel 
J 1 2  ? anti-parallel 
J 2 3  ? anti-parallel 
J 3 4  ? anti-parallel 
J 4 5  ? anti-parallel 
J 5 6  ? anti-parallel 
J 6 7  ? anti-parallel 
K 1 2  ? anti-parallel 
K 2 3  ? anti-parallel 
K 3 4  ? anti-parallel 
K 4 5  ? anti-parallel 
K 5 6  ? anti-parallel 
K 6 7  ? anti-parallel 
K 7 8  ? anti-parallel 
K 8 9  ? anti-parallel 
L 1 2  ? anti-parallel 
L 2 3  ? anti-parallel 
L 3 4  ? anti-parallel 
L 4 5  ? anti-parallel 
L 5 6  ? anti-parallel 
L 6 7  ? anti-parallel 
L 7 8  ? anti-parallel 
L 8 9  ? anti-parallel 
L 9 10 ? anti-parallel 
M 1 2  ? anti-parallel 
M 2 3  ? anti-parallel 
M 3 4  ? anti-parallel 
M 4 5  ? anti-parallel 
M 5 6  ? anti-parallel 
M 6 7  ? anti-parallel 
M 7 8  ? anti-parallel 
N 1 2  ? parallel      
N 2 3  ? anti-parallel 
O 1 2  ? anti-parallel 
O 2 3  ? anti-parallel 
O 3 4  ? anti-parallel 
P 1 2  ? anti-parallel 
Q 1 2  ? anti-parallel 
R 1 2  ? anti-parallel 
R 2 3  ? anti-parallel 
R 3 4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  TYR A 101 ? THR A 103 ? TYR A 148 THR A 150 
A 2  CYS A 51  ? MET A 55  ? CYS A 98  MET A 102 
A 3  GLN A 25  ? ALA A 32  ? GLN A 72  ALA A 79  
A 4  TRP A 307 ? GLU A 321 ? TRP A 354 GLU A 368 
A 5  THR A 164 ? ASN A 170 ? THR A 211 ASN A 217 
A 6  ARG A 180 ? GLU A 185 ? ARG A 227 GLU A 232 
A 7  ASN A 188 ? SER A 192 ? ASN A 235 SER A 239 
B 1  ASN A 188 ? SER A 192 ? ASN A 235 SER A 239 
B 2  ARG A 180 ? GLU A 185 ? ARG A 227 GLU A 232 
B 3  THR A 164 ? ASN A 170 ? THR A 211 ASN A 217 
B 4  PHE A 199 ? LEU A 204 ? PHE A 246 LEU A 251 
B 5  THR A 226 ? CYS A 231 ? THR A 273 CYS A 278 
B 6  LEU A 241 ? VAL A 246 ? LEU A 288 VAL A 293 
B 7  THR A 250 ? LEU A 252 ? THR A 297 LEU A 299 
B 8  LYS A 298 ? MET A 300 ? LYS A 345 MET A 347 
B 9  THR A 290 ? PRO A 291 ? THR A 337 PRO A 338 
C 1  THR A 290 ? PRO A 291 ? THR A 337 PRO A 338 
C 2  LYS A 298 ? MET A 300 ? LYS A 345 MET A 347 
C 3  THR A 250 ? LEU A 252 ? THR A 297 LEU A 299 
C 4  LEU A 241 ? VAL A 246 ? LEU A 288 VAL A 293 
C 5  LYS A 264 ? LEU A 269 ? LYS A 311 LEU A 316 
C 6  TRP A 307 ? GLU A 321 ? TRP A 354 GLU A 368 
C 7  VAL A 413 ? TYR A 423 ? VAL A 460 TYR A 470 
C 8  VAL A 401 ? ARG A 409 ? VAL A 448 ARG A 456 
C 9  LEU A 361 ? PHE A 365 ? LEU A 408 PHE A 412 
C 10 VAL A 368 ? GLU A 369 ? VAL A 415 GLU A 416 
D 1  VAL A 368 ? GLU A 369 ? VAL A 415 GLU A 416 
D 2  LEU A 361 ? PHE A 365 ? LEU A 408 PHE A 412 
D 3  VAL A 401 ? ARG A 409 ? VAL A 448 ARG A 456 
D 4  VAL A 413 ? TYR A 423 ? VAL A 460 TYR A 470 
D 5  TRP A 307 ? GLU A 321 ? TRP A 354 GLU A 368 
D 6  GLN A 25  ? ALA A 32  ? GLN A 72  ALA A 79  
D 7  CYS A 51  ? MET A 55  ? CYS A 98  MET A 102 
D 8  TYR A 101 ? THR A 103 ? TYR A 148 THR A 150 
E 1  VAL A 34  ? GLN A 36  ? VAL A 81  GLN A 83  
E 2  ILE A 140 ? ILE A 143 ? ILE A 187 ILE A 190 
E 3  HIS A 117 ? PHE A 118 ? HIS A 164 PHE A 165 
F 1  GLN A 92  ? LEU A 94  ? GLN A 139 LEU A 141 
F 2  PRO A 78  ? ILE A 84  ? PRO A 125 ILE A 131 
F 3  LEU A 120 ? TYR A 126 ? LEU A 167 TYR A 173 
F 4  ASP A 131 ? LEU A 136 ? ASP A 178 LEU A 183 
G 1  GLU A 213 ? THR A 215 ? GLU A 260 THR A 262 
G 2  LEU B 3   ? LYS B 5   ? LEU B 185 LYS B 187 
H 1  MET A 275 ? SER A 280 ? MET A 322 SER A 327 
H 2  ARG A 283 ? GLN A 288 ? ARG A 330 GLN A 335 
I 1  VAL A 335 ? LEU A 341 ? VAL A 382 LEU A 388 
I 2  MET A 349 ? GLN A 355 ? MET A 396 GLN A 402 
I 3  SER A 379 ? VAL A 383 ? SER A 426 VAL A 430 
I 4  THR A 372 ? CYS A 376 ? THR A 419 CYS A 423 
J 1  TYR C 101 ? THR C 103 ? TYR C 148 THR C 150 
J 2  CYS C 51  ? MET C 55  ? CYS C 98  MET C 102 
J 3  GLN C 25  ? ALA C 32  ? GLN C 72  ALA C 79  
J 4  TRP C 307 ? GLU C 321 ? TRP C 354 GLU C 368 
J 5  THR C 164 ? LEU C 172 ? THR C 211 LEU C 219 
J 6  GLN C 175 ? GLU C 185 ? GLN C 222 GLU C 232 
J 7  ASN C 188 ? SER C 192 ? ASN C 235 SER C 239 
K 1  ASN C 188 ? SER C 192 ? ASN C 235 SER C 239 
K 2  GLN C 175 ? GLU C 185 ? GLN C 222 GLU C 232 
K 3  THR C 164 ? LEU C 172 ? THR C 211 LEU C 219 
K 4  PHE C 199 ? LEU C 203 ? PHE C 246 LEU C 250 
K 5  THR C 226 ? CYS C 231 ? THR C 273 CYS C 278 
K 6  LEU C 241 ? ASP C 247 ? LEU C 288 ASP C 294 
K 7  THR C 250 ? LEU C 252 ? THR C 297 LEU C 299 
K 8  LYS C 298 ? MET C 300 ? LYS C 345 MET C 347 
K 9  THR C 290 ? PRO C 291 ? THR C 337 PRO C 338 
L 1  THR C 290 ? PRO C 291 ? THR C 337 PRO C 338 
L 2  LYS C 298 ? MET C 300 ? LYS C 345 MET C 347 
L 3  THR C 250 ? LEU C 252 ? THR C 297 LEU C 299 
L 4  LEU C 241 ? ASP C 247 ? LEU C 288 ASP C 294 
L 5  LYS C 264 ? LEU C 269 ? LYS C 311 LEU C 316 
L 6  TRP C 307 ? GLU C 321 ? TRP C 354 GLU C 368 
L 7  VAL C 413 ? TYR C 423 ? VAL C 460 TYR C 470 
L 8  VAL C 401 ? ARG C 409 ? VAL C 448 ARG C 456 
L 9  LEU C 361 ? PHE C 365 ? LEU C 408 PHE C 412 
L 10 VAL C 368 ? GLU C 369 ? VAL C 415 GLU C 416 
M 1  VAL C 368 ? GLU C 369 ? VAL C 415 GLU C 416 
M 2  LEU C 361 ? PHE C 365 ? LEU C 408 PHE C 412 
M 3  VAL C 401 ? ARG C 409 ? VAL C 448 ARG C 456 
M 4  VAL C 413 ? TYR C 423 ? VAL C 460 TYR C 470 
M 5  TRP C 307 ? GLU C 321 ? TRP C 354 GLU C 368 
M 6  GLN C 25  ? ALA C 32  ? GLN C 72  ALA C 79  
M 7  CYS C 51  ? MET C 55  ? CYS C 98  MET C 102 
M 8  TYR C 101 ? THR C 103 ? TYR C 148 THR C 150 
N 1  VAL C 34  ? GLN C 36  ? VAL C 81  GLN C 83  
N 2  ILE C 140 ? ILE C 143 ? ILE C 187 ILE C 190 
N 3  HIS C 117 ? PHE C 118 ? HIS C 164 PHE C 165 
O 1  GLN C 92  ? LEU C 94  ? GLN C 139 LEU C 141 
O 2  PRO C 78  ? ILE C 84  ? PRO C 125 ILE C 131 
O 3  LEU C 120 ? TYR C 126 ? LEU C 167 TYR C 173 
O 4  ASP C 131 ? LEU C 136 ? ASP C 178 LEU C 183 
P 1  GLU C 213 ? THR C 215 ? GLU C 260 THR C 262 
P 2  LEU D 3   ? LYS D 5   ? LEU D 185 LYS D 187 
Q 1  MET C 275 ? SER C 280 ? MET C 322 SER C 327 
Q 2  ARG C 283 ? GLN C 288 ? ARG C 330 GLN C 335 
R 1  VAL C 335 ? LEU C 341 ? VAL C 382 LEU C 388 
R 2  MET C 349 ? GLN C 355 ? MET C 396 GLN C 402 
R 3  SER C 379 ? VAL C 383 ? SER C 426 VAL C 430 
R 4  GLU C 371 ? TYR C 374 ? GLU C 418 TYR C 421 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O CYS A 102 ? O CYS A 149 N VAL A 52  ? N VAL A 99  
A 2 3  O CYS A 51  ? O CYS A 98  N LEU A 30  ? N LEU A 77  
A 3 4  N HIS A 31  ? N HIS A 78  O ASP A 313 ? O ASP A 360 
A 4 5  O THR A 308 ? O THR A 355 N PHE A 169 ? N PHE A 216 
A 5 6  N ASN A 170 ? N ASN A 217 O ARG A 180 ? O ARG A 227 
A 6 7  N HIS A 183 ? N HIS A 230 O HIS A 190 ? O HIS A 237 
B 1 2  O HIS A 190 ? O HIS A 237 N HIS A 183 ? N HIS A 230 
B 2 3  O ARG A 180 ? O ARG A 227 N ASN A 170 ? N ASN A 217 
B 3 4  N VAL A 166 ? N VAL A 213 O PHE A 199 ? O PHE A 246 
B 4 5  N TYR A 200 ? N TYR A 247 O VAL A 230 ? O VAL A 277 
B 5 6  N VAL A 227 ? N VAL A 274 O LEU A 241 ? O LEU A 288 
B 6 7  N LYS A 245 ? N LYS A 292 O LEU A 252 ? O LEU A 299 
B 7 8  N ALA A 251 ? N ALA A 298 O GLU A 299 ? O GLU A 346 
B 8 9  O MET A 300 ? O MET A 347 N THR A 290 ? N THR A 337 
C 1 2  N THR A 290 ? N THR A 337 O MET A 300 ? O MET A 347 
C 2 3  O GLU A 299 ? O GLU A 346 N ALA A 251 ? N ALA A 298 
C 3 4  O LEU A 252 ? O LEU A 299 N LYS A 245 ? N LYS A 292 
C 4 5  N ARG A 244 ? N ARG A 291 O ALA A 266 ? O ALA A 313 
C 5 6  N CYS A 265 ? N CYS A 312 O TRP A 307 ? O TRP A 354 
C 6 7  N TYR A 320 ? N TYR A 367 O ILE A 414 ? O ILE A 461 
C 7 8  O PHE A 421 ? O PHE A 468 N VAL A 403 ? N VAL A 450 
C 8 9  O VAL A 408 ? O VAL A 455 N ARG A 362 ? N ARG A 409 
C 9 10 N PHE A 365 ? N PHE A 412 O VAL A 368 ? O VAL A 415 
D 1 2  O VAL A 368 ? O VAL A 415 N PHE A 365 ? N PHE A 412 
D 2 3  N ARG A 362 ? N ARG A 409 O VAL A 408 ? O VAL A 455 
D 3 4  N VAL A 403 ? N VAL A 450 O PHE A 421 ? O PHE A 468 
D 4 5  O ILE A 414 ? O ILE A 461 N TYR A 320 ? N TYR A 367 
D 5 6  O ASP A 313 ? O ASP A 360 N HIS A 31  ? N HIS A 78  
D 6 7  N LEU A 30  ? N LEU A 77  O CYS A 51  ? O CYS A 98  
D 7 8  N VAL A 52  ? N VAL A 99  O CYS A 102 ? O CYS A 149 
E 1 2  N ALA A 35  ? N ALA A 82  O ILE A 143 ? O ILE A 190 
E 2 3  O ILE A 140 ? O ILE A 187 N PHE A 118 ? N PHE A 165 
F 1 2  O GLN A 92  ? O GLN A 139 N ILE A 82  ? N ILE A 129 
F 2 3  N CYS A 79  ? N CYS A 126 O PHE A 125 ? O PHE A 172 
F 3 4  N VAL A 122 ? N VAL A 169 O PHE A 135 ? O PHE A 182 
G 1 2  N PHE A 214 ? N PHE A 261 O VAL B 4   ? O VAL B 186 
H 1 2  N CYS A 278 ? N CYS A 325 O ILE A 285 ? O ILE A 332 
I 1 2  N GLN A 340 ? N GLN A 387 O GLU A 351 ? O GLU A 398 
I 2 3  N LEU A 352 ? N LEU A 399 O MET A 380 ? O MET A 427 
I 3 4  O LEU A 381 ? O LEU A 428 N MET A 373 ? N MET A 420 
J 1 2  O CYS C 102 ? O CYS C 149 N VAL C 52  ? N VAL C 99  
J 2 3  O CYS C 51  ? O CYS C 98  N LEU C 30  ? N LEU C 77  
J 3 4  N HIS C 31  ? N HIS C 78  O ASP C 313 ? O ASP C 360 
J 4 5  O THR C 308 ? O THR C 355 N PHE C 169 ? N PHE C 216 
J 5 6  N LEU C 168 ? N LEU C 215 O LEU C 182 ? O LEU C 229 
J 6 7  N TYR C 181 ? N TYR C 228 O SER C 192 ? O SER C 239 
K 1 2  O SER C 192 ? O SER C 239 N TYR C 181 ? N TYR C 228 
K 2 3  O LEU C 182 ? O LEU C 229 N LEU C 168 ? N LEU C 215 
K 3 4  N VAL C 166 ? N VAL C 213 O PHE C 199 ? O PHE C 246 
K 4 5  N HIS C 202 ? N HIS C 249 O LYS C 228 ? O LYS C 275 
K 5 6  N VAL C 227 ? N VAL C 274 O LEU C 241 ? O LEU C 288 
K 6 7  N LYS C 245 ? N LYS C 292 O LEU C 252 ? O LEU C 299 
K 7 8  N ALA C 251 ? N ALA C 298 O GLU C 299 ? O GLU C 346 
K 8 9  O MET C 300 ? O MET C 347 N THR C 290 ? N THR C 337 
L 1 2  N THR C 290 ? N THR C 337 O MET C 300 ? O MET C 347 
L 2 3  O GLU C 299 ? O GLU C 346 N ALA C 251 ? N ALA C 298 
L 3 4  O LEU C 252 ? O LEU C 299 N LYS C 245 ? N LYS C 292 
L 4 5  N ILE C 242 ? N ILE C 289 O TYR C 268 ? O TYR C 315 
L 5 6  N CYS C 265 ? N CYS C 312 O TRP C 307 ? O TRP C 354 
L 6 7  N TYR C 320 ? N TYR C 367 O ILE C 414 ? O ILE C 461 
L 7 8  O TYR C 415 ? O TYR C 462 N LEU C 407 ? N LEU C 454 
L 8 9  O THR C 406 ? O THR C 453 N TRP C 364 ? N TRP C 411 
L 9 10 N PHE C 365 ? N PHE C 412 O VAL C 368 ? O VAL C 415 
M 1 2  O VAL C 368 ? O VAL C 415 N PHE C 365 ? N PHE C 412 
M 2 3  N TRP C 364 ? N TRP C 411 O THR C 406 ? O THR C 453 
M 3 4  N LEU C 407 ? N LEU C 454 O TYR C 415 ? O TYR C 462 
M 4 5  O ILE C 414 ? O ILE C 461 N TYR C 320 ? N TYR C 367 
M 5 6  O ASP C 313 ? O ASP C 360 N HIS C 31  ? N HIS C 78  
M 6 7  N LEU C 30  ? N LEU C 77  O CYS C 51  ? O CYS C 98  
M 7 8  N VAL C 52  ? N VAL C 99  O CYS C 102 ? O CYS C 149 
N 1 2  N ALA C 35  ? N ALA C 82  O ILE C 143 ? O ILE C 190 
N 2 3  O ILE C 140 ? O ILE C 187 N PHE C 118 ? N PHE C 165 
O 1 2  O GLN C 92  ? O GLN C 139 N ILE C 82  ? N ILE C 129 
O 2 3  N CYS C 79  ? N CYS C 126 O PHE C 125 ? O PHE C 172 
O 3 4  N MET C 124 ? N MET C 171 O ILE C 132 ? O ILE C 179 
P 1 2  N PHE C 214 ? N PHE C 261 O VAL D 4   ? O VAL D 186 
Q 1 2  N SER C 280 ? N SER C 327 O ARG C 283 ? O ARG C 330 
R 1 2  N GLN C 340 ? N GLN C 387 O GLU C 351 ? O GLU C 398 
R 2 3  N LEU C 352 ? N LEU C 399 O MET C 380 ? O MET C 427 
R 3 4  O LEU C 381 ? O LEU C 428 N MET C 373 ? N MET C 420 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE EDO A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 51  ? CYS A 98  . ? 1_555 ? 
2 AC1 4 TYR A 53  ? TYR A 100 . ? 1_555 ? 
3 AC1 4 GLN A 195 ? GLN A 242 . ? 1_555 ? 
4 AC1 4 TRP A 196 ? TRP A 243 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4J2X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4J2X 
_atom_sites.fract_transf_matrix[1][1]   0.016088 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000891 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010278 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006950 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PRO A 1 6   ? 35.145  -16.688 31.003  1.00 142.73 ? 53  PRO A N     1 
ATOM   2    C CA    . PRO A 1 6   ? 35.523  -15.316 30.613  1.00 143.40 ? 53  PRO A CA    1 
ATOM   3    C C     . PRO A 1 6   ? 34.381  -14.540 29.924  1.00 142.33 ? 53  PRO A C     1 
ATOM   4    O O     . PRO A 1 6   ? 34.192  -14.726 28.714  1.00 141.06 ? 53  PRO A O     1 
ATOM   5    C CB    . PRO A 1 6   ? 36.754  -15.519 29.717  1.00 149.25 ? 53  PRO A CB    1 
ATOM   6    C CG    . PRO A 1 6   ? 36.689  -16.983 29.282  1.00 153.72 ? 53  PRO A CG    1 
ATOM   7    C CD    . PRO A 1 6   ? 35.557  -17.680 29.997  1.00 145.30 ? 53  PRO A CD    1 
ATOM   8    N N     . PRO A 1 7   ? 33.628  -13.664 30.674  1.00 135.37 ? 54  PRO A N     1 
ATOM   9    C CA    . PRO A 1 7   ? 32.477  -12.927 30.085  1.00 130.17 ? 54  PRO A CA    1 
ATOM   10   C C     . PRO A 1 7   ? 32.640  -12.225 28.731  1.00 130.16 ? 54  PRO A C     1 
ATOM   11   O O     . PRO A 1 7   ? 33.736  -11.732 28.399  1.00 134.22 ? 54  PRO A O     1 
ATOM   12   C CB    . PRO A 1 7   ? 32.071  -11.935 31.190  1.00 131.36 ? 54  PRO A CB    1 
ATOM   13   C CG    . PRO A 1 7   ? 33.174  -11.998 32.218  1.00 140.30 ? 54  PRO A CG    1 
ATOM   14   C CD    . PRO A 1 7   ? 33.724  -13.381 32.120  1.00 137.79 ? 54  PRO A CD    1 
ATOM   15   N N     . LYS A 1 8   ? 31.516  -12.190 27.962  1.00 117.38 ? 55  LYS A N     1 
ATOM   16   C CA    . LYS A 1 8   ? 31.387  -11.630 26.610  1.00 114.52 ? 55  LYS A CA    1 
ATOM   17   C C     . LYS A 1 8   ? 30.155  -10.714 26.426  1.00 111.10 ? 55  LYS A C     1 
ATOM   18   O O     . LYS A 1 8   ? 29.056  -11.015 26.900  1.00 106.09 ? 55  LYS A O     1 
ATOM   19   C CB    . LYS A 1 8   ? 31.293  -12.752 25.556  1.00 115.88 ? 55  LYS A CB    1 
ATOM   20   C CG    . LYS A 1 8   ? 32.595  -13.465 25.216  1.00 131.98 ? 55  LYS A CG    1 
ATOM   21   C CD    . LYS A 1 8   ? 32.412  -14.506 24.097  1.00 138.06 ? 55  LYS A CD    1 
ATOM   22   C CE    . LYS A 1 8   ? 31.958  -15.874 24.576  1.00 147.74 ? 55  LYS A CE    1 
ATOM   23   N NZ    . LYS A 1 8   ? 30.510  -15.906 24.947  1.00 149.75 ? 55  LYS A NZ    1 
ATOM   24   N N     . ARG A 1 9   ? 30.345  -9.643  25.652  1.00 106.37 ? 56  ARG A N     1 
ATOM   25   C CA    . ARG A 1 9   ? 29.304  -8.689  25.313  1.00 102.92 ? 56  ARG A CA    1 
ATOM   26   C C     . ARG A 1 9   ? 28.321  -9.327  24.319  1.00 104.36 ? 56  ARG A C     1 
ATOM   27   O O     . ARG A 1 9   ? 28.714  -10.261 23.612  1.00 105.29 ? 56  ARG A O     1 
ATOM   28   C CB    . ARG A 1 9   ? 29.933  -7.411  24.727  1.00 102.50 ? 56  ARG A CB    1 
ATOM   29   C CG    . ARG A 1 9   ? 30.362  -6.432  25.792  1.00 108.80 ? 56  ARG A CG    1 
ATOM   30   C CD    . ARG A 1 9   ? 29.888  -5.036  25.484  1.00 120.19 ? 56  ARG A CD    1 
ATOM   31   N NE    . ARG A 1 9   ? 29.402  -4.373  26.692  1.00 135.37 ? 56  ARG A NE    1 
ATOM   32   C CZ    . ARG A 1 9   ? 28.672  -3.260  26.703  1.00 152.36 ? 56  ARG A CZ    1 
ATOM   33   N NH1   . ARG A 1 9   ? 28.343  -2.660  25.562  1.00 130.25 ? 56  ARG A NH1   1 
ATOM   34   N NH2   . ARG A 1 9   ? 28.257  -2.743  27.855  1.00 144.02 ? 56  ARG A NH2   1 
ATOM   35   N N     . LEU A 1 10  ? 27.049  -8.857  24.270  1.00 97.34  ? 57  LEU A N     1 
ATOM   36   C CA    . LEU A 1 10  ? 26.102  -9.437  23.311  1.00 94.63  ? 57  LEU A CA    1 
ATOM   37   C C     . LEU A 1 10  ? 26.390  -8.932  21.905  1.00 99.97  ? 57  LEU A C     1 
ATOM   38   O O     . LEU A 1 10  ? 26.676  -7.746  21.726  1.00 101.92 ? 57  LEU A O     1 
ATOM   39   C CB    . LEU A 1 10  ? 24.634  -9.182  23.686  1.00 90.98  ? 57  LEU A CB    1 
ATOM   40   C CG    . LEU A 1 10  ? 23.585  -10.065 22.975  1.00 93.35  ? 57  LEU A CG    1 
ATOM   41   C CD1   . LEU A 1 10  ? 23.551  -11.454 23.565  1.00 93.06  ? 57  LEU A CD1   1 
ATOM   42   C CD2   . LEU A 1 10  ? 22.179  -9.443  23.044  1.00 90.20  ? 57  LEU A CD2   1 
ATOM   43   N N     . THR A 1 11  ? 26.370  -9.843  20.923  1.00 95.84  ? 58  THR A N     1 
ATOM   44   C CA    . THR A 1 11  ? 26.580  -9.516  19.514  1.00 96.36  ? 58  THR A CA    1 
ATOM   45   C C     . THR A 1 11  ? 25.243  -9.446  18.824  1.00 94.77  ? 58  THR A C     1 
ATOM   46   O O     . THR A 1 11  ? 24.297  -10.077 19.293  1.00 91.55  ? 58  THR A O     1 
ATOM   47   C CB    . THR A 1 11  ? 27.603  -10.450 18.818  1.00 112.55 ? 58  THR A CB    1 
ATOM   48   O OG1   . THR A 1 11  ? 27.823  -9.943  17.495  1.00 121.51 ? 58  THR A OG1   1 
ATOM   49   C CG2   . THR A 1 11  ? 27.157  -11.916 18.750  1.00 108.15 ? 58  THR A CG2   1 
ATOM   50   N N     . ARG A 1 12  ? 25.150  -8.666  17.725  1.00 91.21  ? 59  ARG A N     1 
ATOM   51   C CA    . ARG A 1 12  ? 23.917  -8.522  16.939  1.00 88.23  ? 59  ARG A CA    1 
ATOM   52   C C     . ARG A 1 12  ? 23.429  -9.903  16.471  1.00 92.47  ? 59  ARG A C     1 
ATOM   53   O O     . ARG A 1 12  ? 22.228  -10.149 16.582  1.00 87.69  ? 59  ARG A O     1 
ATOM   54   C CB    . ARG A 1 12  ? 24.079  -7.543  15.765  1.00 85.06  ? 59  ARG A CB    1 
ATOM   55   C CG    . ARG A 1 12  ? 24.178  -6.083  16.203  1.00 93.69  ? 59  ARG A CG    1 
ATOM   56   C CD    . ARG A 1 12  ? 24.117  -5.099  15.044  1.00 105.40 ? 59  ARG A CD    1 
ATOM   57   N NE    . ARG A 1 12  ? 22.772  -4.989  14.476  1.00 114.32 ? 59  ARG A NE    1 
ATOM   58   C CZ    . ARG A 1 12  ? 22.498  -4.475  13.281  1.00 136.25 ? 59  ARG A CZ    1 
ATOM   59   N NH1   . ARG A 1 12  ? 23.477  -4.048  12.492  1.00 126.24 ? 59  ARG A NH1   1 
ATOM   60   N NH2   . ARG A 1 12  ? 21.245  -4.414  12.851  1.00 129.11 ? 59  ARG A NH2   1 
ATOM   61   N N     . GLU A 1 13  ? 24.385  -10.840 16.068  1.00 92.66  ? 60  GLU A N     1 
ATOM   62   C CA    . GLU A 1 13  ? 24.085  -12.227 15.659  1.00 92.70  ? 60  GLU A CA    1 
ATOM   63   C C     . GLU A 1 13  ? 23.335  -12.975 16.784  1.00 94.80  ? 60  GLU A C     1 
ATOM   64   O O     . GLU A 1 13  ? 22.253  -13.511 16.555  1.00 91.84  ? 60  GLU A O     1 
ATOM   65   C CB    . GLU A 1 13  ? 25.363  -12.960 15.279  1.00 97.25  ? 60  GLU A CB    1 
ATOM   66   C CG    . GLU A 1 13  ? 25.185  -14.401 14.807  1.00 110.03 ? 60  GLU A CG    1 
ATOM   67   C CD    . GLU A 1 13  ? 26.464  -15.073 14.315  1.00 146.70 ? 60  GLU A CD    1 
ATOM   68   O OE1   . GLU A 1 13  ? 27.560  -14.784 14.859  1.00 131.29 ? 60  GLU A OE1   1 
ATOM   69   O OE2   . GLU A 1 13  ? 26.365  -15.889 13.369  1.00 145.36 ? 60  GLU A OE2   1 
ATOM   70   N N     . ALA A 1 14  ? 23.894  -12.950 18.005  1.00 91.45  ? 61  ALA A N     1 
ATOM   71   C CA    . ALA A 1 14  ? 23.274  -13.518 19.192  1.00 87.99  ? 61  ALA A CA    1 
ATOM   72   C C     . ALA A 1 14  ? 21.953  -12.815 19.462  1.00 86.44  ? 61  ALA A C     1 
ATOM   73   O O     . ALA A 1 14  ? 20.974  -13.508 19.776  1.00 84.90  ? 61  ALA A O     1 
ATOM   74   C CB    . ALA A 1 14  ? 24.195  -13.367 20.394  1.00 89.88  ? 61  ALA A CB    1 
ATOM   75   N N     . MET A 1 15  ? 21.896  -11.450 19.332  1.00 80.54  ? 62  MET A N     1 
ATOM   76   C CA    . MET A 1 15  ? 20.611  -10.763 19.562  1.00 76.81  ? 62  MET A CA    1 
ATOM   77   C C     . MET A 1 15  ? 19.595  -11.256 18.564  1.00 81.00  ? 62  MET A C     1 
ATOM   78   O O     . MET A 1 15  ? 18.549  -11.723 18.984  1.00 80.31  ? 62  MET A O     1 
ATOM   79   C CB    . MET A 1 15  ? 20.690  -9.229  19.589  1.00 78.19  ? 62  MET A CB    1 
ATOM   80   C CG    . MET A 1 15  ? 19.321  -8.558  19.837  1.00 78.38  ? 62  MET A CG    1 
ATOM   81   S SD    . MET A 1 15  ? 18.731  -8.400  21.561  1.00 79.13  ? 62  MET A SD    1 
ATOM   82   C CE    . MET A 1 15  ? 17.831  -9.663  21.619  1.00 73.28  ? 62  MET A CE    1 
ATOM   83   N N     . ARG A 1 16  ? 19.959  -11.268 17.259  1.00 78.14  ? 63  ARG A N     1 
ATOM   84   C CA    . ARG A 1 16  ? 19.132  -11.752 16.164  1.00 76.66  ? 63  ARG A CA    1 
ATOM   85   C C     . ARG A 1 16  ? 18.578  -13.118 16.476  1.00 81.85  ? 63  ARG A C     1 
ATOM   86   O O     . ARG A 1 16  ? 17.357  -13.297 16.444  1.00 82.87  ? 63  ARG A O     1 
ATOM   87   C CB    . ARG A 1 16  ? 19.900  -11.755 14.844  1.00 76.54  ? 63  ARG A CB    1 
ATOM   88   C CG    . ARG A 1 16  ? 20.057  -10.369 14.230  1.00 88.55  ? 63  ARG A CG    1 
ATOM   89   C CD    . ARG A 1 16  ? 20.843  -10.435 12.925  1.00 99.12  ? 63  ARG A CD    1 
ATOM   90   N NE    . ARG A 1 16  ? 21.221  -9.106  12.456  1.00 107.38 ? 63  ARG A NE    1 
ATOM   91   C CZ    . ARG A 1 16  ? 22.459  -8.634  12.493  1.00 146.79 ? 63  ARG A CZ    1 
ATOM   92   N NH1   . ARG A 1 16  ? 23.455  -9.394  12.929  1.00 146.08 ? 63  ARG A NH1   1 
ATOM   93   N NH2   . ARG A 1 16  ? 22.719  -7.410  12.056  1.00 150.06 ? 63  ARG A NH2   1 
ATOM   94   N N     . ASN A 1 17  ? 19.451  -14.044 16.881  1.00 79.55  ? 64  ASN A N     1 
ATOM   95   C CA    . ASN A 1 17  ? 19.113  -15.419 17.249  1.00 79.53  ? 64  ASN A CA    1 
ATOM   96   C C     . ASN A 1 17  ? 18.093  -15.528 18.374  1.00 83.34  ? 64  ASN A C     1 
ATOM   97   O O     . ASN A 1 17  ? 17.168  -16.341 18.270  1.00 83.68  ? 64  ASN A O     1 
ATOM   98   C CB    . ASN A 1 17  ? 20.371  -16.246 17.523  1.00 79.22  ? 64  ASN A CB    1 
ATOM   99   C CG    . ASN A 1 17  ? 21.135  -16.559 16.261  1.00 105.15 ? 64  ASN A CG    1 
ATOM   100  O OD1   . ASN A 1 17  ? 20.570  -16.655 15.161  1.00 100.24 ? 64  ASN A OD1   1 
ATOM   101  N ND2   . ASN A 1 17  ? 22.442  -16.697 16.385  1.00 104.64 ? 64  ASN A ND2   1 
ATOM   102  N N     . TYR A 1 18  ? 18.223  -14.679 19.414  1.00 78.24  ? 65  TYR A N     1 
ATOM   103  C CA    . TYR A 1 18  ? 17.286  -14.648 20.531  1.00 75.62  ? 65  TYR A CA    1 
ATOM   104  C C     . TYR A 1 18  ? 15.919  -14.230 20.031  1.00 78.35  ? 65  TYR A C     1 
ATOM   105  O O     . TYR A 1 18  ? 14.904  -14.872 20.352  1.00 77.19  ? 65  TYR A O     1 
ATOM   106  C CB    . TYR A 1 18  ? 17.774  -13.688 21.626  1.00 76.64  ? 65  TYR A CB    1 
ATOM   107  C CG    . TYR A 1 18  ? 16.688  -13.306 22.596  1.00 77.58  ? 65  TYR A CG    1 
ATOM   108  C CD1   . TYR A 1 18  ? 16.216  -14.214 23.538  1.00 78.98  ? 65  TYR A CD1   1 
ATOM   109  C CD2   . TYR A 1 18  ? 16.042  -12.079 22.497  1.00 78.29  ? 65  TYR A CD2   1 
ATOM   110  C CE1   . TYR A 1 18  ? 15.156  -13.891 24.388  1.00 78.01  ? 65  TYR A CE1   1 
ATOM   111  C CE2   . TYR A 1 18  ? 15.016  -11.727 23.370  1.00 77.46  ? 65  TYR A CE2   1 
ATOM   112  C CZ    . TYR A 1 18  ? 14.573  -12.639 24.308  1.00 81.21  ? 65  TYR A CZ    1 
ATOM   113  O OH    . TYR A 1 18  ? 13.562  -12.284 25.146  1.00 79.00  ? 65  TYR A OH    1 
ATOM   114  N N     . LEU A 1 19  ? 15.888  -13.149 19.240  1.00 74.47  ? 66  LEU A N     1 
ATOM   115  C CA    . LEU A 1 19  ? 14.643  -12.633 18.692  1.00 73.67  ? 66  LEU A CA    1 
ATOM   116  C C     . LEU A 1 19  ? 13.912  -13.622 17.801  1.00 79.80  ? 66  LEU A C     1 
ATOM   117  O O     . LEU A 1 19  ? 12.698  -13.595 17.774  1.00 78.19  ? 66  LEU A O     1 
ATOM   118  C CB    . LEU A 1 19  ? 14.886  -11.324 17.982  1.00 74.35  ? 66  LEU A CB    1 
ATOM   119  C CG    . LEU A 1 19  ? 15.319  -10.178 18.859  1.00 76.46  ? 66  LEU A CG    1 
ATOM   120  C CD1   . LEU A 1 19  ? 15.981  -9.096  18.025  1.00 77.84  ? 66  LEU A CD1   1 
ATOM   121  C CD2   . LEU A 1 19  ? 14.182  -9.682  19.710  1.00 70.11  ? 66  LEU A CD2   1 
ATOM   122  N N     . LYS A 1 20  ? 14.639  -14.534 17.135  1.00 81.87  ? 67  LYS A N     1 
ATOM   123  C CA    . LYS A 1 20  ? 14.071  -15.617 16.315  1.00 84.02  ? 67  LYS A CA    1 
ATOM   124  C C     . LYS A 1 20  ? 13.198  -16.560 17.194  1.00 90.38  ? 67  LYS A C     1 
ATOM   125  O O     . LYS A 1 20  ? 12.051  -16.778 16.852  1.00 90.95  ? 67  LYS A O     1 
ATOM   126  C CB    . LYS A 1 20  ? 15.189  -16.373 15.555  1.00 87.92  ? 67  LYS A CB    1 
ATOM   127  C CG    . LYS A 1 20  ? 15.784  -15.576 14.383  1.00 92.22  ? 67  LYS A CG    1 
ATOM   128  C CD    . LYS A 1 20  ? 17.176  -16.047 13.945  1.00 102.39 ? 67  LYS A CD    1 
ATOM   129  C CE    . LYS A 1 20  ? 17.706  -15.263 12.752  1.00 108.91 ? 67  LYS A CE    1 
ATOM   130  N NZ    . LYS A 1 20  ? 19.164  -15.488 12.515  1.00 111.47 ? 67  LYS A NZ    1 
ATOM   131  N N     . GLU A 1 21  ? 13.697  -17.033 18.351  1.00 89.39  ? 68  GLU A N     1 
ATOM   132  C CA    . GLU A 1 21  ? 12.933  -17.861 19.308  1.00 90.39  ? 68  GLU A CA    1 
ATOM   133  C C     . GLU A 1 21  ? 12.938  -17.170 20.663  1.00 96.37  ? 68  GLU A C     1 
ATOM   134  O O     . GLU A 1 21  ? 13.953  -17.226 21.387  1.00 99.45  ? 68  GLU A O     1 
ATOM   135  C CB    . GLU A 1 21  ? 13.518  -19.285 19.440  1.00 93.67  ? 68  GLU A CB    1 
ATOM   136  C CG    . GLU A 1 21  ? 14.977  -19.391 19.884  1.00 107.73 ? 68  GLU A CG    1 
ATOM   137  C CD    . GLU A 1 21  ? 15.830  -20.309 19.032  1.00 136.38 ? 68  GLU A CD    1 
ATOM   138  O OE1   . GLU A 1 21  ? 15.623  -21.545 19.094  1.00 132.88 ? 68  GLU A OE1   1 
ATOM   139  O OE2   . GLU A 1 21  ? 16.703  -19.789 18.298  1.00 126.75 ? 68  GLU A OE2   1 
ATOM   140  N N     . ARG A 1 22  ? 11.844  -16.501 21.016  1.00 89.08  ? 69  ARG A N     1 
ATOM   141  C CA    . ARG A 1 22  ? 11.821  -15.743 22.276  1.00 86.34  ? 69  ARG A CA    1 
ATOM   142  C C     . ARG A 1 22  ? 11.721  -16.633 23.589  1.00 90.40  ? 69  ARG A C     1 
ATOM   143  O O     . ARG A 1 22  ? 10.840  -16.445 24.443  1.00 89.49  ? 69  ARG A O     1 
ATOM   144  C CB    . ARG A 1 22  ? 10.883  -14.518 22.160  1.00 81.00  ? 69  ARG A CB    1 
ATOM   145  C CG    . ARG A 1 22  ? 11.287  -13.646 20.934  1.00 85.07  ? 69  ARG A CG    1 
ATOM   146  C CD    . ARG A 1 22  ? 10.234  -12.679 20.395  1.00 75.21  ? 69  ARG A CD    1 
ATOM   147  N NE    . ARG A 1 22  ? 10.718  -11.932 19.226  1.00 85.39  ? 69  ARG A NE    1 
ATOM   148  C CZ    . ARG A 1 22  ? 10.322  -10.702 18.867  1.00 103.94 ? 69  ARG A CZ    1 
ATOM   149  N NH1   . ARG A 1 22  ? 9.418   -10.046 19.587  1.00 94.63  ? 69  ARG A NH1   1 
ATOM   150  N NH2   . ARG A 1 22  ? 10.829  -10.123 17.780  1.00 82.34  ? 69  ARG A NH2   1 
ATOM   151  N N     . GLY A 1 23  ? 12.688  -17.563 23.718  1.00 86.17  ? 70  GLY A N     1 
ATOM   152  C CA    . GLY A 1 23  ? 12.793  -18.554 24.782  1.00 85.14  ? 70  GLY A CA    1 
ATOM   153  C C     . GLY A 1 23  ? 13.261  -18.039 26.122  1.00 87.40  ? 70  GLY A C     1 
ATOM   154  O O     . GLY A 1 23  ? 14.328  -18.453 26.592  1.00 88.64  ? 70  GLY A O     1 
ATOM   155  N N     . ASP A 1 24  ? 12.445  -17.163 26.777  1.00 77.92  ? 71  ASP A N     1 
ATOM   156  C CA    . ASP A 1 24  ? 12.808  -16.569 28.066  1.00 73.69  ? 71  ASP A CA    1 
ATOM   157  C C     . ASP A 1 24  ? 12.490  -17.452 29.233  1.00 73.32  ? 71  ASP A C     1 
ATOM   158  O O     . ASP A 1 24  ? 11.596  -18.286 29.143  1.00 71.21  ? 71  ASP A O     1 
ATOM   159  C CB    . ASP A 1 24  ? 12.095  -15.240 28.291  1.00 72.63  ? 71  ASP A CB    1 
ATOM   160  C CG    . ASP A 1 24  ? 12.371  -14.162 27.295  1.00 78.08  ? 71  ASP A CG    1 
ATOM   161  O OD1   . ASP A 1 24  ? 13.524  -13.731 27.206  1.00 82.37  ? 71  ASP A OD1   1 
ATOM   162  O OD2   . ASP A 1 24  ? 11.400  -13.627 26.723  1.00 86.36  ? 71  ASP A OD2   1 
ATOM   163  N N     . GLN A 1 25  ? 13.195  -17.209 30.357  1.00 70.01  ? 72  GLN A N     1 
ATOM   164  C CA    . GLN A 1 25  ? 13.037  -17.867 31.650  1.00 69.86  ? 72  GLN A CA    1 
ATOM   165  C C     . GLN A 1 25  ? 12.460  -16.812 32.557  1.00 72.73  ? 72  GLN A C     1 
ATOM   166  O O     . GLN A 1 25  ? 13.102  -15.781 32.760  1.00 75.73  ? 72  GLN A O     1 
ATOM   167  C CB    . GLN A 1 25  ? 14.395  -18.354 32.185  1.00 73.07  ? 72  GLN A CB    1 
ATOM   168  C CG    . GLN A 1 25  ? 15.097  -19.364 31.274  1.00 73.03  ? 72  GLN A CG    1 
ATOM   169  C CD    . GLN A 1 25  ? 16.499  -19.707 31.743  1.00 86.02  ? 72  GLN A CD    1 
ATOM   170  O OE1   . GLN A 1 25  ? 16.665  -20.511 32.670  1.00 79.79  ? 72  GLN A OE1   1 
ATOM   171  N NE2   . GLN A 1 25  ? 17.545  -19.168 31.057  1.00 70.04  ? 72  GLN A NE2   1 
ATOM   172  N N     . THR A 1 26  ? 11.225  -17.010 33.011  1.00 66.00  ? 73  THR A N     1 
ATOM   173  C CA    . THR A 1 26  ? 10.496  -16.074 33.873  1.00 65.19  ? 73  THR A CA    1 
ATOM   174  C C     . THR A 1 26  ? 10.309  -16.681 35.279  1.00 71.73  ? 73  THR A C     1 
ATOM   175  O O     . THR A 1 26  ? 10.028  -17.892 35.425  1.00 71.50  ? 73  THR A O     1 
ATOM   176  C CB    . THR A 1 26  ? 9.109   -15.720 33.231  1.00 72.80  ? 73  THR A CB    1 
ATOM   177  O OG1   . THR A 1 26  ? 9.294   -14.982 32.038  1.00 75.00  ? 73  THR A OG1   1 
ATOM   178  C CG2   . THR A 1 26  ? 8.184   -14.912 34.140  1.00 68.67  ? 73  THR A CG2   1 
ATOM   179  N N     . VAL A 1 27  ? 10.429  -15.818 36.309  1.00 68.48  ? 74  VAL A N     1 
ATOM   180  C CA    . VAL A 1 27  ? 10.183  -16.204 37.697  1.00 68.87  ? 74  VAL A CA    1 
ATOM   181  C C     . VAL A 1 27  ? 9.087   -15.306 38.192  1.00 73.00  ? 74  VAL A C     1 
ATOM   182  O O     . VAL A 1 27  ? 9.243   -14.085 38.133  1.00 73.03  ? 74  VAL A O     1 
ATOM   183  C CB    . VAL A 1 27  ? 11.429  -16.197 38.636  1.00 73.30  ? 74  VAL A CB    1 
ATOM   184  C CG1   . VAL A 1 27  ? 11.028  -16.397 40.090  1.00 73.13  ? 74  VAL A CG1   1 
ATOM   185  C CG2   . VAL A 1 27  ? 12.407  -17.273 38.233  1.00 74.57  ? 74  VAL A CG2   1 
ATOM   186  N N     . LEU A 1 28  ? 7.973   -15.908 38.650  1.00 69.26  ? 75  LEU A N     1 
ATOM   187  C CA    . LEU A 1 28  ? 6.836   -15.189 39.219  1.00 68.00  ? 75  LEU A CA    1 
ATOM   188  C C     . LEU A 1 28  ? 6.751   -15.490 40.704  1.00 74.08  ? 75  LEU A C     1 
ATOM   189  O O     . LEU A 1 28  ? 6.754   -16.676 41.083  1.00 75.46  ? 75  LEU A O     1 
ATOM   190  C CB    . LEU A 1 28  ? 5.518   -15.687 38.629  1.00 66.71  ? 75  LEU A CB    1 
ATOM   191  C CG    . LEU A 1 28  ? 5.122   -15.370 37.216  1.00 68.81  ? 75  LEU A CG    1 
ATOM   192  C CD1   . LEU A 1 28  ? 3.819   -16.052 36.926  1.00 68.81  ? 75  LEU A CD1   1 
ATOM   193  C CD2   . LEU A 1 28  ? 4.972   -13.902 37.006  1.00 66.88  ? 75  LEU A CD2   1 
ATOM   194  N N     . ILE A 1 29  ? 6.586   -14.437 41.538  1.00 68.73  ? 76  ILE A N     1 
ATOM   195  C CA    . ILE A 1 29  ? 6.365   -14.597 42.974  1.00 67.95  ? 76  ILE A CA    1 
ATOM   196  C C     . ILE A 1 29  ? 5.032   -13.933 43.216  1.00 72.75  ? 76  ILE A C     1 
ATOM   197  O O     . ILE A 1 29  ? 4.939   -12.705 43.089  1.00 73.36  ? 76  ILE A O     1 
ATOM   198  C CB    . ILE A 1 29  ? 7.481   -14.044 43.886  1.00 71.15  ? 76  ILE A CB    1 
ATOM   199  C CG1   . ILE A 1 29  ? 8.857   -14.632 43.526  1.00 71.73  ? 76  ILE A CG1   1 
ATOM   200  C CG2   . ILE A 1 29  ? 7.135   -14.299 45.348  1.00 71.73  ? 76  ILE A CG2   1 
ATOM   201  C CD1   . ILE A 1 29  ? 9.976   -13.723 43.754  1.00 72.98  ? 76  ILE A CD1   1 
ATOM   202  N N     . LEU A 1 30  ? 3.985   -14.762 43.461  1.00 68.85  ? 77  LEU A N     1 
ATOM   203  C CA    . LEU A 1 30  ? 2.600   -14.368 43.743  1.00 68.05  ? 77  LEU A CA    1 
ATOM   204  C C     . LEU A 1 30  ? 2.346   -14.429 45.271  1.00 74.72  ? 77  LEU A C     1 
ATOM   205  O O     . LEU A 1 30  ? 2.568   -15.476 45.916  1.00 75.46  ? 77  LEU A O     1 
ATOM   206  C CB    . LEU A 1 30  ? 1.662   -15.312 43.007  1.00 67.56  ? 77  LEU A CB    1 
ATOM   207  C CG    . LEU A 1 30  ? 1.310   -14.884 41.597  1.00 70.46  ? 77  LEU A CG    1 
ATOM   208  C CD1   . LEU A 1 30  ? 1.712   -15.903 40.634  1.00 70.76  ? 77  LEU A CD1   1 
ATOM   209  C CD2   . LEU A 1 30  ? -0.132  -14.767 41.455  1.00 70.32  ? 77  LEU A CD2   1 
ATOM   210  N N     . HIS A 1 31  ? 1.921   -13.299 45.861  1.00 70.51  ? 78  HIS A N     1 
ATOM   211  C CA    . HIS A 1 31  ? 1.770   -13.222 47.319  1.00 71.04  ? 78  HIS A CA    1 
ATOM   212  C C     . HIS A 1 31  ? 0.787   -12.156 47.799  1.00 75.29  ? 78  HIS A C     1 
ATOM   213  O O     . HIS A 1 31  ? 0.341   -11.342 47.012  1.00 74.98  ? 78  HIS A O     1 
ATOM   214  C CB    . HIS A 1 31  ? 3.155   -12.913 47.928  1.00 72.44  ? 78  HIS A CB    1 
ATOM   215  C CG    . HIS A 1 31  ? 3.698   -11.563 47.536  1.00 75.31  ? 78  HIS A CG    1 
ATOM   216  N ND1   . HIS A 1 31  ? 4.273   -11.345 46.289  1.00 75.95  ? 78  HIS A ND1   1 
ATOM   217  C CD2   . HIS A 1 31  ? 3.711   -10.400 48.224  1.00 77.11  ? 78  HIS A CD2   1 
ATOM   218  C CE1   . HIS A 1 31  ? 4.628   -10.069 46.272  1.00 75.21  ? 78  HIS A CE1   1 
ATOM   219  N NE2   . HIS A 1 31  ? 4.298   -9.456  47.404  1.00 76.58  ? 78  HIS A NE2   1 
ATOM   220  N N     . ALA A 1 32  ? 0.545   -12.098 49.116  1.00 73.27  ? 79  ALA A N     1 
ATOM   221  C CA    . ALA A 1 32  ? -0.296  -11.090 49.764  1.00 72.67  ? 79  ALA A CA    1 
ATOM   222  C C     . ALA A 1 32  ? 0.533   -9.855  50.107  1.00 76.64  ? 79  ALA A C     1 
ATOM   223  O O     . ALA A 1 32  ? 1.729   -9.962  50.345  1.00 76.51  ? 79  ALA A O     1 
ATOM   224  C CB    . ALA A 1 32  ? -0.903  -11.663 51.015  1.00 74.41  ? 79  ALA A CB    1 
ATOM   225  N N     . LYS A 1 33  ? -0.091  -8.679  50.097  1.00 74.85  ? 80  LYS A N     1 
ATOM   226  C CA    . LYS A 1 33  ? 0.577   -7.408  50.385  1.00 75.44  ? 80  LYS A CA    1 
ATOM   227  C C     . LYS A 1 33  ? 0.859   -7.208  51.891  1.00 81.77  ? 80  LYS A C     1 
ATOM   228  O O     . LYS A 1 33  ? 1.774   -6.465  52.265  1.00 83.16  ? 80  LYS A O     1 
ATOM   229  C CB    . LYS A 1 33  ? -0.202  -6.249  49.770  1.00 77.36  ? 80  LYS A CB    1 
ATOM   230  C CG    . LYS A 1 33  ? 0.154   -5.982  48.309  1.00 91.18  ? 80  LYS A CG    1 
ATOM   231  C CD    . LYS A 1 33  ? -0.794  -4.948  47.682  1.00 102.96 ? 80  LYS A CD    1 
ATOM   232  C CE    . LYS A 1 33  ? -0.255  -4.374  46.383  1.00 117.90 ? 80  LYS A CE    1 
ATOM   233  N NZ    . LYS A 1 33  ? -1.327  -3.794  45.510  1.00 122.81 ? 80  LYS A NZ    1 
ATOM   234  N N     . VAL A 1 34  ? 0.110   -7.906  52.744  1.00 78.37  ? 81  VAL A N     1 
ATOM   235  C CA    . VAL A 1 34  ? 0.273   -7.853  54.200  1.00 79.80  ? 81  VAL A CA    1 
ATOM   236  C C     . VAL A 1 34  ? 0.536   -9.233  54.786  1.00 81.05  ? 81  VAL A C     1 
ATOM   237  O O     . VAL A 1 34  ? 0.400   -10.245 54.092  1.00 79.34  ? 81  VAL A O     1 
ATOM   238  C CB    . VAL A 1 34  ? -0.867  -7.114  54.950  1.00 85.16  ? 81  VAL A CB    1 
ATOM   239  C CG1   . VAL A 1 34  ? -1.116  -5.725  54.365  1.00 84.31  ? 81  VAL A CG1   1 
ATOM   240  C CG2   . VAL A 1 34  ? -2.152  -7.944  54.980  1.00 84.79  ? 81  VAL A CG2   1 
ATOM   241  N N     . ALA A 1 35  ? 0.930   -9.259  56.072  1.00 77.21  ? 82  ALA A N     1 
ATOM   242  C CA    . ALA A 1 35  ? 1.270   -10.459 56.831  1.00 75.95  ? 82  ALA A CA    1 
ATOM   243  C C     . ALA A 1 35  ? 1.046   -10.179 58.309  1.00 81.78  ? 82  ALA A C     1 
ATOM   244  O O     . ALA A 1 35  ? 1.455   -9.130  58.803  1.00 82.44  ? 82  ALA A O     1 
ATOM   245  C CB    . ALA A 1 35  ? 2.728   -10.839 56.585  1.00 76.14  ? 82  ALA A CB    1 
ATOM   246  N N     . GLN A 1 36  ? 0.346   -11.086 58.995  1.00 79.42  ? 83  GLN A N     1 
ATOM   247  C CA    . GLN A 1 36  ? 0.084   -10.993 60.426  1.00 82.09  ? 83  GLN A CA    1 
ATOM   248  C C     . GLN A 1 36  ? 1.244   -11.657 61.179  1.00 89.75  ? 83  GLN A C     1 
ATOM   249  O O     . GLN A 1 36  ? 1.675   -12.748 60.811  1.00 89.21  ? 83  GLN A O     1 
ATOM   250  C CB    . GLN A 1 36  ? -1.243  -11.683 60.754  1.00 83.31  ? 83  GLN A CB    1 
ATOM   251  C CG    . GLN A 1 36  ? -1.733  -11.428 62.173  1.00 91.15  ? 83  GLN A CG    1 
ATOM   252  C CD    . GLN A 1 36  ? -3.056  -12.077 62.507  1.00 99.64  ? 83  GLN A CD    1 
ATOM   253  O OE1   . GLN A 1 36  ? -3.270  -12.476 63.638  1.00 94.62  ? 83  GLN A OE1   1 
ATOM   254  N NE2   . GLN A 1 36  ? -3.988  -12.205 61.554  1.00 89.93  ? 83  GLN A NE2   1 
ATOM   255  N N     . LYS A 1 37  ? 1.743   -11.010 62.231  1.00 91.15  ? 84  LYS A N     1 
ATOM   256  C CA    . LYS A 1 37  ? 2.858   -11.544 63.009  1.00 93.94  ? 84  LYS A CA    1 
ATOM   257  C C     . LYS A 1 37  ? 2.491   -12.527 64.130  1.00 100.33 ? 84  LYS A C     1 
ATOM   258  O O     . LYS A 1 37  ? 1.385   -12.492 64.683  1.00 100.71 ? 84  LYS A O     1 
ATOM   259  C CB    . LYS A 1 37  ? 3.836   -10.429 63.462  1.00 99.84  ? 84  LYS A CB    1 
ATOM   260  C CG    . LYS A 1 37  ? 3.440   -9.635  64.708  1.00 111.99 ? 84  LYS A CG    1 
ATOM   261  C CD    . LYS A 1 37  ? 3.871   -8.172  64.621  1.00 121.42 ? 84  LYS A CD    1 
ATOM   262  C CE    . LYS A 1 37  ? 5.278   -7.901  65.094  1.00 136.52 ? 84  LYS A CE    1 
ATOM   263  N NZ    . LYS A 1 37  ? 5.551   -6.442  65.174  1.00 145.08 ? 84  LYS A NZ    1 
ATOM   264  N N     . SER A 1 38  ? 3.450   -13.405 64.444  1.00 98.80  ? 85  SER A N     1 
ATOM   265  C CA    . SER A 1 38  ? 3.391   -14.451 65.464  1.00 101.11 ? 85  SER A CA    1 
ATOM   266  C C     . SER A 1 38  ? 4.181   -13.958 66.683  1.00 111.60 ? 85  SER A C     1 
ATOM   267  O O     . SER A 1 38  ? 5.044   -13.088 66.545  1.00 112.66 ? 85  SER A O     1 
ATOM   268  C CB    . SER A 1 38  ? 4.030   -15.731 64.930  1.00 103.65 ? 85  SER A CB    1 
ATOM   269  O OG    . SER A 1 38  ? 3.677   -16.042 63.590  1.00 110.89 ? 85  SER A OG    1 
ATOM   270  N N     . TYR A 1 39  ? 3.906   -14.526 67.869  1.00 112.13 ? 86  TYR A N     1 
ATOM   271  C CA    . TYR A 1 39  ? 4.517   -14.116 69.129  1.00 116.04 ? 86  TYR A CA    1 
ATOM   272  C C     . TYR A 1 39  ? 5.157   -15.253 69.990  1.00 127.21 ? 86  TYR A C     1 
ATOM   273  O O     . TYR A 1 39  ? 6.370   -15.486 69.927  1.00 128.70 ? 86  TYR A O     1 
ATOM   274  C CB    . TYR A 1 39  ? 3.494   -13.295 69.955  1.00 116.77 ? 86  TYR A CB    1 
ATOM   275  C CG    . TYR A 1 39  ? 3.071   -11.963 69.362  1.00 113.20 ? 86  TYR A CG    1 
ATOM   276  C CD1   . TYR A 1 39  ? 3.758   -10.793 69.669  1.00 117.41 ? 86  TYR A CD1   1 
ATOM   277  C CD2   . TYR A 1 39  ? 1.904   -11.850 68.612  1.00 109.18 ? 86  TYR A CD2   1 
ATOM   278  C CE1   . TYR A 1 39  ? 3.371   -9.562  69.136  1.00 116.14 ? 86  TYR A CE1   1 
ATOM   279  C CE2   . TYR A 1 39  ? 1.495   -10.621 68.086  1.00 107.94 ? 86  TYR A CE2   1 
ATOM   280  C CZ    . TYR A 1 39  ? 2.229   -9.477  68.359  1.00 114.90 ? 86  TYR A CZ    1 
ATOM   281  O OH    . TYR A 1 39  ? 1.847   -8.251  67.872  1.00 110.37 ? 86  TYR A OH    1 
ATOM   282  N N     . GLY A 1 40  ? 4.348   -15.895 70.823  1.00 127.62 ? 87  GLY A N     1 
ATOM   283  C CA    . GLY A 1 40  ? 4.819   -16.893 71.780  1.00 132.93 ? 87  GLY A CA    1 
ATOM   284  C C     . GLY A 1 40  ? 5.128   -18.272 71.234  1.00 138.33 ? 87  GLY A C     1 
ATOM   285  O O     . GLY A 1 40  ? 4.511   -19.266 71.660  1.00 139.92 ? 87  GLY A O     1 
ATOM   286  N N     . ASN A 1 41  ? 6.131   -18.342 70.323  1.00 132.04 ? 88  ASN A N     1 
ATOM   287  C CA    . ASN A 1 41  ? 6.566   -19.561 69.633  1.00 129.78 ? 88  ASN A CA    1 
ATOM   288  C C     . ASN A 1 41  ? 5.562   -19.960 68.547  1.00 127.05 ? 88  ASN A C     1 
ATOM   289  O O     . ASN A 1 41  ? 5.846   -20.884 67.770  1.00 126.12 ? 88  ASN A O     1 
ATOM   290  C CB    . ASN A 1 41  ? 6.853   -20.717 70.598  1.00 132.35 ? 88  ASN A CB    1 
ATOM   291  C CG    . ASN A 1 41  ? 7.934   -20.387 71.583  1.00 160.75 ? 88  ASN A CG    1 
ATOM   292  O OD1   . ASN A 1 41  ? 9.124   -20.460 71.262  1.00 157.00 ? 88  ASN A OD1   1 
ATOM   293  N ND2   . ASN A 1 41  ? 7.544   -19.973 72.789  1.00 154.77 ? 88  ASN A ND2   1 
ATOM   294  N N     . GLU A 1 42  ? 4.408   -19.226 68.470  1.00 117.65 ? 89  GLU A N     1 
ATOM   295  C CA    . GLU A 1 42  ? 3.333   -19.446 67.494  1.00 111.38 ? 89  GLU A CA    1 
ATOM   296  C C     . GLU A 1 42  ? 3.803   -19.236 66.089  1.00 107.71 ? 89  GLU A C     1 
ATOM   297  O O     . GLU A 1 42  ? 4.784   -18.528 65.877  1.00 106.21 ? 89  GLU A O     1 
ATOM   298  C CB    . GLU A 1 42  ? 2.036   -18.655 67.788  1.00 111.54 ? 89  GLU A CB    1 
ATOM   299  C CG    . GLU A 1 42  ? 2.219   -17.285 68.405  1.00 119.80 ? 89  GLU A CG    1 
ATOM   300  C CD    . GLU A 1 42  ? 1.011   -16.372 68.358  1.00 126.88 ? 89  GLU A CD    1 
ATOM   301  O OE1   . GLU A 1 42  ? 1.202   -15.159 68.126  1.00 123.43 ? 89  GLU A OE1   1 
ATOM   302  O OE2   . GLU A 1 42  ? -0.123  -16.855 68.567  1.00 113.98 ? 89  GLU A OE2   1 
ATOM   303  N N     . LYS A 1 43  ? 3.170   -19.955 65.149  1.00 100.29 ? 90  LYS A N     1 
ATOM   304  C CA    . LYS A 1 43  ? 3.485   -19.940 63.724  1.00 95.58  ? 90  LYS A CA    1 
ATOM   305  C C     . LYS A 1 43  ? 2.189   -19.648 62.986  1.00 98.06  ? 90  LYS A C     1 
ATOM   306  O O     . LYS A 1 43  ? 1.435   -20.556 62.631  1.00 96.46  ? 90  LYS A O     1 
ATOM   307  C CB    . LYS A 1 43  ? 4.136   -21.270 63.266  1.00 96.22  ? 90  LYS A CB    1 
ATOM   308  C CG    . LYS A 1 43  ? 5.508   -21.567 63.905  1.00 93.87  ? 90  LYS A CG    1 
ATOM   309  C CD    . LYS A 1 43  ? 6.113   -22.887 63.437  1.00 91.39  ? 90  LYS A CD    1 
ATOM   310  C CE    . LYS A 1 43  ? 7.259   -23.349 64.288  1.00 119.84 ? 90  LYS A CE    1 
ATOM   311  N NZ    . LYS A 1 43  ? 6.803   -24.035 65.544  1.00 142.69 ? 90  LYS A NZ    1 
ATOM   312  N N     . ARG A 1 44  ? 1.896   -18.352 62.846  1.00 94.57  ? 91  ARG A N     1 
ATOM   313  C CA    . ARG A 1 44  ? 0.721   -17.836 62.154  1.00 91.77  ? 91  ARG A CA    1 
ATOM   314  C C     . ARG A 1 44  ? 1.077   -17.743 60.665  1.00 93.68  ? 91  ARG A C     1 
ATOM   315  O O     . ARG A 1 44  ? 1.491   -16.675 60.194  1.00 94.33  ? 91  ARG A O     1 
ATOM   316  C CB    . ARG A 1 44  ? 0.337   -16.461 62.731  1.00 89.06  ? 91  ARG A CB    1 
ATOM   317  C CG    . ARG A 1 44  ? -0.222  -16.556 64.117  1.00 89.07  ? 91  ARG A CG    1 
ATOM   318  C CD    . ARG A 1 44  ? -0.850  -15.272 64.611  1.00 83.48  ? 91  ARG A CD    1 
ATOM   319  N NE    . ARG A 1 44  ? -1.265  -15.403 66.012  1.00 88.06  ? 91  ARG A NE    1 
ATOM   320  C CZ    . ARG A 1 44  ? -2.439  -15.888 66.416  1.00 105.15 ? 91  ARG A CZ    1 
ATOM   321  N NH1   . ARG A 1 44  ? -3.350  -16.274 65.527  1.00 102.27 ? 91  ARG A NH1   1 
ATOM   322  N NH2   . ARG A 1 44  ? -2.720  -15.968 67.709  1.00 86.39  ? 91  ARG A NH2   1 
ATOM   323  N N     . PHE A 1 45  ? 0.958   -18.879 59.948  1.00 87.21  ? 92  PHE A N     1 
ATOM   324  C CA    . PHE A 1 45  ? 1.307   -19.039 58.530  1.00 83.79  ? 92  PHE A CA    1 
ATOM   325  C C     . PHE A 1 45  ? 0.698   -18.033 57.592  1.00 88.19  ? 92  PHE A C     1 
ATOM   326  O O     . PHE A 1 45  ? -0.453  -17.643 57.785  1.00 88.56  ? 92  PHE A O     1 
ATOM   327  C CB    . PHE A 1 45  ? 1.065   -20.469 58.026  1.00 84.16  ? 92  PHE A CB    1 
ATOM   328  C CG    . PHE A 1 45  ? 1.822   -21.531 58.790  1.00 87.98  ? 92  PHE A CG    1 
ATOM   329  C CD1   . PHE A 1 45  ? 3.195   -21.418 58.999  1.00 92.38  ? 92  PHE A CD1   1 
ATOM   330  C CD2   . PHE A 1 45  ? 1.157   -22.618 59.344  1.00 90.17  ? 92  PHE A CD2   1 
ATOM   331  C CE1   . PHE A 1 45  ? 3.886   -22.382 59.747  1.00 95.77  ? 92  PHE A CE1   1 
ATOM   332  C CE2   . PHE A 1 45  ? 1.850   -23.579 60.089  1.00 95.15  ? 92  PHE A CE2   1 
ATOM   333  C CZ    . PHE A 1 45  ? 3.207   -23.455 60.285  1.00 94.96  ? 92  PHE A CZ    1 
ATOM   334  N N     . PHE A 1 46  ? 1.486   -17.596 56.585  1.00 84.13  ? 93  PHE A N     1 
ATOM   335  C CA    . PHE A 1 46  ? 1.056   -16.634 55.572  1.00 81.83  ? 93  PHE A CA    1 
ATOM   336  C C     . PHE A 1 46  ? -0.041  -17.256 54.746  1.00 86.97  ? 93  PHE A C     1 
ATOM   337  O O     . PHE A 1 46  ? 0.135   -18.360 54.208  1.00 86.61  ? 93  PHE A O     1 
ATOM   338  C CB    . PHE A 1 46  ? 2.223   -16.163 54.687  1.00 81.68  ? 93  PHE A CB    1 
ATOM   339  C CG    . PHE A 1 46  ? 3.338   -15.398 55.372  1.00 84.96  ? 93  PHE A CG    1 
ATOM   340  C CD1   . PHE A 1 46  ? 3.155   -14.838 56.635  1.00 89.42  ? 93  PHE A CD1   1 
ATOM   341  C CD2   . PHE A 1 46  ? 4.545   -15.165 54.720  1.00 87.28  ? 93  PHE A CD2   1 
ATOM   342  C CE1   . PHE A 1 46  ? 4.167   -14.080 57.239  1.00 91.89  ? 93  PHE A CE1   1 
ATOM   343  C CE2   . PHE A 1 46  ? 5.566   -14.423 55.339  1.00 91.25  ? 93  PHE A CE2   1 
ATOM   344  C CZ    . PHE A 1 46  ? 5.369   -13.893 56.595  1.00 90.89  ? 93  PHE A CZ    1 
ATOM   345  N N     . CYS A 1 47  ? -1.200  -16.562 54.714  1.00 84.65  ? 94  CYS A N     1 
ATOM   346  C CA    A CYS A 1 47  ? -2.391  -16.980 53.982  0.52 83.32  ? 94  CYS A CA    1 
ATOM   347  C CA    B CYS A 1 47  ? -2.386  -16.999 53.975  0.48 83.38  ? 94  CYS A CA    1 
ATOM   348  C C     . CYS A 1 47  ? -2.929  -15.850 53.116  1.00 86.00  ? 94  CYS A C     1 
ATOM   349  O O     . CYS A 1 47  ? -3.238  -14.784 53.650  1.00 87.09  ? 94  CYS A O     1 
ATOM   350  C CB    A CYS A 1 47  ? -3.463  -17.522 54.917  0.52 85.07  ? 94  CYS A CB    1 
ATOM   351  C CB    B CYS A 1 47  ? -3.454  -17.590 54.895  0.48 85.21  ? 94  CYS A CB    1 
ATOM   352  S SG    A CYS A 1 47  ? -4.924  -18.140 54.056  0.52 88.35  ? 94  CYS A SG    1 
ATOM   353  S SG    B CYS A 1 47  ? -3.132  -19.303 55.417  0.48 90.56  ? 94  CYS A SG    1 
ATOM   354  N N     . PRO A 1 48  ? -3.031  -16.041 51.772  1.00 80.18  ? 95  PRO A N     1 
ATOM   355  C CA    . PRO A 1 48  ? -2.695  -17.241 50.978  1.00 79.10  ? 95  PRO A CA    1 
ATOM   356  C C     . PRO A 1 48  ? -1.184  -17.548 50.926  1.00 82.47  ? 95  PRO A C     1 
ATOM   357  O O     . PRO A 1 48  ? -0.347  -16.635 51.120  1.00 82.74  ? 95  PRO A O     1 
ATOM   358  C CB    . PRO A 1 48  ? -3.263  -16.893 49.602  1.00 78.75  ? 95  PRO A CB    1 
ATOM   359  C CG    . PRO A 1 48  ? -3.165  -15.426 49.527  1.00 81.68  ? 95  PRO A CG    1 
ATOM   360  C CD    . PRO A 1 48  ? -3.543  -14.973 50.894  1.00 79.41  ? 95  PRO A CD    1 
ATOM   361  N N     . PRO A 1 49  ? -0.796  -18.831 50.747  1.00 76.45  ? 96  PRO A N     1 
ATOM   362  C CA    . PRO A 1 49  ? 0.634   -19.127 50.678  1.00 75.35  ? 96  PRO A CA    1 
ATOM   363  C C     . PRO A 1 49  ? 1.262   -18.506 49.436  1.00 77.52  ? 96  PRO A C     1 
ATOM   364  O O     . PRO A 1 49  ? 0.698   -18.623 48.329  1.00 73.67  ? 96  PRO A O     1 
ATOM   365  C CB    . PRO A 1 49  ? 0.694   -20.663 50.641  1.00 77.31  ? 96  PRO A CB    1 
ATOM   366  C CG    . PRO A 1 49  ? -0.591  -21.086 50.177  1.00 80.98  ? 96  PRO A CG    1 
ATOM   367  C CD    . PRO A 1 49  ? -1.605  -20.046 50.541  1.00 77.23  ? 96  PRO A CD    1 
ATOM   368  N N     . PRO A 1 50  ? 2.441   -17.859 49.612  1.00 76.71  ? 97  PRO A N     1 
ATOM   369  C CA    . PRO A 1 50  ? 3.179   -17.319 48.458  1.00 76.11  ? 97  PRO A CA    1 
ATOM   370  C C     . PRO A 1 50  ? 3.455   -18.402 47.422  1.00 80.81  ? 97  PRO A C     1 
ATOM   371  O O     . PRO A 1 50  ? 3.634   -19.570 47.764  1.00 81.88  ? 97  PRO A O     1 
ATOM   372  C CB    . PRO A 1 50  ? 4.488   -16.839 49.078  1.00 79.32  ? 97  PRO A CB    1 
ATOM   373  C CG    . PRO A 1 50  ? 4.170   -16.595 50.499  1.00 85.27  ? 97  PRO A CG    1 
ATOM   374  C CD    . PRO A 1 50  ? 3.203   -17.664 50.857  1.00 80.76  ? 97  PRO A CD    1 
ATOM   375  N N     . CYS A 1 51  ? 3.464   -18.028 46.155  1.00 76.12  ? 98  CYS A N     1 
ATOM   376  C CA    . CYS A 1 51  ? 3.639   -19.016 45.109  1.00 74.65  ? 98  CYS A CA    1 
ATOM   377  C C     . CYS A 1 51  ? 4.670   -18.608 44.096  1.00 76.08  ? 98  CYS A C     1 
ATOM   378  O O     . CYS A 1 51  ? 4.593   -17.512 43.529  1.00 75.69  ? 98  CYS A O     1 
ATOM   379  C CB    . CYS A 1 51  ? 2.301   -19.300 44.453  1.00 74.56  ? 98  CYS A CB    1 
ATOM   380  S SG    . CYS A 1 51  ? 2.304   -20.741 43.374  1.00 79.32  ? 98  CYS A SG    1 
ATOM   381  N N     . VAL A 1 52  ? 5.635   -19.506 43.868  1.00 70.37  ? 99  VAL A N     1 
ATOM   382  C CA    . VAL A 1 52  ? 6.692   -19.343 42.897  1.00 68.60  ? 99  VAL A CA    1 
ATOM   383  C C     . VAL A 1 52  ? 6.308   -20.166 41.685  1.00 75.58  ? 99  VAL A C     1 
ATOM   384  O O     . VAL A 1 52  ? 6.077   -21.372 41.819  1.00 76.07  ? 99  VAL A O     1 
ATOM   385  C CB    . VAL A 1 52  ? 8.050   -19.771 43.477  1.00 73.10  ? 99  VAL A CB    1 
ATOM   386  C CG1   . VAL A 1 52  ? 9.127   -19.840 42.394  1.00 72.75  ? 99  VAL A CG1   1 
ATOM   387  C CG2   . VAL A 1 52  ? 8.483   -18.830 44.600  1.00 73.61  ? 99  VAL A CG2   1 
ATOM   388  N N     . TYR A 1 53  ? 6.186   -19.498 40.510  1.00 73.21  ? 100 TYR A N     1 
ATOM   389  C CA    . TYR A 1 53  ? 5.911   -20.113 39.195  1.00 73.59  ? 100 TYR A CA    1 
ATOM   390  C C     . TYR A 1 53  ? 7.128   -19.855 38.337  1.00 77.46  ? 100 TYR A C     1 
ATOM   391  O O     . TYR A 1 53  ? 7.590   -18.708 38.249  1.00 77.13  ? 100 TYR A O     1 
ATOM   392  C CB    . TYR A 1 53  ? 4.736   -19.445 38.431  1.00 74.57  ? 100 TYR A CB    1 
ATOM   393  C CG    . TYR A 1 53  ? 3.363   -19.741 38.950  1.00 78.20  ? 100 TYR A CG    1 
ATOM   394  C CD1   . TYR A 1 53  ? 2.834   -19.027 40.019  1.00 80.94  ? 100 TYR A CD1   1 
ATOM   395  C CD2   . TYR A 1 53  ? 2.562   -20.693 38.343  1.00 80.68  ? 100 TYR A CD2   1 
ATOM   396  C CE1   . TYR A 1 53  ? 1.545   -19.279 40.494  1.00 84.25  ? 100 TYR A CE1   1 
ATOM   397  C CE2   . TYR A 1 53  ? 1.293   -20.996 38.843  1.00 83.39  ? 100 TYR A CE2   1 
ATOM   398  C CZ    . TYR A 1 53  ? 0.778   -20.271 39.911  1.00 93.63  ? 100 TYR A CZ    1 
ATOM   399  O OH    . TYR A 1 53  ? -0.494  -20.527 40.385  1.00 99.67  ? 100 TYR A OH    1 
ATOM   400  N N     . LEU A 1 54  ? 7.576   -20.888 37.638  1.00 73.64  ? 101 LEU A N     1 
ATOM   401  C CA    . LEU A 1 54  ? 8.654   -20.808 36.673  1.00 72.60  ? 101 LEU A CA    1 
ATOM   402  C C     . LEU A 1 54  ? 7.959   -20.863 35.315  1.00 75.79  ? 101 LEU A C     1 
ATOM   403  O O     . LEU A 1 54  ? 7.419   -21.895 34.925  1.00 76.63  ? 101 LEU A O     1 
ATOM   404  C CB    . LEU A 1 54  ? 9.666   -21.954 36.855  1.00 73.82  ? 101 LEU A CB    1 
ATOM   405  C CG    . LEU A 1 54  ? 10.218  -22.153 38.258  1.00 79.60  ? 101 LEU A CG    1 
ATOM   406  C CD1   . LEU A 1 54  ? 11.331  -23.173 38.254  1.00 81.01  ? 101 LEU A CD1   1 
ATOM   407  C CD2   . LEU A 1 54  ? 10.701  -20.842 38.862  1.00 83.83  ? 101 LEU A CD2   1 
ATOM   408  N N     . MET A 1 55  ? 7.910   -19.733 34.640  1.00 70.97  ? 102 MET A N     1 
ATOM   409  C CA    . MET A 1 55  ? 7.215   -19.616 33.365  1.00 70.42  ? 102 MET A CA    1 
ATOM   410  C C     . MET A 1 55  ? 8.157   -19.423 32.213  1.00 71.72  ? 102 MET A C     1 
ATOM   411  O O     . MET A 1 55  ? 9.242   -18.877 32.393  1.00 73.61  ? 102 MET A O     1 
ATOM   412  C CB    . MET A 1 55  ? 6.275   -18.420 33.412  1.00 72.34  ? 102 MET A CB    1 
ATOM   413  C CG    . MET A 1 55  ? 5.345   -18.447 34.576  1.00 78.21  ? 102 MET A CG    1 
ATOM   414  S SD    . MET A 1 55  ? 4.060   -19.683 34.356  1.00 86.21  ? 102 MET A SD    1 
ATOM   415  C CE    . MET A 1 55  ? 3.013   -18.783 33.058  1.00 82.45  ? 102 MET A CE    1 
ATOM   416  N N     . GLY A 1 56  ? 7.732   -19.841 31.031  1.00 63.57  ? 103 GLY A N     1 
ATOM   417  C CA    . GLY A 1 56  ? 8.497   -19.617 29.821  1.00 63.80  ? 103 GLY A CA    1 
ATOM   418  C C     . GLY A 1 56  ? 9.214   -20.792 29.216  1.00 72.64  ? 103 GLY A C     1 
ATOM   419  O O     . GLY A 1 56  ? 9.750   -21.651 29.923  1.00 76.81  ? 103 GLY A O     1 
ATOM   420  N N     . SER A 1 57  ? 9.300   -20.764 27.878  1.00 68.30  ? 104 SER A N     1 
ATOM   421  C CA    . SER A 1 57  ? 9.925   -21.777 27.048  1.00 68.99  ? 104 SER A CA    1 
ATOM   422  C C     . SER A 1 57  ? 11.416  -21.967 27.345  1.00 77.31  ? 104 SER A C     1 
ATOM   423  O O     . SER A 1 57  ? 11.994  -22.994 26.961  1.00 81.47  ? 104 SER A O     1 
ATOM   424  C CB    . SER A 1 57  ? 9.708   -21.439 25.585  1.00 69.70  ? 104 SER A CB    1 
ATOM   425  O OG    . SER A 1 57  ? 10.387  -20.246 25.248  1.00 73.64  ? 104 SER A OG    1 
ATOM   426  N N     . GLY A 1 58  ? 12.010  -21.000 28.043  1.00 72.02  ? 105 GLY A N     1 
ATOM   427  C CA    . GLY A 1 58  ? 13.424  -21.008 28.400  1.00 72.83  ? 105 GLY A CA    1 
ATOM   428  C C     . GLY A 1 58  ? 13.843  -22.064 29.394  1.00 76.81  ? 105 GLY A C     1 
ATOM   429  O O     . GLY A 1 58  ? 14.991  -22.503 29.356  1.00 78.53  ? 105 GLY A O     1 
ATOM   430  N N     . TRP A 1 59  ? 12.943  -22.456 30.310  1.00 72.48  ? 106 TRP A N     1 
ATOM   431  C CA    . TRP A 1 59  ? 13.254  -23.475 31.309  1.00 73.34  ? 106 TRP A CA    1 
ATOM   432  C C     . TRP A 1 59  ? 13.570  -24.824 30.649  1.00 81.33  ? 106 TRP A C     1 
ATOM   433  O O     . TRP A 1 59  ? 14.626  -25.405 30.948  1.00 85.21  ? 106 TRP A O     1 
ATOM   434  C CB    . TRP A 1 59  ? 12.186  -23.557 32.404  1.00 70.50  ? 106 TRP A CB    1 
ATOM   435  C CG    . TRP A 1 59  ? 12.033  -22.279 33.180  1.00 70.48  ? 106 TRP A CG    1 
ATOM   436  C CD1   . TRP A 1 59  ? 11.094  -21.315 32.980  1.00 71.96  ? 106 TRP A CD1   1 
ATOM   437  C CD2   . TRP A 1 59  ? 12.867  -21.811 34.252  1.00 71.22  ? 106 TRP A CD2   1 
ATOM   438  N NE1   . TRP A 1 59  ? 11.280  -20.282 33.867  1.00 71.43  ? 106 TRP A NE1   1 
ATOM   439  C CE2   . TRP A 1 59  ? 12.358  -20.563 34.663  1.00 74.23  ? 106 TRP A CE2   1 
ATOM   440  C CE3   . TRP A 1 59  ? 14.034  -22.301 34.873  1.00 75.71  ? 106 TRP A CE3   1 
ATOM   441  C CZ2   . TRP A 1 59  ? 12.938  -19.820 35.701  1.00 74.94  ? 106 TRP A CZ2   1 
ATOM   442  C CZ3   . TRP A 1 59  ? 14.632  -21.550 35.880  1.00 77.90  ? 106 TRP A CZ3   1 
ATOM   443  C CH2   . TRP A 1 59  ? 14.086  -20.324 36.287  1.00 76.93  ? 106 TRP A CH2   1 
ATOM   444  N N     . LYS A 1 60  ? 12.729  -25.253 29.680  1.00 75.78  ? 107 LYS A N     1 
ATOM   445  C CA    . LYS A 1 60  ? 12.915  -26.476 28.888  1.00 77.48  ? 107 LYS A CA    1 
ATOM   446  C C     . LYS A 1 60  ? 14.169  -26.323 28.013  1.00 81.73  ? 107 LYS A C     1 
ATOM   447  O O     . LYS A 1 60  ? 14.983  -27.239 27.974  1.00 83.48  ? 107 LYS A O     1 
ATOM   448  C CB    . LYS A 1 60  ? 11.662  -26.761 28.019  1.00 79.64  ? 107 LYS A CB    1 
ATOM   449  C CG    . LYS A 1 60  ? 11.670  -28.052 27.183  1.00 93.75  ? 107 LYS A CG    1 
ATOM   450  C CD    . LYS A 1 60  ? 11.776  -27.772 25.653  1.00 109.73 ? 107 LYS A CD    1 
ATOM   451  C CE    . LYS A 1 60  ? 11.185  -28.873 24.782  1.00 121.97 ? 107 LYS A CE    1 
ATOM   452  N NZ    . LYS A 1 60  ? 11.250  -28.556 23.319  1.00 128.82 ? 107 LYS A NZ    1 
ATOM   453  N N     . LYS A 1 61  ? 14.340  -25.164 27.336  1.00 77.38  ? 108 LYS A N     1 
ATOM   454  C CA    . LYS A 1 61  ? 15.517  -24.901 26.482  1.00 78.54  ? 108 LYS A CA    1 
ATOM   455  C C     . LYS A 1 61  ? 16.806  -25.094 27.295  1.00 86.95  ? 108 LYS A C     1 
ATOM   456  O O     . LYS A 1 61  ? 17.718  -25.776 26.815  1.00 91.31  ? 108 LYS A O     1 
ATOM   457  C CB    . LYS A 1 61  ? 15.457  -23.505 25.808  1.00 77.43  ? 108 LYS A CB    1 
ATOM   458  C CG    . LYS A 1 61  ? 16.289  -23.431 24.525  1.00 91.13  ? 108 LYS A CG    1 
ATOM   459  C CD    . LYS A 1 61  ? 16.392  -22.025 23.869  1.00 101.51 ? 108 LYS A CD    1 
ATOM   460  C CE    . LYS A 1 61  ? 17.559  -21.183 24.375  1.00 120.00 ? 108 LYS A CE    1 
ATOM   461  N NZ    . LYS A 1 61  ? 18.898  -21.720 24.005  1.00 126.81 ? 108 LYS A NZ    1 
ATOM   462  N N     . LYS A 1 62  ? 16.839  -24.568 28.552  1.00 81.93  ? 109 LYS A N     1 
ATOM   463  C CA    . LYS A 1 62  ? 17.963  -24.695 29.477  1.00 83.36  ? 109 LYS A CA    1 
ATOM   464  C C     . LYS A 1 62  ? 18.126  -26.153 29.976  1.00 92.14  ? 109 LYS A C     1 
ATOM   465  O O     . LYS A 1 62  ? 19.254  -26.637 30.042  1.00 94.98  ? 109 LYS A O     1 
ATOM   466  C CB    . LYS A 1 62  ? 17.853  -23.664 30.619  1.00 82.83  ? 109 LYS A CB    1 
ATOM   467  C CG    . LYS A 1 62  ? 18.993  -23.671 31.661  1.00 85.22  ? 109 LYS A CG    1 
ATOM   468  C CD    . LYS A 1 62  ? 20.345  -23.189 31.125  1.00 87.67  ? 109 LYS A CD    1 
ATOM   469  C CE    . LYS A 1 62  ? 21.364  -23.003 32.209  1.00 92.30  ? 109 LYS A CE    1 
ATOM   470  N NZ    . LYS A 1 62  ? 22.686  -22.650 31.644  1.00 112.74 ? 109 LYS A NZ    1 
ATOM   471  N N     . LYS A 1 63  ? 17.015  -26.862 30.269  1.00 88.51  ? 110 LYS A N     1 
ATOM   472  C CA    . LYS A 1 63  ? 17.062  -28.274 30.670  1.00 91.33  ? 110 LYS A CA    1 
ATOM   473  C C     . LYS A 1 63  ? 17.713  -29.063 29.540  1.00 99.44  ? 110 LYS A C     1 
ATOM   474  O O     . LYS A 1 63  ? 18.541  -29.927 29.810  1.00 103.23 ? 110 LYS A O     1 
ATOM   475  C CB    . LYS A 1 63  ? 15.636  -28.834 30.928  1.00 92.72  ? 110 LYS A CB    1 
ATOM   476  C CG    . LYS A 1 63  ? 15.588  -30.303 31.372  1.00 95.67  ? 110 LYS A CG    1 
ATOM   477  C CD    . LYS A 1 63  ? 14.257  -30.976 31.009  1.00 99.86  ? 110 LYS A CD    1 
ATOM   478  C CE    . LYS A 1 63  ? 13.714  -31.936 32.064  1.00 109.71 ? 110 LYS A CE    1 
ATOM   479  N NZ    . LYS A 1 63  ? 14.529  -33.180 32.242  1.00 121.72 ? 110 LYS A NZ    1 
ATOM   480  N N     . GLU A 1 64  ? 17.344  -28.756 28.281  1.00 95.43  ? 111 GLU A N     1 
ATOM   481  C CA    . GLU A 1 64  ? 17.881  -29.417 27.102  1.00 98.46  ? 111 GLU A CA    1 
ATOM   482  C C     . GLU A 1 64  ? 19.378  -29.158 26.979  1.00 105.36 ? 111 GLU A C     1 
ATOM   483  O O     . GLU A 1 64  ? 20.127  -30.134 26.864  1.00 107.90 ? 111 GLU A O     1 
ATOM   484  C CB    . GLU A 1 64  ? 17.140  -28.985 25.832  1.00 98.79  ? 111 GLU A CB    1 
ATOM   485  C CG    . GLU A 1 64  ? 15.768  -29.622 25.642  1.00 110.62 ? 111 GLU A CG    1 
ATOM   486  C CD    . GLU A 1 64  ? 15.020  -29.210 24.382  1.00 139.03 ? 111 GLU A CD    1 
ATOM   487  O OE1   . GLU A 1 64  ? 15.194  -28.059 23.911  1.00 137.44 ? 111 GLU A OE1   1 
ATOM   488  O OE2   . GLU A 1 64  ? 14.227  -30.040 23.882  1.00 135.92 ? 111 GLU A OE2   1 
ATOM   489  N N     . GLN A 1 65  ? 19.812  -27.858 27.058  1.00 100.60 ? 112 GLN A N     1 
ATOM   490  C CA    . GLN A 1 65  ? 21.221  -27.408 26.994  1.00 102.91 ? 112 GLN A CA    1 
ATOM   491  C C     . GLN A 1 65  ? 22.099  -28.129 28.040  1.00 110.28 ? 112 GLN A C     1 
ATOM   492  O O     . GLN A 1 65  ? 23.148  -28.686 27.692  1.00 114.19 ? 112 GLN A O     1 
ATOM   493  C CB    . GLN A 1 65  ? 21.328  -25.875 27.202  1.00 102.49 ? 112 GLN A CB    1 
ATOM   494  C CG    . GLN A 1 65  ? 22.798  -25.367 27.351  1.00 127.97 ? 112 GLN A CG    1 
ATOM   495  C CD    . GLN A 1 65  ? 23.068  -24.417 28.522  1.00 135.05 ? 112 GLN A CD    1 
ATOM   496  O OE1   . GLN A 1 65  ? 22.466  -23.324 28.623  1.00 131.27 ? 112 GLN A OE1   1 
ATOM   497  N NE2   . GLN A 1 65  ? 24.061  -24.761 29.373  1.00 101.36 ? 112 GLN A NE2   1 
ATOM   498  N N     . MET A 1 66  ? 21.674  -28.087 29.315  1.00 104.22 ? 113 MET A N     1 
ATOM   499  C CA    . MET A 1 66  ? 22.379  -28.690 30.439  1.00 106.19 ? 113 MET A CA    1 
ATOM   500  C C     . MET A 1 66  ? 22.542  -30.190 30.281  1.00 114.24 ? 113 MET A C     1 
ATOM   501  O O     . MET A 1 66  ? 23.654  -30.701 30.455  1.00 117.09 ? 113 MET A O     1 
ATOM   502  C CB    . MET A 1 66  ? 21.688  -28.348 31.765  1.00 106.15 ? 113 MET A CB    1 
ATOM   503  C CG    . MET A 1 66  ? 21.915  -26.919 32.190  1.00 107.11 ? 113 MET A CG    1 
ATOM   504  S SD    . MET A 1 66  ? 21.181  -26.580 33.794  1.00 109.13 ? 113 MET A SD    1 
ATOM   505  C CE    . MET A 1 66  ? 22.520  -26.879 34.826  1.00 109.68 ? 113 MET A CE    1 
ATOM   506  N N     . GLU A 1 67  ? 21.448  -30.887 29.917  1.00 110.40 ? 114 GLU A N     1 
ATOM   507  C CA    . GLU A 1 67  ? 21.455  -32.340 29.728  1.00 113.39 ? 114 GLU A CA    1 
ATOM   508  C C     . GLU A 1 67  ? 22.335  -32.822 28.561  1.00 119.71 ? 114 GLU A C     1 
ATOM   509  O O     . GLU A 1 67  ? 22.907  -33.906 28.671  1.00 123.60 ? 114 GLU A O     1 
ATOM   510  C CB    . GLU A 1 67  ? 20.028  -32.926 29.682  1.00 113.12 ? 114 GLU A CB    1 
ATOM   511  C CG    . GLU A 1 67  ? 19.343  -33.001 31.044  1.00 119.04 ? 114 GLU A CG    1 
ATOM   512  C CD    . GLU A 1 67  ? 17.866  -33.364 31.048  1.00 128.08 ? 114 GLU A CD    1 
ATOM   513  O OE1   . GLU A 1 67  ? 17.338  -33.734 29.976  1.00 123.85 ? 114 GLU A OE1   1 
ATOM   514  O OE2   . GLU A 1 67  ? 17.236  -33.286 32.128  1.00 111.04 ? 114 GLU A OE2   1 
ATOM   515  N N     . THR A 1 68  ? 22.478  -32.020 27.477  1.00 114.50 ? 115 THR A N     1 
ATOM   516  C CA    . THR A 1 68  ? 23.335  -32.399 26.343  1.00 117.59 ? 115 THR A CA    1 
ATOM   517  C C     . THR A 1 68  ? 24.807  -32.252 26.735  1.00 126.65 ? 115 THR A C     1 
ATOM   518  O O     . THR A 1 68  ? 25.636  -33.058 26.300  1.00 130.83 ? 115 THR A O     1 
ATOM   519  C CB    . THR A 1 68  ? 23.046  -31.607 25.051  1.00 118.65 ? 115 THR A CB    1 
ATOM   520  O OG1   . THR A 1 68  ? 23.483  -30.258 25.206  1.00 118.08 ? 115 THR A OG1   1 
ATOM   521  C CG2   . THR A 1 68  ? 21.587  -31.704 24.575  1.00 110.28 ? 115 THR A CG2   1 
ATOM   522  N N     . ASP A 1 69  ? 25.120  -31.219 27.560  1.00 122.16 ? 116 ASP A N     1 
ATOM   523  C CA    . ASP A 1 69  ? 26.460  -30.933 28.074  1.00 124.87 ? 116 ASP A CA    1 
ATOM   524  C C     . ASP A 1 69  ? 26.943  -32.026 29.027  1.00 133.91 ? 116 ASP A C     1 
ATOM   525  O O     . ASP A 1 69  ? 28.153  -32.256 29.120  1.00 138.52 ? 116 ASP A O     1 
ATOM   526  C CB    . ASP A 1 69  ? 26.521  -29.550 28.735  1.00 124.29 ? 116 ASP A CB    1 
ATOM   527  C CG    . ASP A 1 69  ? 26.268  -28.380 27.794  1.00 134.40 ? 116 ASP A CG    1 
ATOM   528  O OD1   . ASP A 1 69  ? 26.593  -28.502 26.588  1.00 136.63 ? 116 ASP A OD1   1 
ATOM   529  O OD2   . ASP A 1 69  ? 25.759  -27.331 28.268  1.00 136.47 ? 116 ASP A OD2   1 
ATOM   530  N N     . GLY A 1 70  ? 26.006  -32.719 29.679  1.00 129.61 ? 117 GLY A N     1 
ATOM   531  C CA    . GLY A 1 70  ? 26.327  -33.841 30.553  1.00 133.50 ? 117 GLY A CA    1 
ATOM   532  C C     . GLY A 1 70  ? 25.543  -33.972 31.836  1.00 137.16 ? 117 GLY A C     1 
ATOM   533  O O     . GLY A 1 70  ? 25.782  -34.902 32.607  1.00 140.35 ? 117 GLY A O     1 
ATOM   534  N N     . CYS A 1 71  ? 24.613  -33.056 32.084  1.00 130.46 ? 118 CYS A N     1 
ATOM   535  C CA    . CYS A 1 71  ? 23.817  -33.080 33.305  1.00 129.23 ? 118 CYS A CA    1 
ATOM   536  C C     . CYS A 1 71  ? 22.738  -34.152 33.294  1.00 131.69 ? 118 CYS A C     1 
ATOM   537  O O     . CYS A 1 71  ? 22.165  -34.450 32.246  1.00 130.26 ? 118 CYS A O     1 
ATOM   538  C CB    . CYS A 1 71  ? 23.233  -31.702 33.604  1.00 125.56 ? 118 CYS A CB    1 
ATOM   539  S SG    . CYS A 1 71  ? 24.473  -30.384 33.731  1.00 130.18 ? 118 CYS A SG    1 
ATOM   540  N N     . SER A 1 72  ? 22.472  -34.731 34.470  1.00 128.48 ? 119 SER A N     1 
ATOM   541  C CA    . SER A 1 72  ? 21.406  -35.704 34.660  1.00 128.26 ? 119 SER A CA    1 
ATOM   542  C C     . SER A 1 72  ? 20.125  -34.897 34.906  1.00 127.53 ? 119 SER A C     1 
ATOM   543  O O     . SER A 1 72  ? 20.220  -33.686 35.115  1.00 125.14 ? 119 SER A O     1 
ATOM   544  C CB    . SER A 1 72  ? 21.709  -36.587 35.868  1.00 135.64 ? 119 SER A CB    1 
ATOM   545  O OG    . SER A 1 72  ? 21.727  -35.854 37.082  1.00 144.32 ? 119 SER A OG    1 
ATOM   546  N N     . GLU A 1 73  ? 18.941  -35.548 34.918  1.00 122.76 ? 120 GLU A N     1 
ATOM   547  C CA    . GLU A 1 73  ? 17.670  -34.868 35.195  1.00 118.65 ? 120 GLU A CA    1 
ATOM   548  C C     . GLU A 1 73  ? 17.715  -34.219 36.578  1.00 120.43 ? 120 GLU A C     1 
ATOM   549  O O     . GLU A 1 73  ? 17.142  -33.142 36.777  1.00 116.73 ? 120 GLU A O     1 
ATOM   550  C CB    . GLU A 1 73  ? 16.483  -35.841 35.094  1.00 120.99 ? 120 GLU A CB    1 
ATOM   551  C CG    . GLU A 1 73  ? 15.959  -36.040 33.678  1.00 136.21 ? 120 GLU A CG    1 
ATOM   552  C CD    . GLU A 1 73  ? 14.838  -37.054 33.515  1.00 161.55 ? 120 GLU A CD    1 
ATOM   553  O OE1   . GLU A 1 73  ? 15.089  -38.267 33.709  1.00 153.28 ? 120 GLU A OE1   1 
ATOM   554  O OE2   . GLU A 1 73  ? 13.717  -36.635 33.143  1.00 155.93 ? 120 GLU A OE2   1 
ATOM   555  N N     . GLN A 1 74  ? 18.440  -34.867 37.515  1.00 119.41 ? 121 GLN A N     1 
ATOM   556  C CA    . GLN A 1 74  ? 18.645  -34.424 38.894  1.00 119.02 ? 121 GLN A CA    1 
ATOM   557  C C     . GLN A 1 74  ? 19.416  -33.101 38.907  1.00 119.96 ? 121 GLN A C     1 
ATOM   558  O O     . GLN A 1 74  ? 19.013  -32.148 39.582  1.00 116.23 ? 121 GLN A O     1 
ATOM   559  C CB    . GLN A 1 74  ? 19.399  -35.512 39.680  1.00 125.12 ? 121 GLN A CB    1 
ATOM   560  C CG    . GLN A 1 74  ? 18.906  -35.695 41.114  1.00 146.53 ? 121 GLN A CG    1 
ATOM   561  C CD    . GLN A 1 74  ? 19.034  -37.129 41.592  1.00 176.71 ? 121 GLN A CD    1 
ATOM   562  O OE1   . GLN A 1 74  ? 20.125  -37.614 41.937  1.00 178.70 ? 121 GLN A OE1   1 
ATOM   563  N NE2   . GLN A 1 74  ? 17.910  -37.834 41.646  1.00 165.29 ? 121 GLN A NE2   1 
ATOM   564  N N     . GLU A 1 75  ? 20.494  -33.048 38.108  1.00 117.25 ? 122 GLU A N     1 
ATOM   565  C CA    . GLU A 1 75  ? 21.384  -31.903 37.952  1.00 115.88 ? 122 GLU A CA    1 
ATOM   566  C C     . GLU A 1 75  ? 20.739  -30.725 37.208  1.00 114.92 ? 122 GLU A C     1 
ATOM   567  O O     . GLU A 1 75  ? 21.045  -29.579 37.525  1.00 114.38 ? 122 GLU A O     1 
ATOM   568  C CB    . GLU A 1 75  ? 22.675  -32.340 37.236  1.00 120.59 ? 122 GLU A CB    1 
ATOM   569  C CG    . GLU A 1 75  ? 23.534  -33.299 38.049  1.00 134.60 ? 122 GLU A CG    1 
ATOM   570  C CD    . GLU A 1 75  ? 24.737  -33.899 37.345  1.00 150.57 ? 122 GLU A CD    1 
ATOM   571  O OE1   . GLU A 1 75  ? 25.863  -33.732 37.866  1.00 143.89 ? 122 GLU A OE1   1 
ATOM   572  O OE2   . GLU A 1 75  ? 24.555  -34.567 36.300  1.00 136.80 ? 122 GLU A OE2   1 
ATOM   573  N N     . SER A 1 76  ? 19.876  -30.999 36.208  1.00 107.96 ? 123 SER A N     1 
ATOM   574  C CA    . SER A 1 76  ? 19.228  -29.980 35.372  1.00 103.41 ? 123 SER A CA    1 
ATOM   575  C C     . SER A 1 76  ? 17.953  -29.339 36.005  1.00 103.50 ? 123 SER A C     1 
ATOM   576  O O     . SER A 1 76  ? 17.458  -28.305 35.527  1.00 100.08 ? 123 SER A O     1 
ATOM   577  C CB    . SER A 1 76  ? 18.937  -30.550 33.982  1.00 106.40 ? 123 SER A CB    1 
ATOM   578  O OG    . SER A 1 76  ? 17.796  -31.396 33.966  1.00 113.31 ? 123 SER A OG    1 
ATOM   579  N N     . GLN A 1 77  ? 17.446  -29.959 37.081  1.00 99.18  ? 124 GLN A N     1 
ATOM   580  C CA    . GLN A 1 77  ? 16.256  -29.539 37.788  1.00 94.95  ? 124 GLN A CA    1 
ATOM   581  C C     . GLN A 1 77  ? 16.485  -28.272 38.590  1.00 96.05  ? 124 GLN A C     1 
ATOM   582  O O     . GLN A 1 77  ? 17.332  -28.276 39.489  1.00 95.29  ? 124 GLN A O     1 
ATOM   583  C CB    . GLN A 1 77  ? 15.754  -30.687 38.687  1.00 97.99  ? 124 GLN A CB    1 
ATOM   584  C CG    . GLN A 1 77  ? 14.596  -30.338 39.635  1.00 104.76 ? 124 GLN A CG    1 
ATOM   585  C CD    . GLN A 1 77  ? 13.307  -29.952 38.953  1.00 116.50 ? 124 GLN A CD    1 
ATOM   586  O OE1   . GLN A 1 77  ? 12.778  -30.674 38.099  1.00 111.52 ? 124 GLN A OE1   1 
ATOM   587  N NE2   . GLN A 1 77  ? 12.746  -28.825 39.367  1.00 104.64 ? 124 GLN A NE2   1 
ATOM   588  N N     . PRO A 1 78  ? 15.707  -27.183 38.314  1.00 90.88  ? 125 PRO A N     1 
ATOM   589  C CA    . PRO A 1 78  ? 15.842  -25.955 39.123  1.00 89.44  ? 125 PRO A CA    1 
ATOM   590  C C     . PRO A 1 78  ? 15.386  -26.214 40.555  1.00 93.76  ? 125 PRO A C     1 
ATOM   591  O O     . PRO A 1 78  ? 14.539  -27.089 40.788  1.00 93.99  ? 125 PRO A O     1 
ATOM   592  C CB    . PRO A 1 78  ? 14.906  -24.950 38.424  1.00 87.20  ? 125 PRO A CB    1 
ATOM   593  C CG    . PRO A 1 78  ? 14.668  -25.507 37.065  1.00 91.12  ? 125 PRO A CG    1 
ATOM   594  C CD    . PRO A 1 78  ? 14.683  -27.002 37.269  1.00 89.61  ? 125 PRO A CD    1 
ATOM   595  N N     . CYS A 1 79  ? 16.002  -25.499 41.509  1.00 89.87  ? 126 CYS A N     1 
ATOM   596  C CA    . CYS A 1 79  ? 15.699  -25.588 42.935  1.00 90.83  ? 126 CYS A CA    1 
ATOM   597  C C     . CYS A 1 79  ? 15.414  -24.204 43.435  1.00 94.31  ? 126 CYS A C     1 
ATOM   598  O O     . CYS A 1 79  ? 16.039  -23.232 43.010  1.00 93.78  ? 126 CYS A O     1 
ATOM   599  C CB    . CYS A 1 79  ? 16.833  -26.227 43.726  1.00 95.20  ? 126 CYS A CB    1 
ATOM   600  S SG    . CYS A 1 79  ? 17.562  -27.682 42.941  1.00 102.25 ? 126 CYS A SG    1 
ATOM   601  N N     . ALA A 1 80  ? 14.468  -24.120 44.345  1.00 90.78  ? 127 ALA A N     1 
ATOM   602  C CA    . ALA A 1 80  ? 14.064  -22.873 44.930  1.00 89.14  ? 127 ALA A CA    1 
ATOM   603  C C     . ALA A 1 80  ? 14.008  -23.069 46.416  1.00 96.79  ? 127 ALA A C     1 
ATOM   604  O O     . ALA A 1 80  ? 13.795  -24.188 46.909  1.00 98.06  ? 127 ALA A O     1 
ATOM   605  C CB    . ALA A 1 80  ? 12.703  -22.473 44.409  1.00 86.48  ? 127 ALA A CB    1 
ATOM   606  N N     . PHE A 1 81  ? 14.261  -21.974 47.130  1.00 93.30  ? 128 PHE A N     1 
ATOM   607  C CA    . PHE A 1 81  ? 14.211  -21.886 48.577  1.00 93.95  ? 128 PHE A CA    1 
ATOM   608  C C     . PHE A 1 81  ? 13.601  -20.547 48.871  1.00 95.75  ? 128 PHE A C     1 
ATOM   609  O O     . PHE A 1 81  ? 13.883  -19.582 48.163  1.00 95.39  ? 128 PHE A O     1 
ATOM   610  C CB    . PHE A 1 81  ? 15.600  -22.001 49.183  1.00 98.61  ? 128 PHE A CB    1 
ATOM   611  C CG    . PHE A 1 81  ? 16.052  -23.423 49.356  1.00 102.25 ? 128 PHE A CG    1 
ATOM   612  C CD1   . PHE A 1 81  ? 16.608  -24.128 48.293  1.00 104.83 ? 128 PHE A CD1   1 
ATOM   613  C CD2   . PHE A 1 81  ? 16.003  -24.037 50.601  1.00 106.41 ? 128 PHE A CD2   1 
ATOM   614  C CE1   . PHE A 1 81  ? 17.037  -25.450 48.460  1.00 107.87 ? 128 PHE A CE1   1 
ATOM   615  C CE2   . PHE A 1 81  ? 16.460  -25.347 50.771  1.00 110.92 ? 128 PHE A CE2   1 
ATOM   616  C CZ    . PHE A 1 81  ? 16.964  -26.047 49.696  1.00 108.77 ? 128 PHE A CZ    1 
ATOM   617  N N     . ILE A 1 82  ? 12.739  -20.490 49.877  1.00 90.34  ? 129 ILE A N     1 
ATOM   618  C CA    . ILE A 1 82  ? 12.040  -19.268 50.223  1.00 88.34  ? 129 ILE A CA    1 
ATOM   619  C C     . ILE A 1 82  ? 12.328  -18.799 51.661  1.00 94.36  ? 129 ILE A C     1 
ATOM   620  O O     . ILE A 1 82  ? 12.526  -19.616 52.569  1.00 94.78  ? 129 ILE A O     1 
ATOM   621  C CB    . ILE A 1 82  ? 10.517  -19.438 49.903  1.00 88.55  ? 129 ILE A CB    1 
ATOM   622  C CG1   . ILE A 1 82  ? 9.752   -18.091 49.881  1.00 85.37  ? 129 ILE A CG1   1 
ATOM   623  C CG2   . ILE A 1 82  ? 9.830   -20.486 50.813  1.00 91.74  ? 129 ILE A CG2   1 
ATOM   624  C CD1   . ILE A 1 82  ? 9.178   -17.788 48.647  1.00 74.04  ? 129 ILE A CD1   1 
ATOM   625  N N     . GLY A 1 83  ? 12.302  -17.485 51.848  1.00 90.88  ? 130 GLY A N     1 
ATOM   626  C CA    . GLY A 1 83  ? 12.493  -16.887 53.155  1.00 93.72  ? 130 GLY A CA    1 
ATOM   627  C C     . GLY A 1 83  ? 12.085  -15.441 53.190  1.00 98.36  ? 130 GLY A C     1 
ATOM   628  O O     . GLY A 1 83  ? 11.616  -14.908 52.190  1.00 95.38  ? 130 GLY A O     1 
ATOM   629  N N     . ILE A 1 84  ? 12.273  -14.806 54.352  1.00 99.89  ? 131 ILE A N     1 
ATOM   630  C CA    . ILE A 1 84  ? 11.991  -13.389 54.597  1.00 100.74 ? 131 ILE A CA    1 
ATOM   631  C C     . ILE A 1 84  ? 13.324  -12.580 54.696  1.00 114.09 ? 131 ILE A C     1 
ATOM   632  O O     . ILE A 1 84  ? 14.373  -13.191 54.917  1.00 115.68 ? 131 ILE A O     1 
ATOM   633  C CB    . ILE A 1 84  ? 10.935  -13.194 55.711  1.00 103.08 ? 131 ILE A CB    1 
ATOM   634  C CG1   . ILE A 1 84  ? 11.480  -13.522 57.085  1.00 106.61 ? 131 ILE A CG1   1 
ATOM   635  C CG2   . ILE A 1 84  ? 9.709   -14.064 55.411  1.00 100.98 ? 131 ILE A CG2   1 
ATOM   636  C CD1   . ILE A 1 84  ? 10.498  -13.306 58.192  1.00 111.06 ? 131 ILE A CD1   1 
ATOM   637  N N     . GLY A 1 85  ? 13.287  -11.273 54.413  1.00 116.49 ? 132 GLY A N     1 
ATOM   638  C CA    . GLY A 1 85  ? 14.485  -10.437 54.294  1.00 122.54 ? 132 GLY A CA    1 
ATOM   639  C C     . GLY A 1 85  ? 15.125  -9.767  55.513  1.00 139.43 ? 132 GLY A C     1 
ATOM   640  O O     . GLY A 1 85  ? 14.807  -8.607  55.796  1.00 140.20 ? 132 GLY A O     1 
ATOM   641  N N     . ASN A 1 86  ? 16.105  -10.413 56.210  1.00 144.32 ? 133 ASN A N     1 
ATOM   642  C CA    . ASN A 1 86  ? 16.613  -11.764 55.946  1.00 146.12 ? 133 ASN A CA    1 
ATOM   643  C C     . ASN A 1 86  ? 16.565  -12.728 57.158  1.00 155.24 ? 133 ASN A C     1 
ATOM   644  O O     . ASN A 1 86  ? 16.761  -13.938 56.981  1.00 155.56 ? 133 ASN A O     1 
ATOM   645  C CB    . ASN A 1 86  ? 18.010  -11.712 55.305  1.00 151.50 ? 133 ASN A CB    1 
ATOM   646  C CG    . ASN A 1 86  ? 18.405  -12.978 54.573  1.00 179.47 ? 133 ASN A CG    1 
ATOM   647  O OD1   . ASN A 1 86  ? 17.638  -13.535 53.757  1.00 170.56 ? 133 ASN A OD1   1 
ATOM   648  N ND2   . ASN A 1 86  ? 19.611  -13.468 54.865  1.00 172.39 ? 133 ASN A ND2   1 
ATOM   649  N N     . SER A 1 87  ? 16.271  -12.202 58.374  1.00 154.76 ? 134 SER A N     1 
ATOM   650  C CA    . SER A 1 87  ? 16.219  -12.978 59.624  1.00 157.74 ? 134 SER A CA    1 
ATOM   651  C C     . SER A 1 87  ? 17.576  -13.685 59.919  1.00 167.76 ? 134 SER A C     1 
ATOM   652  O O     . SER A 1 87  ? 18.629  -13.144 59.556  1.00 168.91 ? 134 SER A O     1 
ATOM   653  C CB    . SER A 1 87  ? 15.034  -13.948 59.629  1.00 156.33 ? 134 SER A CB    1 
ATOM   654  O OG    . SER A 1 87  ? 13.804  -13.254 59.746  1.00 157.48 ? 134 SER A OG    1 
ATOM   655  N N     . ASP A 1 88  ? 17.552  -14.867 60.583  1.00 167.33 ? 135 ASP A N     1 
ATOM   656  C CA    . ASP A 1 88  ? 18.767  -15.627 60.897  1.00 171.38 ? 135 ASP A CA    1 
ATOM   657  C C     . ASP A 1 88  ? 19.035  -16.794 59.910  1.00 172.89 ? 135 ASP A C     1 
ATOM   658  O O     . ASP A 1 88  ? 19.729  -17.758 60.260  1.00 175.79 ? 135 ASP A O     1 
ATOM   659  C CB    . ASP A 1 88  ? 18.814  -16.043 62.380  1.00 177.75 ? 135 ASP A CB    1 
ATOM   660  C CG    . ASP A 1 88  ? 19.626  -15.095 63.250  1.00 194.04 ? 135 ASP A CG    1 
ATOM   661  O OD1   . ASP A 1 88  ? 19.113  -14.002 63.578  1.00 194.41 ? 135 ASP A OD1   1 
ATOM   662  O OD2   . ASP A 1 88  ? 20.767  -15.454 63.616  1.00 204.30 ? 135 ASP A OD2   1 
ATOM   663  N N     . GLN A 1 89  ? 18.505  -16.661 58.656  1.00 163.48 ? 136 GLN A N     1 
ATOM   664  C CA    . GLN A 1 89  ? 18.653  -17.566 57.499  1.00 160.21 ? 136 GLN A CA    1 
ATOM   665  C C     . GLN A 1 89  ? 17.818  -18.878 57.451  1.00 159.86 ? 136 GLN A C     1 
ATOM   666  O O     . GLN A 1 89  ? 18.231  -19.868 56.823  1.00 160.07 ? 136 GLN A O     1 
ATOM   667  C CB    . GLN A 1 89  ? 20.132  -17.768 57.091  1.00 164.66 ? 136 GLN A CB    1 
ATOM   668  C CG    . GLN A 1 89  ? 20.574  -16.888 55.928  1.00 171.47 ? 136 GLN A CG    1 
ATOM   669  C CD    . GLN A 1 89  ? 19.944  -17.308 54.623  1.00 177.38 ? 136 GLN A CD    1 
ATOM   670  O OE1   . GLN A 1 89  ? 20.211  -18.387 54.078  1.00 167.64 ? 136 GLN A OE1   1 
ATOM   671  N NE2   . GLN A 1 89  ? 19.085  -16.459 54.103  1.00 168.49 ? 136 GLN A NE2   1 
ATOM   672  N N     . GLU A 1 90  ? 16.613  -18.856 58.054  1.00 151.25 ? 137 GLU A N     1 
ATOM   673  C CA    . GLU A 1 90  ? 15.688  -19.992 58.030  1.00 146.99 ? 137 GLU A CA    1 
ATOM   674  C C     . GLU A 1 90  ? 14.961  -19.968 56.669  1.00 139.41 ? 137 GLU A C     1 
ATOM   675  O O     . GLU A 1 90  ? 14.033  -19.180 56.466  1.00 136.07 ? 137 GLU A O     1 
ATOM   676  C CB    . GLU A 1 90  ? 14.697  -19.930 59.213  1.00 148.97 ? 137 GLU A CB    1 
ATOM   677  C CG    . GLU A 1 90  ? 15.329  -20.158 60.581  1.00 165.88 ? 137 GLU A CG    1 
ATOM   678  C CD    . GLU A 1 90  ? 16.162  -19.041 61.194  1.00 189.37 ? 137 GLU A CD    1 
ATOM   679  O OE1   . GLU A 1 90  ? 16.034  -17.874 60.751  1.00 172.78 ? 137 GLU A OE1   1 
ATOM   680  O OE2   . GLU A 1 90  ? 16.936  -19.338 62.135  1.00 186.77 ? 137 GLU A OE2   1 
ATOM   681  N N     . MET A 1 91  ? 15.452  -20.775 55.714  1.00 130.38 ? 138 MET A N     1 
ATOM   682  C CA    . MET A 1 91  ? 14.891  -20.867 54.368  1.00 123.72 ? 138 MET A CA    1 
ATOM   683  C C     . MET A 1 91  ? 14.297  -22.234 54.090  1.00 120.09 ? 138 MET A C     1 
ATOM   684  O O     . MET A 1 91  ? 14.976  -23.248 54.258  1.00 122.08 ? 138 MET A O     1 
ATOM   685  C CB    . MET A 1 91  ? 15.919  -20.492 53.284  1.00 125.91 ? 138 MET A CB    1 
ATOM   686  C CG    . MET A 1 91  ? 16.125  -18.998 53.116  1.00 129.06 ? 138 MET A CG    1 
ATOM   687  S SD    . MET A 1 91  ? 16.609  -18.569 51.417  1.00 131.51 ? 138 MET A SD    1 
ATOM   688  C CE    . MET A 1 91  ? 16.767  -16.761 51.573  1.00 128.49 ? 138 MET A CE    1 
ATOM   689  N N     . GLN A 1 92  ? 13.022  -22.253 53.657  1.00 108.85 ? 139 GLN A N     1 
ATOM   690  C CA    . GLN A 1 92  ? 12.274  -23.463 53.327  1.00 105.59 ? 139 GLN A CA    1 
ATOM   691  C C     . GLN A 1 92  ? 12.415  -23.867 51.878  1.00 103.96 ? 139 GLN A C     1 
ATOM   692  O O     . GLN A 1 92  ? 12.314  -23.034 50.983  1.00 99.64  ? 139 GLN A O     1 
ATOM   693  C CB    . GLN A 1 92  ? 10.801  -23.318 53.697  1.00 104.93 ? 139 GLN A CB    1 
ATOM   694  C CG    . GLN A 1 92  ? 10.530  -23.654 55.151  1.00 117.58 ? 139 GLN A CG    1 
ATOM   695  C CD    . GLN A 1 92  ? 9.915   -22.501 55.891  1.00 127.89 ? 139 GLN A CD    1 
ATOM   696  O OE1   . GLN A 1 92  ? 8.716   -22.496 56.163  1.00 121.18 ? 139 GLN A OE1   1 
ATOM   697  N NE2   . GLN A 1 92  ? 10.719  -21.499 56.233  1.00 118.80 ? 139 GLN A NE2   1 
ATOM   698  N N     . GLN A 1 93  ? 12.652  -25.161 51.648  1.00 101.99 ? 140 GLN A N     1 
ATOM   699  C CA    . GLN A 1 93  ? 12.808  -25.694 50.303  1.00 99.77  ? 140 GLN A CA    1 
ATOM   700  C C     . GLN A 1 93  ? 11.473  -25.848 49.656  1.00 101.14 ? 140 GLN A C     1 
ATOM   701  O O     . GLN A 1 93  ? 10.577  -26.458 50.245  1.00 102.10 ? 140 GLN A O     1 
ATOM   702  C CB    . GLN A 1 93  ? 13.522  -27.053 50.303  1.00 103.33 ? 140 GLN A CB    1 
ATOM   703  C CG    . GLN A 1 93  ? 13.788  -27.538 48.880  1.00 99.75  ? 140 GLN A CG    1 
ATOM   704  C CD    . GLN A 1 93  ? 14.679  -28.738 48.744  1.00 110.95 ? 140 GLN A CD    1 
ATOM   705  O OE1   . GLN A 1 93  ? 15.168  -29.336 49.725  1.00 104.18 ? 140 GLN A OE1   1 
ATOM   706  N NE2   . GLN A 1 93  ? 14.908  -29.105 47.490  1.00 96.75  ? 140 GLN A NE2   1 
ATOM   707  N N     . LEU A 1 94  ? 11.351  -25.326 48.435  1.00 93.96  ? 141 LEU A N     1 
ATOM   708  C CA    . LEU A 1 94  ? 10.151  -25.491 47.644  1.00 91.65  ? 141 LEU A CA    1 
ATOM   709  C C     . LEU A 1 94  ? 10.377  -26.711 46.749  1.00 97.32  ? 141 LEU A C     1 
ATOM   710  O O     . LEU A 1 94  ? 11.482  -26.901 46.209  1.00 97.10  ? 141 LEU A O     1 
ATOM   711  C CB    . LEU A 1 94  ? 9.863   -24.256 46.764  1.00 88.99  ? 141 LEU A CB    1 
ATOM   712  C CG    . LEU A 1 94  ? 9.608   -22.899 47.440  1.00 92.89  ? 141 LEU A CG    1 
ATOM   713  C CD1   . LEU A 1 94  ? 9.473   -21.832 46.413  1.00 89.53  ? 141 LEU A CD1   1 
ATOM   714  C CD2   . LEU A 1 94  ? 8.347   -22.911 48.279  1.00 97.39  ? 141 LEU A CD2   1 
ATOM   715  N N     . ASN A 1 95  ? 9.339   -27.538 46.592  1.00 95.45  ? 142 ASN A N     1 
ATOM   716  C CA    . ASN A 1 95  ? 9.469   -28.676 45.710  1.00 97.54  ? 142 ASN A CA    1 
ATOM   717  C C     . ASN A 1 95  ? 8.772   -28.437 44.381  1.00 101.78 ? 142 ASN A C     1 
ATOM   718  O O     . ASN A 1 95  ? 7.538   -28.528 44.302  1.00 101.35 ? 142 ASN A O     1 
ATOM   719  C CB    . ASN A 1 95  ? 9.066   -30.004 46.364  1.00 100.83 ? 142 ASN A CB    1 
ATOM   720  C CG    . ASN A 1 95  ? 9.407   -31.179 45.468  1.00 127.10 ? 142 ASN A CG    1 
ATOM   721  O OD1   . ASN A 1 95  ? 10.586  -31.544 45.295  1.00 120.92 ? 142 ASN A OD1   1 
ATOM   722  N ND2   . ASN A 1 95  ? 8.396   -31.710 44.779  1.00 117.60 ? 142 ASN A ND2   1 
ATOM   723  N N     . LEU A 1 96  ? 9.573   -28.127 43.337  1.00 99.17  ? 143 LEU A N     1 
ATOM   724  C CA    . LEU A 1 96  ? 9.076   -27.901 41.967  1.00 98.02  ? 143 LEU A CA    1 
ATOM   725  C C     . LEU A 1 96  ? 9.358   -29.141 41.091  1.00 107.83 ? 143 LEU A C     1 
ATOM   726  O O     . LEU A 1 96  ? 9.303   -29.033 39.855  1.00 108.40 ? 143 LEU A O     1 
ATOM   727  C CB    . LEU A 1 96  ? 9.725   -26.669 41.296  1.00 95.49  ? 143 LEU A CB    1 
ATOM   728  C CG    . LEU A 1 96  ? 9.926   -25.408 42.108  1.00 98.20  ? 143 LEU A CG    1 
ATOM   729  C CD1   . LEU A 1 96  ? 11.243  -24.765 41.754  1.00 98.27  ? 143 LEU A CD1   1 
ATOM   730  C CD2   . LEU A 1 96  ? 8.781   -24.456 41.931  1.00 96.50  ? 143 LEU A CD2   1 
ATOM   731  N N     . GLU A 1 97  ? 9.707   -30.292 41.715  1.00 106.69 ? 144 GLU A N     1 
ATOM   732  C CA    . GLU A 1 97  ? 9.995   -31.513 40.967  1.00 109.21 ? 144 GLU A CA    1 
ATOM   733  C C     . GLU A 1 97  ? 8.740   -31.953 40.229  1.00 112.37 ? 144 GLU A C     1 
ATOM   734  O O     . GLU A 1 97  ? 7.748   -32.352 40.860  1.00 113.05 ? 144 GLU A O     1 
ATOM   735  C CB    . GLU A 1 97  ? 10.528  -32.639 41.875  1.00 114.51 ? 144 GLU A CB    1 
ATOM   736  C CG    . GLU A 1 97  ? 12.045  -32.750 41.922  1.00 126.66 ? 144 GLU A CG    1 
ATOM   737  C CD    . GLU A 1 97  ? 12.627  -34.148 41.801  1.00 152.20 ? 144 GLU A CD    1 
ATOM   738  O OE1   . GLU A 1 97  ? 11.854  -35.109 41.575  1.00 149.31 ? 144 GLU A OE1   1 
ATOM   739  O OE2   . GLU A 1 97  ? 13.869  -34.278 41.905  1.00 146.80 ? 144 GLU A OE2   1 
ATOM   740  N N     . GLY A 1 98  ? 8.786   -31.779 38.905  1.00 106.28 ? 145 GLY A N     1 
ATOM   741  C CA    . GLY A 1 98  ? 7.716   -32.117 37.973  1.00 104.69 ? 145 GLY A CA    1 
ATOM   742  C C     . GLY A 1 98  ? 6.579   -31.122 37.909  1.00 104.72 ? 145 GLY A C     1 
ATOM   743  O O     . GLY A 1 98  ? 5.577   -31.386 37.240  1.00 105.38 ? 145 GLY A O     1 
ATOM   744  N N     . LYS A 1 99  ? 6.718   -29.975 38.605  1.00 97.65  ? 146 LYS A N     1 
ATOM   745  C CA    . LYS A 1 99  ? 5.708   -28.913 38.666  1.00 94.28  ? 146 LYS A CA    1 
ATOM   746  C C     . LYS A 1 99  ? 6.301   -27.578 38.194  1.00 94.64  ? 146 LYS A C     1 
ATOM   747  O O     . LYS A 1 99  ? 7.468   -27.274 38.486  1.00 93.28  ? 146 LYS A O     1 
ATOM   748  C CB    . LYS A 1 99  ? 5.197   -28.725 40.103  1.00 96.24  ? 146 LYS A CB    1 
ATOM   749  C CG    . LYS A 1 99  ? 4.818   -29.971 40.892  1.00 104.82 ? 146 LYS A CG    1 
ATOM   750  C CD    . LYS A 1 99  ? 4.701   -29.629 42.389  1.00 116.25 ? 146 LYS A CD    1 
ATOM   751  C CE    . LYS A 1 99  ? 3.402   -28.926 42.755  1.00 123.38 ? 146 LYS A CE    1 
ATOM   752  N NZ    . LYS A 1 99  ? 3.548   -28.090 43.975  1.00 126.25 ? 146 LYS A NZ    1 
ATOM   753  N N     . ASN A 1 100 ? 5.487   -26.762 37.511  1.00 89.03  ? 147 ASN A N     1 
ATOM   754  C CA    . ASN A 1 100 ? 5.935   -25.445 37.030  1.00 86.70  ? 147 ASN A CA    1 
ATOM   755  C C     . ASN A 1 100 ? 5.841   -24.424 38.179  1.00 88.97  ? 147 ASN A C     1 
ATOM   756  O O     . ASN A 1 100 ? 6.305   -23.294 38.035  1.00 88.12  ? 147 ASN A O     1 
ATOM   757  C CB    . ASN A 1 100 ? 5.117   -24.968 35.807  1.00 85.58  ? 147 ASN A CB    1 
ATOM   758  C CG    . ASN A 1 100 ? 4.324   -26.065 35.123  1.00 146.46 ? 147 ASN A CG    1 
ATOM   759  O OD1   . ASN A 1 100 ? 4.884   -26.951 34.455  1.00 150.42 ? 147 ASN A OD1   1 
ATOM   760  N ND2   . ASN A 1 100 ? 3.002   -26.067 35.325  1.00 145.56 ? 147 ASN A ND2   1 
ATOM   761  N N     . TYR A 1 101 ? 5.245   -24.827 39.322  1.00 83.56  ? 148 TYR A N     1 
ATOM   762  C CA    . TYR A 1 101 ? 5.036   -23.942 40.457  1.00 80.87  ? 148 TYR A CA    1 
ATOM   763  C C     . TYR A 1 101 ? 5.008   -24.680 41.763  1.00 82.82  ? 148 TYR A C     1 
ATOM   764  O O     . TYR A 1 101 ? 4.803   -25.883 41.765  1.00 81.89  ? 148 TYR A O     1 
ATOM   765  C CB    . TYR A 1 101 ? 3.703   -23.208 40.277  1.00 80.44  ? 148 TYR A CB    1 
ATOM   766  C CG    . TYR A 1 101 ? 2.487   -24.039 40.606  1.00 83.74  ? 148 TYR A CG    1 
ATOM   767  C CD1   . TYR A 1 101 ? 1.977   -24.959 39.691  1.00 87.65  ? 148 TYR A CD1   1 
ATOM   768  C CD2   . TYR A 1 101 ? 1.817   -23.881 41.814  1.00 84.35  ? 148 TYR A CD2   1 
ATOM   769  C CE1   . TYR A 1 101 ? 0.841   -25.714 39.981  1.00 89.67  ? 148 TYR A CE1   1 
ATOM   770  C CE2   . TYR A 1 101 ? 0.687   -24.636 42.120  1.00 86.59  ? 148 TYR A CE2   1 
ATOM   771  C CZ    . TYR A 1 101 ? 0.199   -25.549 41.198  1.00 101.59 ? 148 TYR A CZ    1 
ATOM   772  O OH    . TYR A 1 101 ? -0.925  -26.294 41.502  1.00 112.88 ? 148 TYR A OH    1 
ATOM   773  N N     . CYS A 1 102 ? 5.107   -23.938 42.879  1.00 79.63  ? 149 CYS A N     1 
ATOM   774  C CA    . CYS A 1 102 ? 5.023   -24.484 44.229  1.00 82.48  ? 149 CYS A CA    1 
ATOM   775  C C     . CYS A 1 102 ? 4.631   -23.416 45.221  1.00 84.73  ? 149 CYS A C     1 
ATOM   776  O O     . CYS A 1 102 ? 5.148   -22.306 45.113  1.00 85.43  ? 149 CYS A O     1 
ATOM   777  C CB    . CYS A 1 102 ? 6.340   -25.133 44.638  1.00 86.23  ? 149 CYS A CB    1 
ATOM   778  S SG    . CYS A 1 102 ? 6.260   -26.003 46.226  1.00 93.45  ? 149 CYS A SG    1 
ATOM   779  N N     . THR A 1 103 ? 3.809   -23.758 46.246  1.00 79.11  ? 150 THR A N     1 
ATOM   780  C CA    . THR A 1 103 ? 3.445   -22.786 47.295  1.00 77.01  ? 150 THR A CA    1 
ATOM   781  C C     . THR A 1 103 ? 4.259   -22.916 48.594  1.00 79.20  ? 150 THR A C     1 
ATOM   782  O O     . THR A 1 103 ? 4.624   -24.021 49.009  1.00 78.10  ? 150 THR A O     1 
ATOM   783  C CB    . THR A 1 103 ? 1.950   -22.755 47.603  1.00 81.08  ? 150 THR A CB    1 
ATOM   784  O OG1   . THR A 1 103 ? 1.560   -24.009 48.161  1.00 83.30  ? 150 THR A OG1   1 
ATOM   785  C CG2   . THR A 1 103 ? 1.103   -22.383 46.397  1.00 74.16  ? 150 THR A CG2   1 
ATOM   786  N N     . ALA A 1 104 ? 4.513   -21.757 49.237  1.00 75.20  ? 151 ALA A N     1 
ATOM   787  C CA    . ALA A 1 104 ? 5.239   -21.622 50.488  1.00 76.30  ? 151 ALA A CA    1 
ATOM   788  C C     . ALA A 1 104 ? 4.193   -21.666 51.619  1.00 80.98  ? 151 ALA A C     1 
ATOM   789  O O     . ALA A 1 104 ? 3.698   -20.648 52.147  1.00 79.95  ? 151 ALA A O     1 
ATOM   790  C CB    . ALA A 1 104 ? 6.028   -20.331 50.477  1.00 76.41  ? 151 ALA A CB    1 
ATOM   791  N N     . LYS A 1 105 ? 3.819   -22.911 51.931  1.00 78.28  ? 152 LYS A N     1 
ATOM   792  C CA    . LYS A 1 105 ? 2.771   -23.283 52.869  1.00 78.55  ? 152 LYS A CA    1 
ATOM   793  C C     . LYS A 1 105 ? 3.069   -23.019 54.341  1.00 86.95  ? 152 LYS A C     1 
ATOM   794  O O     . LYS A 1 105 ? 2.122   -22.863 55.116  1.00 87.74  ? 152 LYS A O     1 
ATOM   795  C CB    . LYS A 1 105 ? 2.422   -24.749 52.661  1.00 80.81  ? 152 LYS A CB    1 
ATOM   796  C CG    . LYS A 1 105 ? 1.602   -25.038 51.413  1.00 86.85  ? 152 LYS A CG    1 
ATOM   797  C CD    . LYS A 1 105 ? 2.249   -26.190 50.620  1.00 96.72  ? 152 LYS A CD    1 
ATOM   798  C CE    . LYS A 1 105 ? 1.300   -26.883 49.673  1.00 115.52 ? 152 LYS A CE    1 
ATOM   799  N NZ    . LYS A 1 105 ? 0.316   -27.766 50.374  1.00 131.85 ? 152 LYS A NZ    1 
ATOM   800  N N     . THR A 1 106 ? 4.364   -22.989 54.738  1.00 86.06  ? 153 THR A N     1 
ATOM   801  C CA    . THR A 1 106 ? 4.780   -22.848 56.146  1.00 88.67  ? 153 THR A CA    1 
ATOM   802  C C     . THR A 1 106 ? 5.612   -21.606 56.522  1.00 93.32  ? 153 THR A C     1 
ATOM   803  O O     . THR A 1 106 ? 6.402   -21.659 57.460  1.00 97.02  ? 153 THR A O     1 
ATOM   804  C CB    . THR A 1 106 ? 5.395   -24.165 56.666  1.00 101.98 ? 153 THR A CB    1 
ATOM   805  O OG1   . THR A 1 106 ? 6.390   -24.626 55.744  1.00 106.63 ? 153 THR A OG1   1 
ATOM   806  C CG2   . THR A 1 106 ? 4.356   -25.245 56.899  1.00 99.95  ? 153 THR A CG2   1 
ATOM   807  N N     . LEU A 1 107 ? 5.380   -20.479 55.862  1.00 87.31  ? 154 LEU A N     1 
ATOM   808  C CA    . LEU A 1 107 ? 6.091   -19.249 56.166  1.00 87.49  ? 154 LEU A CA    1 
ATOM   809  C C     . LEU A 1 107 ? 5.387   -18.442 57.261  1.00 95.54  ? 154 LEU A C     1 
ATOM   810  O O     . LEU A 1 107 ? 4.164   -18.391 57.280  1.00 96.72  ? 154 LEU A O     1 
ATOM   811  C CB    . LEU A 1 107 ? 6.218   -18.390 54.902  1.00 84.28  ? 154 LEU A CB    1 
ATOM   812  C CG    . LEU A 1 107 ? 7.297   -18.758 53.885  1.00 87.64  ? 154 LEU A CG    1 
ATOM   813  C CD1   . LEU A 1 107 ? 7.306   -17.760 52.759  1.00 85.90  ? 154 LEU A CD1   1 
ATOM   814  C CD2   . LEU A 1 107 ? 8.679   -18.812 54.510  1.00 90.25  ? 154 LEU A CD2   1 
ATOM   815  N N     . TYR A 1 108 ? 6.149   -17.777 58.142  1.00 92.98  ? 155 TYR A N     1 
ATOM   816  C CA    . TYR A 1 108 ? 5.587   -16.929 59.195  1.00 93.91  ? 155 TYR A CA    1 
ATOM   817  C C     . TYR A 1 108 ? 6.623   -15.880 59.599  1.00 100.42 ? 155 TYR A C     1 
ATOM   818  O O     . TYR A 1 108 ? 7.808   -16.050 59.275  1.00 101.61 ? 155 TYR A O     1 
ATOM   819  C CB    . TYR A 1 108 ? 5.137   -17.767 60.413  1.00 97.20  ? 155 TYR A CB    1 
ATOM   820  C CG    . TYR A 1 108 ? 6.280   -18.526 61.046  1.00 101.45 ? 155 TYR A CG    1 
ATOM   821  C CD1   . TYR A 1 108 ? 6.754   -19.707 60.480  1.00 104.17 ? 155 TYR A CD1   1 
ATOM   822  C CD2   . TYR A 1 108 ? 6.936   -18.029 62.169  1.00 104.11 ? 155 TYR A CD2   1 
ATOM   823  C CE1   . TYR A 1 108 ? 7.856   -20.371 61.013  1.00 109.93 ? 155 TYR A CE1   1 
ATOM   824  C CE2   . TYR A 1 108 ? 8.037   -18.686 62.713  1.00 107.64 ? 155 TYR A CE2   1 
ATOM   825  C CZ    . TYR A 1 108 ? 8.485   -19.867 62.142  1.00 117.29 ? 155 TYR A CZ    1 
ATOM   826  O OH    . TYR A 1 108 ? 9.549   -20.552 62.684  1.00 121.28 ? 155 TYR A OH    1 
ATOM   827  N N     . ILE A 1 109 ? 6.182   -14.814 60.326  1.00 96.36  ? 156 ILE A N     1 
ATOM   828  C CA    . ILE A 1 109 ? 7.033   -13.720 60.834  1.00 96.86  ? 156 ILE A CA    1 
ATOM   829  C C     . ILE A 1 109 ? 6.818   -13.499 62.352  1.00 103.03 ? 156 ILE A C     1 
ATOM   830  O O     . ILE A 1 109 ? 5.686   -13.281 62.782  1.00 101.91 ? 156 ILE A O     1 
ATOM   831  C CB    . ILE A 1 109 ? 6.900   -12.427 59.960  1.00 96.90  ? 156 ILE A CB    1 
ATOM   832  C CG1   . ILE A 1 109 ? 8.051   -11.461 60.204  1.00 99.79  ? 156 ILE A CG1   1 
ATOM   833  C CG2   . ILE A 1 109 ? 5.525   -11.736 60.058  1.00 94.84  ? 156 ILE A CG2   1 
ATOM   834  C CD1   . ILE A 1 109 ? 8.310   -10.526 59.058  1.00 105.80 ? 156 ILE A CD1   1 
ATOM   835  N N     . SER A 1 110 ? 7.886   -13.594 63.162  1.00 103.26 ? 157 SER A N     1 
ATOM   836  C CA    . SER A 1 110 ? 7.763   -13.417 64.617  1.00 106.98 ? 157 SER A CA    1 
ATOM   837  C C     . SER A 1 110 ? 7.940   -11.957 65.123  1.00 115.51 ? 157 SER A C     1 
ATOM   838  O O     . SER A 1 110 ? 8.516   -11.125 64.417  1.00 113.96 ? 157 SER A O     1 
ATOM   839  C CB    . SER A 1 110 ? 8.691   -14.374 65.353  1.00 111.96 ? 157 SER A CB    1 
ATOM   840  O OG    . SER A 1 110 ? 8.650   -14.134 66.750  1.00 123.83 ? 157 SER A OG    1 
ATOM   841  N N     . ASP A 1 111 ? 7.446   -11.664 66.361  1.00 117.25 ? 158 ASP A N     1 
ATOM   842  C CA    . ASP A 1 111 ? 7.555   -10.357 67.035  1.00 120.94 ? 158 ASP A CA    1 
ATOM   843  C C     . ASP A 1 111 ? 9.004   -9.921  67.131  1.00 130.56 ? 158 ASP A C     1 
ATOM   844  O O     . ASP A 1 111 ? 9.284   -8.721  67.078  1.00 132.62 ? 158 ASP A O     1 
ATOM   845  C CB    . ASP A 1 111 ? 6.928   -10.377 68.440  1.00 126.61 ? 158 ASP A CB    1 
ATOM   846  C CG    . ASP A 1 111 ? 7.507   -11.367 69.451  1.00 149.86 ? 158 ASP A CG    1 
ATOM   847  O OD1   . ASP A 1 111 ? 8.116   -12.383 69.021  1.00 151.91 ? 158 ASP A OD1   1 
ATOM   848  O OD2   . ASP A 1 111 ? 7.286   -11.168 70.671  1.00 160.18 ? 158 ASP A OD2   1 
ATOM   849  N N     . SER A 1 112 ? 9.924   -10.915 67.231  1.00 128.79 ? 159 SER A N     1 
ATOM   850  C CA    . SER A 1 112 ? 11.384  -10.767 67.267  1.00 131.18 ? 159 SER A CA    1 
ATOM   851  C C     . SER A 1 112 ? 11.835  -9.933  66.070  1.00 131.33 ? 159 SER A C     1 
ATOM   852  O O     . SER A 1 112 ? 12.769  -9.139  66.194  1.00 133.74 ? 159 SER A O     1 
ATOM   853  C CB    . SER A 1 112 ? 12.071  -12.131 67.247  1.00 135.48 ? 159 SER A CB    1 
ATOM   854  O OG    . SER A 1 112 ? 11.165  -13.222 67.171  1.00 140.36 ? 159 SER A OG    1 
ATOM   855  N N     . ASP A 1 113 ? 11.126  -10.065 64.934  1.00 121.53 ? 160 ASP A N     1 
ATOM   856  C CA    . ASP A 1 113 ? 11.405  -9.241  63.771  1.00 118.86 ? 160 ASP A CA    1 
ATOM   857  C C     . ASP A 1 113 ? 10.830  -7.828  63.984  1.00 123.47 ? 160 ASP A C     1 
ATOM   858  O O     . ASP A 1 113 ? 9.620   -7.667  64.167  1.00 122.03 ? 160 ASP A O     1 
ATOM   859  C CB    . ASP A 1 113 ? 10.867  -9.874  62.485  1.00 115.02 ? 160 ASP A CB    1 
ATOM   860  C CG    . ASP A 1 113 ? 11.759  -9.550  61.319  1.00 116.24 ? 160 ASP A CG    1 
ATOM   861  O OD1   . ASP A 1 113 ? 11.933  -8.343  61.024  1.00 114.57 ? 160 ASP A OD1   1 
ATOM   862  O OD2   . ASP A 1 113 ? 12.355  -10.491 60.753  1.00 119.90 ? 160 ASP A OD2   1 
ATOM   863  N N     . LYS A 1 114 ? 11.704  -6.814  63.993  1.00 121.98 ? 161 LYS A N     1 
ATOM   864  C CA    . LYS A 1 114 ? 11.267  -5.438  64.236  1.00 122.76 ? 161 LYS A CA    1 
ATOM   865  C C     . LYS A 1 114 ? 10.905  -4.627  62.993  1.00 124.17 ? 161 LYS A C     1 
ATOM   866  O O     . LYS A 1 114 ? 10.324  -3.543  63.133  1.00 124.05 ? 161 LYS A O     1 
ATOM   867  C CB    . LYS A 1 114 ? 12.197  -4.689  65.219  1.00 129.43 ? 161 LYS A CB    1 
ATOM   868  C CG    . LYS A 1 114 ? 12.278  -5.322  66.619  1.00 132.77 ? 161 LYS A CG    1 
ATOM   869  C CD    . LYS A 1 114 ? 10.899  -5.541  67.270  1.00 137.40 ? 161 LYS A CD    1 
ATOM   870  C CE    . LYS A 1 114 ? 10.960  -6.281  68.587  1.00 141.53 ? 161 LYS A CE    1 
ATOM   871  N NZ    . LYS A 1 114 ? 9.600   -6.645  69.073  1.00 139.38 ? 161 LYS A NZ    1 
ATOM   872  N N     . ARG A 1 115 ? 11.184  -5.187  61.783  1.00 117.73 ? 162 ARG A N     1 
ATOM   873  C CA    . ARG A 1 115 ? 10.902  -4.579  60.472  1.00 113.77 ? 162 ARG A CA    1 
ATOM   874  C C     . ARG A 1 115 ? 9.425   -4.278  60.331  1.00 115.22 ? 162 ARG A C     1 
ATOM   875  O O     . ARG A 1 115 ? 8.595   -5.140  60.639  1.00 112.78 ? 162 ARG A O     1 
ATOM   876  C CB    . ARG A 1 115 ? 11.295  -5.528  59.331  1.00 109.74 ? 162 ARG A CB    1 
ATOM   877  C CG    . ARG A 1 115 ? 12.787  -5.662  59.068  1.00 117.55 ? 162 ARG A CG    1 
ATOM   878  C CD    . ARG A 1 115 ? 13.057  -6.706  57.996  1.00 114.60 ? 162 ARG A CD    1 
ATOM   879  N NE    . ARG A 1 115 ? 12.773  -8.053  58.492  1.00 119.39 ? 162 ARG A NE    1 
ATOM   880  C CZ    . ARG A 1 115 ? 12.426  -9.087  57.734  1.00 126.23 ? 162 ARG A CZ    1 
ATOM   881  N NH1   . ARG A 1 115 ? 12.333  -8.956  56.421  1.00 115.10 ? 162 ARG A NH1   1 
ATOM   882  N NH2   . ARG A 1 115 ? 12.188  -10.267 58.284  1.00 109.81 ? 162 ARG A NH2   1 
ATOM   883  N N     . LYS A 1 116 ? 9.097   -3.051  59.881  1.00 112.28 ? 163 LYS A N     1 
ATOM   884  C CA    . LYS A 1 116 ? 7.709   -2.633  59.645  1.00 109.93 ? 163 LYS A CA    1 
ATOM   885  C C     . LYS A 1 116 ? 7.183   -3.233  58.312  1.00 106.96 ? 163 LYS A C     1 
ATOM   886  O O     . LYS A 1 116 ? 5.996   -3.571  58.204  1.00 103.77 ? 163 LYS A O     1 
ATOM   887  C CB    . LYS A 1 116 ? 7.591   -1.103  59.715  1.00 114.68 ? 163 LYS A CB    1 
ATOM   888  C CG    . LYS A 1 116 ? 6.749   -0.586  60.899  1.00 131.88 ? 163 LYS A CG    1 
ATOM   889  C CD    . LYS A 1 116 ? 7.272   -0.976  62.289  1.00 143.40 ? 163 LYS A CD    1 
ATOM   890  C CE    . LYS A 1 116 ? 6.406   -0.416  63.390  1.00 152.60 ? 163 LYS A CE    1 
ATOM   891  N NZ    . LYS A 1 116 ? 6.652   -1.102  64.686  1.00 161.14 ? 163 LYS A NZ    1 
ATOM   892  N N     . HIS A 1 117 ? 8.112   -3.378  57.333  1.00 100.64 ? 164 HIS A N     1 
ATOM   893  C CA    A HIS A 1 117 ? 7.878   -3.959  56.014  0.41 95.60  ? 164 HIS A CA    1 
ATOM   894  C CA    B HIS A 1 117 ? 7.896   -3.950  56.001  0.59 96.78  ? 164 HIS A CA    1 
ATOM   895  C C     . HIS A 1 117 ? 8.979   -5.003  55.740  1.00 99.15  ? 164 HIS A C     1 
ATOM   896  O O     . HIS A 1 117 ? 9.995   -5.013  56.431  1.00 102.58 ? 164 HIS A O     1 
ATOM   897  C CB    A HIS A 1 117 ? 7.882   -2.859  54.931  0.41 94.83  ? 164 HIS A CB    1 
ATOM   898  C CB    B HIS A 1 117 ? 7.924   -2.851  54.906  0.59 97.17  ? 164 HIS A CB    1 
ATOM   899  C CG    A HIS A 1 117 ? 6.970   -1.706  55.226  0.41 98.58  ? 164 HIS A CG    1 
ATOM   900  C CG    B HIS A 1 117 ? 9.271   -2.615  54.274  0.59 101.68 ? 164 HIS A CG    1 
ATOM   901  N ND1   A HIS A 1 117 ? 5.691   -1.646  54.704  0.41 97.71  ? 164 HIS A ND1   1 
ATOM   902  N ND1   B HIS A 1 117 ? 10.117  -1.605  54.726  0.59 106.97 ? 164 HIS A ND1   1 
ATOM   903  C CD2   A HIS A 1 117 ? 7.178   -0.615  55.998  0.41 103.01 ? 164 HIS A CD2   1 
ATOM   904  C CD2   B HIS A 1 117 ? 9.870   -3.256  53.237  0.59 101.38 ? 164 HIS A CD2   1 
ATOM   905  C CE1   A HIS A 1 117 ? 5.166   -0.526  55.173  0.41 98.86  ? 164 HIS A CE1   1 
ATOM   906  C CE1   B HIS A 1 117 ? 11.202  -1.685  53.971  0.59 106.47 ? 164 HIS A CE1   1 
ATOM   907  N NE2   A HIS A 1 117 ? 6.023   0.125   55.959  0.41 102.50 ? 164 HIS A NE2   1 
ATOM   908  N NE2   B HIS A 1 117 ? 11.098  -2.662  53.058  0.59 103.58 ? 164 HIS A NE2   1 
ATOM   909  N N     . PHE A 1 118 ? 8.784   -5.875  54.731  1.00 90.35  ? 165 PHE A N     1 
ATOM   910  C CA    . PHE A 1 118 ? 9.745   -6.918  54.329  1.00 87.71  ? 165 PHE A CA    1 
ATOM   911  C C     . PHE A 1 118 ? 9.421   -7.478  52.892  1.00 89.46  ? 165 PHE A C     1 
ATOM   912  O O     . PHE A 1 118 ? 8.362   -7.192  52.319  1.00 84.79  ? 165 PHE A O     1 
ATOM   913  C CB    . PHE A 1 118 ? 9.820   -8.030  55.391  1.00 89.26  ? 165 PHE A CB    1 
ATOM   914  C CG    . PHE A 1 118 ? 8.718   -9.052  55.324  1.00 87.76  ? 165 PHE A CG    1 
ATOM   915  C CD1   . PHE A 1 118 ? 7.481   -8.801  55.899  1.00 90.08  ? 165 PHE A CD1   1 
ATOM   916  C CD2   . PHE A 1 118 ? 8.901   -10.252 54.645  1.00 87.62  ? 165 PHE A CD2   1 
ATOM   917  C CE1   . PHE A 1 118 ? 6.446   -9.732  55.797  1.00 88.96  ? 165 PHE A CE1   1 
ATOM   918  C CE2   . PHE A 1 118 ? 7.854   -11.161 54.511  1.00 88.06  ? 165 PHE A CE2   1 
ATOM   919  C CZ    . PHE A 1 118 ? 6.639   -10.902 55.098  1.00 85.94  ? 165 PHE A CZ    1 
ATOM   920  N N     . MET A 1 119 ? 10.346  -8.264  52.334  1.00 88.21  ? 166 MET A N     1 
ATOM   921  C CA    . MET A 1 119 ? 10.194  -8.904  51.032  1.00 86.15  ? 166 MET A CA    1 
ATOM   922  C C     . MET A 1 119 ? 10.551  -10.372 51.121  1.00 91.59  ? 166 MET A C     1 
ATOM   923  O O     . MET A 1 119 ? 11.454  -10.751 51.857  1.00 94.69  ? 166 MET A O     1 
ATOM   924  C CB    . MET A 1 119 ? 11.124  -8.264  50.011  1.00 88.94  ? 166 MET A CB    1 
ATOM   925  C CG    . MET A 1 119 ? 10.694  -6.919  49.569  1.00 93.57  ? 166 MET A CG    1 
ATOM   926  S SD    . MET A 1 119 ? 11.940  -6.296  48.434  1.00 100.08 ? 166 MET A SD    1 
ATOM   927  C CE    . MET A 1 119 ? 11.084  -4.806  47.824  1.00 96.69  ? 166 MET A CE    1 
ATOM   928  N N     . LEU A 1 120 ? 9.885   -11.205 50.346  1.00 86.35  ? 167 LEU A N     1 
ATOM   929  C CA    . LEU A 1 120 ? 10.251  -12.615 50.339  1.00 85.53  ? 167 LEU A CA    1 
ATOM   930  C C     . LEU A 1 120 ? 11.452  -12.739 49.425  1.00 89.94  ? 167 LEU A C     1 
ATOM   931  O O     . LEU A 1 120 ? 11.589  -11.975 48.462  1.00 89.20  ? 167 LEU A O     1 
ATOM   932  C CB    . LEU A 1 120 ? 9.109   -13.509 49.826  1.00 82.37  ? 167 LEU A CB    1 
ATOM   933  C CG    . LEU A 1 120 ? 7.756   -13.305 50.457  1.00 85.60  ? 167 LEU A CG    1 
ATOM   934  C CD1   . LEU A 1 120 ? 6.660   -13.919 49.607  1.00 83.04  ? 167 LEU A CD1   1 
ATOM   935  C CD2   . LEU A 1 120 ? 7.727   -13.856 51.856  1.00 91.53  ? 167 LEU A CD2   1 
ATOM   936  N N     . SER A 1 121 ? 12.329  -13.663 49.728  1.00 86.77  ? 168 SER A N     1 
ATOM   937  C CA    . SER A 1 121 ? 13.460  -13.852 48.861  1.00 86.80  ? 168 SER A CA    1 
ATOM   938  C C     . SER A 1 121 ? 13.427  -15.267 48.332  1.00 88.79  ? 168 SER A C     1 
ATOM   939  O O     . SER A 1 121 ? 13.187  -16.198 49.101  1.00 90.33  ? 168 SER A O     1 
ATOM   940  C CB    . SER A 1 121 ? 14.751  -13.550 49.600  1.00 95.28  ? 168 SER A CB    1 
ATOM   941  O OG    . SER A 1 121 ? 15.798  -14.395 49.153  1.00 111.00 ? 168 SER A OG    1 
ATOM   942  N N     . VAL A 1 122 ? 13.632  -15.422 47.021  1.00 82.39  ? 169 VAL A N     1 
ATOM   943  C CA    . VAL A 1 122 ? 13.647  -16.724 46.389  1.00 82.30  ? 169 VAL A CA    1 
ATOM   944  C C     . VAL A 1 122 ? 15.058  -17.051 45.903  1.00 89.67  ? 169 VAL A C     1 
ATOM   945  O O     . VAL A 1 122 ? 15.507  -16.518 44.891  1.00 89.17  ? 169 VAL A O     1 
ATOM   946  C CB    . VAL A 1 122 ? 12.570  -16.887 45.287  1.00 83.37  ? 169 VAL A CB    1 
ATOM   947  C CG1   . VAL A 1 122 ? 12.617  -18.278 44.665  1.00 82.75  ? 169 VAL A CG1   1 
ATOM   948  C CG2   . VAL A 1 122 ? 11.179  -16.610 45.836  1.00 82.11  ? 169 VAL A CG2   1 
ATOM   949  N N     . LYS A 1 123 ? 15.750  -17.937 46.625  1.00 89.45  ? 170 LYS A N     1 
ATOM   950  C CA    . LYS A 1 123 ? 17.091  -18.361 46.232  1.00 91.84  ? 170 LYS A CA    1 
ATOM   951  C C     . LYS A 1 123 ? 16.925  -19.464 45.197  1.00 94.40  ? 170 LYS A C     1 
ATOM   952  O O     . LYS A 1 123 ? 16.230  -20.451 45.454  1.00 93.37  ? 170 LYS A O     1 
ATOM   953  C CB    . LYS A 1 123 ? 17.944  -18.829 47.442  1.00 97.22  ? 170 LYS A CB    1 
ATOM   954  C CG    . LYS A 1 123 ? 19.439  -18.934 47.113  1.00 111.62 ? 170 LYS A CG    1 
ATOM   955  C CD    . LYS A 1 123 ? 20.294  -19.468 48.290  1.00 128.25 ? 170 LYS A CD    1 
ATOM   956  C CE    . LYS A 1 123 ? 21.143  -18.418 48.997  1.00 136.22 ? 170 LYS A CE    1 
ATOM   957  N NZ    . LYS A 1 123 ? 21.732  -18.918 50.279  1.00 140.17 ? 170 LYS A NZ    1 
ATOM   958  N N     . MET A 1 124 ? 17.525  -19.273 44.013  1.00 90.24  ? 171 MET A N     1 
ATOM   959  C CA    . MET A 1 124 ? 17.443  -20.255 42.944  1.00 89.23  ? 171 MET A CA    1 
ATOM   960  C C     . MET A 1 124 ? 18.745  -20.698 42.328  1.00 97.59  ? 171 MET A C     1 
ATOM   961  O O     . MET A 1 124 ? 19.639  -19.881 42.076  1.00 99.77  ? 171 MET A O     1 
ATOM   962  C CB    . MET A 1 124 ? 16.462  -19.822 41.892  1.00 87.98  ? 171 MET A CB    1 
ATOM   963  C CG    . MET A 1 124 ? 15.060  -20.077 42.321  1.00 89.30  ? 171 MET A CG    1 
ATOM   964  S SD    . MET A 1 124 ? 14.011  -19.788 40.950  1.00 89.27  ? 171 MET A SD    1 
ATOM   965  C CE    . MET A 1 124 ? 14.194  -21.357 40.065  1.00 86.79  ? 171 MET A CE    1 
ATOM   966  N N     . PHE A 1 125 ? 18.843  -22.014 42.088  1.00 94.62  ? 172 PHE A N     1 
ATOM   967  C CA    . PHE A 1 125 ? 20.009  -22.683 41.514  1.00 97.42  ? 172 PHE A CA    1 
ATOM   968  C C     . PHE A 1 125 ? 19.575  -24.022 40.938  1.00 97.79  ? 172 PHE A C     1 
ATOM   969  O O     . PHE A 1 125 ? 18.532  -24.527 41.324  1.00 97.52  ? 172 PHE A O     1 
ATOM   970  C CB    . PHE A 1 125 ? 21.104  -22.906 42.590  1.00 104.27 ? 172 PHE A CB    1 
ATOM   971  C CG    . PHE A 1 125 ? 20.599  -23.507 43.883  1.00 107.69 ? 172 PHE A CG    1 
ATOM   972  C CD1   . PHE A 1 125 ? 20.416  -24.878 44.009  1.00 112.24 ? 172 PHE A CD1   1 
ATOM   973  C CD2   . PHE A 1 125 ? 20.280  -22.698 44.966  1.00 110.07 ? 172 PHE A CD2   1 
ATOM   974  C CE1   . PHE A 1 125 ? 19.906  -25.422 45.185  1.00 114.17 ? 172 PHE A CE1   1 
ATOM   975  C CE2   . PHE A 1 125 ? 19.767  -23.248 46.141  1.00 113.56 ? 172 PHE A CE2   1 
ATOM   976  C CZ    . PHE A 1 125 ? 19.575  -24.603 46.238  1.00 112.59 ? 172 PHE A CZ    1 
ATOM   977  N N     . TYR A 1 126 ? 20.374  -24.616 40.056  1.00 92.14  ? 173 TYR A N     1 
ATOM   978  C CA    . TYR A 1 126 ? 20.049  -25.922 39.503  1.00 91.33  ? 173 TYR A CA    1 
ATOM   979  C C     . TYR A 1 126 ? 20.563  -27.003 40.466  1.00 101.15 ? 173 TYR A C     1 
ATOM   980  O O     . TYR A 1 126 ? 21.194  -26.696 41.477  1.00 102.79 ? 173 TYR A O     1 
ATOM   981  C CB    . TYR A 1 126 ? 20.640  -26.076 38.094  1.00 91.22  ? 173 TYR A CB    1 
ATOM   982  C CG    . TYR A 1 126 ? 20.152  -25.012 37.146  1.00 88.95  ? 173 TYR A CG    1 
ATOM   983  C CD1   . TYR A 1 126 ? 18.858  -25.061 36.613  1.00 88.08  ? 173 TYR A CD1   1 
ATOM   984  C CD2   . TYR A 1 126 ? 20.956  -23.921 36.817  1.00 89.22  ? 173 TYR A CD2   1 
ATOM   985  C CE1   . TYR A 1 126 ? 18.388  -24.061 35.753  1.00 85.69  ? 173 TYR A CE1   1 
ATOM   986  C CE2   . TYR A 1 126 ? 20.488  -22.901 35.976  1.00 87.10  ? 173 TYR A CE2   1 
ATOM   987  C CZ    . TYR A 1 126 ? 19.200  -22.972 35.453  1.00 91.91  ? 173 TYR A CZ    1 
ATOM   988  O OH    . TYR A 1 126 ? 18.738  -21.988 34.612  1.00 87.73  ? 173 TYR A OH    1 
ATOM   989  N N     . GLY A 1 127 ? 20.255  -28.251 40.157  1.00 99.90  ? 174 GLY A N     1 
ATOM   990  C CA    . GLY A 1 127 ? 20.656  -29.399 40.952  1.00 103.35 ? 174 GLY A CA    1 
ATOM   991  C C     . GLY A 1 127 ? 22.154  -29.487 41.097  1.00 113.20 ? 174 GLY A C     1 
ATOM   992  O O     . GLY A 1 127 ? 22.646  -29.756 42.196  1.00 117.96 ? 174 GLY A O     1 
ATOM   993  N N     . ASN A 1 128 ? 22.896  -29.202 40.008  1.00 109.14 ? 175 ASN A N     1 
ATOM   994  C CA    . ASN A 1 128 ? 24.364  -29.238 40.023  1.00 112.69 ? 175 ASN A CA    1 
ATOM   995  C C     . ASN A 1 128 ? 24.991  -28.105 40.875  1.00 117.99 ? 175 ASN A C     1 
ATOM   996  O O     . ASN A 1 128 ? 26.189  -28.137 41.152  1.00 121.73 ? 175 ASN A O     1 
ATOM   997  C CB    . ASN A 1 128 ? 24.913  -29.236 38.601  1.00 110.43 ? 175 ASN A CB    1 
ATOM   998  C CG    . ASN A 1 128 ? 24.553  -28.012 37.815  1.00 127.39 ? 175 ASN A CG    1 
ATOM   999  O OD1   . ASN A 1 128 ? 23.782  -27.153 38.258  1.00 118.14 ? 175 ASN A OD1   1 
ATOM   1000 N ND2   . ASN A 1 128 ? 25.114  -27.910 36.627  1.00 121.99 ? 175 ASN A ND2   1 
ATOM   1001 N N     . SER A 1 129 ? 24.152  -27.127 41.294  1.00 111.40 ? 176 SER A N     1 
ATOM   1002 C CA    . SER A 1 129 ? 24.430  -25.947 42.129  1.00 110.67 ? 176 SER A CA    1 
ATOM   1003 C C     . SER A 1 129 ? 24.759  -24.650 41.377  1.00 113.12 ? 176 SER A C     1 
ATOM   1004 O O     . SER A 1 129 ? 25.008  -23.615 42.011  1.00 112.56 ? 176 SER A O     1 
ATOM   1005 C CB    . SER A 1 129 ? 25.364  -26.244 43.301  1.00 115.96 ? 176 SER A CB    1 
ATOM   1006 O OG    . SER A 1 129 ? 25.166  -25.288 44.328  1.00 120.07 ? 176 SER A OG    1 
ATOM   1007 N N     . ASP A 1 130 ? 24.697  -24.699 40.023  1.00 108.22 ? 177 ASP A N     1 
ATOM   1008 C CA    . ASP A 1 130 ? 24.903  -23.531 39.166  1.00 106.51 ? 177 ASP A CA    1 
ATOM   1009 C C     . ASP A 1 130 ? 23.829  -22.544 39.566  1.00 107.40 ? 177 ASP A C     1 
ATOM   1010 O O     . ASP A 1 130 ? 22.657  -22.907 39.631  1.00 103.90 ? 177 ASP A O     1 
ATOM   1011 C CB    . ASP A 1 130 ? 24.764  -23.889 37.668  1.00 107.04 ? 177 ASP A CB    1 
ATOM   1012 C CG    . ASP A 1 130 ? 25.872  -24.747 37.074  1.00 125.99 ? 177 ASP A CG    1 
ATOM   1013 O OD1   . ASP A 1 130 ? 26.934  -24.900 37.731  1.00 132.33 ? 177 ASP A OD1   1 
ATOM   1014 O OD2   . ASP A 1 130 ? 25.688  -25.252 35.946  1.00 131.14 ? 177 ASP A OD2   1 
ATOM   1015 N N     . ASP A 1 131 ? 24.238  -21.337 39.933  1.00 105.47 ? 178 ASP A N     1 
ATOM   1016 C CA    . ASP A 1 131 ? 23.333  -20.302 40.412  1.00 102.54 ? 178 ASP A CA    1 
ATOM   1017 C C     . ASP A 1 131 ? 22.428  -19.740 39.336  1.00 101.13 ? 178 ASP A C     1 
ATOM   1018 O O     . ASP A 1 131 ? 22.762  -19.739 38.148  1.00 100.81 ? 178 ASP A O     1 
ATOM   1019 C CB    . ASP A 1 131 ? 24.136  -19.166 41.083  1.00 107.72 ? 178 ASP A CB    1 
ATOM   1020 C CG    . ASP A 1 131 ? 23.375  -18.273 42.062  1.00 129.12 ? 178 ASP A CG    1 
ATOM   1021 O OD1   . ASP A 1 131 ? 22.278  -18.692 42.538  1.00 129.59 ? 178 ASP A OD1   1 
ATOM   1022 O OD2   . ASP A 1 131 ? 23.888  -17.166 42.382  1.00 138.77 ? 178 ASP A OD2   1 
ATOM   1023 N N     . ILE A 1 132 ? 21.248  -19.303 39.771  1.00 93.36  ? 179 ILE A N     1 
ATOM   1024 C CA    . ILE A 1 132 ? 20.274  -18.579 38.975  1.00 88.49  ? 179 ILE A CA    1 
ATOM   1025 C C     . ILE A 1 132 ? 20.321  -17.197 39.658  1.00 93.48  ? 179 ILE A C     1 
ATOM   1026 O O     . ILE A 1 132 ? 20.935  -16.280 39.121  1.00 95.14  ? 179 ILE A O     1 
ATOM   1027 C CB    . ILE A 1 132 ? 18.873  -19.260 38.949  1.00 88.09  ? 179 ILE A CB    1 
ATOM   1028 C CG1   . ILE A 1 132 ? 18.961  -20.698 38.352  1.00 89.12  ? 179 ILE A CG1   1 
ATOM   1029 C CG2   . ILE A 1 132 ? 17.881  -18.408 38.184  1.00 83.05  ? 179 ILE A CG2   1 
ATOM   1030 C CD1   . ILE A 1 132 ? 17.861  -21.672 38.725  1.00 89.08  ? 179 ILE A CD1   1 
ATOM   1031 N N     . GLY A 1 133 ? 19.863  -17.118 40.900  1.00 89.25  ? 180 GLY A N     1 
ATOM   1032 C CA    . GLY A 1 133 ? 19.913  -15.877 41.653  1.00 88.98  ? 180 GLY A CA    1 
ATOM   1033 C C     . GLY A 1 133 ? 18.879  -15.784 42.748  1.00 91.33  ? 180 GLY A C     1 
ATOM   1034 O O     . GLY A 1 133 ? 18.216  -16.777 43.078  1.00 92.49  ? 180 GLY A O     1 
ATOM   1035 N N     . VAL A 1 134 ? 18.744  -14.586 43.325  1.00 84.47  ? 181 VAL A N     1 
ATOM   1036 C CA    . VAL A 1 134 ? 17.835  -14.342 44.436  1.00 83.75  ? 181 VAL A CA    1 
ATOM   1037 C C     . VAL A 1 134 ? 16.865  -13.349 43.957  1.00 87.68  ? 181 VAL A C     1 
ATOM   1038 O O     . VAL A 1 134 ? 17.270  -12.257 43.574  1.00 90.24  ? 181 VAL A O     1 
ATOM   1039 C CB    . VAL A 1 134 ? 18.552  -13.930 45.757  1.00 91.07  ? 181 VAL A CB    1 
ATOM   1040 C CG1   . VAL A 1 134 ? 17.603  -13.249 46.744  1.00 89.83  ? 181 VAL A CG1   1 
ATOM   1041 C CG2   . VAL A 1 134 ? 19.222  -15.138 46.403  1.00 93.67  ? 181 VAL A CG2   1 
ATOM   1042 N N     . PHE A 1 135 ? 15.577  -13.756 43.931  1.00 80.61  ? 182 PHE A N     1 
ATOM   1043 C CA    . PHE A 1 135 ? 14.442  -13.004 43.437  1.00 76.10  ? 182 PHE A CA    1 
ATOM   1044 C C     . PHE A 1 135 ? 13.605  -12.497 44.600  1.00 80.39  ? 182 PHE A C     1 
ATOM   1045 O O     . PHE A 1 135 ? 13.237  -13.275 45.485  1.00 80.90  ? 182 PHE A O     1 
ATOM   1046 C CB    . PHE A 1 135 ? 13.605  -13.911 42.526  1.00 74.90  ? 182 PHE A CB    1 
ATOM   1047 C CG    . PHE A 1 135 ? 14.350  -14.482 41.348  1.00 75.35  ? 182 PHE A CG    1 
ATOM   1048 C CD1   . PHE A 1 135 ? 15.057  -15.671 41.462  1.00 79.49  ? 182 PHE A CD1   1 
ATOM   1049 C CD2   . PHE A 1 135 ? 14.331  -13.838 40.117  1.00 76.11  ? 182 PHE A CD2   1 
ATOM   1050 C CE1   . PHE A 1 135 ? 15.768  -16.191 40.375  1.00 80.77  ? 182 PHE A CE1   1 
ATOM   1051 C CE2   . PHE A 1 135 ? 15.039  -14.358 39.027  1.00 79.45  ? 182 PHE A CE2   1 
ATOM   1052 C CZ    . PHE A 1 135 ? 15.749  -15.535 39.164  1.00 78.91  ? 182 PHE A CZ    1 
ATOM   1053 N N     . LEU A 1 136 ? 13.315  -11.188 44.605  1.00 76.49  ? 183 LEU A N     1 
ATOM   1054 C CA    . LEU A 1 136 ? 12.532  -10.535 45.658  1.00 75.74  ? 183 LEU A CA    1 
ATOM   1055 C C     . LEU A 1 136 ? 11.083  -10.335 45.330  1.00 78.82  ? 183 LEU A C     1 
ATOM   1056 O O     . LEU A 1 136 ? 10.734  -9.960  44.215  1.00 76.33  ? 183 LEU A O     1 
ATOM   1057 C CB    . LEU A 1 136 ? 13.126  -9.191  46.053  1.00 76.90  ? 183 LEU A CB    1 
ATOM   1058 C CG    . LEU A 1 136 ? 14.536  -9.222  46.620  1.00 83.58  ? 183 LEU A CG    1 
ATOM   1059 C CD1   . LEU A 1 136 ? 15.058  -7.820  46.824  1.00 83.74  ? 183 LEU A CD1   1 
ATOM   1060 C CD2   . LEU A 1 136 ? 14.609  -10.069 47.900  1.00 88.93  ? 183 LEU A CD2   1 
ATOM   1061 N N     . SER A 1 137 ? 10.230  -10.545 46.325  1.00 77.36  ? 184 SER A N     1 
ATOM   1062 C CA    . SER A 1 137 ? 8.805   -10.312 46.200  1.00 76.08  ? 184 SER A CA    1 
ATOM   1063 C C     . SER A 1 137 ? 8.629   -8.801  46.289  1.00 83.10  ? 184 SER A C     1 
ATOM   1064 O O     . SER A 1 137 ? 9.582   -8.056  46.610  1.00 84.45  ? 184 SER A O     1 
ATOM   1065 C CB    . SER A 1 137 ? 8.067   -10.949 47.382  1.00 80.03  ? 184 SER A CB    1 
ATOM   1066 O OG    . SER A 1 137 ? 8.061   -10.147 48.563  1.00 83.99  ? 184 SER A OG    1 
ATOM   1067 N N     . LYS A 1 138 ? 7.385   -8.351  46.082  1.00 79.05  ? 185 LYS A N     1 
ATOM   1068 C CA    . LYS A 1 138 ? 7.042   -6.956  46.296  1.00 79.21  ? 185 LYS A CA    1 
ATOM   1069 C C     . LYS A 1 138 ? 7.040   -6.716  47.853  1.00 85.70  ? 185 LYS A C     1 
ATOM   1070 O O     . LYS A 1 138 ? 7.157   -7.679  48.636  1.00 85.17  ? 185 LYS A O     1 
ATOM   1071 C CB    . LYS A 1 138 ? 5.692   -6.635  45.628  1.00 78.54  ? 185 LYS A CB    1 
ATOM   1072 C CG    . LYS A 1 138 ? 5.705   -6.791  44.098  1.00 80.67  ? 185 LYS A CG    1 
ATOM   1073 C CD    . LYS A 1 138 ? 6.748   -5.892  43.418  1.00 87.99  ? 185 LYS A CD    1 
ATOM   1074 C CE    . LYS A 1 138 ? 6.501   -5.611  41.956  1.00 94.52  ? 185 LYS A CE    1 
ATOM   1075 N NZ    . LYS A 1 138 ? 5.098   -5.184  41.678  1.00 102.75 ? 185 LYS A NZ    1 
ATOM   1076 N N     . ARG A 1 139 ? 6.990   -5.445  48.281  1.00 83.26  ? 186 ARG A N     1 
ATOM   1077 C CA    . ARG A 1 139 ? 6.967   -5.066  49.695  1.00 84.85  ? 186 ARG A CA    1 
ATOM   1078 C C     . ARG A 1 139 ? 5.755   -5.716  50.407  1.00 84.66  ? 186 ARG A C     1 
ATOM   1079 O O     . ARG A 1 139 ? 4.658   -5.673  49.876  1.00 83.57  ? 186 ARG A O     1 
ATOM   1080 C CB    . ARG A 1 139 ? 6.900   -3.524  49.788  1.00 87.80  ? 186 ARG A CB    1 
ATOM   1081 C CG    . ARG A 1 139 ? 7.036   -2.903  51.169  1.00 104.18 ? 186 ARG A CG    1 
ATOM   1082 C CD    . ARG A 1 139 ? 7.125   -1.380  51.056  1.00 128.47 ? 186 ARG A CD    1 
ATOM   1083 N NE    . ARG A 1 139 ? 8.430   -0.836  51.463  1.00 151.67 ? 186 ARG A NE    1 
ATOM   1084 C CZ    . ARG A 1 139 ? 9.534   -0.837  50.711  1.00 172.48 ? 186 ARG A CZ    1 
ATOM   1085 N NH1   . ARG A 1 139 ? 9.525   -1.383  49.499  1.00 163.23 ? 186 ARG A NH1   1 
ATOM   1086 N NH2   . ARG A 1 139 ? 10.658  -0.306  51.173  1.00 161.18 ? 186 ARG A NH2   1 
ATOM   1087 N N     . ILE A 1 140 ? 5.968   -6.349  51.566  1.00 79.73  ? 187 ILE A N     1 
ATOM   1088 C CA    . ILE A 1 140 ? 4.904   -6.955  52.377  1.00 78.39  ? 187 ILE A CA    1 
ATOM   1089 C C     . ILE A 1 140 ? 4.841   -6.216  53.736  1.00 84.69  ? 187 ILE A C     1 
ATOM   1090 O O     . ILE A 1 140 ? 5.873   -6.056  54.385  1.00 85.98  ? 187 ILE A O     1 
ATOM   1091 C CB    . ILE A 1 140 ? 5.079   -8.481  52.543  1.00 80.34  ? 187 ILE A CB    1 
ATOM   1092 C CG1   . ILE A 1 140 ? 5.257   -9.161  51.182  1.00 78.01  ? 187 ILE A CG1   1 
ATOM   1093 C CG2   . ILE A 1 140 ? 3.909   -9.081  53.341  1.00 81.61  ? 187 ILE A CG2   1 
ATOM   1094 C CD1   . ILE A 1 140 ? 5.408   -10.643 51.210  1.00 88.43  ? 187 ILE A CD1   1 
ATOM   1095 N N     . LYS A 1 141 ? 3.641   -5.748  54.142  1.00 81.50  ? 188 LYS A N     1 
ATOM   1096 C CA    . LYS A 1 141 ? 3.448   -4.981  55.381  1.00 84.32  ? 188 LYS A CA    1 
ATOM   1097 C C     . LYS A 1 141 ? 3.180   -5.907  56.549  1.00 93.25  ? 188 LYS A C     1 
ATOM   1098 O O     . LYS A 1 141 ? 2.267   -6.733  56.473  1.00 93.13  ? 188 LYS A O     1 
ATOM   1099 C CB    . LYS A 1 141 ? 2.288   -3.980  55.226  1.00 85.83  ? 188 LYS A CB    1 
ATOM   1100 C CG    . LYS A 1 141 ? 2.098   -3.052  56.407  1.00 101.80 ? 188 LYS A CG    1 
ATOM   1101 C CD    . LYS A 1 141 ? 1.217   -1.861  56.095  1.00 114.23 ? 188 LYS A CD    1 
ATOM   1102 C CE    . LYS A 1 141 ? 1.573   -0.661  56.959  1.00 136.83 ? 188 LYS A CE    1 
ATOM   1103 N NZ    . LYS A 1 141 ? 1.100   -0.791  58.370  1.00 146.77 ? 188 LYS A NZ    1 
ATOM   1104 N N     . VAL A 1 142 ? 3.961   -5.764  57.638  1.00 92.70  ? 189 VAL A N     1 
ATOM   1105 C CA    . VAL A 1 142 ? 3.773   -6.566  58.849  1.00 93.83  ? 189 VAL A CA    1 
ATOM   1106 C C     . VAL A 1 142 ? 2.624   -5.917  59.601  1.00 98.42  ? 189 VAL A C     1 
ATOM   1107 O O     . VAL A 1 142 ? 2.550   -4.696  59.680  1.00 99.72  ? 189 VAL A O     1 
ATOM   1108 C CB    . VAL A 1 142 ? 5.054   -6.701  59.711  1.00 100.90 ? 189 VAL A CB    1 
ATOM   1109 C CG1   . VAL A 1 142 ? 4.871   -7.737  60.817  1.00 101.97 ? 189 VAL A CG1   1 
ATOM   1110 C CG2   . VAL A 1 142 ? 6.259   -7.062  58.852  1.00 100.02 ? 189 VAL A CG2   1 
ATOM   1111 N N     . ILE A 1 143 ? 1.702   -6.732  60.081  1.00 95.11  ? 190 ILE A N     1 
ATOM   1112 C CA    . ILE A 1 143 ? 0.483   -6.316  60.753  1.00 96.91  ? 190 ILE A CA    1 
ATOM   1113 C C     . ILE A 1 143 ? 0.366   -7.046  62.073  1.00 108.02 ? 190 ILE A C     1 
ATOM   1114 O O     . ILE A 1 143 ? 0.692   -8.239  62.147  1.00 108.35 ? 190 ILE A O     1 
ATOM   1115 C CB    . ILE A 1 143 ? -0.676  -6.609  59.767  1.00 96.85  ? 190 ILE A CB    1 
ATOM   1116 C CG1   . ILE A 1 143 ? -0.811  -5.451  58.796  1.00 96.88  ? 190 ILE A CG1   1 
ATOM   1117 C CG2   . ILE A 1 143 ? -2.009  -6.970  60.433  1.00 97.58  ? 190 ILE A CG2   1 
ATOM   1118 C CD1   . ILE A 1 143 ? -1.887  -5.595  57.873  1.00 112.50 ? 190 ILE A CD1   1 
ATOM   1119 N N     . SER A 1 144 ? -0.068  -6.337  63.126  1.00 109.60 ? 191 SER A N     1 
ATOM   1120 C CA    . SER A 1 144 ? -0.234  -6.939  64.456  1.00 113.20 ? 191 SER A CA    1 
ATOM   1121 C C     . SER A 1 144 ? -1.324  -8.018  64.394  1.00 116.83 ? 191 SER A C     1 
ATOM   1122 O O     . SER A 1 144 ? -1.094  -9.168  64.794  1.00 116.80 ? 191 SER A O     1 
ATOM   1123 C CB    . SER A 1 144 ? -0.564  -5.872  65.497  1.00 121.25 ? 191 SER A CB    1 
ATOM   1124 O OG    . SER A 1 144 ? -1.479  -4.897  65.020  1.00 131.86 ? 191 SER A OG    1 
ATOM   1125 N N     . LYS A 1 145 ? -2.475  -7.642  63.804  1.00 111.93 ? 192 LYS A N     1 
ATOM   1126 C CA    . LYS A 1 145 ? -3.676  -8.442  63.579  1.00 110.77 ? 192 LYS A CA    1 
ATOM   1127 C C     . LYS A 1 145 ? -4.625  -7.520  62.818  1.00 115.75 ? 192 LYS A C     1 
ATOM   1128 O O     . LYS A 1 145 ? -4.330  -6.326  62.773  1.00 116.51 ? 192 LYS A O     1 
ATOM   1129 C CB    . LYS A 1 145 ? -4.307  -8.875  64.920  1.00 115.50 ? 192 LYS A CB    1 
ATOM   1130 C CG    . LYS A 1 145 ? -5.019  -7.758  65.680  1.00 119.39 ? 192 LYS A CG    1 
ATOM   1131 C CD    . LYS A 1 145 ? -6.275  -8.239  66.408  1.00 122.49 ? 192 LYS A CD    1 
ATOM   1132 C CE    . LYS A 1 145 ? -6.000  -8.829  67.773  1.00 117.11 ? 192 LYS A CE    1 
ATOM   1133 N NZ    . LYS A 1 145 ? -7.259  -9.095  68.502  1.00 125.17 ? 192 LYS A NZ    1 
ATOM   1134 N N     . PRO A 1 146 ? -5.761  -7.980  62.238  1.00 121.97 ? 193 PRO A N     1 
ATOM   1135 C CA    . PRO A 1 146 ? -6.639  -7.028  61.545  1.00 121.27 ? 193 PRO A CA    1 
ATOM   1136 C C     . PRO A 1 146 ? -7.428  -6.140  62.507  1.00 129.69 ? 193 PRO A C     1 
ATOM   1137 O O     . PRO A 1 146 ? -7.738  -6.555  63.625  1.00 130.63 ? 193 PRO A O     1 
ATOM   1138 C CB    . PRO A 1 146 ? -7.539  -7.921  60.694  1.00 119.88 ? 193 PRO A CB    1 
ATOM   1139 C CG    . PRO A 1 146 ? -7.587  -9.190  61.412  1.00 124.85 ? 193 PRO A CG    1 
ATOM   1140 C CD    . PRO A 1 146 ? -6.300  -9.352  62.165  1.00 122.32 ? 193 PRO A CD    1 
ATOM   1141 N N     . SER A 1 147 ? -7.725  -4.908  62.052  1.00 128.81 ? 194 SER A N     1 
ATOM   1142 C CA    . SER A 1 147 ? -8.460  -3.862  62.761  1.00 132.78 ? 194 SER A CA    1 
ATOM   1143 C C     . SER A 1 147 ? -9.919  -4.279  63.098  1.00 139.43 ? 194 SER A C     1 
ATOM   1144 O O     . SER A 1 147 ? -10.782 -4.266  62.208  1.00 137.34 ? 194 SER A O     1 
ATOM   1145 C CB    . SER A 1 147 ? -8.434  -2.575  61.937  1.00 136.45 ? 194 SER A CB    1 
ATOM   1146 O OG    . SER A 1 147 ? -9.054  -1.502  62.627  1.00 153.20 ? 194 SER A OG    1 
ATOM   1147 N N     . LYS A 1 148 ? -10.184 -4.649  64.390  1.00 139.36 ? 195 LYS A N     1 
ATOM   1148 C CA    . LYS A 1 148 ? -11.511 -5.069  64.892  1.00 139.92 ? 195 LYS A CA    1 
ATOM   1149 C C     . LYS A 1 148 ? -12.577 -3.959  64.700  1.00 144.93 ? 195 LYS A C     1 
ATOM   1150 O O     . LYS A 1 148 ? -13.711 -4.254  64.304  1.00 143.59 ? 195 LYS A O     1 
ATOM   1151 C CB    . LYS A 1 148 ? -11.434 -5.527  66.364  1.00 144.94 ? 195 LYS A CB    1 
ATOM   1152 C CG    . LYS A 1 148 ? -12.681 -6.268  66.869  1.00 155.25 ? 195 LYS A CG    1 
ATOM   1153 C CD    . LYS A 1 148 ? -12.745 -6.305  68.406  1.00 168.77 ? 195 LYS A CD    1 
ATOM   1154 C CE    . LYS A 1 148 ? -13.939 -7.056  68.961  1.00 174.76 ? 195 LYS A CE    1 
ATOM   1155 N NZ    . LYS A 1 148 ? -13.935 -7.091  70.454  1.00 183.06 ? 195 LYS A NZ    1 
ATOM   1156 N N     . LYS A 1 149 ? -12.190 -2.691  64.948  1.00 143.37 ? 196 LYS A N     1 
ATOM   1157 C CA    . LYS A 1 149 ? -13.059 -1.524  64.782  1.00 144.67 ? 196 LYS A CA    1 
ATOM   1158 C C     . LYS A 1 149 ? -12.841 -0.830  63.414  1.00 146.35 ? 196 LYS A C     1 
ATOM   1159 O O     . LYS A 1 149 ? -12.099 -1.357  62.574  1.00 142.68 ? 196 LYS A O     1 
ATOM   1160 C CB    . LYS A 1 149 ? -12.946 -0.563  65.987  1.00 151.70 ? 196 LYS A CB    1 
ATOM   1161 C CG    . LYS A 1 149 ? -13.763 -1.027  67.207  1.00 164.41 ? 196 LYS A CG    1 
ATOM   1162 C CD    . LYS A 1 149 ? -13.538 -0.160  68.443  1.00 171.55 ? 196 LYS A CD    1 
ATOM   1163 C CE    . LYS A 1 149 ? -14.429 -0.542  69.599  1.00 176.58 ? 196 LYS A CE    1 
ATOM   1164 N NZ    . LYS A 1 149 ? -15.776 0.077   69.499  1.00 181.15 ? 196 LYS A NZ    1 
ATOM   1165 N N     . LYS A 1 150 ? -13.529 0.314   63.180  1.00 144.47 ? 197 LYS A N     1 
ATOM   1166 C CA    . LYS A 1 150 ? -13.496 1.076   61.926  1.00 142.38 ? 197 LYS A CA    1 
ATOM   1167 C C     . LYS A 1 150 ? -12.115 1.526   61.471  1.00 146.30 ? 197 LYS A C     1 
ATOM   1168 O O     . LYS A 1 150 ? -11.223 1.770   62.287  1.00 147.44 ? 197 LYS A O     1 
ATOM   1169 C CB    . LYS A 1 150 ? -14.531 2.217   61.907  1.00 147.00 ? 197 LYS A CB    1 
ATOM   1170 C CG    . LYS A 1 150 ? -15.980 1.721   61.810  1.00 157.63 ? 197 LYS A CG    1 
ATOM   1171 C CD    . LYS A 1 150 ? -16.992 2.778   62.229  1.00 167.36 ? 197 LYS A CD    1 
ATOM   1172 C CE    . LYS A 1 150 ? -18.368 2.206   62.478  1.00 174.10 ? 197 LYS A CE    1 
ATOM   1173 N NZ    . LYS A 1 150 ? -19.285 2.419   61.325  1.00 179.48 ? 197 LYS A NZ    1 
ATOM   1174 N N     . GLN A 1 151 ? -11.946 1.573   60.142  1.00 141.49 ? 198 GLN A N     1 
ATOM   1175 C CA    . GLN A 1 151 ? -10.711 1.910   59.439  1.00 140.25 ? 198 GLN A CA    1 
ATOM   1176 C C     . GLN A 1 151 ? -10.757 3.325   58.823  1.00 145.79 ? 198 GLN A C     1 
ATOM   1177 O O     . GLN A 1 151 ? -11.834 3.853   58.538  1.00 146.29 ? 198 GLN A O     1 
ATOM   1178 C CB    . GLN A 1 151 ? -10.419 0.813   58.381  1.00 137.10 ? 198 GLN A CB    1 
ATOM   1179 C CG    . GLN A 1 151 ? -9.006  0.801   57.763  1.00 145.59 ? 198 GLN A CG    1 
ATOM   1180 C CD    . GLN A 1 151 ? -7.873  0.879   58.764  1.00 160.57 ? 198 GLN A CD    1 
ATOM   1181 O OE1   . GLN A 1 151 ? -7.828  0.159   59.774  1.00 153.68 ? 198 GLN A OE1   1 
ATOM   1182 N NE2   . GLN A 1 151 ? -6.924  1.760   58.489  1.00 153.58 ? 198 GLN A NE2   1 
ATOM   1183 N N     . SER A 1 152 ? -9.583  3.948   58.668  1.00 143.01 ? 199 SER A N     1 
ATOM   1184 C CA    . SER A 1 152 ? -9.460  5.280   58.081  1.00 144.32 ? 199 SER A CA    1 
ATOM   1185 C C     . SER A 1 152 ? -8.587  5.243   56.839  1.00 145.34 ? 199 SER A C     1 
ATOM   1186 O O     . SER A 1 152 ? -7.678  4.412   56.736  1.00 141.86 ? 199 SER A O     1 
ATOM   1187 C CB    . SER A 1 152 ? -8.917  6.282   59.095  1.00 151.38 ? 199 SER A CB    1 
ATOM   1188 O OG    . SER A 1 152 ? -9.973  7.005   59.703  1.00 159.28 ? 199 SER A OG    1 
ATOM   1189 N N     . LEU A 1 153 ? -8.868  6.154   55.897  1.00 143.09 ? 200 LEU A N     1 
ATOM   1190 C CA    . LEU A 1 153 ? -8.142  6.262   54.632  1.00 141.05 ? 200 LEU A CA    1 
ATOM   1191 C C     . LEU A 1 153 ? -6.730  6.828   54.838  1.00 146.90 ? 200 LEU A C     1 
ATOM   1192 O O     . LEU A 1 153 ? -5.891  6.717   53.933  1.00 144.28 ? 200 LEU A O     1 
ATOM   1193 C CB    . LEU A 1 153 ? -8.937  7.103   53.621  1.00 141.23 ? 200 LEU A CB    1 
ATOM   1194 C CG    . LEU A 1 153 ? -10.068 6.402   52.879  1.00 142.47 ? 200 LEU A CG    1 
ATOM   1195 C CD1   . LEU A 1 153 ? -11.373 6.476   53.660  1.00 144.28 ? 200 LEU A CD1   1 
ATOM   1196 C CD2   . LEU A 1 153 ? -10.298 7.064   51.560  1.00 144.47 ? 200 LEU A CD2   1 
ATOM   1197 N N     . LYS A 1 154 ? -6.474  7.421   56.042  1.00 147.06 ? 201 LYS A N     1 
ATOM   1198 C CA    . LYS A 1 154 ? -5.185  7.981   56.478  1.00 149.18 ? 201 LYS A CA    1 
ATOM   1199 C C     . LYS A 1 154 ? -4.074  6.901   56.317  1.00 150.84 ? 201 LYS A C     1 
ATOM   1200 O O     . LYS A 1 154 ? -3.020  7.187   55.741  1.00 151.20 ? 201 LYS A O     1 
ATOM   1201 C CB    . LYS A 1 154 ? -5.249  8.447   57.949  1.00 154.71 ? 201 LYS A CB    1 
ATOM   1202 C CG    . LYS A 1 154 ? -6.540  9.130   58.403  1.00 156.20 ? 201 LYS A CG    1 
ATOM   1203 C CD    . LYS A 1 154 ? -6.589  9.124   59.935  1.00 160.68 ? 201 LYS A CD    1 
ATOM   1204 C CE    . LYS A 1 154 ? -7.688  9.942   60.574  1.00 156.01 ? 201 LYS A CE    1 
ATOM   1205 N NZ    . LYS A 1 154 ? -7.593  9.910   62.060  1.00 149.99 ? 201 LYS A NZ    1 
ATOM   1206 N N     . ASN A 1 155 ? -4.342  5.659   56.796  1.00 143.95 ? 202 ASN A N     1 
ATOM   1207 C CA    . ASN A 1 155 ? -3.455  4.493   56.684  1.00 140.52 ? 202 ASN A CA    1 
ATOM   1208 C C     . ASN A 1 155 ? -4.012  3.576   55.557  1.00 135.64 ? 202 ASN A C     1 
ATOM   1209 O O     . ASN A 1 155 ? -4.428  2.439   55.798  1.00 132.19 ? 202 ASN A O     1 
ATOM   1210 C CB    . ASN A 1 155 ? -3.319  3.772   58.061  1.00 143.97 ? 202 ASN A CB    1 
ATOM   1211 C CG    . ASN A 1 155 ? -2.334  2.608   58.153  1.00 156.54 ? 202 ASN A CG    1 
ATOM   1212 O OD1   . ASN A 1 155 ? -1.609  2.268   57.211  1.00 147.69 ? 202 ASN A OD1   1 
ATOM   1213 N ND2   . ASN A 1 155 ? -2.301  1.952   59.306  1.00 143.93 ? 202 ASN A ND2   1 
ATOM   1214 N N     . ALA A 1 156 ? -4.025  4.121   54.319  1.00 129.01 ? 203 ALA A N     1 
ATOM   1215 C CA    . ALA A 1 156 ? -4.511  3.508   53.073  1.00 124.18 ? 203 ALA A CA    1 
ATOM   1216 C C     . ALA A 1 156 ? -3.730  2.246   52.660  1.00 124.57 ? 203 ALA A C     1 
ATOM   1217 O O     . ALA A 1 156 ? -4.124  1.527   51.727  1.00 121.79 ? 203 ALA A O     1 
ATOM   1218 C CB    . ALA A 1 156 ? -4.474  4.536   51.955  1.00 125.04 ? 203 ALA A CB    1 
ATOM   1219 N N     . ASP A 1 157 ? -2.625  1.982   53.377  1.00 120.77 ? 204 ASP A N     1 
ATOM   1220 C CA    . ASP A 1 157 ? -1.723  0.830   53.254  1.00 117.26 ? 204 ASP A CA    1 
ATOM   1221 C C     . ASP A 1 157 ? -2.523  -0.453  53.623  1.00 113.22 ? 204 ASP A C     1 
ATOM   1222 O O     . ASP A 1 157 ? -2.170  -1.561  53.212  1.00 111.02 ? 204 ASP A O     1 
ATOM   1223 C CB    . ASP A 1 157 ? -0.501  1.007   54.208  1.00 122.98 ? 204 ASP A CB    1 
ATOM   1224 C CG    . ASP A 1 157 ? -0.047  2.440   54.597  1.00 142.05 ? 204 ASP A CG    1 
ATOM   1225 O OD1   . ASP A 1 157 ? -0.892  3.378   54.563  1.00 142.97 ? 204 ASP A OD1   1 
ATOM   1226 O OD2   . ASP A 1 157 ? 1.110   2.593   55.055  1.00 152.19 ? 204 ASP A OD2   1 
ATOM   1227 N N     . LEU A 1 158 ? -3.624  -0.270  54.370  1.00 106.17 ? 205 LEU A N     1 
ATOM   1228 C CA    . LEU A 1 158 ? -4.533  -1.315  54.806  1.00 103.14 ? 205 LEU A CA    1 
ATOM   1229 C C     . LEU A 1 158 ? -5.880  -1.229  54.101  1.00 104.41 ? 205 LEU A C     1 
ATOM   1230 O O     . LEU A 1 158 ? -6.746  -2.050  54.375  1.00 103.71 ? 205 LEU A O     1 
ATOM   1231 C CB    . LEU A 1 158 ? -4.750  -1.284  56.329  1.00 105.72 ? 205 LEU A CB    1 
ATOM   1232 C CG    . LEU A 1 158 ? -3.561  -1.022  57.246  1.00 112.90 ? 205 LEU A CG    1 
ATOM   1233 C CD1   . LEU A 1 158 ? -4.002  -1.047  58.669  1.00 116.84 ? 205 LEU A CD1   1 
ATOM   1234 C CD2   . LEU A 1 158 ? -2.460  -2.037  57.074  1.00 112.00 ? 205 LEU A CD2   1 
ATOM   1235 N N     . CYS A 1 159 ? -6.076  -0.252  53.214  1.00 100.03 ? 206 CYS A N     1 
ATOM   1236 C CA    . CYS A 1 159 ? -7.347  -0.115  52.497  1.00 98.60  ? 206 CYS A CA    1 
ATOM   1237 C C     . CYS A 1 159 ? -7.300  -0.826  51.156  1.00 98.06  ? 206 CYS A C     1 
ATOM   1238 O O     . CYS A 1 159 ? -6.207  -1.173  50.696  1.00 97.50  ? 206 CYS A O     1 
ATOM   1239 C CB    . CYS A 1 159 ? -7.739  1.350   52.353  1.00 101.34 ? 206 CYS A CB    1 
ATOM   1240 S SG    . CYS A 1 159 ? -8.270  2.125   53.901  1.00 109.62 ? 206 CYS A SG    1 
ATOM   1241 N N     . ILE A 1 160 ? -8.474  -1.066  50.527  1.00 90.22  ? 207 ILE A N     1 
ATOM   1242 C CA    . ILE A 1 160 ? -8.521  -1.766  49.227  1.00 84.38  ? 207 ILE A CA    1 
ATOM   1243 C C     . ILE A 1 160 ? -8.918  -0.850  48.087  1.00 87.18  ? 207 ILE A C     1 
ATOM   1244 O O     . ILE A 1 160 ? -10.067 -0.414  48.015  1.00 88.68  ? 207 ILE A O     1 
ATOM   1245 C CB    . ILE A 1 160 ? -9.339  -3.087  49.270  1.00 84.22  ? 207 ILE A CB    1 
ATOM   1246 C CG1   . ILE A 1 160 ? -8.711  -4.089  50.278  1.00 83.88  ? 207 ILE A CG1   1 
ATOM   1247 C CG2   . ILE A 1 160 ? -9.430  -3.691  47.875  1.00 80.59  ? 207 ILE A CG2   1 
ATOM   1248 C CD1   . ILE A 1 160 ? -9.658  -4.990  50.979  1.00 88.60  ? 207 ILE A CD1   1 
ATOM   1249 N N     . ALA A 1 161 ? -7.965  -0.547  47.200  1.00 81.70  ? 208 ALA A N     1 
ATOM   1250 C CA    . ALA A 1 161 ? -8.228  0.340   46.055  1.00 80.10  ? 208 ALA A CA    1 
ATOM   1251 C C     . ALA A 1 161 ? -8.888  -0.422  44.913  1.00 81.35  ? 208 ALA A C     1 
ATOM   1252 O O     . ALA A 1 161 ? -8.397  -1.477  44.498  1.00 78.02  ? 208 ALA A O     1 
ATOM   1253 C CB    . ALA A 1 161 ? -6.930  0.955   45.566  1.00 80.25  ? 208 ALA A CB    1 
ATOM   1254 N N     . SER A 1 162 ? -9.990  0.124   44.393  1.00 78.29  ? 209 SER A N     1 
ATOM   1255 C CA    . SER A 1 162 ? -10.697 -0.377  43.210  1.00 75.97  ? 209 SER A CA    1 
ATOM   1256 C C     . SER A 1 162 ? -9.672  -0.606  42.062  1.00 78.67  ? 209 SER A C     1 
ATOM   1257 O O     . SER A 1 162 ? -8.827  0.263   41.811  1.00 79.67  ? 209 SER A O     1 
ATOM   1258 C CB    . SER A 1 162 ? -11.721 0.666   42.763  1.00 79.43  ? 209 SER A CB    1 
ATOM   1259 O OG    . SER A 1 162 ? -12.285 0.365   41.500  1.00 85.20  ? 209 SER A OG    1 
ATOM   1260 N N     . GLY A 1 163 ? -9.728  -1.768  41.422  1.00 72.44  ? 210 GLY A N     1 
ATOM   1261 C CA    . GLY A 1 163 ? -8.845  -2.075  40.302  1.00 70.95  ? 210 GLY A CA    1 
ATOM   1262 C C     . GLY A 1 163 ? -7.590  -2.838  40.653  1.00 75.44  ? 210 GLY A C     1 
ATOM   1263 O O     . GLY A 1 163 ? -6.829  -3.243  39.765  1.00 75.66  ? 210 GLY A O     1 
ATOM   1264 N N     . THR A 1 164 ? -7.371  -3.032  41.955  1.00 70.42  ? 211 THR A N     1 
ATOM   1265 C CA    . THR A 1 164 ? -6.260  -3.801  42.485  1.00 67.29  ? 211 THR A CA    1 
ATOM   1266 C C     . THR A 1 164 ? -6.785  -5.190  42.711  1.00 70.42  ? 211 THR A C     1 
ATOM   1267 O O     . THR A 1 164 ? -7.991  -5.406  42.648  1.00 69.74  ? 211 THR A O     1 
ATOM   1268 C CB    . THR A 1 164 ? -5.756  -3.193  43.787  1.00 68.73  ? 211 THR A CB    1 
ATOM   1269 O OG1   . THR A 1 164 ? -6.789  -3.229  44.800  1.00 73.77  ? 211 THR A OG1   1 
ATOM   1270 C CG2   . THR A 1 164 ? -5.111  -1.800  43.593  1.00 52.91  ? 211 THR A CG2   1 
ATOM   1271 N N     . LYS A 1 165 ? -5.890  -6.124  43.021  1.00 67.89  ? 212 LYS A N     1 
ATOM   1272 C CA    . LYS A 1 165 ? -6.207  -7.534  43.181  1.00 66.75  ? 212 LYS A CA    1 
ATOM   1273 C C     . LYS A 1 165 ? -6.291  -8.025  44.634  1.00 74.09  ? 212 LYS A C     1 
ATOM   1274 O O     . LYS A 1 165 ? -5.565  -7.549  45.528  1.00 77.78  ? 212 LYS A O     1 
ATOM   1275 C CB    . LYS A 1 165 ? -5.200  -8.369  42.381  1.00 68.31  ? 212 LYS A CB    1 
ATOM   1276 C CG    . LYS A 1 165 ? -5.211  -8.137  40.865  1.00 71.31  ? 212 LYS A CG    1 
ATOM   1277 C CD    . LYS A 1 165 ? -4.219  -9.046  40.238  1.00 78.04  ? 212 LYS A CD    1 
ATOM   1278 C CE    . LYS A 1 165 ? -2.990  -8.354  39.723  1.00 91.74  ? 212 LYS A CE    1 
ATOM   1279 N NZ    . LYS A 1 165 ? -3.054  -8.260  38.231  1.00 109.64 ? 212 LYS A NZ    1 
ATOM   1280 N N     . VAL A 1 166 ? -7.191  -8.993  44.861  1.00 68.66  ? 213 VAL A N     1 
ATOM   1281 C CA    . VAL A 1 166 ? -7.450  -9.602  46.170  1.00 67.99  ? 213 VAL A CA    1 
ATOM   1282 C C     . VAL A 1 166 ? -7.519  -11.119 46.071  1.00 70.93  ? 213 VAL A C     1 
ATOM   1283 O O     . VAL A 1 166 ? -7.772  -11.670 44.998  1.00 68.53  ? 213 VAL A O     1 
ATOM   1284 C CB    . VAL A 1 166 ? -8.741  -9.061  46.849  1.00 71.16  ? 213 VAL A CB    1 
ATOM   1285 C CG1   . VAL A 1 166 ? -8.602  -7.610  47.250  1.00 71.98  ? 213 VAL A CG1   1 
ATOM   1286 C CG2   . VAL A 1 166 ? -9.974  -9.269  45.975  1.00 70.03  ? 213 VAL A CG2   1 
ATOM   1287 N N     . ALA A 1 167 ? -7.326  -11.773 47.216  1.00 69.60  ? 214 ALA A N     1 
ATOM   1288 C CA    . ALA A 1 167 ? -7.491  -13.206 47.444  1.00 70.15  ? 214 ALA A CA    1 
ATOM   1289 C C     . ALA A 1 167 ? -8.618  -13.265 48.462  1.00 75.37  ? 214 ALA A C     1 
ATOM   1290 O O     . ALA A 1 167 ? -8.766  -12.329 49.266  1.00 76.80  ? 214 ALA A O     1 
ATOM   1291 C CB    . ALA A 1 167 ? -6.227  -13.815 48.036  1.00 71.65  ? 214 ALA A CB    1 
ATOM   1292 N N     . LEU A 1 168 ? -9.436  -14.328 48.405  1.00 70.46  ? 215 LEU A N     1 
ATOM   1293 C CA    . LEU A 1 168 ? -10.589 -14.517 49.282  1.00 70.31  ? 215 LEU A CA    1 
ATOM   1294 C C     . LEU A 1 168 ? -10.590 -15.941 49.712  1.00 74.10  ? 215 LEU A C     1 
ATOM   1295 O O     . LEU A 1 168 ? -10.655 -16.836 48.869  1.00 73.40  ? 215 LEU A O     1 
ATOM   1296 C CB    . LEU A 1 168 ? -11.897 -14.212 48.535  1.00 69.75  ? 215 LEU A CB    1 
ATOM   1297 C CG    . LEU A 1 168 ? -12.112 -12.814 47.966  1.00 71.83  ? 215 LEU A CG    1 
ATOM   1298 C CD1   . LEU A 1 168 ? -13.083 -12.862 46.855  1.00 70.24  ? 215 LEU A CD1   1 
ATOM   1299 C CD2   . LEU A 1 168 ? -12.606 -11.869 49.029  1.00 75.87  ? 215 LEU A CD2   1 
ATOM   1300 N N     . PHE A 1 169 ? -10.480 -16.168 51.015  1.00 72.99  ? 216 PHE A N     1 
ATOM   1301 C CA    . PHE A 1 169 ? -10.435 -17.514 51.568  1.00 73.70  ? 216 PHE A CA    1 
ATOM   1302 C C     . PHE A 1 169 ? -11.432 -17.753 52.702  1.00 80.23  ? 216 PHE A C     1 
ATOM   1303 O O     . PHE A 1 169 ? -11.903 -16.798 53.326  1.00 80.79  ? 216 PHE A O     1 
ATOM   1304 C CB    . PHE A 1 169 ? -8.998  -17.877 51.977  1.00 75.24  ? 216 PHE A CB    1 
ATOM   1305 C CG    . PHE A 1 169 ? -8.412  -17.108 53.130  1.00 77.66  ? 216 PHE A CG    1 
ATOM   1306 C CD1   . PHE A 1 169 ? -7.720  -15.921 52.915  1.00 81.05  ? 216 PHE A CD1   1 
ATOM   1307 C CD2   . PHE A 1 169 ? -8.522  -17.582 54.430  1.00 81.27  ? 216 PHE A CD2   1 
ATOM   1308 C CE1   . PHE A 1 169 ? -7.146  -15.219 53.989  1.00 83.49  ? 216 PHE A CE1   1 
ATOM   1309 C CE2   . PHE A 1 169 ? -7.988  -16.859 55.507  1.00 85.42  ? 216 PHE A CE2   1 
ATOM   1310 C CZ    . PHE A 1 169 ? -7.287  -15.697 55.276  1.00 83.13  ? 216 PHE A CZ    1 
ATOM   1311 N N     . ASN A 1 170 ? -11.739 -19.037 52.967  1.00 78.40  ? 217 ASN A N     1 
ATOM   1312 C CA    . ASN A 1 170 ? -12.668 -19.472 54.015  1.00 80.93  ? 217 ASN A CA    1 
ATOM   1313 C C     . ASN A 1 170 ? -12.029 -20.562 54.853  1.00 90.33  ? 217 ASN A C     1 
ATOM   1314 O O     . ASN A 1 170 ? -11.339 -21.430 54.331  1.00 89.85  ? 217 ASN A O     1 
ATOM   1315 C CB    . ASN A 1 170 ? -13.973 -19.926 53.408  1.00 75.64  ? 217 ASN A CB    1 
ATOM   1316 C CG    . ASN A 1 170 ? -14.969 -20.429 54.384  1.00 96.57  ? 217 ASN A CG    1 
ATOM   1317 O OD1   . ASN A 1 170 ? -14.897 -21.572 54.848  1.00 99.84  ? 217 ASN A OD1   1 
ATOM   1318 N ND2   . ASN A 1 170 ? -15.943 -19.604 54.688  1.00 89.78  ? 217 ASN A ND2   1 
ATOM   1319 N N     . ARG A 1 171 ? -12.275 -20.510 56.155  1.00 92.12  ? 218 ARG A N     1 
ATOM   1320 C CA    . ARG A 1 171 ? -11.694 -21.366 57.176  1.00 95.31  ? 218 ARG A CA    1 
ATOM   1321 C C     . ARG A 1 171 ? -12.813 -21.757 58.144  1.00 109.50 ? 218 ARG A C     1 
ATOM   1322 O O     . ARG A 1 171 ? -13.581 -20.896 58.585  1.00 109.62 ? 218 ARG A O     1 
ATOM   1323 C CB    . ARG A 1 171 ? -10.633 -20.520 57.899  1.00 93.49  ? 218 ARG A CB    1 
ATOM   1324 C CG    . ARG A 1 171 ? -9.573  -21.257 58.686  1.00 106.25 ? 218 ARG A CG    1 
ATOM   1325 C CD    . ARG A 1 171 ? -8.183  -21.060 58.103  1.00 107.83 ? 218 ARG A CD    1 
ATOM   1326 N NE    . ARG A 1 171 ? -7.610  -19.738 58.348  1.00 102.83 ? 218 ARG A NE    1 
ATOM   1327 C CZ    . ARG A 1 171 ? -6.433  -19.341 57.874  1.00 119.31 ? 218 ARG A CZ    1 
ATOM   1328 N NH1   . ARG A 1 171 ? -5.977  -18.124 58.146  1.00 111.53 ? 218 ARG A NH1   1 
ATOM   1329 N NH2   . ARG A 1 171 ? -5.701  -20.156 57.127  1.00 109.56 ? 218 ARG A NH2   1 
ATOM   1330 N N     . LEU A 1 172 ? -12.931 -23.052 58.458  1.00 114.47 ? 219 LEU A N     1 
ATOM   1331 C CA    . LEU A 1 172 ? -13.953 -23.518 59.394  1.00 120.34 ? 219 LEU A CA    1 
ATOM   1332 C C     . LEU A 1 172 ? -13.373 -23.986 60.707  1.00 129.88 ? 219 LEU A C     1 
ATOM   1333 O O     . LEU A 1 172 ? -12.368 -24.704 60.726  1.00 129.45 ? 219 LEU A O     1 
ATOM   1334 C CB    . LEU A 1 172 ? -14.851 -24.615 58.791  1.00 122.02 ? 219 LEU A CB    1 
ATOM   1335 C CG    . LEU A 1 172 ? -15.926 -24.224 57.735  1.00 126.73 ? 219 LEU A CG    1 
ATOM   1336 C CD1   . LEU A 1 172 ? -17.164 -25.092 57.903  1.00 130.34 ? 219 LEU A CD1   1 
ATOM   1337 C CD2   . LEU A 1 172 ? -16.328 -22.709 57.777  1.00 127.94 ? 219 LEU A CD2   1 
ATOM   1338 N N     . ARG A 1 173 ? -14.036 -23.582 61.809  1.00 131.48 ? 220 ARG A N     1 
ATOM   1339 C CA    . ARG A 1 173 ? -13.733 -23.952 63.199  1.00 136.01 ? 220 ARG A CA    1 
ATOM   1340 C C     . ARG A 1 173 ? -12.280 -23.687 63.649  1.00 141.53 ? 220 ARG A C     1 
ATOM   1341 O O     . ARG A 1 173 ? -11.706 -24.523 64.366  1.00 144.33 ? 220 ARG A O     1 
ATOM   1342 C CB    . ARG A 1 173 ? -14.119 -25.423 63.458  1.00 139.17 ? 220 ARG A CB    1 
ATOM   1343 C CG    . ARG A 1 173 ? -15.613 -25.703 63.516  1.00 149.85 ? 220 ARG A CG    1 
ATOM   1344 C CD    . ARG A 1 173 ? -15.869 -27.194 63.443  1.00 159.27 ? 220 ARG A CD    1 
ATOM   1345 N NE    . ARG A 1 173 ? -15.480 -27.745 62.143  1.00 162.58 ? 220 ARG A NE    1 
ATOM   1346 C CZ    . ARG A 1 173 ? -16.337 -28.155 61.213  1.00 175.58 ? 220 ARG A CZ    1 
ATOM   1347 N NH1   . ARG A 1 173 ? -17.647 -28.108 61.438  1.00 158.49 ? 220 ARG A NH1   1 
ATOM   1348 N NH2   . ARG A 1 173 ? -15.892 -28.632 60.058  1.00 163.84 ? 220 ARG A NH2   1 
ATOM   1349 N N     . SER A 1 174 ? -11.700 -22.518 63.249  1.00 135.27 ? 221 SER A N     1 
ATOM   1350 C CA    . SER A 1 174 ? -10.321 -22.101 63.573  1.00 134.80 ? 221 SER A CA    1 
ATOM   1351 C C     . SER A 1 174 ? -9.260  -23.139 63.101  1.00 136.90 ? 221 SER A C     1 
ATOM   1352 O O     . SER A 1 174 ? -8.212  -23.280 63.745  1.00 139.12 ? 221 SER A O     1 
ATOM   1353 C CB    . SER A 1 174 ? -10.166 -21.811 65.074  1.00 142.46 ? 221 SER A CB    1 
ATOM   1354 O OG    . SER A 1 174 ? -10.888 -20.676 65.526  1.00 151.92 ? 221 SER A OG    1 
ATOM   1355 N N     . GLN A 1 175 ? -9.532  -23.860 61.983  1.00 128.83 ? 222 GLN A N     1 
ATOM   1356 C CA    . GLN A 1 175 ? -8.633  -24.905 61.481  1.00 127.05 ? 222 GLN A CA    1 
ATOM   1357 C C     . GLN A 1 175 ? -7.918  -24.521 60.202  1.00 125.90 ? 222 GLN A C     1 
ATOM   1358 O O     . GLN A 1 175 ? -8.567  -24.189 59.214  1.00 122.94 ? 222 GLN A O     1 
ATOM   1359 C CB    . GLN A 1 175 ? -9.376  -26.255 61.298  1.00 129.35 ? 222 GLN A CB    1 
ATOM   1360 C CG    . GLN A 1 175 ? -10.029 -26.836 62.560  1.00 137.00 ? 222 GLN A CG    1 
ATOM   1361 C CD    . GLN A 1 175 ? -9.069  -27.081 63.711  1.00 151.80 ? 222 GLN A CD    1 
ATOM   1362 O OE1   . GLN A 1 175 ? -7.996  -27.684 63.563  1.00 146.06 ? 222 GLN A OE1   1 
ATOM   1363 N NE2   . GLN A 1 175 ? -9.440  -26.607 64.891  1.00 142.40 ? 222 GLN A NE2   1 
ATOM   1364 N N     . THR A 1 176 ? -6.585  -24.638 60.195  1.00 122.00 ? 223 THR A N     1 
ATOM   1365 C CA    . THR A 1 176 ? -5.755  -24.367 59.011  1.00 118.68 ? 223 THR A CA    1 
ATOM   1366 C C     . THR A 1 176 ? -6.022  -25.383 57.861  1.00 119.27 ? 223 THR A C     1 
ATOM   1367 O O     . THR A 1 176 ? -5.721  -25.111 56.690  1.00 116.06 ? 223 THR A O     1 
ATOM   1368 C CB    . THR A 1 176 ? -4.259  -24.287 59.407  1.00 130.86 ? 223 THR A CB    1 
ATOM   1369 O OG1   . THR A 1 176 ? -3.483  -23.895 58.265  1.00 131.83 ? 223 THR A OG1   1 
ATOM   1370 C CG2   . THR A 1 176 ? -3.711  -25.589 60.020  1.00 130.11 ? 223 THR A CG2   1 
ATOM   1371 N N     . VAL A 1 177 ? -6.563  -26.556 58.238  1.00 115.87 ? 224 VAL A N     1 
ATOM   1372 C CA    . VAL A 1 177 ? -6.895  -27.719 57.411  1.00 114.31 ? 224 VAL A CA    1 
ATOM   1373 C C     . VAL A 1 177 ? -8.070  -27.393 56.479  1.00 110.15 ? 224 VAL A C     1 
ATOM   1374 O O     . VAL A 1 177 ? -8.083  -27.842 55.331  1.00 106.76 ? 224 VAL A O     1 
ATOM   1375 C CB    . VAL A 1 177 ? -7.208  -28.961 58.328  1.00 123.31 ? 224 VAL A CB    1 
ATOM   1376 C CG1   . VAL A 1 177 ? -7.404  -30.243 57.513  1.00 124.25 ? 224 VAL A CG1   1 
ATOM   1377 C CG2   . VAL A 1 177 ? -6.136  -29.168 59.405  1.00 125.75 ? 224 VAL A CG2   1 
ATOM   1378 N N     . SER A 1 178 ? -9.058  -26.627 56.994  1.00 104.83 ? 225 SER A N     1 
ATOM   1379 C CA    . SER A 1 178 ? -10.294 -26.254 56.299  1.00 102.52 ? 225 SER A CA    1 
ATOM   1380 C C     . SER A 1 178 ? -10.142 -25.107 55.299  1.00 103.22 ? 225 SER A C     1 
ATOM   1381 O O     . SER A 1 178 ? -11.111 -24.786 54.591  1.00 103.67 ? 225 SER A O     1 
ATOM   1382 C CB    . SER A 1 178 ? -11.384 -25.917 57.306  1.00 106.92 ? 225 SER A CB    1 
ATOM   1383 O OG    . SER A 1 178 ? -10.990 -24.802 58.083  1.00 113.89 ? 225 SER A OG    1 
ATOM   1384 N N     . THR A 1 179 ? -8.945  -24.480 55.255  1.00 94.95  ? 226 THR A N     1 
ATOM   1385 C CA    . THR A 1 179 ? -8.639  -23.365 54.368  1.00 89.66  ? 226 THR A CA    1 
ATOM   1386 C C     . THR A 1 179 ? -8.836  -23.756 52.927  1.00 88.59  ? 226 THR A C     1 
ATOM   1387 O O     . THR A 1 179 ? -8.065  -24.554 52.378  1.00 89.00  ? 226 THR A O     1 
ATOM   1388 C CB    . THR A 1 179 ? -7.231  -22.781 54.607  1.00 93.52  ? 226 THR A CB    1 
ATOM   1389 O OG1   . THR A 1 179 ? -6.901  -22.844 55.996  1.00 103.90 ? 226 THR A OG1   1 
ATOM   1390 C CG2   . THR A 1 179 ? -7.090  -21.351 54.095  1.00 80.93  ? 226 THR A CG2   1 
ATOM   1391 N N     . ARG A 1 180 ? -9.894  -23.178 52.337  1.00 79.73  ? 227 ARG A N     1 
ATOM   1392 C CA    . ARG A 1 180 ? -10.295 -23.260 50.947  1.00 75.52  ? 227 ARG A CA    1 
ATOM   1393 C C     . ARG A 1 180 ? -10.259 -21.810 50.445  1.00 76.10  ? 227 ARG A C     1 
ATOM   1394 O O     . ARG A 1 180 ? -10.651 -20.910 51.185  1.00 75.72  ? 227 ARG A O     1 
ATOM   1395 C CB    . ARG A 1 180 ? -11.714 -23.827 50.824  1.00 75.14  ? 227 ARG A CB    1 
ATOM   1396 C CG    . ARG A 1 180 ? -11.887 -25.255 51.358  1.00 83.44  ? 227 ARG A CG    1 
ATOM   1397 C CD    . ARG A 1 180 ? -12.153 -26.205 50.224  1.00 82.41  ? 227 ARG A CD    1 
ATOM   1398 N NE    . ARG A 1 180 ? -12.188 -27.602 50.633  1.00 91.48  ? 227 ARG A NE    1 
ATOM   1399 C CZ    . ARG A 1 180 ? -12.089 -28.628 49.791  1.00 113.68 ? 227 ARG A CZ    1 
ATOM   1400 N NH1   . ARG A 1 180 ? -11.892 -28.415 48.490  1.00 89.82  ? 227 ARG A NH1   1 
ATOM   1401 N NH2   . ARG A 1 180 ? -12.160 -29.876 50.244  1.00 111.44 ? 227 ARG A NH2   1 
ATOM   1402 N N     . TYR A 1 181 ? -9.809  -21.591 49.191  1.00 70.70  ? 228 TYR A N     1 
ATOM   1403 C CA    . TYR A 1 181 ? -9.650  -20.282 48.535  1.00 68.49  ? 228 TYR A CA    1 
ATOM   1404 C C     . TYR A 1 181 ? -10.496 -20.160 47.288  1.00 70.90  ? 228 TYR A C     1 
ATOM   1405 O O     . TYR A 1 181 ? -10.494 -21.086 46.457  1.00 70.57  ? 228 TYR A O     1 
ATOM   1406 C CB    . TYR A 1 181 ? -8.190  -20.116 48.038  1.00 68.33  ? 228 TYR A CB    1 
ATOM   1407 C CG    . TYR A 1 181 ? -7.160  -20.256 49.121  1.00 72.55  ? 228 TYR A CG    1 
ATOM   1408 C CD1   . TYR A 1 181 ? -6.730  -21.513 49.546  1.00 75.93  ? 228 TYR A CD1   1 
ATOM   1409 C CD2   . TYR A 1 181 ? -6.655  -19.140 49.772  1.00 73.33  ? 228 TYR A CD2   1 
ATOM   1410 C CE1   . TYR A 1 181 ? -5.816  -21.650 50.586  1.00 75.05  ? 228 TYR A CE1   1 
ATOM   1411 C CE2   . TYR A 1 181 ? -5.731  -19.267 50.807  1.00 75.59  ? 228 TYR A CE2   1 
ATOM   1412 C CZ    . TYR A 1 181 ? -5.306  -20.523 51.200  1.00 81.64  ? 228 TYR A CZ    1 
ATOM   1413 O OH    . TYR A 1 181 ? -4.398  -20.650 52.218  1.00 88.50  ? 228 TYR A OH    1 
ATOM   1414 N N     . LEU A 1 182 ? -11.086 -18.969 47.066  1.00 65.81  ? 229 LEU A N     1 
ATOM   1415 C CA    . LEU A 1 182 ? -11.792 -18.719 45.806  1.00 64.44  ? 229 LEU A CA    1 
ATOM   1416 C C     . LEU A 1 182 ? -10.744 -18.844 44.666  1.00 72.84  ? 229 LEU A C     1 
ATOM   1417 O O     . LEU A 1 182 ? -9.580  -18.423 44.817  1.00 73.88  ? 229 LEU A O     1 
ATOM   1418 C CB    . LEU A 1 182 ? -12.503 -17.352 45.776  1.00 62.60  ? 229 LEU A CB    1 
ATOM   1419 C CG    . LEU A 1 182 ? -13.445 -17.127 44.601  1.00 63.81  ? 229 LEU A CG    1 
ATOM   1420 C CD1   . LEU A 1 182 ? -14.665 -17.958 44.737  1.00 64.58  ? 229 LEU A CD1   1 
ATOM   1421 C CD2   . LEU A 1 182 ? -13.828 -15.663 44.447  1.00 63.31  ? 229 LEU A CD2   1 
ATOM   1422 N N     . HIS A 1 183 ? -11.149 -19.508 43.576  1.00 69.93  ? 230 HIS A N     1 
ATOM   1423 C CA    . HIS A 1 183 ? -10.292 -19.836 42.459  1.00 68.21  ? 230 HIS A CA    1 
ATOM   1424 C C     . HIS A 1 183 ? -11.131 -20.371 41.300  1.00 70.15  ? 230 HIS A C     1 
ATOM   1425 O O     . HIS A 1 183 ? -12.082 -21.119 41.508  1.00 69.71  ? 230 HIS A O     1 
ATOM   1426 C CB    . HIS A 1 183 ? -9.325  -20.924 42.950  1.00 70.00  ? 230 HIS A CB    1 
ATOM   1427 C CG    . HIS A 1 183 ? -8.405  -21.487 41.921  1.00 72.45  ? 230 HIS A CG    1 
ATOM   1428 N ND1   . HIS A 1 183 ? -7.318  -20.784 41.476  1.00 72.70  ? 230 HIS A ND1   1 
ATOM   1429 C CD2   . HIS A 1 183 ? -8.383  -22.719 41.369  1.00 74.49  ? 230 HIS A CD2   1 
ATOM   1430 C CE1   . HIS A 1 183 ? -6.682  -21.592 40.646  1.00 71.39  ? 230 HIS A CE1   1 
ATOM   1431 N NE2   . HIS A 1 183 ? -7.306  -22.755 40.531  1.00 72.93  ? 230 HIS A NE2   1 
ATOM   1432 N N     . VAL A 1 184 ? -10.701 -20.056 40.074  1.00 65.05  ? 231 VAL A N     1 
ATOM   1433 C CA    . VAL A 1 184 ? -11.317 -20.507 38.830  1.00 63.18  ? 231 VAL A CA    1 
ATOM   1434 C C     . VAL A 1 184 ? -10.405 -21.510 38.153  1.00 64.68  ? 231 VAL A C     1 
ATOM   1435 O O     . VAL A 1 184 ? -9.248  -21.204 37.869  1.00 62.88  ? 231 VAL A O     1 
ATOM   1436 C CB    . VAL A 1 184 ? -11.536 -19.301 37.881  1.00 65.53  ? 231 VAL A CB    1 
ATOM   1437 C CG1   . VAL A 1 184 ? -12.196 -19.718 36.572  1.00 65.92  ? 231 VAL A CG1   1 
ATOM   1438 C CG2   . VAL A 1 184 ? -12.326 -18.208 38.559  1.00 65.35  ? 231 VAL A CG2   1 
ATOM   1439 N N     . GLU A 1 185 ? -10.922 -22.680 37.856  1.00 63.03  ? 232 GLU A N     1 
ATOM   1440 C CA    . GLU A 1 185 ? -10.236 -23.686 37.055  1.00 63.48  ? 232 GLU A CA    1 
ATOM   1441 C C     . GLU A 1 185 ? -11.275 -24.530 36.366  1.00 69.22  ? 232 GLU A C     1 
ATOM   1442 O O     . GLU A 1 185 ? -12.403 -24.624 36.881  1.00 73.30  ? 232 GLU A O     1 
ATOM   1443 C CB    . GLU A 1 185 ? -9.198  -24.482 37.841  1.00 66.03  ? 232 GLU A CB    1 
ATOM   1444 C CG    . GLU A 1 185 ? -9.694  -25.738 38.557  1.00 89.35  ? 232 GLU A CG    1 
ATOM   1445 C CD    . GLU A 1 185 ? -8.611  -26.587 39.214  1.00 116.86 ? 232 GLU A CD    1 
ATOM   1446 O OE1   . GLU A 1 185 ? -8.991  -27.518 39.961  1.00 116.59 ? 232 GLU A OE1   1 
ATOM   1447 O OE2   . GLU A 1 185 ? -7.400  -26.343 38.982  1.00 97.67  ? 232 GLU A OE2   1 
ATOM   1448 N N     . GLY A 1 186 ? -10.934 -25.067 35.192  1.00 62.91  ? 233 GLY A N     1 
ATOM   1449 C CA    . GLY A 1 186 ? -11.827 -25.880 34.370  1.00 64.13  ? 233 GLY A CA    1 
ATOM   1450 C C     . GLY A 1 186 ? -13.131 -25.201 33.969  1.00 72.50  ? 233 GLY A C     1 
ATOM   1451 O O     . GLY A 1 186 ? -14.183 -25.844 33.869  1.00 76.23  ? 233 GLY A O     1 
ATOM   1452 N N     . GLY A 1 187 ? -13.060 -23.891 33.776  1.00 68.24  ? 234 GLY A N     1 
ATOM   1453 C CA    . GLY A 1 187 ? -14.183 -23.054 33.383  1.00 68.30  ? 234 GLY A CA    1 
ATOM   1454 C C     . GLY A 1 187 ? -15.109 -22.653 34.505  1.00 74.16  ? 234 GLY A C     1 
ATOM   1455 O O     . GLY A 1 187 ? -16.158 -22.067 34.229  1.00 75.83  ? 234 GLY A O     1 
ATOM   1456 N N     . ASN A 1 188 ? -14.777 -23.009 35.769  1.00 71.48  ? 235 ASN A N     1 
ATOM   1457 C CA    . ASN A 1 188 ? -15.663 -22.718 36.910  1.00 72.22  ? 235 ASN A CA    1 
ATOM   1458 C C     . ASN A 1 188 ? -14.975 -22.117 38.096  1.00 73.04  ? 235 ASN A C     1 
ATOM   1459 O O     . ASN A 1 188 ? -13.792 -22.318 38.295  1.00 71.84  ? 235 ASN A O     1 
ATOM   1460 C CB    . ASN A 1 188 ? -16.401 -23.970 37.392  1.00 73.01  ? 235 ASN A CB    1 
ATOM   1461 C CG    . ASN A 1 188 ? -17.154 -24.742 36.338  1.00 87.21  ? 235 ASN A CG    1 
ATOM   1462 O OD1   . ASN A 1 188 ? -18.325 -24.487 36.094  1.00 73.73  ? 235 ASN A OD1   1 
ATOM   1463 N ND2   . ASN A 1 188 ? -16.513 -25.761 35.751  1.00 82.53  ? 235 ASN A ND2   1 
ATOM   1464 N N     . PHE A 1 189 ? -15.751 -21.419 38.912  1.00 68.57  ? 236 PHE A N     1 
ATOM   1465 C CA    . PHE A 1 189 ? -15.328 -20.870 40.180  1.00 66.96  ? 236 PHE A CA    1 
ATOM   1466 C C     . PHE A 1 189 ? -15.506 -21.998 41.167  1.00 71.65  ? 236 PHE A C     1 
ATOM   1467 O O     . PHE A 1 189 ? -16.574 -22.616 41.195  1.00 74.46  ? 236 PHE A O     1 
ATOM   1468 C CB    . PHE A 1 189 ? -16.228 -19.686 40.586  1.00 69.18  ? 236 PHE A CB    1 
ATOM   1469 C CG    . PHE A 1 189 ? -15.781 -18.331 40.080  1.00 68.17  ? 236 PHE A CG    1 
ATOM   1470 C CD1   . PHE A 1 189 ? -16.061 -17.929 38.776  1.00 69.49  ? 236 PHE A CD1   1 
ATOM   1471 C CD2   . PHE A 1 189 ? -15.060 -17.462 40.904  1.00 67.66  ? 236 PHE A CD2   1 
ATOM   1472 C CE1   . PHE A 1 189 ? -15.633 -16.674 38.301  1.00 69.00  ? 236 PHE A CE1   1 
ATOM   1473 C CE2   . PHE A 1 189 ? -14.641 -16.208 40.430  1.00 68.37  ? 236 PHE A CE2   1 
ATOM   1474 C CZ    . PHE A 1 189 ? -14.922 -15.823 39.132  1.00 65.82  ? 236 PHE A CZ    1 
ATOM   1475 N N     . HIS A 1 190 ? -14.452 -22.327 41.913  1.00 66.31  ? 237 HIS A N     1 
ATOM   1476 C CA    . HIS A 1 190 ? -14.507 -23.361 42.928  1.00 68.81  ? 237 HIS A CA    1 
ATOM   1477 C C     . HIS A 1 190 ? -13.738 -22.877 44.151  1.00 74.15  ? 237 HIS A C     1 
ATOM   1478 O O     . HIS A 1 190 ? -13.216 -21.766 44.110  1.00 72.20  ? 237 HIS A O     1 
ATOM   1479 C CB    . HIS A 1 190 ? -14.067 -24.727 42.381  1.00 70.71  ? 237 HIS A CB    1 
ATOM   1480 C CG    . HIS A 1 190 ? -12.601 -24.905 42.239  1.00 74.26  ? 237 HIS A CG    1 
ATOM   1481 N ND1   . HIS A 1 190 ? -11.833 -24.028 41.491  1.00 75.04  ? 237 HIS A ND1   1 
ATOM   1482 C CD2   . HIS A 1 190 ? -11.800 -25.877 42.725  1.00 77.97  ? 237 HIS A CD2   1 
ATOM   1483 C CE1   . HIS A 1 190 ? -10.591 -24.485 41.559  1.00 73.91  ? 237 HIS A CE1   1 
ATOM   1484 N NE2   . HIS A 1 190 ? -10.520 -25.596 42.281  1.00 76.18  ? 237 HIS A NE2   1 
ATOM   1485 N N     . ALA A 1 191 ? -13.739 -23.640 45.266  1.00 73.12  ? 238 ALA A N     1 
ATOM   1486 C CA    . ALA A 1 191 ? -13.026 -23.266 46.484  1.00 72.96  ? 238 ALA A CA    1 
ATOM   1487 C C     . ALA A 1 191 ? -11.945 -24.305 46.702  1.00 77.82  ? 238 ALA A C     1 
ATOM   1488 O O     . ALA A 1 191 ? -12.226 -25.417 47.137  1.00 78.48  ? 238 ALA A O     1 
ATOM   1489 C CB    . ALA A 1 191 ? -13.979 -23.201 47.661  1.00 76.14  ? 238 ALA A CB    1 
ATOM   1490 N N     . SER A 1 192 ? -10.723 -23.965 46.291  1.00 74.66  ? 239 SER A N     1 
ATOM   1491 C CA    . SER A 1 192 ? -9.588  -24.862 46.334  1.00 76.28  ? 239 SER A CA    1 
ATOM   1492 C C     . SER A 1 192 ? -8.890  -24.830 47.656  1.00 85.66  ? 239 SER A C     1 
ATOM   1493 O O     . SER A 1 192 ? -8.709  -23.764 48.234  1.00 88.75  ? 239 SER A O     1 
ATOM   1494 C CB    . SER A 1 192 ? -8.590  -24.506 45.238  1.00 78.15  ? 239 SER A CB    1 
ATOM   1495 O OG    . SER A 1 192 ? -7.739  -25.621 45.031  1.00 90.43  ? 239 SER A OG    1 
ATOM   1496 N N     . SER A 1 193 ? -8.423  -25.971 48.096  1.00 82.65  ? 240 SER A N     1 
ATOM   1497 C CA    . SER A 1 193 ? -7.658  -26.072 49.323  1.00 85.29  ? 240 SER A CA    1 
ATOM   1498 C C     . SER A 1 193 ? -6.150  -25.997 48.976  1.00 90.47  ? 240 SER A C     1 
ATOM   1499 O O     . SER A 1 193 ? -5.291  -25.985 49.874  1.00 90.21  ? 240 SER A O     1 
ATOM   1500 C CB    . SER A 1 193 ? -7.935  -27.429 49.957  1.00 92.24  ? 240 SER A CB    1 
ATOM   1501 O OG    . SER A 1 193 ? -7.491  -28.467 49.096  1.00 101.93 ? 240 SER A OG    1 
ATOM   1502 N N     . GLN A 1 194 ? -5.841  -26.011 47.658  1.00 86.28  ? 241 GLN A N     1 
ATOM   1503 C CA    . GLN A 1 194 ? -4.481  -26.099 47.170  1.00 85.75  ? 241 GLN A CA    1 
ATOM   1504 C C     . GLN A 1 194 ? -4.011  -25.012 46.249  1.00 86.67  ? 241 GLN A C     1 
ATOM   1505 O O     . GLN A 1 194 ? -2.809  -24.750 46.191  1.00 87.24  ? 241 GLN A O     1 
ATOM   1506 C CB    . GLN A 1 194 ? -4.200  -27.514 46.648  1.00 89.05  ? 241 GLN A CB    1 
ATOM   1507 C CG    . GLN A 1 194 ? -3.739  -28.426 47.799  1.00 125.16 ? 241 GLN A CG    1 
ATOM   1508 C CD    . GLN A 1 194 ? -3.805  -29.898 47.483  1.00 163.94 ? 241 GLN A CD    1 
ATOM   1509 O OE1   . GLN A 1 194 ? -3.252  -30.376 46.482  1.00 163.56 ? 241 GLN A OE1   1 
ATOM   1510 N NE2   . GLN A 1 194 ? -4.444  -30.663 48.365  1.00 160.95 ? 241 GLN A NE2   1 
ATOM   1511 N N     . GLN A 1 195 ? -4.943  -24.324 45.593  1.00 80.81  ? 242 GLN A N     1 
ATOM   1512 C CA    . GLN A 1 195 ? -4.647  -23.185 44.710  1.00 77.70  ? 242 GLN A CA    1 
ATOM   1513 C C     . GLN A 1 195 ? -5.440  -21.941 45.152  1.00 78.42  ? 242 GLN A C     1 
ATOM   1514 O O     . GLN A 1 195 ? -6.401  -22.049 45.929  1.00 80.11  ? 242 GLN A O     1 
ATOM   1515 C CB    . GLN A 1 195 ? -4.993  -23.537 43.252  1.00 77.89  ? 242 GLN A CB    1 
ATOM   1516 C CG    . GLN A 1 195 ? -4.187  -24.703 42.676  1.00 85.41  ? 242 GLN A CG    1 
ATOM   1517 C CD    . GLN A 1 195 ? -3.977  -24.527 41.203  1.00 111.15 ? 242 GLN A CD    1 
ATOM   1518 O OE1   . GLN A 1 195 ? -3.192  -23.663 40.750  1.00 119.38 ? 242 GLN A OE1   1 
ATOM   1519 N NE2   . GLN A 1 195 ? -4.707  -25.311 40.426  1.00 87.60  ? 242 GLN A NE2   1 
ATOM   1520 N N     . TRP A 1 196 ? -5.041  -20.760 44.663  1.00 69.71  ? 243 TRP A N     1 
ATOM   1521 C CA    . TRP A 1 196 ? -5.729  -19.504 44.982  1.00 67.00  ? 243 TRP A CA    1 
ATOM   1522 C C     . TRP A 1 196 ? -5.627  -18.532 43.844  1.00 68.15  ? 243 TRP A C     1 
ATOM   1523 O O     . TRP A 1 196 ? -4.608  -18.473 43.156  1.00 66.38  ? 243 TRP A O     1 
ATOM   1524 C CB    . TRP A 1 196 ? -5.283  -18.862 46.328  1.00 65.78  ? 243 TRP A CB    1 
ATOM   1525 C CG    . TRP A 1 196 ? -3.827  -18.524 46.434  1.00 65.56  ? 243 TRP A CG    1 
ATOM   1526 C CD1   . TRP A 1 196 ? -2.826  -19.328 46.913  1.00 69.83  ? 243 TRP A CD1   1 
ATOM   1527 C CD2   . TRP A 1 196 ? -3.221  -17.266 46.131  1.00 64.18  ? 243 TRP A CD2   1 
ATOM   1528 N NE1   . TRP A 1 196 ? -1.618  -18.675 46.836  1.00 69.38  ? 243 TRP A NE1   1 
ATOM   1529 C CE2   . TRP A 1 196 ? -1.835  -17.395 46.382  1.00 69.59  ? 243 TRP A CE2   1 
ATOM   1530 C CE3   . TRP A 1 196 ? -3.711  -16.034 45.665  1.00 63.92  ? 243 TRP A CE3   1 
ATOM   1531 C CZ2   . TRP A 1 196 ? -0.945  -16.330 46.206  1.00 68.39  ? 243 TRP A CZ2   1 
ATOM   1532 C CZ3   . TRP A 1 196 ? -2.819  -15.010 45.417  1.00 64.46  ? 243 TRP A CZ3   1 
ATOM   1533 C CH2   . TRP A 1 196 ? -1.455  -15.162 45.685  1.00 66.27  ? 243 TRP A CH2   1 
ATOM   1534 N N     . GLY A 1 197 ? -6.719  -17.822 43.623  1.00 64.62  ? 244 GLY A N     1 
ATOM   1535 C CA    . GLY A 1 197 ? -6.836  -16.843 42.564  1.00 63.30  ? 244 GLY A CA    1 
ATOM   1536 C C     . GLY A 1 197 ? -6.651  -15.444 43.088  1.00 69.79  ? 244 GLY A C     1 
ATOM   1537 O O     . GLY A 1 197 ? -6.795  -15.205 44.290  1.00 72.51  ? 244 GLY A O     1 
ATOM   1538 N N     . ALA A 1 198 ? -6.324  -14.523 42.174  1.00 64.96  ? 245 ALA A N     1 
ATOM   1539 C CA    . ALA A 1 198 ? -6.171  -13.118 42.463  1.00 65.25  ? 245 ALA A CA    1 
ATOM   1540 C C     . ALA A 1 198 ? -7.255  -12.429 41.651  1.00 70.21  ? 245 ALA A C     1 
ATOM   1541 O O     . ALA A 1 198 ? -7.295  -12.520 40.421  1.00 70.67  ? 245 ALA A O     1 
ATOM   1542 C CB    . ALA A 1 198 ? -4.802  -12.629 42.068  1.00 65.31  ? 245 ALA A CB    1 
ATOM   1543 N N     . PHE A 1 199 ? -8.179  -11.807 42.349  1.00 64.68  ? 246 PHE A N     1 
ATOM   1544 C CA    . PHE A 1 199 ? -9.285  -11.200 41.691  1.00 63.92  ? 246 PHE A CA    1 
ATOM   1545 C C     . PHE A 1 199 ? -9.170  -9.702  41.756  1.00 70.29  ? 246 PHE A C     1 
ATOM   1546 O O     . PHE A 1 199 ? -8.911  -9.134  42.806  1.00 71.49  ? 246 PHE A O     1 
ATOM   1547 C CB    . PHE A 1 199 ? -10.590 -11.701 42.355  1.00 66.68  ? 246 PHE A CB    1 
ATOM   1548 C CG    . PHE A 1 199 ? -10.705 -13.212 42.352  1.00 67.17  ? 246 PHE A CG    1 
ATOM   1549 C CD1   . PHE A 1 199 ? -10.109 -13.971 43.345  1.00 70.43  ? 246 PHE A CD1   1 
ATOM   1550 C CD2   . PHE A 1 199 ? -11.351 -13.878 41.308  1.00 67.49  ? 246 PHE A CD2   1 
ATOM   1551 C CE1   . PHE A 1 199 ? -10.167 -15.369 43.296  1.00 72.20  ? 246 PHE A CE1   1 
ATOM   1552 C CE2   . PHE A 1 199 ? -11.383 -15.261 41.246  1.00 68.98  ? 246 PHE A CE2   1 
ATOM   1553 C CZ    . PHE A 1 199 ? -10.815 -16.001 42.250  1.00 69.13  ? 246 PHE A CZ    1 
ATOM   1554 N N     . TYR A 1 200 ? -9.360  -9.051  40.630  1.00 67.55  ? 247 TYR A N     1 
ATOM   1555 C CA    . TYR A 1 200 ? -9.444  -7.609  40.612  1.00 68.16  ? 247 TYR A CA    1 
ATOM   1556 C C     . TYR A 1 200 ? -10.753 -7.301  41.309  1.00 73.09  ? 247 TYR A C     1 
ATOM   1557 O O     . TYR A 1 200 ? -11.766 -7.959  41.054  1.00 74.74  ? 247 TYR A O     1 
ATOM   1558 C CB    . TYR A 1 200 ? -9.584  -7.092  39.176  1.00 68.47  ? 247 TYR A CB    1 
ATOM   1559 C CG    . TYR A 1 200 ? -8.314  -7.184  38.382  1.00 68.96  ? 247 TYR A CG    1 
ATOM   1560 C CD1   . TYR A 1 200 ? -7.329  -6.212  38.493  1.00 72.18  ? 247 TYR A CD1   1 
ATOM   1561 C CD2   . TYR A 1 200 ? -8.094  -8.237  37.512  1.00 67.86  ? 247 TYR A CD2   1 
ATOM   1562 C CE1   . TYR A 1 200 ? -6.163  -6.280  37.737  1.00 73.61  ? 247 TYR A CE1   1 
ATOM   1563 C CE2   . TYR A 1 200 ? -6.957  -8.291  36.720  1.00 67.81  ? 247 TYR A CE2   1 
ATOM   1564 C CZ    . TYR A 1 200 ? -5.974  -7.333  36.860  1.00 78.69  ? 247 TYR A CZ    1 
ATOM   1565 O OH    . TYR A 1 200 ? -4.821  -7.446  36.116  1.00 84.76  ? 247 TYR A OH    1 
ATOM   1566 N N     . ILE A 1 201 ? -10.739 -6.339  42.189  1.00 68.48  ? 248 ILE A N     1 
ATOM   1567 C CA    . ILE A 1 201 ? -11.959 -5.902  42.836  1.00 68.73  ? 248 ILE A CA    1 
ATOM   1568 C C     . ILE A 1 201 ? -12.231 -4.515  42.251  1.00 74.48  ? 248 ILE A C     1 
ATOM   1569 O O     . ILE A 1 201 ? -11.402 -3.610  42.394  1.00 75.40  ? 248 ILE A O     1 
ATOM   1570 C CB    . ILE A 1 201 ? -11.856 -6.002  44.368  1.00 71.62  ? 248 ILE A CB    1 
ATOM   1571 C CG1   . ILE A 1 201 ? -13.066 -5.412  45.065  1.00 72.81  ? 248 ILE A CG1   1 
ATOM   1572 C CG2   . ILE A 1 201 ? -10.545 -5.416  44.878  1.00 74.32  ? 248 ILE A CG2   1 
ATOM   1573 C CD1   . ILE A 1 201 ? -13.447 -6.157  46.262  1.00 77.94  ? 248 ILE A CD1   1 
ATOM   1574 N N     . HIS A 1 202 ? -13.310 -4.406  41.455  1.00 70.78  ? 249 HIS A N     1 
ATOM   1575 C CA    . HIS A 1 202 ? -13.700 -3.170  40.763  1.00 71.54  ? 249 HIS A CA    1 
ATOM   1576 C C     . HIS A 1 202 ? -14.902 -2.579  41.398  1.00 77.74  ? 249 HIS A C     1 
ATOM   1577 O O     . HIS A 1 202 ? -15.870 -3.290  41.647  1.00 78.26  ? 249 HIS A O     1 
ATOM   1578 C CB    . HIS A 1 202 ? -14.043 -3.434  39.294  1.00 71.32  ? 249 HIS A CB    1 
ATOM   1579 C CG    . HIS A 1 202 ? -12.906 -3.959  38.480  1.00 72.46  ? 249 HIS A CG    1 
ATOM   1580 N ND1   . HIS A 1 202 ? -11.838 -3.158  38.143  1.00 73.72  ? 249 HIS A ND1   1 
ATOM   1581 C CD2   . HIS A 1 202 ? -12.738 -5.177  37.915  1.00 72.20  ? 249 HIS A CD2   1 
ATOM   1582 C CE1   . HIS A 1 202 ? -11.043 -3.915  37.408  1.00 71.17  ? 249 HIS A CE1   1 
ATOM   1583 N NE2   . HIS A 1 202 ? -11.546 -5.133  37.235  1.00 70.76  ? 249 HIS A NE2   1 
ATOM   1584 N N     . LEU A 1 203 ? -14.878 -1.272  41.612  1.00 76.54  ? 250 LEU A N     1 
ATOM   1585 C CA    . LEU A 1 203 ? -16.016 -0.583  42.185  1.00 79.14  ? 250 LEU A CA    1 
ATOM   1586 C C     . LEU A 1 203 ? -16.905 -0.089  41.053  1.00 85.43  ? 250 LEU A C     1 
ATOM   1587 O O     . LEU A 1 203 ? -16.400 0.515   40.102  1.00 85.22  ? 250 LEU A O     1 
ATOM   1588 C CB    . LEU A 1 203 ? -15.537 0.590   43.048  1.00 80.95  ? 250 LEU A CB    1 
ATOM   1589 C CG    . LEU A 1 203 ? -16.604 1.562   43.524  1.00 87.76  ? 250 LEU A CG    1 
ATOM   1590 C CD1   . LEU A 1 203 ? -17.527 0.915   44.535  1.00 87.86  ? 250 LEU A CD1   1 
ATOM   1591 C CD2   . LEU A 1 203 ? -15.984 2.811   44.038  1.00 91.33  ? 250 LEU A CD2   1 
ATOM   1592 N N     . LEU A 1 204 ? -18.218 -0.355  41.151  1.00 83.46  ? 251 LEU A N     1 
ATOM   1593 C CA    . LEU A 1 204 ? -19.200 0.123   40.169  1.00 85.36  ? 251 LEU A CA    1 
ATOM   1594 C C     . LEU A 1 204 ? -20.127 1.095   40.866  1.00 93.53  ? 251 LEU A C     1 
ATOM   1595 O O     . LEU A 1 204 ? -20.372 0.909   42.049  1.00 95.21  ? 251 LEU A O     1 
ATOM   1596 C CB    . LEU A 1 204 ? -20.088 -1.001  39.557  1.00 84.26  ? 251 LEU A CB    1 
ATOM   1597 C CG    . LEU A 1 204 ? -19.672 -2.457  39.523  1.00 84.01  ? 251 LEU A CG    1 
ATOM   1598 C CD1   . LEU A 1 204 ? -20.666 -3.236  38.713  1.00 83.15  ? 251 LEU A CD1   1 
ATOM   1599 C CD2   . LEU A 1 204 ? -18.298 -2.637  38.953  1.00 80.78  ? 251 LEU A CD2   1 
ATOM   1600 N N     . ASP A 1 205 ? -20.714 2.074   40.159  1.00 92.84  ? 252 ASP A N     1 
ATOM   1601 C CA    . ASP A 1 205 ? -21.684 2.900   40.867  1.00 96.75  ? 252 ASP A CA    1 
ATOM   1602 C C     . ASP A 1 205 ? -22.951 2.100   41.151  1.00 102.21 ? 252 ASP A C     1 
ATOM   1603 O O     . ASP A 1 205 ? -23.186 1.071   40.501  1.00 99.10  ? 252 ASP A O     1 
ATOM   1604 C CB    . ASP A 1 205 ? -21.920 4.321   40.282  1.00 102.00 ? 252 ASP A CB    1 
ATOM   1605 C CG    . ASP A 1 205 ? -22.058 4.468   38.784  1.00 115.23 ? 252 ASP A CG    1 
ATOM   1606 O OD1   . ASP A 1 205 ? -21.040 4.314   38.082  1.00 118.13 ? 252 ASP A OD1   1 
ATOM   1607 O OD2   . ASP A 1 205 ? -23.143 4.891   38.327  1.00 119.52 ? 252 ASP A OD2   1 
ATOM   1608 N N     . ASP A 1 206 ? -23.699 2.498   42.200  1.00 103.65 ? 253 ASP A N     1 
ATOM   1609 C CA    . ASP A 1 206 ? -24.910 1.785   42.619  1.00 105.57 ? 253 ASP A CA    1 
ATOM   1610 C C     . ASP A 1 206 ? -25.909 1.589   41.460  1.00 109.61 ? 253 ASP A C     1 
ATOM   1611 O O     . ASP A 1 206 ? -26.467 0.497   41.288  1.00 107.54 ? 253 ASP A O     1 
ATOM   1612 C CB    . ASP A 1 206 ? -25.551 2.429   43.876  1.00 110.91 ? 253 ASP A CB    1 
ATOM   1613 C CG    . ASP A 1 206 ? -24.885 2.078   45.219  1.00 123.91 ? 253 ASP A CG    1 
ATOM   1614 O OD1   . ASP A 1 206 ? -24.542 0.874   45.430  1.00 123.19 ? 253 ASP A OD1   1 
ATOM   1615 O OD2   . ASP A 1 206 ? -24.777 2.986   46.092  1.00 128.68 ? 253 ASP A OD2   1 
ATOM   1616 N N     . ASP A 1 207 ? -26.020 2.608   40.602  1.00 107.91 ? 254 ASP A N     1 
ATOM   1617 C CA    . ASP A 1 207 ? -26.916 2.604   39.461  1.00 109.84 ? 254 ASP A CA    1 
ATOM   1618 C C     . ASP A 1 207 ? -26.570 1.603   38.371  1.00 111.12 ? 254 ASP A C     1 
ATOM   1619 O O     . ASP A 1 207 ? -27.442 1.246   37.586  1.00 112.30 ? 254 ASP A O     1 
ATOM   1620 C CB    . ASP A 1 207 ? -27.157 4.041   38.955  1.00 115.66 ? 254 ASP A CB    1 
ATOM   1621 C CG    . ASP A 1 207 ? -28.097 4.847   39.871  1.00 144.87 ? 254 ASP A CG    1 
ATOM   1622 O OD1   . ASP A 1 207 ? -28.112 4.582   41.117  1.00 146.07 ? 254 ASP A OD1   1 
ATOM   1623 O OD2   . ASP A 1 207 ? -28.836 5.727   39.348  1.00 160.36 ? 254 ASP A OD2   1 
ATOM   1624 N N     . GLU A 1 208 ? -25.334 1.081   38.378  1.00 104.97 ? 255 GLU A N     1 
ATOM   1625 C CA    . GLU A 1 208 ? -24.855 0.125   37.375  1.00 102.36 ? 255 GLU A CA    1 
ATOM   1626 C C     . GLU A 1 208 ? -25.531 -1.238  37.285  1.00 104.89 ? 255 GLU A C     1 
ATOM   1627 O O     . GLU A 1 208 ? -25.516 -2.042  38.227  1.00 101.80 ? 255 GLU A O     1 
ATOM   1628 C CB    . GLU A 1 208 ? -23.317 0.006   37.335  1.00 100.19 ? 255 GLU A CB    1 
ATOM   1629 C CG    . GLU A 1 208 ? -22.791 -0.669  36.075  1.00 102.26 ? 255 GLU A CG    1 
ATOM   1630 C CD    . GLU A 1 208 ? -21.758 0.115   35.294  1.00 125.27 ? 255 GLU A CD    1 
ATOM   1631 O OE1   . GLU A 1 208 ? -21.691 -0.076  34.057  1.00 100.36 ? 255 GLU A OE1   1 
ATOM   1632 O OE2   . GLU A 1 208 ? -20.992 0.891   35.918  1.00 130.49 ? 255 GLU A OE2   1 
ATOM   1633 N N     . SER A 1 209 ? -26.040 -1.482  36.071  1.00 103.90 ? 256 SER A N     1 
ATOM   1634 C CA    . SER A 1 209 ? -26.702 -2.666  35.531  1.00 104.36 ? 256 SER A CA    1 
ATOM   1635 C C     . SER A 1 209 ? -25.755 -3.860  35.448  1.00 106.04 ? 256 SER A C     1 
ATOM   1636 O O     . SER A 1 209 ? -24.535 -3.678  35.347  1.00 102.89 ? 256 SER A O     1 
ATOM   1637 C CB    . SER A 1 209 ? -27.200 -2.362  34.118  1.00 109.20 ? 256 SER A CB    1 
ATOM   1638 O OG    . SER A 1 209 ? -26.235 -1.679  33.328  1.00 112.91 ? 256 SER A OG    1 
ATOM   1639 N N     . GLU A 1 210 ? -26.343 -5.082  35.437  1.00 102.96 ? 257 GLU A N     1 
ATOM   1640 C CA    . GLU A 1 210 ? -25.648 -6.362  35.288  1.00 99.23  ? 257 GLU A CA    1 
ATOM   1641 C C     . GLU A 1 210 ? -25.274 -6.574  33.836  1.00 100.48 ? 257 GLU A C     1 
ATOM   1642 O O     . GLU A 1 210 ? -25.854 -5.957  32.946  1.00 101.36 ? 257 GLU A O     1 
ATOM   1643 C CB    . GLU A 1 210 ? -26.553 -7.518  35.745  1.00 102.00 ? 257 GLU A CB    1 
ATOM   1644 C CG    . GLU A 1 210 ? -25.967 -8.377  36.857  1.00 108.27 ? 257 GLU A CG    1 
ATOM   1645 C CD    . GLU A 1 210 ? -24.771 -9.211  36.453  1.00 113.90 ? 257 GLU A CD    1 
ATOM   1646 O OE1   . GLU A 1 210 ? -24.953 -10.165 35.663  1.00 136.30 ? 257 GLU A OE1   1 
ATOM   1647 O OE2   . GLU A 1 210 ? -23.647 -8.894  36.901  1.00 85.05  ? 257 GLU A OE2   1 
ATOM   1648 N N     . GLY A 1 211 ? -24.305 -7.447  33.607  1.00 95.19  ? 258 GLY A N     1 
ATOM   1649 C CA    . GLY A 1 211 ? -23.852 -7.778  32.260  1.00 93.83  ? 258 GLY A CA    1 
ATOM   1650 C C     . GLY A 1 211 ? -22.360 -7.865  32.172  1.00 93.44  ? 258 GLY A C     1 
ATOM   1651 O O     . GLY A 1 211 ? -21.665 -7.383  33.066  1.00 93.23  ? 258 GLY A O     1 
ATOM   1652 N N     . GLU A 1 212 ? -21.874 -8.467  31.084  1.00 88.12  ? 259 GLU A N     1 
ATOM   1653 C CA    . GLU A 1 212 ? -20.464 -8.739  30.737  1.00 83.97  ? 259 GLU A CA    1 
ATOM   1654 C C     . GLU A 1 212 ? -19.573 -7.480  30.667  1.00 87.49  ? 259 GLU A C     1 
ATOM   1655 O O     . GLU A 1 212 ? -18.385 -7.557  30.975  1.00 84.86  ? 259 GLU A O     1 
ATOM   1656 C CB    . GLU A 1 212 ? -20.452 -9.488  29.403  1.00 84.88  ? 259 GLU A CB    1 
ATOM   1657 C CG    . GLU A 1 212 ? -19.115 -9.970  28.889  1.00 94.39  ? 259 GLU A CG    1 
ATOM   1658 C CD    . GLU A 1 212 ? -19.139 -10.352 27.424  1.00 111.26 ? 259 GLU A CD    1 
ATOM   1659 O OE1   . GLU A 1 212 ? -18.055 -10.642 26.869  1.00 105.03 ? 259 GLU A OE1   1 
ATOM   1660 O OE2   . GLU A 1 212 ? -20.240 -10.366 26.827  1.00 110.74 ? 259 GLU A OE2   1 
ATOM   1661 N N     . GLU A 1 213 ? -20.144 -6.339  30.243  1.00 86.85  ? 260 GLU A N     1 
ATOM   1662 C CA    . GLU A 1 213 ? -19.426 -5.065  30.118  1.00 86.19  ? 260 GLU A CA    1 
ATOM   1663 C C     . GLU A 1 213 ? -19.841 -4.167  31.243  1.00 87.42  ? 260 GLU A C     1 
ATOM   1664 O O     . GLU A 1 213 ? -21.029 -4.077  31.529  1.00 89.69  ? 260 GLU A O     1 
ATOM   1665 C CB    . GLU A 1 213 ? -19.744 -4.355  28.781  1.00 89.77  ? 260 GLU A CB    1 
ATOM   1666 C CG    . GLU A 1 213 ? -18.785 -4.624  27.629  1.00 99.32  ? 260 GLU A CG    1 
ATOM   1667 C CD    . GLU A 1 213 ? -19.457 -4.617  26.264  1.00 133.23 ? 260 GLU A CD    1 
ATOM   1668 O OE1   . GLU A 1 213 ? -20.255 -3.689  25.990  1.00 148.10 ? 260 GLU A OE1   1 
ATOM   1669 O OE2   . GLU A 1 213 ? -19.208 -5.557  25.473  1.00 121.61 ? 260 GLU A OE2   1 
ATOM   1670 N N     . PHE A 1 214 ? -18.883 -3.474  31.861  1.00 80.62  ? 261 PHE A N     1 
ATOM   1671 C CA    . PHE A 1 214 ? -19.175 -2.529  32.928  1.00 81.94  ? 261 PHE A CA    1 
ATOM   1672 C C     . PHE A 1 214 ? -18.166 -1.416  33.048  1.00 87.65  ? 261 PHE A C     1 
ATOM   1673 O O     . PHE A 1 214 ? -17.044 -1.491  32.526  1.00 83.37  ? 261 PHE A O     1 
ATOM   1674 C CB    . PHE A 1 214 ? -19.428 -3.201  34.282  1.00 82.90  ? 261 PHE A CB    1 
ATOM   1675 C CG    . PHE A 1 214 ? -18.320 -4.108  34.723  1.00 81.54  ? 261 PHE A CG    1 
ATOM   1676 C CD1   . PHE A 1 214 ? -18.250 -5.420  34.262  1.00 83.15  ? 261 PHE A CD1   1 
ATOM   1677 C CD2   . PHE A 1 214 ? -17.343 -3.658  35.604  1.00 83.42  ? 261 PHE A CD2   1 
ATOM   1678 C CE1   . PHE A 1 214 ? -17.214 -6.254  34.653  1.00 82.17  ? 261 PHE A CE1   1 
ATOM   1679 C CE2   . PHE A 1 214 ? -16.315 -4.495  36.013  1.00 83.93  ? 261 PHE A CE2   1 
ATOM   1680 C CZ    . PHE A 1 214 ? -16.247 -5.783  35.518  1.00 81.17  ? 261 PHE A CZ    1 
ATOM   1681 N N     . THR A 1 215 ? -18.611 -0.342  33.712  1.00 88.67  ? 262 THR A N     1 
ATOM   1682 C CA    . THR A 1 215 ? -17.802 0.832   33.951  1.00 89.30  ? 262 THR A CA    1 
ATOM   1683 C C     . THR A 1 215 ? -17.279 0.719   35.362  1.00 91.37  ? 262 THR A C     1 
ATOM   1684 O O     . THR A 1 215 ? -18.038 0.446   36.301  1.00 92.30  ? 262 THR A O     1 
ATOM   1685 C CB    . THR A 1 215 ? -18.575 2.122   33.651  1.00 103.09 ? 262 THR A CB    1 
ATOM   1686 O OG1   . THR A 1 215 ? -19.692 1.825   32.802  1.00 106.16 ? 262 THR A OG1   1 
ATOM   1687 C CG2   . THR A 1 215 ? -17.698 3.178   32.989  1.00 102.53 ? 262 THR A CG2   1 
ATOM   1688 N N     . VAL A 1 216 ? -15.964 0.836   35.489  1.00 84.48  ? 263 VAL A N     1 
ATOM   1689 C CA    . VAL A 1 216 ? -15.289 0.771   36.772  1.00 82.70  ? 263 VAL A CA    1 
ATOM   1690 C C     . VAL A 1 216 ? -15.094 2.189   37.270  1.00 88.47  ? 263 VAL A C     1 
ATOM   1691 O O     . VAL A 1 216 ? -14.974 3.130   36.473  1.00 89.34  ? 263 VAL A O     1 
ATOM   1692 C CB    . VAL A 1 216 ? -13.972 -0.043  36.731  1.00 83.88  ? 263 VAL A CB    1 
ATOM   1693 C CG1   . VAL A 1 216 ? -14.256 -1.493  36.381  1.00 81.92  ? 263 VAL A CG1   1 
ATOM   1694 C CG2   . VAL A 1 216 ? -12.961 0.555   35.758  1.00 83.35  ? 263 VAL A CG2   1 
ATOM   1695 N N     . ARG A 1 217 ? -15.122 2.346   38.586  1.00 84.87  ? 264 ARG A N     1 
ATOM   1696 C CA    . ARG A 1 217 ? -14.956 3.642   39.222  1.00 86.33  ? 264 ARG A CA    1 
ATOM   1697 C C     . ARG A 1 217 ? -13.759 3.591   40.132  1.00 88.58  ? 264 ARG A C     1 
ATOM   1698 O O     . ARG A 1 217 ? -13.451 2.525   40.661  1.00 86.17  ? 264 ARG A O     1 
ATOM   1699 C CB    . ARG A 1 217 ? -16.228 4.039   39.991  1.00 86.87  ? 264 ARG A CB    1 
ATOM   1700 C CG    . ARG A 1 217 ? -17.407 4.400   39.088  1.00 97.44  ? 264 ARG A CG    1 
ATOM   1701 C CD    . ARG A 1 217 ? -17.222 5.743   38.370  1.00 111.96 ? 264 ARG A CD    1 
ATOM   1702 N NE    . ARG A 1 217 ? -18.395 6.113   37.572  1.00 115.29 ? 264 ARG A NE    1 
ATOM   1703 C CZ    . ARG A 1 217 ? -18.673 5.607   36.378  1.00 126.00 ? 264 ARG A CZ    1 
ATOM   1704 N NH1   . ARG A 1 217 ? -19.765 5.984   35.731  1.00 107.58 ? 264 ARG A NH1   1 
ATOM   1705 N NH2   . ARG A 1 217 ? -17.873 4.704   35.830  1.00 122.12 ? 264 ARG A NH2   1 
ATOM   1706 N N     . ASP A 1 218 ? -13.085 4.734   40.308  1.00 87.83  ? 265 ASP A N     1 
ATOM   1707 C CA    . ASP A 1 218 ? -11.907 4.882   41.170  1.00 88.26  ? 265 ASP A CA    1 
ATOM   1708 C C     . ASP A 1 218 ? -12.266 5.095   42.650  1.00 90.91  ? 265 ASP A C     1 
ATOM   1709 O O     . ASP A 1 218 ? -13.429 5.347   42.987  1.00 89.51  ? 265 ASP A O     1 
ATOM   1710 C CB    . ASP A 1 218 ? -10.950 5.978   40.654  1.00 92.51  ? 265 ASP A CB    1 
ATOM   1711 C CG    . ASP A 1 218 ? -10.198 5.617   39.378  1.00 111.30 ? 265 ASP A CG    1 
ATOM   1712 O OD1   . ASP A 1 218 ? -9.781  4.419   39.237  1.00 107.91 ? 265 ASP A OD1   1 
ATOM   1713 O OD2   . ASP A 1 218 ? -10.020 6.526   38.514  1.00 122.82 ? 265 ASP A OD2   1 
ATOM   1714 N N     . GLY A 1 219 ? -11.267 4.901   43.511  1.00 87.14  ? 266 GLY A N     1 
ATOM   1715 C CA    . GLY A 1 219 ? -11.427 5.057   44.946  1.00 88.80  ? 266 GLY A CA    1 
ATOM   1716 C C     . GLY A 1 219 ? -11.312 3.797   45.779  1.00 90.00  ? 266 GLY A C     1 
ATOM   1717 O O     . GLY A 1 219 ? -11.184 2.685   45.264  1.00 87.37  ? 266 GLY A O     1 
ATOM   1718 N N     . TYR A 1 220 ? -11.400 3.985   47.092  1.00 86.91  ? 267 TYR A N     1 
ATOM   1719 C CA    . TYR A 1 220 ? -11.295 2.910   48.052  1.00 84.71  ? 267 TYR A CA    1 
ATOM   1720 C C     . TYR A 1 220 ? -12.612 2.181   48.244  1.00 88.95  ? 267 TYR A C     1 
ATOM   1721 O O     . TYR A 1 220 ? -13.674 2.817   48.273  1.00 90.33  ? 267 TYR A O     1 
ATOM   1722 C CB    . TYR A 1 220 ? -10.668 3.420   49.372  1.00 86.76  ? 267 TYR A CB    1 
ATOM   1723 C CG    . TYR A 1 220 ? -9.194  3.750   49.221  1.00 87.64  ? 267 TYR A CG    1 
ATOM   1724 C CD1   . TYR A 1 220 ? -8.248  2.744   49.013  1.00 86.22  ? 267 TYR A CD1   1 
ATOM   1725 C CD2   . TYR A 1 220 ? -8.750  5.069   49.233  1.00 91.63  ? 267 TYR A CD2   1 
ATOM   1726 C CE1   . TYR A 1 220 ? -6.896  3.045   48.848  1.00 86.92  ? 267 TYR A CE1   1 
ATOM   1727 C CE2   . TYR A 1 220 ? -7.397  5.382   49.090  1.00 92.98  ? 267 TYR A CE2   1 
ATOM   1728 C CZ    . TYR A 1 220 ? -6.474  4.368   48.888  1.00 100.25 ? 267 TYR A CZ    1 
ATOM   1729 O OH    . TYR A 1 220 ? -5.144  4.686   48.732  1.00 104.11 ? 267 TYR A OH    1 
ATOM   1730 N N     . ILE A 1 221 ? -12.535 0.833   48.347  1.00 83.91  ? 268 ILE A N     1 
ATOM   1731 C CA    . ILE A 1 221 ? -13.698 -0.035  48.560  1.00 83.57  ? 268 ILE A CA    1 
ATOM   1732 C C     . ILE A 1 221 ? -14.192 0.081   50.008  1.00 90.38  ? 268 ILE A C     1 
ATOM   1733 O O     . ILE A 1 221 ? -13.392 -0.036  50.950  1.00 89.49  ? 268 ILE A O     1 
ATOM   1734 C CB    . ILE A 1 221 ? -13.489 -1.519  48.139  1.00 83.29  ? 268 ILE A CB    1 
ATOM   1735 C CG1   . ILE A 1 221 ? -12.821 -1.683  46.750  1.00 80.91  ? 268 ILE A CG1   1 
ATOM   1736 C CG2   . ILE A 1 221 ? -14.799 -2.293  48.228  1.00 84.51  ? 268 ILE A CG2   1 
ATOM   1737 C CD1   . ILE A 1 221 ? -13.705 -1.429  45.502  1.00 86.26  ? 268 ILE A CD1   1 
ATOM   1738 N N     . HIS A 1 222 ? -15.526 0.299   50.143  1.00 89.29  ? 269 HIS A N     1 
ATOM   1739 C CA    . HIS A 1 222 ? -16.333 0.438   51.363  1.00 91.67  ? 269 HIS A CA    1 
ATOM   1740 C C     . HIS A 1 222 ? -17.394 -0.625  51.446  1.00 94.17  ? 269 HIS A C     1 
ATOM   1741 O O     . HIS A 1 222 ? -17.964 -1.024  50.429  1.00 91.97  ? 269 HIS A O     1 
ATOM   1742 C CB    . HIS A 1 222 ? -17.056 1.796   51.374  1.00 95.35  ? 269 HIS A CB    1 
ATOM   1743 C CG    . HIS A 1 222 ? -16.124 2.938   51.534  1.00 100.17 ? 269 HIS A CG    1 
ATOM   1744 N ND1   . HIS A 1 222 ? -15.210 3.261   50.548  1.00 100.33 ? 269 HIS A ND1   1 
ATOM   1745 C CD2   . HIS A 1 222 ? -15.928 3.745   52.597  1.00 104.72 ? 269 HIS A CD2   1 
ATOM   1746 C CE1   . HIS A 1 222 ? -14.515 4.276   51.027  1.00 101.81 ? 269 HIS A CE1   1 
ATOM   1747 N NE2   . HIS A 1 222 ? -14.913 4.606   52.253  1.00 104.91 ? 269 HIS A NE2   1 
ATOM   1748 N N     . TYR A 1 223 ? -17.728 -1.027  52.664  1.00 92.51  ? 270 TYR A N     1 
ATOM   1749 C CA    . TYR A 1 223 ? -18.801 -1.986  52.841  1.00 93.12  ? 270 TYR A CA    1 
ATOM   1750 C C     . TYR A 1 223 ? -20.102 -1.341  52.332  1.00 98.38  ? 270 TYR A C     1 
ATOM   1751 O O     . TYR A 1 223 ? -20.320 -0.142  52.536  1.00 101.11 ? 270 TYR A O     1 
ATOM   1752 C CB    . TYR A 1 223 ? -18.901 -2.424  54.308  1.00 97.05  ? 270 TYR A CB    1 
ATOM   1753 C CG    . TYR A 1 223 ? -17.691 -3.214  54.770  1.00 98.96  ? 270 TYR A CG    1 
ATOM   1754 C CD1   . TYR A 1 223 ? -17.523 -4.552  54.407  1.00 99.03  ? 270 TYR A CD1   1 
ATOM   1755 C CD2   . TYR A 1 223 ? -16.712 -2.626  55.572  1.00 100.69 ? 270 TYR A CD2   1 
ATOM   1756 C CE1   . TYR A 1 223 ? -16.420 -5.287  54.840  1.00 98.69  ? 270 TYR A CE1   1 
ATOM   1757 C CE2   . TYR A 1 223 ? -15.601 -3.352  56.006  1.00 100.33 ? 270 TYR A CE2   1 
ATOM   1758 C CZ    . TYR A 1 223 ? -15.455 -4.678  55.627  1.00 104.98 ? 270 TYR A CZ    1 
ATOM   1759 O OH    . TYR A 1 223 ? -14.370 -5.397  56.050  1.00 103.80 ? 270 TYR A OH    1 
ATOM   1760 N N     . GLY A 1 224 ? -20.879 -2.107  51.577  1.00 91.43  ? 271 GLY A N     1 
ATOM   1761 C CA    . GLY A 1 224 ? -22.127 -1.632  51.007  1.00 92.15  ? 271 GLY A CA    1 
ATOM   1762 C C     . GLY A 1 224 ? -21.974 -1.194  49.571  1.00 94.71  ? 271 GLY A C     1 
ATOM   1763 O O     . GLY A 1 224 ? -22.969 -0.925  48.889  1.00 97.27  ? 271 GLY A O     1 
ATOM   1764 N N     . GLN A 1 225 ? -20.734 -1.108  49.093  1.00 86.43  ? 272 GLN A N     1 
ATOM   1765 C CA    . GLN A 1 225 ? -20.515 -0.666  47.732  1.00 84.52  ? 272 GLN A CA    1 
ATOM   1766 C C     . GLN A 1 225 ? -20.723 -1.809  46.743  1.00 90.52  ? 272 GLN A C     1 
ATOM   1767 O O     . GLN A 1 225 ? -20.486 -2.967  47.100  1.00 89.97  ? 272 GLN A O     1 
ATOM   1768 C CB    . GLN A 1 225 ? -19.106 -0.084  47.596  1.00 83.61  ? 272 GLN A CB    1 
ATOM   1769 C CG    . GLN A 1 225 ? -18.969 1.376   48.021  1.00 87.28  ? 272 GLN A CG    1 
ATOM   1770 C CD    . GLN A 1 225 ? -17.558 1.913   47.880  1.00 103.11 ? 272 GLN A CD    1 
ATOM   1771 O OE1   . GLN A 1 225 ? -16.587 1.147   47.799  1.00 103.48 ? 272 GLN A OE1   1 
ATOM   1772 N NE2   . GLN A 1 225 ? -17.406 3.245   47.833  1.00 74.96  ? 272 GLN A NE2   1 
ATOM   1773 N N     . THR A 1 226 ? -21.135 -1.501  45.489  1.00 88.26  ? 273 THR A N     1 
ATOM   1774 C CA    . THR A 1 226 ? -21.231 -2.571  44.502  1.00 85.90  ? 273 THR A CA    1 
ATOM   1775 C C     . THR A 1 226 ? -19.854 -2.804  43.902  1.00 86.87  ? 273 THR A C     1 
ATOM   1776 O O     . THR A 1 226 ? -19.236 -1.868  43.383  1.00 87.62  ? 273 THR A O     1 
ATOM   1777 C CB    . THR A 1 226 ? -22.293 -2.338  43.443  1.00 97.88  ? 273 THR A CB    1 
ATOM   1778 O OG1   . THR A 1 226 ? -23.557 -2.123  44.072  1.00 101.09 ? 273 THR A OG1   1 
ATOM   1779 C CG2   . THR A 1 226 ? -22.385 -3.516  42.469  1.00 96.76  ? 273 THR A CG2   1 
ATOM   1780 N N     . VAL A 1 227 ? -19.371 -4.048  44.012  1.00 79.63  ? 274 VAL A N     1 
ATOM   1781 C CA    . VAL A 1 227 ? -18.090 -4.485  43.479  1.00 76.03  ? 274 VAL A CA    1 
ATOM   1782 C C     . VAL A 1 227 ? -18.287 -5.500  42.382  1.00 79.87  ? 274 VAL A C     1 
ATOM   1783 O O     . VAL A 1 227 ? -19.392 -6.034  42.203  1.00 82.05  ? 274 VAL A O     1 
ATOM   1784 C CB    . VAL A 1 227 ? -17.082 -5.003  44.545  1.00 78.21  ? 274 VAL A CB    1 
ATOM   1785 C CG1   . VAL A 1 227 ? -16.774 -3.929  45.584  1.00 80.30  ? 274 VAL A CG1   1 
ATOM   1786 C CG2   . VAL A 1 227 ? -17.537 -6.311  45.199  1.00 77.05  ? 274 VAL A CG2   1 
ATOM   1787 N N     . LYS A 1 228 ? -17.198 -5.766  41.656  1.00 73.29  ? 275 LYS A N     1 
ATOM   1788 C CA    . LYS A 1 228 ? -17.092 -6.776  40.625  1.00 71.32  ? 275 LYS A CA    1 
ATOM   1789 C C     . LYS A 1 228 ? -15.755 -7.461  40.813  1.00 74.97  ? 275 LYS A C     1 
ATOM   1790 O O     . LYS A 1 228 ? -14.734 -6.789  40.985  1.00 74.53  ? 275 LYS A O     1 
ATOM   1791 C CB    . LYS A 1 228 ? -17.224 -6.181  39.231  1.00 73.28  ? 275 LYS A CB    1 
ATOM   1792 C CG    . LYS A 1 228 ? -17.845 -7.162  38.241  1.00 78.13  ? 275 LYS A CG    1 
ATOM   1793 C CD    . LYS A 1 228 ? -19.350 -7.000  38.095  1.00 82.58  ? 275 LYS A CD    1 
ATOM   1794 C CE    . LYS A 1 228 ? -19.853 -7.784  36.905  1.00 84.38  ? 275 LYS A CE    1 
ATOM   1795 N NZ    . LYS A 1 228 ? -20.139 -9.189  37.246  1.00 81.49  ? 275 LYS A NZ    1 
ATOM   1796 N N     . LEU A 1 229 ? -15.775 -8.800  40.891  1.00 70.70  ? 276 LEU A N     1 
ATOM   1797 C CA    . LEU A 1 229 ? -14.579 -9.604  41.115  1.00 67.28  ? 276 LEU A CA    1 
ATOM   1798 C C     . LEU A 1 229 ? -14.234 -10.296 39.816  1.00 67.05  ? 276 LEU A C     1 
ATOM   1799 O O     . LEU A 1 229 ? -15.011 -11.111 39.341  1.00 64.09  ? 276 LEU A O     1 
ATOM   1800 C CB    . LEU A 1 229 ? -14.808 -10.645 42.245  1.00 67.45  ? 276 LEU A CB    1 
ATOM   1801 C CG    . LEU A 1 229 ? -15.103 -10.128 43.681  1.00 71.65  ? 276 LEU A CG    1 
ATOM   1802 C CD1   . LEU A 1 229 ? -15.523 -11.249 44.583  1.00 71.42  ? 276 LEU A CD1   1 
ATOM   1803 C CD2   . LEU A 1 229 ? -13.897 -9.490  44.301  1.00 72.93  ? 276 LEU A CD2   1 
ATOM   1804 N N     . VAL A 1 230 ? -13.085 -9.943  39.218  1.00 63.66  ? 277 VAL A N     1 
ATOM   1805 C CA    . VAL A 1 230 ? -12.633 -10.554 37.962  1.00 61.53  ? 277 VAL A CA    1 
ATOM   1806 C C     . VAL A 1 230 ? -11.327 -11.284 38.171  1.00 67.09  ? 277 VAL A C     1 
ATOM   1807 O O     . VAL A 1 230 ? -10.358 -10.636 38.589  1.00 68.78  ? 277 VAL A O     1 
ATOM   1808 C CB    . VAL A 1 230 ? -12.505 -9.540  36.801  1.00 62.22  ? 277 VAL A CB    1 
ATOM   1809 C CG1   . VAL A 1 230 ? -12.253 -10.265 35.486  1.00 59.52  ? 277 VAL A CG1   1 
ATOM   1810 C CG2   . VAL A 1 230 ? -13.744 -8.639  36.700  1.00 63.50  ? 277 VAL A CG2   1 
ATOM   1811 N N     . CYS A 1 231 ? -11.280 -12.612 37.867  1.00 62.24  ? 278 CYS A N     1 
ATOM   1812 C CA    . CYS A 1 231 ? -10.044 -13.406 37.959  1.00 61.36  ? 278 CYS A CA    1 
ATOM   1813 C C     . CYS A 1 231 ? -8.984  -12.843 37.005  1.00 66.21  ? 278 CYS A C     1 
ATOM   1814 O O     . CYS A 1 231 ? -9.259  -12.669 35.805  1.00 67.14  ? 278 CYS A O     1 
ATOM   1815 C CB    . CYS A 1 231 ? -10.302 -14.877 37.677  1.00 61.88  ? 278 CYS A CB    1 
ATOM   1816 S SG    . CYS A 1 231 ? -8.799  -15.833 37.324  1.00 64.72  ? 278 CYS A SG    1 
ATOM   1817 N N     . SER A 1 232 ? -7.790  -12.538 37.548  1.00 59.89  ? 279 SER A N     1 
ATOM   1818 C CA    . SER A 1 232 ? -6.687  -11.938 36.802  1.00 58.65  ? 279 SER A CA    1 
ATOM   1819 C C     . SER A 1 232 ? -5.970  -12.879 35.795  1.00 63.81  ? 279 SER A C     1 
ATOM   1820 O O     . SER A 1 232 ? -5.035  -12.452 35.141  1.00 64.36  ? 279 SER A O     1 
ATOM   1821 C CB    . SER A 1 232 ? -5.686  -11.317 37.771  1.00 62.18  ? 279 SER A CB    1 
ATOM   1822 O OG    . SER A 1 232 ? -5.013  -12.270 38.576  1.00 72.51  ? 279 SER A OG    1 
ATOM   1823 N N     . VAL A 1 233 ? -6.413  -14.136 35.663  1.00 60.36  ? 280 VAL A N     1 
ATOM   1824 C CA    . VAL A 1 233 ? -5.807  -15.160 34.789  1.00 58.30  ? 280 VAL A CA    1 
ATOM   1825 C C     . VAL A 1 233 ? -6.795  -15.562 33.719  1.00 67.45  ? 280 VAL A C     1 
ATOM   1826 O O     . VAL A 1 233 ? -6.489  -15.411 32.527  1.00 70.65  ? 280 VAL A O     1 
ATOM   1827 C CB    . VAL A 1 233 ? -5.318  -16.423 35.581  1.00 57.36  ? 280 VAL A CB    1 
ATOM   1828 C CG1   . VAL A 1 233 ? -5.010  -17.564 34.655  1.00 55.80  ? 280 VAL A CG1   1 
ATOM   1829 C CG2   . VAL A 1 233 ? -4.121  -16.115 36.436  1.00 55.65  ? 280 VAL A CG2   1 
ATOM   1830 N N     . THR A 1 234 ? -7.948  -16.131 34.151  1.00 62.66  ? 281 THR A N     1 
ATOM   1831 C CA    . THR A 1 234 ? -9.019  -16.618 33.299  1.00 61.93  ? 281 THR A CA    1 
ATOM   1832 C C     . THR A 1 234 ? -9.802  -15.492 32.670  1.00 68.78  ? 281 THR A C     1 
ATOM   1833 O O     . THR A 1 234 ? -10.296 -15.671 31.557  1.00 72.47  ? 281 THR A O     1 
ATOM   1834 C CB    . THR A 1 234 ? -9.971  -17.491 34.084  1.00 61.66  ? 281 THR A CB    1 
ATOM   1835 O OG1   . THR A 1 234 ? -10.685 -16.663 35.011  1.00 69.65  ? 281 THR A OG1   1 
ATOM   1836 C CG2   . THR A 1 234 ? -9.281  -18.631 34.776  1.00 56.41  ? 281 THR A CG2   1 
ATOM   1837 N N     . GLY A 1 235 ? -9.985  -14.392 33.389  1.00 64.04  ? 282 GLY A N     1 
ATOM   1838 C CA    . GLY A 1 235 ? -10.767 -13.261 32.887  1.00 64.96  ? 282 GLY A CA    1 
ATOM   1839 C C     . GLY A 1 235 ? -12.261 -13.362 33.165  1.00 72.33  ? 282 GLY A C     1 
ATOM   1840 O O     . GLY A 1 235 ? -13.050 -12.587 32.620  1.00 75.41  ? 282 GLY A O     1 
ATOM   1841 N N     . MET A 1 236 ? -12.658 -14.290 34.037  1.00 68.56  ? 283 MET A N     1 
ATOM   1842 C CA    . MET A 1 236 ? -14.043 -14.513 34.425  1.00 70.41  ? 283 MET A CA    1 
ATOM   1843 C C     . MET A 1 236 ? -14.448 -13.745 35.671  1.00 75.79  ? 283 MET A C     1 
ATOM   1844 O O     . MET A 1 236 ? -13.685 -13.628 36.635  1.00 75.96  ? 283 MET A O     1 
ATOM   1845 C CB    . MET A 1 236 ? -14.291 -16.007 34.664  1.00 73.54  ? 283 MET A CB    1 
ATOM   1846 C CG    . MET A 1 236 ? -15.545 -16.485 34.033  1.00 79.46  ? 283 MET A CG    1 
ATOM   1847 S SD    . MET A 1 236 ? -15.760 -18.223 34.346  1.00 85.69  ? 283 MET A SD    1 
ATOM   1848 C CE    . MET A 1 236 ? -14.716 -18.898 33.134  1.00 82.17  ? 283 MET A CE    1 
ATOM   1849 N N     . ALA A 1 237 ? -15.691 -13.291 35.682  1.00 72.86  ? 284 ALA A N     1 
ATOM   1850 C CA    . ALA A 1 237 ? -16.232 -12.558 36.811  1.00 72.20  ? 284 ALA A CA    1 
ATOM   1851 C C     . ALA A 1 237 ? -17.421 -13.303 37.421  1.00 77.74  ? 284 ALA A C     1 
ATOM   1852 O O     . ALA A 1 237 ? -17.963 -14.227 36.811  1.00 78.95  ? 284 ALA A O     1 
ATOM   1853 C CB    . ALA A 1 237 ? -16.667 -11.179 36.352  1.00 73.13  ? 284 ALA A CB    1 
ATOM   1854 N N     . LEU A 1 238 ? -17.793 -12.917 38.641  1.00 72.93  ? 285 LEU A N     1 
ATOM   1855 C CA    . LEU A 1 238 ? -18.983 -13.389 39.309  1.00 74.41  ? 285 LEU A CA    1 
ATOM   1856 C C     . LEU A 1 238 ? -20.036 -12.296 39.053  1.00 81.59  ? 285 LEU A C     1 
ATOM   1857 O O     . LEU A 1 238 ? -19.642 -11.161 38.776  1.00 82.04  ? 285 LEU A O     1 
ATOM   1858 C CB    . LEU A 1 238 ? -18.737 -13.469 40.810  1.00 74.56  ? 285 LEU A CB    1 
ATOM   1859 C CG    . LEU A 1 238 ? -17.952 -14.640 41.325  1.00 78.50  ? 285 LEU A CG    1 
ATOM   1860 C CD1   . LEU A 1 238 ? -17.485 -14.350 42.716  1.00 79.69  ? 285 LEU A CD1   1 
ATOM   1861 C CD2   . LEU A 1 238 ? -18.752 -15.973 41.235  1.00 78.91  ? 285 LEU A CD2   1 
ATOM   1862 N N     . PRO A 1 239 ? -21.359 -12.545 39.226  1.00 79.14  ? 286 PRO A N     1 
ATOM   1863 C CA    . PRO A 1 239 ? -22.336 -11.461 39.055  1.00 80.73  ? 286 PRO A CA    1 
ATOM   1864 C C     . PRO A 1 239 ? -22.111 -10.311 40.041  1.00 84.62  ? 286 PRO A C     1 
ATOM   1865 O O     . PRO A 1 239 ? -21.258 -10.458 40.927  1.00 85.27  ? 286 PRO A O     1 
ATOM   1866 C CB    . PRO A 1 239 ? -23.662 -12.167 39.303  1.00 84.89  ? 286 PRO A CB    1 
ATOM   1867 C CG    . PRO A 1 239 ? -23.318 -13.333 40.123  1.00 88.31  ? 286 PRO A CG    1 
ATOM   1868 C CD    . PRO A 1 239 ? -22.038 -13.802 39.594  1.00 81.30  ? 286 PRO A CD    1 
ATOM   1869 N N     . ARG A 1 240 ? -22.808 -9.161  39.885  1.00 79.37  ? 287 ARG A N     1 
ATOM   1870 C CA    . ARG A 1 240 ? -22.527 -8.053  40.794  1.00 78.97  ? 287 ARG A CA    1 
ATOM   1871 C C     . ARG A 1 240 ? -22.754 -8.401  42.249  1.00 84.44  ? 287 ARG A C     1 
ATOM   1872 O O     . ARG A 1 240 ? -23.733 -9.060  42.614  1.00 86.16  ? 287 ARG A O     1 
ATOM   1873 C CB    . ARG A 1 240 ? -23.246 -6.768  40.431  1.00 80.62  ? 287 ARG A CB    1 
ATOM   1874 C CG    . ARG A 1 240 ? -23.070 -6.289  38.995  1.00 82.49  ? 287 ARG A CG    1 
ATOM   1875 C CD    . ARG A 1 240 ? -24.294 -5.484  38.620  1.00 87.49  ? 287 ARG A CD    1 
ATOM   1876 N NE    . ARG A 1 240 ? -25.481 -6.139  39.170  1.00 96.82  ? 287 ARG A NE    1 
ATOM   1877 C CZ    . ARG A 1 240 ? -26.683 -5.601  39.241  1.00 105.38 ? 287 ARG A CZ    1 
ATOM   1878 N NH1   . ARG A 1 240 ? -26.902 -4.387  38.756  1.00 88.67  ? 287 ARG A NH1   1 
ATOM   1879 N NH2   . ARG A 1 240 ? -27.678 -6.272  39.790  1.00 97.58  ? 287 ARG A NH2   1 
ATOM   1880 N N     . LEU A 1 241 ? -21.803 -8.012  43.066  1.00 79.79  ? 288 LEU A N     1 
ATOM   1881 C CA    . LEU A 1 241 ? -21.884 -8.300  44.472  1.00 80.92  ? 288 LEU A CA    1 
ATOM   1882 C C     . LEU A 1 241 ? -21.839 -7.000  45.261  1.00 87.96  ? 288 LEU A C     1 
ATOM   1883 O O     . LEU A 1 241 ? -21.369 -5.981  44.753  1.00 88.35  ? 288 LEU A O     1 
ATOM   1884 C CB    . LEU A 1 241 ? -20.691 -9.191  44.883  1.00 78.78  ? 288 LEU A CB    1 
ATOM   1885 C CG    . LEU A 1 241 ? -20.520 -10.545 44.202  1.00 81.54  ? 288 LEU A CG    1 
ATOM   1886 C CD1   . LEU A 1 241 ? -19.195 -11.152 44.565  1.00 78.93  ? 288 LEU A CD1   1 
ATOM   1887 C CD2   . LEU A 1 241 ? -21.663 -11.510 44.545  1.00 86.86  ? 288 LEU A CD2   1 
ATOM   1888 N N     . ILE A 1 242 ? -22.343 -7.042  46.493  1.00 86.27  ? 289 ILE A N     1 
ATOM   1889 C CA    . ILE A 1 242 ? -22.258 -5.961  47.462  1.00 87.87  ? 289 ILE A CA    1 
ATOM   1890 C C     . ILE A 1 242 ? -21.384 -6.537  48.569  1.00 91.85  ? 289 ILE A C     1 
ATOM   1891 O O     . ILE A 1 242 ? -21.699 -7.593  49.156  1.00 91.81  ? 289 ILE A O     1 
ATOM   1892 C CB    . ILE A 1 242 ? -23.636 -5.482  48.005  1.00 94.05  ? 289 ILE A CB    1 
ATOM   1893 C CG1   . ILE A 1 242 ? -24.401 -4.666  46.944  1.00 95.40  ? 289 ILE A CG1   1 
ATOM   1894 C CG2   . ILE A 1 242 ? -23.447 -4.652  49.274  1.00 95.00  ? 289 ILE A CG2   1 
ATOM   1895 C CD1   . ILE A 1 242 ? -25.838 -4.888  46.976  1.00 99.89  ? 289 ILE A CD1   1 
ATOM   1896 N N     . ILE A 1 243 ? -20.267 -5.876  48.818  1.00 87.18  ? 290 ILE A N     1 
ATOM   1897 C CA    . ILE A 1 243 ? -19.388 -6.332  49.876  1.00 87.19  ? 290 ILE A CA    1 
ATOM   1898 C C     . ILE A 1 243 ? -19.957 -5.852  51.224  1.00 95.86  ? 290 ILE A C     1 
ATOM   1899 O O     . ILE A 1 243 ? -20.367 -4.690  51.346  1.00 96.16  ? 290 ILE A O     1 
ATOM   1900 C CB    . ILE A 1 243 ? -17.897 -6.016  49.590  1.00 88.01  ? 290 ILE A CB    1 
ATOM   1901 C CG1   . ILE A 1 243 ? -16.961 -6.673  50.640  1.00 87.93  ? 290 ILE A CG1   1 
ATOM   1902 C CG2   . ILE A 1 243 ? -17.630 -4.502  49.306  1.00 88.06  ? 290 ILE A CG2   1 
ATOM   1903 C CD1   . ILE A 1 243 ? -15.459 -6.654  50.289  1.00 91.52  ? 290 ILE A CD1   1 
ATOM   1904 N N     . ARG A 1 244 ? -20.095 -6.796  52.182  1.00 94.59  ? 291 ARG A N     1 
ATOM   1905 C CA    . ARG A 1 244 ? -20.698 -6.556  53.492  1.00 97.53  ? 291 ARG A CA    1 
ATOM   1906 C C     . ARG A 1 244 ? -19.856 -7.078  54.637  1.00 104.65 ? 291 ARG A C     1 
ATOM   1907 O O     . ARG A 1 244 ? -19.220 -8.120  54.493  1.00 104.14 ? 291 ARG A O     1 
ATOM   1908 C CB    . ARG A 1 244 ? -22.098 -7.167  53.538  1.00 96.10  ? 291 ARG A CB    1 
ATOM   1909 C CG    . ARG A 1 244 ? -23.108 -6.283  52.857  1.00 99.08  ? 291 ARG A CG    1 
ATOM   1910 C CD    . ARG A 1 244 ? -24.449 -6.944  52.649  1.00 106.74 ? 291 ARG A CD    1 
ATOM   1911 N NE    . ARG A 1 244 ? -25.384 -6.009  52.015  1.00 111.72 ? 291 ARG A NE    1 
ATOM   1912 C CZ    . ARG A 1 244 ? -26.584 -6.335  51.546  1.00 122.56 ? 291 ARG A CZ    1 
ATOM   1913 N NH1   . ARG A 1 244 ? -27.043 -7.578  51.675  1.00 98.56  ? 291 ARG A NH1   1 
ATOM   1914 N NH2   . ARG A 1 244 ? -27.346 -5.419  50.967  1.00 116.99 ? 291 ARG A NH2   1 
ATOM   1915 N N     . LYS A 1 245 ? -19.857 -6.344  55.778  1.00 104.01 ? 292 LYS A N     1 
ATOM   1916 C CA    . LYS A 1 245 ? -19.111 -6.657  57.010  1.00 104.64 ? 292 LYS A CA    1 
ATOM   1917 C C     . LYS A 1 245 ? -19.754 -7.833  57.715  1.00 108.63 ? 292 LYS A C     1 
ATOM   1918 O O     . LYS A 1 245 ? -20.964 -8.019  57.637  1.00 109.40 ? 292 LYS A O     1 
ATOM   1919 C CB    . LYS A 1 245 ? -19.029 -5.414  57.953  1.00 109.77 ? 292 LYS A CB    1 
ATOM   1920 C CG    . LYS A 1 245 ? -18.055 -5.500  59.156  1.00 118.74 ? 292 LYS A CG    1 
ATOM   1921 C CD    . LYS A 1 245 ? -16.567 -5.761  58.779  1.00 127.33 ? 292 LYS A CD    1 
ATOM   1922 C CE    . LYS A 1 245 ? -15.852 -6.717  59.727  1.00 130.98 ? 292 LYS A CE    1 
ATOM   1923 N NZ    . LYS A 1 245 ? -14.550 -7.210  59.192  1.00 119.42 ? 292 LYS A NZ    1 
ATOM   1924 N N     . VAL A 1 246 ? -18.933 -8.641  58.366  1.00 104.62 ? 293 VAL A N     1 
ATOM   1925 C CA    . VAL A 1 246 ? -19.364 -9.815  59.100  1.00 106.14 ? 293 VAL A CA    1 
ATOM   1926 C C     . VAL A 1 246 ? -18.985 -9.596  60.567  1.00 116.39 ? 293 VAL A C     1 
ATOM   1927 O O     . VAL A 1 246 ? -17.804 -9.380  60.862  1.00 115.37 ? 293 VAL A O     1 
ATOM   1928 C CB    . VAL A 1 246 ? -18.735 -11.099 58.486  1.00 106.98 ? 293 VAL A CB    1 
ATOM   1929 C CG1   . VAL A 1 246 ? -18.951 -12.313 59.374  1.00 108.71 ? 293 VAL A CG1   1 
ATOM   1930 C CG2   . VAL A 1 246 ? -19.280 -11.363 57.090  1.00 104.33 ? 293 VAL A CG2   1 
ATOM   1931 N N     . ASP A 1 247 ? -19.990 -9.607  61.478  1.00 119.11 ? 294 ASP A N     1 
ATOM   1932 C CA    . ASP A 1 247 ? -19.768 -9.438  62.919  1.00 123.16 ? 294 ASP A CA    1 
ATOM   1933 C C     . ASP A 1 247 ? -19.333 -10.773 63.531  1.00 128.54 ? 294 ASP A C     1 
ATOM   1934 O O     . ASP A 1 247 ? -18.337 -10.816 64.266  1.00 130.16 ? 294 ASP A O     1 
ATOM   1935 C CB    . ASP A 1 247 ? -21.010 -8.872  63.627  1.00 129.04 ? 294 ASP A CB    1 
ATOM   1936 C CG    . ASP A 1 247 ? -20.751 -8.300  65.014  1.00 146.68 ? 294 ASP A CG    1 
ATOM   1937 O OD1   . ASP A 1 247 ? -19.947 -7.345  65.125  1.00 147.98 ? 294 ASP A OD1   1 
ATOM   1938 O OD2   . ASP A 1 247 ? -21.411 -8.756  65.978  1.00 155.93 ? 294 ASP A OD2   1 
ATOM   1939 N N     . LYS A 1 248 ? -20.062 -11.863 63.210  1.00 123.54 ? 295 LYS A N     1 
ATOM   1940 C CA    . LYS A 1 248 ? -19.739 -13.225 63.653  1.00 123.35 ? 295 LYS A CA    1 
ATOM   1941 C C     . LYS A 1 248 ? -20.299 -14.214 62.629  1.00 122.92 ? 295 LYS A C     1 
ATOM   1942 O O     . LYS A 1 248 ? -19.570 -14.655 61.727  1.00 118.06 ? 295 LYS A O     1 
ATOM   1943 C CB    . LYS A 1 248 ? -20.250 -13.502 65.088  1.00 129.81 ? 295 LYS A CB    1 
ATOM   1944 C CG    . LYS A 1 248 ? -19.122 -13.657 66.113  1.00 143.16 ? 295 LYS A CG    1 
ATOM   1945 C CD    . LYS A 1 248 ? -18.835 -15.129 66.487  1.00 151.45 ? 295 LYS A CD    1 
ATOM   1946 C CE    . LYS A 1 248 ? -17.778 -15.296 67.570  1.00 160.58 ? 295 LYS A CE    1 
ATOM   1947 N NZ    . LYS A 1 248 ? -18.276 -14.970 68.943  1.00 168.96 ? 295 LYS A NZ    1 
ATOM   1948 N N     . GLN A 1 249 ? -21.604 -14.528 62.754  1.00 120.38 ? 296 GLN A N     1 
ATOM   1949 C CA    . GLN A 1 249 ? -22.337 -15.392 61.834  1.00 118.84 ? 296 GLN A CA    1 
ATOM   1950 C C     . GLN A 1 249 ? -23.431 -14.541 61.167  1.00 120.40 ? 296 GLN A C     1 
ATOM   1951 O O     . GLN A 1 249 ? -24.406 -15.061 60.626  1.00 120.65 ? 296 GLN A O     1 
ATOM   1952 C CB    . GLN A 1 249 ? -22.896 -16.618 62.578  1.00 123.40 ? 296 GLN A CB    1 
ATOM   1953 C CG    . GLN A 1 249 ? -21.802 -17.639 62.911  1.00 144.12 ? 296 GLN A CG    1 
ATOM   1954 C CD    . GLN A 1 249 ? -22.264 -18.835 63.710  1.00 168.65 ? 296 GLN A CD    1 
ATOM   1955 O OE1   . GLN A 1 249 ? -23.168 -18.755 64.557  1.00 168.48 ? 296 GLN A OE1   1 
ATOM   1956 N NE2   . GLN A 1 249 ? -21.598 -19.967 63.496  1.00 158.87 ? 296 GLN A NE2   1 
ATOM   1957 N N     . THR A 1 250 ? -23.223 -13.216 61.194  1.00 114.76 ? 297 THR A N     1 
ATOM   1958 C CA    . THR A 1 250 ? -24.111 -12.173 60.684  1.00 114.23 ? 297 THR A CA    1 
ATOM   1959 C C     . THR A 1 250 ? -23.435 -11.387 59.593  1.00 113.97 ? 297 THR A C     1 
ATOM   1960 O O     . THR A 1 250 ? -22.214 -11.431 59.478  1.00 111.50 ? 297 THR A O     1 
ATOM   1961 C CB    . THR A 1 250 ? -24.422 -11.172 61.803  1.00 121.81 ? 297 THR A CB    1 
ATOM   1962 O OG1   . THR A 1 250 ? -23.201 -10.881 62.491  1.00 120.99 ? 297 THR A OG1   1 
ATOM   1963 C CG2   . THR A 1 250 ? -25.504 -11.665 62.768  1.00 122.54 ? 297 THR A CG2   1 
ATOM   1964 N N     . ALA A 1 251 ? -24.231 -10.633 58.818  1.00 109.70 ? 298 ALA A N     1 
ATOM   1965 C CA    . ALA A 1 251 ? -23.773 -9.743  57.758  1.00 106.28 ? 298 ALA A CA    1 
ATOM   1966 C C     . ALA A 1 251 ? -24.468 -8.410  58.007  1.00 112.66 ? 298 ALA A C     1 
ATOM   1967 O O     . ALA A 1 251 ? -25.704 -8.337  57.981  1.00 114.31 ? 298 ALA A O     1 
ATOM   1968 C CB    . ALA A 1 251 ? -24.136 -10.301 56.390  1.00 104.68 ? 298 ALA A CB    1 
ATOM   1969 N N     . LEU A 1 252 ? -23.673 -7.382  58.333  1.00 109.56 ? 299 LEU A N     1 
ATOM   1970 C CA    . LEU A 1 252 ? -24.145 -6.030  58.643  1.00 112.35 ? 299 LEU A CA    1 
ATOM   1971 C C     . LEU A 1 252 ? -24.389 -5.215  57.375  1.00 116.05 ? 299 LEU A C     1 
ATOM   1972 O O     . LEU A 1 252 ? -23.461 -4.997  56.586  1.00 113.68 ? 299 LEU A O     1 
ATOM   1973 C CB    . LEU A 1 252 ? -23.163 -5.323  59.583  1.00 113.31 ? 299 LEU A CB    1 
ATOM   1974 C CG    . LEU A 1 252 ? -22.944 -6.030  60.907  1.00 120.00 ? 299 LEU A CG    1 
ATOM   1975 C CD1   . LEU A 1 252 ? -21.474 -6.137  61.224  1.00 118.75 ? 299 LEU A CD1   1 
ATOM   1976 C CD2   . LEU A 1 252 ? -23.734 -5.367  62.010  1.00 126.73 ? 299 LEU A CD2   1 
ATOM   1977 N N     . LEU A 1 253 ? -25.646 -4.779  57.180  1.00 114.52 ? 300 LEU A N     1 
ATOM   1978 C CA    . LEU A 1 253 ? -26.089 -4.049  55.989  1.00 113.48 ? 300 LEU A CA    1 
ATOM   1979 C C     . LEU A 1 253 ? -25.831 -2.542  56.045  1.00 120.23 ? 300 LEU A C     1 
ATOM   1980 O O     . LEU A 1 253 ? -25.322 -1.976  55.073  1.00 118.63 ? 300 LEU A O     1 
ATOM   1981 C CB    . LEU A 1 253 ? -27.561 -4.363  55.653  1.00 115.10 ? 300 LEU A CB    1 
ATOM   1982 C CG    . LEU A 1 253 ? -28.045 -5.798  55.920  1.00 119.29 ? 300 LEU A CG    1 
ATOM   1983 C CD1   . LEU A 1 253 ? -29.537 -5.886  55.859  1.00 123.05 ? 300 LEU A CD1   1 
ATOM   1984 C CD2   . LEU A 1 253 ? -27.408 -6.804  54.996  1.00 115.42 ? 300 LEU A CD2   1 
ATOM   1985 N N     . ASP A 1 254 ? -26.146 -1.908  57.189  1.00 120.89 ? 301 ASP A N     1 
ATOM   1986 C CA    . ASP A 1 254 ? -25.971 -0.472  57.444  1.00 122.84 ? 301 ASP A CA    1 
ATOM   1987 C C     . ASP A 1 254 ? -24.489 0.003   57.491  1.00 123.86 ? 301 ASP A C     1 
ATOM   1988 O O     . ASP A 1 254 ? -24.263 1.220   57.531  1.00 126.38 ? 301 ASP A O     1 
ATOM   1989 C CB    . ASP A 1 254 ? -26.710 -0.066  58.739  1.00 129.35 ? 301 ASP A CB    1 
ATOM   1990 C CG    . ASP A 1 254 ? -26.037 -0.552  60.015  1.00 142.56 ? 301 ASP A CG    1 
ATOM   1991 O OD1   . ASP A 1 254 ? -25.910 -1.792  60.190  1.00 141.52 ? 301 ASP A OD1   1 
ATOM   1992 O OD2   . ASP A 1 254 ? -25.614 0.305   60.826  1.00 151.36 ? 301 ASP A OD2   1 
ATOM   1993 N N     . ALA A 1 255 ? -23.496 -0.932  57.512  1.00 114.62 ? 302 ALA A N     1 
ATOM   1994 C CA    . ALA A 1 255 ? -22.075 -0.579  57.550  1.00 112.16 ? 302 ALA A CA    1 
ATOM   1995 C C     . ALA A 1 255 ? -21.604 0.005   56.214  1.00 116.73 ? 302 ALA A C     1 
ATOM   1996 O O     . ALA A 1 255 ? -22.033 -0.442  55.139  1.00 114.64 ? 302 ALA A O     1 
ATOM   1997 C CB    . ALA A 1 255 ? -21.237 -1.779  57.937  1.00 110.40 ? 302 ALA A CB    1 
ATOM   1998 N N     . ASP A 1 256 ? -20.755 1.044   56.292  1.00 115.52 ? 303 ASP A N     1 
ATOM   1999 C CA    . ASP A 1 256 ? -20.212 1.756   55.131  1.00 114.07 ? 303 ASP A CA    1 
ATOM   2000 C C     . ASP A 1 256 ? -18.763 2.191   55.367  1.00 118.18 ? 303 ASP A C     1 
ATOM   2001 O O     . ASP A 1 256 ? -18.257 3.108   54.713  1.00 119.61 ? 303 ASP A O     1 
ATOM   2002 C CB    . ASP A 1 256 ? -21.114 2.946   54.753  1.00 118.61 ? 303 ASP A CB    1 
ATOM   2003 C CG    . ASP A 1 256 ? -21.176 4.090   55.753  1.00 133.21 ? 303 ASP A CG    1 
ATOM   2004 O OD1   . ASP A 1 256 ? -20.951 3.841   56.966  1.00 136.04 ? 303 ASP A OD1   1 
ATOM   2005 O OD2   . ASP A 1 256 ? -21.500 5.227   55.333  1.00 139.35 ? 303 ASP A OD2   1 
ATOM   2006 N N     . ASP A 1 257 ? -18.096 1.501   56.288  1.00 112.47 ? 304 ASP A N     1 
ATOM   2007 C CA    . ASP A 1 257 ? -16.712 1.737   56.674  1.00 111.63 ? 304 ASP A CA    1 
ATOM   2008 C C     . ASP A 1 257 ? -15.774 1.259   55.557  1.00 110.13 ? 304 ASP A C     1 
ATOM   2009 O O     . ASP A 1 257 ? -16.190 0.430   54.743  1.00 107.75 ? 304 ASP A O     1 
ATOM   2010 C CB    . ASP A 1 257 ? -16.426 0.999   57.994  1.00 115.13 ? 304 ASP A CB    1 
ATOM   2011 C CG    . ASP A 1 257 ? -17.652 0.293   58.544  1.00 134.18 ? 304 ASP A CG    1 
ATOM   2012 O OD1   . ASP A 1 257 ? -17.999 -0.791  58.016  1.00 134.65 ? 304 ASP A OD1   1 
ATOM   2013 O OD2   . ASP A 1 257 ? -18.346 0.888   59.401  1.00 143.19 ? 304 ASP A OD2   1 
ATOM   2014 N N     . PRO A 1 258 ? -14.520 1.753   55.455  1.00 104.49 ? 305 PRO A N     1 
ATOM   2015 C CA    . PRO A 1 258 ? -13.645 1.248   54.400  1.00 100.42 ? 305 PRO A CA    1 
ATOM   2016 C C     . PRO A 1 258 ? -13.192 -0.177  54.715  1.00 101.71 ? 305 PRO A C     1 
ATOM   2017 O O     . PRO A 1 258 ? -12.771 -0.469  55.839  1.00 102.91 ? 305 PRO A O     1 
ATOM   2018 C CB    . PRO A 1 258 ? -12.476 2.247   54.380  1.00 103.04 ? 305 PRO A CB    1 
ATOM   2019 C CG    . PRO A 1 258 ? -12.814 3.309   55.355  1.00 111.33 ? 305 PRO A CG    1 
ATOM   2020 C CD    . PRO A 1 258 ? -13.804 2.726   56.297  1.00 108.38 ? 305 PRO A CD    1 
ATOM   2021 N N     . VAL A 1 259 ? -13.332 -1.069  53.711  1.00 94.56  ? 306 VAL A N     1 
ATOM   2022 C CA    . VAL A 1 259 ? -12.943 -2.484  53.744  1.00 90.71  ? 306 VAL A CA    1 
ATOM   2023 C C     . VAL A 1 259 ? -11.420 -2.568  53.947  1.00 93.43  ? 306 VAL A C     1 
ATOM   2024 O O     . VAL A 1 259 ? -10.662 -1.947  53.194  1.00 93.53  ? 306 VAL A O     1 
ATOM   2025 C CB    . VAL A 1 259 ? -13.427 -3.249  52.472  1.00 90.27  ? 306 VAL A CB    1 
ATOM   2026 C CG1   . VAL A 1 259 ? -13.039 -4.713  52.522  1.00 88.12  ? 306 VAL A CG1   1 
ATOM   2027 C CG2   . VAL A 1 259 ? -14.932 -3.127  52.291  1.00 90.86  ? 306 VAL A CG2   1 
ATOM   2028 N N     . SER A 1 260 ? -10.983 -3.291  54.988  1.00 89.13  ? 307 SER A N     1 
ATOM   2029 C CA    . SER A 1 260 ? -9.558  -3.436  55.258  1.00 88.18  ? 307 SER A CA    1 
ATOM   2030 C C     . SER A 1 260 ? -9.013  -4.862  55.154  1.00 87.55  ? 307 SER A C     1 
ATOM   2031 O O     . SER A 1 260 ? -9.762  -5.838  55.134  1.00 85.80  ? 307 SER A O     1 
ATOM   2032 C CB    . SER A 1 260 ? -9.164  -2.743  56.565  1.00 95.86  ? 307 SER A CB    1 
ATOM   2033 O OG    . SER A 1 260 ? -8.676  -3.608  57.580  1.00 106.17 ? 307 SER A OG    1 
ATOM   2034 N N     . GLN A 1 261 ? -7.687  -4.951  55.081  1.00 82.86  ? 308 GLN A N     1 
ATOM   2035 C CA    . GLN A 1 261 ? -6.882  -6.164  55.015  1.00 81.07  ? 308 GLN A CA    1 
ATOM   2036 C C     . GLN A 1 261 ? -7.223  -7.139  56.133  1.00 87.22  ? 308 GLN A C     1 
ATOM   2037 O O     . GLN A 1 261 ? -7.306  -6.751  57.306  1.00 92.00  ? 308 GLN A O     1 
ATOM   2038 C CB    . GLN A 1 261 ? -5.389  -5.795  55.101  1.00 82.81  ? 308 GLN A CB    1 
ATOM   2039 C CG    . GLN A 1 261 ? -4.871  -4.986  53.910  1.00 78.07  ? 308 GLN A CG    1 
ATOM   2040 C CD    . GLN A 1 261 ? -5.007  -5.750  52.633  1.00 94.07  ? 308 GLN A CD    1 
ATOM   2041 O OE1   . GLN A 1 261 ? -4.649  -6.936  52.548  1.00 96.27  ? 308 GLN A OE1   1 
ATOM   2042 N NE2   . GLN A 1 261 ? -5.576  -5.104  51.633  1.00 81.95  ? 308 GLN A NE2   1 
ATOM   2043 N N     . LEU A 1 262 ? -7.421  -8.406  55.757  1.00 80.03  ? 309 LEU A N     1 
ATOM   2044 C CA    . LEU A 1 262 ? -7.735  -9.532  56.632  1.00 79.90  ? 309 LEU A CA    1 
ATOM   2045 C C     . LEU A 1 262 ? -9.078  -9.449  57.333  1.00 87.42  ? 309 LEU A C     1 
ATOM   2046 O O     . LEU A 1 262 ? -9.319  -10.208 58.267  1.00 88.88  ? 309 LEU A O     1 
ATOM   2047 C CB    . LEU A 1 262 ? -6.588  -9.880  57.602  1.00 81.09  ? 309 LEU A CB    1 
ATOM   2048 C CG    . LEU A 1 262 ? -5.231  -10.290 57.015  1.00 82.45  ? 309 LEU A CG    1 
ATOM   2049 C CD1   . LEU A 1 262 ? -4.226  -10.489 58.129  1.00 85.47  ? 309 LEU A CD1   1 
ATOM   2050 C CD2   . LEU A 1 262 ? -5.338  -11.551 56.213  1.00 79.66  ? 309 LEU A CD2   1 
ATOM   2051 N N     . HIS A 1 263 ? -9.963  -8.576  56.875  1.00 86.65  ? 310 HIS A N     1 
ATOM   2052 C CA    . HIS A 1 263 ? -11.295 -8.493  57.437  1.00 91.44  ? 310 HIS A CA    1 
ATOM   2053 C C     . HIS A 1 263 ? -12.142 -9.615  56.863  1.00 92.15  ? 310 HIS A C     1 
ATOM   2054 O O     . HIS A 1 263 ? -11.884 -10.056 55.748  1.00 89.43  ? 310 HIS A O     1 
ATOM   2055 C CB    . HIS A 1 263 ? -11.939 -7.182  57.004  1.00 95.99  ? 310 HIS A CB    1 
ATOM   2056 C CG    . HIS A 1 263 ? -11.693 -6.002  57.902  1.00 105.20 ? 310 HIS A CG    1 
ATOM   2057 N ND1   . HIS A 1 263 ? -12.045 -4.701  57.502  1.00 108.77 ? 310 HIS A ND1   1 
ATOM   2058 C CD2   . HIS A 1 263 ? -11.177 -5.947  59.156  1.00 111.63 ? 310 HIS A CD2   1 
ATOM   2059 C CE1   . HIS A 1 263 ? -11.732 -3.915  58.520  1.00 112.03 ? 310 HIS A CE1   1 
ATOM   2060 N NE2   . HIS A 1 263 ? -11.193 -4.612  59.534  1.00 114.03 ? 310 HIS A NE2   1 
ATOM   2061 N N     . LYS A 1 264 ? -13.182 -10.041 57.591  1.00 89.63  ? 311 LYS A N     1 
ATOM   2062 C CA    . LYS A 1 264 ? -14.153 -11.031 57.123  1.00 87.87  ? 311 LYS A CA    1 
ATOM   2063 C C     . LYS A 1 264 ? -15.253 -10.264 56.384  1.00 92.49  ? 311 LYS A C     1 
ATOM   2064 O O     . LYS A 1 264 ? -15.739 -9.226  56.875  1.00 93.57  ? 311 LYS A O     1 
ATOM   2065 C CB    . LYS A 1 264 ? -14.747 -11.835 58.278  1.00 91.80  ? 311 LYS A CB    1 
ATOM   2066 C CG    . LYS A 1 264 ? -13.795 -12.869 58.859  1.00 105.21 ? 311 LYS A CG    1 
ATOM   2067 C CD    . LYS A 1 264 ? -14.469 -13.668 59.994  1.00 130.15 ? 311 LYS A CD    1 
ATOM   2068 C CE    . LYS A 1 264 ? -14.665 -12.894 61.295  1.00 150.06 ? 311 LYS A CE    1 
ATOM   2069 N NZ    . LYS A 1 264 ? -15.797 -13.424 62.110  1.00 159.14 ? 311 LYS A NZ    1 
ATOM   2070 N N     . CYS A 1 265 ? -15.624 -10.782 55.192  1.00 87.86  ? 312 CYS A N     1 
ATOM   2071 C CA    . CYS A 1 265 ? -16.595 -10.219 54.244  1.00 87.35  ? 312 CYS A CA    1 
ATOM   2072 C C     . CYS A 1 265 ? -17.704 -11.147 53.938  1.00 88.40  ? 312 CYS A C     1 
ATOM   2073 O O     . CYS A 1 265 ? -17.567 -12.358 54.132  1.00 88.56  ? 312 CYS A O     1 
ATOM   2074 C CB    . CYS A 1 265 ? -15.894 -9.828  52.950  1.00 86.30  ? 312 CYS A CB    1 
ATOM   2075 S SG    . CYS A 1 265 ? -14.629 -8.570  53.166  1.00 90.94  ? 312 CYS A SG    1 
ATOM   2076 N N     . ALA A 1 266 ? -18.761 -10.588 53.339  1.00 82.27  ? 313 ALA A N     1 
ATOM   2077 C CA    . ALA A 1 266 ? -19.897 -11.330 52.834  1.00 82.36  ? 313 ALA A CA    1 
ATOM   2078 C C     . ALA A 1 266 ? -20.206 -10.773 51.458  1.00 85.68  ? 313 ALA A C     1 
ATOM   2079 O O     . ALA A 1 266 ? -20.182 -9.552  51.255  1.00 86.50  ? 313 ALA A O     1 
ATOM   2080 C CB    . ALA A 1 266 ? -21.087 -11.172 53.745  1.00 86.21  ? 313 ALA A CB    1 
ATOM   2081 N N     . PHE A 1 267 ? -20.471 -11.664 50.502  1.00 80.38  ? 314 PHE A N     1 
ATOM   2082 C CA    . PHE A 1 267 ? -20.790 -11.242 49.152  1.00 79.05  ? 314 PHE A CA    1 
ATOM   2083 C C     . PHE A 1 267 ? -22.260 -11.429 48.751  1.00 88.35  ? 314 PHE A C     1 
ATOM   2084 O O     . PHE A 1 267 ? -22.644 -12.473 48.208  1.00 89.13  ? 314 PHE A O     1 
ATOM   2085 C CB    . PHE A 1 267 ? -19.794 -11.804 48.148  1.00 76.76  ? 314 PHE A CB    1 
ATOM   2086 C CG    . PHE A 1 267 ? -18.443 -11.166 48.344  1.00 75.70  ? 314 PHE A CG    1 
ATOM   2087 C CD1   . PHE A 1 267 ? -18.188 -9.878  47.876  1.00 77.77  ? 314 PHE A CD1   1 
ATOM   2088 C CD2   . PHE A 1 267 ? -17.426 -11.847 49.000  1.00 76.21  ? 314 PHE A CD2   1 
ATOM   2089 C CE1   . PHE A 1 267 ? -16.943 -9.283  48.068  1.00 77.22  ? 314 PHE A CE1   1 
ATOM   2090 C CE2   . PHE A 1 267 ? -16.174 -11.252 49.183  1.00 77.84  ? 314 PHE A CE2   1 
ATOM   2091 C CZ    . PHE A 1 267 ? -15.940 -9.976  48.714  1.00 75.49  ? 314 PHE A CZ    1 
ATOM   2092 N N     . TYR A 1 268 ? -23.089 -10.410 49.036  1.00 86.27  ? 315 TYR A N     1 
ATOM   2093 C CA    . TYR A 1 268 ? -24.488 -10.500 48.678  1.00 88.30  ? 315 TYR A CA    1 
ATOM   2094 C C     . TYR A 1 268 ? -24.645 -10.285 47.172  1.00 91.79  ? 315 TYR A C     1 
ATOM   2095 O O     . TYR A 1 268 ? -24.218 -9.247  46.653  1.00 91.25  ? 315 TYR A O     1 
ATOM   2096 C CB    . TYR A 1 268 ? -25.353 -9.544  49.519  1.00 92.52  ? 315 TYR A CB    1 
ATOM   2097 C CG    . TYR A 1 268 ? -26.698 -9.240  48.896  1.00 96.50  ? 315 TYR A CG    1 
ATOM   2098 C CD1   . TYR A 1 268 ? -27.708 -10.197 48.868  1.00 100.70 ? 315 TYR A CD1   1 
ATOM   2099 C CD2   . TYR A 1 268 ? -26.945 -8.009  48.288  1.00 96.93  ? 315 TYR A CD2   1 
ATOM   2100 C CE1   . TYR A 1 268 ? -28.923 -9.945  48.232  1.00 104.76 ? 315 TYR A CE1   1 
ATOM   2101 C CE2   . TYR A 1 268 ? -28.144 -7.756  47.630  1.00 99.70  ? 315 TYR A CE2   1 
ATOM   2102 C CZ    . TYR A 1 268 ? -29.136 -8.721  47.617  1.00 112.51 ? 315 TYR A CZ    1 
ATOM   2103 O OH    . TYR A 1 268 ? -30.343 -8.460  47.019  1.00 122.69 ? 315 TYR A OH    1 
ATOM   2104 N N     . LEU A 1 269 ? -25.228 -11.294 46.475  1.00 87.85  ? 316 LEU A N     1 
ATOM   2105 C CA    . LEU A 1 269 ? -25.486 -11.265 45.042  1.00 86.67  ? 316 LEU A CA    1 
ATOM   2106 C C     . LEU A 1 269 ? -26.529 -10.212 44.816  1.00 97.42  ? 316 LEU A C     1 
ATOM   2107 O O     . LEU A 1 269 ? -27.670 -10.372 45.260  1.00 101.63 ? 316 LEU A O     1 
ATOM   2108 C CB    . LEU A 1 269 ? -25.936 -12.635 44.530  1.00 86.47  ? 316 LEU A CB    1 
ATOM   2109 C CG    . LEU A 1 269 ? -24.790 -13.576 44.165  1.00 89.14  ? 316 LEU A CG    1 
ATOM   2110 C CD1   . LEU A 1 269 ? -24.334 -14.389 45.348  1.00 89.84  ? 316 LEU A CD1   1 
ATOM   2111 C CD2   . LEU A 1 269 ? -25.190 -14.515 43.078  1.00 93.56  ? 316 LEU A CD2   1 
ATOM   2112 N N     . LYS A 1 270 ? -26.115 -9.071  44.229  1.00 93.76  ? 317 LYS A N     1 
ATOM   2113 C CA    . LYS A 1 270 ? -27.005 -7.928  43.995  1.00 95.80  ? 317 LYS A CA    1 
ATOM   2114 C C     . LYS A 1 270 ? -28.300 -8.382  43.308  1.00 103.87 ? 317 LYS A C     1 
ATOM   2115 O O     . LYS A 1 270 ? -28.248 -9.207  42.393  1.00 102.92 ? 317 LYS A O     1 
ATOM   2116 C CB    . LYS A 1 270 ? -26.268 -6.825  43.191  1.00 95.13  ? 317 LYS A CB    1 
ATOM   2117 C CG    . LYS A 1 270 ? -26.999 -5.477  43.078  1.00 90.21  ? 317 LYS A CG    1 
ATOM   2118 C CD    . LYS A 1 270 ? -26.065 -4.283  43.304  1.00 88.65  ? 317 LYS A CD    1 
ATOM   2119 C CE    . LYS A 1 270 ? -26.629 -2.983  42.764  1.00 92.46  ? 317 LYS A CE    1 
ATOM   2120 N NZ    . LYS A 1 270 ? -25.591 -2.154  42.062  1.00 105.29 ? 317 LYS A NZ    1 
ATOM   2121 N N     . ASP A 1 271 ? -29.452 -7.886  43.797  1.00 105.12 ? 318 ASP A N     1 
ATOM   2122 C CA    . ASP A 1 271 ? -30.790 -8.161  43.243  1.00 108.70 ? 318 ASP A CA    1 
ATOM   2123 C C     . ASP A 1 271 ? -31.241 -9.635  43.380  1.00 115.00 ? 318 ASP A C     1 
ATOM   2124 O O     . ASP A 1 271 ? -31.647 -10.258 42.390  1.00 117.11 ? 318 ASP A O     1 
ATOM   2125 C CB    . ASP A 1 271 ? -30.911 -7.649  41.773  1.00 109.90 ? 318 ASP A CB    1 
ATOM   2126 C CG    . ASP A 1 271 ? -30.773 -6.146  41.578  1.00 111.93 ? 318 ASP A CG    1 
ATOM   2127 O OD1   . ASP A 1 271 ? -31.241 -5.379  42.471  1.00 113.71 ? 318 ASP A OD1   1 
ATOM   2128 O OD2   . ASP A 1 271 ? -30.268 -5.729  40.500  1.00 107.51 ? 318 ASP A OD2   1 
ATOM   2129 N N     . THR A 1 272 ? -31.156 -10.190 44.605  1.00 109.79 ? 319 THR A N     1 
ATOM   2130 C CA    . THR A 1 272 ? -31.554 -11.569 44.935  1.00 109.51 ? 319 THR A CA    1 
ATOM   2131 C C     . THR A 1 272 ? -32.189 -11.555 46.321  1.00 116.06 ? 319 THR A C     1 
ATOM   2132 O O     . THR A 1 272 ? -31.955 -10.610 47.083  1.00 115.51 ? 319 THR A O     1 
ATOM   2133 C CB    . THR A 1 272 ? -30.354 -12.564 44.880  1.00 105.23 ? 319 THR A CB    1 
ATOM   2134 O OG1   . THR A 1 272 ? -29.372 -12.227 45.862  1.00 96.98  ? 319 THR A OG1   1 
ATOM   2135 C CG2   . THR A 1 272 ? -29.712 -12.693 43.492  1.00 95.80  ? 319 THR A CG2   1 
ATOM   2136 N N     . GLU A 1 273 ? -32.988 -12.590 46.662  1.00 115.87 ? 320 GLU A N     1 
ATOM   2137 C CA    . GLU A 1 273 ? -33.631 -12.656 47.989  1.00 118.47 ? 320 GLU A CA    1 
ATOM   2138 C C     . GLU A 1 273 ? -32.606 -13.113 49.025  1.00 118.39 ? 320 GLU A C     1 
ATOM   2139 O O     . GLU A 1 273 ? -32.567 -14.290 49.382  1.00 118.94 ? 320 GLU A O     1 
ATOM   2140 C CB    . GLU A 1 273 ? -34.902 -13.545 47.996  1.00 123.79 ? 320 GLU A CB    1 
ATOM   2141 C CG    . GLU A 1 273 ? -36.151 -12.887 47.422  1.00 139.15 ? 320 GLU A CG    1 
ATOM   2142 C CD    . GLU A 1 273 ? -37.089 -12.194 48.399  1.00 167.16 ? 320 GLU A CD    1 
ATOM   2143 O OE1   . GLU A 1 273 ? -37.426 -12.788 49.452  1.00 155.92 ? 320 GLU A OE1   1 
ATOM   2144 O OE2   . GLU A 1 273 ? -37.546 -11.075 48.071  1.00 164.49 ? 320 GLU A OE2   1 
ATOM   2145 N N     . ARG A 1 274 ? -31.742 -12.176 49.464  1.00 110.80 ? 321 ARG A N     1 
ATOM   2146 C CA    . ARG A 1 274 ? -30.690 -12.386 50.472  1.00 108.36 ? 321 ARG A CA    1 
ATOM   2147 C C     . ARG A 1 274 ? -29.734 -13.545 50.139  1.00 108.79 ? 321 ARG A C     1 
ATOM   2148 O O     . ARG A 1 274 ? -29.343 -14.290 51.031  1.00 108.82 ? 321 ARG A O     1 
ATOM   2149 C CB    . ARG A 1 274 ? -31.286 -12.534 51.903  1.00 110.94 ? 321 ARG A CB    1 
ATOM   2150 C CG    . ARG A 1 274 ? -32.427 -11.565 52.216  1.00 117.93 ? 321 ARG A CG    1 
ATOM   2151 C CD    . ARG A 1 274 ? -33.052 -11.781 53.578  1.00 120.98 ? 321 ARG A CD    1 
ATOM   2152 N NE    . ARG A 1 274 ? -33.642 -13.111 53.760  1.00 132.21 ? 321 ARG A NE    1 
ATOM   2153 C CZ    . ARG A 1 274 ? -34.834 -13.486 53.299  1.00 148.40 ? 321 ARG A CZ    1 
ATOM   2154 N NH1   . ARG A 1 274 ? -35.564 -12.652 52.566  1.00 139.76 ? 321 ARG A NH1   1 
ATOM   2155 N NH2   . ARG A 1 274 ? -35.293 -14.707 53.542  1.00 129.08 ? 321 ARG A NH2   1 
ATOM   2156 N N     . MET A 1 275 ? -29.354 -13.687 48.868  1.00 103.28 ? 322 MET A N     1 
ATOM   2157 C CA    . MET A 1 275 ? -28.432 -14.741 48.424  1.00 100.53 ? 322 MET A CA    1 
ATOM   2158 C C     . MET A 1 275 ? -26.988 -14.290 48.508  1.00 100.62 ? 322 MET A C     1 
ATOM   2159 O O     . MET A 1 275 ? -26.647 -13.204 48.041  1.00 99.33  ? 322 MET A O     1 
ATOM   2160 C CB    . MET A 1 275 ? -28.750 -15.220 47.010  1.00 102.31 ? 322 MET A CB    1 
ATOM   2161 C CG    . MET A 1 275 ? -30.137 -15.716 46.861  1.00 109.76 ? 322 MET A CG    1 
ATOM   2162 S SD    . MET A 1 275 ? -30.364 -17.304 47.637  1.00 115.80 ? 322 MET A SD    1 
ATOM   2163 C CE    . MET A 1 275 ? -32.126 -17.496 47.363  1.00 117.44 ? 322 MET A CE    1 
ATOM   2164 N N     . TYR A 1 276 ? -26.144 -15.128 49.104  1.00 95.35  ? 323 TYR A N     1 
ATOM   2165 C CA    . TYR A 1 276 ? -24.735 -14.827 49.295  1.00 92.19  ? 323 TYR A CA    1 
ATOM   2166 C C     . TYR A 1 276 ? -23.846 -15.883 48.647  1.00 95.58  ? 323 TYR A C     1 
ATOM   2167 O O     . TYR A 1 276 ? -24.228 -17.061 48.555  1.00 96.10  ? 323 TYR A O     1 
ATOM   2168 C CB    . TYR A 1 276 ? -24.408 -14.735 50.802  1.00 93.89  ? 323 TYR A CB    1 
ATOM   2169 C CG    . TYR A 1 276 ? -24.932 -13.504 51.511  1.00 96.76  ? 323 TYR A CG    1 
ATOM   2170 C CD1   . TYR A 1 276 ? -26.255 -13.431 51.939  1.00 101.57 ? 323 TYR A CD1   1 
ATOM   2171 C CD2   . TYR A 1 276 ? -24.083 -12.447 51.836  1.00 96.49  ? 323 TYR A CD2   1 
ATOM   2172 C CE1   . TYR A 1 276 ? -26.740 -12.309 52.609  1.00 104.15 ? 323 TYR A CE1   1 
ATOM   2173 C CE2   . TYR A 1 276 ? -24.553 -11.322 52.519  1.00 99.66  ? 323 TYR A CE2   1 
ATOM   2174 C CZ    . TYR A 1 276 ? -25.885 -11.258 52.908  1.00 110.17 ? 323 TYR A CZ    1 
ATOM   2175 O OH    . TYR A 1 276 ? -26.370 -10.163 53.595  1.00 111.66 ? 323 TYR A OH    1 
ATOM   2176 N N     . LEU A 1 277 ? -22.637 -15.447 48.234  1.00 90.35  ? 324 LEU A N     1 
ATOM   2177 C CA    . LEU A 1 277 ? -21.585 -16.273 47.653  1.00 88.75  ? 324 LEU A CA    1 
ATOM   2178 C C     . LEU A 1 277 ? -21.049 -17.158 48.784  1.00 96.67  ? 324 LEU A C     1 
ATOM   2179 O O     . LEU A 1 277 ? -20.423 -16.667 49.743  1.00 97.94  ? 324 LEU A O     1 
ATOM   2180 C CB    . LEU A 1 277 ? -20.496 -15.367 47.110  1.00 85.99  ? 324 LEU A CB    1 
ATOM   2181 C CG    . LEU A 1 277 ? -19.388 -16.029 46.352  1.00 88.17  ? 324 LEU A CG    1 
ATOM   2182 C CD1   . LEU A 1 277 ? -19.852 -16.430 44.964  1.00 88.24  ? 324 LEU A CD1   1 
ATOM   2183 C CD2   . LEU A 1 277 ? -18.200 -15.105 46.288  1.00 87.91  ? 324 LEU A CD2   1 
ATOM   2184 N N     . CYS A 1 278 ? -21.389 -18.456 48.695  1.00 93.37  ? 325 CYS A N     1 
ATOM   2185 C CA    . CYS A 1 278 ? -21.132 -19.457 49.714  1.00 93.56  ? 325 CYS A CA    1 
ATOM   2186 C C     . CYS A 1 278 ? -20.386 -20.628 49.160  1.00 95.30  ? 325 CYS A C     1 
ATOM   2187 O O     . CYS A 1 278 ? -20.434 -20.910 47.974  1.00 92.48  ? 325 CYS A O     1 
ATOM   2188 C CB    . CYS A 1 278 ? -22.455 -19.889 50.348  1.00 97.09  ? 325 CYS A CB    1 
ATOM   2189 S SG    . CYS A 1 278 ? -22.292 -20.966 51.797  1.00 103.11 ? 325 CYS A SG    1 
ATOM   2190 N N     . LEU A 1 279 ? -19.748 -21.336 50.060  1.00 95.31  ? 326 LEU A N     1 
ATOM   2191 C CA    . LEU A 1 279 ? -18.931 -22.517 49.865  1.00 96.19  ? 326 LEU A CA    1 
ATOM   2192 C C     . LEU A 1 279 ? -19.654 -23.746 50.444  1.00 104.99 ? 326 LEU A C     1 
ATOM   2193 O O     . LEU A 1 279 ? -20.217 -23.681 51.542  1.00 107.49 ? 326 LEU A O     1 
ATOM   2194 C CB    . LEU A 1 279 ? -17.660 -22.256 50.705  1.00 95.57  ? 326 LEU A CB    1 
ATOM   2195 C CG    . LEU A 1 279 ? -16.446 -23.175 50.633  1.00 98.77  ? 326 LEU A CG    1 
ATOM   2196 C CD1   . LEU A 1 279 ? -15.261 -22.456 51.206  1.00 96.57  ? 326 LEU A CD1   1 
ATOM   2197 C CD2   . LEU A 1 279 ? -16.644 -24.441 51.461  1.00 104.51 ? 326 LEU A CD2   1 
ATOM   2198 N N     . SER A 1 280 ? -19.575 -24.870 49.735  1.00 102.43 ? 327 SER A N     1 
ATOM   2199 C CA    . SER A 1 280 ? -20.034 -26.182 50.184  1.00 105.57 ? 327 SER A CA    1 
ATOM   2200 C C     . SER A 1 280 ? -18.998 -27.157 49.620  1.00 109.10 ? 327 SER A C     1 
ATOM   2201 O O     . SER A 1 280 ? -19.027 -27.486 48.424  1.00 107.07 ? 327 SER A O     1 
ATOM   2202 C CB    . SER A 1 280 ? -21.453 -26.495 49.714  1.00 110.85 ? 327 SER A CB    1 
ATOM   2203 O OG    . SER A 1 280 ? -21.901 -27.692 50.335  1.00 119.63 ? 327 SER A OG    1 
ATOM   2204 N N     . GLN A 1 281 ? -18.010 -27.516 50.470  1.00 106.77 ? 328 GLN A N     1 
ATOM   2205 C CA    . GLN A 1 281 ? -16.858 -28.361 50.130  1.00 106.52 ? 328 GLN A CA    1 
ATOM   2206 C C     . GLN A 1 281 ? -15.993 -27.627 49.082  1.00 106.03 ? 328 GLN A C     1 
ATOM   2207 O O     . GLN A 1 281 ? -15.445 -26.571 49.399  1.00 103.86 ? 328 GLN A O     1 
ATOM   2208 C CB    . GLN A 1 281 ? -17.261 -29.797 49.693  1.00 110.81 ? 328 GLN A CB    1 
ATOM   2209 C CG    . GLN A 1 281 ? -17.962 -30.629 50.784  1.00 141.77 ? 328 GLN A CG    1 
ATOM   2210 C CD    . GLN A 1 281 ? -19.476 -30.469 50.840  1.00 167.30 ? 328 GLN A CD    1 
ATOM   2211 O OE1   . GLN A 1 281 ? -20.152 -30.177 49.838  1.00 162.84 ? 328 GLN A OE1   1 
ATOM   2212 N NE2   . GLN A 1 281 ? -20.051 -30.712 52.016  1.00 158.87 ? 328 GLN A NE2   1 
ATOM   2213 N N     . GLU A 1 282 ? -15.909 -28.136 47.843  1.00 100.32 ? 329 GLU A N     1 
ATOM   2214 C CA    . GLU A 1 282 ? -15.116 -27.485 46.804  1.00 96.33  ? 329 GLU A CA    1 
ATOM   2215 C C     . GLU A 1 282 ? -15.996 -26.564 45.955  1.00 98.00  ? 329 GLU A C     1 
ATOM   2216 O O     . GLU A 1 282 ? -15.465 -25.760 45.186  1.00 95.75  ? 329 GLU A O     1 
ATOM   2217 C CB    . GLU A 1 282 ? -14.463 -28.551 45.914  1.00 97.73  ? 329 GLU A CB    1 
ATOM   2218 C CG    . GLU A 1 282 ? -13.141 -28.157 45.271  1.00 104.43 ? 329 GLU A CG    1 
ATOM   2219 C CD    . GLU A 1 282 ? -12.684 -29.101 44.172  1.00 129.98 ? 329 GLU A CD    1 
ATOM   2220 O OE1   . GLU A 1 282 ? -12.229 -28.596 43.118  1.00 117.47 ? 329 GLU A OE1   1 
ATOM   2221 O OE2   . GLU A 1 282 ? -12.816 -30.339 44.343  1.00 122.03 ? 329 GLU A OE2   1 
ATOM   2222 N N     . ARG A 1 283 ? -17.340 -26.680 46.099  1.00 94.50  ? 330 ARG A N     1 
ATOM   2223 C CA    . ARG A 1 283 ? -18.340 -25.938 45.317  1.00 92.62  ? 330 ARG A CA    1 
ATOM   2224 C C     . ARG A 1 283 ? -18.610 -24.501 45.765  1.00 93.58  ? 330 ARG A C     1 
ATOM   2225 O O     . ARG A 1 283 ? -18.697 -24.228 46.971  1.00 95.32  ? 330 ARG A O     1 
ATOM   2226 C CB    . ARG A 1 283 ? -19.685 -26.698 45.267  1.00 93.97  ? 330 ARG A CB    1 
ATOM   2227 C CG    . ARG A 1 283 ? -19.568 -28.194 44.954  1.00 101.43 ? 330 ARG A CG    1 
ATOM   2228 C CD    . ARG A 1 283 ? -20.846 -28.880 44.484  1.00 108.29 ? 330 ARG A CD    1 
ATOM   2229 N NE    . ARG A 1 283 ? -22.101 -28.340 45.034  1.00 117.18 ? 330 ARG A NE    1 
ATOM   2230 C CZ    . ARG A 1 283 ? -22.504 -28.459 46.300  1.00 129.31 ? 330 ARG A CZ    1 
ATOM   2231 N NH1   . ARG A 1 283 ? -21.723 -29.044 47.204  1.00 119.43 ? 330 ARG A NH1   1 
ATOM   2232 N NH2   . ARG A 1 283 ? -23.666 -27.949 46.682  1.00 109.61 ? 330 ARG A NH2   1 
ATOM   2233 N N     . ILE A 1 284 ? -18.807 -23.594 44.778  1.00 84.58  ? 331 ILE A N     1 
ATOM   2234 C CA    . ILE A 1 284 ? -19.219 -22.220 45.038  1.00 81.74  ? 331 ILE A CA    1 
ATOM   2235 C C     . ILE A 1 284 ? -20.714 -22.152 44.690  1.00 89.31  ? 331 ILE A C     1 
ATOM   2236 O O     . ILE A 1 284 ? -21.099 -22.400 43.539  1.00 90.58  ? 331 ILE A O     1 
ATOM   2237 C CB    . ILE A 1 284 ? -18.338 -21.154 44.339  1.00 80.48  ? 331 ILE A CB    1 
ATOM   2238 C CG1   . ILE A 1 284 ? -16.848 -21.228 44.793  1.00 78.51  ? 331 ILE A CG1   1 
ATOM   2239 C CG2   . ILE A 1 284 ? -18.890 -19.766 44.535  1.00 79.94  ? 331 ILE A CG2   1 
ATOM   2240 C CD1   . ILE A 1 284 ? -16.465 -20.726 46.200  1.00 78.40  ? 331 ILE A CD1   1 
ATOM   2241 N N     . ILE A 1 285 ? -21.561 -21.926 45.718  1.00 87.28  ? 332 ILE A N     1 
ATOM   2242 C CA    . ILE A 1 285 ? -23.024 -21.865 45.584  1.00 89.26  ? 332 ILE A CA    1 
ATOM   2243 C C     . ILE A 1 285 ? -23.604 -20.517 45.992  1.00 95.86  ? 332 ILE A C     1 
ATOM   2244 O O     . ILE A 1 285 ? -22.868 -19.564 46.264  1.00 94.57  ? 332 ILE A O     1 
ATOM   2245 C CB    . ILE A 1 285 ? -23.790 -23.068 46.227  1.00 94.79  ? 332 ILE A CB    1 
ATOM   2246 C CG1   . ILE A 1 285 ? -23.435 -23.272 47.701  1.00 95.77  ? 332 ILE A CG1   1 
ATOM   2247 C CG2   . ILE A 1 285 ? -23.589 -24.343 45.433  1.00 96.32  ? 332 ILE A CG2   1 
ATOM   2248 C CD1   . ILE A 1 285 ? -24.572 -23.446 48.548  1.00 104.02 ? 332 ILE A CD1   1 
ATOM   2249 N N     . GLN A 1 286 ? -24.933 -20.459 46.039  1.00 95.06  ? 333 GLN A N     1 
ATOM   2250 C CA    . GLN A 1 286 ? -25.735 -19.302 46.391  1.00 95.46  ? 333 GLN A CA    1 
ATOM   2251 C C     . GLN A 1 286 ? -26.560 -19.673 47.654  1.00 101.80 ? 333 GLN A C     1 
ATOM   2252 O O     . GLN A 1 286 ? -27.519 -20.444 47.568  1.00 102.47 ? 333 GLN A O     1 
ATOM   2253 C CB    . GLN A 1 286 ? -26.666 -19.029 45.207  1.00 97.33  ? 333 GLN A CB    1 
ATOM   2254 C CG    . GLN A 1 286 ? -26.830 -17.584 44.810  1.00 94.36  ? 333 GLN A CG    1 
ATOM   2255 C CD    . GLN A 1 286 ? -27.888 -17.526 43.741  1.00 97.77  ? 333 GLN A CD    1 
ATOM   2256 O OE1   . GLN A 1 286 ? -27.699 -18.045 42.639  1.00 88.74  ? 333 GLN A OE1   1 
ATOM   2257 N NE2   . GLN A 1 286 ? -29.059 -16.970 44.056  1.00 92.03  ? 333 GLN A NE2   1 
ATOM   2258 N N     . PHE A 1 287 ? -26.165 -19.164 48.825  1.00 99.92  ? 334 PHE A N     1 
ATOM   2259 C CA    . PHE A 1 287 ? -26.895 -19.495 50.045  1.00 104.10 ? 334 PHE A CA    1 
ATOM   2260 C C     . PHE A 1 287 ? -27.705 -18.330 50.588  1.00 110.72 ? 334 PHE A C     1 
ATOM   2261 O O     . PHE A 1 287 ? -27.173 -17.230 50.738  1.00 108.42 ? 334 PHE A O     1 
ATOM   2262 C CB    . PHE A 1 287 ? -25.975 -20.086 51.111  1.00 106.14 ? 334 PHE A CB    1 
ATOM   2263 C CG    . PHE A 1 287 ? -26.704 -20.744 52.257  1.00 112.63 ? 334 PHE A CG    1 
ATOM   2264 C CD1   . PHE A 1 287 ? -27.072 -22.084 52.190  1.00 118.65 ? 334 PHE A CD1   1 
ATOM   2265 C CD2   . PHE A 1 287 ? -27.006 -20.030 53.416  1.00 117.12 ? 334 PHE A CD2   1 
ATOM   2266 C CE1   . PHE A 1 287 ? -27.735 -22.697 53.262  1.00 123.24 ? 334 PHE A CE1   1 
ATOM   2267 C CE2   . PHE A 1 287 ? -27.660 -20.645 54.489  1.00 123.21 ? 334 PHE A CE2   1 
ATOM   2268 C CZ    . PHE A 1 287 ? -28.021 -21.973 54.403  1.00 123.46 ? 334 PHE A CZ    1 
ATOM   2269 N N     . GLN A 1 288 ? -28.993 -18.589 50.902  1.00 111.93 ? 335 GLN A N     1 
ATOM   2270 C CA    . GLN A 1 288 ? -29.929 -17.593 51.408  1.00 114.45 ? 335 GLN A CA    1 
ATOM   2271 C C     . GLN A 1 288 ? -29.762 -17.358 52.905  1.00 123.69 ? 335 GLN A C     1 
ATOM   2272 O O     . GLN A 1 288 ? -29.795 -18.309 53.691  1.00 125.50 ? 335 GLN A O     1 
ATOM   2273 C CB    . GLN A 1 288 ? -31.379 -17.970 51.070  1.00 118.76 ? 335 GLN A CB    1 
ATOM   2274 C CG    . GLN A 1 288 ? -32.374 -16.864 51.419  1.00 121.09 ? 335 GLN A CG    1 
ATOM   2275 C CD    . GLN A 1 288 ? -33.803 -17.254 51.162  1.00 127.03 ? 335 GLN A CD    1 
ATOM   2276 O OE1   . GLN A 1 288 ? -34.266 -17.265 50.016  1.00 109.10 ? 335 GLN A OE1   1 
ATOM   2277 N NE2   . GLN A 1 288 ? -34.547 -17.531 52.238  1.00 128.79 ? 335 GLN A NE2   1 
ATOM   2278 N N     . ALA A 1 289 ? -29.615 -16.077 53.293  1.00 122.12 ? 336 ALA A N     1 
ATOM   2279 C CA    . ALA A 1 289 ? -29.471 -15.649 54.682  1.00 124.33 ? 336 ALA A CA    1 
ATOM   2280 C C     . ALA A 1 289 ? -30.823 -15.530 55.347  1.00 136.07 ? 336 ALA A C     1 
ATOM   2281 O O     . ALA A 1 289 ? -31.815 -15.188 54.692  1.00 137.70 ? 336 ALA A O     1 
ATOM   2282 C CB    . ALA A 1 289 ? -28.771 -14.305 54.742  1.00 122.88 ? 336 ALA A CB    1 
ATOM   2283 N N     . THR A 1 290 ? -30.858 -15.784 56.655  1.00 136.90 ? 337 THR A N     1 
ATOM   2284 C CA    . THR A 1 290 ? -32.064 -15.630 57.466  1.00 142.18 ? 337 THR A CA    1 
ATOM   2285 C C     . THR A 1 290 ? -31.970 -14.244 58.116  1.00 148.40 ? 337 THR A C     1 
ATOM   2286 O O     . THR A 1 290 ? -30.944 -13.953 58.736  1.00 146.60 ? 337 THR A O     1 
ATOM   2287 C CB    . THR A 1 290 ? -32.196 -16.766 58.484  1.00 153.68 ? 337 THR A CB    1 
ATOM   2288 O OG1   . THR A 1 290 ? -30.917 -17.378 58.679  1.00 152.35 ? 337 THR A OG1   1 
ATOM   2289 C CG2   . THR A 1 290 ? -33.209 -17.807 58.056  1.00 154.09 ? 337 THR A CG2   1 
ATOM   2290 N N     . PRO A 1 291 ? -32.951 -13.331 57.924  1.00 148.04 ? 338 PRO A N     1 
ATOM   2291 C CA    . PRO A 1 291 ? -32.813 -11.996 58.533  1.00 148.36 ? 338 PRO A CA    1 
ATOM   2292 C C     . PRO A 1 291 ? -33.056 -12.011 60.034  1.00 155.62 ? 338 PRO A C     1 
ATOM   2293 O O     . PRO A 1 291 ? -33.838 -12.830 60.519  1.00 157.82 ? 338 PRO A O     1 
ATOM   2294 C CB    . PRO A 1 291 ? -33.821 -11.126 57.768  1.00 151.51 ? 338 PRO A CB    1 
ATOM   2295 C CG    . PRO A 1 291 ? -34.653 -12.059 56.952  1.00 156.99 ? 338 PRO A CG    1 
ATOM   2296 C CD    . PRO A 1 291 ? -34.236 -13.473 57.208  1.00 152.06 ? 338 PRO A CD    1 
ATOM   2297 N N     . CYS A 1 292 ? -32.353 -11.129 60.767  1.00 152.82 ? 339 CYS A N     1 
ATOM   2298 C CA    . CYS A 1 292 ? -32.473 -11.028 62.219  1.00 156.80 ? 339 CYS A CA    1 
ATOM   2299 C C     . CYS A 1 292 ? -33.863 -10.553 62.658  1.00 165.62 ? 339 CYS A C     1 
ATOM   2300 O O     . CYS A 1 292 ? -34.393 -9.603  62.071  1.00 165.88 ? 339 CYS A O     1 
ATOM   2301 C CB    . CYS A 1 292 ? -31.358 -10.176 62.814  1.00 156.24 ? 339 CYS A CB    1 
ATOM   2302 S SG    . CYS A 1 292 ? -29.794 -11.066 63.032  1.00 157.09 ? 339 CYS A SG    1 
ATOM   2303 N N     . PRO A 1 293 ? -34.494 -11.245 63.641  1.00 165.39 ? 340 PRO A N     1 
ATOM   2304 C CA    . PRO A 1 293 ? -35.865 -10.882 64.036  1.00 169.96 ? 340 PRO A CA    1 
ATOM   2305 C C     . PRO A 1 293 ? -36.036 -9.473  64.597  1.00 176.38 ? 340 PRO A C     1 
ATOM   2306 O O     . PRO A 1 293 ? -37.000 -8.795  64.233  1.00 178.27 ? 340 PRO A O     1 
ATOM   2307 C CB    . PRO A 1 293 ? -36.242 -11.968 65.050  1.00 174.79 ? 340 PRO A CB    1 
ATOM   2308 C CG    . PRO A 1 293 ? -35.284 -13.087 64.793  1.00 175.69 ? 340 PRO A CG    1 
ATOM   2309 C CD    . PRO A 1 293 ? -34.019 -12.416 64.405  1.00 166.77 ? 340 PRO A CD    1 
ATOM   2310 N N     . LYS A 1 294 ? -35.100 -9.030  65.460  1.00 172.60 ? 341 LYS A N     1 
ATOM   2311 C CA    . LYS A 1 294 ? -35.137 -7.703  66.083  1.00 174.24 ? 341 LYS A CA    1 
ATOM   2312 C C     . LYS A 1 294 ? -34.349 -6.617  65.314  1.00 176.01 ? 341 LYS A C     1 
ATOM   2313 O O     . LYS A 1 294 ? -34.491 -5.434  65.650  1.00 178.84 ? 341 LYS A O     1 
ATOM   2314 C CB    . LYS A 1 294 ? -34.707 -7.769  67.563  1.00 177.54 ? 341 LYS A CB    1 
ATOM   2315 C CG    . LYS A 1 294 ? -35.829 -8.161  68.512  1.00 183.49 ? 341 LYS A CG    1 
ATOM   2316 C CD    . LYS A 1 294 ? -35.364 -8.118  69.963  1.00 188.92 ? 341 LYS A CD    1 
ATOM   2317 C CE    . LYS A 1 294 ? -36.458 -8.472  70.942  1.00 193.50 ? 341 LYS A CE    1 
ATOM   2318 N NZ    . LYS A 1 294 ? -36.050 -8.213  72.347  1.00 198.18 ? 341 LYS A NZ    1 
ATOM   2319 N N     . GLU A 1 295 ? -33.531 -6.999  64.299  1.00 166.47 ? 342 GLU A N     1 
ATOM   2320 C CA    . GLU A 1 295 ? -32.734 -6.031  63.529  1.00 162.93 ? 342 GLU A CA    1 
ATOM   2321 C C     . GLU A 1 295 ? -32.935 -6.146  62.014  1.00 164.40 ? 342 GLU A C     1 
ATOM   2322 O O     . GLU A 1 295 ? -32.678 -7.203  61.424  1.00 161.84 ? 342 GLU A O     1 
ATOM   2323 C CB    . GLU A 1 295 ? -31.223 -6.118  63.860  1.00 161.09 ? 342 GLU A CB    1 
ATOM   2324 C CG    . GLU A 1 295 ? -30.856 -6.084  65.334  1.00 171.52 ? 342 GLU A CG    1 
ATOM   2325 C CD    . GLU A 1 295 ? -30.620 -7.448  65.957  1.00 185.58 ? 342 GLU A CD    1 
ATOM   2326 O OE1   . GLU A 1 295 ? -29.486 -7.688  66.430  1.00 171.95 ? 342 GLU A OE1   1 
ATOM   2327 O OE2   . GLU A 1 295 ? -31.558 -8.279  65.967  1.00 178.67 ? 342 GLU A OE2   1 
ATOM   2328 N N     . GLN A 1 296 ? -33.339 -5.029  61.384  1.00 160.76 ? 343 GLN A N     1 
ATOM   2329 C CA    . GLN A 1 296 ? -33.543 -4.914  59.933  1.00 157.86 ? 343 GLN A CA    1 
ATOM   2330 C C     . GLN A 1 296 ? -32.180 -4.789  59.170  1.00 155.02 ? 343 GLN A C     1 
ATOM   2331 O O     . GLN A 1 296 ? -32.130 -5.004  57.950  1.00 152.21 ? 343 GLN A O     1 
ATOM   2332 C CB    . GLN A 1 296 ? -34.457 -3.695  59.641  1.00 162.18 ? 343 GLN A CB    1 
ATOM   2333 C CG    . GLN A 1 296 ? -35.164 -3.720  58.280  1.00 171.72 ? 343 GLN A CG    1 
ATOM   2334 C CD    . GLN A 1 296 ? -35.381 -2.334  57.712  1.00 185.13 ? 343 GLN A CD    1 
ATOM   2335 O OE1   . GLN A 1 296 ? -36.400 -1.686  57.964  1.00 184.19 ? 343 GLN A OE1   1 
ATOM   2336 N NE2   . GLN A 1 296 ? -34.438 -1.857  56.908  1.00 168.77 ? 343 GLN A NE2   1 
ATOM   2337 N N     . ASN A 1 297 ? -31.089 -4.445  59.901  1.00 148.28 ? 344 ASN A N     1 
ATOM   2338 C CA    . ASN A 1 297 ? -29.743 -4.218  59.355  1.00 142.89 ? 344 ASN A CA    1 
ATOM   2339 C C     . ASN A 1 297 ? -28.756 -5.400  59.520  1.00 139.93 ? 344 ASN A C     1 
ATOM   2340 O O     . ASN A 1 297 ? -27.563 -5.253  59.230  1.00 135.44 ? 344 ASN A O     1 
ATOM   2341 C CB    . ASN A 1 297 ? -29.165 -2.911  59.936  1.00 144.05 ? 344 ASN A CB    1 
ATOM   2342 C CG    . ASN A 1 297 ? -29.004 -2.875  61.447  1.00 157.44 ? 344 ASN A CG    1 
ATOM   2343 O OD1   . ASN A 1 297 ? -29.298 -3.837  62.176  1.00 148.12 ? 344 ASN A OD1   1 
ATOM   2344 N ND2   . ASN A 1 297 ? -28.510 -1.752  61.952  1.00 148.34 ? 344 ASN A ND2   1 
ATOM   2345 N N     . LYS A 1 298 ? -29.261 -6.555  59.991  1.00 135.62 ? 345 LYS A N     1 
ATOM   2346 C CA    . LYS A 1 298 ? -28.483 -7.772  60.214  1.00 132.31 ? 345 LYS A CA    1 
ATOM   2347 C C     . LYS A 1 298 ? -29.184 -8.996  59.624  1.00 135.17 ? 345 LYS A C     1 
ATOM   2348 O O     . LYS A 1 298 ? -30.401 -9.148  59.775  1.00 138.00 ? 345 LYS A O     1 
ATOM   2349 C CB    . LYS A 1 298 ? -28.246 -8.006  61.716  1.00 136.55 ? 345 LYS A CB    1 
ATOM   2350 C CG    . LYS A 1 298 ? -27.028 -7.307  62.306  1.00 145.28 ? 345 LYS A CG    1 
ATOM   2351 C CD    . LYS A 1 298 ? -26.526 -8.026  63.577  1.00 151.49 ? 345 LYS A CD    1 
ATOM   2352 C CE    . LYS A 1 298 ? -25.882 -7.097  64.584  1.00 154.15 ? 345 LYS A CE    1 
ATOM   2353 N NZ    . LYS A 1 298 ? -24.885 -7.804  65.428  1.00 154.13 ? 345 LYS A NZ    1 
ATOM   2354 N N     . GLU A 1 299 ? -28.394 -9.882  58.980  1.00 127.18 ? 346 GLU A N     1 
ATOM   2355 C CA    . GLU A 1 299 ? -28.837 -11.145 58.381  1.00 125.53 ? 346 GLU A CA    1 
ATOM   2356 C C     . GLU A 1 299 ? -27.889 -12.264 58.806  1.00 126.03 ? 346 GLU A C     1 
ATOM   2357 O O     . GLU A 1 299 ? -26.680 -12.122 58.603  1.00 123.22 ? 346 GLU A O     1 
ATOM   2358 C CB    . GLU A 1 299 ? -28.824 -11.053 56.844  1.00 124.04 ? 346 GLU A CB    1 
ATOM   2359 C CG    . GLU A 1 299 ? -29.854 -10.113 56.247  1.00 138.79 ? 346 GLU A CG    1 
ATOM   2360 C CD    . GLU A 1 299 ? -29.741 -9.900  54.748  1.00 167.87 ? 346 GLU A CD    1 
ATOM   2361 O OE1   . GLU A 1 299 ? -30.043 -8.775  54.289  1.00 165.32 ? 346 GLU A OE1   1 
ATOM   2362 O OE2   . GLU A 1 299 ? -29.356 -10.851 54.030  1.00 166.15 ? 346 GLU A OE2   1 
ATOM   2363 N N     . MET A 1 300 ? -28.421 -13.381 59.359  1.00 122.58 ? 347 MET A N     1 
ATOM   2364 C CA    . MET A 1 300 ? -27.621 -14.560 59.724  1.00 120.64 ? 347 MET A CA    1 
ATOM   2365 C C     . MET A 1 300 ? -27.173 -15.284 58.452  1.00 119.05 ? 347 MET A C     1 
ATOM   2366 O O     . MET A 1 300 ? -28.003 -15.718 57.648  1.00 118.75 ? 347 MET A O     1 
ATOM   2367 C CB    . MET A 1 300 ? -28.400 -15.535 60.603  1.00 126.86 ? 347 MET A CB    1 
ATOM   2368 C CG    . MET A 1 300 ? -28.697 -15.011 61.960  1.00 134.67 ? 347 MET A CG    1 
ATOM   2369 S SD    . MET A 1 300 ? -30.190 -15.808 62.592  1.00 145.02 ? 347 MET A SD    1 
ATOM   2370 C CE    . MET A 1 300 ? -31.475 -14.710 61.948  1.00 142.91 ? 347 MET A CE    1 
ATOM   2371 N N     . ILE A 1 301 ? -25.860 -15.398 58.272  1.00 111.14 ? 348 ILE A N     1 
ATOM   2372 C CA    . ILE A 1 301 ? -25.259 -16.044 57.110  1.00 107.75 ? 348 ILE A CA    1 
ATOM   2373 C C     . ILE A 1 301 ? -24.570 -17.384 57.451  1.00 114.00 ? 348 ILE A C     1 
ATOM   2374 O O     . ILE A 1 301 ? -24.102 -17.578 58.577  1.00 115.37 ? 348 ILE A O     1 
ATOM   2375 C CB    . ILE A 1 301 ? -24.347 -15.064 56.285  1.00 106.45 ? 348 ILE A CB    1 
ATOM   2376 C CG1   . ILE A 1 301 ? -23.230 -14.447 57.135  1.00 106.31 ? 348 ILE A CG1   1 
ATOM   2377 C CG2   . ILE A 1 301 ? -25.163 -13.967 55.631  1.00 105.41 ? 348 ILE A CG2   1 
ATOM   2378 C CD1   . ILE A 1 301 ? -21.877 -14.881 56.769  1.00 110.55 ? 348 ILE A CD1   1 
ATOM   2379 N N     . ASN A 1 302 ? -24.497 -18.295 56.461  1.00 110.32 ? 349 ASN A N     1 
ATOM   2380 C CA    . ASN A 1 302 ? -23.841 -19.598 56.567  1.00 110.33 ? 349 ASN A CA    1 
ATOM   2381 C C     . ASN A 1 302 ? -22.345 -19.396 56.892  1.00 112.66 ? 349 ASN A C     1 
ATOM   2382 O O     . ASN A 1 302 ? -21.785 -18.333 56.620  1.00 109.74 ? 349 ASN A O     1 
ATOM   2383 C CB    . ASN A 1 302 ? -24.010 -20.351 55.248  1.00 111.88 ? 349 ASN A CB    1 
ATOM   2384 C CG    . ASN A 1 302 ? -23.472 -21.758 55.227  1.00 135.31 ? 349 ASN A CG    1 
ATOM   2385 O OD1   . ASN A 1 302 ? -22.278 -21.993 54.990  1.00 128.28 ? 349 ASN A OD1   1 
ATOM   2386 N ND2   . ASN A 1 302 ? -24.354 -22.725 55.420  1.00 127.47 ? 349 ASN A ND2   1 
ATOM   2387 N N     . ASP A 1 303 ? -21.716 -20.412 57.487  1.00 111.17 ? 350 ASP A N     1 
ATOM   2388 C CA    . ASP A 1 303 ? -20.312 -20.388 57.890  1.00 110.12 ? 350 ASP A CA    1 
ATOM   2389 C C     . ASP A 1 303 ? -19.379 -20.333 56.661  1.00 110.96 ? 350 ASP A C     1 
ATOM   2390 O O     . ASP A 1 303 ? -18.290 -19.751 56.724  1.00 110.26 ? 350 ASP A O     1 
ATOM   2391 C CB    . ASP A 1 303 ? -20.016 -21.569 58.835  1.00 114.84 ? 350 ASP A CB    1 
ATOM   2392 C CG    . ASP A 1 303 ? -21.033 -21.706 59.972  1.00 134.00 ? 350 ASP A CG    1 
ATOM   2393 O OD1   . ASP A 1 303 ? -22.194 -22.117 59.694  1.00 135.36 ? 350 ASP A OD1   1 
ATOM   2394 O OD2   . ASP A 1 303 ? -20.678 -21.382 61.133  1.00 145.23 ? 350 ASP A OD2   1 
ATOM   2395 N N     . GLY A 1 304 ? -19.858 -20.867 55.540  1.00 104.60 ? 351 GLY A N     1 
ATOM   2396 C CA    . GLY A 1 304 ? -19.144 -20.837 54.270  1.00 100.08 ? 351 GLY A CA    1 
ATOM   2397 C C     . GLY A 1 304 ? -19.416 -19.587 53.458  1.00 99.21  ? 351 GLY A C     1 
ATOM   2398 O O     . GLY A 1 304 ? -18.993 -19.501 52.305  1.00 95.47  ? 351 GLY A O     1 
ATOM   2399 N N     . ALA A 1 305 ? -20.131 -18.613 54.053  1.00 96.82  ? 352 ALA A N     1 
ATOM   2400 C CA    . ALA A 1 305 ? -20.485 -17.332 53.433  1.00 95.38  ? 352 ALA A CA    1 
ATOM   2401 C C     . ALA A 1 305 ? -19.597 -16.174 53.948  1.00 97.17  ? 352 ALA A C     1 
ATOM   2402 O O     . ALA A 1 305 ? -19.699 -15.038 53.452  1.00 94.94  ? 352 ALA A O     1 
ATOM   2403 C CB    . ALA A 1 305 ? -21.957 -17.030 53.661  1.00 98.92  ? 352 ALA A CB    1 
ATOM   2404 N N     . SER A 1 306 ? -18.699 -16.487 54.912  1.00 94.21  ? 353 SER A N     1 
ATOM   2405 C CA    . SER A 1 306 ? -17.718 -15.554 55.453  1.00 93.91  ? 353 SER A CA    1 
ATOM   2406 C C     . SER A 1 306 ? -16.360 -15.741 54.732  1.00 95.07  ? 353 SER A C     1 
ATOM   2407 O O     . SER A 1 306 ? -15.838 -16.855 54.680  1.00 94.98  ? 353 SER A O     1 
ATOM   2408 C CB    . SER A 1 306 ? -17.572 -15.732 56.958  1.00 100.85 ? 353 SER A CB    1 
ATOM   2409 O OG    . SER A 1 306 ? -16.684 -14.759 57.486  1.00 112.14 ? 353 SER A OG    1 
ATOM   2410 N N     . TRP A 1 307 ? -15.819 -14.652 54.145  1.00 88.78  ? 354 TRP A N     1 
ATOM   2411 C CA    . TRP A 1 307 ? -14.572 -14.672 53.372  1.00 85.63  ? 354 TRP A CA    1 
ATOM   2412 C C     . TRP A 1 307 ? -13.573 -13.658 53.885  1.00 88.64  ? 354 TRP A C     1 
ATOM   2413 O O     . TRP A 1 307 ? -13.911 -12.478 53.986  1.00 90.24  ? 354 TRP A O     1 
ATOM   2414 C CB    . TRP A 1 307 ? -14.854 -14.351 51.890  1.00 82.08  ? 354 TRP A CB    1 
ATOM   2415 C CG    . TRP A 1 307 ? -15.708 -15.362 51.191  1.00 82.74  ? 354 TRP A CG    1 
ATOM   2416 C CD1   . TRP A 1 307 ? -17.065 -15.327 51.028  1.00 86.90  ? 354 TRP A CD1   1 
ATOM   2417 C CD2   . TRP A 1 307 ? -15.252 -16.557 50.540  1.00 80.98  ? 354 TRP A CD2   1 
ATOM   2418 N NE1   . TRP A 1 307 ? -17.488 -16.459 50.361  1.00 86.06  ? 354 TRP A NE1   1 
ATOM   2419 C CE2   . TRP A 1 307 ? -16.392 -17.214 50.022  1.00 85.38  ? 354 TRP A CE2   1 
ATOM   2420 C CE3   . TRP A 1 307 ? -13.982 -17.126 50.325  1.00 80.03  ? 354 TRP A CE3   1 
ATOM   2421 C CZ2   . TRP A 1 307 ? -16.300 -18.410 49.306  1.00 83.51  ? 354 TRP A CZ2   1 
ATOM   2422 C CZ3   . TRP A 1 307 ? -13.893 -18.316 49.620  1.00 80.19  ? 354 TRP A CZ3   1 
ATOM   2423 C CH2   . TRP A 1 307 ? -15.040 -18.952 49.133  1.00 81.66  ? 354 TRP A CH2   1 
ATOM   2424 N N     . THR A 1 308 ? -12.332 -14.087 54.161  1.00 81.88  ? 355 THR A N     1 
ATOM   2425 C CA    . THR A 1 308 ? -11.315 -13.132 54.571  1.00 80.64  ? 355 THR A CA    1 
ATOM   2426 C C     . THR A 1 308 ? -10.756 -12.483 53.289  1.00 83.19  ? 355 THR A C     1 
ATOM   2427 O O     . THR A 1 308 ? -10.461 -13.178 52.312  1.00 82.50  ? 355 THR A O     1 
ATOM   2428 C CB    . THR A 1 308 ? -10.285 -13.783 55.470  1.00 80.57  ? 355 THR A CB    1 
ATOM   2429 O OG1   . THR A 1 308 ? -10.939 -14.305 56.622  1.00 82.06  ? 355 THR A OG1   1 
ATOM   2430 C CG2   . THR A 1 308 ? -9.195  -12.818 55.904  1.00 76.27  ? 355 THR A CG2   1 
ATOM   2431 N N     . ILE A 1 309 ? -10.678 -11.155 53.274  1.00 77.64  ? 356 ILE A N     1 
ATOM   2432 C CA    . ILE A 1 309 ? -10.185 -10.432 52.119  1.00 74.34  ? 356 ILE A CA    1 
ATOM   2433 C C     . ILE A 1 309 ? -8.762  -9.976  52.378  1.00 76.74  ? 356 ILE A C     1 
ATOM   2434 O O     . ILE A 1 309 ? -8.451  -9.500  53.459  1.00 77.18  ? 356 ILE A O     1 
ATOM   2435 C CB    . ILE A 1 309 ? -11.141 -9.270  51.717  1.00 77.69  ? 356 ILE A CB    1 
ATOM   2436 C CG1   . ILE A 1 309 ? -10.832 -8.792  50.272  1.00 76.43  ? 356 ILE A CG1   1 
ATOM   2437 C CG2   . ILE A 1 309 ? -11.104 -8.109  52.745  1.00 79.79  ? 356 ILE A CG2   1 
ATOM   2438 C CD1   . ILE A 1 309 ? -11.901 -8.146  49.523  1.00 86.78  ? 356 ILE A CD1   1 
ATOM   2439 N N     . ILE A 1 310 ? -7.895  -10.124 51.388  1.00 72.46  ? 357 ILE A N     1 
ATOM   2440 C CA    . ILE A 1 310 ? -6.501  -9.700  51.507  1.00 72.97  ? 357 ILE A CA    1 
ATOM   2441 C C     . ILE A 1 310 ? -5.971  -9.226  50.148  1.00 78.73  ? 357 ILE A C     1 
ATOM   2442 O O     . ILE A 1 310 ? -6.239  -9.859  49.126  1.00 77.98  ? 357 ILE A O     1 
ATOM   2443 C CB    . ILE A 1 310 ? -5.608  -10.776 52.197  1.00 75.72  ? 357 ILE A CB    1 
ATOM   2444 C CG1   . ILE A 1 310 ? -4.151  -10.288 52.415  1.00 76.66  ? 357 ILE A CG1   1 
ATOM   2445 C CG2   . ILE A 1 310 ? -5.701  -12.112 51.478  1.00 73.14  ? 357 ILE A CG2   1 
ATOM   2446 C CD1   . ILE A 1 310 ? -3.352  -11.137 53.313  1.00 84.12  ? 357 ILE A CD1   1 
ATOM   2447 N N     . SER A 1 311 ? -5.253  -8.087  50.143  1.00 76.51  ? 358 SER A N     1 
ATOM   2448 C CA    . SER A 1 311 ? -4.656  -7.549  48.935  1.00 74.54  ? 358 SER A CA    1 
ATOM   2449 C C     . SER A 1 311 ? -3.462  -8.369  48.546  1.00 76.81  ? 358 SER A C     1 
ATOM   2450 O O     . SER A 1 311 ? -2.692  -8.769  49.410  1.00 76.77  ? 358 SER A O     1 
ATOM   2451 C CB    . SER A 1 311 ? -4.269  -6.090  49.111  1.00 77.49  ? 358 SER A CB    1 
ATOM   2452 O OG    . SER A 1 311 ? -5.279  -5.301  48.506  1.00 87.05  ? 358 SER A OG    1 
ATOM   2453 N N     . THR A 1 312 ? -3.363  -8.684  47.251  1.00 72.13  ? 359 THR A N     1 
ATOM   2454 C CA    . THR A 1 312 ? -2.260  -9.449  46.684  1.00 71.29  ? 359 THR A CA    1 
ATOM   2455 C C     . THR A 1 312 ? -1.457  -8.597  45.686  1.00 75.88  ? 359 THR A C     1 
ATOM   2456 O O     . THR A 1 312 ? -1.975  -7.597  45.160  1.00 75.53  ? 359 THR A O     1 
ATOM   2457 C CB    . THR A 1 312 ? -2.763  -10.698 45.940  1.00 75.09  ? 359 THR A CB    1 
ATOM   2458 O OG1   . THR A 1 312 ? -3.285  -10.317 44.655  1.00 80.30  ? 359 THR A OG1   1 
ATOM   2459 C CG2   . THR A 1 312 ? -3.733  -11.533 46.743  1.00 67.73  ? 359 THR A CG2   1 
ATOM   2460 N N     . ASP A 1 313 ? -0.220  -9.047  45.391  1.00 71.76  ? 360 ASP A N     1 
ATOM   2461 C CA    . ASP A 1 313 ? 0.664   -8.466  44.396  1.00 71.78  ? 360 ASP A CA    1 
ATOM   2462 C C     . ASP A 1 313 ? 1.451   -9.569  43.704  1.00 74.75  ? 360 ASP A C     1 
ATOM   2463 O O     . ASP A 1 313 ? 1.463   -10.707 44.171  1.00 74.42  ? 360 ASP A O     1 
ATOM   2464 C CB    . ASP A 1 313 ? 1.613   -7.421  45.012  1.00 76.51  ? 360 ASP A CB    1 
ATOM   2465 C CG    . ASP A 1 313 ? 2.063   -6.302  44.067  1.00 86.43  ? 360 ASP A CG    1 
ATOM   2466 O OD1   . ASP A 1 313 ? 1.737   -6.378  42.841  1.00 83.30  ? 360 ASP A OD1   1 
ATOM   2467 O OD2   . ASP A 1 313 ? 2.713   -5.334  44.555  1.00 91.93  ? 360 ASP A OD2   1 
ATOM   2468 N N     . LYS A 1 314 ? 2.122   -9.229  42.598  1.00 69.84  ? 361 LYS A N     1 
ATOM   2469 C CA    . LYS A 1 314 ? 2.901   -10.171 41.826  1.00 68.52  ? 361 LYS A CA    1 
ATOM   2470 C C     . LYS A 1 314 ? 4.246   -9.569  41.461  1.00 75.66  ? 361 LYS A C     1 
ATOM   2471 O O     . LYS A 1 314 ? 4.284   -8.396  41.077  1.00 77.70  ? 361 LYS A O     1 
ATOM   2472 C CB    . LYS A 1 314 ? 2.092   -10.547 40.571  1.00 68.63  ? 361 LYS A CB    1 
ATOM   2473 C CG    . LYS A 1 314 ? 2.892   -10.993 39.350  1.00 79.81  ? 361 LYS A CG    1 
ATOM   2474 C CD    . LYS A 1 314 ? 2.063   -11.829 38.404  1.00 79.87  ? 361 LYS A CD    1 
ATOM   2475 C CE    . LYS A 1 314 ? 1.725   -11.105 37.119  1.00 81.51  ? 361 LYS A CE    1 
ATOM   2476 N NZ    . LYS A 1 314 ? 1.408   -12.083 36.023  1.00 93.31  ? 361 LYS A NZ    1 
ATOM   2477 N N     . ALA A 1 315 ? 5.348   -10.350 41.585  1.00 71.29  ? 362 ALA A N     1 
ATOM   2478 C CA    . ALA A 1 315 ? 6.684   -9.924  41.141  1.00 71.63  ? 362 ALA A CA    1 
ATOM   2479 C C     . ALA A 1 315 ? 7.026   -10.795 39.925  1.00 73.86  ? 362 ALA A C     1 
ATOM   2480 O O     . ALA A 1 315 ? 6.768   -12.002 39.943  1.00 73.41  ? 362 ALA A O     1 
ATOM   2481 C CB    . ALA A 1 315 ? 7.718   -10.105 42.239  1.00 74.65  ? 362 ALA A CB    1 
ATOM   2482 N N     . GLU A 1 316 ? 7.531   -10.176 38.849  1.00 68.51  ? 363 GLU A N     1 
ATOM   2483 C CA    . GLU A 1 316 ? 7.839   -10.854 37.597  1.00 66.95  ? 363 GLU A CA    1 
ATOM   2484 C C     . GLU A 1 316 ? 9.236   -10.463 37.106  1.00 74.16  ? 363 GLU A C     1 
ATOM   2485 O O     . GLU A 1 316 ? 9.588   -9.268  37.069  1.00 76.78  ? 363 GLU A O     1 
ATOM   2486 C CB    . GLU A 1 316 ? 6.778   -10.468 36.587  1.00 67.13  ? 363 GLU A CB    1 
ATOM   2487 C CG    . GLU A 1 316 ? 6.698   -11.316 35.330  1.00 83.04  ? 363 GLU A CG    1 
ATOM   2488 C CD    . GLU A 1 316 ? 5.560   -10.941 34.398  1.00 102.64 ? 363 GLU A CD    1 
ATOM   2489 O OE1   . GLU A 1 316 ? 4.609   -10.253 34.844  1.00 103.36 ? 363 GLU A OE1   1 
ATOM   2490 O OE2   . GLU A 1 316 ? 5.626   -11.333 33.211  1.00 95.31  ? 363 GLU A OE2   1 
ATOM   2491 N N     . TYR A 1 317 ? 10.054  -11.490 36.786  1.00 68.87  ? 364 TYR A N     1 
ATOM   2492 C CA    . TYR A 1 317 ? 11.440  -11.361 36.365  1.00 68.63  ? 364 TYR A CA    1 
ATOM   2493 C C     . TYR A 1 317 ? 11.689  -12.248 35.196  1.00 74.71  ? 364 TYR A C     1 
ATOM   2494 O O     . TYR A 1 317 ? 11.454  -13.449 35.261  1.00 77.80  ? 364 TYR A O     1 
ATOM   2495 C CB    . TYR A 1 317 ? 12.357  -11.742 37.508  1.00 70.48  ? 364 TYR A CB    1 
ATOM   2496 C CG    . TYR A 1 317 ? 12.091  -10.925 38.749  1.00 70.79  ? 364 TYR A CG    1 
ATOM   2497 C CD1   . TYR A 1 317 ? 12.380  -9.571  38.789  1.00 72.19  ? 364 TYR A CD1   1 
ATOM   2498 C CD2   . TYR A 1 317 ? 11.547  -11.511 39.887  1.00 70.81  ? 364 TYR A CD2   1 
ATOM   2499 C CE1   . TYR A 1 317 ? 12.138  -8.819  39.924  1.00 72.02  ? 364 TYR A CE1   1 
ATOM   2500 C CE2   . TYR A 1 317 ? 11.303  -10.766 41.033  1.00 71.70  ? 364 TYR A CE2   1 
ATOM   2501 C CZ    . TYR A 1 317 ? 11.577  -9.415  41.037  1.00 74.10  ? 364 TYR A CZ    1 
ATOM   2502 O OH    . TYR A 1 317 ? 11.316  -8.659  42.150  1.00 75.05  ? 364 TYR A OH    1 
ATOM   2503 N N     . THR A 1 318 ? 12.147  -11.668 34.112  1.00 69.87  ? 365 THR A N     1 
ATOM   2504 C CA    . THR A 1 318 ? 12.368  -12.385 32.877  1.00 68.13  ? 365 THR A CA    1 
ATOM   2505 C C     . THR A 1 318 ? 13.783  -12.136 32.426  1.00 75.59  ? 365 THR A C     1 
ATOM   2506 O O     . THR A 1 318 ? 14.209  -10.968 32.322  1.00 79.46  ? 365 THR A O     1 
ATOM   2507 C CB    . THR A 1 318 ? 11.317  -11.930 31.881  1.00 64.49  ? 365 THR A CB    1 
ATOM   2508 O OG1   . THR A 1 318 ? 10.023  -12.147 32.468  1.00 61.54  ? 365 THR A OG1   1 
ATOM   2509 C CG2   . THR A 1 318 ? 11.438  -12.628 30.551  1.00 59.47  ? 365 THR A CG2   1 
ATOM   2510 N N     . PHE A 1 319 ? 14.502  -13.237 32.147  1.00 68.96  ? 366 PHE A N     1 
ATOM   2511 C CA    . PHE A 1 319 ? 15.902  -13.229 31.737  1.00 70.25  ? 366 PHE A CA    1 
ATOM   2512 C C     . PHE A 1 319 ? 16.228  -14.319 30.686  1.00 74.81  ? 366 PHE A C     1 
ATOM   2513 O O     . PHE A 1 319 ? 15.454  -15.270 30.486  1.00 71.16  ? 366 PHE A O     1 
ATOM   2514 C CB    . PHE A 1 319 ? 16.797  -13.362 32.972  1.00 74.29  ? 366 PHE A CB    1 
ATOM   2515 C CG    . PHE A 1 319 ? 16.593  -14.622 33.777  1.00 75.67  ? 366 PHE A CG    1 
ATOM   2516 C CD1   . PHE A 1 319 ? 15.567  -14.706 34.724  1.00 77.86  ? 366 PHE A CD1   1 
ATOM   2517 C CD2   . PHE A 1 319 ? 17.421  -15.727 33.591  1.00 78.49  ? 366 PHE A CD2   1 
ATOM   2518 C CE1   . PHE A 1 319 ? 15.356  -15.882 35.451  1.00 79.03  ? 366 PHE A CE1   1 
ATOM   2519 C CE2   . PHE A 1 319 ? 17.213  -16.901 34.320  1.00 82.19  ? 366 PHE A CE2   1 
ATOM   2520 C CZ    . PHE A 1 319 ? 16.160  -16.982 35.223  1.00 79.51  ? 366 PHE A CZ    1 
ATOM   2521 N N     . TYR A 1 320 ? 17.375  -14.164 30.005  1.00 74.47  ? 367 TYR A N     1 
ATOM   2522 C CA    . TYR A 1 320 ? 17.814  -15.088 28.957  1.00 74.75  ? 367 TYR A CA    1 
ATOM   2523 C C     . TYR A 1 320 ? 19.329  -15.016 28.820  1.00 80.54  ? 367 TYR A C     1 
ATOM   2524 O O     . TYR A 1 320 ? 19.882  -13.923 28.760  1.00 79.87  ? 367 TYR A O     1 
ATOM   2525 C CB    . TYR A 1 320 ? 17.108  -14.760 27.616  1.00 74.15  ? 367 TYR A CB    1 
ATOM   2526 C CG    . TYR A 1 320 ? 17.549  -15.619 26.452  1.00 77.30  ? 367 TYR A CG    1 
ATOM   2527 C CD1   . TYR A 1 320 ? 16.936  -16.834 26.183  1.00 77.51  ? 367 TYR A CD1   1 
ATOM   2528 C CD2   . TYR A 1 320 ? 18.603  -15.230 25.635  1.00 81.22  ? 367 TYR A CD2   1 
ATOM   2529 C CE1   . TYR A 1 320 ? 17.356  -17.641 25.127  1.00 77.06  ? 367 TYR A CE1   1 
ATOM   2530 C CE2   . TYR A 1 320 ? 19.005  -16.011 24.552  1.00 83.18  ? 367 TYR A CE2   1 
ATOM   2531 C CZ    . TYR A 1 320 ? 18.371  -17.213 24.294  1.00 86.45  ? 367 TYR A CZ    1 
ATOM   2532 O OH    . TYR A 1 320 ? 18.804  -18.013 23.256  1.00 89.14  ? 367 TYR A OH    1 
ATOM   2533 N N     . GLU A 1 321 ? 20.000  -16.181 28.782  1.00 80.37  ? 368 GLU A N     1 
ATOM   2534 C CA    . GLU A 1 321 ? 21.469  -16.239 28.654  1.00 83.27  ? 368 GLU A CA    1 
ATOM   2535 C C     . GLU A 1 321 ? 21.823  -16.062 27.156  1.00 89.23  ? 368 GLU A C     1 
ATOM   2536 O O     . GLU A 1 321 ? 22.109  -17.046 26.446  1.00 89.55  ? 368 GLU A O     1 
ATOM   2537 C CB    . GLU A 1 321 ? 22.054  -17.555 29.216  1.00 85.57  ? 368 GLU A CB    1 
ATOM   2538 C CG    . GLU A 1 321 ? 21.634  -17.957 30.625  1.00 94.22  ? 368 GLU A CG    1 
ATOM   2539 C CD    . GLU A 1 321 ? 22.105  -19.319 31.135  1.00 116.80 ? 368 GLU A CD    1 
ATOM   2540 O OE1   . GLU A 1 321 ? 22.489  -20.199 30.322  1.00 92.93  ? 368 GLU A OE1   1 
ATOM   2541 O OE2   . GLU A 1 321 ? 22.040  -19.517 32.371  1.00 111.53 ? 368 GLU A OE2   1 
ATOM   2542 N N     . GLY A 1 322 ? 21.759  -14.801 26.702  1.00 84.92  ? 369 GLY A N     1 
ATOM   2543 C CA    . GLY A 1 322 ? 22.012  -14.395 25.325  1.00 84.14  ? 369 GLY A CA    1 
ATOM   2544 C C     . GLY A 1 322 ? 23.356  -14.795 24.779  1.00 90.44  ? 369 GLY A C     1 
ATOM   2545 O O     . GLY A 1 322 ? 23.482  -15.066 23.581  1.00 89.18  ? 369 GLY A O     1 
ATOM   2546 N N     . MET A 1 323 ? 24.372  -14.833 25.665  1.00 91.13  ? 370 MET A N     1 
ATOM   2547 C CA    . MET A 1 323 ? 25.748  -15.174 25.316  1.00 93.84  ? 370 MET A CA    1 
ATOM   2548 C C     . MET A 1 323 ? 26.190  -16.473 26.019  1.00 99.10  ? 370 MET A C     1 
ATOM   2549 O O     . MET A 1 323 ? 27.380  -16.755 26.178  1.00 103.60 ? 370 MET A O     1 
ATOM   2550 C CB    . MET A 1 323 ? 26.657  -13.963 25.583  1.00 99.10  ? 370 MET A CB    1 
ATOM   2551 C CG    . MET A 1 323 ? 27.611  -13.675 24.462  1.00 105.87 ? 370 MET A CG    1 
ATOM   2552 S SD    . MET A 1 323 ? 26.761  -13.157 22.965  1.00 108.15 ? 370 MET A SD    1 
ATOM   2553 C CE    . MET A 1 323 ? 27.786  -13.858 21.742  1.00 107.65 ? 370 MET A CE    1 
ATOM   2554 N N     . GLY A 1 324 ? 25.208  -17.279 26.377  1.00 92.48  ? 371 GLY A N     1 
ATOM   2555 C CA    . GLY A 1 324 ? 25.410  -18.552 27.048  1.00 92.94  ? 371 GLY A CA    1 
ATOM   2556 C C     . GLY A 1 324 ? 25.432  -18.384 28.553  1.00 97.13  ? 371 GLY A C     1 
ATOM   2557 O O     . GLY A 1 324 ? 25.311  -17.246 29.036  1.00 94.84  ? 371 GLY A O     1 
ATOM   2558 N N     . PRO A 1 325 ? 25.594  -19.508 29.320  1.00 95.93  ? 372 PRO A N     1 
ATOM   2559 C CA    . PRO A 1 325 ? 25.691  -19.397 30.790  1.00 96.80  ? 372 PRO A CA    1 
ATOM   2560 C C     . PRO A 1 325 ? 26.761  -18.396 31.222  1.00 103.20 ? 372 PRO A C     1 
ATOM   2561 O O     . PRO A 1 325 ? 27.799  -18.235 30.560  1.00 103.29 ? 372 PRO A O     1 
ATOM   2562 C CB    . PRO A 1 325 ? 26.025  -20.825 31.243  1.00 99.89  ? 372 PRO A CB    1 
ATOM   2563 C CG    . PRO A 1 325 ? 25.584  -21.699 30.134  1.00 102.30 ? 372 PRO A CG    1 
ATOM   2564 C CD    . PRO A 1 325 ? 25.804  -20.906 28.883  1.00 97.82  ? 372 PRO A CD    1 
ATOM   2565 N N     . VAL A 1 326 ? 26.445  -17.669 32.300  1.00 100.90 ? 373 VAL A N     1 
ATOM   2566 C CA    . VAL A 1 326 ? 27.259  -16.580 32.853  1.00 103.38 ? 373 VAL A CA    1 
ATOM   2567 C C     . VAL A 1 326 ? 27.818  -16.908 34.237  1.00 109.43 ? 373 VAL A C     1 
ATOM   2568 O O     . VAL A 1 326 ? 27.230  -17.741 34.960  1.00 107.48 ? 373 VAL A O     1 
ATOM   2569 C CB    . VAL A 1 326 ? 26.448  -15.239 32.907  1.00 104.58 ? 373 VAL A CB    1 
ATOM   2570 C CG1   . VAL A 1 326 ? 26.295  -14.611 31.526  1.00 102.98 ? 373 VAL A CG1   1 
ATOM   2571 C CG2   . VAL A 1 326 ? 25.090  -15.413 33.592  1.00 100.73 ? 373 VAL A CG2   1 
ATOM   2572 N N     . LEU A 1 327 ? 28.915  -16.190 34.637  1.00 109.05 ? 374 LEU A N     1 
ATOM   2573 C CA    . LEU A 1 327 ? 29.456  -16.332 35.982  1.00 112.00 ? 374 LEU A CA    1 
ATOM   2574 C C     . LEU A 1 327 ? 28.484  -15.701 36.994  1.00 114.77 ? 374 LEU A C     1 
ATOM   2575 O O     . LEU A 1 327 ? 27.924  -16.415 37.848  1.00 113.92 ? 374 LEU A O     1 
ATOM   2576 C CB    . LEU A 1 327 ? 30.818  -15.666 36.108  1.00 116.70 ? 374 LEU A CB    1 
ATOM   2577 C CG    . LEU A 1 327 ? 32.009  -16.479 35.685  1.00 123.94 ? 374 LEU A CG    1 
ATOM   2578 C CD1   . LEU A 1 327 ? 33.148  -15.566 35.303  1.00 127.23 ? 374 LEU A CD1   1 
ATOM   2579 C CD2   . LEU A 1 327 ? 32.408  -17.458 36.766  1.00 128.24 ? 374 LEU A CD2   1 
ATOM   2580 N N     . ALA A 1 328 ? 28.255  -14.369 36.856  1.00 109.25 ? 375 ALA A N     1 
ATOM   2581 C CA    . ALA A 1 328 ? 27.405  -13.575 37.745  1.00 107.50 ? 375 ALA A CA    1 
ATOM   2582 C C     . ALA A 1 328 ? 25.925  -13.998 37.739  1.00 108.66 ? 375 ALA A C     1 
ATOM   2583 O O     . ALA A 1 328 ? 25.421  -14.359 36.666  1.00 106.58 ? 375 ALA A O     1 
ATOM   2584 C CB    . ALA A 1 328 ? 27.528  -12.102 37.387  1.00 108.72 ? 375 ALA A CB    1 
ATOM   2585 N N     . PRO A 1 329 ? 25.177  -13.925 38.884  1.00 104.06 ? 376 PRO A N     1 
ATOM   2586 C CA    . PRO A 1 329 ? 23.738  -14.248 38.822  1.00 98.68  ? 376 PRO A CA    1 
ATOM   2587 C C     . PRO A 1 329 ? 23.028  -13.265 37.916  1.00 99.25  ? 376 PRO A C     1 
ATOM   2588 O O     . PRO A 1 329 ? 23.522  -12.182 37.585  1.00 98.90  ? 376 PRO A O     1 
ATOM   2589 C CB    . PRO A 1 329 ? 23.244  -14.100 40.270  1.00 100.83 ? 376 PRO A CB    1 
ATOM   2590 C CG    . PRO A 1 329 ? 24.450  -14.026 41.106  1.00 110.25 ? 376 PRO A CG    1 
ATOM   2591 C CD    . PRO A 1 329 ? 25.560  -13.489 40.241  1.00 108.47 ? 376 PRO A CD    1 
ATOM   2592 N N     . VAL A 1 330 ? 21.867  -13.680 37.501  1.00 94.17  ? 377 VAL A N     1 
ATOM   2593 C CA    . VAL A 1 330 ? 20.990  -12.940 36.614  1.00 91.06  ? 377 VAL A CA    1 
ATOM   2594 C C     . VAL A 1 330 ? 20.267  -11.842 37.360  1.00 95.34  ? 377 VAL A C     1 
ATOM   2595 O O     . VAL A 1 330 ? 19.835  -10.864 36.754  1.00 95.56  ? 377 VAL A O     1 
ATOM   2596 C CB    . VAL A 1 330 ? 20.022  -13.918 35.918  1.00 91.04  ? 377 VAL A CB    1 
ATOM   2597 C CG1   . VAL A 1 330 ? 20.779  -14.802 34.931  1.00 91.35  ? 377 VAL A CG1   1 
ATOM   2598 C CG2   . VAL A 1 330 ? 19.250  -14.763 36.936  1.00 89.72  ? 377 VAL A CG2   1 
ATOM   2599 N N     . THR A 1 331 ? 20.147  -12.007 38.674  1.00 92.00  ? 378 THR A N     1 
ATOM   2600 C CA    . THR A 1 331 ? 19.468  -11.098 39.581  1.00 91.58  ? 378 THR A CA    1 
ATOM   2601 C C     . THR A 1 331 ? 20.436  -10.017 40.074  1.00 99.64  ? 378 THR A C     1 
ATOM   2602 O O     . THR A 1 331 ? 21.612  -10.325 40.189  1.00 103.30 ? 378 THR A O     1 
ATOM   2603 C CB    . THR A 1 331 ? 18.943  -11.906 40.768  1.00 99.49  ? 378 THR A CB    1 
ATOM   2604 O OG1   . THR A 1 331 ? 20.041  -12.540 41.410  1.00 104.09 ? 378 THR A OG1   1 
ATOM   2605 C CG2   . THR A 1 331 ? 17.971  -12.950 40.358  1.00 95.27  ? 378 THR A CG2   1 
ATOM   2606 N N     . PRO A 1 332 ? 19.998  -8.786  40.444  1.00 84.56  ? 379 PRO A N     1 
ATOM   2607 C CA    . PRO A 1 332 ? 18.637  -8.239  40.395  1.00 83.69  ? 379 PRO A CA    1 
ATOM   2608 C C     . PRO A 1 332 ? 18.220  -8.024  38.950  1.00 87.47  ? 379 PRO A C     1 
ATOM   2609 O O     . PRO A 1 332 ? 18.915  -7.350  38.178  1.00 88.93  ? 379 PRO A O     1 
ATOM   2610 C CB    . PRO A 1 332 ? 18.756  -6.921  41.187  1.00 87.19  ? 379 PRO A CB    1 
ATOM   2611 C CG    . PRO A 1 332 ? 20.031  -7.015  41.920  1.00 93.63  ? 379 PRO A CG    1 
ATOM   2612 C CD    . PRO A 1 332 ? 20.913  -7.781  40.997  1.00 88.02  ? 379 PRO A CD    1 
ATOM   2613 N N     . VAL A 1 333 ? 17.120  -8.664  38.572  1.00 81.97  ? 380 VAL A N     1 
ATOM   2614 C CA    . VAL A 1 333 ? 16.584  -8.543  37.220  1.00 78.17  ? 380 VAL A CA    1 
ATOM   2615 C C     . VAL A 1 333 ? 15.900  -7.168  37.081  1.00 82.63  ? 380 VAL A C     1 
ATOM   2616 O O     . VAL A 1 333 ? 14.997  -6.866  37.886  1.00 83.50  ? 380 VAL A O     1 
ATOM   2617 C CB    . VAL A 1 333 ? 15.659  -9.726  36.817  1.00 77.98  ? 380 VAL A CB    1 
ATOM   2618 C CG1   . VAL A 1 333 ? 14.995  -9.468  35.479  1.00 74.78  ? 380 VAL A CG1   1 
ATOM   2619 C CG2   . VAL A 1 333 ? 16.438  -11.030 36.773  1.00 77.36  ? 380 VAL A CG2   1 
ATOM   2620 N N     . PRO A 1 334 ? 16.356  -6.327  36.102  1.00 76.57  ? 381 PRO A N     1 
ATOM   2621 C CA    . PRO A 1 334 ? 15.704  -5.021  35.883  1.00 76.16  ? 381 PRO A CA    1 
ATOM   2622 C C     . PRO A 1 334 ? 14.279  -5.209  35.375  1.00 79.80  ? 381 PRO A C     1 
ATOM   2623 O O     . PRO A 1 334 ? 13.997  -6.099  34.564  1.00 78.24  ? 381 PRO A O     1 
ATOM   2624 C CB    . PRO A 1 334 ? 16.558  -4.375  34.793  1.00 76.80  ? 381 PRO A CB    1 
ATOM   2625 C CG    . PRO A 1 334 ? 17.176  -5.504  34.079  1.00 79.23  ? 381 PRO A CG    1 
ATOM   2626 C CD    . PRO A 1 334 ? 17.414  -6.568  35.101  1.00 75.61  ? 381 PRO A CD    1 
ATOM   2627 N N     . VAL A 1 335 ? 13.371  -4.383  35.882  1.00 76.89  ? 382 VAL A N     1 
ATOM   2628 C CA    . VAL A 1 335 ? 11.965  -4.404  35.486  1.00 74.18  ? 382 VAL A CA    1 
ATOM   2629 C C     . VAL A 1 335 ? 11.614  -3.020  34.921  1.00 78.51  ? 382 VAL A C     1 
ATOM   2630 O O     . VAL A 1 335 ? 11.936  -2.014  35.546  1.00 79.43  ? 382 VAL A O     1 
ATOM   2631 C CB    . VAL A 1 335 ? 11.090  -4.775  36.681  1.00 78.22  ? 382 VAL A CB    1 
ATOM   2632 C CG1   . VAL A 1 335 ? 9.626   -4.761  36.293  1.00 78.84  ? 382 VAL A CG1   1 
ATOM   2633 C CG2   . VAL A 1 335 ? 11.479  -6.129  37.220  1.00 77.26  ? 382 VAL A CG2   1 
ATOM   2634 N N     . VAL A 1 336 ? 11.017  -2.971  33.728  1.00 73.75  ? 383 VAL A N     1 
ATOM   2635 C CA    . VAL A 1 336 ? 10.624  -1.694  33.133  1.00 74.70  ? 383 VAL A CA    1 
ATOM   2636 C C     . VAL A 1 336 ? 9.120   -1.506  33.315  1.00 84.08  ? 383 VAL A C     1 
ATOM   2637 O O     . VAL A 1 336 ? 8.324   -2.340  32.860  1.00 84.90  ? 383 VAL A O     1 
ATOM   2638 C CB    . VAL A 1 336 ? 11.095  -1.518  31.675  1.00 75.89  ? 383 VAL A CB    1 
ATOM   2639 C CG1   . VAL A 1 336 ? 10.512  -0.251  31.053  1.00 77.63  ? 383 VAL A CG1   1 
ATOM   2640 C CG2   . VAL A 1 336 ? 12.620  -1.498  31.605  1.00 74.64  ? 383 VAL A CG2   1 
ATOM   2641 N N     . GLU A 1 337 ? 8.744   -0.435  34.026  1.00 83.68  ? 384 GLU A N     1 
ATOM   2642 C CA    . GLU A 1 337 ? 7.363   -0.103  34.325  1.00 87.08  ? 384 GLU A CA    1 
ATOM   2643 C C     . GLU A 1 337 ? 6.636   0.566   33.153  1.00 93.81  ? 384 GLU A C     1 
ATOM   2644 O O     . GLU A 1 337 ? 5.497   0.210   32.854  1.00 94.67  ? 384 GLU A O     1 
ATOM   2645 C CB    . GLU A 1 337 ? 7.293   0.724   35.609  1.00 92.27  ? 384 GLU A CB    1 
ATOM   2646 C CG    . GLU A 1 337 ? 7.623   -0.122  36.831  1.00 104.86 ? 384 GLU A CG    1 
ATOM   2647 C CD    . GLU A 1 337 ? 7.943   0.567   38.145  1.00 129.61 ? 384 GLU A CD    1 
ATOM   2648 O OE1   . GLU A 1 337 ? 7.923   1.820   38.209  1.00 122.88 ? 384 GLU A OE1   1 
ATOM   2649 O OE2   . GLU A 1 337 ? 8.234   -0.166  39.117  1.00 117.95 ? 384 GLU A OE2   1 
ATOM   2650 N N     . SER A 1 338 ? 7.312   1.494   32.464  1.00 92.11  ? 385 SER A N     1 
ATOM   2651 C CA    . SER A 1 338 ? 6.769   2.262   31.336  1.00 93.15  ? 385 SER A CA    1 
ATOM   2652 C C     . SER A 1 338 ? 7.888   2.911   30.531  1.00 95.20  ? 385 SER A C     1 
ATOM   2653 O O     . SER A 1 338 ? 9.022   2.976   31.003  1.00 91.68  ? 385 SER A O     1 
ATOM   2654 C CB    . SER A 1 338 ? 5.849   3.358   31.859  1.00 100.54 ? 385 SER A CB    1 
ATOM   2655 O OG    . SER A 1 338 ? 6.477   4.061   32.921  1.00 110.56 ? 385 SER A OG    1 
ATOM   2656 N N     . LEU A 1 339 ? 7.550   3.409   29.323  1.00 94.64  ? 386 LEU A N     1 
ATOM   2657 C CA    . LEU A 1 339 ? 8.468   4.148   28.443  1.00 95.28  ? 386 LEU A CA    1 
ATOM   2658 C C     . LEU A 1 339 ? 7.823   5.472   28.026  1.00 103.32 ? 386 LEU A C     1 
ATOM   2659 O O     . LEU A 1 339 ? 6.606   5.520   27.801  1.00 103.47 ? 386 LEU A O     1 
ATOM   2660 C CB    . LEU A 1 339 ? 8.862   3.362   27.179  1.00 92.62  ? 386 LEU A CB    1 
ATOM   2661 C CG    . LEU A 1 339 ? 9.186   1.880   27.326  1.00 94.53  ? 386 LEU A CG    1 
ATOM   2662 C CD1   . LEU A 1 339 ? 8.824   1.130   26.071  1.00 93.51  ? 386 LEU A CD1   1 
ATOM   2663 C CD2   . LEU A 1 339 ? 10.642  1.661   27.692  1.00 95.35  ? 386 LEU A CD2   1 
ATOM   2664 N N     . GLN A 1 340 ? 8.650   6.534   27.899  1.00 103.04 ? 387 GLN A N     1 
ATOM   2665 C CA    . GLN A 1 340 ? 8.223   7.877   27.487  1.00 107.64 ? 387 GLN A CA    1 
ATOM   2666 C C     . GLN A 1 340 ? 9.248   8.594   26.621  1.00 113.04 ? 387 GLN A C     1 
ATOM   2667 O O     . GLN A 1 340 ? 10.452  8.415   26.796  1.00 111.09 ? 387 GLN A O     1 
ATOM   2668 C CB    . GLN A 1 340 ? 7.919   8.747   28.712  1.00 113.42 ? 387 GLN A CB    1 
ATOM   2669 C CG    . GLN A 1 340 ? 6.430   8.876   29.022  1.00 140.30 ? 387 GLN A CG    1 
ATOM   2670 C CD    . GLN A 1 340 ? 6.139   10.026  29.958  1.00 163.94 ? 387 GLN A CD    1 
ATOM   2671 O OE1   . GLN A 1 340 ? 6.433   11.192  29.661  1.00 162.13 ? 387 GLN A OE1   1 
ATOM   2672 N NE2   . GLN A 1 340 ? 5.529   9.725   31.102  1.00 156.25 ? 387 GLN A NE2   1 
ATOM   2673 N N     . LEU A 1 341 ? 8.766   9.447   25.720  1.00 113.78 ? 388 LEU A N     1 
ATOM   2674 C CA    . LEU A 1 341 ? 9.614   10.277  24.876  1.00 116.15 ? 388 LEU A CA    1 
ATOM   2675 C C     . LEU A 1 341 ? 9.941   11.574  25.643  1.00 129.95 ? 388 LEU A C     1 
ATOM   2676 O O     . LEU A 1 341 ? 9.157   12.003  26.501  1.00 132.43 ? 388 LEU A O     1 
ATOM   2677 C CB    . LEU A 1 341 ? 8.870   10.607  23.574  1.00 117.76 ? 388 LEU A CB    1 
ATOM   2678 C CG    . LEU A 1 341 ? 8.927   9.626   22.396  1.00 118.87 ? 388 LEU A CG    1 
ATOM   2679 C CD1   . LEU A 1 341 ? 10.343  9.436   21.873  1.00 117.20 ? 388 LEU A CD1   1 
ATOM   2680 C CD2   . LEU A 1 341 ? 8.197   8.316   22.687  1.00 118.56 ? 388 LEU A CD2   1 
ATOM   2681 N N     . ASN A 1 342 ? 11.076  12.218  25.310  1.00 132.00 ? 389 ASN A N     1 
ATOM   2682 C CA    . ASN A 1 342 ? 11.531  13.461  25.956  1.00 138.86 ? 389 ASN A CA    1 
ATOM   2683 C C     . ASN A 1 342 ? 10.945  14.864  25.527  1.00 151.22 ? 389 ASN A C     1 
ATOM   2684 O O     . ASN A 1 342 ? 11.069  15.812  26.312  1.00 155.20 ? 389 ASN A O     1 
ATOM   2685 C CB    . ASN A 1 342 ? 13.060  13.492  26.075  1.00 143.06 ? 389 ASN A CB    1 
ATOM   2686 C CG    . ASN A 1 342 ? 13.611  12.815  27.318  1.00 169.54 ? 389 ASN A CG    1 
ATOM   2687 O OD1   . ASN A 1 342 ? 12.992  11.917  27.918  1.00 159.59 ? 389 ASN A OD1   1 
ATOM   2688 N ND2   . ASN A 1 342 ? 14.804  13.235  27.730  1.00 163.86 ? 389 ASN A ND2   1 
ATOM   2689 N N     . GLY A 1 343 ? 10.326  15.022  24.345  1.00 149.70 ? 390 GLY A N     1 
ATOM   2690 C CA    . GLY A 1 343 ? 10.096  14.029  23.295  1.00 145.08 ? 390 GLY A CA    1 
ATOM   2691 C C     . GLY A 1 343 ? 11.250  13.850  22.323  1.00 146.93 ? 390 GLY A C     1 
ATOM   2692 O O     . GLY A 1 343 ? 11.930  12.821  22.354  1.00 140.76 ? 390 GLY A O     1 
ATOM   2693 N N     . GLY A 1 344 ? 11.456  14.822  21.430  1.00 148.50 ? 391 GLY A N     1 
ATOM   2694 C CA    . GLY A 1 344 ? 10.711  16.078  21.369  1.00 154.53 ? 391 GLY A CA    1 
ATOM   2695 C C     . GLY A 1 344 ? 11.438  17.162  22.140  1.00 163.57 ? 391 GLY A C     1 
ATOM   2696 O O     . GLY A 1 344 ? 10.839  17.875  22.952  1.00 167.01 ? 391 GLY A O     1 
ATOM   2697 N N     . GLY A 1 345 ? 12.749  17.220  21.905  1.00 160.21 ? 392 GLY A N     1 
ATOM   2698 C CA    . GLY A 1 345 ? 13.706  18.157  22.475  1.00 164.52 ? 392 GLY A CA    1 
ATOM   2699 C C     . GLY A 1 345 ? 14.781  18.369  21.434  1.00 168.64 ? 392 GLY A C     1 
ATOM   2700 O O     . GLY A 1 345 ? 14.528  19.032  20.428  1.00 172.60 ? 392 GLY A O     1 
ATOM   2701 N N     . ASP A 1 346 ? 15.960  17.750  21.622  1.00 160.70 ? 393 ASP A N     1 
ATOM   2702 C CA    . ASP A 1 346 ? 17.050  17.819  20.640  1.00 161.37 ? 393 ASP A CA    1 
ATOM   2703 C C     . ASP A 1 346 ? 16.828  16.658  19.660  1.00 156.45 ? 393 ASP A C     1 
ATOM   2704 O O     . ASP A 1 346 ? 16.202  16.857  18.614  1.00 156.31 ? 393 ASP A O     1 
ATOM   2705 C CB    . ASP A 1 346 ? 18.429  17.748  21.334  1.00 164.57 ? 393 ASP A CB    1 
ATOM   2706 C CG    . ASP A 1 346 ? 19.608  17.780  20.380  1.00 176.73 ? 393 ASP A CG    1 
ATOM   2707 O OD1   . ASP A 1 346 ? 20.071  18.898  20.041  1.00 185.94 ? 393 ASP A OD1   1 
ATOM   2708 O OD2   . ASP A 1 346 ? 20.077  16.690  19.980  1.00 174.95 ? 393 ASP A OD2   1 
ATOM   2709 N N     . VAL A 1 347 ? 17.298  15.444  20.034  1.00 145.62 ? 394 VAL A N     1 
ATOM   2710 C CA    . VAL A 1 347 ? 17.099  14.194  19.303  1.00 138.98 ? 394 VAL A CA    1 
ATOM   2711 C C     . VAL A 1 347 ? 16.111  13.374  20.112  1.00 135.85 ? 394 VAL A C     1 
ATOM   2712 O O     . VAL A 1 347 ? 15.914  13.658  21.298  1.00 135.42 ? 394 VAL A O     1 
ATOM   2713 C CB    . VAL A 1 347 ? 18.395  13.399  18.986  1.00 141.43 ? 394 VAL A CB    1 
ATOM   2714 C CG1   . VAL A 1 347 ? 19.247  14.121  17.952  1.00 146.97 ? 394 VAL A CG1   1 
ATOM   2715 C CG2   . VAL A 1 347 ? 19.198  13.074  20.244  1.00 140.12 ? 394 VAL A CG2   1 
ATOM   2716 N N     . ALA A 1 348 ? 15.480  12.377  19.473  1.00 127.40 ? 395 ALA A N     1 
ATOM   2717 C CA    . ALA A 1 348 ? 14.492  11.512  20.107  1.00 122.20 ? 395 ALA A CA    1 
ATOM   2718 C C     . ALA A 1 348 ? 15.139  10.645  21.184  1.00 122.56 ? 395 ALA A C     1 
ATOM   2719 O O     . ALA A 1 348 ? 16.062  9.867   20.904  1.00 120.54 ? 395 ALA A O     1 
ATOM   2720 C CB    . ALA A 1 348 ? 13.791  10.652  19.068  1.00 120.10 ? 395 ALA A CB    1 
ATOM   2721 N N     . MET A 1 349 ? 14.686  10.851  22.431  1.00 117.82 ? 396 MET A N     1 
ATOM   2722 C CA    . MET A 1 349 ? 15.159  10.144  23.611  1.00 114.03 ? 396 MET A CA    1 
ATOM   2723 C C     . MET A 1 349 ? 14.019  9.344   24.130  1.00 114.36 ? 396 MET A C     1 
ATOM   2724 O O     . MET A 1 349 ? 12.881  9.821   24.096  1.00 116.51 ? 396 MET A O     1 
ATOM   2725 C CB    . MET A 1 349 ? 15.556  11.118  24.734  1.00 120.34 ? 396 MET A CB    1 
ATOM   2726 C CG    . MET A 1 349 ? 16.630  12.086  24.371  1.00 129.22 ? 396 MET A CG    1 
ATOM   2727 S SD    . MET A 1 349 ? 18.232  11.297  24.213  1.00 132.38 ? 396 MET A SD    1 
ATOM   2728 C CE    . MET A 1 349 ? 19.260  12.738  24.004  1.00 136.87 ? 396 MET A CE    1 
ATOM   2729 N N     . LEU A 1 350 ? 14.320  8.152   24.670  1.00 105.59 ? 397 LEU A N     1 
ATOM   2730 C CA    . LEU A 1 350 ? 13.344  7.295   25.329  1.00 101.26 ? 397 LEU A CA    1 
ATOM   2731 C C     . LEU A 1 350 ? 13.733  7.231   26.794  1.00 105.13 ? 397 LEU A C     1 
ATOM   2732 O O     . LEU A 1 350 ? 14.925  7.055   27.105  1.00 105.10 ? 397 LEU A O     1 
ATOM   2733 C CB    . LEU A 1 350 ? 13.318  5.883   24.718  1.00 96.49  ? 397 LEU A CB    1 
ATOM   2734 C CG    . LEU A 1 350 ? 12.044  5.057   24.942  1.00 97.52  ? 397 LEU A CG    1 
ATOM   2735 C CD1   . LEU A 1 350 ? 10.851  5.664   24.209  1.00 99.64  ? 397 LEU A CD1   1 
ATOM   2736 C CD2   . LEU A 1 350 ? 12.231  3.670   24.457  1.00 93.58  ? 397 LEU A CD2   1 
ATOM   2737 N N     . GLU A 1 351 ? 12.740  7.447   27.684  1.00 102.14 ? 398 GLU A N     1 
ATOM   2738 C CA    . GLU A 1 351 ? 12.891  7.374   29.131  1.00 102.96 ? 398 GLU A CA    1 
ATOM   2739 C C     . GLU A 1 351 ? 12.278  6.067   29.662  1.00 105.78 ? 398 GLU A C     1 
ATOM   2740 O O     . GLU A 1 351 ? 11.109  5.746   29.396  1.00 106.10 ? 398 GLU A O     1 
ATOM   2741 C CB    . GLU A 1 351 ? 12.286  8.589   29.843  1.00 109.10 ? 398 GLU A CB    1 
ATOM   2742 C CG    . GLU A 1 351 ? 12.814  8.743   31.267  1.00 126.07 ? 398 GLU A CG    1 
ATOM   2743 C CD    . GLU A 1 351 ? 11.980  9.518   32.278  1.00 151.84 ? 398 GLU A CD    1 
ATOM   2744 O OE1   . GLU A 1 351 ? 11.203  10.412  31.867  1.00 139.12 ? 398 GLU A OE1   1 
ATOM   2745 O OE2   . GLU A 1 351 ? 12.130  9.245   33.493  1.00 141.85 ? 398 GLU A OE2   1 
ATOM   2746 N N     . LEU A 1 352 ? 13.084  5.328   30.423  1.00 99.47  ? 399 LEU A N     1 
ATOM   2747 C CA    . LEU A 1 352 ? 12.707  4.075   31.044  1.00 95.59  ? 399 LEU A CA    1 
ATOM   2748 C C     . LEU A 1 352 ? 12.532  4.267   32.549  1.00 100.12 ? 399 LEU A C     1 
ATOM   2749 O O     . LEU A 1 352 ? 13.412  4.785   33.243  1.00 101.89 ? 399 LEU A O     1 
ATOM   2750 C CB    . LEU A 1 352 ? 13.753  3.000   30.751  1.00 92.96  ? 399 LEU A CB    1 
ATOM   2751 C CG    . LEU A 1 352 ? 13.839  2.559   29.300  1.00 96.31  ? 399 LEU A CG    1 
ATOM   2752 C CD1   . LEU A 1 352 ? 14.928  3.298   28.569  1.00 98.29  ? 399 LEU A CD1   1 
ATOM   2753 C CD2   . LEU A 1 352 ? 14.099  1.083   29.203  1.00 96.32  ? 399 LEU A CD2   1 
ATOM   2754 N N     . THR A 1 353 ? 11.353  3.895   33.031  1.00 95.54  ? 400 THR A N     1 
ATOM   2755 C CA    . THR A 1 353 ? 10.960  3.943   34.428  1.00 96.43  ? 400 THR A CA    1 
ATOM   2756 C C     . THR A 1 353 ? 10.817  2.490   34.849  1.00 96.35  ? 400 THR A C     1 
ATOM   2757 O O     . THR A 1 353 ? 10.193  1.700   34.146  1.00 93.93  ? 400 THR A O     1 
ATOM   2758 C CB    . THR A 1 353 ? 9.644   4.736   34.561  1.00 99.24  ? 400 THR A CB    1 
ATOM   2759 O OG1   . THR A 1 353 ? 9.899   6.096   34.227  1.00 96.69  ? 400 THR A OG1   1 
ATOM   2760 C CG2   . THR A 1 353 ? 9.028   4.656   35.959  1.00 100.47 ? 400 THR A CG2   1 
ATOM   2761 N N     . GLY A 1 354 ? 11.405  2.152   35.973  1.00 92.72  ? 401 GLY A N     1 
ATOM   2762 C CA    . GLY A 1 354 ? 11.311  0.816   36.520  1.00 90.88  ? 401 GLY A CA    1 
ATOM   2763 C C     . GLY A 1 354 ? 12.040  0.686   37.829  1.00 99.18  ? 401 GLY A C     1 
ATOM   2764 O O     . GLY A 1 354 ? 11.914  1.543   38.708  1.00 103.34 ? 401 GLY A O     1 
ATOM   2765 N N     . GLN A 1 355 ? 12.799  -0.407  37.947  1.00 95.29  ? 402 GLN A N     1 
ATOM   2766 C CA    . GLN A 1 355 ? 13.605  -0.773  39.101  1.00 97.70  ? 402 GLN A CA    1 
ATOM   2767 C C     . GLN A 1 355 ? 14.714  -1.756  38.677  1.00 98.71  ? 402 GLN A C     1 
ATOM   2768 O O     . GLN A 1 355 ? 14.601  -2.441  37.645  1.00 93.93  ? 402 GLN A O     1 
ATOM   2769 C CB    . GLN A 1 355 ? 12.713  -1.345  40.236  1.00 101.81 ? 402 GLN A CB    1 
ATOM   2770 C CG    . GLN A 1 355 ? 13.407  -1.531  41.613  1.00 137.71 ? 402 GLN A CG    1 
ATOM   2771 C CD    . GLN A 1 355 ? 14.089  -0.294  42.204  1.00 159.05 ? 402 GLN A CD    1 
ATOM   2772 O OE1   . GLN A 1 355 ? 15.257  0.021   41.914  1.00 148.44 ? 402 GLN A OE1   1 
ATOM   2773 N NE2   . GLN A 1 355 ? 13.402  0.383   43.119  1.00 155.91 ? 402 GLN A NE2   1 
ATOM   2774 N N     . ASN A 1 356 ? 15.802  -1.774  39.481  1.00 97.83  ? 403 ASN A N     1 
ATOM   2775 C CA    . ASN A 1 356 ? 16.998  -2.611  39.358  1.00 96.44  ? 403 ASN A CA    1 
ATOM   2776 C C     . ASN A 1 356 ? 17.847  -2.289  38.139  1.00 98.39  ? 403 ASN A C     1 
ATOM   2777 O O     . ASN A 1 356 ? 18.591  -3.146  37.659  1.00 96.69  ? 403 ASN A O     1 
ATOM   2778 C CB    . ASN A 1 356 ? 16.692  -4.120  39.500  1.00 96.05  ? 403 ASN A CB    1 
ATOM   2779 C CG    . ASN A 1 356 ? 15.812  -4.496  40.676  1.00 113.45 ? 403 ASN A CG    1 
ATOM   2780 O OD1   . ASN A 1 356 ? 15.859  -3.883  41.748  1.00 108.81 ? 403 ASN A OD1   1 
ATOM   2781 N ND2   . ASN A 1 356 ? 14.999  -5.533  40.501  1.00 99.12  ? 403 ASN A ND2   1 
ATOM   2782 N N     . PHE A 1 357 ? 17.770  -1.036  37.665  1.00 96.20  ? 404 PHE A N     1 
ATOM   2783 C CA    . PHE A 1 357 ? 18.606  -0.549  36.568  1.00 95.92  ? 404 PHE A CA    1 
ATOM   2784 C C     . PHE A 1 357 ? 20.027  -0.382  37.141  1.00 104.68 ? 404 PHE A C     1 
ATOM   2785 O O     . PHE A 1 357 ? 20.176  -0.061  38.327  1.00 108.49 ? 404 PHE A O     1 
ATOM   2786 C CB    . PHE A 1 357 ? 18.094  0.800   36.007  1.00 98.42  ? 404 PHE A CB    1 
ATOM   2787 C CG    . PHE A 1 357 ? 16.704  0.820   35.396  1.00 97.45  ? 404 PHE A CG    1 
ATOM   2788 C CD1   . PHE A 1 357 ? 16.142  -0.332  34.850  1.00 95.85  ? 404 PHE A CD1   1 
ATOM   2789 C CD2   . PHE A 1 357 ? 15.984  2.003   35.308  1.00 101.19 ? 404 PHE A CD2   1 
ATOM   2790 C CE1   . PHE A 1 357 ? 14.874  -0.302  34.263  1.00 94.33  ? 404 PHE A CE1   1 
ATOM   2791 C CE2   . PHE A 1 357 ? 14.715  2.028   34.717  1.00 101.57 ? 404 PHE A CE2   1 
ATOM   2792 C CZ    . PHE A 1 357 ? 14.178  0.880   34.187  1.00 95.26  ? 404 PHE A CZ    1 
ATOM   2793 N N     . THR A 1 358 ? 21.059  -0.676  36.324  1.00 99.84  ? 405 THR A N     1 
ATOM   2794 C CA    . THR A 1 358 ? 22.465  -0.580  36.712  1.00 102.94 ? 405 THR A CA    1 
ATOM   2795 C C     . THR A 1 358 ? 23.270  0.113   35.621  1.00 107.61 ? 405 THR A C     1 
ATOM   2796 O O     . THR A 1 358 ? 22.873  0.059   34.455  1.00 102.85 ? 405 THR A O     1 
ATOM   2797 C CB    . THR A 1 358 ? 23.055  -1.955  36.990  1.00 110.84 ? 405 THR A CB    1 
ATOM   2798 O OG1   . THR A 1 358 ? 23.239  -2.653  35.751  1.00 111.11 ? 405 THR A OG1   1 
ATOM   2799 C CG2   . THR A 1 358 ? 22.250  -2.755  38.018  1.00 107.13 ? 405 THR A CG2   1 
ATOM   2800 N N     . PRO A 1 359 ? 24.427  0.742   35.953  1.00 110.77 ? 406 PRO A N     1 
ATOM   2801 C CA    . PRO A 1 359 ? 25.236  1.386   34.902  1.00 112.85 ? 406 PRO A CA    1 
ATOM   2802 C C     . PRO A 1 359 ? 25.707  0.424   33.802  1.00 116.64 ? 406 PRO A C     1 
ATOM   2803 O O     . PRO A 1 359 ? 25.993  0.862   32.685  1.00 116.47 ? 406 PRO A O     1 
ATOM   2804 C CB    . PRO A 1 359 ? 26.412  1.957   35.685  1.00 120.51 ? 406 PRO A CB    1 
ATOM   2805 C CG    . PRO A 1 359 ? 26.475  1.120   36.913  1.00 124.90 ? 406 PRO A CG    1 
ATOM   2806 C CD    . PRO A 1 359 ? 25.065  0.906   37.275  1.00 116.27 ? 406 PRO A CD    1 
ATOM   2807 N N     . ASN A 1 360 ? 25.741  -0.888  34.104  1.00 112.49 ? 407 ASN A N     1 
ATOM   2808 C CA    . ASN A 1 360 ? 26.191  -1.902  33.159  1.00 110.81 ? 407 ASN A CA    1 
ATOM   2809 C C     . ASN A 1 360 ? 25.116  -2.551  32.276  1.00 106.45 ? 407 ASN A C     1 
ATOM   2810 O O     . ASN A 1 360 ? 25.326  -3.650  31.769  1.00 104.28 ? 407 ASN A O     1 
ATOM   2811 C CB    . ASN A 1 360 ? 27.154  -2.900  33.822  1.00 119.33 ? 407 ASN A CB    1 
ATOM   2812 C CG    . ASN A 1 360 ? 26.599  -3.639  35.020  1.00 134.86 ? 407 ASN A CG    1 
ATOM   2813 O OD1   . ASN A 1 360 ? 25.745  -4.548  34.895  1.00 104.76 ? 407 ASN A OD1   1 
ATOM   2814 N ND2   . ASN A 1 360 ? 27.160  -3.319  36.195  1.00 130.29 ? 407 ASN A ND2   1 
ATOM   2815 N N     . LEU A 1 361 ? 23.996  -1.830  32.039  1.00 99.94  ? 408 LEU A N     1 
ATOM   2816 C CA    . LEU A 1 361 ? 22.869  -2.239  31.174  1.00 94.24  ? 408 LEU A CA    1 
ATOM   2817 C C     . LEU A 1 361 ? 22.811  -1.354  29.915  1.00 98.62  ? 408 LEU A C     1 
ATOM   2818 O O     . LEU A 1 361 ? 23.087  -0.155  30.006  1.00 101.07 ? 408 LEU A O     1 
ATOM   2819 C CB    . LEU A 1 361 ? 21.514  -2.107  31.900  1.00 91.71  ? 408 LEU A CB    1 
ATOM   2820 C CG    . LEU A 1 361 ? 21.178  -3.051  33.040  1.00 95.28  ? 408 LEU A CG    1 
ATOM   2821 C CD1   . LEU A 1 361 ? 19.870  -2.666  33.671  1.00 94.02  ? 408 LEU A CD1   1 
ATOM   2822 C CD2   . LEU A 1 361 ? 21.066  -4.464  32.573  1.00 97.35  ? 408 LEU A CD2   1 
ATOM   2823 N N     . ARG A 1 362 ? 22.401  -1.929  28.760  1.00 92.44  ? 409 ARG A N     1 
ATOM   2824 C CA    . ARG A 1 362 ? 22.275  -1.204  27.488  1.00 92.47  ? 409 ARG A CA    1 
ATOM   2825 C C     . ARG A 1 362 ? 20.901  -1.421  26.860  1.00 93.60  ? 409 ARG A C     1 
ATOM   2826 O O     . ARG A 1 362 ? 20.408  -2.556  26.859  1.00 92.35  ? 409 ARG A O     1 
ATOM   2827 C CB    . ARG A 1 362 ? 23.379  -1.628  26.504  1.00 94.33  ? 409 ARG A CB    1 
ATOM   2828 C CG    . ARG A 1 362 ? 24.803  -1.361  26.977  1.00 108.16 ? 409 ARG A CG    1 
ATOM   2829 C CD    . ARG A 1 362 ? 25.196  0.107   26.905  1.00 119.68 ? 409 ARG A CD    1 
ATOM   2830 N NE    . ARG A 1 362 ? 26.561  0.328   27.387  1.00 135.81 ? 409 ARG A NE    1 
ATOM   2831 C CZ    . ARG A 1 362 ? 26.902  0.544   28.658  1.00 148.97 ? 409 ARG A CZ    1 
ATOM   2832 N NH1   . ARG A 1 362 ? 25.972  0.571   29.608  1.00 118.84 ? 409 ARG A NH1   1 
ATOM   2833 N NH2   . ARG A 1 362 ? 28.174  0.733   28.987  1.00 148.83 ? 409 ARG A NH2   1 
ATOM   2834 N N     . VAL A 1 363 ? 20.272  -0.343  26.334  1.00 89.39  ? 410 VAL A N     1 
ATOM   2835 C CA    . VAL A 1 363 ? 18.951  -0.454  25.699  1.00 86.91  ? 410 VAL A CA    1 
ATOM   2836 C C     . VAL A 1 363 ? 19.091  -0.876  24.237  1.00 90.02  ? 410 VAL A C     1 
ATOM   2837 O O     . VAL A 1 363 ? 19.982  -0.395  23.530  1.00 91.70  ? 410 VAL A O     1 
ATOM   2838 C CB    . VAL A 1 363 ? 18.033  0.786   25.869  1.00 92.03  ? 410 VAL A CB    1 
ATOM   2839 C CG1   . VAL A 1 363 ? 16.619  0.498   25.353  1.00 90.02  ? 410 VAL A CG1   1 
ATOM   2840 C CG2   . VAL A 1 363 ? 17.975  1.237   27.320  1.00 92.78  ? 410 VAL A CG2   1 
ATOM   2841 N N     . TRP A 1 364 ? 18.229  -1.802  23.801  1.00 83.63  ? 411 TRP A N     1 
ATOM   2842 C CA    . TRP A 1 364 ? 18.247  -2.302  22.433  1.00 83.35  ? 411 TRP A CA    1 
ATOM   2843 C C     . TRP A 1 364 ? 16.882  -2.212  21.842  1.00 86.32  ? 411 TRP A C     1 
ATOM   2844 O O     . TRP A 1 364 ? 15.908  -2.580  22.493  1.00 86.10  ? 411 TRP A O     1 
ATOM   2845 C CB    . TRP A 1 364 ? 18.696  -3.770  22.366  1.00 80.61  ? 411 TRP A CB    1 
ATOM   2846 C CG    . TRP A 1 364 ? 20.168  -4.007  22.549  1.00 82.31  ? 411 TRP A CG    1 
ATOM   2847 C CD1   . TRP A 1 364 ? 20.901  -3.762  23.672  1.00 85.76  ? 411 TRP A CD1   1 
ATOM   2848 C CD2   . TRP A 1 364 ? 21.040  -4.708  21.646  1.00 83.14  ? 411 TRP A CD2   1 
ATOM   2849 N NE1   . TRP A 1 364 ? 22.180  -4.242  23.517  1.00 86.94  ? 411 TRP A NE1   1 
ATOM   2850 C CE2   . TRP A 1 364 ? 22.301  -4.803  22.270  1.00 88.31  ? 411 TRP A CE2   1 
ATOM   2851 C CE3   . TRP A 1 364 ? 20.880  -5.259  20.362  1.00 84.39  ? 411 TRP A CE3   1 
ATOM   2852 C CZ2   . TRP A 1 364 ? 23.397  -5.418  21.652  1.00 89.26  ? 411 TRP A CZ2   1 
ATOM   2853 C CZ3   . TRP A 1 364 ? 21.974  -5.859  19.749  1.00 87.29  ? 411 TRP A CZ3   1 
ATOM   2854 C CH2   . TRP A 1 364 ? 23.205  -5.951  20.399  1.00 89.30  ? 411 TRP A CH2   1 
ATOM   2855 N N     . PHE A 1 365 ? 16.812  -1.739  20.600  1.00 82.21  ? 412 PHE A N     1 
ATOM   2856 C CA    . PHE A 1 365 ? 15.592  -1.657  19.807  1.00 81.14  ? 412 PHE A CA    1 
ATOM   2857 C C     . PHE A 1 365 ? 15.806  -2.766  18.766  1.00 87.49  ? 412 PHE A C     1 
ATOM   2858 O O     . PHE A 1 365 ? 16.729  -2.687  17.962  1.00 88.83  ? 412 PHE A O     1 
ATOM   2859 C CB    . PHE A 1 365 ? 15.448  -0.254  19.182  1.00 83.89  ? 412 PHE A CB    1 
ATOM   2860 C CG    . PHE A 1 365 ? 15.227  0.880   20.159  1.00 84.39  ? 412 PHE A CG    1 
ATOM   2861 C CD1   . PHE A 1 365 ? 16.218  1.250   21.062  1.00 86.32  ? 412 PHE A CD1   1 
ATOM   2862 C CD2   . PHE A 1 365 ? 14.056  1.631   20.125  1.00 86.77  ? 412 PHE A CD2   1 
ATOM   2863 C CE1   . PHE A 1 365 ? 16.017  2.307   21.957  1.00 87.85  ? 412 PHE A CE1   1 
ATOM   2864 C CE2   . PHE A 1 365 ? 13.867  2.703   21.006  1.00 90.32  ? 412 PHE A CE2   1 
ATOM   2865 C CZ    . PHE A 1 365 ? 14.854  3.037   21.912  1.00 87.94  ? 412 PHE A CZ    1 
ATOM   2866 N N     . GLY A 1 366 ? 15.078  -3.863  18.894  1.00 84.37  ? 413 GLY A N     1 
ATOM   2867 C CA    . GLY A 1 366 ? 15.340  -5.011  18.034  1.00 85.67  ? 413 GLY A CA    1 
ATOM   2868 C C     . GLY A 1 366 ? 16.772  -5.502  18.228  1.00 90.58  ? 413 GLY A C     1 
ATOM   2869 O O     . GLY A 1 366 ? 17.214  -5.666  19.379  1.00 91.83  ? 413 GLY A O     1 
ATOM   2870 N N     . ASP A 1 367 ? 17.521  -5.663  17.107  1.00 85.60  ? 414 ASP A N     1 
ATOM   2871 C CA    . ASP A 1 367 ? 18.929  -6.083  17.079  1.00 85.97  ? 414 ASP A CA    1 
ATOM   2872 C C     . ASP A 1 367 ? 19.865  -4.866  17.000  1.00 91.63  ? 414 ASP A C     1 
ATOM   2873 O O     . ASP A 1 367 ? 21.037  -4.997  16.639  1.00 93.14  ? 414 ASP A O     1 
ATOM   2874 C CB    . ASP A 1 367 ? 19.180  -7.029  15.881  1.00 90.04  ? 414 ASP A CB    1 
ATOM   2875 C CG    . ASP A 1 367 ? 19.014  -6.416  14.494  1.00 102.61 ? 414 ASP A CG    1 
ATOM   2876 O OD1   . ASP A 1 367 ? 18.446  -5.314  14.392  1.00 101.81 ? 414 ASP A OD1   1 
ATOM   2877 O OD2   . ASP A 1 367 ? 19.449  -7.050  13.509  1.00 115.34 ? 414 ASP A OD2   1 
ATOM   2878 N N     . VAL A 1 368 ? 19.326  -3.677  17.319  1.00 87.75  ? 415 VAL A N     1 
ATOM   2879 C CA    . VAL A 1 368 ? 20.038  -2.400  17.255  1.00 89.41  ? 415 VAL A CA    1 
ATOM   2880 C C     . VAL A 1 368 ? 20.268  -1.861  18.670  1.00 90.94  ? 415 VAL A C     1 
ATOM   2881 O O     . VAL A 1 368 ? 19.318  -1.590  19.394  1.00 89.24  ? 415 VAL A O     1 
ATOM   2882 C CB    . VAL A 1 368 ? 19.267  -1.399  16.343  1.00 94.29  ? 415 VAL A CB    1 
ATOM   2883 C CG1   . VAL A 1 368 ? 19.842  0.009   16.413  1.00 96.48  ? 415 VAL A CG1   1 
ATOM   2884 C CG2   . VAL A 1 368 ? 19.208  -1.899  14.905  1.00 96.03  ? 415 VAL A CG2   1 
ATOM   2885 N N     . GLU A 1 369 ? 21.530  -1.724  19.055  1.00 88.21  ? 416 GLU A N     1 
ATOM   2886 C CA    . GLU A 1 369 ? 21.902  -1.197  20.361  1.00 88.45  ? 416 GLU A CA    1 
ATOM   2887 C C     . GLU A 1 369 ? 21.834  0.334   20.322  1.00 93.87  ? 416 GLU A C     1 
ATOM   2888 O O     . GLU A 1 369 ? 22.342  0.952   19.381  1.00 97.51  ? 416 GLU A O     1 
ATOM   2889 C CB    . GLU A 1 369 ? 23.315  -1.675  20.747  1.00 92.05  ? 416 GLU A CB    1 
ATOM   2890 C CG    . GLU A 1 369 ? 23.772  -1.212  22.122  1.00 101.58 ? 416 GLU A CG    1 
ATOM   2891 C CD    . GLU A 1 369 ? 25.189  -1.580  22.514  1.00 122.27 ? 416 GLU A CD    1 
ATOM   2892 O OE1   . GLU A 1 369 ? 25.576  -1.261  23.661  1.00 120.01 ? 416 GLU A OE1   1 
ATOM   2893 O OE2   . GLU A 1 369 ? 25.924  -2.153  21.675  1.00 113.00 ? 416 GLU A OE2   1 
ATOM   2894 N N     . ALA A 1 370 ? 21.221  0.932   21.355  1.00 86.78  ? 417 ALA A N     1 
ATOM   2895 C CA    . ALA A 1 370 ? 21.044  2.372   21.484  1.00 87.82  ? 417 ALA A CA    1 
ATOM   2896 C C     . ALA A 1 370 ? 22.030  2.967   22.485  1.00 95.30  ? 417 ALA A C     1 
ATOM   2897 O O     . ALA A 1 370 ? 22.394  2.266   23.448  1.00 93.11  ? 417 ALA A O     1 
ATOM   2898 C CB    . ALA A 1 370 ? 19.618  2.672   21.928  1.00 85.73  ? 417 ALA A CB    1 
ATOM   2899 N N     . GLU A 1 371 ? 22.466  4.266   22.261  1.00 96.06  ? 418 GLU A N     1 
ATOM   2900 C CA    . GLU A 1 371 ? 23.331  4.994   23.198  1.00 99.50  ? 418 GLU A CA    1 
ATOM   2901 C C     . GLU A 1 371 ? 22.514  5.054   24.483  1.00 104.65 ? 418 GLU A C     1 
ATOM   2902 O O     . GLU A 1 371 ? 21.373  5.549   24.469  1.00 102.09 ? 418 GLU A O     1 
ATOM   2903 C CB    . GLU A 1 371 ? 23.654  6.399   22.686  1.00 106.06 ? 418 GLU A CB    1 
ATOM   2904 N N     . THR A 1 372 ? 23.025  4.384   25.535  1.00 103.55 ? 419 THR A N     1 
ATOM   2905 C CA    . THR A 1 372 ? 22.336  4.235   26.817  1.00 102.36 ? 419 THR A CA    1 
ATOM   2906 C C     . THR A 1 372 ? 23.015  4.987   27.939  1.00 113.99 ? 419 THR A C     1 
ATOM   2907 O O     . THR A 1 372 ? 24.222  4.842   28.146  1.00 117.14 ? 419 THR A O     1 
ATOM   2908 C CB    . THR A 1 372 ? 22.103  2.752   27.122  1.00 100.45 ? 419 THR A CB    1 
ATOM   2909 O OG1   . THR A 1 372 ? 21.282  2.214   26.086  1.00 97.45  ? 419 THR A OG1   1 
ATOM   2910 C CG2   . THR A 1 372 ? 21.437  2.518   28.477  1.00 95.35  ? 419 THR A CG2   1 
ATOM   2911 N N     . MET A 1 373 ? 22.219  5.766   28.681  1.00 113.67 ? 420 MET A N     1 
ATOM   2912 C CA    . MET A 1 373 ? 22.694  6.569   29.793  1.00 118.99 ? 420 MET A CA    1 
ATOM   2913 C C     . MET A 1 373 ? 21.973  6.235   31.085  1.00 119.36 ? 420 MET A C     1 
ATOM   2914 O O     . MET A 1 373 ? 20.769  6.458   31.207  1.00 117.43 ? 420 MET A O     1 
ATOM   2915 C CB    . MET A 1 373 ? 22.589  8.069   29.466  1.00 126.86 ? 420 MET A CB    1 
ATOM   2916 C CG    . MET A 1 373 ? 23.297  8.939   30.472  1.00 138.14 ? 420 MET A CG    1 
ATOM   2917 S SD    . MET A 1 373 ? 22.846  10.686  30.388  1.00 149.59 ? 420 MET A SD    1 
ATOM   2918 C CE    . MET A 1 373 ? 21.900  10.848  31.924  1.00 146.64 ? 420 MET A CE    1 
ATOM   2919 N N     . TYR A 1 374 ? 22.729  5.731   32.056  1.00 116.56 ? 421 TYR A N     1 
ATOM   2920 C CA    . TYR A 1 374 ? 22.242  5.406   33.392  1.00 116.29 ? 421 TYR A CA    1 
ATOM   2921 C C     . TYR A 1 374 ? 21.995  6.698   34.168  1.00 124.08 ? 421 TYR A C     1 
ATOM   2922 O O     . TYR A 1 374 ? 22.761  7.651   34.028  1.00 129.87 ? 421 TYR A O     1 
ATOM   2923 C CB    . TYR A 1 374 ? 23.285  4.549   34.134  1.00 119.06 ? 421 TYR A CB    1 
ATOM   2924 C CG    . TYR A 1 374 ? 22.901  4.157   35.547  1.00 121.07 ? 421 TYR A CG    1 
ATOM   2925 C CD1   . TYR A 1 374 ? 21.907  3.207   35.785  1.00 118.89 ? 421 TYR A CD1   1 
ATOM   2926 C CD2   . TYR A 1 374 ? 23.556  4.705   36.646  1.00 126.34 ? 421 TYR A CD2   1 
ATOM   2927 C CE1   . TYR A 1 374 ? 21.565  2.829   37.084  1.00 120.85 ? 421 TYR A CE1   1 
ATOM   2928 C CE2   . TYR A 1 374 ? 23.225  4.331   37.948  1.00 127.76 ? 421 TYR A CE2   1 
ATOM   2929 C CZ    . TYR A 1 374 ? 22.233  3.389   38.163  1.00 132.08 ? 421 TYR A CZ    1 
ATOM   2930 O OH    . TYR A 1 374 ? 21.911  3.011   39.444  1.00 135.02 ? 421 TYR A OH    1 
ATOM   2931 N N     . ARG A 1 375 ? 20.932  6.728   34.973  1.00 118.23 ? 422 ARG A N     1 
ATOM   2932 C CA    . ARG A 1 375 ? 20.579  7.872   35.805  1.00 122.67 ? 422 ARG A CA    1 
ATOM   2933 C C     . ARG A 1 375 ? 20.595  7.437   37.275  1.00 127.84 ? 422 ARG A C     1 
ATOM   2934 O O     . ARG A 1 375 ? 21.391  7.947   38.064  1.00 133.42 ? 422 ARG A O     1 
ATOM   2935 C CB    . ARG A 1 375 ? 19.226  8.474   35.375  1.00 121.21 ? 422 ARG A CB    1 
ATOM   2936 C CG    . ARG A 1 375 ? 19.353  9.469   34.224  1.00 133.67 ? 422 ARG A CG    1 
ATOM   2937 C CD    . ARG A 1 375 ? 18.025  9.869   33.602  1.00 143.69 ? 422 ARG A CD    1 
ATOM   2938 N NE    . ARG A 1 375 ? 17.188  10.669  34.502  1.00 156.73 ? 422 ARG A NE    1 
ATOM   2939 C CZ    . ARG A 1 375 ? 16.073  11.296  34.137  1.00 169.21 ? 422 ARG A CZ    1 
ATOM   2940 N NH1   . ARG A 1 375 ? 15.657  11.247  32.877  1.00 151.98 ? 422 ARG A NH1   1 
ATOM   2941 N NH2   . ARG A 1 375 ? 15.373  11.987  35.025  1.00 158.13 ? 422 ARG A NH2   1 
ATOM   2942 N N     . CYS A 1 376 ? 19.745  6.464   37.617  1.00 119.36 ? 423 CYS A N     1 
ATOM   2943 C CA    . CYS A 1 376 ? 19.611  5.845   38.931  1.00 119.84 ? 423 CYS A CA    1 
ATOM   2944 C C     . CYS A 1 376 ? 18.964  4.492   38.683  1.00 117.55 ? 423 CYS A C     1 
ATOM   2945 O O     . CYS A 1 376 ? 18.583  4.213   37.544  1.00 113.81 ? 423 CYS A O     1 
ATOM   2946 C CB    . CYS A 1 376 ? 18.767  6.710   39.860  1.00 124.31 ? 423 CYS A CB    1 
ATOM   2947 S SG    . CYS A 1 376 ? 17.010  6.762   39.429  1.00 124.99 ? 423 CYS A SG    1 
ATOM   2948 N N     . GLY A 1 377 ? 18.819  3.679   39.729  1.00 113.11 ? 424 GLY A N     1 
ATOM   2949 C CA    . GLY A 1 377 ? 18.235  2.344   39.636  1.00 107.84 ? 424 GLY A CA    1 
ATOM   2950 C C     . GLY A 1 377 ? 16.812  2.265   39.122  1.00 108.26 ? 424 GLY A C     1 
ATOM   2951 O O     . GLY A 1 377 ? 16.364  1.189   38.720  1.00 105.41 ? 424 GLY A O     1 
ATOM   2952 N N     . GLU A 1 378 ? 16.093  3.396   39.127  1.00 105.62 ? 425 GLU A N     1 
ATOM   2953 C CA    . GLU A 1 378 ? 14.695  3.490   38.708  1.00 103.57 ? 425 GLU A CA    1 
ATOM   2954 C C     . GLU A 1 378 ? 14.490  4.385   37.451  1.00 109.40 ? 425 GLU A C     1 
ATOM   2955 O O     . GLU A 1 378 ? 13.345  4.665   37.072  1.00 109.56 ? 425 GLU A O     1 
ATOM   2956 C CB    . GLU A 1 378 ? 13.817  3.949   39.892  1.00 108.78 ? 425 GLU A CB    1 
ATOM   2957 C CG    . GLU A 1 378 ? 14.081  3.222   41.209  1.00 122.19 ? 425 GLU A CG    1 
ATOM   2958 C CD    . GLU A 1 378 ? 15.124  3.810   42.150  1.00 150.11 ? 425 GLU A CD    1 
ATOM   2959 O OE1   . GLU A 1 378 ? 14.866  3.829   43.376  1.00 146.56 ? 425 GLU A OE1   1 
ATOM   2960 O OE2   . GLU A 1 378 ? 16.202  4.234   41.673  1.00 145.62 ? 425 GLU A OE2   1 
ATOM   2961 N N     . SER A 1 379 ? 15.598  4.829   36.801  1.00 106.79 ? 426 SER A N     1 
ATOM   2962 C CA    . SER A 1 379 ? 15.539  5.660   35.592  1.00 106.53 ? 426 SER A CA    1 
ATOM   2963 C C     . SER A 1 379 ? 16.736  5.490   34.675  1.00 109.86 ? 426 SER A C     1 
ATOM   2964 O O     . SER A 1 379 ? 17.874  5.472   35.133  1.00 110.68 ? 426 SER A O     1 
ATOM   2965 C CB    . SER A 1 379 ? 15.332  7.139   35.925  1.00 113.48 ? 426 SER A CB    1 
ATOM   2966 O OG    . SER A 1 379 ? 14.848  7.857   34.799  1.00 115.14 ? 426 SER A OG    1 
ATOM   2967 N N     . MET A 1 380 ? 16.459  5.390   33.367  1.00 105.72 ? 427 MET A N     1 
ATOM   2968 C CA    . MET A 1 380 ? 17.440  5.263   32.289  1.00 105.72 ? 427 MET A CA    1 
ATOM   2969 C C     . MET A 1 380 ? 16.990  6.026   31.038  1.00 110.45 ? 427 MET A C     1 
ATOM   2970 O O     . MET A 1 380 ? 15.802  6.087   30.729  1.00 108.67 ? 427 MET A O     1 
ATOM   2971 C CB    . MET A 1 380 ? 17.676  3.790   31.928  1.00 104.21 ? 427 MET A CB    1 
ATOM   2972 C CG    . MET A 1 380 ? 18.601  3.069   32.874  1.00 109.21 ? 427 MET A CG    1 
ATOM   2973 S SD    . MET A 1 380 ? 19.079  1.443   32.253  1.00 109.88 ? 427 MET A SD    1 
ATOM   2974 C CE    . MET A 1 380 ? 20.900  1.693   32.157  1.00 110.51 ? 427 MET A CE    1 
ATOM   2975 N N     . LEU A 1 381 ? 17.946  6.598   30.319  1.00 110.09 ? 428 LEU A N     1 
ATOM   2976 C CA    . LEU A 1 381 ? 17.674  7.331   29.091  1.00 110.77 ? 428 LEU A CA    1 
ATOM   2977 C C     . LEU A 1 381 ? 18.432  6.722   27.945  1.00 111.05 ? 428 LEU A C     1 
ATOM   2978 O O     . LEU A 1 381 ? 19.595  6.326   28.106  1.00 110.56 ? 428 LEU A O     1 
ATOM   2979 C CB    . LEU A 1 381 ? 18.097  8.801   29.225  1.00 116.88 ? 428 LEU A CB    1 
ATOM   2980 C CG    . LEU A 1 381 ? 17.109  9.766   29.858  1.00 125.17 ? 428 LEU A CG    1 
ATOM   2981 C CD1   . LEU A 1 381 ? 17.738  11.137  29.999  1.00 131.87 ? 428 LEU A CD1   1 
ATOM   2982 C CD2   . LEU A 1 381 ? 15.818  9.870   29.039  1.00 126.64 ? 428 LEU A CD2   1 
ATOM   2983 N N     . CYS A 1 382 ? 17.797  6.680   26.771  1.00 104.82 ? 429 CYS A N     1 
ATOM   2984 C CA    . CYS A 1 382 ? 18.496  6.177   25.597  1.00 103.09 ? 429 CYS A CA    1 
ATOM   2985 C C     . CYS A 1 382 ? 18.125  6.933   24.319  1.00 105.91 ? 429 CYS A C     1 
ATOM   2986 O O     . CYS A 1 382 ? 17.072  7.576   24.280  1.00 107.34 ? 429 CYS A O     1 
ATOM   2987 C CB    . CYS A 1 382 ? 18.312  4.671   25.454  1.00 98.89  ? 429 CYS A CB    1 
ATOM   2988 S SG    . CYS A 1 382 ? 16.661  4.178   24.932  1.00 99.53  ? 429 CYS A SG    1 
ATOM   2989 N N     . VAL A 1 383 ? 18.988  6.880   23.288  1.00 99.93  ? 430 VAL A N     1 
ATOM   2990 C CA    . VAL A 1 383 ? 18.675  7.568   22.030  1.00 100.68 ? 430 VAL A CA    1 
ATOM   2991 C C     . VAL A 1 383 ? 18.020  6.592   21.051  1.00 100.19 ? 430 VAL A C     1 
ATOM   2992 O O     . VAL A 1 383 ? 18.594  5.546   20.732  1.00 96.76  ? 430 VAL A O     1 
ATOM   2993 C CB    . VAL A 1 383 ? 19.871  8.339   21.378  1.00 108.43 ? 430 VAL A CB    1 
ATOM   2994 C CG1   . VAL A 1 383 ? 19.386  9.287   20.284  1.00 110.98 ? 430 VAL A CG1   1 
ATOM   2995 C CG2   . VAL A 1 383 ? 20.690  9.102   22.414  1.00 111.84 ? 430 VAL A CG2   1 
ATOM   2996 N N     . VAL A 1 384 ? 16.811  6.945   20.584  1.00 97.42  ? 431 VAL A N     1 
ATOM   2997 C CA    . VAL A 1 384 ? 16.041  6.196   19.589  1.00 95.41  ? 431 VAL A CA    1 
ATOM   2998 C C     . VAL A 1 384 ? 16.918  6.134   18.321  1.00 104.69 ? 431 VAL A C     1 
ATOM   2999 O O     . VAL A 1 384 ? 17.346  7.193   17.826  1.00 109.78 ? 431 VAL A O     1 
ATOM   3000 C CB    . VAL A 1 384 ? 14.704  6.920   19.285  1.00 100.23 ? 431 VAL A CB    1 
ATOM   3001 C CG1   . VAL A 1 384 ? 14.054  6.391   18.007  1.00 99.26  ? 431 VAL A CG1   1 
ATOM   3002 C CG2   . VAL A 1 384 ? 13.742  6.863   20.475  1.00 98.53  ? 431 VAL A CG2   1 
ATOM   3003 N N     . PRO A 1 385 ? 17.234  4.938   17.778  1.00 99.43  ? 432 PRO A N     1 
ATOM   3004 C CA    . PRO A 1 385 ? 18.060  4.909   16.557  1.00 102.42 ? 432 PRO A CA    1 
ATOM   3005 C C     . PRO A 1 385 ? 17.325  5.461   15.317  1.00 109.08 ? 432 PRO A C     1 
ATOM   3006 O O     . PRO A 1 385 ? 16.097  5.608   15.334  1.00 108.50 ? 432 PRO A O     1 
ATOM   3007 C CB    . PRO A 1 385 ? 18.431  3.429   16.425  1.00 100.76 ? 432 PRO A CB    1 
ATOM   3008 C CG    . PRO A 1 385 ? 17.335  2.711   17.102  1.00 100.13 ? 432 PRO A CG    1 
ATOM   3009 C CD    . PRO A 1 385 ? 16.859  3.578   18.211  1.00 95.68  ? 432 PRO A CD    1 
ATOM   3010 N N     . ASP A 1 386 ? 18.060  5.772   14.247  1.00 108.36 ? 433 ASP A N     1 
ATOM   3011 C CA    . ASP A 1 386 ? 17.412  6.246   13.027  1.00 111.68 ? 433 ASP A CA    1 
ATOM   3012 C C     . ASP A 1 386 ? 16.623  5.091   12.390  1.00 115.04 ? 433 ASP A C     1 
ATOM   3013 O O     . ASP A 1 386 ? 17.030  3.923   12.516  1.00 111.17 ? 433 ASP A O     1 
ATOM   3014 C CB    . ASP A 1 386 ? 18.449  6.788   12.032  1.00 118.46 ? 433 ASP A CB    1 
ATOM   3015 C CG    . ASP A 1 386 ? 17.855  7.665   10.951  1.00 131.50 ? 433 ASP A CG    1 
ATOM   3016 O OD1   . ASP A 1 386 ? 17.561  8.851   11.240  1.00 133.58 ? 433 ASP A OD1   1 
ATOM   3017 O OD2   . ASP A 1 386 ? 17.702  7.178   9.813   1.00 139.52 ? 433 ASP A OD2   1 
ATOM   3018 N N     . ILE A 1 387 ? 15.493  5.417   11.709  1.00 113.86 ? 434 ILE A N     1 
ATOM   3019 C CA    . ILE A 1 387 ? 14.660  4.411   11.022  1.00 111.78 ? 434 ILE A CA    1 
ATOM   3020 C C     . ILE A 1 387 ? 15.475  3.540   10.043  1.00 115.15 ? 434 ILE A C     1 
ATOM   3021 O O     . ILE A 1 387 ? 15.207  2.341   9.935   1.00 111.32 ? 434 ILE A O     1 
ATOM   3022 C CB    . ILE A 1 387 ? 13.361  5.007   10.392  1.00 116.85 ? 434 ILE A CB    1 
ATOM   3023 C CG1   . ILE A 1 387 ? 12.371  3.902   9.934   1.00 115.65 ? 434 ILE A CG1   1 
ATOM   3024 C CG2   . ILE A 1 387 ? 13.650  6.008   9.263   1.00 121.54 ? 434 ILE A CG2   1 
ATOM   3025 C CD1   . ILE A 1 387 ? 11.748  3.050   11.030  1.00 114.18 ? 434 ILE A CD1   1 
ATOM   3026 N N     . SER A 1 388 ? 16.503  4.156   9.387   1.00 115.27 ? 435 SER A N     1 
ATOM   3027 C CA    . SER A 1 388 ? 17.441  3.533   8.450   1.00 117.31 ? 435 SER A CA    1 
ATOM   3028 C C     . SER A 1 388 ? 18.218  2.356   9.081   1.00 118.95 ? 435 SER A C     1 
ATOM   3029 O O     . SER A 1 388 ? 18.753  1.515   8.348   1.00 120.12 ? 435 SER A O     1 
ATOM   3030 C CB    . SER A 1 388 ? 18.401  4.575   7.887   1.00 125.29 ? 435 SER A CB    1 
ATOM   3031 O OG    . SER A 1 388 ? 19.201  5.153   8.905   1.00 133.01 ? 435 SER A OG    1 
ATOM   3032 N N     . ALA A 1 389 ? 18.248  2.287   10.436  1.00 111.54 ? 436 ALA A N     1 
ATOM   3033 C CA    . ALA A 1 389 ? 18.881  1.205   11.179  1.00 108.41 ? 436 ALA A CA    1 
ATOM   3034 C C     . ALA A 1 389 ? 18.012  -0.060  11.175  1.00 110.01 ? 436 ALA A C     1 
ATOM   3035 O O     . ALA A 1 389 ? 18.504  -1.125  11.552  1.00 109.88 ? 436 ALA A O     1 
ATOM   3036 C CB    . ALA A 1 389 ? 19.169  1.638   12.604  1.00 106.85 ? 436 ALA A CB    1 
ATOM   3037 N N     . PHE A 1 390 ? 16.737  0.048   10.739  1.00 105.22 ? 437 PHE A N     1 
ATOM   3038 C CA    . PHE A 1 390 ? 15.779  -1.069  10.647  1.00 103.13 ? 437 PHE A CA    1 
ATOM   3039 C C     . PHE A 1 390 ? 15.308  -1.320  9.207   1.00 110.46 ? 437 PHE A C     1 
ATOM   3040 O O     . PHE A 1 390 ? 14.868  -2.424  8.875   1.00 109.78 ? 437 PHE A O     1 
ATOM   3041 C CB    . PHE A 1 390 ? 14.553  -0.829  11.555  1.00 102.45 ? 437 PHE A CB    1 
ATOM   3042 C CG    . PHE A 1 390 ? 14.891  -0.673  13.017  1.00 100.71 ? 437 PHE A CG    1 
ATOM   3043 C CD1   . PHE A 1 390 ? 15.216  -1.781  13.796  1.00 101.64 ? 437 PHE A CD1   1 
ATOM   3044 C CD2   . PHE A 1 390 ? 14.930  0.584   13.606  1.00 102.54 ? 437 PHE A CD2   1 
ATOM   3045 C CE1   . PHE A 1 390 ? 15.550  -1.633  15.144  1.00 99.55  ? 437 PHE A CE1   1 
ATOM   3046 C CE2   . PHE A 1 390 ? 15.278  0.731   14.946  1.00 102.91 ? 437 PHE A CE2   1 
ATOM   3047 C CZ    . PHE A 1 390 ? 15.573  -0.377  15.708  1.00 98.54  ? 437 PHE A CZ    1 
ATOM   3048 N N     . ARG A 1 391 ? 15.341  -0.277  8.377   1.00 110.48 ? 438 ARG A N     1 
ATOM   3049 C CA    . ARG A 1 391 ? 14.911  -0.350  6.990   1.00 114.10 ? 438 ARG A CA    1 
ATOM   3050 C C     . ARG A 1 391 ? 15.928  0.411   6.144   1.00 121.44 ? 438 ARG A C     1 
ATOM   3051 O O     . ARG A 1 391 ? 15.989  1.637   6.237   1.00 122.23 ? 438 ARG A O     1 
ATOM   3052 C CB    . ARG A 1 391 ? 13.498  0.247   6.826   1.00 114.10 ? 438 ARG A CB    1 
ATOM   3053 C CG    . ARG A 1 391 ? 12.410  -0.316  7.746   1.00 120.07 ? 438 ARG A CG    1 
ATOM   3054 C CD    . ARG A 1 391 ? 11.723  -1.526  7.149   1.00 133.42 ? 438 ARG A CD    1 
ATOM   3055 N NE    . ARG A 1 391 ? 11.309  -2.492  8.170   1.00 140.16 ? 438 ARG A NE    1 
ATOM   3056 C CZ    . ARG A 1 391 ? 10.053  -2.887  8.363   1.00 156.60 ? 438 ARG A CZ    1 
ATOM   3057 N NH1   . ARG A 1 391 ? 9.070   -2.396  7.613   1.00 149.54 ? 438 ARG A NH1   1 
ATOM   3058 N NH2   . ARG A 1 391 ? 9.769   -3.775  9.307   1.00 138.42 ? 438 ARG A NH2   1 
ATOM   3059 N N     . GLU A 1 392 ? 16.741  -0.323  5.342   1.00 119.68 ? 439 GLU A N     1 
ATOM   3060 C CA    . GLU A 1 392 ? 17.782  0.224   4.470   1.00 124.34 ? 439 GLU A CA    1 
ATOM   3061 C C     . GLU A 1 392 ? 17.287  1.451   3.700   1.00 133.15 ? 439 GLU A C     1 
ATOM   3062 O O     . GLU A 1 392 ? 16.162  1.451   3.183   1.00 134.40 ? 439 GLU A O     1 
ATOM   3063 C CB    . GLU A 1 392 ? 18.294  -0.853  3.490   1.00 128.91 ? 439 GLU A CB    1 
ATOM   3064 C CG    . GLU A 1 392 ? 19.583  -0.493  2.754   1.00 146.50 ? 439 GLU A CG    1 
ATOM   3065 C CD    . GLU A 1 392 ? 19.962  -1.367  1.569   1.00 179.13 ? 439 GLU A CD    1 
ATOM   3066 O OE1   . GLU A 1 392 ? 19.989  -0.846  0.430   1.00 176.46 ? 439 GLU A OE1   1 
ATOM   3067 O OE2   . GLU A 1 392 ? 20.271  -2.562  1.783   1.00 176.58 ? 439 GLU A OE2   1 
ATOM   3068 N N     . GLY A 1 393 ? 18.123  2.491   3.694   1.00 131.34 ? 440 GLY A N     1 
ATOM   3069 C CA    . GLY A 1 393 ? 17.906  3.758   3.005   1.00 135.71 ? 440 GLY A CA    1 
ATOM   3070 C C     . GLY A 1 393 ? 16.617  4.523   3.244   1.00 137.98 ? 440 GLY A C     1 
ATOM   3071 O O     . GLY A 1 393 ? 16.223  5.306   2.379   1.00 141.49 ? 440 GLY A O     1 
ATOM   3072 N N     . TRP A 1 394 ? 15.955  4.334   4.407   1.00 129.87 ? 441 TRP A N     1 
ATOM   3073 C CA    . TRP A 1 394 ? 14.722  5.067   4.713   1.00 129.77 ? 441 TRP A CA    1 
ATOM   3074 C C     . TRP A 1 394 ? 15.020  6.511   5.123   1.00 133.04 ? 441 TRP A C     1 
ATOM   3075 O O     . TRP A 1 394 ? 15.339  6.795   6.286   1.00 129.02 ? 441 TRP A O     1 
ATOM   3076 C CB    . TRP A 1 394 ? 13.845  4.331   5.738   1.00 123.81 ? 441 TRP A CB    1 
ATOM   3077 C CG    . TRP A 1 394 ? 12.914  3.305   5.151   1.00 125.75 ? 441 TRP A CG    1 
ATOM   3078 C CD1   . TRP A 1 394 ? 13.119  2.553   4.028   1.00 131.75 ? 441 TRP A CD1   1 
ATOM   3079 C CD2   . TRP A 1 394 ? 11.675  2.845   5.721   1.00 123.32 ? 441 TRP A CD2   1 
ATOM   3080 N NE1   . TRP A 1 394 ? 12.074  1.675   3.849   1.00 131.10 ? 441 TRP A NE1   1 
ATOM   3081 C CE2   . TRP A 1 394 ? 11.178  1.826   4.879   1.00 129.04 ? 441 TRP A CE2   1 
ATOM   3082 C CE3   . TRP A 1 394 ? 10.952  3.175   6.879   1.00 121.51 ? 441 TRP A CE3   1 
ATOM   3083 C CZ2   . TRP A 1 394 ? 9.986   1.141   5.155   1.00 127.28 ? 441 TRP A CZ2   1 
ATOM   3084 C CZ3   . TRP A 1 394 ? 9.768   2.502   7.148   1.00 122.16 ? 441 TRP A CZ3   1 
ATOM   3085 C CH2   . TRP A 1 394 ? 9.296   1.498   6.292   1.00 124.53 ? 441 TRP A CH2   1 
ATOM   3086 N N     . ARG A 1 395 ? 14.939  7.421   4.124   1.00 133.51 ? 442 ARG A N     1 
ATOM   3087 C CA    . ARG A 1 395 ? 15.182  8.862   4.243   1.00 136.37 ? 442 ARG A CA    1 
ATOM   3088 C C     . ARG A 1 395 ? 14.192  9.508   5.242   1.00 135.34 ? 442 ARG A C     1 
ATOM   3089 O O     . ARG A 1 395 ? 14.430  10.615  5.729   1.00 136.06 ? 442 ARG A O     1 
ATOM   3090 C CB    . ARG A 1 395 ? 15.134  9.516   2.843   1.00 145.94 ? 442 ARG A CB    1 
ATOM   3091 C CG    . ARG A 1 395 ? 15.855  10.864  2.711   1.00 166.02 ? 442 ARG A CG    1 
ATOM   3092 C CD    . ARG A 1 395 ? 17.370  10.739  2.632   1.00 176.53 ? 442 ARG A CD    1 
ATOM   3093 N NE    . ARG A 1 395 ? 17.882  10.955  1.280   1.00 195.65 ? 442 ARG A NE    1 
ATOM   3094 C CZ    . ARG A 1 395 ? 19.167  11.139  0.986   1.00 209.45 ? 442 ARG A CZ    1 
ATOM   3095 N NH1   . ARG A 1 395 ? 20.082  11.140  1.949   1.00 202.61 ? 442 ARG A NH1   1 
ATOM   3096 N NH2   . ARG A 1 395 ? 19.547  11.331  -0.274  1.00 197.93 ? 442 ARG A NH2   1 
ATOM   3097 N N     . TRP A 1 396 ? 13.108  8.771   5.566   1.00 126.69 ? 443 TRP A N     1 
ATOM   3098 C CA    . TRP A 1 396 ? 12.062  9.088   6.536   1.00 123.87 ? 443 TRP A CA    1 
ATOM   3099 C C     . TRP A 1 396 ? 11.342  7.787   6.905   1.00 124.63 ? 443 TRP A C     1 
ATOM   3100 O O     . TRP A 1 396 ? 11.584  6.758   6.265   1.00 122.61 ? 443 TRP A O     1 
ATOM   3101 C CB    . TRP A 1 396 ? 11.060  10.124  5.985   1.00 127.44 ? 443 TRP A CB    1 
ATOM   3102 C CG    . TRP A 1 396 ? 10.233  9.641   4.831   1.00 130.70 ? 443 TRP A CG    1 
ATOM   3103 C CD1   . TRP A 1 396 ? 9.009   9.039   4.890   1.00 132.60 ? 443 TRP A CD1   1 
ATOM   3104 C CD2   . TRP A 1 396 ? 10.574  9.727   3.443   1.00 135.38 ? 443 TRP A CD2   1 
ATOM   3105 N NE1   . TRP A 1 396 ? 8.574   8.729   3.623   1.00 136.34 ? 443 TRP A NE1   1 
ATOM   3106 C CE2   . TRP A 1 396 ? 9.514   9.145   2.714   1.00 141.29 ? 443 TRP A CE2   1 
ATOM   3107 C CE3   . TRP A 1 396 ? 11.680  10.239  2.741   1.00 139.90 ? 443 TRP A CE3   1 
ATOM   3108 C CZ2   . TRP A 1 396 ? 9.531   9.054   1.317   1.00 145.58 ? 443 TRP A CZ2   1 
ATOM   3109 C CZ3   . TRP A 1 396 ? 11.694  10.149  1.360   1.00 146.35 ? 443 TRP A CZ3   1 
ATOM   3110 C CH2   . TRP A 1 396 ? 10.634  9.559   0.662   1.00 148.61 ? 443 TRP A CH2   1 
ATOM   3111 N N     . VAL A 1 397 ? 10.451  7.831   7.920   1.00 120.48 ? 444 VAL A N     1 
ATOM   3112 C CA    . VAL A 1 397 ? 9.665   6.660   8.304   1.00 117.15 ? 444 VAL A CA    1 
ATOM   3113 C C     . VAL A 1 397 ? 8.505   6.555   7.302   1.00 127.39 ? 444 VAL A C     1 
ATOM   3114 O O     . VAL A 1 397 ? 7.617   7.417   7.302   1.00 130.01 ? 444 VAL A O     1 
ATOM   3115 C CB    . VAL A 1 397 ? 9.271   6.586   9.822   1.00 116.33 ? 444 VAL A CB    1 
ATOM   3116 C CG1   . VAL A 1 397 ? 8.797   7.926   10.370  1.00 119.13 ? 444 VAL A CG1   1 
ATOM   3117 C CG2   . VAL A 1 397 ? 8.249   5.488   10.101  1.00 113.74 ? 444 VAL A CG2   1 
ATOM   3118 N N     . ARG A 1 398 ? 8.600   5.560   6.371   1.00 125.88 ? 445 ARG A N     1 
ATOM   3119 C CA    . ARG A 1 398 ? 7.640   5.296   5.284   1.00 130.54 ? 445 ARG A CA    1 
ATOM   3120 C C     . ARG A 1 398 ? 6.284   4.838   5.821   1.00 137.03 ? 445 ARG A C     1 
ATOM   3121 O O     . ARG A 1 398 ? 5.266   5.495   5.575   1.00 142.22 ? 445 ARG A O     1 
ATOM   3122 C CB    . ARG A 1 398 ? 8.207   4.282   4.271   1.00 128.17 ? 445 ARG A CB    1 
ATOM   3123 C CG    . ARG A 1 398 ? 8.426   4.846   2.877   1.00 139.01 ? 445 ARG A CG    1 
ATOM   3124 C CD    . ARG A 1 398 ? 9.823   5.399   2.684   1.00 142.26 ? 445 ARG A CD    1 
ATOM   3125 N NE    . ARG A 1 398 ? 10.761  4.366   2.249   1.00 145.52 ? 445 ARG A NE    1 
ATOM   3126 C CZ    . ARG A 1 398 ? 11.619  4.505   1.240   1.00 155.01 ? 445 ARG A CZ    1 
ATOM   3127 N NH1   . ARG A 1 398 ? 11.670  5.646   0.552   1.00 137.64 ? 445 ARG A NH1   1 
ATOM   3128 N NH2   . ARG A 1 398 ? 12.434  3.508   0.912   1.00 131.83 ? 445 ARG A NH2   1 
ATOM   3129 N N     . GLN A 1 399 ? 6.272   3.728   6.562   1.00 129.59 ? 446 GLN A N     1 
ATOM   3130 C CA    . GLN A 1 399 ? 5.069   3.185   7.178   1.00 129.60 ? 446 GLN A CA    1 
ATOM   3131 C C     . GLN A 1 399 ? 5.439   2.605   8.540   1.00 128.25 ? 446 GLN A C     1 
ATOM   3132 O O     . GLN A 1 399 ? 6.573   2.150   8.693   1.00 125.24 ? 446 GLN A O     1 
ATOM   3133 C CB    . GLN A 1 399 ? 4.393   2.149   6.265   1.00 134.36 ? 446 GLN A CB    1 
ATOM   3134 C CG    . GLN A 1 399 ? 3.254   2.755   5.442   1.00 158.48 ? 446 GLN A CG    1 
ATOM   3135 C CD    . GLN A 1 399 ? 2.614   1.782   4.479   1.00 186.03 ? 446 GLN A CD    1 
ATOM   3136 O OE1   . GLN A 1 399 ? 2.003   0.782   4.877   1.00 182.19 ? 446 GLN A OE1   1 
ATOM   3137 N NE2   . GLN A 1 399 ? 2.678   2.091   3.186   1.00 182.55 ? 446 GLN A NE2   1 
ATOM   3138 N N     . PRO A 1 400 ? 4.534   2.646   9.546   1.00 123.76 ? 447 PRO A N     1 
ATOM   3139 C CA    . PRO A 1 400 ? 4.886   2.152   10.891  1.00 118.42 ? 447 PRO A CA    1 
ATOM   3140 C C     . PRO A 1 400 ? 5.688   0.856   11.067  1.00 118.29 ? 447 PRO A C     1 
ATOM   3141 O O     . PRO A 1 400 ? 5.409   -0.163  10.432  1.00 120.19 ? 447 PRO A O     1 
ATOM   3142 C CB    . PRO A 1 400 ? 3.542   2.123   11.609  1.00 121.78 ? 447 PRO A CB    1 
ATOM   3143 C CG    . PRO A 1 400 ? 2.803   3.270   10.992  1.00 131.20 ? 447 PRO A CG    1 
ATOM   3144 C CD    . PRO A 1 400 ? 3.168   3.210   9.539   1.00 129.62 ? 447 PRO A CD    1 
ATOM   3145 N N     . VAL A 1 401 ? 6.716   0.929   11.935  1.00 108.55 ? 448 VAL A N     1 
ATOM   3146 C CA    . VAL A 1 401 ? 7.614   -0.165  12.292  1.00 102.95 ? 448 VAL A CA    1 
ATOM   3147 C C     . VAL A 1 401 ? 7.577   -0.347  13.818  1.00 102.57 ? 448 VAL A C     1 
ATOM   3148 O O     . VAL A 1 401 ? 7.889   0.592   14.563  1.00 101.62 ? 448 VAL A O     1 
ATOM   3149 C CB    . VAL A 1 401 ? 9.049   0.112   11.772  1.00 105.31 ? 448 VAL A CB    1 
ATOM   3150 C CG1   . VAL A 1 401 ? 10.056  -0.873  12.355  1.00 100.59 ? 448 VAL A CG1   1 
ATOM   3151 C CG2   . VAL A 1 401 ? 9.091   0.083   10.252  1.00 109.23 ? 448 VAL A CG2   1 
ATOM   3152 N N     . GLN A 1 402 ? 7.197   -1.543  14.281  1.00 96.67  ? 449 GLN A N     1 
ATOM   3153 C CA    . GLN A 1 402 ? 7.156   -1.822  15.716  1.00 93.46  ? 449 GLN A CA    1 
ATOM   3154 C C     . GLN A 1 402 ? 8.351   -2.684  16.088  1.00 93.26  ? 449 GLN A C     1 
ATOM   3155 O O     . GLN A 1 402 ? 8.550   -3.743  15.488  1.00 93.70  ? 449 GLN A O     1 
ATOM   3156 C CB    . GLN A 1 402 ? 5.822   -2.469  16.119  1.00 96.55  ? 449 GLN A CB    1 
ATOM   3157 C CG    . GLN A 1 402 ? 5.588   -2.452  17.614  1.00 111.83 ? 449 GLN A CG    1 
ATOM   3158 C CD    . GLN A 1 402 ? 4.142   -2.511  18.000  1.00 145.75 ? 449 GLN A CD    1 
ATOM   3159 O OE1   . GLN A 1 402 ? 3.235   -2.317  17.186  1.00 150.04 ? 449 GLN A OE1   1 
ATOM   3160 N NE2   . GLN A 1 402 ? 3.890   -2.837  19.254  1.00 143.96 ? 449 GLN A NE2   1 
ATOM   3161 N N     . VAL A 1 403 ? 9.180   -2.212  17.041  1.00 86.28  ? 450 VAL A N     1 
ATOM   3162 C CA    . VAL A 1 403 ? 10.415  -2.912  17.452  1.00 82.15  ? 450 VAL A CA    1 
ATOM   3163 C C     . VAL A 1 403 ? 10.484  -3.197  18.949  1.00 85.71  ? 450 VAL A C     1 
ATOM   3164 O O     . VAL A 1 403 ? 10.160  -2.311  19.737  1.00 86.64  ? 450 VAL A O     1 
ATOM   3165 C CB    . VAL A 1 403 ? 11.712  -2.226  16.948  1.00 84.22  ? 450 VAL A CB    1 
ATOM   3166 C CG1   . VAL A 1 403 ? 11.953  -2.529  15.476  1.00 85.85  ? 450 VAL A CG1   1 
ATOM   3167 C CG2   . VAL A 1 403 ? 11.727  -0.720  17.233  1.00 84.38  ? 450 VAL A CG2   1 
ATOM   3168 N N     . PRO A 1 404 ? 10.940  -4.389  19.394  1.00 80.37  ? 451 PRO A N     1 
ATOM   3169 C CA    . PRO A 1 404 ? 10.997  -4.631  20.843  1.00 78.03  ? 451 PRO A CA    1 
ATOM   3170 C C     . PRO A 1 404 ? 12.052  -3.788  21.530  1.00 82.06  ? 451 PRO A C     1 
ATOM   3171 O O     . PRO A 1 404 ? 13.101  -3.512  20.934  1.00 81.40  ? 451 PRO A O     1 
ATOM   3172 C CB    . PRO A 1 404 ? 11.331  -6.123  20.943  1.00 77.91  ? 451 PRO A CB    1 
ATOM   3173 C CG    . PRO A 1 404 ? 11.992  -6.451  19.684  1.00 82.78  ? 451 PRO A CG    1 
ATOM   3174 C CD    . PRO A 1 404 ? 11.402  -5.569  18.635  1.00 81.18  ? 451 PRO A CD    1 
ATOM   3175 N N     . VAL A 1 405 ? 11.759  -3.371  22.774  1.00 78.92  ? 452 VAL A N     1 
ATOM   3176 C CA    . VAL A 1 405 ? 12.711  -2.671  23.641  1.00 77.88  ? 452 VAL A CA    1 
ATOM   3177 C C     . VAL A 1 405 ? 13.227  -3.739  24.620  1.00 78.85  ? 452 VAL A C     1 
ATOM   3178 O O     . VAL A 1 405 ? 12.441  -4.414  25.278  1.00 77.54  ? 452 VAL A O     1 
ATOM   3179 C CB    . VAL A 1 405 ? 12.115  -1.415  24.332  1.00 83.45  ? 452 VAL A CB    1 
ATOM   3180 C CG1   . VAL A 1 405 ? 13.120  -0.774  25.285  1.00 83.20  ? 452 VAL A CG1   1 
ATOM   3181 C CG2   . VAL A 1 405 ? 11.643  -0.387  23.292  1.00 85.56  ? 452 VAL A CG2   1 
ATOM   3182 N N     . THR A 1 406 ? 14.541  -3.960  24.630  1.00 75.85  ? 453 THR A N     1 
ATOM   3183 C CA    . THR A 1 406 ? 15.182  -4.983  25.455  1.00 74.98  ? 453 THR A CA    1 
ATOM   3184 C C     . THR A 1 406 ? 16.302  -4.365  26.209  1.00 80.55  ? 453 THR A C     1 
ATOM   3185 O O     . THR A 1 406 ? 17.003  -3.516  25.649  1.00 83.67  ? 453 THR A O     1 
ATOM   3186 C CB    . THR A 1 406 ? 15.759  -6.138  24.585  1.00 89.28  ? 453 THR A CB    1 
ATOM   3187 O OG1   . THR A 1 406 ? 15.280  -6.105  23.231  1.00 99.37  ? 453 THR A OG1   1 
ATOM   3188 C CG2   . THR A 1 406 ? 15.460  -7.477  25.151  1.00 88.32  ? 453 THR A CG2   1 
ATOM   3189 N N     . LEU A 1 407 ? 16.498  -4.772  27.476  1.00 76.41  ? 454 LEU A N     1 
ATOM   3190 C CA    . LEU A 1 407 ? 17.649  -4.316  28.275  1.00 76.86  ? 454 LEU A CA    1 
ATOM   3191 C C     . LEU A 1 407 ? 18.636  -5.446  28.221  1.00 83.22  ? 454 LEU A C     1 
ATOM   3192 O O     . LEU A 1 407 ? 18.249  -6.602  28.408  1.00 83.70  ? 454 LEU A O     1 
ATOM   3193 C CB    . LEU A 1 407 ? 17.293  -4.001  29.730  1.00 76.60  ? 454 LEU A CB    1 
ATOM   3194 C CG    . LEU A 1 407 ? 16.671  -2.644  29.979  1.00 81.71  ? 454 LEU A CG    1 
ATOM   3195 C CD1   . LEU A 1 407 ? 16.102  -2.584  31.356  1.00 82.39  ? 454 LEU A CD1   1 
ATOM   3196 C CD2   . LEU A 1 407 ? 17.702  -1.516  29.819  1.00 87.73  ? 454 LEU A CD2   1 
ATOM   3197 N N     . VAL A 1 408 ? 19.886  -5.142  27.888  1.00 81.01  ? 455 VAL A N     1 
ATOM   3198 C CA    . VAL A 1 408 ? 20.928  -6.166  27.741  1.00 81.43  ? 455 VAL A CA    1 
ATOM   3199 C C     . VAL A 1 408 ? 22.032  -5.825  28.711  1.00 89.67  ? 455 VAL A C     1 
ATOM   3200 O O     . VAL A 1 408 ? 22.241  -4.635  28.971  1.00 93.14  ? 455 VAL A O     1 
ATOM   3201 C CB    . VAL A 1 408 ? 21.397  -6.264  26.253  1.00 84.88  ? 455 VAL A CB    1 
ATOM   3202 C CG1   . VAL A 1 408 ? 22.587  -7.181  26.083  1.00 85.13  ? 455 VAL A CG1   1 
ATOM   3203 C CG2   . VAL A 1 408 ? 20.251  -6.742  25.360  1.00 83.53  ? 455 VAL A CG2   1 
ATOM   3204 N N     . ARG A 1 409 ? 22.702  -6.851  29.291  1.00 85.13  ? 456 ARG A N     1 
ATOM   3205 C CA    . ARG A 1 409 ? 23.791  -6.660  30.253  1.00 87.41  ? 456 ARG A CA    1 
ATOM   3206 C C     . ARG A 1 409 ? 25.143  -6.860  29.583  1.00 97.00  ? 456 ARG A C     1 
ATOM   3207 O O     . ARG A 1 409 ? 25.255  -7.498  28.529  1.00 97.16  ? 456 ARG A O     1 
ATOM   3208 C CB    . ARG A 1 409 ? 23.616  -7.601  31.450  1.00 84.37  ? 456 ARG A CB    1 
ATOM   3209 C CG    . ARG A 1 409 ? 24.362  -7.174  32.704  1.00 83.71  ? 456 ARG A CG    1 
ATOM   3210 C CD    . ARG A 1 409 ? 23.812  -7.824  33.963  1.00 75.14  ? 456 ARG A CD    1 
ATOM   3211 N NE    . ARG A 1 409 ? 24.129  -9.252  34.043  1.00 79.49  ? 456 ARG A NE    1 
ATOM   3212 C CZ    . ARG A 1 409 ? 23.863  -10.025 35.092  1.00 96.40  ? 456 ARG A CZ    1 
ATOM   3213 N NH1   . ARG A 1 409 ? 23.294  -9.510  36.180  1.00 85.60  ? 456 ARG A NH1   1 
ATOM   3214 N NH2   . ARG A 1 409 ? 24.177  -11.319 35.069  1.00 77.97  ? 456 ARG A NH2   1 
ATOM   3215 N N     . ASN A 1 410 ? 26.181  -6.292  30.198  1.00 98.33  ? 457 ASN A N     1 
ATOM   3216 C CA    . ASN A 1 410 ? 27.553  -6.335  29.702  1.00 101.22 ? 457 ASN A CA    1 
ATOM   3217 C C     . ASN A 1 410 ? 28.072  -7.770  29.491  1.00 105.90 ? 457 ASN A C     1 
ATOM   3218 O O     . ASN A 1 410 ? 28.849  -7.998  28.568  1.00 108.00 ? 457 ASN A O     1 
ATOM   3219 C CB    . ASN A 1 410 ? 28.469  -5.454  30.566  1.00 100.23 ? 457 ASN A CB    1 
ATOM   3220 C CG    . ASN A 1 410 ? 28.773  -5.905  32.002  1.00 131.61 ? 457 ASN A CG    1 
ATOM   3221 O OD1   . ASN A 1 410 ? 28.444  -7.011  32.479  1.00 115.30 ? 457 ASN A OD1   1 
ATOM   3222 N ND2   . ASN A 1 410 ? 29.503  -5.057  32.717  1.00 136.70 ? 457 ASN A ND2   1 
ATOM   3223 N N     . ASP A 1 411 ? 27.574  -8.739  30.290  1.00 100.38 ? 458 ASP A N     1 
ATOM   3224 C CA    . ASP A 1 411 ? 27.971  -10.149 30.222  1.00 100.54 ? 458 ASP A CA    1 
ATOM   3225 C C     . ASP A 1 411 ? 27.123  -11.027 29.269  1.00 102.77 ? 458 ASP A C     1 
ATOM   3226 O O     . ASP A 1 411 ? 27.449  -12.206 29.114  1.00 106.68 ? 458 ASP A O     1 
ATOM   3227 C CB    . ASP A 1 411 ? 28.032  -10.760 31.628  1.00 102.39 ? 458 ASP A CB    1 
ATOM   3228 C CG    . ASP A 1 411 ? 26.688  -10.852 32.319  1.00 104.39 ? 458 ASP A CG    1 
ATOM   3229 O OD1   . ASP A 1 411 ? 25.752  -10.130 31.903  1.00 100.20 ? 458 ASP A OD1   1 
ATOM   3230 O OD2   . ASP A 1 411 ? 26.576  -11.621 33.292  1.00 111.83 ? 458 ASP A OD2   1 
ATOM   3231 N N     . GLY A 1 412 ? 26.083  -10.466 28.646  1.00 92.69  ? 459 GLY A N     1 
ATOM   3232 C CA    . GLY A 1 412 ? 25.271  -11.199 27.679  1.00 89.67  ? 459 GLY A CA    1 
ATOM   3233 C C     . GLY A 1 412 ? 23.813  -11.492 28.007  1.00 89.44  ? 459 GLY A C     1 
ATOM   3234 O O     . GLY A 1 412 ? 23.055  -11.903 27.122  1.00 86.31  ? 459 GLY A O     1 
ATOM   3235 N N     . VAL A 1 413 ? 23.410  -11.311 29.279  1.00 84.12  ? 460 VAL A N     1 
ATOM   3236 C CA    . VAL A 1 413 ? 22.045  -11.574 29.728  1.00 79.12  ? 460 VAL A CA    1 
ATOM   3237 C C     . VAL A 1 413 ? 21.097  -10.553 29.113  1.00 80.85  ? 460 VAL A C     1 
ATOM   3238 O O     . VAL A 1 413 ? 21.370  -9.358  29.108  1.00 81.83  ? 460 VAL A O     1 
ATOM   3239 C CB    . VAL A 1 413 ? 21.912  -11.679 31.267  1.00 81.77  ? 460 VAL A CB    1 
ATOM   3240 C CG1   . VAL A 1 413 ? 20.549  -12.229 31.680  1.00 78.70  ? 460 VAL A CG1   1 
ATOM   3241 C CG2   . VAL A 1 413 ? 23.013  -12.557 31.846  1.00 84.73  ? 460 VAL A CG2   1 
ATOM   3242 N N     . ILE A 1 414 ? 20.023  -11.066 28.516  1.00 74.68  ? 461 ILE A N     1 
ATOM   3243 C CA    . ILE A 1 414 ? 18.950  -10.328 27.871  1.00 71.10  ? 461 ILE A CA    1 
ATOM   3244 C C     . ILE A 1 414 ? 17.803  -10.377 28.852  1.00 78.19  ? 461 ILE A C     1 
ATOM   3245 O O     . ILE A 1 414 ? 17.493  -11.458 29.369  1.00 80.22  ? 461 ILE A O     1 
ATOM   3246 C CB    . ILE A 1 414 ? 18.564  -10.992 26.514  1.00 70.83  ? 461 ILE A CB    1 
ATOM   3247 C CG1   . ILE A 1 414 ? 19.738  -10.953 25.510  1.00 71.05  ? 461 ILE A CG1   1 
ATOM   3248 C CG2   . ILE A 1 414 ? 17.307  -10.357 25.914  1.00 67.06  ? 461 ILE A CG2   1 
ATOM   3249 C CD1   . ILE A 1 414 ? 19.606  -11.942 24.324  1.00 64.78  ? 461 ILE A CD1   1 
ATOM   3250 N N     . TYR A 1 415 ? 17.188  -9.211  29.108  1.00 74.01  ? 462 TYR A N     1 
ATOM   3251 C CA    . TYR A 1 415 ? 16.021  -9.020  29.960  1.00 73.40  ? 462 TYR A CA    1 
ATOM   3252 C C     . TYR A 1 415 ? 14.967  -8.347  29.067  1.00 78.00  ? 462 TYR A C     1 
ATOM   3253 O O     . TYR A 1 415 ? 15.049  -7.140  28.817  1.00 78.07  ? 462 TYR A O     1 
ATOM   3254 C CB    . TYR A 1 415 ? 16.377  -8.097  31.138  1.00 75.59  ? 462 TYR A CB    1 
ATOM   3255 C CG    . TYR A 1 415 ? 17.504  -8.572  32.018  1.00 79.16  ? 462 TYR A CG    1 
ATOM   3256 C CD1   . TYR A 1 415 ? 17.379  -9.733  32.775  1.00 81.87  ? 462 TYR A CD1   1 
ATOM   3257 C CD2   . TYR A 1 415 ? 18.678  -7.828  32.148  1.00 82.24  ? 462 TYR A CD2   1 
ATOM   3258 C CE1   . TYR A 1 415 ? 18.415  -10.174 33.604  1.00 84.40  ? 462 TYR A CE1   1 
ATOM   3259 C CE2   . TYR A 1 415 ? 19.708  -8.239  33.009  1.00 84.87  ? 462 TYR A CE2   1 
ATOM   3260 C CZ    . TYR A 1 415 ? 19.570  -9.421  33.726  1.00 87.97  ? 462 TYR A CZ    1 
ATOM   3261 O OH    . TYR A 1 415 ? 20.541  -9.867  34.575  1.00 84.23  ? 462 TYR A OH    1 
ATOM   3262 N N     . SER A 1 416 ? 14.027  -9.124  28.518  1.00 75.25  ? 463 SER A N     1 
ATOM   3263 C CA    . SER A 1 416 ? 12.983  -8.551  27.658  1.00 75.33  ? 463 SER A CA    1 
ATOM   3264 C C     . SER A 1 416 ? 11.993  -7.742  28.516  1.00 82.45  ? 463 SER A C     1 
ATOM   3265 O O     . SER A 1 416 ? 11.873  -8.016  29.707  1.00 82.97  ? 463 SER A O     1 
ATOM   3266 C CB    . SER A 1 416 ? 12.263  -9.644  26.883  1.00 78.67  ? 463 SER A CB    1 
ATOM   3267 O OG    . SER A 1 416 ? 11.438  -10.425 27.732  1.00 88.93  ? 463 SER A OG    1 
ATOM   3268 N N     . THR A 1 417 ? 11.295  -6.754  27.927  1.00 80.20  ? 464 THR A N     1 
ATOM   3269 C CA    . THR A 1 417 ? 10.369  -5.909  28.694  1.00 80.56  ? 464 THR A CA    1 
ATOM   3270 C C     . THR A 1 417 ? 8.880   -6.138  28.393  1.00 87.10  ? 464 THR A C     1 
ATOM   3271 O O     . THR A 1 417 ? 8.031   -5.629  29.139  1.00 88.26  ? 464 THR A O     1 
ATOM   3272 C CB    . THR A 1 417 ? 10.651  -4.447  28.406  1.00 77.32  ? 464 THR A CB    1 
ATOM   3273 O OG1   . THR A 1 417 ? 10.165  -4.197  27.096  1.00 81.39  ? 464 THR A OG1   1 
ATOM   3274 C CG2   . THR A 1 417 ? 12.139  -4.068  28.543  1.00 67.85  ? 464 THR A CG2   1 
ATOM   3275 N N     . SER A 1 418 ? 8.561   -6.806  27.263  1.00 83.91  ? 465 SER A N     1 
ATOM   3276 C CA    . SER A 1 418 ? 7.182   -6.982  26.766  1.00 86.35  ? 465 SER A CA    1 
ATOM   3277 C C     . SER A 1 418 ? 6.605   -5.635  26.277  1.00 89.19  ? 465 SER A C     1 
ATOM   3278 O O     . SER A 1 418 ? 5.421   -5.517  25.975  1.00 91.32  ? 465 SER A O     1 
ATOM   3279 C CB    . SER A 1 418 ? 6.281   -7.685  27.775  1.00 95.01  ? 465 SER A CB    1 
ATOM   3280 O OG    . SER A 1 418 ? 6.913   -8.883  28.195  1.00 111.94 ? 465 SER A OG    1 
ATOM   3281 N N     . LEU A 1 419 ? 7.509   -4.650  26.106  1.00 82.05  ? 466 LEU A N     1 
ATOM   3282 C CA    . LEU A 1 419 ? 7.253   -3.310  25.606  1.00 80.98  ? 466 LEU A CA    1 
ATOM   3283 C C     . LEU A 1 419 ? 7.969   -3.150  24.304  1.00 81.75  ? 466 LEU A C     1 
ATOM   3284 O O     . LEU A 1 419 ? 8.998   -3.793  24.090  1.00 81.20  ? 466 LEU A O     1 
ATOM   3285 C CB    . LEU A 1 419 ? 7.748   -2.256  26.595  1.00 80.50  ? 466 LEU A CB    1 
ATOM   3286 C CG    . LEU A 1 419 ? 6.960   -2.168  27.885  1.00 85.62  ? 466 LEU A CG    1 
ATOM   3287 C CD1   . LEU A 1 419 ? 7.611   -1.196  28.846  1.00 85.72  ? 466 LEU A CD1   1 
ATOM   3288 C CD2   . LEU A 1 419 ? 5.500   -1.850  27.614  1.00 88.54  ? 466 LEU A CD2   1 
ATOM   3289 N N     . THR A 1 420 ? 7.411   -2.328  23.417  1.00 77.84  ? 467 THR A N     1 
ATOM   3290 C CA    . THR A 1 420 ? 7.957   -2.094  22.096  1.00 78.25  ? 467 THR A CA    1 
ATOM   3291 C C     . THR A 1 420 ? 7.981   -0.614  21.853  1.00 86.19  ? 467 THR A C     1 
ATOM   3292 O O     . THR A 1 420 ? 7.309   0.120   22.572  1.00 88.81  ? 467 THR A O     1 
ATOM   3293 C CB    . THR A 1 420 ? 7.107   -2.771  20.978  1.00 86.68  ? 467 THR A CB    1 
ATOM   3294 O OG1   . THR A 1 420 ? 5.858   -2.101  20.825  1.00 87.93  ? 467 THR A OG1   1 
ATOM   3295 C CG2   . THR A 1 420 ? 6.900   -4.263  21.175  1.00 86.02  ? 467 THR A CG2   1 
ATOM   3296 N N     . PHE A 1 421 ? 8.732   -0.185  20.823  1.00 82.82  ? 468 PHE A N     1 
ATOM   3297 C CA    . PHE A 1 421 ? 8.826   1.173   20.329  1.00 85.13  ? 468 PHE A CA    1 
ATOM   3298 C C     . PHE A 1 421 ? 8.292   1.124   18.913  1.00 91.67  ? 468 PHE A C     1 
ATOM   3299 O O     . PHE A 1 421 ? 8.650   0.234   18.137  1.00 90.27  ? 468 PHE A O     1 
ATOM   3300 C CB    . PHE A 1 421 ? 10.264  1.681   20.337  1.00 86.95  ? 468 PHE A CB    1 
ATOM   3301 C CG    . PHE A 1 421 ? 10.373  3.121   19.887  1.00 92.63  ? 468 PHE A CG    1 
ATOM   3302 C CD1   . PHE A 1 421 ? 10.171  4.167   20.784  1.00 97.47  ? 468 PHE A CD1   1 
ATOM   3303 C CD2   . PHE A 1 421 ? 10.663  3.433   18.559  1.00 96.72  ? 468 PHE A CD2   1 
ATOM   3304 C CE1   . PHE A 1 421 ? 10.260  5.498   20.360  1.00 101.70 ? 468 PHE A CE1   1 
ATOM   3305 C CE2   . PHE A 1 421 ? 10.742  4.763   18.136  1.00 102.40 ? 468 PHE A CE2   1 
ATOM   3306 C CZ    . PHE A 1 421 ? 10.548  5.785   19.040  1.00 101.97 ? 468 PHE A CZ    1 
ATOM   3307 N N     . THR A 1 422 ? 7.390   2.050   18.593  1.00 92.57  ? 469 THR A N     1 
ATOM   3308 C CA    . THR A 1 422 ? 6.741   2.088   17.295  1.00 94.67  ? 469 THR A CA    1 
ATOM   3309 C C     . THR A 1 422 ? 7.056   3.410   16.646  1.00 101.57 ? 469 THR A C     1 
ATOM   3310 O O     . THR A 1 422 ? 6.782   4.461   17.233  1.00 103.11 ? 469 THR A O     1 
ATOM   3311 C CB    . THR A 1 422 ? 5.219   1.825   17.439  1.00 100.71 ? 469 THR A CB    1 
ATOM   3312 O OG1   . THR A 1 422 ? 4.975   0.857   18.459  1.00 97.55  ? 469 THR A OG1   1 
ATOM   3313 C CG2   . THR A 1 422 ? 4.577   1.345   16.150  1.00 100.70 ? 469 THR A CG2   1 
ATOM   3314 N N     . TYR A 1 423 ? 7.671   3.347   15.448  1.00 98.57  ? 470 TYR A N     1 
ATOM   3315 C CA    . TYR A 1 423 ? 8.004   4.487   14.593  1.00 100.93 ? 470 TYR A CA    1 
ATOM   3316 C C     . TYR A 1 423 ? 6.780   4.783   13.753  1.00 110.21 ? 470 TYR A C     1 
ATOM   3317 O O     . TYR A 1 423 ? 6.173   3.840   13.251  1.00 109.19 ? 470 TYR A O     1 
ATOM   3318 C CB    . TYR A 1 423 ? 9.132   4.107   13.644  1.00 100.66 ? 470 TYR A CB    1 
ATOM   3319 C CG    . TYR A 1 423 ? 10.478  3.953   14.309  1.00 98.86  ? 470 TYR A CG    1 
ATOM   3320 C CD1   . TYR A 1 423 ? 10.876  2.728   14.855  1.00 96.59  ? 470 TYR A CD1   1 
ATOM   3321 C CD2   . TYR A 1 423 ? 11.398  4.998   14.310  1.00 100.69 ? 470 TYR A CD2   1 
ATOM   3322 C CE1   . TYR A 1 423 ? 12.136  2.567   15.431  1.00 92.99  ? 470 TYR A CE1   1 
ATOM   3323 C CE2   . TYR A 1 423 ? 12.661  4.848   14.879  1.00 99.80  ? 470 TYR A CE2   1 
ATOM   3324 C CZ    . TYR A 1 423 ? 13.025  3.631   15.440  1.00 104.18 ? 470 TYR A CZ    1 
ATOM   3325 O OH    . TYR A 1 423 ? 14.268  3.495   16.003  1.00 105.61 ? 470 TYR A OH    1 
ATOM   3326 N N     . THR A 1 424 ? 6.403   6.073   13.606  1.00 113.05 ? 471 THR A N     1 
ATOM   3327 C CA    . THR A 1 424 ? 5.248   6.507   12.796  1.00 119.14 ? 471 THR A CA    1 
ATOM   3328 C C     . THR A 1 424 ? 5.578   7.805   12.054  1.00 131.35 ? 471 THR A C     1 
ATOM   3329 O O     . THR A 1 424 ? 6.336   8.610   12.604  1.00 132.19 ? 471 THR A O     1 
ATOM   3330 C CB    . THR A 1 424 ? 3.999   6.766   13.676  1.00 127.47 ? 471 THR A CB    1 
ATOM   3331 O OG1   . THR A 1 424 ? 4.357   7.543   14.821  1.00 127.17 ? 471 THR A OG1   1 
ATOM   3332 C CG2   . THR A 1 424 ? 3.270   5.495   14.079  1.00 122.88 ? 471 THR A CG2   1 
ATOM   3333 N N     . PRO A 1 425 ? 4.982   8.099   10.867  1.00 133.59 ? 472 PRO A N     1 
ATOM   3334 C CA    . PRO A 1 425 ? 5.283   9.382   10.197  1.00 140.82 ? 472 PRO A CA    1 
ATOM   3335 C C     . PRO A 1 425 ? 4.373   10.530  10.667  1.00 164.93 ? 472 PRO A C     1 
ATOM   3336 O O     . PRO A 1 425 ? 4.648   11.720  10.455  1.00 134.92 ? 472 PRO A O     1 
ATOM   3337 C CB    . PRO A 1 425 ? 5.107   9.055   8.704   1.00 145.52 ? 472 PRO A CB    1 
ATOM   3338 C CG    . PRO A 1 425 ? 4.551   7.612   8.649   1.00 146.36 ? 472 PRO A CG    1 
ATOM   3339 C CD    . PRO A 1 425 ? 4.088   7.274   10.033  1.00 137.78 ? 472 PRO A CD    1 
ATOM   3340 N N     . SER B 2 1   ? -13.746 5.694   35.894  1.00 110.71 ? 183 SER B N     1 
ATOM   3341 C CA    . SER B 2 1   ? -12.834 5.747   34.756  1.00 111.09 ? 183 SER B CA    1 
ATOM   3342 C C     . SER B 2 1   ? -12.427 4.353   34.215  1.00 112.30 ? 183 SER B C     1 
ATOM   3343 O O     . SER B 2 1   ? -11.606 3.638   34.831  1.00 113.00 ? 183 SER B O     1 
ATOM   3344 C CB    . SER B 2 1   ? -11.596 6.591   35.081  1.00 118.73 ? 183 SER B CB    1 
ATOM   3345 O OG    . SER B 2 1   ? -10.659 5.929   35.921  1.00 128.38 ? 183 SER B OG    1 
ATOM   3346 N N     . GLY B 2 2   ? -12.998 4.003   33.059  1.00 103.77 ? 184 GLY B N     1 
ATOM   3347 C CA    . GLY B 2 2   ? -12.706 2.753   32.369  1.00 99.58  ? 184 GLY B CA    1 
ATOM   3348 C C     . GLY B 2 2   ? -13.848 1.767   32.255  1.00 96.72  ? 184 GLY B C     1 
ATOM   3349 O O     . GLY B 2 2   ? -14.718 1.694   33.127  1.00 94.48  ? 184 GLY B O     1 
ATOM   3350 N N     . LEU B 2 3   ? -13.825 0.991   31.159  1.00 90.96  ? 185 LEU B N     1 
ATOM   3351 C CA    . LEU B 2 3   ? -14.777 -0.087  30.875  1.00 89.01  ? 185 LEU B CA    1 
ATOM   3352 C C     . LEU B 2 3   ? -14.063 -1.454  30.967  1.00 89.22  ? 185 LEU B C     1 
ATOM   3353 O O     . LEU B 2 3   ? -12.879 -1.547  30.609  1.00 88.98  ? 185 LEU B O     1 
ATOM   3354 C CB    . LEU B 2 3   ? -15.450 0.090   29.504  1.00 89.52  ? 185 LEU B CB    1 
ATOM   3355 C CG    . LEU B 2 3   ? -16.342 1.335   29.352  1.00 96.45  ? 185 LEU B CG    1 
ATOM   3356 C CD1   . LEU B 2 3   ? -16.337 1.828   27.926  1.00 97.84  ? 185 LEU B CD1   1 
ATOM   3357 C CD2   . LEU B 2 3   ? -17.771 1.088   29.865  1.00 97.83  ? 185 LEU B CD2   1 
ATOM   3358 N N     . VAL B 2 4   ? -14.765 -2.494  31.506  1.00 80.81  ? 186 VAL B N     1 
ATOM   3359 C CA    . VAL B 2 4   ? -14.240 -3.859  31.663  1.00 77.29  ? 186 VAL B CA    1 
ATOM   3360 C C     . VAL B 2 4   ? -15.201 -4.887  31.031  1.00 77.95  ? 186 VAL B C     1 
ATOM   3361 O O     . VAL B 2 4   ? -16.393 -4.829  31.275  1.00 76.33  ? 186 VAL B O     1 
ATOM   3362 C CB    . VAL B 2 4   ? -13.890 -4.182  33.151  1.00 80.32  ? 186 VAL B CB    1 
ATOM   3363 C CG1   . VAL B 2 4   ? -13.492 -5.648  33.346  1.00 78.91  ? 186 VAL B CG1   1 
ATOM   3364 C CG2   . VAL B 2 4   ? -12.783 -3.273  33.662  1.00 80.91  ? 186 VAL B CG2   1 
ATOM   3365 N N     . LYS B 2 5   ? -14.683 -5.812  30.216  1.00 74.91  ? 187 LYS B N     1 
ATOM   3366 C CA    . LYS B 2 5   ? -15.493 -6.871  29.598  1.00 74.12  ? 187 LYS B CA    1 
ATOM   3367 C C     . LYS B 2 5   ? -15.048 -8.205  30.223  1.00 76.70  ? 187 LYS B C     1 
ATOM   3368 O O     . LYS B 2 5   ? -13.923 -8.656  29.973  1.00 74.64  ? 187 LYS B O     1 
ATOM   3369 C CB    . LYS B 2 5   ? -15.404 -6.844  28.041  1.00 75.14  ? 187 LYS B CB    1 
ATOM   3370 C CG    . LYS B 2 5   ? -16.293 -7.860  27.305  1.00 78.78  ? 187 LYS B CG    1 
ATOM   3371 C CD    . LYS B 2 5   ? -16.470 -7.464  25.831  1.00 94.88  ? 187 LYS B CD    1 
ATOM   3372 C CE    . LYS B 2 5   ? -16.468 -8.612  24.831  1.00 104.84 ? 187 LYS B CE    1 
ATOM   3373 N NZ    . LYS B 2 5   ? -17.844 -8.989  24.353  1.00 103.86 ? 187 LYS B NZ    1 
ATOM   3374 N N     . ALA B 2 6   ? -15.923 -8.793  31.088  1.00 63.71  ? 188 ALA B N     1 
ATOM   3375 C CA    . ALA B 2 6   ? -15.646 -10.036 31.805  1.00 63.22  ? 188 ALA B CA    1 
ATOM   3376 C C     . ALA B 2 6   ? -16.873 -10.920 31.908  1.00 73.73  ? 188 ALA B C     1 
ATOM   3377 O O     . ALA B 2 6   ? -17.801 -10.584 32.659  1.00 78.62  ? 188 ALA B O     1 
ATOM   3378 C CB    . ALA B 2 6   ? -15.105 -9.730  33.191  1.00 62.07  ? 188 ALA B CB    1 
ATOM   3379 N N     . PRO B 2 7   ? -16.915 -12.061 31.170  1.00 68.97  ? 189 PRO B N     1 
ATOM   3380 C CA    . PRO B 2 7   ? -18.074 -12.972 31.275  1.00 68.65  ? 189 PRO B CA    1 
ATOM   3381 C C     . PRO B 2 7   ? -18.373 -13.428 32.706  1.00 74.25  ? 189 PRO B C     1 
ATOM   3382 O O     . PRO B 2 7   ? -17.457 -13.699 33.488  1.00 72.09  ? 189 PRO B O     1 
ATOM   3383 C CB    . PRO B 2 7   ? -17.701 -14.112 30.343  1.00 69.76  ? 189 PRO B CB    1 
ATOM   3384 C CG    . PRO B 2 7   ? -16.750 -13.487 29.365  1.00 74.37  ? 189 PRO B CG    1 
ATOM   3385 C CD    . PRO B 2 7   ? -15.908 -12.607 30.234  1.00 68.71  ? 189 PRO B CD    1 
ATOM   3386 N N     . VAL B 2 8   ? -19.674 -13.417 33.064  1.00 75.46  ? 190 VAL B N     1 
ATOM   3387 C CA    . VAL B 2 8   ? -20.231 -13.717 34.389  1.00 75.65  ? 190 VAL B CA    1 
ATOM   3388 C C     . VAL B 2 8   ? -20.519 -15.196 34.608  1.00 81.73  ? 190 VAL B C     1 
ATOM   3389 O O     . VAL B 2 8   ? -21.371 -15.756 33.935  1.00 83.83  ? 190 VAL B O     1 
ATOM   3390 C CB    . VAL B 2 8   ? -21.470 -12.808 34.686  1.00 80.61  ? 190 VAL B CB    1 
ATOM   3391 C CG1   . VAL B 2 8   ? -22.275 -13.284 35.882  1.00 82.37  ? 190 VAL B CG1   1 
ATOM   3392 C CG2   . VAL B 2 8   ? -21.064 -11.365 34.884  1.00 79.21  ? 190 VAL B CG2   1 
ATOM   3393 N N     . TRP B 2 9   ? -19.857 -15.800 35.606  1.00 79.97  ? 191 TRP B N     1 
ATOM   3394 C CA    . TRP B 2 9   ? -20.074 -17.178 36.046  1.00 81.35  ? 191 TRP B CA    1 
ATOM   3395 C C     . TRP B 2 9   ? -21.151 -17.151 37.145  1.00 89.11  ? 191 TRP B C     1 
ATOM   3396 O O     . TRP B 2 9   ? -20.924 -16.646 38.237  1.00 85.65  ? 191 TRP B O     1 
ATOM   3397 C CB    . TRP B 2 9   ? -18.773 -17.810 36.539  1.00 78.50  ? 191 TRP B CB    1 
ATOM   3398 C CG    . TRP B 2 9   ? -18.871 -19.278 36.828  1.00 81.53  ? 191 TRP B CG    1 
ATOM   3399 C CD1   . TRP B 2 9   ? -18.626 -20.301 35.960  1.00 84.89  ? 191 TRP B CD1   1 
ATOM   3400 C CD2   . TRP B 2 9   ? -19.199 -19.892 38.092  1.00 82.84  ? 191 TRP B CD2   1 
ATOM   3401 N NE1   . TRP B 2 9   ? -18.790 -21.512 36.595  1.00 86.07  ? 191 TRP B NE1   1 
ATOM   3402 C CE2   . TRP B 2 9   ? -19.169 -21.289 37.898  1.00 87.80  ? 191 TRP B CE2   1 
ATOM   3403 C CE3   . TRP B 2 9   ? -19.542 -19.396 39.365  1.00 84.49  ? 191 TRP B CE3   1 
ATOM   3404 C CZ2   . TRP B 2 9   ? -19.485 -22.192 38.923  1.00 88.20  ? 191 TRP B CZ2   1 
ATOM   3405 C CZ3   . TRP B 2 9   ? -19.841 -20.294 40.381  1.00 86.90  ? 191 TRP B CZ3   1 
ATOM   3406 C CH2   . TRP B 2 9   ? -19.785 -21.671 40.163  1.00 88.32  ? 191 TRP B CH2   1 
ATOM   3407 N N     . TRP B 2 10  ? -22.356 -17.631 36.814  1.00 93.08  ? 192 TRP B N     1 
ATOM   3408 C CA    . TRP B 2 10  ? -23.474 -17.646 37.753  1.00 95.86  ? 192 TRP B CA    1 
ATOM   3409 C C     . TRP B 2 10  ? -23.372 -18.746 38.789  1.00 101.17 ? 192 TRP B C     1 
ATOM   3410 O O     . TRP B 2 10  ? -23.404 -19.919 38.414  1.00 100.18 ? 192 TRP B O     1 
ATOM   3411 C CB    . TRP B 2 10  ? -24.820 -17.682 37.015  1.00 96.84  ? 192 TRP B CB    1 
ATOM   3412 C CG    . TRP B 2 10  ? -25.228 -16.314 36.569  1.00 98.94  ? 192 TRP B CG    1 
ATOM   3413 C CD1   . TRP B 2 10  ? -24.986 -15.732 35.351  1.00 101.57 ? 192 TRP B CD1   1 
ATOM   3414 C CD2   . TRP B 2 10  ? -25.790 -15.294 37.399  1.00 100.11 ? 192 TRP B CD2   1 
ATOM   3415 N NE1   . TRP B 2 10  ? -25.410 -14.419 35.358  1.00 101.88 ? 192 TRP B NE1   1 
ATOM   3416 C CE2   . TRP B 2 10  ? -25.887 -14.116 36.612  1.00 104.38 ? 192 TRP B CE2   1 
ATOM   3417 C CE3   . TRP B 2 10  ? -26.204 -15.252 38.747  1.00 102.51 ? 192 TRP B CE3   1 
ATOM   3418 C CZ2   . TRP B 2 10  ? -26.408 -12.920 37.121  1.00 104.77 ? 192 TRP B CZ2   1 
ATOM   3419 C CZ3   . TRP B 2 10  ? -26.751 -14.078 39.243  1.00 105.37 ? 192 TRP B CZ3   1 
ATOM   3420 C CH2   . TRP B 2 10  ? -26.840 -12.926 38.439  1.00 106.36 ? 192 TRP B CH2   1 
ATOM   3421 N N     . PRO B 2 11  ? -23.248 -18.407 40.101  1.00 99.93  ? 193 PRO B N     1 
ATOM   3422 C CA    . PRO B 2 11  ? -23.245 -19.462 41.127  1.00 101.12 ? 193 PRO B CA    1 
ATOM   3423 C C     . PRO B 2 11  ? -24.668 -19.969 41.252  1.00 105.11 ? 193 PRO B C     1 
ATOM   3424 O O     . PRO B 2 11  ? -25.593 -19.178 41.109  1.00 105.57 ? 193 PRO B O     1 
ATOM   3425 C CB    . PRO B 2 11  ? -22.752 -18.744 42.398  1.00 103.16 ? 193 PRO B CB    1 
ATOM   3426 C CG    . PRO B 2 11  ? -22.398 -17.348 41.973  1.00 106.03 ? 193 PRO B CG    1 
ATOM   3427 C CD    . PRO B 2 11  ? -23.201 -17.078 40.735  1.00 101.63 ? 193 PRO B CD    1 
ATOM   3428 N N     . MET B 2 12  ? -24.856 -21.278 41.402  1.00 102.46 ? 194 MET B N     1 
ATOM   3429 C CA    . MET B 2 12  ? -26.213 -21.834 41.451  1.00 103.85 ? 194 MET B CA    1 
ATOM   3430 C C     . MET B 2 12  ? -26.743 -22.108 42.849  1.00 107.71 ? 194 MET B C     1 
ATOM   3431 O O     . MET B 2 12  ? -25.978 -22.125 43.813  1.00 106.81 ? 194 MET B O     1 
ATOM   3432 C CB    . MET B 2 12  ? -26.324 -23.084 40.556  1.00 107.03 ? 194 MET B CB    1 
ATOM   3433 C CG    . MET B 2 12  ? -26.156 -22.796 39.063  1.00 111.60 ? 194 MET B CG    1 
ATOM   3434 S SD    . MET B 2 12  ? -27.058 -21.324 38.467  1.00 118.42 ? 194 MET B SD    1 
ATOM   3435 C CE    . MET B 2 12  ? -26.907 -21.560 36.680  1.00 115.78 ? 194 MET B CE    1 
ATOM   3436 N N     . LYS B 2 13  ? -28.062 -22.337 42.955  1.00 106.55 ? 195 LYS B N     1 
ATOM   3437 C CA    . LYS B 2 13  ? -28.736 -22.727 44.196  1.00 107.72 ? 195 LYS B CA    1 
ATOM   3438 C C     . LYS B 2 13  ? -28.556 -24.256 44.375  1.00 115.19 ? 195 LYS B C     1 
ATOM   3439 O O     . LYS B 2 13  ? -27.593 -24.826 43.852  1.00 113.47 ? 195 LYS B O     1 
ATOM   3440 C CB    . LYS B 2 13  ? -30.216 -22.332 44.127  1.00 109.99 ? 195 LYS B CB    1 
ATOM   3441 C CG    . LYS B 2 13  ? -30.495 -20.896 44.573  1.00 116.88 ? 195 LYS B CG    1 
ATOM   3442 C CD    . LYS B 2 13  ? -31.687 -20.225 43.846  1.00 126.64 ? 195 LYS B CD    1 
ATOM   3443 C CE    . LYS B 2 13  ? -33.062 -20.879 44.053  1.00 144.61 ? 195 LYS B CE    1 
ATOM   3444 N NZ    . LYS B 2 13  ? -33.624 -20.690 45.429  1.00 152.30 ? 195 LYS B NZ    1 
ATOM   3445 N N     . ASP B 2 14  ? -29.458 -24.912 45.122  1.00 117.24 ? 196 ASP B N     1 
ATOM   3446 C CA    . ASP B 2 14  ? -29.447 -26.369 45.356  1.00 118.74 ? 196 ASP B CA    1 
ATOM   3447 C C     . ASP B 2 14  ? -30.858 -26.929 45.375  1.00 123.93 ? 196 ASP B C     1 
ATOM   3448 O O     . ASP B 2 14  ? -31.774 -26.223 45.808  1.00 124.87 ? 196 ASP B O     1 
ATOM   3449 C CB    . ASP B 2 14  ? -28.741 -26.721 46.676  1.00 122.00 ? 196 ASP B CB    1 
ATOM   3450 C CG    . ASP B 2 14  ? -27.222 -26.643 46.661  1.00 133.01 ? 196 ASP B CG    1 
ATOM   3451 O OD1   . ASP B 2 14  ? -26.621 -26.841 45.571  1.00 132.81 ? 196 ASP B OD1   1 
ATOM   3452 O OD2   . ASP B 2 14  ? -26.627 -26.479 47.753  1.00 138.37 ? 196 ASP B OD2   1 
ATOM   3453 N N     . ASN B 2 15  ? -31.020 -28.210 44.926  1.00 120.38 ? 197 ASN B N     1 
ATOM   3454 C CA    . ASN B 2 15  ? -32.276 -28.993 44.860  1.00 128.87 ? 197 ASN B CA    1 
ATOM   3455 C C     . ASN B 2 15  ? -33.185 -28.614 43.678  1.00 159.54 ? 197 ASN B C     1 
ATOM   3456 O O     . ASN B 2 15  ? -33.841 -29.480 43.087  1.00 119.41 ? 197 ASN B O     1 
ATOM   3457 C CB    . ASN B 2 15  ? -33.040 -29.006 46.213  1.00 126.72 ? 197 ASN B CB    1 
ATOM   3458 C CG    . ASN B 2 15  ? -34.253 -29.909 46.254  1.00 151.60 ? 197 ASN B CG    1 
ATOM   3459 O OD1   . ASN B 2 15  ? -34.164 -31.139 46.131  1.00 143.41 ? 197 ASN B OD1   1 
ATOM   3460 N ND2   . ASN B 2 15  ? -35.418 -29.317 46.460  1.00 145.81 ? 197 ASN B ND2   1 
ATOM   3461 N N     . PRO C 1 6   ? 7.021   -15.747 -43.532 1.00 164.50 ? 53  PRO C N     1 
ATOM   3462 C CA    . PRO C 1 6   ? 7.562   -17.105 -43.363 1.00 161.94 ? 53  PRO C CA    1 
ATOM   3463 C C     . PRO C 1 6   ? 8.121   -17.352 -41.957 1.00 160.49 ? 53  PRO C C     1 
ATOM   3464 O O     . PRO C 1 6   ? 8.589   -16.394 -41.332 1.00 157.99 ? 53  PRO C O     1 
ATOM   3465 C CB    . PRO C 1 6   ? 8.656   -17.184 -44.425 1.00 167.30 ? 53  PRO C CB    1 
ATOM   3466 C CG    . PRO C 1 6   ? 9.091   -15.776 -44.626 1.00 173.63 ? 53  PRO C CG    1 
ATOM   3467 C CD    . PRO C 1 6   ? 7.928   -14.879 -44.307 1.00 169.51 ? 53  PRO C CD    1 
ATOM   3468 N N     . PRO C 1 7   ? 8.096   -18.608 -41.431 1.00 154.34 ? 54  PRO C N     1 
ATOM   3469 C CA    . PRO C 1 7   ? 8.658   -18.846 -40.088 1.00 147.94 ? 54  PRO C CA    1 
ATOM   3470 C C     . PRO C 1 7   ? 10.171  -19.089 -40.103 1.00 150.23 ? 54  PRO C C     1 
ATOM   3471 O O     . PRO C 1 7   ? 10.732  -19.576 -41.097 1.00 153.23 ? 54  PRO C O     1 
ATOM   3472 C CB    . PRO C 1 7   ? 7.883   -20.066 -39.580 1.00 147.06 ? 54  PRO C CB    1 
ATOM   3473 C CG    . PRO C 1 7   ? 7.358   -20.750 -40.810 1.00 156.69 ? 54  PRO C CG    1 
ATOM   3474 C CD    . PRO C 1 7   ? 7.579   -19.862 -42.019 1.00 157.88 ? 54  PRO C CD    1 
ATOM   3475 N N     . LYS C 1 8   ? 10.830  -18.727 -38.988 1.00 141.46 ? 55  LYS C N     1 
ATOM   3476 C CA    . LYS C 1 8   ? 12.273  -18.881 -38.792 1.00 139.26 ? 55  LYS C CA    1 
ATOM   3477 C C     . LYS C 1 8   ? 12.562  -19.932 -37.711 1.00 135.15 ? 55  LYS C C     1 
ATOM   3478 O O     . LYS C 1 8   ? 12.164  -19.767 -36.554 1.00 130.30 ? 55  LYS C O     1 
ATOM   3479 C CB    . LYS C 1 8   ? 12.922  -17.539 -38.401 1.00 141.43 ? 55  LYS C CB    1 
ATOM   3480 C CG    . LYS C 1 8   ? 13.380  -16.670 -39.566 1.00 154.38 ? 55  LYS C CG    1 
ATOM   3481 C CD    . LYS C 1 8   ? 14.323  -15.546 -39.101 1.00 158.74 ? 55  LYS C CD    1 
ATOM   3482 C CE    . LYS C 1 8   ? 13.627  -14.403 -38.390 1.00 159.49 ? 55  LYS C CE    1 
ATOM   3483 N NZ    . LYS C 1 8   ? 14.511  -13.757 -37.382 1.00 162.06 ? 55  LYS C NZ    1 
ATOM   3484 N N     . ARG C 1 9   ? 13.257  -21.010 -38.096 1.00 130.51 ? 56  ARG C N     1 
ATOM   3485 C CA    . ARG C 1 9   ? 13.649  -22.067 -37.166 1.00 125.76 ? 56  ARG C CA    1 
ATOM   3486 C C     . ARG C 1 9   ? 14.849  -21.595 -36.338 1.00 125.26 ? 56  ARG C C     1 
ATOM   3487 O O     . ARG C 1 9   ? 15.763  -20.969 -36.885 1.00 127.64 ? 56  ARG C O     1 
ATOM   3488 C CB    . ARG C 1 9   ? 13.949  -23.384 -37.902 1.00 126.14 ? 56  ARG C CB    1 
ATOM   3489 C CG    . ARG C 1 9   ? 12.687  -24.100 -38.374 1.00 134.96 ? 56  ARG C CG    1 
ATOM   3490 C CD    . ARG C 1 9   ? 13.002  -25.440 -38.997 1.00 145.15 ? 56  ARG C CD    1 
ATOM   3491 N NE    . ARG C 1 9   ? 12.663  -26.580 -38.136 1.00 140.80 ? 56  ARG C NE    1 
ATOM   3492 C CZ    . ARG C 1 9   ? 13.478  -27.119 -37.231 1.00 151.25 ? 56  ARG C CZ    1 
ATOM   3493 N NH1   . ARG C 1 9   ? 14.676  -26.591 -37.006 1.00 141.83 ? 56  ARG C NH1   1 
ATOM   3494 N NH2   . ARG C 1 9   ? 13.094  -28.179 -36.533 1.00 134.48 ? 56  ARG C NH2   1 
ATOM   3495 N N     . LEU C 1 10  ? 14.821  -21.867 -35.022 1.00 114.98 ? 57  LEU C N     1 
ATOM   3496 C CA    . LEU C 1 10  ? 15.870  -21.461 -34.097 1.00 112.00 ? 57  LEU C CA    1 
ATOM   3497 C C     . LEU C 1 10  ? 17.290  -22.009 -34.425 1.00 115.94 ? 57  LEU C C     1 
ATOM   3498 O O     . LEU C 1 10  ? 17.464  -23.206 -34.665 1.00 115.32 ? 57  LEU C O     1 
ATOM   3499 C CB    . LEU C 1 10  ? 15.454  -21.772 -32.658 1.00 107.67 ? 57  LEU C CB    1 
ATOM   3500 C CG    . LEU C 1 10  ? 16.305  -21.112 -31.575 1.00 110.38 ? 57  LEU C CG    1 
ATOM   3501 C CD1   . LEU C 1 10  ? 15.820  -19.701 -31.270 1.00 110.02 ? 57  LEU C CD1   1 
ATOM   3502 C CD2   . LEU C 1 10  ? 16.373  -21.972 -30.342 1.00 108.77 ? 57  LEU C CD2   1 
ATOM   3503 N N     . THR C 1 11  ? 18.288  -21.099 -34.427 1.00 112.73 ? 58  THR C N     1 
ATOM   3504 C CA    . THR C 1 11  ? 19.706  -21.340 -34.721 1.00 113.97 ? 58  THR C CA    1 
ATOM   3505 C C     . THR C 1 11  ? 20.487  -21.520 -33.422 1.00 114.91 ? 58  THR C C     1 
ATOM   3506 O O     . THR C 1 11  ? 20.100  -20.920 -32.418 1.00 112.34 ? 58  THR C O     1 
ATOM   3507 C CB    . THR C 1 11  ? 20.278  -20.140 -35.525 1.00 124.76 ? 58  THR C CB    1 
ATOM   3508 O OG1   . THR C 1 11  ? 20.297  -18.964 -34.711 1.00 119.03 ? 58  THR C OG1   1 
ATOM   3509 C CG2   . THR C 1 11  ? 19.505  -19.860 -36.815 1.00 126.83 ? 58  THR C CG2   1 
ATOM   3510 N N     . ARG C 1 12  ? 21.601  -22.297 -33.433 1.00 112.46 ? 59  ARG C N     1 
ATOM   3511 C CA    . ARG C 1 12  ? 22.427  -22.521 -32.229 1.00 111.04 ? 59  ARG C CA    1 
ATOM   3512 C C     . ARG C 1 12  ? 22.807  -21.192 -31.543 1.00 119.17 ? 59  ARG C C     1 
ATOM   3513 O O     . ARG C 1 12  ? 22.522  -21.037 -30.351 1.00 117.68 ? 59  ARG C O     1 
ATOM   3514 C CB    . ARG C 1 12  ? 23.670  -23.417 -32.484 1.00 109.67 ? 59  ARG C CB    1 
ATOM   3515 C CG    . ARG C 1 12  ? 23.370  -24.843 -32.991 1.00 112.55 ? 59  ARG C CG    1 
ATOM   3516 C CD    . ARG C 1 12  ? 24.042  -25.941 -32.173 1.00 116.86 ? 59  ARG C CD    1 
ATOM   3517 N NE    . ARG C 1 12  ? 25.280  -26.460 -32.757 1.00 128.54 ? 59  ARG C NE    1 
ATOM   3518 C CZ    . ARG C 1 12  ? 26.349  -26.834 -32.056 1.00 142.37 ? 59  ARG C CZ    1 
ATOM   3519 N NH1   . ARG C 1 12  ? 27.421  -27.315 -32.676 1.00 137.17 ? 59  ARG C NH1   1 
ATOM   3520 N NH2   . ARG C 1 12  ? 26.361  -26.719 -30.735 1.00 122.31 ? 59  ARG C NH2   1 
ATOM   3521 N N     . GLU C 1 13  ? 23.350  -20.208 -32.309 1.00 119.91 ? 60  GLU C N     1 
ATOM   3522 C CA    . GLU C 1 13  ? 23.733  -18.884 -31.787 1.00 121.00 ? 60  GLU C CA    1 
ATOM   3523 C C     . GLU C 1 13  ? 22.559  -18.131 -31.120 1.00 122.72 ? 60  GLU C C     1 
ATOM   3524 O O     . GLU C 1 13  ? 22.753  -17.554 -30.050 1.00 121.16 ? 60  GLU C O     1 
ATOM   3525 C CB    . GLU C 1 13  ? 24.411  -18.020 -32.863 1.00 126.69 ? 60  GLU C CB    1 
ATOM   3526 C CG    . GLU C 1 13  ? 25.433  -17.039 -32.303 1.00 140.73 ? 60  GLU C CG    1 
ATOM   3527 C CD    . GLU C 1 13  ? 25.571  -15.730 -33.062 1.00 166.87 ? 60  GLU C CD    1 
ATOM   3528 O OE1   . GLU C 1 13  ? 24.629  -14.907 -32.989 1.00 171.29 ? 60  GLU C OE1   1 
ATOM   3529 O OE2   . GLU C 1 13  ? 26.636  -15.504 -33.687 1.00 151.83 ? 60  GLU C OE2   1 
ATOM   3530 N N     . ALA C 1 14  ? 21.344  -18.179 -31.721 1.00 118.24 ? 61  ALA C N     1 
ATOM   3531 C CA    . ALA C 1 14  ? 20.143  -17.550 -31.158 1.00 115.79 ? 61  ALA C CA    1 
ATOM   3532 C C     . ALA C 1 14  ? 19.818  -18.153 -29.790 1.00 116.23 ? 61  ALA C C     1 
ATOM   3533 O O     . ALA C 1 14  ? 19.440  -17.418 -28.871 1.00 114.03 ? 61  ALA C O     1 
ATOM   3534 C CB    . ALA C 1 14  ? 18.962  -17.727 -32.097 1.00 117.01 ? 61  ALA C CB    1 
ATOM   3535 N N     . MET C 1 15  ? 20.001  -19.498 -29.662 1.00 111.94 ? 62  MET C N     1 
ATOM   3536 C CA    . MET C 1 15  ? 19.810  -20.263 -28.427 1.00 108.36 ? 62  MET C CA    1 
ATOM   3537 C C     . MET C 1 15  ? 20.886  -19.860 -27.414 1.00 112.35 ? 62  MET C C     1 
ATOM   3538 O O     . MET C 1 15  ? 20.540  -19.574 -26.262 1.00 108.79 ? 62  MET C O     1 
ATOM   3539 C CB    . MET C 1 15  ? 19.838  -21.785 -28.698 1.00 110.07 ? 62  MET C CB    1 
ATOM   3540 C CG    . MET C 1 15  ? 19.703  -22.650 -27.442 1.00 110.66 ? 62  MET C CG    1 
ATOM   3541 S SD    . MET C 1 15  ? 18.305  -22.186 -26.373 1.00 111.18 ? 62  MET C SD    1 
ATOM   3542 C CE    . MET C 1 15  ? 17.093  -23.371 -26.879 1.00 106.42 ? 62  MET C CE    1 
ATOM   3543 N N     . ARG C 1 16  ? 22.186  -19.820 -27.860 1.00 111.94 ? 63  ARG C N     1 
ATOM   3544 C CA    . ARG C 1 16  ? 23.340  -19.401 -27.055 1.00 112.64 ? 63  ARG C CA    1 
ATOM   3545 C C     . ARG C 1 16  ? 23.061  -18.003 -26.482 1.00 118.61 ? 63  ARG C C     1 
ATOM   3546 O O     . ARG C 1 16  ? 23.227  -17.792 -25.275 1.00 117.50 ? 63  ARG C O     1 
ATOM   3547 C CB    . ARG C 1 16  ? 24.621  -19.365 -27.897 1.00 114.11 ? 63  ARG C CB    1 
ATOM   3548 C CG    . ARG C 1 16  ? 25.203  -20.722 -28.231 1.00 123.21 ? 63  ARG C CG    1 
ATOM   3549 C CD    . ARG C 1 16  ? 26.590  -20.611 -28.847 1.00 127.95 ? 63  ARG C CD    1 
ATOM   3550 N NE    . ARG C 1 16  ? 26.552  -20.335 -30.283 1.00 132.31 ? 63  ARG C NE    1 
ATOM   3551 C CZ    . ARG C 1 16  ? 26.596  -21.270 -31.227 1.00 156.19 ? 63  ARG C CZ    1 
ATOM   3552 N NH1   . ARG C 1 16  ? 26.570  -20.928 -32.510 1.00 155.88 ? 63  ARG C NH1   1 
ATOM   3553 N NH2   . ARG C 1 16  ? 26.673  -22.555 -30.898 1.00 140.64 ? 63  ARG C NH2   1 
ATOM   3554 N N     . ASN C 1 17  ? 22.566  -17.074 -27.343 1.00 117.10 ? 64  ASN C N     1 
ATOM   3555 C CA    . ASN C 1 17  ? 22.225  -15.707 -26.962 1.00 117.67 ? 64  ASN C CA    1 
ATOM   3556 C C     . ASN C 1 17  ? 20.953  -15.621 -26.109 1.00 119.84 ? 64  ASN C C     1 
ATOM   3557 O O     . ASN C 1 17  ? 20.780  -14.637 -25.378 1.00 120.91 ? 64  ASN C O     1 
ATOM   3558 C CB    . ASN C 1 17  ? 22.233  -14.763 -28.164 1.00 121.24 ? 64  ASN C CB    1 
ATOM   3559 C CG    . ASN C 1 17  ? 23.610  -14.644 -28.817 1.00 157.61 ? 64  ASN C CG    1 
ATOM   3560 O OD1   . ASN C 1 17  ? 23.796  -14.911 -30.015 1.00 153.57 ? 64  ASN C OD1   1 
ATOM   3561 N ND2   . ASN C 1 17  ? 24.619  -14.250 -28.044 1.00 152.43 ? 64  ASN C ND2   1 
ATOM   3562 N N     . TYR C 1 18  ? 20.099  -16.669 -26.131 1.00 112.74 ? 65  TYR C N     1 
ATOM   3563 C CA    . TYR C 1 18  ? 18.929  -16.679 -25.259 1.00 109.40 ? 65  TYR C CA    1 
ATOM   3564 C C     . TYR C 1 18  ? 19.370  -17.050 -23.841 1.00 111.56 ? 65  TYR C C     1 
ATOM   3565 O O     . TYR C 1 18  ? 19.143  -16.275 -22.925 1.00 110.67 ? 65  TYR C O     1 
ATOM   3566 C CB    . TYR C 1 18  ? 17.804  -17.604 -25.768 1.00 108.91 ? 65  TYR C CB    1 
ATOM   3567 C CG    . TYR C 1 18  ? 16.849  -18.029 -24.671 1.00 108.23 ? 65  TYR C CG    1 
ATOM   3568 C CD1   . TYR C 1 18  ? 16.078  -17.091 -23.985 1.00 109.01 ? 65  TYR C CD1   1 
ATOM   3569 C CD2   . TYR C 1 18  ? 16.772  -19.361 -24.263 1.00 107.71 ? 65  TYR C CD2   1 
ATOM   3570 C CE1   . TYR C 1 18  ? 15.229  -17.471 -22.946 1.00 106.87 ? 65  TYR C CE1   1 
ATOM   3571 C CE2   . TYR C 1 18  ? 15.920  -19.753 -23.229 1.00 105.83 ? 65  TYR C CE2   1 
ATOM   3572 C CZ    . TYR C 1 18  ? 15.144  -18.804 -22.581 1.00 114.33 ? 65  TYR C CZ    1 
ATOM   3573 O OH    . TYR C 1 18  ? 14.310  -19.176 -21.561 1.00 117.61 ? 65  TYR C OH    1 
ATOM   3574 N N     . LEU C 1 19  ? 20.017  -18.222 -23.678 1.00 107.47 ? 66  LEU C N     1 
ATOM   3575 C CA    . LEU C 1 19  ? 20.545  -18.768 -22.423 1.00 106.09 ? 66  LEU C CA    1 
ATOM   3576 C C     . LEU C 1 19  ? 21.444  -17.761 -21.681 1.00 115.08 ? 66  LEU C C     1 
ATOM   3577 O O     . LEU C 1 19  ? 21.502  -17.788 -20.442 1.00 113.44 ? 66  LEU C O     1 
ATOM   3578 C CB    . LEU C 1 19  ? 21.366  -20.050 -22.719 1.00 106.11 ? 66  LEU C CB    1 
ATOM   3579 C CG    . LEU C 1 19  ? 20.638  -21.259 -23.325 1.00 107.88 ? 66  LEU C CG    1 
ATOM   3580 C CD1   . LEU C 1 19  ? 21.612  -22.207 -23.956 1.00 109.34 ? 66  LEU C CD1   1 
ATOM   3581 C CD2   . LEU C 1 19  ? 19.805  -22.000 -22.289 1.00 106.45 ? 66  LEU C CD2   1 
ATOM   3582 N N     . LYS C 1 20  ? 22.157  -16.892 -22.465 1.00 116.59 ? 67  LYS C N     1 
ATOM   3583 C CA    . LYS C 1 20  ? 23.097  -15.840 -22.039 1.00 119.21 ? 67  LYS C CA    1 
ATOM   3584 C C     . LYS C 1 20  ? 22.487  -14.897 -21.004 1.00 123.08 ? 67  LYS C C     1 
ATOM   3585 O O     . LYS C 1 20  ? 22.967  -14.871 -19.871 1.00 122.18 ? 67  LYS C O     1 
ATOM   3586 C CB    . LYS C 1 20  ? 23.617  -15.048 -23.263 1.00 124.11 ? 67  LYS C CB    1 
ATOM   3587 C CG    . LYS C 1 20  ? 24.882  -14.216 -23.027 1.00 136.74 ? 67  LYS C CG    1 
ATOM   3588 C CD    . LYS C 1 20  ? 25.114  -13.203 -24.167 1.00 146.51 ? 67  LYS C CD    1 
ATOM   3589 C CE    . LYS C 1 20  ? 26.566  -12.816 -24.377 1.00 159.11 ? 67  LYS C CE    1 
ATOM   3590 N NZ    . LYS C 1 20  ? 27.059  -11.847 -23.361 1.00 167.41 ? 67  LYS C NZ    1 
ATOM   3591 N N     . GLU C 1 21  ? 21.428  -14.144 -21.385 1.00 120.84 ? 68  GLU C N     1 
ATOM   3592 C CA    . GLU C 1 21  ? 20.768  -13.169 -20.507 1.00 121.13 ? 68  GLU C CA    1 
ATOM   3593 C C     . GLU C 1 21  ? 19.299  -13.487 -20.221 1.00 122.90 ? 68  GLU C C     1 
ATOM   3594 O O     . GLU C 1 21  ? 18.656  -12.705 -19.509 1.00 123.06 ? 68  GLU C O     1 
ATOM   3595 C CB    . GLU C 1 21  ? 20.876  -11.743 -21.099 1.00 125.64 ? 68  GLU C CB    1 
ATOM   3596 C CG    . GLU C 1 21  ? 22.158  -10.993 -20.768 1.00 139.13 ? 68  GLU C CG    1 
ATOM   3597 C CD    . GLU C 1 21  ? 23.067  -10.681 -21.946 1.00 160.97 ? 68  GLU C CD    1 
ATOM   3598 O OE1   . GLU C 1 21  ? 22.554  -10.558 -23.083 1.00 157.22 ? 68  GLU C OE1   1 
ATOM   3599 O OE2   . GLU C 1 21  ? 24.292  -10.533 -21.728 1.00 151.88 ? 68  GLU C OE2   1 
ATOM   3600 N N     . ARG C 1 22  ? 18.765  -14.612 -20.777 1.00 116.69 ? 69  ARG C N     1 
ATOM   3601 C CA    . ARG C 1 22  ? 17.352  -15.057 -20.682 1.00 112.68 ? 69  ARG C CA    1 
ATOM   3602 C C     . ARG C 1 22  ? 16.341  -13.965 -21.167 1.00 115.17 ? 69  ARG C C     1 
ATOM   3603 O O     . ARG C 1 22  ? 16.436  -13.520 -22.322 1.00 116.02 ? 69  ARG C O     1 
ATOM   3604 C CB    . ARG C 1 22  ? 17.015  -15.694 -19.317 1.00 108.19 ? 69  ARG C CB    1 
ATOM   3605 C CG    . ARG C 1 22  ? 17.694  -17.044 -19.101 1.00 112.12 ? 69  ARG C CG    1 
ATOM   3606 C CD    . ARG C 1 22  ? 16.772  -18.245 -19.268 1.00 116.00 ? 69  ARG C CD    1 
ATOM   3607 N NE    . ARG C 1 22  ? 17.538  -19.493 -19.141 1.00 129.47 ? 69  ARG C NE    1 
ATOM   3608 C CZ    . ARG C 1 22  ? 17.095  -20.712 -19.452 1.00 136.95 ? 69  ARG C CZ    1 
ATOM   3609 N NH1   . ARG C 1 22  ? 15.863  -20.883 -19.914 1.00 125.09 ? 69  ARG C NH1   1 
ATOM   3610 N NH2   . ARG C 1 22  ? 17.885  -21.768 -19.305 1.00 112.28 ? 69  ARG C NH2   1 
ATOM   3611 N N     . GLY C 1 23  ? 15.442  -13.518 -20.290 1.00 108.66 ? 70  GLY C N     1 
ATOM   3612 C CA    . GLY C 1 23  ? 14.498  -12.464 -20.638 1.00 108.35 ? 70  GLY C CA    1 
ATOM   3613 C C     . GLY C 1 23  ? 13.185  -12.999 -21.144 1.00 108.03 ? 70  GLY C C     1 
ATOM   3614 O O     . GLY C 1 23  ? 12.613  -12.468 -22.101 1.00 108.17 ? 70  GLY C O     1 
ATOM   3615 N N     . ASP C 1 24  ? 12.703  -14.051 -20.474 1.00 100.78 ? 71  ASP C N     1 
ATOM   3616 C CA    . ASP C 1 24  ? 11.446  -14.734 -20.758 1.00 98.38  ? 71  ASP C CA    1 
ATOM   3617 C C     . ASP C 1 24  ? 10.200  -13.868 -20.490 1.00 101.88 ? 71  ASP C C     1 
ATOM   3618 O O     . ASP C 1 24  ? 10.260  -12.874 -19.762 1.00 102.58 ? 71  ASP C O     1 
ATOM   3619 C CB    . ASP C 1 24  ? 11.345  -15.994 -19.885 1.00 97.19  ? 71  ASP C CB    1 
ATOM   3620 C CG    . ASP C 1 24  ? 12.373  -17.053 -20.165 1.00 113.73 ? 71  ASP C CG    1 
ATOM   3621 O OD1   . ASP C 1 24  ? 12.120  -17.907 -21.049 1.00 115.64 ? 71  ASP C OD1   1 
ATOM   3622 O OD2   . ASP C 1 24  ? 13.403  -17.074 -19.462 1.00 124.10 ? 71  ASP C OD2   1 
ATOM   3623 N N     . GLN C 1 25  ? 9.057   -14.312 -21.033 1.00 96.68  ? 72  GLN C N     1 
ATOM   3624 C CA    . GLN C 1 25  ? 7.743   -13.754 -20.786 1.00 95.46  ? 72  GLN C CA    1 
ATOM   3625 C C     . GLN C 1 25  ? 6.939   -14.842 -20.056 1.00 96.90  ? 72  GLN C C     1 
ATOM   3626 O O     . GLN C 1 25  ? 6.608   -15.880 -20.630 1.00 96.51  ? 72  GLN C O     1 
ATOM   3627 C CB    . GLN C 1 25  ? 7.055   -13.352 -22.090 1.00 98.64  ? 72  GLN C CB    1 
ATOM   3628 C CG    . GLN C 1 25  ? 7.452   -11.992 -22.619 1.00 103.28 ? 72  GLN C CG    1 
ATOM   3629 C CD    . GLN C 1 25  ? 6.924   -11.815 -24.012 1.00 119.45 ? 72  GLN C CD    1 
ATOM   3630 O OE1   . GLN C 1 25  ? 5.815   -11.319 -24.200 1.00 117.18 ? 72  GLN C OE1   1 
ATOM   3631 N NE2   . GLN C 1 25  ? 7.685   -12.257 -25.022 1.00 108.85 ? 72  GLN C NE2   1 
ATOM   3632 N N     . THR C 1 26  ? 6.700   -14.634 -18.766 1.00 91.46  ? 73  THR C N     1 
ATOM   3633 C CA    . THR C 1 26  ? 5.926   -15.562 -17.945 1.00 88.00  ? 73  THR C CA    1 
ATOM   3634 C C     . THR C 1 26  ? 4.493   -14.990 -17.722 1.00 89.53  ? 73  THR C C     1 
ATOM   3635 O O     . THR C 1 26  ? 4.290   -13.762 -17.637 1.00 88.08  ? 73  THR C O     1 
ATOM   3636 C CB    . THR C 1 26  ? 6.665   -15.846 -16.611 1.00 91.82  ? 73  THR C CB    1 
ATOM   3637 O OG1   . THR C 1 26  ? 8.040   -16.164 -16.853 1.00 90.74  ? 73  THR C OG1   1 
ATOM   3638 C CG2   . THR C 1 26  ? 5.986   -16.934 -15.747 1.00 86.14  ? 73  THR C CG2   1 
ATOM   3639 N N     . VAL C 1 27  ? 3.511   -15.915 -17.660 1.00 83.61  ? 74  VAL C N     1 
ATOM   3640 C CA    . VAL C 1 27  ? 2.116   -15.641 -17.354 1.00 81.81  ? 74  VAL C CA    1 
ATOM   3641 C C     . VAL C 1 27  ? 1.782   -16.507 -16.162 1.00 85.98  ? 74  VAL C C     1 
ATOM   3642 O O     . VAL C 1 27  ? 1.877   -17.731 -16.245 1.00 85.61  ? 74  VAL C O     1 
ATOM   3643 C CB    . VAL C 1 27  ? 1.159   -15.940 -18.517 1.00 84.65  ? 74  VAL C CB    1 
ATOM   3644 C CG1   . VAL C 1 27  ? -0.291  -15.777 -18.084 1.00 82.63  ? 74  VAL C CG1   1 
ATOM   3645 C CG2   . VAL C 1 27  ? 1.482   -15.077 -19.724 1.00 87.21  ? 74  VAL C CG2   1 
ATOM   3646 N N     . LEU C 1 28  ? 1.384   -15.871 -15.061 1.00 82.69  ? 75  LEU C N     1 
ATOM   3647 C CA    . LEU C 1 28  ? 0.944   -16.552 -13.854 1.00 80.64  ? 75  LEU C CA    1 
ATOM   3648 C C     . LEU C 1 28  ? -0.551  -16.404 -13.678 1.00 81.82  ? 75  LEU C C     1 
ATOM   3649 O O     . LEU C 1 28  ? -1.123  -15.337 -13.955 1.00 81.24  ? 75  LEU C O     1 
ATOM   3650 C CB    . LEU C 1 28  ? 1.616   -15.953 -12.625 1.00 80.88  ? 75  LEU C CB    1 
ATOM   3651 C CG    . LEU C 1 28  ? 3.027   -16.382 -12.349 1.00 85.54  ? 75  LEU C CG    1 
ATOM   3652 C CD1   . LEU C 1 28  ? 3.586   -15.581 -11.243 1.00 85.79  ? 75  LEU C CD1   1 
ATOM   3653 C CD2   . LEU C 1 28  ? 3.062   -17.801 -11.941 1.00 88.80  ? 75  LEU C CD2   1 
ATOM   3654 N N     . ILE C 1 29  ? -1.185  -17.481 -13.213 1.00 75.97  ? 76  ILE C N     1 
ATOM   3655 C CA    . ILE C 1 29  ? -2.603  -17.462 -12.880 1.00 74.72  ? 76  ILE C CA    1 
ATOM   3656 C C     . ILE C 1 29  ? -2.720  -18.016 -11.481 1.00 78.78  ? 76  ILE C C     1 
ATOM   3657 O O     . ILE C 1 29  ? -2.583  -19.220 -11.266 1.00 79.26  ? 76  ILE C O     1 
ATOM   3658 C CB    . ILE C 1 29  ? -3.579  -18.121 -13.888 1.00 76.98  ? 76  ILE C CB    1 
ATOM   3659 C CG1   . ILE C 1 29  ? -3.352  -17.592 -15.333 1.00 77.34  ? 76  ILE C CG1   1 
ATOM   3660 C CG2   . ILE C 1 29  ? -5.024  -17.864 -13.409 1.00 76.81  ? 76  ILE C CG2   1 
ATOM   3661 C CD1   . ILE C 1 29  ? -3.959  -18.399 -16.404 1.00 73.47  ? 76  ILE C CD1   1 
ATOM   3662 N N     . LEU C 1 30  ? -2.925  -17.128 -10.528 1.00 74.18  ? 77  LEU C N     1 
ATOM   3663 C CA    . LEU C 1 30  ? -3.048  -17.484 -9.122  1.00 72.63  ? 77  LEU C CA    1 
ATOM   3664 C C     . LEU C 1 30  ? -4.542  -17.517 -8.766  1.00 75.94  ? 77  LEU C C     1 
ATOM   3665 O O     . LEU C 1 30  ? -5.263  -16.555 -9.036  1.00 76.15  ? 77  LEU C O     1 
ATOM   3666 C CB    . LEU C 1 30  ? -2.260  -16.474 -8.269  1.00 72.92  ? 77  LEU C CB    1 
ATOM   3667 C CG    . LEU C 1 30  ? -0.876  -16.061 -8.806  1.00 78.30  ? 77  LEU C CG    1 
ATOM   3668 C CD1   . LEU C 1 30  ? -0.182  -15.211 -7.853  1.00 79.74  ? 77  LEU C CD1   1 
ATOM   3669 C CD2   . LEU C 1 30  ? 0.021   -17.222 -8.974  1.00 80.98  ? 77  LEU C CD2   1 
ATOM   3670 N N     . HIS C 1 31  ? -5.022  -18.660 -8.254  1.00 70.66  ? 78  HIS C N     1 
ATOM   3671 C CA    . HIS C 1 31  ? -6.438  -18.867 -7.968  1.00 70.47  ? 78  HIS C CA    1 
ATOM   3672 C C     . HIS C 1 31  ? -6.624  -19.885 -6.858  1.00 73.15  ? 78  HIS C C     1 
ATOM   3673 O O     . HIS C 1 31  ? -5.668  -20.545 -6.481  1.00 75.22  ? 78  HIS C O     1 
ATOM   3674 C CB    . HIS C 1 31  ? -7.163  -19.373 -9.260  1.00 72.10  ? 78  HIS C CB    1 
ATOM   3675 C CG    . HIS C 1 31  ? -6.680  -20.710 -9.775  1.00 75.22  ? 78  HIS C CG    1 
ATOM   3676 N ND1   . HIS C 1 31  ? -5.642  -20.806 -10.688 1.00 77.57  ? 78  HIS C ND1   1 
ATOM   3677 C CD2   . HIS C 1 31  ? -7.110  -21.959 -9.488  1.00 76.48  ? 78  HIS C CD2   1 
ATOM   3678 C CE1   . HIS C 1 31  ? -5.458  -22.103 -10.898 1.00 76.84  ? 78  HIS C CE1   1 
ATOM   3679 N NE2   . HIS C 1 31  ? -6.328  -22.834 -10.217 1.00 76.79  ? 78  HIS C NE2   1 
ATOM   3680 N N     . ALA C 1 32  ? -7.873  -20.079 -6.411  1.00 66.40  ? 79  ALA C N     1 
ATOM   3681 C CA    . ALA C 1 32  ? -8.278  -21.069 -5.433  1.00 64.43  ? 79  ALA C CA    1 
ATOM   3682 C C     . ALA C 1 32  ? -8.596  -22.363 -6.157  1.00 70.75  ? 79  ALA C C     1 
ATOM   3683 O O     . ALA C 1 32  ? -8.928  -22.323 -7.330  1.00 72.05  ? 79  ALA C O     1 
ATOM   3684 C CB    . ALA C 1 32  ? -9.490  -20.582 -4.693  1.00 64.78  ? 79  ALA C CB    1 
ATOM   3685 N N     . LYS C 1 33  ? -8.477  -23.514 -5.471  1.00 69.08  ? 80  LYS C N     1 
ATOM   3686 C CA    . LYS C 1 33  ? -8.676  -24.869 -6.016  1.00 69.26  ? 80  LYS C CA    1 
ATOM   3687 C C     . LYS C 1 33  ? -10.149 -25.252 -6.118  1.00 76.09  ? 80  LYS C C     1 
ATOM   3688 O O     . LYS C 1 33  ? -10.485 -26.275 -6.746  1.00 77.51  ? 80  LYS C O     1 
ATOM   3689 C CB    . LYS C 1 33  ? -7.933  -25.899 -5.143  1.00 70.94  ? 80  LYS C CB    1 
ATOM   3690 C CG    . LYS C 1 33  ? -6.427  -25.976 -5.362  1.00 73.82  ? 80  LYS C CG    1 
ATOM   3691 C CD    . LYS C 1 33  ? -5.893  -27.286 -4.777  1.00 83.13  ? 80  LYS C CD    1 
ATOM   3692 C CE    . LYS C 1 33  ? -4.377  -27.366 -4.741  1.00 96.41  ? 80  LYS C CE    1 
ATOM   3693 N NZ    . LYS C 1 33  ? -3.872  -28.202 -3.615  1.00 93.53  ? 80  LYS C NZ    1 
ATOM   3694 N N     . VAL C 1 34  ? -11.026 -24.451 -5.464  1.00 72.84  ? 81  VAL C N     1 
ATOM   3695 C CA    . VAL C 1 34  ? -12.482 -24.652 -5.392  1.00 73.08  ? 81  VAL C CA    1 
ATOM   3696 C C     . VAL C 1 34  ? -13.249 -23.330 -5.578  1.00 76.67  ? 81  VAL C C     1 
ATOM   3697 O O     . VAL C 1 34  ? -12.716 -22.263 -5.289  1.00 75.90  ? 81  VAL C O     1 
ATOM   3698 C CB    . VAL C 1 34  ? -12.930 -25.389 -4.086  1.00 76.70  ? 81  VAL C CB    1 
ATOM   3699 C CG1   . VAL C 1 34  ? -12.132 -26.661 -3.837  1.00 75.88  ? 81  VAL C CG1   1 
ATOM   3700 C CG2   . VAL C 1 34  ? -12.889 -24.475 -2.858  1.00 76.00  ? 81  VAL C CG2   1 
ATOM   3701 N N     . ALA C 1 35  ? -14.517 -23.408 -6.016  1.00 74.15  ? 82  ALA C N     1 
ATOM   3702 C CA    . ALA C 1 35  ? -15.402 -22.247 -6.200  1.00 73.31  ? 82  ALA C CA    1 
ATOM   3703 C C     . ALA C 1 35  ? -16.815 -22.635 -5.869  1.00 76.21  ? 82  ALA C C     1 
ATOM   3704 O O     . ALA C 1 35  ? -17.246 -23.724 -6.232  1.00 77.61  ? 82  ALA C O     1 
ATOM   3705 C CB    . ALA C 1 35  ? -15.333 -21.757 -7.634  1.00 75.05  ? 82  ALA C CB    1 
ATOM   3706 N N     . GLN C 1 36  ? -17.536 -21.761 -5.175  1.00 72.41  ? 83  GLN C N     1 
ATOM   3707 C CA    . GLN C 1 36  ? -18.936 -21.977 -4.787  1.00 72.77  ? 83  GLN C CA    1 
ATOM   3708 C C     . GLN C 1 36  ? -19.845 -21.443 -5.831  1.00 79.21  ? 83  GLN C C     1 
ATOM   3709 O O     . GLN C 1 36  ? -19.724 -20.269 -6.210  1.00 77.84  ? 83  GLN C O     1 
ATOM   3710 C CB    . GLN C 1 36  ? -19.264 -21.231 -3.505  1.00 73.40  ? 83  GLN C CB    1 
ATOM   3711 C CG    . GLN C 1 36  ? -19.888 -22.083 -2.438  1.00 80.05  ? 83  GLN C CG    1 
ATOM   3712 C CD    . GLN C 1 36  ? -20.360 -21.197 -1.326  1.00 87.38  ? 83  GLN C CD    1 
ATOM   3713 O OE1   . GLN C 1 36  ? -21.535 -20.846 -1.260  1.00 81.98  ? 83  GLN C OE1   1 
ATOM   3714 N NE2   . GLN C 1 36  ? -19.446 -20.777 -0.451  1.00 76.59  ? 83  GLN C NE2   1 
ATOM   3715 N N     . LYS C 1 37  ? -20.816 -22.285 -6.254  1.00 80.75  ? 84  LYS C N     1 
ATOM   3716 C CA    . LYS C 1 37  ? -21.835 -21.924 -7.252  1.00 82.88  ? 84  LYS C CA    1 
ATOM   3717 C C     . LYS C 1 37  ? -22.868 -20.916 -6.778  1.00 86.91  ? 84  LYS C C     1 
ATOM   3718 O O     . LYS C 1 37  ? -23.159 -20.804 -5.576  1.00 85.09  ? 84  LYS C O     1 
ATOM   3719 C CB    . LYS C 1 37  ? -22.481 -23.162 -7.902  1.00 88.02  ? 84  LYS C CB    1 
ATOM   3720 C CG    . LYS C 1 37  ? -23.260 -24.062 -6.949  1.00 111.70 ? 84  LYS C CG    1 
ATOM   3721 C CD    . LYS C 1 37  ? -22.957 -25.566 -7.126  1.00 122.70 ? 84  LYS C CD    1 
ATOM   3722 C CE    . LYS C 1 37  ? -23.457 -26.185 -8.421  1.00 123.46 ? 84  LYS C CE    1 
ATOM   3723 N NZ    . LYS C 1 37  ? -23.073 -27.621 -8.540  1.00 122.99 ? 84  LYS C NZ    1 
ATOM   3724 N N     . SER C 1 38  ? -23.393 -20.159 -7.753  1.00 86.68  ? 85  SER C N     1 
ATOM   3725 C CA    . SER C 1 38  ? -24.432 -19.144 -7.615  1.00 88.38  ? 85  SER C CA    1 
ATOM   3726 C C     . SER C 1 38  ? -25.758 -19.748 -8.132  1.00 97.05  ? 85  SER C C     1 
ATOM   3727 O O     . SER C 1 38  ? -25.776 -20.443 -9.152  1.00 98.34  ? 85  SER C O     1 
ATOM   3728 C CB    . SER C 1 38  ? -24.060 -17.906 -8.428  1.00 93.17  ? 85  SER C CB    1 
ATOM   3729 O OG    . SER C 1 38  ? -22.770 -17.430 -8.078  1.00 105.18 ? 85  SER C OG    1 
ATOM   3730 N N     . TYR C 1 39  ? -26.861 -19.500 -7.417  1.00 95.28  ? 86  TYR C N     1 
ATOM   3731 C CA    . TYR C 1 39  ? -28.172 -20.008 -7.793  1.00 97.55  ? 86  TYR C CA    1 
ATOM   3732 C C     . TYR C 1 39  ? -29.125 -18.858 -8.068  1.00 105.21 ? 86  TYR C C     1 
ATOM   3733 O O     . TYR C 1 39  ? -29.175 -17.901 -7.308  1.00 103.54 ? 86  TYR C O     1 
ATOM   3734 C CB    . TYR C 1 39  ? -28.741 -20.906 -6.682  1.00 97.71  ? 86  TYR C CB    1 
ATOM   3735 C CG    . TYR C 1 39  ? -27.910 -22.122 -6.324  1.00 96.57  ? 86  TYR C CG    1 
ATOM   3736 C CD1   . TYR C 1 39  ? -27.781 -23.189 -7.210  1.00 99.70  ? 86  TYR C CD1   1 
ATOM   3737 C CD2   . TYR C 1 39  ? -27.342 -22.254 -5.061  1.00 94.80  ? 86  TYR C CD2   1 
ATOM   3738 C CE1   . TYR C 1 39  ? -27.065 -24.331 -6.869  1.00 99.37  ? 86  TYR C CE1   1 
ATOM   3739 C CE2   . TYR C 1 39  ? -26.605 -23.383 -4.714  1.00 94.67  ? 86  TYR C CE2   1 
ATOM   3740 C CZ    . TYR C 1 39  ? -26.480 -24.425 -5.618  1.00 104.63 ? 86  TYR C CZ    1 
ATOM   3741 O OH    . TYR C 1 39  ? -25.772 -25.550 -5.275  1.00 104.91 ? 86  TYR C OH    1 
ATOM   3742 N N     . GLY C 1 40  ? -29.918 -18.985 -9.124  1.00 106.67 ? 87  GLY C N     1 
ATOM   3743 C CA    . GLY C 1 40  ? -30.877 -17.961 -9.505  1.00 109.36 ? 87  GLY C CA    1 
ATOM   3744 C C     . GLY C 1 40  ? -30.179 -16.750 -10.072 1.00 114.68 ? 87  GLY C C     1 
ATOM   3745 O O     . GLY C 1 40  ? -29.252 -16.897 -10.876 1.00 114.83 ? 87  GLY C O     1 
ATOM   3746 N N     . ASN C 1 41  ? -30.580 -15.548 -9.620  1.00 112.07 ? 88  ASN C N     1 
ATOM   3747 C CA    . ASN C 1 41  ? -30.002 -14.296 -10.118 1.00 112.05 ? 88  ASN C CA    1 
ATOM   3748 C C     . ASN C 1 41  ? -28.739 -13.821 -9.417  1.00 110.12 ? 88  ASN C C     1 
ATOM   3749 O O     . ASN C 1 41  ? -28.062 -12.926 -9.927  1.00 110.10 ? 88  ASN C O     1 
ATOM   3750 C CB    . ASN C 1 41  ? -31.056 -13.199 -10.203 1.00 118.15 ? 88  ASN C CB    1 
ATOM   3751 C CG    . ASN C 1 41  ? -31.939 -13.320 -11.420 1.00 141.17 ? 88  ASN C CG    1 
ATOM   3752 O OD1   . ASN C 1 41  ? -31.600 -13.994 -12.414 1.00 124.60 ? 88  ASN C OD1   1 
ATOM   3753 N ND2   . ASN C 1 41  ? -33.086 -12.644 -11.372 1.00 140.04 ? 88  ASN C ND2   1 
ATOM   3754 N N     . GLU C 1 42  ? -28.402 -14.455 -8.282  1.00 101.92 ? 89  GLU C N     1 
ATOM   3755 C CA    . GLU C 1 42  ? -27.249 -14.133 -7.442  1.00 97.01  ? 89  GLU C CA    1 
ATOM   3756 C C     . GLU C 1 42  ? -25.921 -14.352 -8.140  1.00 98.39  ? 89  GLU C C     1 
ATOM   3757 O O     . GLU C 1 42  ? -25.830 -15.196 -9.042  1.00 98.89  ? 89  GLU C O     1 
ATOM   3758 C CB    . GLU C 1 42  ? -27.315 -14.877 -6.093  1.00 95.63  ? 89  GLU C CB    1 
ATOM   3759 C CG    . GLU C 1 42  ? -27.013 -16.362 -6.179  1.00 100.16 ? 89  GLU C CG    1 
ATOM   3760 C CD    . GLU C 1 42  ? -27.162 -17.205 -4.924  1.00 113.25 ? 89  GLU C CD    1 
ATOM   3761 O OE1   . GLU C 1 42  ? -27.799 -16.751 -3.942  1.00 89.36  ? 89  GLU C OE1   1 
ATOM   3762 O OE2   . GLU C 1 42  ? -26.679 -18.361 -4.955  1.00 103.90 ? 89  GLU C OE2   1 
ATOM   3763 N N     . LYS C 1 43  ? -24.891 -13.582 -7.701  1.00 91.06  ? 90  LYS C N     1 
ATOM   3764 C CA    . LYS C 1 43  ? -23.518 -13.623 -8.193  1.00 87.63  ? 90  LYS C CA    1 
ATOM   3765 C C     . LYS C 1 43  ? -22.566 -13.858 -7.011  1.00 88.88  ? 90  LYS C C     1 
ATOM   3766 O O     . LYS C 1 43  ? -22.117 -12.898 -6.380  1.00 88.49  ? 90  LYS C O     1 
ATOM   3767 C CB    . LYS C 1 43  ? -23.177 -12.305 -8.918  1.00 90.69  ? 90  LYS C CB    1 
ATOM   3768 C CG    . LYS C 1 43  ? -23.883 -12.148 -10.261 1.00 104.18 ? 90  LYS C CG    1 
ATOM   3769 C CD    . LYS C 1 43  ? -23.974 -10.713 -10.733 1.00 108.25 ? 90  LYS C CD    1 
ATOM   3770 C CE    . LYS C 1 43  ? -24.496 -10.640 -12.138 1.00 116.01 ? 90  LYS C CE    1 
ATOM   3771 N NZ    . LYS C 1 43  ? -23.407 -10.328 -13.098 1.00 127.81 ? 90  LYS C NZ    1 
ATOM   3772 N N     . ARG C 1 44  ? -22.272 -15.126 -6.685  1.00 83.16  ? 91  ARG C N     1 
ATOM   3773 C CA    . ARG C 1 44  ? -21.314 -15.410 -5.608  1.00 80.10  ? 91  ARG C CA    1 
ATOM   3774 C C     . ARG C 1 44  ? -19.879 -15.359 -6.156  1.00 86.78  ? 91  ARG C C     1 
ATOM   3775 O O     . ARG C 1 44  ? -19.377 -16.329 -6.747  1.00 87.40  ? 91  ARG C O     1 
ATOM   3776 C CB    . ARG C 1 44  ? -21.602 -16.730 -4.913  1.00 73.46  ? 91  ARG C CB    1 
ATOM   3777 C CG    . ARG C 1 44  ? -22.806 -16.672 -4.049  1.00 77.02  ? 91  ARG C CG    1 
ATOM   3778 C CD    . ARG C 1 44  ? -23.157 -18.044 -3.567  1.00 82.63  ? 91  ARG C CD    1 
ATOM   3779 N NE    . ARG C 1 44  ? -24.491 -18.051 -2.982  1.00 89.84  ? 91  ARG C NE    1 
ATOM   3780 C CZ    . ARG C 1 44  ? -24.756 -17.705 -1.732  1.00 91.73  ? 91  ARG C CZ    1 
ATOM   3781 N NH1   . ARG C 1 44  ? -23.778 -17.321 -0.921  1.00 71.71  ? 91  ARG C NH1   1 
ATOM   3782 N NH2   . ARG C 1 44  ? -26.003 -17.746 -1.280  1.00 77.40  ? 91  ARG C NH2   1 
ATOM   3783 N N     . PHE C 1 45  ? -19.249 -14.189 -5.993  1.00 83.58  ? 92  PHE C N     1 
ATOM   3784 C CA    . PHE C 1 45  ? -17.924 -13.898 -6.501  1.00 82.36  ? 92  PHE C CA    1 
ATOM   3785 C C     . PHE C 1 45  ? -16.857 -14.739 -5.893  1.00 88.15  ? 92  PHE C C     1 
ATOM   3786 O O     . PHE C 1 45  ? -16.968 -15.107 -4.711  1.00 89.07  ? 92  PHE C O     1 
ATOM   3787 C CB    . PHE C 1 45  ? -17.606 -12.419 -6.358  1.00 84.70  ? 92  PHE C CB    1 
ATOM   3788 C CG    . PHE C 1 45  ? -18.482 -11.540 -7.217  1.00 89.72  ? 92  PHE C CG    1 
ATOM   3789 C CD1   . PHE C 1 45  ? -18.859 -11.940 -8.499  1.00 95.03  ? 92  PHE C CD1   1 
ATOM   3790 C CD2   . PHE C 1 45  ? -18.903 -10.299 -6.763  1.00 93.15  ? 92  PHE C CD2   1 
ATOM   3791 C CE1   . PHE C 1 45  ? -19.666 -11.126 -9.296  1.00 98.96  ? 92  PHE C CE1   1 
ATOM   3792 C CE2   . PHE C 1 45  ? -19.676 -9.474  -7.576  1.00 99.32  ? 92  PHE C CE2   1 
ATOM   3793 C CZ    . PHE C 1 45  ? -20.074 -9.905  -8.827  1.00 99.37  ? 92  PHE C CZ    1 
ATOM   3794 N N     . PHE C 1 46  ? -15.824 -15.069 -6.717  1.00 82.89  ? 93  PHE C N     1 
ATOM   3795 C CA    . PHE C 1 46  ? -14.683 -15.857 -6.293  1.00 79.24  ? 93  PHE C CA    1 
ATOM   3796 C C     . PHE C 1 46  ? -13.797 -14.986 -5.405  1.00 86.21  ? 93  PHE C C     1 
ATOM   3797 O O     . PHE C 1 46  ? -13.320 -13.933 -5.843  1.00 87.00  ? 93  PHE C O     1 
ATOM   3798 C CB    . PHE C 1 46  ? -13.867 -16.344 -7.491  1.00 79.48  ? 93  PHE C CB    1 
ATOM   3799 C CG    . PHE C 1 46  ? -14.497 -17.216 -8.552  1.00 80.92  ? 93  PHE C CG    1 
ATOM   3800 C CD1   . PHE C 1 46  ? -15.644 -17.952 -8.285  1.00 84.41  ? 93  PHE C CD1   1 
ATOM   3801 C CD2   . PHE C 1 46  ? -13.880 -17.390 -9.784  1.00 83.25  ? 93  PHE C CD2   1 
ATOM   3802 C CE1   . PHE C 1 46  ? -16.222 -18.760 -9.274  1.00 86.69  ? 93  PHE C CE1   1 
ATOM   3803 C CE2   . PHE C 1 46  ? -14.460 -18.201 -10.775 1.00 87.48  ? 93  PHE C CE2   1 
ATOM   3804 C CZ    . PHE C 1 46  ? -15.620 -18.889 -10.509 1.00 86.09  ? 93  PHE C CZ    1 
ATOM   3805 N N     . CYS C 1 47  ? -13.659 -15.390 -4.133  1.00 83.78  ? 94  CYS C N     1 
ATOM   3806 C CA    . CYS C 1 47  ? -12.788 -14.796 -3.119  1.00 83.88  ? 94  CYS C CA    1 
ATOM   3807 C C     . CYS C 1 47  ? -11.924 -15.973 -2.710  1.00 83.50  ? 94  CYS C C     1 
ATOM   3808 O O     . CYS C 1 47  ? -12.482 -17.018 -2.386  1.00 83.27  ? 94  CYS C O     1 
ATOM   3809 C CB    . CYS C 1 47  ? -13.556 -14.193 -1.941  1.00 86.23  ? 94  CYS C CB    1 
ATOM   3810 S SG    . CYS C 1 47  ? -14.708 -12.844 -2.407  1.00 93.38  ? 94  CYS C SG    1 
ATOM   3811 N N     . PRO C 1 48  ? -10.573 -15.900 -2.851  1.00 76.72  ? 95  PRO C N     1 
ATOM   3812 C CA    . PRO C 1 48  ? -9.785  -14.747 -3.318  1.00 76.01  ? 95  PRO C CA    1 
ATOM   3813 C C     . PRO C 1 48  ? -10.056 -14.513 -4.811  1.00 79.73  ? 95  PRO C C     1 
ATOM   3814 O O     . PRO C 1 48  ? -10.418 -15.479 -5.534  1.00 78.23  ? 95  PRO C O     1 
ATOM   3815 C CB    . PRO C 1 48  ? -8.337  -15.206 -3.117  1.00 76.44  ? 95  PRO C CB    1 
ATOM   3816 C CG    . PRO C 1 48  ? -8.380  -16.442 -2.308  1.00 78.67  ? 95  PRO C CG    1 
ATOM   3817 C CD    . PRO C 1 48  ? -9.704  -17.051 -2.545  1.00 74.90  ? 95  PRO C CD    1 
ATOM   3818 N N     . PRO C 1 49  ? -9.956  -13.239 -5.278  1.00 75.87  ? 96  PRO C N     1 
ATOM   3819 C CA    . PRO C 1 49  ? -10.161 -12.982 -6.714  1.00 75.65  ? 96  PRO C CA    1 
ATOM   3820 C C     . PRO C 1 49  ? -8.986  -13.576 -7.510  1.00 78.93  ? 96  PRO C C     1 
ATOM   3821 O O     . PRO C 1 49  ? -7.820  -13.322 -7.154  1.00 77.83  ? 96  PRO C O     1 
ATOM   3822 C CB    . PRO C 1 49  ? -10.215 -11.463 -6.802  1.00 78.70  ? 96  PRO C CB    1 
ATOM   3823 C CG    . PRO C 1 49  ? -9.445  -10.990 -5.617  1.00 83.03  ? 96  PRO C CG    1 
ATOM   3824 C CD    . PRO C 1 49  ? -9.572  -12.012 -4.547  1.00 77.31  ? 96  PRO C CD    1 
ATOM   3825 N N     . PRO C 1 50  ? -9.247  -14.430 -8.541  1.00 74.93  ? 97  PRO C N     1 
ATOM   3826 C CA    . PRO C 1 50  ? -8.133  -15.012 -9.302  1.00 74.52  ? 97  PRO C CA    1 
ATOM   3827 C C     . PRO C 1 50  ? -7.232  -13.908 -9.802  1.00 84.00  ? 97  PRO C C     1 
ATOM   3828 O O     . PRO C 1 50  ? -7.703  -12.789 -10.081 1.00 86.29  ? 97  PRO C O     1 
ATOM   3829 C CB    . PRO C 1 50  ? -8.828  -15.724 -10.451 1.00 76.01  ? 97  PRO C CB    1 
ATOM   3830 C CG    . PRO C 1 50  ? -10.175 -16.028 -9.926  1.00 79.68  ? 97  PRO C CG    1 
ATOM   3831 C CD    . PRO C 1 50  ? -10.544 -14.857 -9.101  1.00 75.74  ? 97  PRO C CD    1 
ATOM   3832 N N     . CYS C 1 51  ? -5.932  -14.194 -9.862  1.00 81.10  ? 98  CYS C N     1 
ATOM   3833 C CA    . CYS C 1 51  ? -4.961  -13.198 -10.277 1.00 81.67  ? 98  CYS C CA    1 
ATOM   3834 C C     . CYS C 1 51  ? -4.117  -13.552 -11.480 1.00 85.44  ? 98  CYS C C     1 
ATOM   3835 O O     . CYS C 1 51  ? -3.660  -14.679 -11.607 1.00 85.22  ? 98  CYS C O     1 
ATOM   3836 C CB    . CYS C 1 51  ? -4.097  -12.805 -9.101  1.00 82.16  ? 98  CYS C CB    1 
ATOM   3837 S SG    . CYS C 1 51  ? -3.055  -11.383 -9.436  1.00 89.24  ? 98  CYS C SG    1 
ATOM   3838 N N     . VAL C 1 52  ? -3.882  -12.576 -12.350 1.00 83.34  ? 99  VAL C N     1 
ATOM   3839 C CA    . VAL C 1 52  ? -3.034  -12.740 -13.518 1.00 83.73  ? 99  VAL C CA    1 
ATOM   3840 C C     . VAL C 1 52  ? -1.821  -11.848 -13.364 1.00 89.65  ? 99  VAL C C     1 
ATOM   3841 O O     . VAL C 1 52  ? -1.951  -10.641 -13.249 1.00 87.98  ? 99  VAL C O     1 
ATOM   3842 C CB    . VAL C 1 52  ? -3.787  -12.519 -14.847 1.00 89.43  ? 99  VAL C CB    1 
ATOM   3843 C CG1   . VAL C 1 52  ? -2.855  -12.677 -16.039 1.00 90.64  ? 99  VAL C CG1   1 
ATOM   3844 C CG2   . VAL C 1 52  ? -4.965  -13.483 -14.974 1.00 88.25  ? 99  VAL C CG2   1 
ATOM   3845 N N     . TYR C 1 53  ? -0.642  -12.466 -13.298 1.00 91.51  ? 100 TYR C N     1 
ATOM   3846 C CA    . TYR C 1 53  ? 0.658   -11.789 -13.201 1.00 94.68  ? 100 TYR C CA    1 
ATOM   3847 C C     . TYR C 1 53  ? 1.431   -11.969 -14.497 1.00 96.87  ? 100 TYR C C     1 
ATOM   3848 O O     . TYR C 1 53  ? 1.454   -13.065 -15.061 1.00 94.93  ? 100 TYR C O     1 
ATOM   3849 C CB    . TYR C 1 53  ? 1.531   -12.384 -12.083 1.00 97.02  ? 100 TYR C CB    1 
ATOM   3850 C CG    . TYR C 1 53  ? 1.326   -11.778 -10.724 1.00 102.25 ? 100 TYR C CG    1 
ATOM   3851 C CD1   . TYR C 1 53  ? 0.361   -12.282 -9.859  1.00 104.27 ? 100 TYR C CD1   1 
ATOM   3852 C CD2   . TYR C 1 53  ? 2.157   -10.767 -10.257 1.00 105.91 ? 100 TYR C CD2   1 
ATOM   3853 C CE1   . TYR C 1 53  ? 0.185   -11.752 -8.577  1.00 108.17 ? 100 TYR C CE1   1 
ATOM   3854 C CE2   . TYR C 1 53  ? 1.986   -10.219 -8.982  1.00 108.53 ? 100 TYR C CE2   1 
ATOM   3855 C CZ    . TYR C 1 53  ? 0.991   -10.714 -8.144  1.00 119.42 ? 100 TYR C CZ    1 
ATOM   3856 O OH    . TYR C 1 53  ? 0.791   -10.213 -6.872  1.00 124.58 ? 100 TYR C OH    1 
ATOM   3857 N N     . LEU C 1 54  ? 2.112   -10.908 -14.920 1.00 94.41  ? 101 LEU C N     1 
ATOM   3858 C CA    . LEU C 1 54  ? 2.980   -10.933 -16.077 1.00 95.53  ? 101 LEU C CA    1 
ATOM   3859 C C     . LEU C 1 54  ? 4.400   -10.807 -15.531 1.00 103.85 ? 101 LEU C C     1 
ATOM   3860 O O     . LEU C 1 54  ? 4.812   -9.739  -15.077 1.00 106.23 ? 101 LEU C O     1 
ATOM   3861 C CB    . LEU C 1 54  ? 2.617   -9.833  -17.075 1.00 97.36  ? 101 LEU C CB    1 
ATOM   3862 C CG    . LEU C 1 54  ? 1.179   -9.825  -17.581 1.00 100.74 ? 101 LEU C CG    1 
ATOM   3863 C CD1   . LEU C 1 54  ? 1.014   -8.813  -18.699 1.00 103.66 ? 101 LEU C CD1   1 
ATOM   3864 C CD2   . LEU C 1 54  ? 0.721   -11.218 -18.037 1.00 100.31 ? 101 LEU C CD2   1 
ATOM   3865 N N     . MET C 1 55  ? 5.105   -11.940 -15.479 1.00 100.96 ? 102 MET C N     1 
ATOM   3866 C CA    . MET C 1 55  ? 6.447   -12.030 -14.906 1.00 101.89 ? 102 MET C CA    1 
ATOM   3867 C C     . MET C 1 55  ? 7.548   -12.097 -15.939 1.00 102.38 ? 102 MET C C     1 
ATOM   3868 O O     . MET C 1 55  ? 7.324   -12.573 -17.049 1.00 101.64 ? 102 MET C O     1 
ATOM   3869 C CB    . MET C 1 55  ? 6.546   -13.262 -13.993 1.00 103.33 ? 102 MET C CB    1 
ATOM   3870 C CG    . MET C 1 55  ? 5.667   -13.192 -12.771 1.00 107.78 ? 102 MET C CG    1 
ATOM   3871 S SD    . MET C 1 55  ? 6.183   -11.945 -11.573 1.00 116.16 ? 102 MET C SD    1 
ATOM   3872 C CE    . MET C 1 55  ? 7.840   -12.613 -11.076 1.00 113.51 ? 102 MET C CE    1 
ATOM   3873 N N     . GLY C 1 56  ? 8.740   -11.671 -15.542 1.00 97.70  ? 103 GLY C N     1 
ATOM   3874 C CA    . GLY C 1 56  ? 9.915   -11.755 -16.392 1.00 99.32  ? 103 GLY C CA    1 
ATOM   3875 C C     . GLY C 1 56  ? 10.260  -10.479 -17.110 1.00 106.59 ? 103 GLY C C     1 
ATOM   3876 O O     . GLY C 1 56  ? 9.390   -9.642  -17.363 1.00 107.89 ? 103 GLY C O     1 
ATOM   3877 N N     . SER C 1 57  ? 11.546  -10.345 -17.458 1.00 104.24 ? 104 SER C N     1 
ATOM   3878 C CA    . SER C 1 57  ? 12.095  -9.175  -18.139 1.00 106.80 ? 104 SER C CA    1 
ATOM   3879 C C     . SER C 1 57  ? 11.647  -9.061  -19.595 1.00 110.17 ? 104 SER C C     1 
ATOM   3880 O O     . SER C 1 57  ? 11.780  -7.981  -20.181 1.00 113.54 ? 104 SER C O     1 
ATOM   3881 C CB    . SER C 1 57  ? 13.617  -9.160  -18.028 1.00 113.20 ? 104 SER C CB    1 
ATOM   3882 O OG    . SER C 1 57  ? 14.198  -10.406 -18.388 1.00 123.64 ? 104 SER C OG    1 
ATOM   3883 N N     . GLY C 1 58  ? 11.090  -10.157 -20.134 1.00 102.70 ? 105 GLY C N     1 
ATOM   3884 C CA    . GLY C 1 58  ? 10.585  -10.283 -21.497 1.00 103.00 ? 105 GLY C CA    1 
ATOM   3885 C C     . GLY C 1 58  ? 9.495   -9.310  -21.877 1.00 108.78 ? 105 GLY C C     1 
ATOM   3886 O O     . GLY C 1 58  ? 9.402   -8.905  -23.039 1.00 110.30 ? 105 GLY C O     1 
ATOM   3887 N N     . TRP C 1 59  ? 8.670   -8.917  -20.891 1.00 105.13 ? 106 TRP C N     1 
ATOM   3888 C CA    . TRP C 1 59  ? 7.584   -7.954  -21.064 1.00 105.98 ? 106 TRP C CA    1 
ATOM   3889 C C     . TRP C 1 59  ? 8.116   -6.572  -21.401 1.00 113.04 ? 106 TRP C C     1 
ATOM   3890 O O     . TRP C 1 59  ? 7.580   -5.918  -22.306 1.00 113.43 ? 106 TRP C O     1 
ATOM   3891 C CB    . TRP C 1 59  ? 6.686   -7.941  -19.831 1.00 102.14 ? 106 TRP C CB    1 
ATOM   3892 C CG    . TRP C 1 59  ? 6.019   -9.264  -19.613 1.00 99.91  ? 106 TRP C CG    1 
ATOM   3893 C CD1   . TRP C 1 59  ? 6.367   -10.217 -18.702 1.00 100.13 ? 106 TRP C CD1   1 
ATOM   3894 C CD2   . TRP C 1 59  ? 4.958   -9.825  -20.397 1.00 99.48  ? 106 TRP C CD2   1 
ATOM   3895 N NE1   . TRP C 1 59  ? 5.563   -11.326 -18.843 1.00 97.36  ? 106 TRP C NE1   1 
ATOM   3896 C CE2   . TRP C 1 59  ? 4.691   -11.115 -19.879 1.00 100.20 ? 106 TRP C CE2   1 
ATOM   3897 C CE3   . TRP C 1 59  ? 4.160   -9.338  -21.449 1.00 103.04 ? 106 TRP C CE3   1 
ATOM   3898 C CZ2   . TRP C 1 59  ? 3.663   -11.923 -20.377 1.00 98.67  ? 106 TRP C CZ2   1 
ATOM   3899 C CZ3   . TRP C 1 59  ? 3.152   -10.146 -21.952 1.00 103.82 ? 106 TRP C CZ3   1 
ATOM   3900 C CH2   . TRP C 1 59  ? 2.906   -11.418 -21.412 1.00 101.15 ? 106 TRP C CH2   1 
ATOM   3901 N N     . LYS C 1 60  ? 9.211   -6.161  -20.717 1.00 112.19 ? 107 LYS C N     1 
ATOM   3902 C CA    . LYS C 1 60  ? 9.851   -4.863  -20.947 1.00 116.93 ? 107 LYS C CA    1 
ATOM   3903 C C     . LYS C 1 60  ? 10.491  -4.819  -22.314 1.00 123.55 ? 107 LYS C C     1 
ATOM   3904 O O     . LYS C 1 60  ? 10.235  -3.872  -23.063 1.00 126.97 ? 107 LYS C O     1 
ATOM   3905 C CB    . LYS C 1 60  ? 10.873  -4.495  -19.850 1.00 120.04 ? 107 LYS C CB    1 
ATOM   3906 C CG    . LYS C 1 60  ? 11.133  -2.980  -19.772 1.00 133.95 ? 107 LYS C CG    1 
ATOM   3907 C CD    . LYS C 1 60  ? 12.313  -2.615  -18.866 1.00 141.88 ? 107 LYS C CD    1 
ATOM   3908 C CE    . LYS C 1 60  ? 12.576  -1.127  -18.823 1.00 150.22 ? 107 LYS C CE    1 
ATOM   3909 N NZ    . LYS C 1 60  ? 13.750  -0.799  -17.972 1.00 157.02 ? 107 LYS C NZ    1 
ATOM   3910 N N     . LYS C 1 61  ? 11.295  -5.840  -22.651 1.00 118.23 ? 108 LYS C N     1 
ATOM   3911 C CA    . LYS C 1 61  ? 11.941  -5.885  -23.952 1.00 121.46 ? 108 LYS C CA    1 
ATOM   3912 C C     . LYS C 1 61  ? 10.949  -5.950  -25.098 1.00 128.41 ? 108 LYS C C     1 
ATOM   3913 O O     . LYS C 1 61  ? 11.126  -5.210  -26.068 1.00 133.17 ? 108 LYS C O     1 
ATOM   3914 C CB    . LYS C 1 61  ? 13.085  -6.914  -24.051 1.00 123.10 ? 108 LYS C CB    1 
ATOM   3915 C CG    . LYS C 1 61  ? 12.780  -8.312  -23.538 1.00 138.83 ? 108 LYS C CG    1 
ATOM   3916 C CD    . LYS C 1 61  ? 13.967  -8.940  -22.780 1.00 149.62 ? 108 LYS C CD    1 
ATOM   3917 C CE    . LYS C 1 61  ? 14.946  -9.670  -23.680 1.00 161.25 ? 108 LYS C CE    1 
ATOM   3918 N NZ    . LYS C 1 61  ? 16.036  -10.316 -22.903 1.00 167.59 ? 108 LYS C NZ    1 
ATOM   3919 N N     . LYS C 1 62  ? 9.857   -6.736  -24.950 1.00 122.03 ? 109 LYS C N     1 
ATOM   3920 C CA    . LYS C 1 62  ? 8.803   -6.825  -25.975 1.00 123.17 ? 109 LYS C CA    1 
ATOM   3921 C C     . LYS C 1 62  ? 8.096   -5.464  -26.170 1.00 132.28 ? 109 LYS C C     1 
ATOM   3922 O O     . LYS C 1 62  ? 7.791   -5.109  -27.311 1.00 135.53 ? 109 LYS C O     1 
ATOM   3923 C CB    . LYS C 1 62  ? 7.817   -7.991  -25.697 1.00 120.63 ? 109 LYS C CB    1 
ATOM   3924 C CG    . LYS C 1 62  ? 6.652   -8.161  -26.691 1.00 121.27 ? 109 LYS C CG    1 
ATOM   3925 C CD    . LYS C 1 62  ? 7.039   -8.748  -28.048 1.00 125.00 ? 109 LYS C CD    1 
ATOM   3926 C CE    . LYS C 1 62  ? 5.888   -8.684  -29.029 1.00 125.20 ? 109 LYS C CE    1 
ATOM   3927 N NZ    . LYS C 1 62  ? 6.234   -9.282  -30.344 1.00 129.59 ? 109 LYS C NZ    1 
ATOM   3928 N N     . LYS C 1 63  ? 7.897   -4.680  -25.079 1.00 129.30 ? 110 LYS C N     1 
ATOM   3929 C CA    . LYS C 1 63  ? 7.298   -3.340  -25.169 1.00 132.59 ? 110 LYS C CA    1 
ATOM   3930 C C     . LYS C 1 63  ? 8.268   -2.395  -25.900 1.00 143.01 ? 110 LYS C C     1 
ATOM   3931 O O     . LYS C 1 63  ? 7.826   -1.562  -26.689 1.00 146.43 ? 110 LYS C O     1 
ATOM   3932 C CB    . LYS C 1 63  ? 6.951   -2.780  -23.780 1.00 132.58 ? 110 LYS C CB    1 
ATOM   3933 C CG    . LYS C 1 63  ? 6.002   -1.581  -23.832 1.00 143.72 ? 110 LYS C CG    1 
ATOM   3934 C CD    . LYS C 1 63  ? 6.095   -0.670  -22.598 1.00 149.19 ? 110 LYS C CD    1 
ATOM   3935 C CE    . LYS C 1 63  ? 5.280   0.607   -22.726 1.00 155.98 ? 110 LYS C CE    1 
ATOM   3936 N NZ    . LYS C 1 63  ? 3.815   0.373   -22.603 1.00 158.68 ? 110 LYS C NZ    1 
ATOM   3937 N N     . GLU C 1 64  ? 9.584   -2.555  -25.661 1.00 140.77 ? 111 GLU C N     1 
ATOM   3938 C CA    . GLU C 1 64  ? 10.632  -1.742  -26.278 1.00 145.64 ? 111 GLU C CA    1 
ATOM   3939 C C     . GLU C 1 64  ? 10.792  -2.024  -27.781 1.00 151.43 ? 111 GLU C C     1 
ATOM   3940 O O     . GLU C 1 64  ? 10.867  -1.069  -28.562 1.00 155.63 ? 111 GLU C O     1 
ATOM   3941 C CB    . GLU C 1 64  ? 11.961  -1.913  -25.530 1.00 146.51 ? 111 GLU C CB    1 
ATOM   3942 C CG    . GLU C 1 64  ? 12.002  -1.166  -24.204 1.00 161.53 ? 111 GLU C CG    1 
ATOM   3943 C CD    . GLU C 1 64  ? 13.208  -1.401  -23.310 1.00 191.19 ? 111 GLU C CD    1 
ATOM   3944 O OE1   . GLU C 1 64  ? 14.047  -2.276  -23.634 1.00 191.59 ? 111 GLU C OE1   1 
ATOM   3945 O OE2   . GLU C 1 64  ? 13.306  -0.708  -22.270 1.00 184.56 ? 111 GLU C OE2   1 
ATOM   3946 N N     . GLN C 1 65  ? 10.839  -3.331  -28.178 1.00 144.39 ? 112 GLN C N     1 
ATOM   3947 C CA    . GLN C 1 65  ? 10.949  -3.799  -29.573 1.00 145.77 ? 112 GLN C CA    1 
ATOM   3948 C C     . GLN C 1 65  ? 9.784   -3.254  -30.407 1.00 152.93 ? 112 GLN C C     1 
ATOM   3949 O O     . GLN C 1 65  ? 10.016  -2.709  -31.483 1.00 157.75 ? 112 GLN C O     1 
ATOM   3950 C CB    . GLN C 1 65  ? 11.006  -5.344  -29.637 1.00 142.77 ? 112 GLN C CB    1 
ATOM   3951 C CG    . GLN C 1 65  ? 10.750  -5.971  -31.028 1.00 153.08 ? 112 GLN C CG    1 
ATOM   3952 C CD    . GLN C 1 65  ? 9.365   -6.590  -31.205 1.00 159.83 ? 112 GLN C CD    1 
ATOM   3953 O OE1   . GLN C 1 65  ? 8.832   -7.276  -30.323 1.00 147.01 ? 112 GLN C OE1   1 
ATOM   3954 N NE2   . GLN C 1 65  ? 8.784   -6.433  -32.387 1.00 152.51 ? 112 GLN C NE2   1 
ATOM   3955 N N     . MET C 1 66  ? 8.545   -3.385  -29.896 1.00 146.85 ? 113 MET C N     1 
ATOM   3956 C CA    . MET C 1 66  ? 7.334   -2.903  -30.557 1.00 149.41 ? 113 MET C CA    1 
ATOM   3957 C C     . MET C 1 66  ? 7.342   -1.368  -30.693 1.00 158.61 ? 113 MET C C     1 
ATOM   3958 O O     . MET C 1 66  ? 7.209   -0.866  -31.811 1.00 162.63 ? 113 MET C O     1 
ATOM   3959 C CB    . MET C 1 66  ? 6.079   -3.369  -29.800 1.00 147.93 ? 113 MET C CB    1 
ATOM   3960 C CG    . MET C 1 66  ? 5.699   -4.814  -30.052 1.00 148.05 ? 113 MET C CG    1 
ATOM   3961 S SD    . MET C 1 66  ? 4.049   -5.218  -29.397 1.00 149.14 ? 113 MET C SD    1 
ATOM   3962 C CE    . MET C 1 66  ? 4.360   -5.137  -27.615 1.00 141.43 ? 113 MET C CE    1 
ATOM   3963 N N     . GLU C 1 67  ? 7.520   -0.635  -29.561 1.00 154.65 ? 114 GLU C N     1 
ATOM   3964 C CA    . GLU C 1 67  ? 7.538   0.833   -29.510 1.00 159.12 ? 114 GLU C CA    1 
ATOM   3965 C C     . GLU C 1 67  ? 8.545   1.480   -30.457 1.00 168.55 ? 114 GLU C C     1 
ATOM   3966 O O     . GLU C 1 67  ? 8.205   2.462   -31.118 1.00 173.47 ? 114 GLU C O     1 
ATOM   3967 C CB    . GLU C 1 67  ? 7.697   1.349   -28.076 1.00 158.38 ? 114 GLU C CB    1 
ATOM   3968 C CG    . GLU C 1 67  ? 6.381   1.370   -27.313 1.00 164.56 ? 114 GLU C CG    1 
ATOM   3969 C CD    . GLU C 1 67  ? 6.454   1.885   -25.890 1.00 181.18 ? 114 GLU C CD    1 
ATOM   3970 O OE1   . GLU C 1 67  ? 7.368   1.468   -25.142 1.00 178.95 ? 114 GLU C OE1   1 
ATOM   3971 O OE2   . GLU C 1 67  ? 5.570   2.684   -25.509 1.00 175.02 ? 114 GLU C OE2   1 
ATOM   3972 N N     . THR C 1 68  ? 9.763   0.905   -30.554 1.00 164.89 ? 115 THR C N     1 
ATOM   3973 C CA    . THR C 1 68  ? 10.817  1.378   -31.463 1.00 169.68 ? 115 THR C CA    1 
ATOM   3974 C C     . THR C 1 68  ? 10.460  1.066   -32.934 1.00 176.92 ? 115 THR C C     1 
ATOM   3975 O O     . THR C 1 68  ? 10.895  1.788   -33.836 1.00 178.22 ? 115 THR C O     1 
ATOM   3976 C CB    . THR C 1 68  ? 12.209  0.854   -31.050 1.00 171.85 ? 115 THR C CB    1 
ATOM   3977 O OG1   . THR C 1 68  ? 12.166  -0.563  -30.913 1.00 164.85 ? 115 THR C OG1   1 
ATOM   3978 C CG2   . THR C 1 68  ? 12.719  1.486   -29.757 1.00 168.54 ? 115 THR C CG2   1 
ATOM   3979 N N     . ASP C 1 69  ? 9.638   0.015   -33.161 1.00 169.40 ? 116 ASP C N     1 
ATOM   3980 C CA    . ASP C 1 69  ? 9.174   -0.401  -34.485 1.00 171.77 ? 116 ASP C CA    1 
ATOM   3981 C C     . ASP C 1 69  ? 7.965   0.405   -35.003 1.00 178.17 ? 116 ASP C C     1 
ATOM   3982 O O     . ASP C 1 69  ? 7.572   0.222   -36.157 1.00 179.13 ? 116 ASP C O     1 
ATOM   3983 C CB    . ASP C 1 69  ? 8.916   -1.925  -34.533 1.00 169.09 ? 116 ASP C CB    1 
ATOM   3984 C CG    . ASP C 1 69  ? 10.166  -2.796  -34.662 1.00 176.29 ? 116 ASP C CG    1 
ATOM   3985 O OD1   . ASP C 1 69  ? 11.186  -2.304  -35.202 1.00 180.33 ? 116 ASP C OD1   1 
ATOM   3986 O OD2   . ASP C 1 69  ? 10.109  -3.981  -34.260 1.00 174.19 ? 116 ASP C OD2   1 
ATOM   3987 N N     . GLY C 1 70  ? 7.412   1.297   -34.170 1.00 175.60 ? 117 GLY C N     1 
ATOM   3988 C CA    . GLY C 1 70  ? 6.303   2.169   -34.556 1.00 176.62 ? 117 GLY C CA    1 
ATOM   3989 C C     . GLY C 1 70  ? 5.131   2.297   -33.599 1.00 178.81 ? 117 GLY C C     1 
ATOM   3990 O O     . GLY C 1 70  ? 4.323   3.223   -33.736 1.00 178.25 ? 117 GLY C O     1 
ATOM   3991 N N     . CYS C 1 71  ? 5.023   1.371   -32.630 1.00 173.75 ? 118 CYS C N     1 
ATOM   3992 C CA    . CYS C 1 71  ? 3.939   1.326   -31.638 1.00 170.09 ? 118 CYS C CA    1 
ATOM   3993 C C     . CYS C 1 71  ? 3.919   2.505   -30.659 1.00 174.64 ? 118 CYS C C     1 
ATOM   3994 O O     . CYS C 1 71  ? 4.892   3.262   -30.559 1.00 176.79 ? 118 CYS C O     1 
ATOM   3995 C CB    . CYS C 1 71  ? 3.936   -0.009  -30.896 1.00 163.32 ? 118 CYS C CB    1 
ATOM   3996 S SG    . CYS C 1 71  ? 3.721   -1.456  -31.965 1.00 165.77 ? 118 CYS C SG    1 
ATOM   3997 N N     . SER C 1 72  ? 2.783   2.654   -29.949 1.00 168.87 ? 119 SER C N     1 
ATOM   3998 C CA    . SER C 1 72  ? 2.558   3.659   -28.908 1.00 168.85 ? 119 SER C CA    1 
ATOM   3999 C C     . SER C 1 72  ? 2.308   2.901   -27.602 1.00 164.80 ? 119 SER C C     1 
ATOM   4000 O O     . SER C 1 72  ? 2.046   1.697   -27.648 1.00 159.77 ? 119 SER C O     1 
ATOM   4001 C CB    . SER C 1 72  ? 1.370   4.557   -29.258 1.00 176.74 ? 119 SER C CB    1 
ATOM   4002 O OG    . SER C 1 72  ? 0.112   3.912   -29.125 1.00 182.59 ? 119 SER C OG    1 
ATOM   4003 N N     . GLU C 1 73  ? 2.381   3.595   -26.447 1.00 160.00 ? 120 GLU C N     1 
ATOM   4004 C CA    . GLU C 1 73  ? 2.171   3.009   -25.115 1.00 153.75 ? 120 GLU C CA    1 
ATOM   4005 C C     . GLU C 1 73  ? 0.878   2.196   -25.037 1.00 152.61 ? 120 GLU C C     1 
ATOM   4006 O O     . GLU C 1 73  ? 0.871   1.124   -24.433 1.00 146.63 ? 120 GLU C O     1 
ATOM   4007 C CB    . GLU C 1 73  ? 2.206   4.089   -24.020 1.00 156.79 ? 120 GLU C CB    1 
ATOM   4008 C CG    . GLU C 1 73  ? 3.528   4.835   -23.929 1.00 174.41 ? 120 GLU C CG    1 
ATOM   4009 C CD    . GLU C 1 73  ? 4.266   4.690   -22.613 1.00 195.06 ? 120 GLU C CD    1 
ATOM   4010 O OE1   . GLU C 1 73  ? 3.789   5.251   -21.599 1.00 193.43 ? 120 GLU C OE1   1 
ATOM   4011 O OE2   . GLU C 1 73  ? 5.341   4.048   -22.603 1.00 189.49 ? 120 GLU C OE2   1 
ATOM   4012 N N     . GLN C 1 74  ? -0.193  2.686   -25.693 1.00 152.93 ? 121 GLN C N     1 
ATOM   4013 C CA    . GLN C 1 74  ? -1.502  2.035   -25.749 1.00 151.54 ? 121 GLN C CA    1 
ATOM   4014 C C     . GLN C 1 74  ? -1.452  0.794   -26.649 1.00 154.74 ? 121 GLN C C     1 
ATOM   4015 O O     . GLN C 1 74  ? -2.000  -0.250  -26.277 1.00 150.48 ? 121 GLN C O     1 
ATOM   4016 C CB    . GLN C 1 74  ? -2.590  3.019   -26.214 1.00 158.32 ? 121 GLN C CB    1 
ATOM   4017 C CG    . GLN C 1 74  ? -2.683  4.286   -25.358 1.00 172.72 ? 121 GLN C CG    1 
ATOM   4018 C CD    . GLN C 1 74  ? -4.050  4.918   -25.393 1.00 190.53 ? 121 GLN C CD    1 
ATOM   4019 O OE1   . GLN C 1 74  ? -4.284  5.922   -26.086 1.00 188.54 ? 121 GLN C OE1   1 
ATOM   4020 N NE2   . GLN C 1 74  ? -4.975  4.360   -24.616 1.00 169.91 ? 121 GLN C NE2   1 
ATOM   4021 N N     . GLU C 1 75  ? -0.761  0.896   -27.806 1.00 154.51 ? 122 GLU C N     1 
ATOM   4022 C CA    . GLU C 1 75  ? -0.596  -0.202  -28.769 1.00 153.45 ? 122 GLU C CA    1 
ATOM   4023 C C     . GLU C 1 75  ? 0.295   -1.323  -28.220 1.00 151.82 ? 122 GLU C C     1 
ATOM   4024 O O     . GLU C 1 75  ? 0.113   -2.487  -28.585 1.00 149.15 ? 122 GLU C O     1 
ATOM   4025 C CB    . GLU C 1 75  ? -0.003  0.310   -30.093 1.00 160.37 ? 122 GLU C CB    1 
ATOM   4026 C CG    . GLU C 1 75  ? -0.936  1.193   -30.908 1.00 178.30 ? 122 GLU C CG    1 
ATOM   4027 C CD    . GLU C 1 75  ? -0.516  1.425   -32.348 1.00 196.59 ? 122 GLU C CD    1 
ATOM   4028 O OE1   . GLU C 1 75  ? -1.366  1.230   -33.246 1.00 193.59 ? 122 GLU C OE1   1 
ATOM   4029 O OE2   . GLU C 1 75  ? 0.657   1.798   -32.584 1.00 190.29 ? 122 GLU C OE2   1 
ATOM   4030 N N     . SER C 1 76  ? 1.267   -0.964  -27.360 1.00 146.34 ? 123 SER C N     1 
ATOM   4031 C CA    . SER C 1 76  ? 2.236   -1.888  -26.770 1.00 141.29 ? 123 SER C CA    1 
ATOM   4032 C C     . SER C 1 76  ? 1.826   -2.456  -25.410 1.00 139.43 ? 123 SER C C     1 
ATOM   4033 O O     . SER C 1 76  ? 2.506   -3.353  -24.922 1.00 135.54 ? 123 SER C O     1 
ATOM   4034 C CB    . SER C 1 76  ? 3.610   -1.232  -26.678 1.00 147.09 ? 123 SER C CB    1 
ATOM   4035 O OG    . SER C 1 76  ? 3.622   -0.148  -25.762 1.00 157.74 ? 123 SER C OG    1 
ATOM   4036 N N     . GLN C 1 77  ? 0.739   -1.946  -24.790 1.00 135.21 ? 124 GLN C N     1 
ATOM   4037 C CA    . GLN C 1 77  ? 0.283   -2.443  -23.490 1.00 129.55 ? 124 GLN C CA    1 
ATOM   4038 C C     . GLN C 1 77  ? -0.433  -3.801  -23.636 1.00 129.52 ? 124 GLN C C     1 
ATOM   4039 O O     . GLN C 1 77  ? -1.386  -3.900  -24.420 1.00 129.97 ? 124 GLN C O     1 
ATOM   4040 C CB    . GLN C 1 77  ? -0.600  -1.405  -22.763 1.00 131.71 ? 124 GLN C CB    1 
ATOM   4041 C CG    . GLN C 1 77  ? -1.201  -1.886  -21.428 1.00 129.24 ? 124 GLN C CG    1 
ATOM   4042 C CD    . GLN C 1 77  ? -0.234  -1.950  -20.268 1.00 135.81 ? 124 GLN C CD    1 
ATOM   4043 O OE1   . GLN C 1 77  ? 0.408   -0.959  -19.899 1.00 133.52 ? 124 GLN C OE1   1 
ATOM   4044 N NE2   . GLN C 1 77  ? -0.190  -3.097  -19.601 1.00 116.91 ? 124 GLN C NE2   1 
ATOM   4045 N N     . PRO C 1 78  ? 0.017   -4.854  -22.893 1.00 121.97 ? 125 PRO C N     1 
ATOM   4046 C CA    . PRO C 1 78  ? -0.664  -6.156  -22.971 1.00 118.72 ? 125 PRO C CA    1 
ATOM   4047 C C     . PRO C 1 78  ? -2.032  -6.069  -22.328 1.00 122.08 ? 125 PRO C C     1 
ATOM   4048 O O     . PRO C 1 78  ? -2.246  -5.262  -21.411 1.00 121.97 ? 125 PRO C O     1 
ATOM   4049 C CB    . PRO C 1 78  ? 0.239   -7.093  -22.164 1.00 116.46 ? 125 PRO C CB    1 
ATOM   4050 C CG    . PRO C 1 78  ? 1.486   -6.335  -21.902 1.00 122.25 ? 125 PRO C CG    1 
ATOM   4051 C CD    . PRO C 1 78  ? 1.122   -4.902  -21.917 1.00 121.26 ? 125 PRO C CD    1 
ATOM   4052 N N     . CYS C 1 79  ? -2.967  -6.868  -22.846 1.00 117.93 ? 126 CYS C N     1 
ATOM   4053 C CA    . CYS C 1 79  ? -4.344  -6.892  -22.368 1.00 116.95 ? 126 CYS C CA    1 
ATOM   4054 C C     . CYS C 1 79  ? -4.755  -8.289  -22.044 1.00 116.87 ? 126 CYS C C     1 
ATOM   4055 O O     . CYS C 1 79  ? -4.175  -9.247  -22.561 1.00 115.93 ? 126 CYS C O     1 
ATOM   4056 C CB    . CYS C 1 79  ? -5.287  -6.265  -23.385 1.00 121.35 ? 126 CYS C CB    1 
ATOM   4057 S SG    . CYS C 1 79  ? -4.664  -4.735  -24.103 1.00 130.18 ? 126 CYS C SG    1 
ATOM   4058 N N     . ALA C 1 80  ? -5.781  -8.404  -21.195 1.00 110.06 ? 127 ALA C N     1 
ATOM   4059 C CA    . ALA C 1 80  ? -6.301  -9.686  -20.781 1.00 105.29 ? 127 ALA C CA    1 
ATOM   4060 C C     . ALA C 1 80  ? -7.784  -9.612  -20.462 1.00 106.16 ? 127 ALA C C     1 
ATOM   4061 O O     . ALA C 1 80  ? -8.285  -8.610  -19.954 1.00 104.41 ? 127 ALA C O     1 
ATOM   4062 C CB    . ALA C 1 80  ? -5.514  -10.211 -19.591 1.00 101.88 ? 127 ALA C CB    1 
ATOM   4063 N N     . PHE C 1 81  ? -8.473  -10.691 -20.821 1.00 102.10 ? 128 PHE C N     1 
ATOM   4064 C CA    . PHE C 1 81  ? -9.884  -10.973 -20.594 1.00 101.87 ? 128 PHE C CA    1 
ATOM   4065 C C     . PHE C 1 81  ? -9.918  -12.330 -19.918 1.00 103.49 ? 128 PHE C C     1 
ATOM   4066 O O     . PHE C 1 81  ? -9.108  -13.205 -20.254 1.00 105.18 ? 128 PHE C O     1 
ATOM   4067 C CB    . PHE C 1 81  ? -10.640 -11.010 -21.919 1.00 107.27 ? 128 PHE C CB    1 
ATOM   4068 C CG    . PHE C 1 81  ? -10.935 -9.623  -22.415 1.00 112.24 ? 128 PHE C CG    1 
ATOM   4069 C CD1   . PHE C 1 81  ? -9.960  -8.879  -23.071 1.00 116.59 ? 128 PHE C CD1   1 
ATOM   4070 C CD2   . PHE C 1 81  ? -12.179 -9.044  -22.203 1.00 116.35 ? 128 PHE C CD2   1 
ATOM   4071 C CE1   . PHE C 1 81  ? -10.218 -7.577  -23.491 1.00 121.11 ? 128 PHE C CE1   1 
ATOM   4072 C CE2   . PHE C 1 81  ? -12.443 -7.746  -22.639 1.00 122.69 ? 128 PHE C CE2   1 
ATOM   4073 C CZ    . PHE C 1 81  ? -11.453 -7.015  -23.261 1.00 122.56 ? 128 PHE C CZ    1 
ATOM   4074 N N     . ILE C 1 82  ? -10.789 -12.493 -18.925 1.00 94.97  ? 129 ILE C N     1 
ATOM   4075 C CA    . ILE C 1 82  ? -10.850 -13.736 -18.157 1.00 89.56  ? 129 ILE C CA    1 
ATOM   4076 C C     . ILE C 1 82  ? -12.250 -14.293 -18.120 1.00 93.85  ? 129 ILE C C     1 
ATOM   4077 O O     . ILE C 1 82  ? -13.217 -13.542 -18.034 1.00 96.95  ? 129 ILE C O     1 
ATOM   4078 C CB    . ILE C 1 82  ? -10.216 -13.548 -16.757 1.00 88.12  ? 129 ILE C CB    1 
ATOM   4079 C CG1   . ILE C 1 82  ? -10.111 -14.881 -15.976 1.00 85.02  ? 129 ILE C CG1   1 
ATOM   4080 C CG2   . ILE C 1 82  ? -10.896 -12.428 -15.964 1.00 87.59  ? 129 ILE C CG2   1 
ATOM   4081 C CD1   . ILE C 1 82  ? -9.019  -14.946 -14.959 1.00 83.16  ? 129 ILE C CD1   1 
ATOM   4082 N N     . GLY C 1 83  ? -12.344 -15.601 -18.212 1.00 87.57  ? 130 GLY C N     1 
ATOM   4083 C CA    . GLY C 1 83  ? -13.622 -16.277 -18.174 1.00 88.53  ? 130 GLY C CA    1 
ATOM   4084 C C     . GLY C 1 83  ? -13.539 -17.682 -17.635 1.00 91.82  ? 130 GLY C C     1 
ATOM   4085 O O     . GLY C 1 83  ? -12.489 -18.119 -17.162 1.00 87.19  ? 130 GLY C O     1 
ATOM   4086 N N     . ILE C 1 84  ? -14.669 -18.386 -17.722 1.00 93.44  ? 131 ILE C N     1 
ATOM   4087 C CA    . ILE C 1 84  ? -14.881 -19.762 -17.291 1.00 93.87  ? 131 ILE C CA    1 
ATOM   4088 C C     . ILE C 1 84  ? -15.032 -20.651 -18.573 1.00 109.16 ? 131 ILE C C     1 
ATOM   4089 O O     . ILE C 1 84  ? -15.534 -20.153 -19.592 1.00 112.89 ? 131 ILE C O     1 
ATOM   4090 C CB    . ILE C 1 84  ? -16.117 -19.709 -16.361 1.00 95.58  ? 131 ILE C CB    1 
ATOM   4091 C CG1   . ILE C 1 84  ? -15.711 -19.129 -15.001 1.00 91.30  ? 131 ILE C CG1   1 
ATOM   4092 C CG2   . ILE C 1 84  ? -16.796 -21.056 -16.205 1.00 98.53  ? 131 ILE C CG2   1 
ATOM   4093 C CD1   . ILE C 1 84  ? -16.793 -19.110 -14.016 1.00 96.40  ? 131 ILE C CD1   1 
ATOM   4094 N N     . GLY C 1 85  ? -14.544 -21.903 -18.516 1.00 109.71 ? 132 GLY C N     1 
ATOM   4095 C CA    . GLY C 1 85  ? -14.526 -22.881 -19.613 1.00 114.76 ? 132 GLY C CA    1 
ATOM   4096 C C     . GLY C 1 85  ? -15.698 -22.910 -20.594 1.00 129.03 ? 132 GLY C C     1 
ATOM   4097 O O     . GLY C 1 85  ? -16.426 -23.909 -20.671 1.00 130.97 ? 132 GLY C O     1 
ATOM   4098 N N     . ASN C 1 86  ? -15.826 -21.836 -21.418 1.00 130.86 ? 133 ASN C N     1 
ATOM   4099 C CA    . ASN C 1 86  ? -16.895 -21.543 -22.390 1.00 136.55 ? 133 ASN C CA    1 
ATOM   4100 C C     . ASN C 1 86  ? -18.096 -20.916 -21.670 1.00 142.44 ? 133 ASN C C     1 
ATOM   4101 O O     . ASN C 1 86  ? -18.426 -19.754 -21.938 1.00 143.39 ? 133 ASN C O     1 
ATOM   4102 C CB    . ASN C 1 86  ? -17.289 -22.752 -23.264 1.00 142.05 ? 133 ASN C CB    1 
ATOM   4103 C CG    . ASN C 1 86  ? -16.504 -22.890 -24.548 1.00 166.96 ? 133 ASN C CG    1 
ATOM   4104 O OD1   . ASN C 1 86  ? -17.084 -23.037 -25.631 1.00 161.94 ? 133 ASN C OD1   1 
ATOM   4105 N ND2   . ASN C 1 86  ? -15.171 -22.878 -24.460 1.00 156.12 ? 133 ASN C ND2   1 
ATOM   4106 N N     . SER C 1 87  ? -18.726 -21.687 -20.741 1.00 138.89 ? 134 SER C N     1 
ATOM   4107 C CA    . SER C 1 87  ? -19.848 -21.335 -19.854 1.00 139.34 ? 134 SER C CA    1 
ATOM   4108 C C     . SER C 1 87  ? -21.055 -20.552 -20.413 1.00 149.46 ? 134 SER C C     1 
ATOM   4109 O O     . SER C 1 87  ? -21.979 -20.270 -19.631 1.00 149.54 ? 134 SER C O     1 
ATOM   4110 C CB    . SER C 1 87  ? -19.326 -20.613 -18.615 1.00 138.71 ? 134 SER C CB    1 
ATOM   4111 O OG    . SER C 1 87  ? -18.689 -19.388 -18.945 1.00 146.56 ? 134 SER C OG    1 
ATOM   4112 N N     . ASP C 1 88  ? -21.041 -20.160 -21.728 1.00 149.77 ? 135 ASP C N     1 
ATOM   4113 C CA    . ASP C 1 88  ? -22.062 -19.317 -22.387 1.00 153.61 ? 135 ASP C CA    1 
ATOM   4114 C C     . ASP C 1 88  ? -22.050 -17.865 -21.797 1.00 153.90 ? 135 ASP C C     1 
ATOM   4115 O O     . ASP C 1 88  ? -22.633 -16.956 -22.390 1.00 156.97 ? 135 ASP C O     1 
ATOM   4116 C CB    . ASP C 1 88  ? -23.458 -19.983 -22.367 1.00 158.78 ? 135 ASP C CB    1 
ATOM   4117 C CG    . ASP C 1 88  ? -24.556 -19.199 -23.047 1.00 175.80 ? 135 ASP C CG    1 
ATOM   4118 O OD1   . ASP C 1 88  ? -24.705 -19.335 -24.281 1.00 181.43 ? 135 ASP C OD1   1 
ATOM   4119 O OD2   . ASP C 1 88  ? -25.276 -18.461 -22.344 1.00 181.84 ? 135 ASP C OD2   1 
ATOM   4120 N N     . GLN C 1 89  ? -21.330 -17.667 -20.651 1.00 143.53 ? 136 GLN C N     1 
ATOM   4121 C CA    . GLN C 1 89  ? -21.093 -16.397 -19.938 1.00 140.13 ? 136 GLN C CA    1 
ATOM   4122 C C     . GLN C 1 89  ? -19.989 -15.636 -20.709 1.00 141.65 ? 136 GLN C C     1 
ATOM   4123 O O     . GLN C 1 89  ? -19.106 -16.276 -21.288 1.00 141.22 ? 136 GLN C O     1 
ATOM   4124 C CB    . GLN C 1 89  ? -20.619 -16.649 -18.472 1.00 135.85 ? 136 GLN C CB    1 
ATOM   4125 C CG    . GLN C 1 89  ? -21.549 -17.516 -17.584 1.00 134.09 ? 136 GLN C CG    1 
ATOM   4126 C CD    . GLN C 1 89  ? -21.098 -17.670 -16.131 1.00 122.85 ? 136 GLN C CD    1 
ATOM   4127 O OE1   . GLN C 1 89  ? -20.687 -16.708 -15.475 1.00 114.27 ? 136 GLN C OE1   1 
ATOM   4128 N NE2   . GLN C 1 89  ? -21.252 -18.873 -15.561 1.00 94.57  ? 136 GLN C NE2   1 
ATOM   4129 N N     . GLU C 1 90  ? -20.035 -14.290 -20.714 1.00 136.32 ? 137 GLU C N     1 
ATOM   4130 C CA    . GLU C 1 90  ? -19.046 -13.453 -21.413 1.00 135.52 ? 137 GLU C CA    1 
ATOM   4131 C C     . GLU C 1 90  ? -17.806 -13.153 -20.576 1.00 131.94 ? 137 GLU C C     1 
ATOM   4132 O O     . GLU C 1 90  ? -17.903 -12.964 -19.362 1.00 129.63 ? 137 GLU C O     1 
ATOM   4133 C CB    . GLU C 1 90  ? -19.668 -12.153 -21.936 1.00 141.28 ? 137 GLU C CB    1 
ATOM   4134 C CG    . GLU C 1 90  ? -20.436 -11.362 -20.887 1.00 151.73 ? 137 GLU C CG    1 
ATOM   4135 C CD    . GLU C 1 90  ? -20.850 -9.966  -21.302 1.00 174.62 ? 137 GLU C CD    1 
ATOM   4136 O OE1   . GLU C 1 90  ? -21.277 -9.779  -22.466 1.00 162.03 ? 137 GLU C OE1   1 
ATOM   4137 O OE2   . GLU C 1 90  ? -20.766 -9.060  -20.442 1.00 168.06 ? 137 GLU C OE2   1 
ATOM   4138 N N     . MET C 1 91  ? -16.644 -13.090 -21.240 1.00 124.51 ? 138 MET C N     1 
ATOM   4139 C CA    . MET C 1 91  ? -15.348 -12.819 -20.616 1.00 118.63 ? 138 MET C CA    1 
ATOM   4140 C C     . MET C 1 91  ? -15.252 -11.415 -20.030 1.00 119.21 ? 138 MET C C     1 
ATOM   4141 O O     . MET C 1 91  ? -15.842 -10.477 -20.582 1.00 122.56 ? 138 MET C O     1 
ATOM   4142 C CB    . MET C 1 91  ? -14.217 -13.058 -21.617 1.00 121.15 ? 138 MET C CB    1 
ATOM   4143 C CG    . MET C 1 91  ? -13.841 -14.506 -21.748 1.00 122.36 ? 138 MET C CG    1 
ATOM   4144 S SD    . MET C 1 91  ? -12.483 -14.678 -22.902 1.00 126.98 ? 138 MET C SD    1 
ATOM   4145 C CE    . MET C 1 91  ? -11.457 -15.780 -21.997 1.00 118.85 ? 138 MET C CE    1 
ATOM   4146 N N     . GLN C 1 92  ? -14.503 -11.280 -18.913 1.00 108.92 ? 139 GLN C N     1 
ATOM   4147 C CA    . GLN C 1 92  ? -14.312 -10.023 -18.182 1.00 107.00 ? 139 GLN C CA    1 
ATOM   4148 C C     . GLN C 1 92  ? -12.928 -9.400  -18.381 1.00 107.93 ? 139 GLN C C     1 
ATOM   4149 O O     . GLN C 1 92  ? -11.929 -10.076 -18.180 1.00 105.31 ? 139 GLN C O     1 
ATOM   4150 C CB    . GLN C 1 92  ? -14.610 -10.227 -16.692 1.00 104.63 ? 139 GLN C CB    1 
ATOM   4151 C CG    . GLN C 1 92  ? -16.105 -10.319 -16.367 1.00 108.80 ? 139 GLN C CG    1 
ATOM   4152 C CD    . GLN C 1 92  ? -16.373 -10.722 -14.928 1.00 123.79 ? 139 GLN C CD    1 
ATOM   4153 O OE1   . GLN C 1 92  ? -15.821 -10.160 -13.964 1.00 115.90 ? 139 GLN C OE1   1 
ATOM   4154 N NE2   . GLN C 1 92  ? -17.251 -11.700 -14.748 1.00 111.82 ? 139 GLN C NE2   1 
ATOM   4155 N N     . GLN C 1 93  ? -12.875 -8.108  -18.774 1.00 105.77 ? 140 GLN C N     1 
ATOM   4156 C CA    . GLN C 1 93  ? -11.639 -7.349  -19.009 1.00 105.32 ? 140 GLN C CA    1 
ATOM   4157 C C     . GLN C 1 93  ? -10.909 -7.080  -17.720 1.00 105.02 ? 140 GLN C C     1 
ATOM   4158 O O     . GLN C 1 93  ? -11.525 -6.659  -16.750 1.00 105.34 ? 140 GLN C O     1 
ATOM   4159 C CB    . GLN C 1 93  ? -11.943 -6.002  -19.697 1.00 111.29 ? 140 GLN C CB    1 
ATOM   4160 C CG    . GLN C 1 93  ? -10.709 -5.144  -20.075 1.00 128.72 ? 140 GLN C CG    1 
ATOM   4161 C CD    . GLN C 1 93  ? -10.897 -3.650  -19.807 1.00 151.61 ? 140 GLN C CD    1 
ATOM   4162 O OE1   . GLN C 1 93  ? -11.918 -3.035  -20.172 1.00 142.41 ? 140 GLN C OE1   1 
ATOM   4163 N NE2   . GLN C 1 93  ? -9.898  -3.023  -19.176 1.00 144.95 ? 140 GLN C NE2   1 
ATOM   4164 N N     . LEU C 1 94  ? -9.596  -7.289  -17.723 1.00 98.51  ? 141 LEU C N     1 
ATOM   4165 C CA    . LEU C 1 94  ? -8.722  -6.967  -16.608 1.00 95.57  ? 141 LEU C CA    1 
ATOM   4166 C C     . LEU C 1 94  ? -7.948  -5.696  -16.984 1.00 105.03 ? 141 LEU C C     1 
ATOM   4167 O O     . LEU C 1 94  ? -7.589  -5.508  -18.153 1.00 106.98 ? 141 LEU C O     1 
ATOM   4168 C CB    . LEU C 1 94  ? -7.717  -8.101  -16.334 1.00 91.40  ? 141 LEU C CB    1 
ATOM   4169 C CG    . LEU C 1 94  ? -8.254  -9.475  -15.943 1.00 91.48  ? 141 LEU C CG    1 
ATOM   4170 C CD1   . LEU C 1 94  ? -7.133  -10.497 -15.925 1.00 87.89  ? 141 LEU C CD1   1 
ATOM   4171 C CD2   . LEU C 1 94  ? -9.004  -9.445  -14.616 1.00 89.52  ? 141 LEU C CD2   1 
ATOM   4172 N N     . ASN C 1 95  ? -7.665  -4.839  -15.996 1.00 103.58 ? 142 ASN C N     1 
ATOM   4173 C CA    . ASN C 1 95  ? -6.865  -3.646  -16.242 1.00 106.81 ? 142 ASN C CA    1 
ATOM   4174 C C     . ASN C 1 95  ? -5.397  -3.801  -15.767 1.00 107.79 ? 142 ASN C C     1 
ATOM   4175 O O     . ASN C 1 95  ? -5.087  -3.604  -14.577 1.00 106.06 ? 142 ASN C O     1 
ATOM   4176 C CB    . ASN C 1 95  ? -7.527  -2.382  -15.695 1.00 112.04 ? 142 ASN C CB    1 
ATOM   4177 C CG    . ASN C 1 95  ? -6.821  -1.138  -16.167 1.00 151.68 ? 142 ASN C CG    1 
ATOM   4178 O OD1   . ASN C 1 95  ? -6.824  -0.804  -17.361 1.00 154.43 ? 142 ASN C OD1   1 
ATOM   4179 N ND2   . ASN C 1 95  ? -6.141  -0.468  -15.252 1.00 143.75 ? 142 ASN C ND2   1 
ATOM   4180 N N     . LEU C 1 96  ? -4.502  -4.162  -16.716 1.00 102.82 ? 143 LEU C N     1 
ATOM   4181 C CA    . LEU C 1 96  ? -3.058  -4.296  -16.464 1.00 101.09 ? 143 LEU C CA    1 
ATOM   4182 C C     . LEU C 1 96  ? -2.321  -2.966  -16.757 1.00 112.22 ? 143 LEU C C     1 
ATOM   4183 O O     . LEU C 1 96  ? -1.084  -2.969  -16.859 1.00 113.34 ? 143 LEU C O     1 
ATOM   4184 C CB    . LEU C 1 96  ? -2.433  -5.417  -17.312 1.00 98.44  ? 143 LEU C CB    1 
ATOM   4185 C CG    . LEU C 1 96  ? -2.962  -6.827  -17.114 1.00 97.58  ? 143 LEU C CG    1 
ATOM   4186 C CD1   . LEU C 1 96  ? -2.954  -7.578  -18.431 1.00 97.56  ? 143 LEU C CD1   1 
ATOM   4187 C CD2   . LEU C 1 96  ? -2.194  -7.563  -16.016 1.00 92.74  ? 143 LEU C CD2   1 
ATOM   4188 N N     . GLU C 1 97  ? -3.077  -1.840  -16.901 1.00 111.86 ? 144 GLU C N     1 
ATOM   4189 C CA    . GLU C 1 97  ? -2.523  -0.520  -17.209 1.00 116.38 ? 144 GLU C CA    1 
ATOM   4190 C C     . GLU C 1 97  ? -1.511  -0.052  -16.154 1.00 121.35 ? 144 GLU C C     1 
ATOM   4191 O O     . GLU C 1 97  ? -1.899  0.342   -15.047 1.00 120.68 ? 144 GLU C O     1 
ATOM   4192 C CB    . GLU C 1 97  ? -3.643  0.516   -17.420 1.00 121.35 ? 144 GLU C CB    1 
ATOM   4193 C CG    . GLU C 1 97  ? -4.084  0.702   -18.864 1.00 133.16 ? 144 GLU C CG    1 
ATOM   4194 C CD    . GLU C 1 97  ? -5.018  1.884   -19.081 1.00 159.69 ? 144 GLU C CD    1 
ATOM   4195 O OE1   . GLU C 1 97  ? -6.174  1.826   -18.601 1.00 158.12 ? 144 GLU C OE1   1 
ATOM   4196 O OE2   . GLU C 1 97  ? -4.596  2.867   -19.736 1.00 147.75 ? 144 GLU C OE2   1 
ATOM   4197 N N     . GLY C 1 98  ? -0.227  -0.138  -16.514 1.00 119.45 ? 145 GLY C N     1 
ATOM   4198 C CA    . GLY C 1 98  ? 0.899   0.222   -15.654 1.00 120.42 ? 145 GLY C CA    1 
ATOM   4199 C C     . GLY C 1 98  ? 0.953   -0.617  -14.390 1.00 122.02 ? 145 GLY C C     1 
ATOM   4200 O O     . GLY C 1 98  ? 1.214   -0.100  -13.298 1.00 122.63 ? 145 GLY C O     1 
ATOM   4201 N N     . LYS C 1 99  ? 0.653   -1.913  -14.538 1.00 115.01 ? 146 LYS C N     1 
ATOM   4202 C CA    . LYS C 1 99  ? 0.587   -2.898  -13.459 1.00 111.11 ? 146 LYS C CA    1 
ATOM   4203 C C     . LYS C 1 99  ? 1.078   -4.226  -14.001 1.00 110.39 ? 146 LYS C C     1 
ATOM   4204 O O     . LYS C 1 99  ? 0.803   -4.549  -15.160 1.00 111.08 ? 146 LYS C O     1 
ATOM   4205 C CB    . LYS C 1 99  ? -0.879  -3.056  -12.983 1.00 112.82 ? 146 LYS C CB    1 
ATOM   4206 C CG    . LYS C 1 99  ? -1.353  -1.988  -12.010 1.00 122.07 ? 146 LYS C CG    1 
ATOM   4207 C CD    . LYS C 1 99  ? -2.746  -1.522  -12.337 1.00 133.93 ? 146 LYS C CD    1 
ATOM   4208 C CE    . LYS C 1 99  ? -2.951  -0.122  -11.797 1.00 148.04 ? 146 LYS C CE    1 
ATOM   4209 N NZ    . LYS C 1 99  ? -4.093  0.571   -12.447 1.00 153.93 ? 146 LYS C NZ    1 
ATOM   4210 N N     . ASN C 1 100 ? 1.798   -5.000  -13.185 1.00 102.35 ? 147 ASN C N     1 
ATOM   4211 C CA    . ASN C 1 100 ? 2.279   -6.309  -13.648 1.00 98.76  ? 147 ASN C CA    1 
ATOM   4212 C C     . ASN C 1 100 ? 1.162   -7.311  -13.438 1.00 98.40  ? 147 ASN C C     1 
ATOM   4213 O O     . ASN C 1 100 ? 1.169   -8.380  -14.048 1.00 97.25  ? 147 ASN C O     1 
ATOM   4214 C CB    . ASN C 1 100 ? 3.549   -6.785  -12.919 1.00 95.37  ? 147 ASN C CB    1 
ATOM   4215 C CG    . ASN C 1 100 ? 4.334   -5.710  -12.232 1.00 129.67 ? 147 ASN C CG    1 
ATOM   4216 O OD1   . ASN C 1 100 ? 5.252   -5.119  -12.816 1.00 129.71 ? 147 ASN C OD1   1 
ATOM   4217 N ND2   . ASN C 1 100 ? 3.978   -5.428  -10.975 1.00 123.27 ? 147 ASN C ND2   1 
ATOM   4218 N N     . TYR C 1 101 ? 0.192   -6.959  -12.590 1.00 92.29  ? 148 TYR C N     1 
ATOM   4219 C CA    . TYR C 1 101 ? -0.908  -7.851  -12.287 1.00 88.99  ? 148 TYR C CA    1 
ATOM   4220 C C     . TYR C 1 101 ? -2.274  -7.182  -12.298 1.00 91.97  ? 148 TYR C C     1 
ATOM   4221 O O     . TYR C 1 101 ? -2.379  -5.957  -12.255 1.00 92.15  ? 148 TYR C O     1 
ATOM   4222 C CB    . TYR C 1 101 ? -0.665  -8.512  -10.913 1.00 88.45  ? 148 TYR C CB    1 
ATOM   4223 C CG    . TYR C 1 101 ? -0.740  -7.556  -9.734  1.00 91.07  ? 148 TYR C CG    1 
ATOM   4224 C CD1   . TYR C 1 101 ? -1.953  -7.277  -9.114  1.00 92.37  ? 148 TYR C CD1   1 
ATOM   4225 C CD2   . TYR C 1 101 ? 0.410   -6.970  -9.210  1.00 93.42  ? 148 TYR C CD2   1 
ATOM   4226 C CE1   . TYR C 1 101 ? -2.030  -6.401  -8.034  1.00 94.87  ? 148 TYR C CE1   1 
ATOM   4227 C CE2   . TYR C 1 101 ? 0.348   -6.105  -8.120  1.00 96.04  ? 148 TYR C CE2   1 
ATOM   4228 C CZ    . TYR C 1 101 ? -0.879  -5.812  -7.540  1.00 105.20 ? 148 TYR C CZ    1 
ATOM   4229 O OH    . TYR C 1 101 ? -0.975  -4.944  -6.470  1.00 108.04 ? 148 TYR C OH    1 
ATOM   4230 N N     . CYS C 1 102 ? -3.320  -8.023  -12.308 1.00 87.34  ? 149 CYS C N     1 
ATOM   4231 C CA    . CYS C 1 102 ? -4.712  -7.655  -12.125 1.00 87.87  ? 149 CYS C CA    1 
ATOM   4232 C C     . CYS C 1 102 ? -5.530  -8.793  -11.540 1.00 87.24  ? 149 CYS C C     1 
ATOM   4233 O O     . CYS C 1 102 ? -5.306  -9.959  -11.871 1.00 83.22  ? 149 CYS C O     1 
ATOM   4234 C CB    . CYS C 1 102 ? -5.365  -7.066  -13.367 1.00 91.46  ? 149 CYS C CB    1 
ATOM   4235 S SG    . CYS C 1 102 ? -6.991  -6.316  -13.040 1.00 97.41  ? 149 CYS C SG    1 
ATOM   4236 N N     . THR C 1 103 ? -6.497  -8.438  -10.675 1.00 83.92  ? 150 THR C N     1 
ATOM   4237 C CA    . THR C 1 103 ? -7.377  -9.415  -10.057 1.00 81.26  ? 150 THR C CA    1 
ATOM   4238 C C     . THR C 1 103 ? -8.765  -9.363  -10.663 1.00 84.44  ? 150 THR C C     1 
ATOM   4239 O O     . THR C 1 103 ? -9.254  -8.291  -11.013 1.00 84.64  ? 150 THR C O     1 
ATOM   4240 C CB    . THR C 1 103 ? -7.381  -9.312  -8.536  1.00 86.51  ? 150 THR C CB    1 
ATOM   4241 O OG1   . THR C 1 103 ? -8.031  -8.099  -8.099  1.00 86.41  ? 150 THR C OG1   1 
ATOM   4242 C CG2   . THR C 1 103 ? -5.996  -9.503  -7.936  1.00 80.06  ? 150 THR C CG2   1 
ATOM   4243 N N     . ALA C 1 104 ? -9.357  -10.549 -10.822 1.00 79.34  ? 151 ALA C N     1 
ATOM   4244 C CA    . ALA C 1 104 ? -10.680 -10.786 -11.363 1.00 80.07  ? 151 ALA C CA    1 
ATOM   4245 C C     . ALA C 1 104 ? -11.679 -10.771 -10.182 1.00 83.98  ? 151 ALA C C     1 
ATOM   4246 O O     . ALA C 1 104 ? -12.133 -11.805 -9.635  1.00 83.13  ? 151 ALA C O     1 
ATOM   4247 C CB    . ALA C 1 104 ? -10.699 -12.117 -12.114 1.00 79.76  ? 151 ALA C CB    1 
ATOM   4248 N N     . LYS C 1 105 ? -11.997 -9.548  -9.792  1.00 80.78  ? 152 LYS C N     1 
ATOM   4249 C CA    . LYS C 1 105 ? -12.878 -9.233  -8.683  1.00 79.60  ? 152 LYS C CA    1 
ATOM   4250 C C     . LYS C 1 105 ? -14.312 -9.703  -8.894  1.00 86.71  ? 152 LYS C C     1 
ATOM   4251 O O     . LYS C 1 105 ? -15.035 -9.831  -7.903  1.00 88.30  ? 152 LYS C O     1 
ATOM   4252 C CB    . LYS C 1 105 ? -12.866 -7.719  -8.422  1.00 81.64  ? 152 LYS C CB    1 
ATOM   4253 C CG    . LYS C 1 105 ? -11.540 -7.182  -7.942  1.00 90.55  ? 152 LYS C CG    1 
ATOM   4254 C CD    . LYS C 1 105 ? -11.336 -5.727  -8.331  1.00 97.15  ? 152 LYS C CD    1 
ATOM   4255 C CE    . LYS C 1 105 ? -9.876  -5.375  -8.532  1.00 108.61 ? 152 LYS C CE    1 
ATOM   4256 N NZ    . LYS C 1 105 ? -9.297  -5.932  -9.794  1.00 112.77 ? 152 LYS C NZ    1 
ATOM   4257 N N     . THR C 1 106 ? -14.751 -9.932  -10.154 1.00 83.77  ? 153 THR C N     1 
ATOM   4258 C CA    . THR C 1 106 ? -16.171 -10.238 -10.412 1.00 84.70  ? 153 THR C CA    1 
ATOM   4259 C C     . THR C 1 106 ? -16.573 -11.498 -11.188 1.00 86.83  ? 153 THR C C     1 
ATOM   4260 O O     . THR C 1 106 ? -17.543 -11.449 -11.949 1.00 88.36  ? 153 THR C O     1 
ATOM   4261 C CB    . THR C 1 106 ? -16.891 -8.982  -10.918 1.00 97.88  ? 153 THR C CB    1 
ATOM   4262 O OG1   . THR C 1 106 ? -16.171 -8.444  -12.037 1.00 97.57  ? 153 THR C OG1   1 
ATOM   4263 C CG2   . THR C 1 106 ? -17.060 -7.931  -9.832  1.00 98.03  ? 153 THR C CG2   1 
ATOM   4264 N N     . LEU C 1 107 ? -15.888 -12.633 -10.950 1.00 80.59  ? 154 LEU C N     1 
ATOM   4265 C CA    . LEU C 1 107 ? -16.210 -13.909 -11.601 1.00 79.58  ? 154 LEU C CA    1 
ATOM   4266 C C     . LEU C 1 107 ? -17.161 -14.720 -10.761 1.00 85.65  ? 154 LEU C C     1 
ATOM   4267 O O     . LEU C 1 107 ? -17.134 -14.608 -9.537  1.00 84.87  ? 154 LEU C O     1 
ATOM   4268 C CB    . LEU C 1 107 ? -14.964 -14.746 -11.860 1.00 76.81  ? 154 LEU C CB    1 
ATOM   4269 C CG    . LEU C 1 107 ? -13.965 -14.225 -12.851 1.00 80.86  ? 154 LEU C CG    1 
ATOM   4270 C CD1   . LEU C 1 107 ? -12.717 -15.024 -12.762 1.00 78.04  ? 154 LEU C CD1   1 
ATOM   4271 C CD2   . LEU C 1 107 ? -14.521 -14.237 -14.277 1.00 84.45  ? 154 LEU C CD2   1 
ATOM   4272 N N     . TYR C 1 108 ? -17.979 -15.570 -11.409 1.00 84.57  ? 155 TYR C N     1 
ATOM   4273 C CA    . TYR C 1 108 ? -18.938 -16.448 -10.734 1.00 84.14  ? 155 TYR C CA    1 
ATOM   4274 C C     . TYR C 1 108 ? -19.390 -17.565 -11.649 1.00 92.19  ? 155 TYR C C     1 
ATOM   4275 O O     . TYR C 1 108 ? -19.390 -17.380 -12.872 1.00 93.63  ? 155 TYR C O     1 
ATOM   4276 C CB    . TYR C 1 108 ? -20.145 -15.636 -10.233 1.00 85.79  ? 155 TYR C CB    1 
ATOM   4277 C CG    . TYR C 1 108 ? -21.089 -15.153 -11.314 1.00 90.18  ? 155 TYR C CG    1 
ATOM   4278 C CD1   . TYR C 1 108 ? -20.761 -14.068 -12.120 1.00 93.96  ? 155 TYR C CD1   1 
ATOM   4279 C CD2   . TYR C 1 108 ? -22.338 -15.743 -11.490 1.00 92.23  ? 155 TYR C CD2   1 
ATOM   4280 C CE1   . TYR C 1 108 ? -21.623 -13.628 -13.124 1.00 98.61  ? 155 TYR C CE1   1 
ATOM   4281 C CE2   . TYR C 1 108 ? -23.212 -15.303 -12.480 1.00 96.45  ? 155 TYR C CE2   1 
ATOM   4282 C CZ    . TYR C 1 108 ? -22.854 -14.241 -13.293 1.00 106.29 ? 155 TYR C CZ    1 
ATOM   4283 O OH    . TYR C 1 108 ? -23.739 -13.775 -14.244 1.00 111.91 ? 155 TYR C OH    1 
ATOM   4284 N N     . ILE C 1 109 ? -19.780 -18.724 -11.068 1.00 90.66  ? 156 ILE C N     1 
ATOM   4285 C CA    . ILE C 1 109 ? -20.323 -19.855 -11.848 1.00 92.84  ? 156 ILE C CA    1 
ATOM   4286 C C     . ILE C 1 109 ? -21.812 -19.868 -11.656 1.00 101.86 ? 156 ILE C C     1 
ATOM   4287 O O     . ILE C 1 109 ? -22.278 -19.795 -10.525 1.00 100.73 ? 156 ILE C O     1 
ATOM   4288 C CB    . ILE C 1 109 ? -19.701 -21.251 -11.569 1.00 94.03  ? 156 ILE C CB    1 
ATOM   4289 C CG1   . ILE C 1 109 ? -18.551 -21.185 -10.578 1.00 91.08  ? 156 ILE C CG1   1 
ATOM   4290 C CG2   . ILE C 1 109 ? -19.278 -21.971 -12.880 1.00 95.84  ? 156 ILE C CG2   1 
ATOM   4291 C CD1   . ILE C 1 109 ? -18.890 -21.729 -9.298  1.00 98.79  ? 156 ILE C CD1   1 
ATOM   4292 N N     . SER C 1 110 ? -22.576 -19.918 -12.738 1.00 105.23 ? 157 SER C N     1 
ATOM   4293 C CA    . SER C 1 110 ? -24.021 -19.884 -12.544 1.00 108.97 ? 157 SER C CA    1 
ATOM   4294 C C     . SER C 1 110 ? -24.683 -21.247 -12.410 1.00 118.86 ? 157 SER C C     1 
ATOM   4295 O O     . SER C 1 110 ? -24.022 -22.295 -12.474 1.00 115.36 ? 157 SER C O     1 
ATOM   4296 C CB    . SER C 1 110 ? -24.710 -18.998 -13.577 1.00 113.91 ? 157 SER C CB    1 
ATOM   4297 O OG    . SER C 1 110 ? -24.036 -19.068 -14.820 1.00 124.72 ? 157 SER C OG    1 
ATOM   4298 N N     . ASP C 1 111 ? -26.005 -21.206 -12.152 1.00 123.26 ? 158 ASP C N     1 
ATOM   4299 C CA    . ASP C 1 111 ? -26.868 -22.372 -12.060 1.00 127.10 ? 158 ASP C CA    1 
ATOM   4300 C C     . ASP C 1 111 ? -26.872 -23.015 -13.468 1.00 137.56 ? 158 ASP C C     1 
ATOM   4301 O O     . ASP C 1 111 ? -26.741 -24.243 -13.591 1.00 137.64 ? 158 ASP C O     1 
ATOM   4302 C CB    . ASP C 1 111 ? -28.281 -21.929 -11.650 1.00 131.57 ? 158 ASP C CB    1 
ATOM   4303 C CG    . ASP C 1 111 ? -28.894 -22.727 -10.514 1.00 145.01 ? 158 ASP C CG    1 
ATOM   4304 O OD1   . ASP C 1 111 ? -28.476 -23.903 -10.310 1.00 144.78 ? 158 ASP C OD1   1 
ATOM   4305 O OD2   . ASP C 1 111 ? -29.818 -22.193 -9.844  1.00 152.09 ? 158 ASP C OD2   1 
ATOM   4306 N N     . SER C 1 112 ? -26.923 -22.145 -14.526 1.00 137.61 ? 159 SER C N     1 
ATOM   4307 C CA    . SER C 1 112 ? -26.851 -22.495 -15.947 1.00 140.97 ? 159 SER C CA    1 
ATOM   4308 C C     . SER C 1 112 ? -25.687 -23.473 -16.195 1.00 143.64 ? 159 SER C C     1 
ATOM   4309 O O     . SER C 1 112 ? -25.866 -24.459 -16.917 1.00 147.16 ? 159 SER C O     1 
ATOM   4310 C CB    . SER C 1 112 ? -26.720 -21.238 -16.811 1.00 145.41 ? 159 SER C CB    1 
ATOM   4311 O OG    . SER C 1 112 ? -25.442 -20.624 -16.745 1.00 147.20 ? 159 SER C OG    1 
ATOM   4312 N N     . ASP C 1 113 ? -24.527 -23.236 -15.546 1.00 134.76 ? 160 ASP C N     1 
ATOM   4313 C CA    . ASP C 1 113 ? -23.385 -24.141 -15.636 1.00 132.30 ? 160 ASP C CA    1 
ATOM   4314 C C     . ASP C 1 113 ? -23.672 -25.328 -14.713 1.00 135.10 ? 160 ASP C C     1 
ATOM   4315 O O     . ASP C 1 113 ? -24.011 -25.131 -13.540 1.00 133.51 ? 160 ASP C O     1 
ATOM   4316 C CB    . ASP C 1 113 ? -22.059 -23.445 -15.255 1.00 129.74 ? 160 ASP C CB    1 
ATOM   4317 C CG    . ASP C 1 113 ? -20.844 -24.043 -15.958 1.00 135.23 ? 160 ASP C CG    1 
ATOM   4318 O OD1   . ASP C 1 113 ? -20.597 -25.271 -15.798 1.00 131.86 ? 160 ASP C OD1   1 
ATOM   4319 O OD2   . ASP C 1 113 ? -20.149 -23.295 -16.674 1.00 143.20 ? 160 ASP C OD2   1 
ATOM   4320 N N     . LYS C 1 114 ? -23.603 -26.552 -15.264 1.00 131.84 ? 161 LYS C N     1 
ATOM   4321 C CA    . LYS C 1 114 ? -23.874 -27.774 -14.507 1.00 130.40 ? 161 LYS C CA    1 
ATOM   4322 C C     . LYS C 1 114 ? -22.613 -28.620 -14.275 1.00 130.61 ? 161 LYS C C     1 
ATOM   4323 O O     . LYS C 1 114 ? -22.720 -29.770 -13.827 1.00 131.25 ? 161 LYS C O     1 
ATOM   4324 C CB    . LYS C 1 114 ? -25.012 -28.592 -15.163 1.00 136.22 ? 161 LYS C CB    1 
ATOM   4325 C CG    . LYS C 1 114 ? -26.394 -27.939 -15.083 1.00 135.03 ? 161 LYS C CG    1 
ATOM   4326 C CD    . LYS C 1 114 ? -26.963 -27.850 -13.660 1.00 134.90 ? 161 LYS C CD    1 
ATOM   4327 C CE    . LYS C 1 114 ? -28.340 -27.230 -13.660 1.00 140.40 ? 161 LYS C CE    1 
ATOM   4328 N NZ    . LYS C 1 114 ? -28.780 -26.822 -12.301 1.00 143.39 ? 161 LYS C NZ    1 
ATOM   4329 N N     . ARG C 1 115 ? -21.418 -28.034 -14.534 1.00 122.52 ? 162 ARG C N     1 
ATOM   4330 C CA    . ARG C 1 115 ? -20.133 -28.729 -14.382 1.00 119.13 ? 162 ARG C CA    1 
ATOM   4331 C C     . ARG C 1 115 ? -19.693 -28.972 -12.932 1.00 116.91 ? 162 ARG C C     1 
ATOM   4332 O O     . ARG C 1 115 ? -20.027 -28.191 -12.035 1.00 115.19 ? 162 ARG C O     1 
ATOM   4333 C CB    . ARG C 1 115 ? -19.030 -28.040 -15.185 1.00 116.84 ? 162 ARG C CB    1 
ATOM   4334 C CG    . ARG C 1 115 ? -19.115 -28.298 -16.681 1.00 124.22 ? 162 ARG C CG    1 
ATOM   4335 C CD    . ARG C 1 115 ? -18.102 -27.484 -17.462 1.00 121.57 ? 162 ARG C CD    1 
ATOM   4336 N NE    . ARG C 1 115 ? -18.218 -26.046 -17.197 1.00 120.78 ? 162 ARG C NE    1 
ATOM   4337 C CZ    . ARG C 1 115 ? -17.291 -25.151 -17.529 1.00 128.13 ? 162 ARG C CZ    1 
ATOM   4338 N NH1   . ARG C 1 115 ? -16.182 -25.532 -18.158 1.00 116.05 ? 162 ARG C NH1   1 
ATOM   4339 N NH2   . ARG C 1 115 ? -17.463 -23.870 -17.232 1.00 98.68  ? 162 ARG C NH2   1 
ATOM   4340 N N     . LYS C 1 116 ? -18.953 -30.080 -12.725 1.00 109.99 ? 163 LYS C N     1 
ATOM   4341 C CA    . LYS C 1 116 ? -18.403 -30.544 -11.448 1.00 106.30 ? 163 LYS C CA    1 
ATOM   4342 C C     . LYS C 1 116 ? -17.058 -29.820 -11.175 1.00 103.66 ? 163 LYS C C     1 
ATOM   4343 O O     . LYS C 1 116 ? -16.733 -29.501 -10.023 1.00 101.10 ? 163 LYS C O     1 
ATOM   4344 C CB    . LYS C 1 116 ? -18.186 -32.077 -11.484 1.00 110.92 ? 163 LYS C CB    1 
ATOM   4345 C CG    . LYS C 1 116 ? -19.176 -32.875 -12.354 1.00 137.34 ? 163 LYS C CG    1 
ATOM   4346 C CD    . LYS C 1 116 ? -20.308 -33.546 -11.544 1.00 150.50 ? 163 LYS C CD    1 
ATOM   4347 C CE    . LYS C 1 116 ? -21.278 -34.349 -12.399 1.00 158.73 ? 163 LYS C CE    1 
ATOM   4348 N NZ    . LYS C 1 116 ? -20.737 -35.674 -12.823 1.00 159.55 ? 163 LYS C NZ    1 
ATOM   4349 N N     . HIS C 1 117 ? -16.298 -29.588 -12.267 1.00 96.99  ? 164 HIS C N     1 
ATOM   4350 C CA    A HIS C 1 117 ? -15.000 -28.909 -12.288 0.50 94.05  ? 164 HIS C CA    1 
ATOM   4351 C CA    B HIS C 1 117 ? -14.991 -28.928 -12.290 0.50 93.22  ? 164 HIS C CA    1 
ATOM   4352 C C     . HIS C 1 117 ? -14.975 -27.942 -13.484 1.00 95.45  ? 164 HIS C C     1 
ATOM   4353 O O     . HIS C 1 117 ? -15.886 -27.976 -14.303 1.00 98.45  ? 164 HIS C O     1 
ATOM   4354 C CB    A HIS C 1 117 ? -13.866 -29.940 -12.405 0.50 95.43  ? 164 HIS C CB    1 
ATOM   4355 C CB    B HIS C 1 117 ? -13.860 -29.974 -12.437 0.50 93.86  ? 164 HIS C CB    1 
ATOM   4356 C CG    A HIS C 1 117 ? -14.187 -31.058 -13.346 0.50 102.54 ? 164 HIS C CG    1 
ATOM   4357 C CG    B HIS C 1 117 ? -13.801 -31.006 -11.345 0.50 96.99  ? 164 HIS C CG    1 
ATOM   4358 N ND1   A HIS C 1 117 ? -14.248 -30.855 -14.715 0.50 106.50 ? 164 HIS C ND1   1 
ATOM   4359 N ND1   B HIS C 1 117 ? -12.805 -30.983 -10.384 0.50 96.69  ? 164 HIS C ND1   1 
ATOM   4360 C CD2   A HIS C 1 117 ? -14.502 -32.347 -13.079 0.50 106.70 ? 164 HIS C CD2   1 
ATOM   4361 C CD2   B HIS C 1 117 ? -14.586 -32.087 -11.127 0.50 100.44 ? 164 HIS C CD2   1 
ATOM   4362 C CE1   A HIS C 1 117 ? -14.585 -32.023 -15.235 0.50 109.24 ? 164 HIS C CE1   1 
ATOM   4363 C CE1   B HIS C 1 117 ? -13.030 -32.032 -9.607  0.50 96.76  ? 164 HIS C CE1   1 
ATOM   4364 N NE2   A HIS C 1 117 ? -14.745 -32.953 -14.290 0.50 109.75 ? 164 HIS C NE2   1 
ATOM   4365 N NE2   B HIS C 1 117 ? -14.101 -32.712 -10.001 0.50 99.37  ? 164 HIS C NE2   1 
ATOM   4366 N N     . PHE C 1 118 ? -13.950 -27.064 -13.584 1.00 84.54  ? 165 PHE C N     1 
ATOM   4367 C CA    . PHE C 1 118 ? -13.778 -26.063 -14.656 1.00 82.55  ? 165 PHE C CA    1 
ATOM   4368 C C     . PHE C 1 118 ? -12.389 -25.423 -14.531 1.00 83.63  ? 165 PHE C C     1 
ATOM   4369 O O     . PHE C 1 118 ? -11.660 -25.666 -13.555 1.00 79.02  ? 165 PHE C O     1 
ATOM   4370 C CB    . PHE C 1 118 ? -14.893 -24.958 -14.627 1.00 84.22  ? 165 PHE C CB    1 
ATOM   4371 C CG    . PHE C 1 118 ? -14.770 -23.919 -13.514 1.00 82.05  ? 165 PHE C CG    1 
ATOM   4372 C CD1   . PHE C 1 118 ? -15.157 -24.219 -12.211 1.00 82.09  ? 165 PHE C CD1   1 
ATOM   4373 C CD2   . PHE C 1 118 ? -14.243 -22.658 -13.769 1.00 82.31  ? 165 PHE C CD2   1 
ATOM   4374 C CE1   . PHE C 1 118 ? -14.992 -23.291 -11.183 1.00 81.63  ? 165 PHE C CE1   1 
ATOM   4375 C CE2   . PHE C 1 118 ? -14.072 -21.728 -12.735 1.00 83.42  ? 165 PHE C CE2   1 
ATOM   4376 C CZ    . PHE C 1 118 ? -14.440 -22.053 -11.447 1.00 80.35  ? 165 PHE C CZ    1 
ATOM   4377 N N     . MET C 1 119 ? -12.043 -24.574 -15.517 1.00 82.79  ? 166 MET C N     1 
ATOM   4378 C CA    . MET C 1 119 ? -10.771 -23.848 -15.566 1.00 82.03  ? 166 MET C CA    1 
ATOM   4379 C C     . MET C 1 119 ? -11.023 -22.432 -16.009 1.00 88.27  ? 166 MET C C     1 
ATOM   4380 O O     . MET C 1 119 ? -11.946 -22.178 -16.784 1.00 91.38  ? 166 MET C O     1 
ATOM   4381 C CB    . MET C 1 119 ? -9.805  -24.493 -16.568 1.00 85.33  ? 166 MET C CB    1 
ATOM   4382 C CG    . MET C 1 119 ? -9.219  -25.787 -16.084 1.00 88.53  ? 166 MET C CG    1 
ATOM   4383 S SD    . MET C 1 119 ? -8.317  -26.614 -17.402 1.00 94.24  ? 166 MET C SD    1 
ATOM   4384 C CE    . MET C 1 119 ? -6.981  -27.302 -16.444 1.00 88.95  ? 166 MET C CE    1 
ATOM   4385 N N     . LEU C 1 120 ? -10.187 -21.513 -15.546 1.00 82.63  ? 167 LEU C N     1 
ATOM   4386 C CA    . LEU C 1 120 ? -10.279 -20.138 -15.983 1.00 83.05  ? 167 LEU C CA    1 
ATOM   4387 C C     . LEU C 1 120 ? -9.521  -20.073 -17.283 1.00 87.45  ? 167 LEU C C     1 
ATOM   4388 O O     . LEU C 1 120 ? -8.560  -20.803 -17.463 1.00 87.11  ? 167 LEU C O     1 
ATOM   4389 C CB    . LEU C 1 120 ? -9.669  -19.169 -14.962 1.00 81.41  ? 167 LEU C CB    1 
ATOM   4390 C CG    . LEU C 1 120 ? -10.130 -19.319 -13.506 1.00 84.55  ? 167 LEU C CG    1 
ATOM   4391 C CD1   . LEU C 1 120 ? -9.245  -18.533 -12.587 1.00 82.71  ? 167 LEU C CD1   1 
ATOM   4392 C CD2   . LEU C 1 120 ? -11.599 -18.934 -13.321 1.00 88.66  ? 167 LEU C CD2   1 
ATOM   4393 N N     . SER C 1 121 ? -9.975  -19.250 -18.199 1.00 86.15  ? 168 SER C N     1 
ATOM   4394 C CA    . SER C 1 121 ? -9.347  -19.076 -19.488 1.00 88.03  ? 168 SER C CA    1 
ATOM   4395 C C     . SER C 1 121 ? -8.946  -17.613 -19.597 1.00 94.18  ? 168 SER C C     1 
ATOM   4396 O O     . SER C 1 121 ? -9.781  -16.730 -19.399 1.00 95.35  ? 168 SER C O     1 
ATOM   4397 C CB    . SER C 1 121 ? -10.313 -19.474 -20.593 1.00 94.57  ? 168 SER C CB    1 
ATOM   4398 O OG    . SER C 1 121 ? -9.896  -18.952 -21.841 1.00 108.15 ? 168 SER C OG    1 
ATOM   4399 N N     . VAL C 1 122 ? -7.657  -17.353 -19.847 1.00 91.02  ? 169 VAL C N     1 
ATOM   4400 C CA    . VAL C 1 122 ? -7.137  -15.993 -19.973 1.00 91.68  ? 169 VAL C CA    1 
ATOM   4401 C C     . VAL C 1 122 ? -6.749  -15.762 -21.418 1.00 99.55  ? 169 VAL C C     1 
ATOM   4402 O O     . VAL C 1 122 ? -5.796  -16.384 -21.899 1.00 98.91  ? 169 VAL C O     1 
ATOM   4403 C CB    . VAL C 1 122 ? -5.980  -15.714 -18.986 1.00 92.16  ? 169 VAL C CB    1 
ATOM   4404 C CG1   . VAL C 1 122 ? -5.375  -14.330 -19.213 1.00 92.93  ? 169 VAL C CG1   1 
ATOM   4405 C CG2   . VAL C 1 122 ? -6.457  -15.867 -17.543 1.00 89.32  ? 169 VAL C CG2   1 
ATOM   4406 N N     . LYS C 1 123 ? -7.533  -14.917 -22.116 1.00 99.37  ? 170 LYS C N     1 
ATOM   4407 C CA    . LYS C 1 123 ? -7.319  -14.543 -23.514 1.00 103.49 ? 170 LYS C CA    1 
ATOM   4408 C C     . LYS C 1 123 ? -6.416  -13.301 -23.506 1.00 108.87 ? 170 LYS C C     1 
ATOM   4409 O O     . LYS C 1 123 ? -6.721  -12.323 -22.811 1.00 108.26 ? 170 LYS C O     1 
ATOM   4410 C CB    . LYS C 1 123 ? -8.666  -14.253 -24.205 1.00 109.75 ? 170 LYS C CB    1 
ATOM   4411 C CG    . LYS C 1 123 ? -8.709  -14.580 -25.702 1.00 127.83 ? 170 LYS C CG    1 
ATOM   4412 C CD    . LYS C 1 123 ? -10.071 -14.188 -26.297 1.00 144.47 ? 170 LYS C CD    1 
ATOM   4413 C CE    . LYS C 1 123 ? -10.566 -15.072 -27.427 1.00 158.06 ? 170 LYS C CE    1 
ATOM   4414 N NZ    . LYS C 1 123 ? -11.915 -14.650 -27.928 1.00 160.87 ? 170 LYS C NZ    1 
ATOM   4415 N N     . MET C 1 124 ? -5.292  -13.351 -24.240 1.00 106.03 ? 171 MET C N     1 
ATOM   4416 C CA    . MET C 1 124 ? -4.345  -12.245 -24.235 1.00 106.73 ? 171 MET C CA    1 
ATOM   4417 C C     . MET C 1 124 ? -3.831  -11.822 -25.593 1.00 116.95 ? 171 MET C C     1 
ATOM   4418 O O     . MET C 1 124 ? -3.644  -12.655 -26.483 1.00 118.54 ? 171 MET C O     1 
ATOM   4419 C CB    . MET C 1 124 ? -3.169  -12.583 -23.345 1.00 105.55 ? 171 MET C CB    1 
ATOM   4420 C CG    . MET C 1 124 ? -3.354  -12.165 -21.940 1.00 105.93 ? 171 MET C CG    1 
ATOM   4421 S SD    . MET C 1 124 ? -1.756  -12.177 -21.132 1.00 106.68 ? 171 MET C SD    1 
ATOM   4422 C CE    . MET C 1 124 ? -1.839  -13.631 -20.435 1.00 100.04 ? 171 MET C CE    1 
ATOM   4423 N N     . PHE C 1 125 ? -3.560  -10.501 -25.713 1.00 116.02 ? 172 PHE C N     1 
ATOM   4424 C CA    . PHE C 1 125 ? -3.078  -9.749  -26.881 1.00 119.65 ? 172 PHE C CA    1 
ATOM   4425 C C     . PHE C 1 125 ? -2.672  -8.335  -26.415 1.00 123.56 ? 172 PHE C C     1 
ATOM   4426 O O     . PHE C 1 125 ? -2.979  -7.945  -25.286 1.00 119.92 ? 172 PHE C O     1 
ATOM   4427 C CB    . PHE C 1 125 ? -4.181  -9.645  -27.971 1.00 125.68 ? 172 PHE C CB    1 
ATOM   4428 C CG    . PHE C 1 125 ? -5.536  -9.269  -27.420 1.00 127.67 ? 172 PHE C CG    1 
ATOM   4429 C CD1   . PHE C 1 125 ? -5.885  -7.937  -27.235 1.00 133.57 ? 172 PHE C CD1   1 
ATOM   4430 C CD2   . PHE C 1 125 ? -6.444  -10.249 -27.034 1.00 128.03 ? 172 PHE C CD2   1 
ATOM   4431 C CE1   . PHE C 1 125 ? -7.114  -7.593  -26.668 1.00 134.94 ? 172 PHE C CE1   1 
ATOM   4432 C CE2   . PHE C 1 125 ? -7.668  -9.905  -26.458 1.00 131.34 ? 172 PHE C CE2   1 
ATOM   4433 C CZ    . PHE C 1 125 ? -7.998  -8.580  -26.286 1.00 132.00 ? 172 PHE C CZ    1 
ATOM   4434 N N     . TYR C 1 126 ? -2.007  -7.568  -27.298 1.00 124.03 ? 173 TYR C N     1 
ATOM   4435 C CA    . TYR C 1 126 ? -1.593  -6.183  -27.047 1.00 125.48 ? 173 TYR C CA    1 
ATOM   4436 C C     . TYR C 1 126 ? -2.691  -5.323  -27.638 1.00 133.05 ? 173 TYR C C     1 
ATOM   4437 O O     . TYR C 1 126 ? -3.548  -5.866  -28.334 1.00 133.32 ? 173 TYR C O     1 
ATOM   4438 C CB    . TYR C 1 126 ? -0.216  -5.886  -27.689 1.00 128.39 ? 173 TYR C CB    1 
ATOM   4439 C CG    . TYR C 1 126 ? 0.834   -6.940  -27.387 1.00 126.34 ? 173 TYR C CG    1 
ATOM   4440 C CD1   . TYR C 1 126 ? 1.566   -6.908  -26.202 1.00 124.94 ? 173 TYR C CD1   1 
ATOM   4441 C CD2   . TYR C 1 126 ? 1.069   -7.992  -28.270 1.00 126.86 ? 173 TYR C CD2   1 
ATOM   4442 C CE1   . TYR C 1 126 ? 2.510   -7.890  -25.909 1.00 122.36 ? 173 TYR C CE1   1 
ATOM   4443 C CE2   . TYR C 1 126 ? 1.993   -8.992  -27.976 1.00 124.30 ? 173 TYR C CE2   1 
ATOM   4444 C CZ    . TYR C 1 126 ? 2.714   -8.935  -26.796 1.00 129.31 ? 173 TYR C CZ    1 
ATOM   4445 O OH    . TYR C 1 126 ? 3.638   -9.912  -26.517 1.00 130.67 ? 173 TYR C OH    1 
ATOM   4446 N N     . GLY C 1 127 ? -2.688  -4.021  -27.327 1.00 133.27 ? 174 GLY C N     1 
ATOM   4447 C CA    . GLY C 1 127 ? -3.680  -3.046  -27.790 1.00 138.03 ? 174 GLY C CA    1 
ATOM   4448 C C     . GLY C 1 127 ? -3.982  -3.082  -29.278 1.00 148.33 ? 174 GLY C C     1 
ATOM   4449 O O     . GLY C 1 127 ? -5.145  -3.020  -29.679 1.00 150.08 ? 174 GLY C O     1 
ATOM   4450 N N     . ASN C 1 128 ? -2.931  -3.248  -30.100 1.00 148.51 ? 175 ASN C N     1 
ATOM   4451 C CA    . ASN C 1 128 ? -2.968  -3.328  -31.567 1.00 153.96 ? 175 ASN C CA    1 
ATOM   4452 C C     . ASN C 1 128 ? -3.515  -4.676  -32.125 1.00 158.27 ? 175 ASN C C     1 
ATOM   4453 O O     . ASN C 1 128 ? -3.408  -4.919  -33.335 1.00 162.82 ? 175 ASN C O     1 
ATOM   4454 C CB    . ASN C 1 128 ? -1.558  -3.076  -32.106 1.00 156.55 ? 175 ASN C CB    1 
ATOM   4455 C CG    . ASN C 1 128 ? -0.598  -4.203  -31.797 1.00 174.05 ? 175 ASN C CG    1 
ATOM   4456 O OD1   . ASN C 1 128 ? -0.518  -4.695  -30.667 1.00 163.29 ? 175 ASN C OD1   1 
ATOM   4457 N ND2   . ASN C 1 128 ? 0.121   -4.664  -32.807 1.00 166.77 ? 175 ASN C ND2   1 
ATOM   4458 N N     . SER C 1 129 ? -4.083  -5.538  -31.245 1.00 149.06 ? 176 SER C N     1 
ATOM   4459 C CA    . SER C 1 129 ? -4.670  -6.863  -31.517 1.00 146.98 ? 176 SER C CA    1 
ATOM   4460 C C     . SER C 1 129 ? -3.708  -8.054  -31.786 1.00 148.42 ? 176 SER C C     1 
ATOM   4461 O O     . SER C 1 129 ? -4.183  -9.179  -31.976 1.00 146.45 ? 176 SER C O     1 
ATOM   4462 C CB    . SER C 1 129 ? -5.847  -6.797  -32.493 1.00 154.98 ? 176 SER C CB    1 
ATOM   4463 O OG    . SER C 1 129 ? -5.435  -6.960  -33.841 1.00 169.15 ? 176 SER C OG    1 
ATOM   4464 N N     . ASP C 1 130 ? -2.373  -7.821  -31.748 1.00 144.71 ? 177 ASP C N     1 
ATOM   4465 C CA    . ASP C 1 130 ? -1.350  -8.870  -31.918 1.00 142.28 ? 177 ASP C CA    1 
ATOM   4466 C C     . ASP C 1 130 ? -1.520  -9.950  -30.815 1.00 141.09 ? 177 ASP C C     1 
ATOM   4467 O O     . ASP C 1 130 ? -1.214  -9.707  -29.644 1.00 137.90 ? 177 ASP C O     1 
ATOM   4468 C CB    . ASP C 1 130 ? 0.066   -8.262  -31.877 1.00 144.05 ? 177 ASP C CB    1 
ATOM   4469 C CG    . ASP C 1 130 ? 0.614   -7.791  -33.206 1.00 156.60 ? 177 ASP C CG    1 
ATOM   4470 O OD1   . ASP C 1 130 ? -0.154  -7.186  -33.985 1.00 161.43 ? 177 ASP C OD1   1 
ATOM   4471 O OD2   . ASP C 1 130 ? 1.828   -7.956  -33.434 1.00 161.64 ? 177 ASP C OD2   1 
ATOM   4472 N N     . ASP C 1 131 ? -2.057  -11.119 -31.205 1.00 136.09 ? 178 ASP C N     1 
ATOM   4473 C CA    . ASP C 1 131 ? -2.407  -12.237 -30.331 1.00 130.96 ? 178 ASP C CA    1 
ATOM   4474 C C     . ASP C 1 131 ? -1.261  -12.902 -29.558 1.00 129.95 ? 178 ASP C C     1 
ATOM   4475 O O     . ASP C 1 131 ? -0.237  -13.262 -30.150 1.00 131.34 ? 178 ASP C O     1 
ATOM   4476 C CB    . ASP C 1 131 ? -3.213  -13.281 -31.132 1.00 134.65 ? 178 ASP C CB    1 
ATOM   4477 C CG    . ASP C 1 131 ? -3.990  -14.301 -30.315 1.00 145.84 ? 178 ASP C CG    1 
ATOM   4478 O OD1   . ASP C 1 131 ? -4.703  -13.894 -29.365 1.00 145.51 ? 178 ASP C OD1   1 
ATOM   4479 O OD2   . ASP C 1 131 ? -3.958  -15.492 -30.676 1.00 152.32 ? 178 ASP C OD2   1 
ATOM   4480 N N     . ILE C 1 132 ? -1.464  -13.088 -28.229 1.00 119.98 ? 179 ILE C N     1 
ATOM   4481 C CA    . ILE C 1 132 ? -0.547  -13.823 -27.344 1.00 114.33 ? 179 ILE C CA    1 
ATOM   4482 C C     . ILE C 1 132 ? -1.077  -15.274 -27.277 1.00 116.04 ? 179 ILE C C     1 
ATOM   4483 O O     . ILE C 1 132 ? -0.363  -16.211 -27.640 1.00 115.03 ? 179 ILE C O     1 
ATOM   4484 C CB    . ILE C 1 132 ? -0.350  -13.190 -25.931 1.00 113.56 ? 179 ILE C CB    1 
ATOM   4485 C CG1   . ILE C 1 132 ? -0.040  -11.674 -26.015 1.00 116.05 ? 179 ILE C CG1   1 
ATOM   4486 C CG2   . ILE C 1 132 ? 0.751   -13.941 -25.159 1.00 109.80 ? 179 ILE C CG2   1 
ATOM   4487 C CD1   . ILE C 1 132 ? -0.089  -10.895 -24.680 1.00 116.93 ? 179 ILE C CD1   1 
ATOM   4488 N N     . GLY C 1 133 ? -2.339  -15.428 -26.868 1.00 111.60 ? 180 GLY C N     1 
ATOM   4489 C CA    . GLY C 1 133 ? -3.001  -16.727 -26.792 1.00 109.44 ? 180 GLY C CA    1 
ATOM   4490 C C     . GLY C 1 133 ? -3.879  -16.930 -25.576 1.00 106.45 ? 180 GLY C C     1 
ATOM   4491 O O     . GLY C 1 133 ? -3.993  -16.038 -24.729 1.00 104.95 ? 180 GLY C O     1 
ATOM   4492 N N     . VAL C 1 134 ? -4.524  -18.097 -25.506 1.00 98.90  ? 181 VAL C N     1 
ATOM   4493 C CA    . VAL C 1 134 ? -5.396  -18.450 -24.391 1.00 95.91  ? 181 VAL C CA    1 
ATOM   4494 C C     . VAL C 1 134 ? -4.562  -19.198 -23.360 1.00 97.06  ? 181 VAL C C     1 
ATOM   4495 O O     . VAL C 1 134 ? -3.792  -20.071 -23.746 1.00 98.16  ? 181 VAL C O     1 
ATOM   4496 C CB    . VAL C 1 134 ? -6.671  -19.212 -24.870 1.00 101.04 ? 181 VAL C CB    1 
ATOM   4497 C CG1   . VAL C 1 134 ? -7.314  -20.045 -23.766 1.00 97.70  ? 181 VAL C CG1   1 
ATOM   4498 C CG2   . VAL C 1 134 ? -7.690  -18.237 -25.434 1.00 104.14 ? 181 VAL C CG2   1 
ATOM   4499 N N     . PHE C 1 135 ? -4.679  -18.841 -22.067 1.00 89.91  ? 182 PHE C N     1 
ATOM   4500 C CA    . PHE C 1 135 ? -3.923  -19.497 -21.002 1.00 86.32  ? 182 PHE C CA    1 
ATOM   4501 C C     . PHE C 1 135 ? -4.869  -20.041 -19.963 1.00 88.41  ? 182 PHE C C     1 
ATOM   4502 O O     . PHE C 1 135 ? -5.592  -19.289 -19.317 1.00 87.27  ? 182 PHE C O     1 
ATOM   4503 C CB    . PHE C 1 135 ? -2.946  -18.538 -20.334 1.00 87.29  ? 182 PHE C CB    1 
ATOM   4504 C CG    . PHE C 1 135 ? -1.895  -17.918 -21.214 1.00 91.05  ? 182 PHE C CG    1 
ATOM   4505 C CD1   . PHE C 1 135 ? -2.209  -16.860 -22.060 1.00 97.17  ? 182 PHE C CD1   1 
ATOM   4506 C CD2   . PHE C 1 135 ? -0.571  -18.323 -21.127 1.00 93.23  ? 182 PHE C CD2   1 
ATOM   4507 C CE1   . PHE C 1 135 ? -1.231  -16.267 -22.858 1.00 100.25 ? 182 PHE C CE1   1 
ATOM   4508 C CE2   . PHE C 1 135 ? 0.413   -17.715 -21.907 1.00 98.27  ? 182 PHE C CE2   1 
ATOM   4509 C CZ    . PHE C 1 135 ? 0.079   -16.685 -22.762 1.00 98.89  ? 182 PHE C CZ    1 
ATOM   4510 N N     . LEU C 1 136 ? -4.876  -21.357 -19.811 1.00 85.82  ? 183 LEU C N     1 
ATOM   4511 C CA    . LEU C 1 136 ? -5.731  -22.043 -18.853 1.00 83.89  ? 183 LEU C CA    1 
ATOM   4512 C C     . LEU C 1 136 ? -5.151  -22.086 -17.465 1.00 84.92  ? 183 LEU C C     1 
ATOM   4513 O O     . LEU C 1 136 ? -3.943  -22.270 -17.296 1.00 83.47  ? 183 LEU C O     1 
ATOM   4514 C CB    . LEU C 1 136 ? -6.001  -23.468 -19.313 1.00 84.53  ? 183 LEU C CB    1 
ATOM   4515 C CG    . LEU C 1 136 ? -6.990  -23.656 -20.425 1.00 91.44  ? 183 LEU C CG    1 
ATOM   4516 C CD1   . LEU C 1 136 ? -6.991  -25.095 -20.853 1.00 93.98  ? 183 LEU C CD1   1 
ATOM   4517 C CD2   . LEU C 1 136 ? -8.397  -23.258 -19.994 1.00 91.83  ? 183 LEU C CD2   1 
ATOM   4518 N N     . SER C 1 137 ? -6.014  -21.949 -16.462 1.00 80.57  ? 184 SER C N     1 
ATOM   4519 C CA    . SER C 1 137 ? -5.589  -22.069 -15.073 1.00 78.06  ? 184 SER C CA    1 
ATOM   4520 C C     . SER C 1 137 ? -5.579  -23.574 -14.783 1.00 81.92  ? 184 SER C C     1 
ATOM   4521 O O     . SER C 1 137 ? -5.944  -24.382 -15.657 1.00 82.56  ? 184 SER C O     1 
ATOM   4522 C CB    . SER C 1 137 ? -6.599  -21.387 -14.151 1.00 79.47  ? 184 SER C CB    1 
ATOM   4523 O OG    . SER C 1 137 ? -7.844  -22.071 -14.119 1.00 85.93  ? 184 SER C OG    1 
ATOM   4524 N N     . LYS C 1 138 ? -5.225  -23.947 -13.545 1.00 77.31  ? 185 LYS C N     1 
ATOM   4525 C CA    . LYS C 1 138 ? -5.289  -25.335 -13.102 1.00 78.20  ? 185 LYS C CA    1 
ATOM   4526 C C     . LYS C 1 138 ? -6.790  -25.651 -12.839 1.00 85.88  ? 185 LYS C C     1 
ATOM   4527 O O     . LYS C 1 138 ? -7.595  -24.715 -12.816 1.00 88.36  ? 185 LYS C O     1 
ATOM   4528 C CB    . LYS C 1 138 ? -4.399  -25.549 -11.857 1.00 79.57  ? 185 LYS C CB    1 
ATOM   4529 C CG    . LYS C 1 138 ? -2.890  -25.260 -12.089 1.00 94.97  ? 185 LYS C CG    1 
ATOM   4530 C CD    . LYS C 1 138 ? -2.051  -26.514 -12.419 1.00 107.16 ? 185 LYS C CD    1 
ATOM   4531 C CE    . LYS C 1 138 ? -0.606  -26.236 -12.828 1.00 119.32 ? 185 LYS C CE    1 
ATOM   4532 N NZ    . LYS C 1 138 ? -0.435  -25.938 -14.296 1.00 124.18 ? 185 LYS C NZ    1 
ATOM   4533 N N     . ARG C 1 139 ? -7.186  -26.935 -12.715 1.00 82.84  ? 186 ARG C N     1 
ATOM   4534 C CA    . ARG C 1 139 ? -8.586  -27.339 -12.445 1.00 83.08  ? 186 ARG C CA    1 
ATOM   4535 C C     . ARG C 1 139 ? -9.123  -26.681 -11.153 1.00 84.44  ? 186 ARG C C     1 
ATOM   4536 O O     . ARG C 1 139 ? -8.351  -26.472 -10.192 1.00 82.60  ? 186 ARG C O     1 
ATOM   4537 C CB    . ARG C 1 139 ? -8.688  -28.868 -12.314 1.00 85.04  ? 186 ARG C CB    1 
ATOM   4538 C CG    . ARG C 1 139 ? -10.098 -29.435 -12.376 1.00 101.81 ? 186 ARG C CG    1 
ATOM   4539 C CD    . ARG C 1 139 ? -10.110 -30.953 -12.547 1.00 122.70 ? 186 ARG C CD    1 
ATOM   4540 N NE    . ARG C 1 139 ? -9.563  -31.394 -13.841 1.00 137.13 ? 186 ARG C NE    1 
ATOM   4541 C CZ    . ARG C 1 139 ? -10.230 -31.391 -14.995 1.00 148.91 ? 186 ARG C CZ    1 
ATOM   4542 N NH1   . ARG C 1 139 ? -11.480 -30.943 -15.049 1.00 129.26 ? 186 ARG C NH1   1 
ATOM   4543 N NH2   . ARG C 1 139 ? -9.644  -31.818 -16.107 1.00 135.11 ? 186 ARG C NH2   1 
ATOM   4544 N N     . ILE C 1 140 ? -10.440 -26.303 -11.174 1.00 79.04  ? 187 ILE C N     1 
ATOM   4545 C CA    . ILE C 1 140 ? -11.172 -25.695 -10.057 1.00 75.67  ? 187 ILE C CA    1 
ATOM   4546 C C     . ILE C 1 140 ? -12.418 -26.535 -9.768  1.00 81.30  ? 187 ILE C C     1 
ATOM   4547 O O     . ILE C 1 140 ? -13.236 -26.742 -10.653 1.00 82.35  ? 187 ILE C O     1 
ATOM   4548 C CB    . ILE C 1 140 ? -11.458 -24.172 -10.228 1.00 76.58  ? 187 ILE C CB    1 
ATOM   4549 C CG1   . ILE C 1 140 ? -10.150 -23.391 -10.498 1.00 74.04  ? 187 ILE C CG1   1 
ATOM   4550 C CG2   . ILE C 1 140 ? -12.190 -23.609 -8.980  1.00 76.07  ? 187 ILE C CG2   1 
ATOM   4551 C CD1   . ILE C 1 140 ? -10.311 -22.031 -11.047 1.00 70.81  ? 187 ILE C CD1   1 
ATOM   4552 N N     . LYS C 1 141 ? -12.516 -27.073 -8.545  1.00 79.09  ? 188 LYS C N     1 
ATOM   4553 C CA    . LYS C 1 141 ? -13.629 -27.932 -8.113  1.00 80.66  ? 188 LYS C CA    1 
ATOM   4554 C C     . LYS C 1 141 ? -14.866 -27.081 -7.821  1.00 85.42  ? 188 LYS C C     1 
ATOM   4555 O O     . LYS C 1 141 ? -14.783 -26.091 -7.094  1.00 84.51  ? 188 LYS C O     1 
ATOM   4556 C CB    . LYS C 1 141 ? -13.221 -28.707 -6.836  1.00 82.03  ? 188 LYS C CB    1 
ATOM   4557 C CG    . LYS C 1 141 ? -13.647 -30.166 -6.764  1.00 85.88  ? 188 LYS C CG    1 
ATOM   4558 C CD    . LYS C 1 141 ? -14.933 -30.425 -5.968  1.00 94.97  ? 188 LYS C CD    1 
ATOM   4559 C CE    . LYS C 1 141 ? -15.159 -31.888 -5.632  1.00 106.80 ? 188 LYS C CE    1 
ATOM   4560 N NZ    . LYS C 1 141 ? -15.293 -32.763 -6.847  1.00 117.88 ? 188 LYS C NZ    1 
ATOM   4561 N N     . VAL C 1 142 ? -16.002 -27.444 -8.373  1.00 83.94  ? 189 VAL C N     1 
ATOM   4562 C CA    . VAL C 1 142 ? -17.193 -26.672 -8.036  1.00 84.78  ? 189 VAL C CA    1 
ATOM   4563 C C     . VAL C 1 142 ? -17.769 -27.337 -6.791  1.00 92.41  ? 189 VAL C C     1 
ATOM   4564 O O     . VAL C 1 142 ? -17.874 -28.579 -6.733  1.00 95.57  ? 189 VAL C O     1 
ATOM   4565 C CB    . VAL C 1 142 ? -18.257 -26.554 -9.159  1.00 89.54  ? 189 VAL C CB    1 
ATOM   4566 C CG1   . VAL C 1 142 ? -19.351 -25.572 -8.744  1.00 89.16  ? 189 VAL C CG1   1 
ATOM   4567 C CG2   . VAL C 1 142 ? -17.630 -26.140 -10.485 1.00 89.39  ? 189 VAL C CG2   1 
ATOM   4568 N N     . ILE C 1 143 ? -18.098 -26.520 -5.789  1.00 86.92  ? 190 ILE C N     1 
ATOM   4569 C CA    . ILE C 1 143 ? -18.653 -27.000 -4.535  1.00 87.68  ? 190 ILE C CA    1 
ATOM   4570 C C     . ILE C 1 143 ? -19.881 -26.211 -4.184  1.00 98.71  ? 190 ILE C C     1 
ATOM   4571 O O     . ILE C 1 143 ? -20.057 -25.065 -4.613  1.00 100.20 ? 190 ILE C O     1 
ATOM   4572 C CB    . ILE C 1 143 ? -17.608 -27.021 -3.364  1.00 88.47  ? 190 ILE C CB    1 
ATOM   4573 C CG1   . ILE C 1 143 ? -17.273 -25.618 -2.828  1.00 86.07  ? 190 ILE C CG1   1 
ATOM   4574 C CG2   . ILE C 1 143 ? -16.330 -27.856 -3.689  1.00 86.77  ? 190 ILE C CG2   1 
ATOM   4575 C CD1   . ILE C 1 143 ? -16.262 -25.656 -1.787  1.00 84.07  ? 190 ILE C CD1   1 
ATOM   4576 N N     . SER C 1 144 ? -20.761 -26.834 -3.428  1.00 99.42  ? 191 SER C N     1 
ATOM   4577 C CA    . SER C 1 144 ? -21.937 -26.149 -2.917  1.00 101.21 ? 191 SER C CA    1 
ATOM   4578 C C     . SER C 1 144 ? -21.451 -25.636 -1.534  1.00 107.05 ? 191 SER C C     1 
ATOM   4579 O O     . SER C 1 144 ? -20.297 -25.937 -1.156  1.00 104.26 ? 191 SER C O     1 
ATOM   4580 C CB    . SER C 1 144 ? -23.113 -27.114 -2.805  1.00 105.96 ? 191 SER C CB    1 
ATOM   4581 O OG    . SER C 1 144 ? -22.771 -28.319 -2.141  1.00 112.31 ? 191 SER C OG    1 
ATOM   4582 N N     . LYS C 1 145 ? -22.281 -24.838 -0.810  1.00 106.43 ? 192 LYS C N     1 
ATOM   4583 C CA    . LYS C 1 145 ? -21.928 -24.285 0.509   1.00 106.27 ? 192 LYS C CA    1 
ATOM   4584 C C     . LYS C 1 145 ? -21.128 -25.272 1.367   1.00 111.16 ? 192 LYS C C     1 
ATOM   4585 O O     . LYS C 1 145 ? -21.413 -26.480 1.324   1.00 112.02 ? 192 LYS C O     1 
ATOM   4586 C CB    . LYS C 1 145 ? -23.186 -23.844 1.274   1.00 111.45 ? 192 LYS C CB    1 
ATOM   4587 C CG    . LYS C 1 145 ? -23.195 -22.331 1.573   1.00 134.90 ? 192 LYS C CG    1 
ATOM   4588 C CD    . LYS C 1 145 ? -24.461 -21.845 2.311   1.00 144.26 ? 192 LYS C CD    1 
ATOM   4589 C CE    . LYS C 1 145 ? -25.003 -20.554 1.730   1.00 147.14 ? 192 LYS C CE    1 
ATOM   4590 N NZ    . LYS C 1 145 ? -25.964 -20.788 0.608   1.00 148.74 ? 192 LYS C NZ    1 
ATOM   4591 N N     . PRO C 1 146 ? -20.109 -24.812 2.133   1.00 127.61 ? 193 PRO C N     1 
ATOM   4592 C CA    . PRO C 1 146 ? -19.345 -25.759 2.968   1.00 126.78 ? 193 PRO C CA    1 
ATOM   4593 C C     . PRO C 1 146 ? -20.191 -26.443 4.055   1.00 132.92 ? 193 PRO C C     1 
ATOM   4594 O O     . PRO C 1 146 ? -20.967 -25.780 4.767   1.00 132.87 ? 193 PRO C O     1 
ATOM   4595 C CB    . PRO C 1 146 ? -18.211 -24.904 3.550   1.00 125.76 ? 193 PRO C CB    1 
ATOM   4596 C CG    . PRO C 1 146 ? -18.717 -23.539 3.501   1.00 130.12 ? 193 PRO C CG    1 
ATOM   4597 C CD    . PRO C 1 146 ? -19.609 -23.435 2.296   1.00 127.41 ? 193 PRO C CD    1 
ATOM   4598 N N     . SER C 1 147 ? -20.060 -27.788 4.139   1.00 130.07 ? 194 SER C N     1 
ATOM   4599 C CA    . SER C 1 147 ? -20.745 -28.644 5.109   1.00 131.37 ? 194 SER C CA    1 
ATOM   4600 C C     . SER C 1 147 ? -20.301 -28.246 6.523   1.00 132.74 ? 194 SER C C     1 
ATOM   4601 O O     . SER C 1 147 ? -19.084 -28.226 6.790   1.00 130.51 ? 194 SER C O     1 
ATOM   4602 C CB    . SER C 1 147 ? -20.419 -30.116 4.833   1.00 136.85 ? 194 SER C CB    1 
ATOM   4603 O OG    . SER C 1 147 ? -21.230 -31.032 5.556   1.00 147.84 ? 194 SER C OG    1 
ATOM   4604 N N     . LYS C 1 148 ? -21.288 -27.867 7.400   1.00 128.44 ? 195 LYS C N     1 
ATOM   4605 C CA    . LYS C 1 148 ? -21.056 -27.476 8.812   1.00 126.10 ? 195 LYS C CA    1 
ATOM   4606 C C     . LYS C 1 148 ? -20.889 -28.718 9.731   1.00 126.11 ? 195 LYS C C     1 
ATOM   4607 O O     . LYS C 1 148 ? -20.464 -28.584 10.893  1.00 124.21 ? 195 LYS C O     1 
ATOM   4608 C CB    . LYS C 1 148 ? -22.160 -26.542 9.339   1.00 129.40 ? 195 LYS C CB    1 
ATOM   4609 C CG    . LYS C 1 148 ? -21.843 -25.049 9.209   1.00 138.85 ? 195 LYS C CG    1 
ATOM   4610 C CD    . LYS C 1 148 ? -22.899 -24.155 9.906   1.00 147.27 ? 195 LYS C CD    1 
ATOM   4611 C CE    . LYS C 1 148 ? -24.143 -23.893 9.067   1.00 152.63 ? 195 LYS C CE    1 
ATOM   4612 N NZ    . LYS C 1 148 ? -25.342 -23.583 9.898   1.00 154.03 ? 195 LYS C NZ    1 
ATOM   4613 N N     . LYS C 1 149 ? -21.203 -29.924 9.171   1.00 120.28 ? 196 LYS C N     1 
ATOM   4614 C CA    . LYS C 1 149 ? -21.043 -31.239 9.794   1.00 120.29 ? 196 LYS C CA    1 
ATOM   4615 C C     . LYS C 1 149 ? -19.545 -31.570 9.872   1.00 119.06 ? 196 LYS C C     1 
ATOM   4616 O O     . LYS C 1 149 ? -18.757 -31.031 9.086   1.00 117.72 ? 196 LYS C O     1 
ATOM   4617 C CB    . LYS C 1 149 ? -21.748 -32.333 8.956   1.00 126.34 ? 196 LYS C CB    1 
ATOM   4618 C CG    . LYS C 1 149 ? -23.269 -32.240 8.948   1.00 147.14 ? 196 LYS C CG    1 
ATOM   4619 C CD    . LYS C 1 149 ? -23.937 -33.484 8.386   1.00 159.38 ? 196 LYS C CD    1 
ATOM   4620 C CE    . LYS C 1 149 ? -25.440 -33.317 8.423   1.00 166.80 ? 196 LYS C CE    1 
ATOM   4621 N NZ    . LYS C 1 149 ? -26.160 -34.564 8.068   1.00 169.03 ? 196 LYS C NZ    1 
ATOM   4622 N N     . LYS C 1 150 ? -19.152 -32.475 10.801  1.00 112.07 ? 197 LYS C N     1 
ATOM   4623 C CA    . LYS C 1 150 ? -17.761 -32.899 10.948  1.00 108.20 ? 197 LYS C CA    1 
ATOM   4624 C C     . LYS C 1 150 ? -17.279 -33.480 9.640   1.00 111.04 ? 197 LYS C C     1 
ATOM   4625 O O     . LYS C 1 150 ? -17.985 -34.276 9.003   1.00 112.92 ? 197 LYS C O     1 
ATOM   4626 C CB    . LYS C 1 150 ? -17.584 -33.924 12.075  1.00 109.86 ? 197 LYS C CB    1 
ATOM   4627 C CG    . LYS C 1 150 ? -17.249 -33.306 13.411  1.00 107.67 ? 197 LYS C CG    1 
ATOM   4628 C CD    . LYS C 1 150 ? -17.345 -34.335 14.524  1.00 114.08 ? 197 LYS C CD    1 
ATOM   4629 C CE    . LYS C 1 150 ? -17.558 -33.739 15.904  1.00 120.08 ? 197 LYS C CE    1 
ATOM   4630 N NZ    . LYS C 1 150 ? -18.882 -33.072 16.065  1.00 124.62 ? 197 LYS C NZ    1 
ATOM   4631 N N     . GLN C 1 151 ? -16.114 -33.007 9.193   1.00 104.50 ? 198 GLN C N     1 
ATOM   4632 C CA    . GLN C 1 151 ? -15.509 -33.502 7.972   1.00 103.40 ? 198 GLN C CA    1 
ATOM   4633 C C     . GLN C 1 151 ? -14.794 -34.808 8.297   1.00 106.57 ? 198 GLN C C     1 
ATOM   4634 O O     . GLN C 1 151 ? -14.450 -35.070 9.455   1.00 105.67 ? 198 GLN C O     1 
ATOM   4635 C CB    . GLN C 1 151 ? -14.566 -32.455 7.349   1.00 101.94 ? 198 GLN C CB    1 
ATOM   4636 C CG    . GLN C 1 151 ? -14.035 -32.811 5.955   1.00 107.56 ? 198 GLN C CG    1 
ATOM   4637 C CD    . GLN C 1 151 ? -15.059 -32.789 4.844   1.00 124.78 ? 198 GLN C CD    1 
ATOM   4638 O OE1   . GLN C 1 151 ? -14.984 -31.962 3.931   1.00 120.15 ? 198 GLN C OE1   1 
ATOM   4639 N NE2   . GLN C 1 151 ? -15.982 -33.747 4.834   1.00 116.82 ? 198 GLN C NE2   1 
ATOM   4640 N N     . SER C 1 152 ? -14.651 -35.653 7.287   1.00 104.13 ? 199 SER C N     1 
ATOM   4641 C CA    . SER C 1 152 ? -13.962 -36.933 7.381   1.00 105.64 ? 199 SER C CA    1 
ATOM   4642 C C     . SER C 1 152 ? -12.926 -36.937 6.288   1.00 107.43 ? 199 SER C C     1 
ATOM   4643 O O     . SER C 1 152 ? -13.102 -36.247 5.280   1.00 105.47 ? 199 SER C O     1 
ATOM   4644 C CB    . SER C 1 152 ? -14.938 -38.082 7.150   1.00 112.93 ? 199 SER C CB    1 
ATOM   4645 O OG    . SER C 1 152 ? -14.269 -39.324 7.296   1.00 127.89 ? 199 SER C OG    1 
ATOM   4646 N N     . LEU C 1 153 ? -11.878 -37.745 6.443   1.00 104.92 ? 200 LEU C N     1 
ATOM   4647 C CA    . LEU C 1 153 ? -10.875 -37.863 5.388   1.00 105.17 ? 200 LEU C CA    1 
ATOM   4648 C C     . LEU C 1 153 ? -11.458 -38.616 4.168   1.00 110.71 ? 200 LEU C C     1 
ATOM   4649 O O     . LEU C 1 153 ? -10.839 -38.638 3.109   1.00 110.50 ? 200 LEU C O     1 
ATOM   4650 C CB    . LEU C 1 153 ? -9.569  -38.474 5.906   1.00 106.10 ? 200 LEU C CB    1 
ATOM   4651 C CG    . LEU C 1 153 ? -8.796  -37.586 6.873   1.00 109.23 ? 200 LEU C CG    1 
ATOM   4652 C CD1   . LEU C 1 153 ? -9.007  -38.028 8.328   1.00 110.86 ? 200 LEU C CD1   1 
ATOM   4653 C CD2   . LEU C 1 153 ? -7.357  -37.631 6.577   1.00 111.91 ? 200 LEU C CD2   1 
ATOM   4654 N N     . LYS C 1 154 ? -12.712 -39.119 4.289   1.00 108.91 ? 201 LYS C N     1 
ATOM   4655 C CA    . LYS C 1 154 ? -13.449 -39.761 3.189   1.00 111.26 ? 201 LYS C CA    1 
ATOM   4656 C C     . LYS C 1 154 ? -13.660 -38.723 2.084   1.00 111.89 ? 201 LYS C C     1 
ATOM   4657 O O     . LYS C 1 154 ? -13.851 -39.079 0.923   1.00 113.21 ? 201 LYS C O     1 
ATOM   4658 C CB    . LYS C 1 154 ? -14.814 -40.330 3.656   1.00 116.70 ? 201 LYS C CB    1 
ATOM   4659 C CG    . LYS C 1 154 ? -14.808 -41.243 4.903   1.00 140.93 ? 201 LYS C CG    1 
ATOM   4660 C CD    . LYS C 1 154 ? -13.753 -42.389 4.928   1.00 153.68 ? 201 LYS C CD    1 
ATOM   4661 C CE    . LYS C 1 154 ? -13.512 -42.938 6.330   1.00 159.56 ? 201 LYS C CE    1 
ATOM   4662 N NZ    . LYS C 1 154 ? -12.945 -41.923 7.276   1.00 153.33 ? 201 LYS C NZ    1 
ATOM   4663 N N     . ASN C 1 155 ? -13.584 -37.437 2.474   1.00 104.18 ? 202 ASN C N     1 
ATOM   4664 C CA    . ASN C 1 155 ? -13.676 -36.241 1.645   1.00 101.23 ? 202 ASN C CA    1 
ATOM   4665 C C     . ASN C 1 155 ? -12.311 -35.529 1.615   1.00 99.27  ? 202 ASN C C     1 
ATOM   4666 O O     . ASN C 1 155 ? -12.267 -34.287 1.655   1.00 95.27  ? 202 ASN C O     1 
ATOM   4667 C CB    . ASN C 1 155 ? -14.746 -35.297 2.207   1.00 102.40 ? 202 ASN C CB    1 
ATOM   4668 C CG    . ASN C 1 155 ? -16.132 -35.498 1.663   1.00 129.00 ? 202 ASN C CG    1 
ATOM   4669 O OD1   . ASN C 1 155 ? -16.356 -35.552 0.444   1.00 126.82 ? 202 ASN C OD1   1 
ATOM   4670 N ND2   . ASN C 1 155 ? -17.106 -35.516 2.558   1.00 120.25 ? 202 ASN C ND2   1 
ATOM   4671 N N     . ALA C 1 156 ? -11.192 -36.320 1.538   1.00 94.97  ? 203 ALA C N     1 
ATOM   4672 C CA    . ALA C 1 156 ? -9.814  -35.783 1.494   1.00 91.89  ? 203 ALA C CA    1 
ATOM   4673 C C     . ALA C 1 156 ? -9.603  -34.816 0.322   1.00 91.97  ? 203 ALA C C     1 
ATOM   4674 O O     . ALA C 1 156 ? -8.749  -33.932 0.394   1.00 89.62  ? 203 ALA C O     1 
ATOM   4675 C CB    . ALA C 1 156 ? -8.780  -36.906 1.462   1.00 94.00  ? 203 ALA C CB    1 
ATOM   4676 N N     . ASP C 1 157 ? -10.423 -34.958 -0.731  1.00 88.54  ? 204 ASP C N     1 
ATOM   4677 C CA    . ASP C 1 157 ? -10.396 -34.104 -1.913  1.00 87.64  ? 204 ASP C CA    1 
ATOM   4678 C C     . ASP C 1 157 ? -10.721 -32.616 -1.568  1.00 89.36  ? 204 ASP C C     1 
ATOM   4679 O O     . ASP C 1 157 ? -10.427 -31.731 -2.371  1.00 90.54  ? 204 ASP C O     1 
ATOM   4680 C CB    . ASP C 1 157 ? -11.333 -34.678 -3.002  1.00 91.43  ? 204 ASP C CB    1 
ATOM   4681 C CG    . ASP C 1 157 ? -12.815 -34.772 -2.640  1.00 103.60 ? 204 ASP C CG    1 
ATOM   4682 O OD1   . ASP C 1 157 ? -13.125 -35.118 -1.478  1.00 103.74 ? 204 ASP C OD1   1 
ATOM   4683 O OD2   . ASP C 1 157 ? -13.669 -34.563 -3.547  1.00 110.04 ? 204 ASP C OD2   1 
ATOM   4684 N N     . LEU C 1 158 ? -11.269 -32.353 -0.359  1.00 81.54  ? 205 LEU C N     1 
ATOM   4685 C CA    . LEU C 1 158 ? -11.652 -31.029 0.135   1.00 78.28  ? 205 LEU C CA    1 
ATOM   4686 C C     . LEU C 1 158 ? -10.853 -30.697 1.382   1.00 81.22  ? 205 LEU C C     1 
ATOM   4687 O O     . LEU C 1 158 ? -11.060 -29.646 2.000   1.00 78.67  ? 205 LEU C O     1 
ATOM   4688 C CB    . LEU C 1 158 ? -13.153 -31.025 0.500   1.00 78.05  ? 205 LEU C CB    1 
ATOM   4689 C CG    . LEU C 1 158 ? -14.143 -31.149 -0.641  1.00 81.91  ? 205 LEU C CG    1 
ATOM   4690 C CD1   . LEU C 1 158 ? -15.502 -31.427 -0.123  1.00 81.70  ? 205 LEU C CD1   1 
ATOM   4691 C CD2   . LEU C 1 158 ? -14.199 -29.890 -1.440  1.00 82.81  ? 205 LEU C CD2   1 
ATOM   4692 N N     . CYS C 1 159 ? -9.994  -31.635 1.798   1.00 78.64  ? 206 CYS C N     1 
ATOM   4693 C CA    . CYS C 1 159 ? -9.163  -31.473 2.976   1.00 77.40  ? 206 CYS C CA    1 
ATOM   4694 C C     . CYS C 1 159 ? -7.869  -30.755 2.632   1.00 82.39  ? 206 CYS C C     1 
ATOM   4695 O O     . CYS C 1 159 ? -7.664  -30.409 1.469   1.00 84.44  ? 206 CYS C O     1 
ATOM   4696 C CB    . CYS C 1 159 ? -8.934  -32.808 3.665   1.00 79.45  ? 206 CYS C CB    1 
ATOM   4697 S SG    . CYS C 1 159 ? -10.439 -33.500 4.404   1.00 84.59  ? 206 CYS C SG    1 
ATOM   4698 N N     . ILE C 1 160 ? -7.055  -30.406 3.638   1.00 76.39  ? 207 ILE C N     1 
ATOM   4699 C CA    . ILE C 1 160 ? -5.862  -29.591 3.415   1.00 72.78  ? 207 ILE C CA    1 
ATOM   4700 C C     . ILE C 1 160 ? -4.619  -30.349 3.825   1.00 75.19  ? 207 ILE C C     1 
ATOM   4701 O O     . ILE C 1 160 ? -4.414  -30.632 5.014   1.00 75.38  ? 207 ILE C O     1 
ATOM   4702 C CB    . ILE C 1 160 ? -6.046  -28.212 4.119   1.00 72.64  ? 207 ILE C CB    1 
ATOM   4703 C CG1   . ILE C 1 160 ? -7.161  -27.420 3.440   1.00 71.60  ? 207 ILE C CG1   1 
ATOM   4704 C CG2   . ILE C 1 160 ? -4.752  -27.412 4.133   1.00 72.66  ? 207 ILE C CG2   1 
ATOM   4705 C CD1   . ILE C 1 160 ? -7.908  -26.403 4.291   1.00 78.25  ? 207 ILE C CD1   1 
ATOM   4706 N N     . ALA C 1 161 ? -3.801  -30.718 2.847   1.00 70.79  ? 208 ALA C N     1 
ATOM   4707 C CA    . ALA C 1 161 ? -2.584  -31.462 3.198   1.00 70.32  ? 208 ALA C CA    1 
ATOM   4708 C C     . ALA C 1 161 ? -1.485  -30.503 3.644   1.00 75.30  ? 208 ALA C C     1 
ATOM   4709 O O     . ALA C 1 161 ? -1.346  -29.410 3.091   1.00 73.93  ? 208 ALA C O     1 
ATOM   4710 C CB    . ALA C 1 161 ? -2.108  -32.296 2.033   1.00 71.59  ? 208 ALA C CB    1 
ATOM   4711 N N     . SER C 1 162 ? -0.708  -30.916 4.652   1.00 73.05  ? 209 SER C N     1 
ATOM   4712 C CA    . SER C 1 162 ? 0.453   -30.176 5.137   1.00 72.51  ? 209 SER C CA    1 
ATOM   4713 C C     . SER C 1 162 ? 1.412   -29.959 3.947   1.00 76.63  ? 209 SER C C     1 
ATOM   4714 O O     . SER C 1 162 ? 1.664   -30.899 3.174   1.00 78.26  ? 209 SER C O     1 
ATOM   4715 C CB    . SER C 1 162 ? 1.159   -30.990 6.219   1.00 75.46  ? 209 SER C CB    1 
ATOM   4716 O OG    . SER C 1 162 ? 2.287   -30.338 6.768   1.00 78.71  ? 209 SER C OG    1 
ATOM   4717 N N     . GLY C 1 163 ? 1.896   -28.732 3.798   1.00 70.83  ? 210 GLY C N     1 
ATOM   4718 C CA    . GLY C 1 163 ? 2.822   -28.380 2.735   1.00 72.29  ? 210 GLY C CA    1 
ATOM   4719 C C     . GLY C 1 163 ? 2.191   -27.786 1.496   1.00 76.38  ? 210 GLY C C     1 
ATOM   4720 O O     . GLY C 1 163 ? 2.896   -27.437 0.535   1.00 79.01  ? 210 GLY C O     1 
ATOM   4721 N N     . THR C 1 164 ? 0.871   -27.637 1.519   1.00 68.97  ? 211 THR C N     1 
ATOM   4722 C CA    . THR C 1 164 ? 0.142   -27.030 0.423   1.00 66.83  ? 211 THR C CA    1 
ATOM   4723 C C     . THR C 1 164 ? -0.158  -25.581 0.767   1.00 72.23  ? 211 THR C C     1 
ATOM   4724 O O     . THR C 1 164 ? -0.051  -25.183 1.932   1.00 72.22  ? 211 THR C O     1 
ATOM   4725 C CB    . THR C 1 164 ? -1.098  -27.838 0.058   1.00 61.75  ? 211 THR C CB    1 
ATOM   4726 O OG1   . THR C 1 164 ? -2.027  -27.806 1.124   1.00 73.57  ? 211 THR C OG1   1 
ATOM   4727 C CG2   . THR C 1 164 ? -0.794  -29.251 -0.272  1.00 51.96  ? 211 THR C CG2   1 
ATOM   4728 N N     . LYS C 1 165 ? -0.551  -24.791 -0.251  1.00 68.90  ? 212 LYS C N     1 
ATOM   4729 C CA    . LYS C 1 165 ? -0.828  -23.369 -0.095  1.00 66.42  ? 212 LYS C CA    1 
ATOM   4730 C C     . LYS C 1 165 ? -2.293  -23.071 0.226   1.00 70.50  ? 212 LYS C C     1 
ATOM   4731 O O     . LYS C 1 165 ? -3.204  -23.733 -0.283  1.00 72.16  ? 212 LYS C O     1 
ATOM   4732 C CB    . LYS C 1 165 ? -0.297  -22.549 -1.305  1.00 67.24  ? 212 LYS C CB    1 
ATOM   4733 C CG    . LYS C 1 165 ? 1.153   -22.875 -1.703  1.00 64.76  ? 212 LYS C CG    1 
ATOM   4734 C CD    . LYS C 1 165 ? 1.672   -22.179 -3.004  1.00 86.90  ? 212 LYS C CD    1 
ATOM   4735 C CE    . LYS C 1 165 ? 0.898   -22.379 -4.327  1.00 103.95 ? 212 LYS C CE    1 
ATOM   4736 N NZ    . LYS C 1 165 ? -0.043  -21.237 -4.671  1.00 104.32 ? 212 LYS C NZ    1 
ATOM   4737 N N     . VAL C 1 166 ? -2.507  -22.082 1.088   1.00 66.36  ? 213 VAL C N     1 
ATOM   4738 C CA    . VAL C 1 166 ? -3.826  -21.583 1.478   1.00 66.05  ? 213 VAL C CA    1 
ATOM   4739 C C     . VAL C 1 166 ? -3.913  -20.040 1.372   1.00 69.31  ? 213 VAL C C     1 
ATOM   4740 O O     . VAL C 1 166 ? -2.905  -19.339 1.359   1.00 69.84  ? 213 VAL C O     1 
ATOM   4741 C CB    . VAL C 1 166 ? -4.331  -22.079 2.882   1.00 69.35  ? 213 VAL C CB    1 
ATOM   4742 C CG1   . VAL C 1 166 ? -4.480  -23.596 2.939   1.00 70.12  ? 213 VAL C CG1   1 
ATOM   4743 C CG2   . VAL C 1 166 ? -3.493  -21.535 4.050   1.00 67.87  ? 213 VAL C CG2   1 
ATOM   4744 N N     . ALA C 1 167 ? -5.117  -19.537 1.346   1.00 65.00  ? 214 ALA C N     1 
ATOM   4745 C CA    . ALA C 1 167 ? -5.406  -18.127 1.381   1.00 66.57  ? 214 ALA C CA    1 
ATOM   4746 C C     . ALA C 1 167 ? -6.347  -17.997 2.570   1.00 71.70  ? 214 ALA C C     1 
ATOM   4747 O O     . ALA C 1 167 ? -7.092  -18.933 2.878   1.00 69.72  ? 214 ALA C O     1 
ATOM   4748 C CB    . ALA C 1 167 ? -6.108  -17.693 0.107   1.00 68.45  ? 214 ALA C CB    1 
ATOM   4749 N N     . LEU C 1 168 ? -6.262  -16.864 3.281   1.00 69.50  ? 215 LEU C N     1 
ATOM   4750 C CA    . LEU C 1 168 ? -7.054  -16.638 4.478   1.00 67.30  ? 215 LEU C CA    1 
ATOM   4751 C C     . LEU C 1 168 ? -7.642  -15.276 4.420   1.00 71.55  ? 215 LEU C C     1 
ATOM   4752 O O     . LEU C 1 168 ? -6.922  -14.307 4.178   1.00 73.49  ? 215 LEU C O     1 
ATOM   4753 C CB    . LEU C 1 168 ? -6.167  -16.798 5.714   1.00 66.30  ? 215 LEU C CB    1 
ATOM   4754 C CG    . LEU C 1 168 ? -5.803  -18.243 6.021   1.00 70.84  ? 215 LEU C CG    1 
ATOM   4755 C CD1   . LEU C 1 168 ? -4.541  -18.343 6.833   1.00 70.85  ? 215 LEU C CD1   1 
ATOM   4756 C CD2   . LEU C 1 168 ? -6.950  -18.939 6.738   1.00 76.75  ? 215 LEU C CD2   1 
ATOM   4757 N N     . PHE C 1 169 ? -8.953  -15.186 4.571   1.00 66.61  ? 216 PHE C N     1 
ATOM   4758 C CA    . PHE C 1 169 ? -9.580  -13.874 4.555   1.00 66.89  ? 216 PHE C CA    1 
ATOM   4759 C C     . PHE C 1 169 ? -10.580 -13.701 5.644   1.00 68.77  ? 216 PHE C C     1 
ATOM   4760 O O     . PHE C 1 169 ? -11.186 -14.689 6.081   1.00 67.05  ? 216 PHE C O     1 
ATOM   4761 C CB    . PHE C 1 169 ? -10.208 -13.527 3.190   1.00 69.63  ? 216 PHE C CB    1 
ATOM   4762 C CG    . PHE C 1 169 ? -11.203 -14.517 2.638   1.00 70.82  ? 216 PHE C CG    1 
ATOM   4763 C CD1   . PHE C 1 169 ? -10.778 -15.605 1.874   1.00 73.25  ? 216 PHE C CD1   1 
ATOM   4764 C CD2   . PHE C 1 169 ? -12.569 -14.357 2.866   1.00 72.90  ? 216 PHE C CD2   1 
ATOM   4765 C CE1   . PHE C 1 169 ? -11.702 -16.533 1.369   1.00 74.47  ? 216 PHE C CE1   1 
ATOM   4766 C CE2   . PHE C 1 169 ? -13.494 -15.275 2.350   1.00 76.00  ? 216 PHE C CE2   1 
ATOM   4767 C CZ    . PHE C 1 169 ? -13.056 -16.355 1.599   1.00 74.04  ? 216 PHE C CZ    1 
ATOM   4768 N N     . ASN C 1 170 ? -10.766 -12.426 6.059   1.00 65.44  ? 217 ASN C N     1 
ATOM   4769 C CA    . ASN C 1 170 ? -11.758 -11.979 7.026   1.00 65.51  ? 217 ASN C CA    1 
ATOM   4770 C C     . ASN C 1 170 ? -12.776 -11.119 6.293   1.00 72.78  ? 217 ASN C C     1 
ATOM   4771 O O     . ASN C 1 170 ? -12.424 -10.361 5.395   1.00 72.42  ? 217 ASN C O     1 
ATOM   4772 C CB    . ASN C 1 170 ? -11.125 -11.229 8.182   1.00 63.53  ? 217 ASN C CB    1 
ATOM   4773 C CG    . ASN C 1 170 ? -12.099 -10.721 9.228   1.00 86.88  ? 217 ASN C CG    1 
ATOM   4774 O OD1   . ASN C 1 170 ? -12.624 -9.588  9.172   1.00 85.59  ? 217 ASN C OD1   1 
ATOM   4775 N ND2   . ASN C 1 170 ? -12.336 -11.539 10.223  1.00 77.53  ? 217 ASN C ND2   1 
ATOM   4776 N N     . ARG C 1 171 ? -14.048 -11.298 6.645   1.00 73.32  ? 218 ARG C N     1 
ATOM   4777 C CA    . ARG C 1 171 ? -15.212 -10.587 6.111   1.00 75.61  ? 218 ARG C CA    1 
ATOM   4778 C C     . ARG C 1 171 ? -16.098 -10.262 7.307   1.00 83.56  ? 218 ARG C C     1 
ATOM   4779 O O     . ARG C 1 171 ? -16.247 -11.090 8.203   1.00 82.55  ? 218 ARG C O     1 
ATOM   4780 C CB    . ARG C 1 171 ? -15.930 -11.469 5.107   1.00 73.54  ? 218 ARG C CB    1 
ATOM   4781 C CG    . ARG C 1 171 ? -17.127 -10.833 4.460   1.00 81.28  ? 218 ARG C CG    1 
ATOM   4782 C CD    . ARG C 1 171 ? -17.018 -11.020 2.977   1.00 86.77  ? 218 ARG C CD    1 
ATOM   4783 N NE    . ARG C 1 171 ? -17.216 -12.400 2.543   1.00 81.61  ? 218 ARG C NE    1 
ATOM   4784 C CZ    . ARG C 1 171 ? -16.673 -12.928 1.452   1.00 93.12  ? 218 ARG C CZ    1 
ATOM   4785 N NH1   . ARG C 1 171 ? -16.957 -14.172 1.099   1.00 92.64  ? 218 ARG C NH1   1 
ATOM   4786 N NH2   . ARG C 1 171 ? -15.840 -12.214 0.704   1.00 69.08  ? 218 ARG C NH2   1 
ATOM   4787 N N     . LEU C 1 172 ? -16.642 -9.049  7.353   1.00 84.95  ? 219 LEU C N     1 
ATOM   4788 C CA    . LEU C 1 172 ? -17.422 -8.591  8.500   1.00 86.49  ? 219 LEU C CA    1 
ATOM   4789 C C     . LEU C 1 172 ? -18.877 -8.245  8.160   1.00 93.25  ? 219 LEU C C     1 
ATOM   4790 O O     . LEU C 1 172 ? -19.140 -7.483  7.227   1.00 94.18  ? 219 LEU C O     1 
ATOM   4791 C CB    . LEU C 1 172 ? -16.657 -7.430  9.159   1.00 87.32  ? 219 LEU C CB    1 
ATOM   4792 C CG    . LEU C 1 172 ? -17.258 -6.734  10.357  1.00 95.08  ? 219 LEU C CG    1 
ATOM   4793 C CD1   . LEU C 1 172 ? -17.613 -7.712  11.498  1.00 95.54  ? 219 LEU C CD1   1 
ATOM   4794 C CD2   . LEU C 1 172 ? -16.362 -5.624  10.820  1.00 98.24  ? 219 LEU C CD2   1 
ATOM   4795 N N     . ARG C 1 173 ? -19.809 -8.826  8.950   1.00 91.42  ? 220 ARG C N     1 
ATOM   4796 C CA    . ARG C 1 173 ? -21.289 -8.734  8.886   1.00 93.29  ? 220 ARG C CA    1 
ATOM   4797 C C     . ARG C 1 173 ? -21.883 -8.959  7.493   1.00 97.55  ? 220 ARG C C     1 
ATOM   4798 O O     . ARG C 1 173 ? -22.760 -8.208  7.039   1.00 99.36  ? 220 ARG C O     1 
ATOM   4799 C CB    . ARG C 1 173 ? -21.843 -7.464  9.541   1.00 96.68  ? 220 ARG C CB    1 
ATOM   4800 C CG    . ARG C 1 173 ? -21.397 -7.192  10.972  1.00 106.83 ? 220 ARG C CG    1 
ATOM   4801 C CD    . ARG C 1 173 ? -21.789 -5.775  11.348  1.00 122.29 ? 220 ARG C CD    1 
ATOM   4802 N NE    . ARG C 1 173 ? -21.121 -4.788  10.496  1.00 131.26 ? 220 ARG C NE    1 
ATOM   4803 C CZ    . ARG C 1 173 ? -19.990 -4.173  10.820  1.00 140.02 ? 220 ARG C CZ    1 
ATOM   4804 N NH1   . ARG C 1 173 ? -19.408 -4.413  11.989  1.00 119.58 ? 220 ARG C NH1   1 
ATOM   4805 N NH2   . ARG C 1 173 ? -19.440 -3.300  9.985   1.00 126.38 ? 220 ARG C NH2   1 
ATOM   4806 N N     . SER C 1 174 ? -21.385 -10.017 6.823   1.00 92.41  ? 221 SER C N     1 
ATOM   4807 C CA    . SER C 1 174 ? -21.799 -10.501 5.499   1.00 92.27  ? 221 SER C CA    1 
ATOM   4808 C C     . SER C 1 174 ? -21.603 -9.493  4.356   1.00 96.75  ? 221 SER C C     1 
ATOM   4809 O O     . SER C 1 174 ? -22.247 -9.598  3.305   1.00 98.39  ? 221 SER C O     1 
ATOM   4810 C CB    . SER C 1 174 ? -23.212 -11.079 5.547   1.00 95.87  ? 221 SER C CB    1 
ATOM   4811 O OG    . SER C 1 174 ? -23.353 -11.976 6.637   1.00 99.52  ? 221 SER C OG    1 
ATOM   4812 N N     . GLN C 1 175 ? -20.652 -8.559  4.537   1.00 91.56  ? 222 GLN C N     1 
ATOM   4813 C CA    . GLN C 1 175 ? -20.357 -7.525  3.545   1.00 91.49  ? 222 GLN C CA    1 
ATOM   4814 C C     . GLN C 1 175 ? -19.158 -7.845  2.673   1.00 93.12  ? 222 GLN C C     1 
ATOM   4815 O O     . GLN C 1 175 ? -18.044 -7.918  3.188   1.00 91.18  ? 222 GLN C O     1 
ATOM   4816 C CB    . GLN C 1 175 ? -20.251 -6.134  4.205   1.00 93.02  ? 222 GLN C CB    1 
ATOM   4817 C CG    . GLN C 1 175 ? -21.572 -5.655  4.811   1.00 99.39  ? 222 GLN C CG    1 
ATOM   4818 C CD    . GLN C 1 175 ? -22.739 -5.628  3.830   1.00 122.39 ? 222 GLN C CD    1 
ATOM   4819 O OE1   . GLN C 1 175 ? -22.599 -5.293  2.638   1.00 120.68 ? 222 GLN C OE1   1 
ATOM   4820 N NE2   . GLN C 1 175 ? -23.919 -6.005  4.311   1.00 111.91 ? 222 GLN C NE2   1 
ATOM   4821 N N     . THR C 1 176 ? -19.376 -8.023  1.348   1.00 89.83  ? 223 THR C N     1 
ATOM   4822 C CA    . THR C 1 176 ? -18.267 -8.303  0.424   1.00 88.54  ? 223 THR C CA    1 
ATOM   4823 C C     . THR C 1 176 ? -17.184 -7.225  0.513   1.00 93.61  ? 223 THR C C     1 
ATOM   4824 O O     . THR C 1 176 ? -15.995 -7.543  0.478   1.00 93.89  ? 223 THR C O     1 
ATOM   4825 C CB    . THR C 1 176 ? -18.738 -8.577  -1.012  1.00 92.94  ? 223 THR C CB    1 
ATOM   4826 O OG1   . THR C 1 176 ? -17.605 -8.944  -1.822  1.00 95.08  ? 223 THR C OG1   1 
ATOM   4827 C CG2   . THR C 1 176 ? -19.493 -7.420  -1.629  1.00 88.24  ? 223 THR C CG2   1 
ATOM   4828 N N     . VAL C 1 177 ? -17.622 -5.968  0.677   1.00 89.76  ? 224 VAL C N     1 
ATOM   4829 C CA    . VAL C 1 177 ? -16.858 -4.735  0.847   1.00 89.76  ? 224 VAL C CA    1 
ATOM   4830 C C     . VAL C 1 177 ? -15.738 -4.899  1.899   1.00 89.35  ? 224 VAL C C     1 
ATOM   4831 O O     . VAL C 1 177 ? -14.612 -4.420  1.694   1.00 89.99  ? 224 VAL C O     1 
ATOM   4832 C CB    . VAL C 1 177 ? -17.826 -3.604  1.300   1.00 96.58  ? 224 VAL C CB    1 
ATOM   4833 C CG1   . VAL C 1 177 ? -17.251 -2.226  0.989   1.00 98.02  ? 224 VAL C CG1   1 
ATOM   4834 C CG2   . VAL C 1 177 ? -19.236 -3.783  0.705   1.00 98.49  ? 224 VAL C CG2   1 
ATOM   4835 N N     . SER C 1 178 ? -16.061 -5.548  3.031   1.00 80.64  ? 225 SER C N     1 
ATOM   4836 C CA    . SER C 1 178 ? -15.135 -5.695  4.143   1.00 77.54  ? 225 SER C CA    1 
ATOM   4837 C C     . SER C 1 178 ? -14.055 -6.752  3.977   1.00 82.64  ? 225 SER C C     1 
ATOM   4838 O O     . SER C 1 178 ? -13.158 -6.799  4.835   1.00 83.05  ? 225 SER C O     1 
ATOM   4839 C CB    . SER C 1 178 ? -15.898 -5.904  5.444   1.00 78.57  ? 225 SER C CB    1 
ATOM   4840 O OG    . SER C 1 178 ? -16.672 -7.090  5.393   1.00 88.44  ? 225 SER C OG    1 
ATOM   4841 N N     . THR C 1 179 ? -14.115 -7.613  2.904   1.00 77.47  ? 226 THR C N     1 
ATOM   4842 C CA    . THR C 1 179 ? -13.114 -8.676  2.714   1.00 73.98  ? 226 THR C CA    1 
ATOM   4843 C C     . THR C 1 179 ? -11.705 -8.138  2.693   1.00 74.58  ? 226 THR C C     1 
ATOM   4844 O O     . THR C 1 179 ? -11.383 -7.268  1.886   1.00 75.20  ? 226 THR C O     1 
ATOM   4845 C CB    . THR C 1 179 ? -13.380 -9.539  1.480   1.00 82.15  ? 226 THR C CB    1 
ATOM   4846 O OG1   . THR C 1 179 ? -14.770 -9.731  1.324   1.00 87.13  ? 226 THR C OG1   1 
ATOM   4847 C CG2   . THR C 1 179 ? -12.691 -10.886 1.556   1.00 74.58  ? 226 THR C CG2   1 
ATOM   4848 N N     . ARG C 1 180 ? -10.890 -8.666  3.599   1.00 69.88  ? 227 ARG C N     1 
ATOM   4849 C CA    . ARG C 1 180 ? -9.457  -8.400  3.809   1.00 70.25  ? 227 ARG C CA    1 
ATOM   4850 C C     . ARG C 1 180 ? -8.765  -9.754  3.829   1.00 70.07  ? 227 ARG C C     1 
ATOM   4851 O O     . ARG C 1 180 ? -9.189  -10.636 4.563   1.00 68.74  ? 227 ARG C O     1 
ATOM   4852 C CB    . ARG C 1 180 ? -9.178  -7.662  5.151   1.00 72.26  ? 227 ARG C CB    1 
ATOM   4853 C CG    . ARG C 1 180 ? -9.839  -6.287  5.291   1.00 85.75  ? 227 ARG C CG    1 
ATOM   4854 C CD    . ARG C 1 180 ? -8.875  -5.163  5.005   1.00 107.14 ? 227 ARG C CD    1 
ATOM   4855 N NE    . ARG C 1 180 ? -9.215  -3.958  5.762   1.00 122.48 ? 227 ARG C NE    1 
ATOM   4856 C CZ    . ARG C 1 180 ? -8.639  -2.770  5.595   1.00 140.82 ? 227 ARG C CZ    1 
ATOM   4857 N NH1   . ARG C 1 180 ? -7.693  -2.604  4.676   1.00 129.14 ? 227 ARG C NH1   1 
ATOM   4858 N NH2   . ARG C 1 180 ? -9.017  -1.734  6.331   1.00 131.68 ? 227 ARG C NH2   1 
ATOM   4859 N N     . TYR C 1 181 ? -7.720  -9.915  3.021   1.00 65.42  ? 228 TYR C N     1 
ATOM   4860 C CA    . TYR C 1 181 ? -6.948  -11.145 2.850   1.00 63.26  ? 228 TYR C CA    1 
ATOM   4861 C C     . TYR C 1 181 ? -5.610  -11.011 3.509   1.00 69.45  ? 228 TYR C C     1 
ATOM   4862 O O     . TYR C 1 181 ? -4.928  -9.976  3.325   1.00 69.81  ? 228 TYR C O     1 
ATOM   4863 C CB    . TYR C 1 181 ? -6.664  -11.357 1.356   1.00 64.28  ? 228 TYR C CB    1 
ATOM   4864 C CG    . TYR C 1 181 ? -7.916  -11.403 0.516   1.00 66.17  ? 228 TYR C CG    1 
ATOM   4865 C CD1   . TYR C 1 181 ? -8.623  -12.593 0.351   1.00 68.84  ? 228 TYR C CD1   1 
ATOM   4866 C CD2   . TYR C 1 181 ? -8.419  -10.251 -0.094  1.00 65.35  ? 228 TYR C CD2   1 
ATOM   4867 C CE1   . TYR C 1 181 ? -9.827  -12.623 -0.347  1.00 72.95  ? 228 TYR C CE1   1 
ATOM   4868 C CE2   . TYR C 1 181 ? -9.601  -10.280 -0.819  1.00 64.88  ? 228 TYR C CE2   1 
ATOM   4869 C CZ    . TYR C 1 181 ? -10.308 -11.464 -0.930  1.00 76.22  ? 228 TYR C CZ    1 
ATOM   4870 O OH    . TYR C 1 181 ? -11.463 -11.529 -1.656  1.00 83.08  ? 228 TYR C OH    1 
ATOM   4871 N N     . LEU C 1 182 ? -5.189  -12.088 4.225   1.00 65.49  ? 229 LEU C N     1 
ATOM   4872 C CA    . LEU C 1 182 ? -3.860  -12.139 4.821   1.00 65.36  ? 229 LEU C CA    1 
ATOM   4873 C C     . LEU C 1 182 ? -2.850  -12.024 3.675   1.00 75.62  ? 229 LEU C C     1 
ATOM   4874 O O     . LEU C 1 182 ? -3.013  -12.667 2.628   1.00 77.64  ? 229 LEU C O     1 
ATOM   4875 C CB    . LEU C 1 182 ? -3.619  -13.404 5.678   1.00 63.15  ? 229 LEU C CB    1 
ATOM   4876 C CG    . LEU C 1 182 ? -2.366  -13.368 6.606   1.00 66.96  ? 229 LEU C CG    1 
ATOM   4877 C CD1   . LEU C 1 182 ? -2.444  -12.225 7.635   1.00 66.60  ? 229 LEU C CD1   1 
ATOM   4878 C CD2   . LEU C 1 182 ? -2.180  -14.668 7.323   1.00 66.13  ? 229 LEU C CD2   1 
ATOM   4879 N N     . HIS C 1 183 ? -1.875  -11.127 3.847   1.00 74.32  ? 230 HIS C N     1 
ATOM   4880 C CA    . HIS C 1 183 ? -0.864  -10.809 2.851   1.00 76.13  ? 230 HIS C CA    1 
ATOM   4881 C C     . HIS C 1 183 ? 0.405   -10.267 3.519   1.00 79.71  ? 230 HIS C C     1 
ATOM   4882 O O     . HIS C 1 183 ? 0.340   -9.686  4.605   1.00 75.93  ? 230 HIS C O     1 
ATOM   4883 C CB    . HIS C 1 183 ? -1.459  -9.736  1.906   1.00 78.46  ? 230 HIS C CB    1 
ATOM   4884 C CG    . HIS C 1 183 ? -0.569  -9.284  0.785   1.00 83.78  ? 230 HIS C CG    1 
ATOM   4885 N ND1   . HIS C 1 183 ? -0.300  -10.098 -0.300  1.00 85.87  ? 230 HIS C ND1   1 
ATOM   4886 C CD2   . HIS C 1 183 ? 0.031   -8.095  0.588   1.00 86.99  ? 230 HIS C CD2   1 
ATOM   4887 C CE1   . HIS C 1 183 ? 0.463   -9.387  -1.105  1.00 86.74  ? 230 HIS C CE1   1 
ATOM   4888 N NE2   . HIS C 1 183 ? 0.686   -8.176  -0.611  1.00 88.37  ? 230 HIS C NE2   1 
ATOM   4889 N N     . VAL C 1 184 ? 1.555   -10.436 2.840   1.00 80.08  ? 231 VAL C N     1 
ATOM   4890 C CA    . VAL C 1 184 ? 2.850   -9.877  3.267   1.00 82.27  ? 231 VAL C CA    1 
ATOM   4891 C C     . VAL C 1 184 ? 3.321   -8.825  2.222   1.00 92.42  ? 231 VAL C C     1 
ATOM   4892 O O     . VAL C 1 184 ? 3.735   -9.185  1.111   1.00 93.41  ? 231 VAL C O     1 
ATOM   4893 C CB    . VAL C 1 184 ? 3.940   -10.943 3.529   1.00 84.82  ? 231 VAL C CB    1 
ATOM   4894 C CG1   . VAL C 1 184 ? 5.088   -10.336 4.309   1.00 85.79  ? 231 VAL C CG1   1 
ATOM   4895 C CG2   . VAL C 1 184 ? 3.375   -12.161 4.259   1.00 82.47  ? 231 VAL C CG2   1 
ATOM   4896 N N     . GLU C 1 185 ? 3.202   -7.545  2.556   1.00 92.91  ? 232 GLU C N     1 
ATOM   4897 C CA    . GLU C 1 185 ? 3.660   -6.469  1.684   1.00 97.92  ? 232 GLU C CA    1 
ATOM   4898 C C     . GLU C 1 185 ? 4.713   -5.733  2.477   1.00 107.84 ? 232 GLU C C     1 
ATOM   4899 O O     . GLU C 1 185 ? 4.483   -5.352  3.634   1.00 108.20 ? 232 GLU C O     1 
ATOM   4900 C CB    . GLU C 1 185 ? 2.519   -5.535  1.244   1.00 100.05 ? 232 GLU C CB    1 
ATOM   4901 C CG    . GLU C 1 185 ? 2.734   -4.859  -0.108  1.00 113.42 ? 232 GLU C CG    1 
ATOM   4902 C CD    . GLU C 1 185 ? 1.769   -3.742  -0.475  1.00 137.52 ? 232 GLU C CD    1 
ATOM   4903 O OE1   . GLU C 1 185 ? 1.006   -3.281  0.408   1.00 121.85 ? 232 GLU C OE1   1 
ATOM   4904 O OE2   . GLU C 1 185 ? 1.814   -3.293  -1.644  1.00 138.28 ? 232 GLU C OE2   1 
ATOM   4905 N N     . GLY C 1 186 ? 5.887   -5.614  1.882   1.00 108.14 ? 233 GLY C N     1 
ATOM   4906 C CA    . GLY C 1 186 ? 7.036   -5.040  2.563   1.00 110.59 ? 233 GLY C CA    1 
ATOM   4907 C C     . GLY C 1 186 ? 7.557   -6.057  3.563   1.00 111.29 ? 233 GLY C C     1 
ATOM   4908 O O     . GLY C 1 186 ? 7.639   -7.260  3.244   1.00 109.31 ? 233 GLY C O     1 
ATOM   4909 N N     . GLY C 1 187 ? 7.861   -5.583  4.773   1.00 105.08 ? 234 GLY C N     1 
ATOM   4910 C CA    . GLY C 1 187 ? 8.362   -6.462  5.822   1.00 103.00 ? 234 GLY C CA    1 
ATOM   4911 C C     . GLY C 1 187 ? 7.347   -6.759  6.901   1.00 100.82 ? 234 GLY C C     1 
ATOM   4912 O O     . GLY C 1 187 ? 7.710   -6.881  8.076   1.00 100.37 ? 234 GLY C O     1 
ATOM   4913 N N     . ASN C 1 188 ? 6.064   -6.817  6.527   1.00 92.47  ? 235 ASN C N     1 
ATOM   4914 C CA    . ASN C 1 188 ? 5.010   -6.984  7.513   1.00 89.48  ? 235 ASN C CA    1 
ATOM   4915 C C     . ASN C 1 188 ? 3.816   -7.724  6.960   1.00 91.11  ? 235 ASN C C     1 
ATOM   4916 O O     . ASN C 1 188 ? 3.445   -7.539  5.797   1.00 92.49  ? 235 ASN C O     1 
ATOM   4917 C CB    . ASN C 1 188 ? 4.493   -5.596  7.998   1.00 90.96  ? 235 ASN C CB    1 
ATOM   4918 C CG    . ASN C 1 188 ? 5.404   -4.701  8.810   1.00 117.83 ? 235 ASN C CG    1 
ATOM   4919 O OD1   . ASN C 1 188 ? 5.170   -4.471  9.995   1.00 114.05 ? 235 ASN C OD1   1 
ATOM   4920 N ND2   . ASN C 1 188 ? 6.322   -4.002  8.160   1.00 115.92 ? 235 ASN C ND2   1 
ATOM   4921 N N     . PHE C 1 189 ? 3.157   -8.485  7.835   1.00 83.74  ? 236 PHE C N     1 
ATOM   4922 C CA    . PHE C 1 189 ? 1.887   -9.128  7.560   1.00 80.65  ? 236 PHE C CA    1 
ATOM   4923 C C     . PHE C 1 189 ? 0.830   -8.048  7.749   1.00 83.97  ? 236 PHE C C     1 
ATOM   4924 O O     . PHE C 1 189 ? 0.918   -7.209  8.660   1.00 83.72  ? 236 PHE C O     1 
ATOM   4925 C CB    . PHE C 1 189 ? 1.599   -10.262 8.563   1.00 80.52  ? 236 PHE C CB    1 
ATOM   4926 C CG    . PHE C 1 189 ? 2.188   -11.591 8.187   1.00 81.58  ? 236 PHE C CG    1 
ATOM   4927 C CD1   . PHE C 1 189 ? 3.544   -11.832 8.329   1.00 87.35  ? 236 PHE C CD1   1 
ATOM   4928 C CD2   . PHE C 1 189 ? 1.391   -12.599 7.675   1.00 81.24  ? 236 PHE C CD2   1 
ATOM   4929 C CE1   . PHE C 1 189 ? 4.094   -13.062 7.956   1.00 88.21  ? 236 PHE C CE1   1 
ATOM   4930 C CE2   . PHE C 1 189 ? 1.943   -13.825 7.307   1.00 83.94  ? 236 PHE C CE2   1 
ATOM   4931 C CZ    . PHE C 1 189 ? 3.289   -14.048 7.448   1.00 83.56  ? 236 PHE C CZ    1 
ATOM   4932 N N     . HIS C 1 190 ? -0.160  -8.068  6.877   1.00 80.42  ? 237 HIS C N     1 
ATOM   4933 C CA    . HIS C 1 190 ? -1.267  -7.146  6.909   1.00 80.24  ? 237 HIS C CA    1 
ATOM   4934 C C     . HIS C 1 190 ? -2.518  -7.825  6.328   1.00 81.26  ? 237 HIS C C     1 
ATOM   4935 O O     . HIS C 1 190 ? -2.454  -8.949  5.815   1.00 78.87  ? 237 HIS C O     1 
ATOM   4936 C CB    . HIS C 1 190 ? -0.881  -5.799  6.245   1.00 84.19  ? 237 HIS C CB    1 
ATOM   4937 C CG    . HIS C 1 190 ? -0.848  -5.771  4.741   1.00 89.46  ? 237 HIS C CG    1 
ATOM   4938 N ND1   . HIS C 1 190 ? -0.251  -6.781  4.001   1.00 91.16  ? 237 HIS C ND1   1 
ATOM   4939 C CD2   . HIS C 1 190 ? -1.290  -4.813  3.885   1.00 92.96  ? 237 HIS C CD2   1 
ATOM   4940 C CE1   . HIS C 1 190 ? -0.396  -6.428  2.731   1.00 91.31  ? 237 HIS C CE1   1 
ATOM   4941 N NE2   . HIS C 1 190 ? -1.006  -5.251  2.610   1.00 92.85  ? 237 HIS C NE2   1 
ATOM   4942 N N     . ALA C 1 191 ? -3.668  -7.201  6.527   1.00 77.44  ? 238 ALA C N     1 
ATOM   4943 C CA    . ALA C 1 191 ? -4.923  -7.684  5.986   1.00 75.42  ? 238 ALA C CA    1 
ATOM   4944 C C     . ALA C 1 191 ? -5.214  -6.702  4.831   1.00 79.55  ? 238 ALA C C     1 
ATOM   4945 O O     . ALA C 1 191 ? -5.514  -5.519  5.047   1.00 76.83  ? 238 ALA C O     1 
ATOM   4946 C CB    . ALA C 1 191 ? -6.014  -7.652  7.043   1.00 75.26  ? 238 ALA C CB    1 
ATOM   4947 N N     . SER C 1 192 ? -4.978  -7.196  3.599   1.00 76.86  ? 239 SER C N     1 
ATOM   4948 C CA    . SER C 1 192 ? -5.137  -6.421  2.393   1.00 78.09  ? 239 SER C CA    1 
ATOM   4949 C C     . SER C 1 192 ? -6.563  -6.481  1.843   1.00 85.08  ? 239 SER C C     1 
ATOM   4950 O O     . SER C 1 192 ? -7.220  -7.521  1.875   1.00 83.35  ? 239 SER C O     1 
ATOM   4951 C CB    . SER C 1 192 ? -4.139  -6.885  1.348   1.00 78.77  ? 239 SER C CB    1 
ATOM   4952 O OG    . SER C 1 192 ? -4.375  -6.178  0.145   1.00 85.63  ? 239 SER C OG    1 
ATOM   4953 N N     . SER C 1 193 ? -7.035  -5.368  1.326   1.00 84.97  ? 240 SER C N     1 
ATOM   4954 C CA    . SER C 1 193 ? -8.362  -5.352  0.740   1.00 86.29  ? 240 SER C CA    1 
ATOM   4955 C C     . SER C 1 193 ? -8.198  -5.535  -0.756  1.00 92.21  ? 240 SER C C     1 
ATOM   4956 O O     . SER C 1 193 ? -9.163  -5.869  -1.460  1.00 93.43  ? 240 SER C O     1 
ATOM   4957 C CB    . SER C 1 193 ? -9.055  -4.024  1.029   1.00 92.61  ? 240 SER C CB    1 
ATOM   4958 O OG    . SER C 1 193 ? -8.251  -2.945  0.584   1.00 106.77 ? 240 SER C OG    1 
ATOM   4959 N N     . GLN C 1 194 ? -6.964  -5.310  -1.243  1.00 87.47  ? 241 GLN C N     1 
ATOM   4960 C CA    . GLN C 1 194 ? -6.675  -5.360  -2.666  1.00 87.28  ? 241 GLN C CA    1 
ATOM   4961 C C     . GLN C 1 194 ? -5.824  -6.519  -3.153  1.00 85.70  ? 241 GLN C C     1 
ATOM   4962 O O     . GLN C 1 194 ? -5.936  -6.869  -4.312  1.00 85.94  ? 241 GLN C O     1 
ATOM   4963 C CB    . GLN C 1 194 ? -6.185  -3.975  -3.164  1.00 91.93  ? 241 GLN C CB    1 
ATOM   4964 C CG    . GLN C 1 194 ? -7.323  -2.924  -3.327  1.00 107.16 ? 241 GLN C CG    1 
ATOM   4965 C CD    . GLN C 1 194 ? -8.434  -3.331  -4.318  1.00 121.57 ? 241 GLN C CD    1 
ATOM   4966 O OE1   . GLN C 1 194 ? -8.201  -3.588  -5.529  1.00 110.13 ? 241 GLN C OE1   1 
ATOM   4967 N NE2   . GLN C 1 194 ? -9.677  -3.391  -3.822  1.00 104.10 ? 241 GLN C NE2   1 
ATOM   4968 N N     . GLN C 1 195 ? -5.038  -7.147  -2.260  1.00 79.25  ? 242 GLN C N     1 
ATOM   4969 C CA    . GLN C 1 195 ? -4.103  -8.254  -2.500  1.00 77.47  ? 242 GLN C CA    1 
ATOM   4970 C C     . GLN C 1 195 ? -4.271  -9.407  -1.523  1.00 79.46  ? 242 GLN C C     1 
ATOM   4971 O O     . GLN C 1 195 ? -4.876  -9.244  -0.468  1.00 78.29  ? 242 GLN C O     1 
ATOM   4972 C CB    . GLN C 1 195 ? -2.667  -7.753  -2.395  1.00 80.05  ? 242 GLN C CB    1 
ATOM   4973 C CG    . GLN C 1 195 ? -2.246  -6.908  -3.588  1.00 98.73  ? 242 GLN C CG    1 
ATOM   4974 C CD    . GLN C 1 195 ? -0.867  -6.354  -3.411  1.00 105.28 ? 242 GLN C CD    1 
ATOM   4975 O OE1   . GLN C 1 195 ? 0.077   -6.756  -4.111  1.00 101.73 ? 242 GLN C OE1   1 
ATOM   4976 N NE2   . GLN C 1 195 ? -0.722  -5.453  -2.440  1.00 88.29  ? 242 GLN C NE2   1 
ATOM   4977 N N     . TRP C 1 196 ? -3.721  -10.589 -1.882  1.00 74.65  ? 243 TRP C N     1 
ATOM   4978 C CA    . TRP C 1 196 ? -3.817  -11.821 -1.104  1.00 71.47  ? 243 TRP C CA    1 
ATOM   4979 C C     . TRP C 1 196 ? -2.592  -12.696 -1.262  1.00 76.62  ? 243 TRP C C     1 
ATOM   4980 O O     . TRP C 1 196 ? -2.001  -12.773 -2.342  1.00 77.95  ? 243 TRP C O     1 
ATOM   4981 C CB    . TRP C 1 196 ? -5.111  -12.616 -1.405  1.00 68.62  ? 243 TRP C CB    1 
ATOM   4982 C CG    . TRP C 1 196 ? -5.310  -13.113 -2.804  1.00 70.25  ? 243 TRP C CG    1 
ATOM   4983 C CD1   . TRP C 1 196 ? -6.030  -12.497 -3.776  1.00 74.45  ? 243 TRP C CD1   1 
ATOM   4984 C CD2   . TRP C 1 196 ? -4.964  -14.418 -3.330  1.00 70.21  ? 243 TRP C CD2   1 
ATOM   4985 N NE1   . TRP C 1 196 ? -6.083  -13.290 -4.907  1.00 74.97  ? 243 TRP C NE1   1 
ATOM   4986 C CE2   . TRP C 1 196 ? -5.440  -14.474 -4.660  1.00 74.86  ? 243 TRP C CE2   1 
ATOM   4987 C CE3   . TRP C 1 196 ? -4.323  -15.555 -2.800  1.00 70.82  ? 243 TRP C CE3   1 
ATOM   4988 C CZ2   . TRP C 1 196 ? -5.262  -15.599 -5.482  1.00 73.79  ? 243 TRP C CZ2   1 
ATOM   4989 C CZ3   . TRP C 1 196 ? -4.152  -16.672 -3.622  1.00 72.10  ? 243 TRP C CZ3   1 
ATOM   4990 C CH2   . TRP C 1 196 ? -4.619  -16.686 -4.944  1.00 73.21  ? 243 TRP C CH2   1 
ATOM   4991 N N     . GLY C 1 197 ? -2.207  -13.330 -0.163  1.00 72.07  ? 244 GLY C N     1 
ATOM   4992 C CA    . GLY C 1 197 ? -1.057  -14.208 -0.144  1.00 71.85  ? 244 GLY C CA    1 
ATOM   4993 C C     . GLY C 1 197 ? -1.465  -15.653 -0.246  1.00 76.62  ? 244 GLY C C     1 
ATOM   4994 O O     . GLY C 1 197 ? -2.620  -15.998 0.017   1.00 78.55  ? 244 GLY C O     1 
ATOM   4995 N N     . ALA C 1 198 ? -0.539  -16.489 -0.697  1.00 71.25  ? 245 ALA C N     1 
ATOM   4996 C CA    . ALA C 1 198 ? -0.725  -17.917 -0.714  1.00 69.24  ? 245 ALA C CA    1 
ATOM   4997 C C     . ALA C 1 198 ? 0.279   -18.331 0.335   1.00 75.35  ? 245 ALA C C     1 
ATOM   4998 O O     . ALA C 1 198 ? 1.412   -17.820 0.362   1.00 76.76  ? 245 ALA C O     1 
ATOM   4999 C CB    . ALA C 1 198 ? -0.381  -18.503 -2.055  1.00 70.53  ? 245 ALA C CB    1 
ATOM   5000 N N     . PHE C 1 199 ? -0.171  -19.156 1.273   1.00 69.42  ? 246 PHE C N     1 
ATOM   5001 C CA    . PHE C 1 199 ? 0.654   -19.539 2.390   1.00 67.97  ? 246 PHE C CA    1 
ATOM   5002 C C     . PHE C 1 199 ? 0.781   -21.017 2.494   1.00 72.86  ? 246 PHE C C     1 
ATOM   5003 O O     . PHE C 1 199 ? -0.217  -21.709 2.458   1.00 74.40  ? 246 PHE C O     1 
ATOM   5004 C CB    . PHE C 1 199 ? 0.002   -18.994 3.671   1.00 67.51  ? 246 PHE C CB    1 
ATOM   5005 C CG    . PHE C 1 199 ? -0.047  -17.486 3.719   1.00 67.11  ? 246 PHE C CG    1 
ATOM   5006 C CD1   . PHE C 1 199 ? 1.031   -16.753 4.231   1.00 67.39  ? 246 PHE C CD1   1 
ATOM   5007 C CD2   . PHE C 1 199 ? -1.178  -16.799 3.292   1.00 66.42  ? 246 PHE C CD2   1 
ATOM   5008 C CE1   . PHE C 1 199 ? 0.997   -15.371 4.266   1.00 67.06  ? 246 PHE C CE1   1 
ATOM   5009 C CE2   . PHE C 1 199 ? -1.220  -15.402 3.340   1.00 69.47  ? 246 PHE C CE2   1 
ATOM   5010 C CZ    . PHE C 1 199 ? -0.128  -14.696 3.817   1.00 67.83  ? 246 PHE C CZ    1 
ATOM   5011 N N     . TYR C 1 200 ? 1.979   -21.521 2.663   1.00 69.75  ? 247 TYR C N     1 
ATOM   5012 C CA    . TYR C 1 200 ? 2.146   -22.936 2.917   1.00 69.89  ? 247 TYR C CA    1 
ATOM   5013 C C     . TYR C 1 200 ? 1.632   -23.123 4.328   1.00 73.58  ? 247 TYR C C     1 
ATOM   5014 O O     . TYR C 1 200 ? 1.873   -22.254 5.204   1.00 74.24  ? 247 TYR C O     1 
ATOM   5015 C CB    . TYR C 1 200 ? 3.624   -23.331 2.881   1.00 72.89  ? 247 TYR C CB    1 
ATOM   5016 C CG    . TYR C 1 200 ? 4.196   -23.302 1.491   1.00 78.36  ? 247 TYR C CG    1 
ATOM   5017 C CD1   . TYR C 1 200 ? 4.012   -24.373 0.619   1.00 81.71  ? 247 TYR C CD1   1 
ATOM   5018 C CD2   . TYR C 1 200 ? 4.889   -22.190 1.024   1.00 80.33  ? 247 TYR C CD2   1 
ATOM   5019 C CE1   . TYR C 1 200 ? 4.512   -24.340 -0.682  1.00 84.40  ? 247 TYR C CE1   1 
ATOM   5020 C CE2   . TYR C 1 200 ? 5.421   -22.160 -0.262  1.00 82.95  ? 247 TYR C CE2   1 
ATOM   5021 C CZ    . TYR C 1 200 ? 5.215   -23.229 -1.120  1.00 92.69  ? 247 TYR C CZ    1 
ATOM   5022 O OH    . TYR C 1 200 ? 5.715   -23.190 -2.405  1.00 99.27  ? 247 TYR C OH    1 
ATOM   5023 N N     . ILE C 1 201 ? 0.902   -24.223 4.545   1.00 66.18  ? 248 ILE C N     1 
ATOM   5024 C CA    . ILE C 1 201 ? 0.417   -24.554 5.866   1.00 63.86  ? 248 ILE C CA    1 
ATOM   5025 C C     . ILE C 1 201 ? 1.145   -25.803 6.252   1.00 71.48  ? 248 ILE C C     1 
ATOM   5026 O O     . ILE C 1 201 ? 0.852   -26.878 5.736   1.00 73.53  ? 248 ILE C O     1 
ATOM   5027 C CB    . ILE C 1 201 ? -1.125  -24.615 5.978   1.00 65.18  ? 248 ILE C CB    1 
ATOM   5028 C CG1   . ILE C 1 201 ? -1.574  -24.818 7.440   1.00 64.13  ? 248 ILE C CG1   1 
ATOM   5029 C CG2   . ILE C 1 201 ? -1.764  -25.622 4.979   1.00 67.15  ? 248 ILE C CG2   1 
ATOM   5030 C CD1   . ILE C 1 201 ? -3.065  -24.594 7.715   1.00 75.86  ? 248 ILE C CD1   1 
ATOM   5031 N N     . HIS C 1 202 ? 2.167   -25.654 7.103   1.00 68.88  ? 249 HIS C N     1 
ATOM   5032 C CA    . HIS C 1 202 ? 2.986   -26.782 7.543   1.00 69.12  ? 249 HIS C CA    1 
ATOM   5033 C C     . HIS C 1 202 ? 2.539   -27.312 8.872   1.00 73.65  ? 249 HIS C C     1 
ATOM   5034 O O     . HIS C 1 202 ? 2.325   -26.540 9.800   1.00 73.67  ? 249 HIS C O     1 
ATOM   5035 C CB    . HIS C 1 202 ? 4.449   -26.374 7.629   1.00 70.84  ? 249 HIS C CB    1 
ATOM   5036 C CG    . HIS C 1 202 ? 5.030   -25.940 6.317   1.00 75.20  ? 249 HIS C CG    1 
ATOM   5037 N ND1   . HIS C 1 202 ? 5.181   -26.830 5.258   1.00 78.01  ? 249 HIS C ND1   1 
ATOM   5038 C CD2   . HIS C 1 202 ? 5.509   -24.729 5.943   1.00 76.82  ? 249 HIS C CD2   1 
ATOM   5039 C CE1   . HIS C 1 202 ? 5.749   -26.134 4.288   1.00 78.08  ? 249 HIS C CE1   1 
ATOM   5040 N NE2   . HIS C 1 202 ? 5.976   -24.869 4.656   1.00 77.84  ? 249 HIS C NE2   1 
ATOM   5041 N N     . LEU C 1 203 ? 2.415   -28.634 8.981   1.00 70.98  ? 250 LEU C N     1 
ATOM   5042 C CA    . LEU C 1 203 ? 2.061   -29.275 10.236  1.00 70.16  ? 250 LEU C CA    1 
ATOM   5043 C C     . LEU C 1 203 ? 3.341   -29.529 11.057  1.00 76.81  ? 250 LEU C C     1 
ATOM   5044 O O     . LEU C 1 203 ? 4.284   -30.156 10.570  1.00 77.97  ? 250 LEU C O     1 
ATOM   5045 C CB    . LEU C 1 203 ? 1.310   -30.586 9.947   1.00 70.59  ? 250 LEU C CB    1 
ATOM   5046 C CG    . LEU C 1 203 ? 1.090   -31.561 11.108  1.00 75.58  ? 250 LEU C CG    1 
ATOM   5047 C CD1   . LEU C 1 203 ? 0.218   -30.953 12.217  1.00 73.87  ? 250 LEU C CD1   1 
ATOM   5048 C CD2   . LEU C 1 203 ? 0.530   -32.842 10.610  1.00 77.33  ? 250 LEU C CD2   1 
ATOM   5049 N N     . LEU C 1 204 ? 3.368   -29.022 12.291  1.00 73.21  ? 251 LEU C N     1 
ATOM   5050 C CA    . LEU C 1 204 ? 4.470   -29.232 13.228  1.00 74.32  ? 251 LEU C CA    1 
ATOM   5051 C C     . LEU C 1 204 ? 4.022   -30.209 14.335  1.00 84.02  ? 251 LEU C C     1 
ATOM   5052 O O     . LEU C 1 204 ? 2.821   -30.440 14.505  1.00 82.68  ? 251 LEU C O     1 
ATOM   5053 C CB    . LEU C 1 204 ? 4.875   -27.913 13.924  1.00 72.54  ? 251 LEU C CB    1 
ATOM   5054 C CG    . LEU C 1 204 ? 5.124   -26.637 13.141  1.00 75.94  ? 251 LEU C CG    1 
ATOM   5055 C CD1   . LEU C 1 204 ? 5.580   -25.547 14.074  1.00 74.79  ? 251 LEU C CD1   1 
ATOM   5056 C CD2   . LEU C 1 204 ? 6.142   -26.821 12.090  1.00 82.36  ? 251 LEU C CD2   1 
ATOM   5057 N N     . ASP C 1 205 ? 4.987   -30.723 15.137  1.00 86.56  ? 252 ASP C N     1 
ATOM   5058 C CA    . ASP C 1 205 ? 4.685   -31.539 16.311  1.00 88.65  ? 252 ASP C CA    1 
ATOM   5059 C C     . ASP C 1 205 ? 4.331   -30.578 17.435  1.00 90.44  ? 252 ASP C C     1 
ATOM   5060 O O     . ASP C 1 205 ? 4.813   -29.434 17.470  1.00 89.23  ? 252 ASP C O     1 
ATOM   5061 C CB    . ASP C 1 205 ? 5.907   -32.348 16.767  1.00 95.19  ? 252 ASP C CB    1 
ATOM   5062 C CG    . ASP C 1 205 ? 6.550   -33.170 15.682  1.00 120.92 ? 252 ASP C CG    1 
ATOM   5063 O OD1   . ASP C 1 205 ? 7.441   -32.626 14.974  1.00 125.29 ? 252 ASP C OD1   1 
ATOM   5064 O OD2   . ASP C 1 205 ? 6.166   -34.360 15.530  1.00 128.53 ? 252 ASP C OD2   1 
ATOM   5065 N N     . ASP C 1 206 ? 3.547   -31.057 18.390  1.00 86.93  ? 253 ASP C N     1 
ATOM   5066 C CA    . ASP C 1 206 ? 3.190   -30.263 19.552  1.00 86.19  ? 253 ASP C CA    1 
ATOM   5067 C C     . ASP C 1 206 ? 4.446   -29.889 20.355  1.00 94.78  ? 253 ASP C C     1 
ATOM   5068 O O     . ASP C 1 206 ? 4.512   -28.775 20.865  1.00 95.60  ? 253 ASP C O     1 
ATOM   5069 C CB    . ASP C 1 206 ? 2.209   -31.033 20.431  1.00 87.92  ? 253 ASP C CB    1 
ATOM   5070 C CG    . ASP C 1 206 ? 0.925   -31.446 19.751  1.00 97.56  ? 253 ASP C CG    1 
ATOM   5071 O OD1   . ASP C 1 206 ? 0.554   -30.810 18.718  1.00 101.71 ? 253 ASP C OD1   1 
ATOM   5072 O OD2   . ASP C 1 206 ? 0.233   -32.321 20.294  1.00 95.26  ? 253 ASP C OD2   1 
ATOM   5073 N N     . ASP C 1 207 ? 5.448   -30.789 20.434  1.00 93.74  ? 254 ASP C N     1 
ATOM   5074 C CA    . ASP C 1 207 ? 6.679   -30.514 21.173  1.00 96.49  ? 254 ASP C CA    1 
ATOM   5075 C C     . ASP C 1 207 ? 7.664   -29.604 20.423  1.00 100.76 ? 254 ASP C C     1 
ATOM   5076 O O     . ASP C 1 207 ? 8.568   -29.028 21.048  1.00 103.22 ? 254 ASP C O     1 
ATOM   5077 C CB    . ASP C 1 207 ? 7.337   -31.804 21.713  1.00 102.54 ? 254 ASP C CB    1 
ATOM   5078 C CG    . ASP C 1 207 ? 7.872   -32.741 20.646  1.00 125.18 ? 254 ASP C CG    1 
ATOM   5079 O OD1   . ASP C 1 207 ? 7.079   -33.147 19.754  1.00 127.40 ? 254 ASP C OD1   1 
ATOM   5080 O OD2   . ASP C 1 207 ? 9.073   -33.107 20.723  1.00 134.85 ? 254 ASP C OD2   1 
ATOM   5081 N N     . GLU C 1 208 ? 7.467   -29.434 19.107  1.00 95.34  ? 255 GLU C N     1 
ATOM   5082 C CA    . GLU C 1 208 ? 8.289   -28.539 18.294  1.00 95.64  ? 255 GLU C CA    1 
ATOM   5083 C C     . GLU C 1 208 ? 8.185   -27.111 18.860  1.00 100.51 ? 255 GLU C C     1 
ATOM   5084 O O     . GLU C 1 208 ? 7.079   -26.538 18.968  1.00 99.16  ? 255 GLU C O     1 
ATOM   5085 C CB    . GLU C 1 208 ? 7.860   -28.585 16.810  1.00 95.45  ? 255 GLU C CB    1 
ATOM   5086 C CG    . GLU C 1 208 ? 8.657   -27.692 15.873  1.00 101.11 ? 255 GLU C CG    1 
ATOM   5087 C CD    . GLU C 1 208 ? 10.086  -28.122 15.643  1.00 129.95 ? 255 GLU C CD    1 
ATOM   5088 O OE1   . GLU C 1 208 ? 10.289  -29.177 15.002  1.00 131.45 ? 255 GLU C OE1   1 
ATOM   5089 O OE2   . GLU C 1 208 ? 11.003  -27.400 16.095  1.00 134.11 ? 255 GLU C OE2   1 
ATOM   5090 N N     . SER C 1 209 ? 9.355   -26.585 19.272  1.00 97.79  ? 256 SER C N     1 
ATOM   5091 C CA    . SER C 1 209 ? 9.558   -25.254 19.853  1.00 96.17  ? 256 SER C CA    1 
ATOM   5092 C C     . SER C 1 209 ? 9.533   -24.141 18.794  1.00 96.53  ? 256 SER C C     1 
ATOM   5093 O O     . SER C 1 209 ? 9.477   -24.431 17.593  1.00 95.47  ? 256 SER C O     1 
ATOM   5094 C CB    . SER C 1 209 ? 10.884  -25.219 20.605  1.00 101.39 ? 256 SER C CB    1 
ATOM   5095 O OG    . SER C 1 209 ? 11.926  -25.751 19.803  1.00 114.27 ? 256 SER C OG    1 
ATOM   5096 N N     . GLU C 1 210 ? 9.586   -22.864 19.250  1.00 89.87  ? 257 GLU C N     1 
ATOM   5097 C CA    . GLU C 1 210 ? 9.627   -21.698 18.371  1.00 86.81  ? 257 GLU C CA    1 
ATOM   5098 C C     . GLU C 1 210 ? 11.020  -21.551 17.746  1.00 92.43  ? 257 GLU C C     1 
ATOM   5099 O O     . GLU C 1 210 ? 12.013  -21.804 18.424  1.00 93.89  ? 257 GLU C O     1 
ATOM   5100 C CB    . GLU C 1 210 ? 9.264   -20.453 19.156  1.00 86.60  ? 257 GLU C CB    1 
ATOM   5101 C CG    . GLU C 1 210 ? 9.004   -19.258 18.272  1.00 92.32  ? 257 GLU C CG    1 
ATOM   5102 C CD    . GLU C 1 210 ? 7.854   -19.469 17.315  1.00 107.38 ? 257 GLU C CD    1 
ATOM   5103 O OE1   . GLU C 1 210 ? 6.694   -19.582 17.788  1.00 95.95  ? 257 GLU C OE1   1 
ATOM   5104 O OE2   . GLU C 1 210 ? 8.123   -19.534 16.092  1.00 86.50  ? 257 GLU C OE2   1 
ATOM   5105 N N     . GLY C 1 211 ? 11.078  -21.174 16.467  1.00 88.59  ? 258 GLY C N     1 
ATOM   5106 C CA    . GLY C 1 211 ? 12.339  -21.001 15.755  1.00 90.90  ? 258 GLY C CA    1 
ATOM   5107 C C     . GLY C 1 211 ? 12.217  -20.818 14.260  1.00 95.87  ? 258 GLY C C     1 
ATOM   5108 O O     . GLY C 1 211 ? 11.110  -20.857 13.713  1.00 96.28  ? 258 GLY C O     1 
ATOM   5109 N N     . GLU C 1 212 ? 13.369  -20.665 13.592  1.00 93.89  ? 259 GLU C N     1 
ATOM   5110 C CA    . GLU C 1 212 ? 13.505  -20.406 12.169  1.00 93.99  ? 259 GLU C CA    1 
ATOM   5111 C C     . GLU C 1 212 ? 13.089  -21.460 11.140  1.00 102.19 ? 259 GLU C C     1 
ATOM   5112 O O     . GLU C 1 212 ? 12.349  -21.035 10.272  1.00 102.69 ? 259 GLU C O     1 
ATOM   5113 C CB    . GLU C 1 212 ? 14.842  -19.760 11.804  1.00 98.25  ? 259 GLU C CB    1 
ATOM   5114 C CG    . GLU C 1 212 ? 14.759  -18.304 11.379  1.00 105.89 ? 259 GLU C CG    1 
ATOM   5115 C CD    . GLU C 1 212 ? 15.846  -17.821 10.427  1.00 129.49 ? 259 GLU C CD    1 
ATOM   5116 O OE1   . GLU C 1 212 ? 15.498  -17.048 9.505   1.00 125.15 ? 259 GLU C OE1   1 
ATOM   5117 O OE2   . GLU C 1 212 ? 17.031  -18.205 10.590  1.00 120.41 ? 259 GLU C OE2   1 
ATOM   5118 N N     . GLU C 1 213 ? 13.685  -22.661 10.961  1.00 102.14 ? 260 GLU C N     1 
ATOM   5119 C CA    . GLU C 1 213 ? 14.372  -23.716 11.703  1.00 104.83 ? 260 GLU C CA    1 
ATOM   5120 C C     . GLU C 1 213 ? 13.343  -24.511 12.497  1.00 106.42 ? 260 GLU C C     1 
ATOM   5121 O O     . GLU C 1 213 ? 13.174  -24.328 13.707  1.00 107.47 ? 260 GLU C O     1 
ATOM   5122 C CB    . GLU C 1 213 ? 15.615  -23.292 12.492  1.00 110.11 ? 260 GLU C CB    1 
ATOM   5123 C CG    . GLU C 1 213 ? 16.917  -23.412 11.703  1.00 131.56 ? 260 GLU C CG    1 
ATOM   5124 C CD    . GLU C 1 213 ? 17.496  -24.810 11.540  1.00 161.29 ? 260 GLU C CD    1 
ATOM   5125 O OE1   . GLU C 1 213 ? 18.561  -25.084 12.143  1.00 146.15 ? 260 GLU C OE1   1 
ATOM   5126 O OE2   . GLU C 1 213 ? 16.906  -25.618 10.784  1.00 156.86 ? 260 GLU C OE2   1 
ATOM   5127 N N     . PHE C 1 214 ? 12.556  -25.310 11.752  1.00 98.19  ? 261 PHE C N     1 
ATOM   5128 C CA    . PHE C 1 214 ? 11.503  -26.185 12.252  1.00 93.64  ? 261 PHE C CA    1 
ATOM   5129 C C     . PHE C 1 214 ? 11.277  -27.374 11.323  1.00 92.71  ? 261 PHE C C     1 
ATOM   5130 O O     . PHE C 1 214 ? 11.528  -27.306 10.120  1.00 90.24  ? 261 PHE C O     1 
ATOM   5131 C CB    . PHE C 1 214 ? 10.203  -25.430 12.567  1.00 92.14  ? 261 PHE C CB    1 
ATOM   5132 C CG    . PHE C 1 214 ? 9.610   -24.666 11.413  1.00 92.41  ? 261 PHE C CG    1 
ATOM   5133 C CD1   . PHE C 1 214 ? 8.697   -25.268 10.555  1.00 93.45  ? 261 PHE C CD1   1 
ATOM   5134 C CD2   . PHE C 1 214 ? 9.928   -23.329 11.206  1.00 95.77  ? 261 PHE C CD2   1 
ATOM   5135 C CE1   . PHE C 1 214 ? 8.138   -24.561 9.496   1.00 92.55  ? 261 PHE C CE1   1 
ATOM   5136 C CE2   . PHE C 1 214 ? 9.352   -22.614 10.155  1.00 96.75  ? 261 PHE C CE2   1 
ATOM   5137 C CZ    . PHE C 1 214 ? 8.473   -23.242 9.300   1.00 92.63  ? 261 PHE C CZ    1 
ATOM   5138 N N     . THR C 1 215 ? 10.855  -28.479 11.920  1.00 89.39  ? 262 THR C N     1 
ATOM   5139 C CA    . THR C 1 215 ? 10.588  -29.748 11.269  1.00 90.20  ? 262 THR C CA    1 
ATOM   5140 C C     . THR C 1 215 ? 9.096   -29.829 10.991  1.00 93.80  ? 262 THR C C     1 
ATOM   5141 O O     . THR C 1 215 ? 8.267   -29.680 11.906  1.00 92.90  ? 262 THR C O     1 
ATOM   5142 C CB    . THR C 1 215 ? 11.062  -30.907 12.164  1.00 98.58  ? 262 THR C CB    1 
ATOM   5143 O OG1   . THR C 1 215 ? 12.430  -30.703 12.589  1.00 97.39  ? 262 THR C OG1   1 
ATOM   5144 C CG2   . THR C 1 215 ? 10.852  -32.267 11.514  1.00 97.17  ? 262 THR C CG2   1 
ATOM   5145 N N     . VAL C 1 216 ? 8.773   -30.068 9.709   1.00 89.31  ? 263 VAL C N     1 
ATOM   5146 C CA    . VAL C 1 216 ? 7.425   -30.220 9.185   1.00 85.07  ? 263 VAL C CA    1 
ATOM   5147 C C     . VAL C 1 216 ? 7.069   -31.693 8.931   1.00 91.11  ? 263 VAL C C     1 
ATOM   5148 O O     . VAL C 1 216 ? 7.892   -32.485 8.458   1.00 93.98  ? 263 VAL C O     1 
ATOM   5149 C CB    . VAL C 1 216 ? 7.134   -29.278 7.997   1.00 85.76  ? 263 VAL C CB    1 
ATOM   5150 C CG1   . VAL C 1 216 ? 7.687   -27.885 8.281   1.00 84.73  ? 263 VAL C CG1   1 
ATOM   5151 C CG2   . VAL C 1 216 ? 7.657   -29.822 6.671   1.00 86.58  ? 263 VAL C CG2   1 
ATOM   5152 N N     . ARG C 1 217 ? 5.838   -32.044 9.284   1.00 86.16  ? 264 ARG C N     1 
ATOM   5153 C CA    . ARG C 1 217 ? 5.281   -33.388 9.183   1.00 86.47  ? 264 ARG C CA    1 
ATOM   5154 C C     . ARG C 1 217 ? 4.260   -33.494 8.069   1.00 88.04  ? 264 ARG C C     1 
ATOM   5155 O O     . ARG C 1 217 ? 3.558   -32.530 7.791   1.00 85.32  ? 264 ARG C O     1 
ATOM   5156 C CB    . ARG C 1 217 ? 4.586   -33.742 10.512  1.00 86.13  ? 264 ARG C CB    1 
ATOM   5157 C CG    . ARG C 1 217 ? 5.453   -33.582 11.750  1.00 94.73  ? 264 ARG C CG    1 
ATOM   5158 C CD    . ARG C 1 217 ? 6.741   -34.348 11.621  1.00 107.49 ? 264 ARG C CD    1 
ATOM   5159 N NE    . ARG C 1 217 ? 7.431   -34.428 12.898  1.00 117.22 ? 264 ARG C NE    1 
ATOM   5160 C CZ    . ARG C 1 217 ? 8.613   -35.001 13.074  1.00 127.86 ? 264 ARG C CZ    1 
ATOM   5161 N NH1   . ARG C 1 217 ? 9.165   -35.031 14.279  1.00 117.41 ? 264 ARG C NH1   1 
ATOM   5162 N NH2   . ARG C 1 217 ? 9.257   -35.543 12.044  1.00 105.87 ? 264 ARG C NH2   1 
ATOM   5163 N N     . ASP C 1 218 ? 4.149   -34.675 7.462   1.00 86.75  ? 265 ASP C N     1 
ATOM   5164 C CA    . ASP C 1 218 ? 3.161   -34.946 6.429   1.00 86.23  ? 265 ASP C CA    1 
ATOM   5165 C C     . ASP C 1 218 ? 1.807   -35.287 7.058   1.00 88.08  ? 265 ASP C C     1 
ATOM   5166 O O     . ASP C 1 218 ? 1.733   -35.722 8.222   1.00 88.36  ? 265 ASP C O     1 
ATOM   5167 C CB    . ASP C 1 218 ? 3.622   -36.083 5.509   1.00 91.71  ? 265 ASP C CB    1 
ATOM   5168 C CG    . ASP C 1 218 ? 4.816   -35.722 4.649   1.00 114.60 ? 265 ASP C CG    1 
ATOM   5169 O OD1   . ASP C 1 218 ? 4.820   -34.600 4.071   1.00 114.16 ? 265 ASP C OD1   1 
ATOM   5170 O OD2   . ASP C 1 218 ? 5.746   -36.569 4.535   1.00 127.05 ? 265 ASP C OD2   1 
ATOM   5171 N N     . GLY C 1 219 ? 0.747   -35.063 6.284   1.00 81.05  ? 266 GLY C N     1 
ATOM   5172 C CA    . GLY C 1 219 ? -0.604  -35.366 6.718   1.00 78.78  ? 266 GLY C CA    1 
ATOM   5173 C C     . GLY C 1 219 ? -1.609  -34.268 6.519   1.00 77.43  ? 266 GLY C C     1 
ATOM   5174 O O     . GLY C 1 219 ? -1.261  -33.148 6.160   1.00 75.11  ? 266 GLY C O     1 
ATOM   5175 N N     . TYR C 1 220 ? -2.870  -34.612 6.729   1.00 73.85  ? 267 TYR C N     1 
ATOM   5176 C CA    . TYR C 1 220 ? -3.978  -33.689 6.594   1.00 72.08  ? 267 TYR C CA    1 
ATOM   5177 C C     . TYR C 1 220 ? -4.119  -32.851 7.851   1.00 78.59  ? 267 TYR C C     1 
ATOM   5178 O O     . TYR C 1 220 ? -3.996  -33.384 8.953   1.00 81.73  ? 267 TYR C O     1 
ATOM   5179 C CB    . TYR C 1 220 ? -5.264  -34.439 6.243   1.00 72.46  ? 267 TYR C CB    1 
ATOM   5180 C CG    . TYR C 1 220 ? -5.304  -34.824 4.785   1.00 73.30  ? 267 TYR C CG    1 
ATOM   5181 C CD1   . TYR C 1 220 ? -5.480  -33.862 3.795   1.00 74.77  ? 267 TYR C CD1   1 
ATOM   5182 C CD2   . TYR C 1 220 ? -5.144  -36.146 4.388   1.00 75.49  ? 267 TYR C CD2   1 
ATOM   5183 C CE1   . TYR C 1 220 ? -5.510  -34.209 2.446   1.00 77.72  ? 267 TYR C CE1   1 
ATOM   5184 C CE2   . TYR C 1 220 ? -5.176  -36.506 3.043   1.00 77.60  ? 267 TYR C CE2   1 
ATOM   5185 C CZ    . TYR C 1 220 ? -5.334  -35.529 2.073   1.00 89.79  ? 267 TYR C CZ    1 
ATOM   5186 O OH    . TYR C 1 220 ? -5.351  -35.862 0.741   1.00 101.06 ? 267 TYR C OH    1 
ATOM   5187 N N     . ILE C 1 221 ? -4.284  -31.530 7.675   1.00 72.71  ? 268 ILE C N     1 
ATOM   5188 C CA    . ILE C 1 221 ? -4.410  -30.540 8.737   1.00 70.77  ? 268 ILE C CA    1 
ATOM   5189 C C     . ILE C 1 221 ? -5.729  -30.705 9.475   1.00 75.63  ? 268 ILE C C     1 
ATOM   5190 O O     . ILE C 1 221 ? -6.806  -30.594 8.879   1.00 76.48  ? 268 ILE C O     1 
ATOM   5191 C CB    . ILE C 1 221 ? -4.266  -29.097 8.159   1.00 72.09  ? 268 ILE C CB    1 
ATOM   5192 C CG1   . ILE C 1 221 ? -2.928  -28.876 7.428   1.00 71.03  ? 268 ILE C CG1   1 
ATOM   5193 C CG2   . ILE C 1 221 ? -4.544  -28.007 9.240   1.00 73.90  ? 268 ILE C CG2   1 
ATOM   5194 C CD1   . ILE C 1 221 ? -1.689  -28.904 8.288   1.00 65.13  ? 268 ILE C CD1   1 
ATOM   5195 N N     . HIS C 1 222 ? -5.630  -30.950 10.775  1.00 71.84  ? 269 HIS C N     1 
ATOM   5196 C CA    . HIS C 1 222 ? -6.772  -31.120 11.666  1.00 71.21  ? 269 HIS C CA    1 
ATOM   5197 C C     . HIS C 1 222 ? -6.831  -29.984 12.665  1.00 75.20  ? 269 HIS C C     1 
ATOM   5198 O O     . HIS C 1 222 ? -5.800  -29.429 13.070  1.00 73.48  ? 269 HIS C O     1 
ATOM   5199 C CB    . HIS C 1 222 ? -6.642  -32.440 12.437  1.00 73.12  ? 269 HIS C CB    1 
ATOM   5200 C CG    . HIS C 1 222 ? -6.794  -33.654 11.590  1.00 77.91  ? 269 HIS C CG    1 
ATOM   5201 N ND1   . HIS C 1 222 ? -6.021  -33.852 10.461  1.00 79.90  ? 269 HIS C ND1   1 
ATOM   5202 C CD2   . HIS C 1 222 ? -7.621  -34.705 11.742  1.00 81.57  ? 269 HIS C CD2   1 
ATOM   5203 C CE1   . HIS C 1 222 ? -6.404  -35.007 9.957   1.00 81.23  ? 269 HIS C CE1   1 
ATOM   5204 N NE2   . HIS C 1 222 ? -7.374  -35.555 10.685  1.00 82.81  ? 269 HIS C NE2   1 
ATOM   5205 N N     . TYR C 1 223 ? -8.041  -29.672 13.119  1.00 72.65  ? 270 TYR C N     1 
ATOM   5206 C CA    . TYR C 1 223 ? -8.198  -28.666 14.143  1.00 70.94  ? 270 TYR C CA    1 
ATOM   5207 C C     . TYR C 1 223 ? -7.464  -29.129 15.399  1.00 74.71  ? 270 TYR C C     1 
ATOM   5208 O O     . TYR C 1 223 ? -7.346  -30.341 15.635  1.00 78.59  ? 270 TYR C O     1 
ATOM   5209 C CB    . TYR C 1 223 ? -9.670  -28.459 14.430  1.00 71.85  ? 270 TYR C CB    1 
ATOM   5210 C CG    . TYR C 1 223 ? -10.397 -27.804 13.287  1.00 73.40  ? 270 TYR C CG    1 
ATOM   5211 C CD1   . TYR C 1 223 ? -10.063 -26.520 12.863  1.00 74.19  ? 270 TYR C CD1   1 
ATOM   5212 C CD2   . TYR C 1 223 ? -11.448 -28.448 12.652  1.00 76.36  ? 270 TYR C CD2   1 
ATOM   5213 C CE1   . TYR C 1 223 ? -10.757 -25.895 11.822  1.00 75.35  ? 270 TYR C CE1   1 
ATOM   5214 C CE2   . TYR C 1 223 ? -12.124 -27.853 11.587  1.00 78.06  ? 270 TYR C CE2   1 
ATOM   5215 C CZ    . TYR C 1 223 ? -11.786 -26.571 11.182  1.00 85.90  ? 270 TYR C CZ    1 
ATOM   5216 O OH    . TYR C 1 223 ? -12.487 -26.001 10.148  1.00 87.51  ? 270 TYR C OH    1 
ATOM   5217 N N     . GLY C 1 224 ? -6.909  -28.174 16.136  1.00 65.88  ? 271 GLY C N     1 
ATOM   5218 C CA    . GLY C 1 224 ? -6.189  -28.455 17.369  1.00 65.56  ? 271 GLY C CA    1 
ATOM   5219 C C     . GLY C 1 224 ? -4.711  -28.741 17.213  1.00 70.87  ? 271 GLY C C     1 
ATOM   5220 O O     . GLY C 1 224 ? -4.001  -28.860 18.219  1.00 72.02  ? 271 GLY C O     1 
ATOM   5221 N N     . GLN C 1 225 ? -4.235  -28.804 15.956  1.00 67.04  ? 272 GLN C N     1 
ATOM   5222 C CA    . GLN C 1 225 ? -2.843  -29.051 15.600  1.00 67.57  ? 272 GLN C CA    1 
ATOM   5223 C C     . GLN C 1 225 ? -2.018  -27.773 15.504  1.00 73.67  ? 272 GLN C C     1 
ATOM   5224 O O     . GLN C 1 225 ? -2.554  -26.703 15.214  1.00 72.73  ? 272 GLN C O     1 
ATOM   5225 C CB    . GLN C 1 225 ? -2.759  -29.802 14.258  1.00 68.99  ? 272 GLN C CB    1 
ATOM   5226 C CG    . GLN C 1 225 ? -3.153  -31.271 14.347  1.00 69.16  ? 272 GLN C CG    1 
ATOM   5227 C CD    . GLN C 1 225 ? -2.984  -32.024 13.064  1.00 76.55  ? 272 GLN C CD    1 
ATOM   5228 O OE1   . GLN C 1 225 ? -3.156  -31.506 11.956  1.00 80.02  ? 272 GLN C OE1   1 
ATOM   5229 N NE2   . GLN C 1 225 ? -2.674  -33.281 13.196  1.00 60.93  ? 272 GLN C NE2   1 
ATOM   5230 N N     . THR C 1 226 ? -0.702  -27.901 15.685  1.00 73.49  ? 273 THR C N     1 
ATOM   5231 C CA    . THR C 1 226 ? 0.180   -26.762 15.547  1.00 73.70  ? 273 THR C CA    1 
ATOM   5232 C C     . THR C 1 226 ? 0.626   -26.657 14.121  1.00 81.36  ? 273 THR C C     1 
ATOM   5233 O O     . THR C 1 226 ? 1.127   -27.625 13.540  1.00 84.78  ? 273 THR C O     1 
ATOM   5234 C CB    . THR C 1 226 ? 1.340   -26.803 16.515  1.00 77.27  ? 273 THR C CB    1 
ATOM   5235 O OG1   . THR C 1 226 ? 0.808   -26.815 17.836  1.00 79.07  ? 273 THR C OG1   1 
ATOM   5236 C CG2   . THR C 1 226 ? 2.270   -25.606 16.339  1.00 74.92  ? 273 THR C CG2   1 
ATOM   5237 N N     . VAL C 1 227 ? 0.430   -25.473 13.549  1.00 75.74  ? 274 VAL C N     1 
ATOM   5238 C CA    . VAL C 1 227 ? 0.796   -25.198 12.176  1.00 73.54  ? 274 VAL C CA    1 
ATOM   5239 C C     . VAL C 1 227 ? 1.675   -23.999 12.077  1.00 77.25  ? 274 VAL C C     1 
ATOM   5240 O O     . VAL C 1 227 ? 1.741   -23.165 12.980  1.00 77.46  ? 274 VAL C O     1 
ATOM   5241 C CB    . VAL C 1 227 ? -0.404  -25.129 11.190  1.00 73.65  ? 274 VAL C CB    1 
ATOM   5242 C CG1   . VAL C 1 227 ? -1.153  -26.451 11.136  1.00 72.63  ? 274 VAL C CG1   1 
ATOM   5243 C CG2   . VAL C 1 227 ? -1.336  -23.975 11.524  1.00 71.82  ? 274 VAL C CG2   1 
ATOM   5244 N N     . LYS C 1 228 ? 2.346   -23.918 10.957  1.00 73.73  ? 275 LYS C N     1 
ATOM   5245 C CA    . LYS C 1 228 ? 3.199   -22.820 10.611  1.00 73.21  ? 275 LYS C CA    1 
ATOM   5246 C C     . LYS C 1 228 ? 2.700   -22.368 9.246   1.00 77.00  ? 275 LYS C C     1 
ATOM   5247 O O     . LYS C 1 228 ? 2.517   -23.198 8.340   1.00 75.73  ? 275 LYS C O     1 
ATOM   5248 C CB    . LYS C 1 228 ? 4.658   -23.289 10.585  1.00 77.06  ? 275 LYS C CB    1 
ATOM   5249 C CG    . LYS C 1 228 ? 5.648   -22.177 10.922  1.00 84.64  ? 275 LYS C CG    1 
ATOM   5250 C CD    . LYS C 1 228 ? 5.923   -21.945 12.418  1.00 79.82  ? 275 LYS C CD    1 
ATOM   5251 C CE    . LYS C 1 228 ? 6.859   -20.771 12.524  1.00 93.40  ? 275 LYS C CE    1 
ATOM   5252 N NZ    . LYS C 1 228 ? 6.799   -20.119 13.849  1.00 106.41 ? 275 LYS C NZ    1 
ATOM   5253 N N     . LEU C 1 229 ? 2.340   -21.072 9.146   1.00 73.61  ? 276 LEU C N     1 
ATOM   5254 C CA    . LEU C 1 229 ? 1.879   -20.462 7.893   1.00 72.65  ? 276 LEU C CA    1 
ATOM   5255 C C     . LEU C 1 229 ? 3.078   -19.731 7.294   1.00 79.63  ? 276 LEU C C     1 
ATOM   5256 O O     . LEU C 1 229 ? 3.612   -18.834 7.957   1.00 78.79  ? 276 LEU C O     1 
ATOM   5257 C CB    . LEU C 1 229 ? 0.733   -19.483 8.128   1.00 70.31  ? 276 LEU C CB    1 
ATOM   5258 C CG    . LEU C 1 229 ? -0.544  -20.035 8.669   1.00 71.23  ? 276 LEU C CG    1 
ATOM   5259 C CD1   . LEU C 1 229 ? -1.468  -18.893 9.037   1.00 70.06  ? 276 LEU C CD1   1 
ATOM   5260 C CD2   . LEU C 1 229 ? -1.211  -20.981 7.664   1.00 71.41  ? 276 LEU C CD2   1 
ATOM   5261 N N     . VAL C 1 230 ? 3.551   -20.165 6.088   1.00 77.48  ? 277 VAL C N     1 
ATOM   5262 C CA    . VAL C 1 230 ? 4.756   -19.603 5.447   1.00 78.89  ? 277 VAL C CA    1 
ATOM   5263 C C     . VAL C 1 230 ? 4.455   -19.006 4.075   1.00 83.30  ? 277 VAL C C     1 
ATOM   5264 O O     . VAL C 1 230 ? 4.095   -19.738 3.161   1.00 84.99  ? 277 VAL C O     1 
ATOM   5265 C CB    . VAL C 1 230 ? 5.912   -20.638 5.357   1.00 83.88  ? 277 VAL C CB    1 
ATOM   5266 C CG1   . VAL C 1 230 ? 7.145   -20.024 4.709   1.00 85.61  ? 277 VAL C CG1   1 
ATOM   5267 C CG2   . VAL C 1 230 ? 6.260   -21.230 6.723   1.00 83.80  ? 277 VAL C CG2   1 
ATOM   5268 N N     . CYS C 1 231 ? 4.685   -17.706 3.909   1.00 78.80  ? 278 CYS C N     1 
ATOM   5269 C CA    . CYS C 1 231 ? 4.442   -16.989 2.658   1.00 79.23  ? 278 CYS C CA    1 
ATOM   5270 C C     . CYS C 1 231 ? 5.221   -17.524 1.447   1.00 84.98  ? 278 CYS C C     1 
ATOM   5271 O O     . CYS C 1 231 ? 6.448   -17.421 1.377   1.00 87.18  ? 278 CYS C O     1 
ATOM   5272 C CB    . CYS C 1 231 ? 4.640   -15.490 2.858   1.00 80.85  ? 278 CYS C CB    1 
ATOM   5273 S SG    . CYS C 1 231 ? 4.373   -14.486 1.378   1.00 86.02  ? 278 CYS C SG    1 
ATOM   5274 N N     . SER C 1 232 ? 4.477   -18.097 0.483   1.00 80.71  ? 279 SER C N     1 
ATOM   5275 C CA    . SER C 1 232 ? 4.945   -18.670 -0.793  1.00 81.06  ? 279 SER C CA    1 
ATOM   5276 C C     . SER C 1 232 ? 5.789   -17.694 -1.658  1.00 88.82  ? 279 SER C C     1 
ATOM   5277 O O     . SER C 1 232 ? 6.401   -18.119 -2.644  1.00 90.34  ? 279 SER C O     1 
ATOM   5278 C CB    . SER C 1 232 ? 3.745   -19.147 -1.604  1.00 80.46  ? 279 SER C CB    1 
ATOM   5279 O OG    . SER C 1 232 ? 2.909   -18.041 -1.904  1.00 86.63  ? 279 SER C OG    1 
ATOM   5280 N N     . VAL C 1 233 ? 5.801   -16.397 -1.292  1.00 85.91  ? 280 VAL C N     1 
ATOM   5281 C CA    . VAL C 1 233 ? 6.505   -15.344 -2.008  1.00 87.99  ? 280 VAL C CA    1 
ATOM   5282 C C     . VAL C 1 233 ? 7.650   -14.684 -1.198  1.00 94.64  ? 280 VAL C C     1 
ATOM   5283 O O     . VAL C 1 233 ? 8.791   -14.675 -1.675  1.00 97.24  ? 280 VAL C O     1 
ATOM   5284 C CB    . VAL C 1 233 ? 5.494   -14.361 -2.669  1.00 90.59  ? 280 VAL C CB    1 
ATOM   5285 C CG1   . VAL C 1 233 ? 6.017   -12.927 -2.743  1.00 92.02  ? 280 VAL C CG1   1 
ATOM   5286 C CG2   . VAL C 1 233 ? 5.094   -14.859 -4.046  1.00 90.47  ? 280 VAL C CG2   1 
ATOM   5287 N N     . THR C 1 234 ? 7.350   -14.147 0.003   1.00 88.88  ? 281 THR C N     1 
ATOM   5288 C CA    . THR C 1 234 ? 8.351   -13.493 0.853   1.00 89.75  ? 281 THR C CA    1 
ATOM   5289 C C     . THR C 1 234 ? 9.124   -14.494 1.739   1.00 94.58  ? 281 THR C C     1 
ATOM   5290 O O     . THR C 1 234 ? 10.141  -14.123 2.330   1.00 96.96  ? 281 THR C O     1 
ATOM   5291 C CB    . THR C 1 234 ? 7.693   -12.426 1.732   1.00 97.89  ? 281 THR C CB    1 
ATOM   5292 O OG1   . THR C 1 234 ? 6.909   -13.069 2.738   1.00 96.73  ? 281 THR C OG1   1 
ATOM   5293 C CG2   . THR C 1 234 ? 6.847   -11.436 0.940   1.00 97.38  ? 281 THR C CG2   1 
ATOM   5294 N N     . GLY C 1 235 ? 8.602   -15.714 1.880   1.00 88.66  ? 282 GLY C N     1 
ATOM   5295 C CA    . GLY C 1 235 ? 9.196   -16.755 2.711   1.00 88.45  ? 282 GLY C CA    1 
ATOM   5296 C C     . GLY C 1 235 ? 9.053   -16.542 4.208   1.00 91.02  ? 282 GLY C C     1 
ATOM   5297 O O     . GLY C 1 235 ? 9.563   -17.348 4.993   1.00 90.75  ? 282 GLY C O     1 
ATOM   5298 N N     . MET C 1 236 ? 8.376   -15.450 4.605   1.00 86.94  ? 283 MET C N     1 
ATOM   5299 C CA    . MET C 1 236 ? 8.165   -15.034 5.981   1.00 87.31  ? 283 MET C CA    1 
ATOM   5300 C C     . MET C 1 236 ? 7.052   -15.824 6.652   1.00 86.01  ? 283 MET C C     1 
ATOM   5301 O O     . MET C 1 236 ? 6.023   -16.103 6.025   1.00 84.94  ? 283 MET C O     1 
ATOM   5302 C CB    . MET C 1 236 ? 7.841   -13.538 6.010   1.00 91.78  ? 283 MET C CB    1 
ATOM   5303 C CG    . MET C 1 236 ? 8.916   -12.693 6.682   1.00 100.73 ? 283 MET C CG    1 
ATOM   5304 S SD    . MET C 1 236 ? 8.282   -11.053 7.175   1.00 108.14 ? 283 MET C SD    1 
ATOM   5305 C CE    . MET C 1 236 ? 8.632   -10.101 5.639   1.00 107.25 ? 283 MET C CE    1 
ATOM   5306 N N     . ALA C 1 237 ? 7.226   -16.157 7.939   1.00 79.61  ? 284 ALA C N     1 
ATOM   5307 C CA    . ALA C 1 237 ? 6.216   -16.920 8.693   1.00 75.43  ? 284 ALA C CA    1 
ATOM   5308 C C     . ALA C 1 237 ? 5.722   -16.243 9.944   1.00 77.72  ? 284 ALA C C     1 
ATOM   5309 O O     . ALA C 1 237 ? 6.418   -15.459 10.538  1.00 79.70  ? 284 ALA C O     1 
ATOM   5310 C CB    . ALA C 1 237 ? 6.760   -18.282 9.058   1.00 76.12  ? 284 ALA C CB    1 
ATOM   5311 N N     . LEU C 1 238 ? 4.528   -16.573 10.368  1.00 73.85  ? 285 LEU C N     1 
ATOM   5312 C CA    . LEU C 1 238 ? 3.953   -16.122 11.640  1.00 72.28  ? 285 LEU C CA    1 
ATOM   5313 C C     . LEU C 1 238 ? 4.482   -17.075 12.743  1.00 78.73  ? 285 LEU C C     1 
ATOM   5314 O O     . LEU C 1 238 ? 4.908   -18.193 12.415  1.00 78.67  ? 285 LEU C O     1 
ATOM   5315 C CB    . LEU C 1 238 ? 2.414   -16.234 11.580  1.00 68.62  ? 285 LEU C CB    1 
ATOM   5316 C CG    . LEU C 1 238 ? 1.718   -15.081 10.909  1.00 71.11  ? 285 LEU C CG    1 
ATOM   5317 C CD1   . LEU C 1 238 ? 0.295   -15.467 10.493  1.00 69.12  ? 285 LEU C CD1   1 
ATOM   5318 C CD2   . LEU C 1 238 ? 1.788   -13.819 11.773  1.00 71.20  ? 285 LEU C CD2   1 
ATOM   5319 N N     . PRO C 1 239 ? 4.442   -16.718 14.048  1.00 75.36  ? 286 PRO C N     1 
ATOM   5320 C CA    . PRO C 1 239 ? 4.848   -17.705 15.062  1.00 75.04  ? 286 PRO C CA    1 
ATOM   5321 C C     . PRO C 1 239 ? 3.887   -18.920 15.082  1.00 74.05  ? 286 PRO C C     1 
ATOM   5322 O O     . PRO C 1 239 ? 2.827   -18.861 14.481  1.00 71.09  ? 286 PRO C O     1 
ATOM   5323 C CB    . PRO C 1 239 ? 4.834   -16.904 16.369  1.00 77.22  ? 286 PRO C CB    1 
ATOM   5324 C CG    . PRO C 1 239 ? 4.560   -15.482 15.986  1.00 81.46  ? 286 PRO C CG    1 
ATOM   5325 C CD    . PRO C 1 239 ? 3.919   -15.487 14.672  1.00 76.45  ? 286 PRO C CD    1 
ATOM   5326 N N     . ARG C 1 240 ? 4.263   -20.027 15.737  1.00 70.00  ? 287 ARG C N     1 
ATOM   5327 C CA    . ARG C 1 240 ? 3.431   -21.223 15.787  1.00 68.28  ? 287 ARG C CA    1 
ATOM   5328 C C     . ARG C 1 240 ? 2.041   -20.876 16.225  1.00 74.45  ? 287 ARG C C     1 
ATOM   5329 O O     . ARG C 1 240 ? 1.831   -20.093 17.158  1.00 76.02  ? 287 ARG C O     1 
ATOM   5330 C CB    . ARG C 1 240 ? 4.022   -22.283 16.714  1.00 67.68  ? 287 ARG C CB    1 
ATOM   5331 C CG    . ARG C 1 240 ? 5.461   -22.707 16.365  1.00 75.48  ? 287 ARG C CG    1 
ATOM   5332 C CD    . ARG C 1 240 ? 6.209   -23.218 17.594  1.00 83.33  ? 287 ARG C CD    1 
ATOM   5333 N NE    . ARG C 1 240 ? 5.960   -22.349 18.746  1.00 83.12  ? 287 ARG C NE    1 
ATOM   5334 C CZ    . ARG C 1 240 ? 5.904   -22.746 20.011  1.00 87.87  ? 287 ARG C CZ    1 
ATOM   5335 N NH1   . ARG C 1 240 ? 6.142   -24.016 20.330  1.00 63.38  ? 287 ARG C NH1   1 
ATOM   5336 N NH2   . ARG C 1 240 ? 5.619   -21.878 20.968  1.00 72.35  ? 287 ARG C NH2   1 
ATOM   5337 N N     . LEU C 1 241 ? 1.084   -21.411 15.498  1.00 70.57  ? 288 LEU C N     1 
ATOM   5338 C CA    . LEU C 1 241 ? -0.331  -21.195 15.736  1.00 67.63  ? 288 LEU C CA    1 
ATOM   5339 C C     . LEU C 1 241 ? -1.010  -22.534 15.907  1.00 70.10  ? 288 LEU C C     1 
ATOM   5340 O O     . LEU C 1 241 ? -0.573  -23.516 15.313  1.00 68.51  ? 288 LEU C O     1 
ATOM   5341 C CB    . LEU C 1 241 ? -0.950  -20.499 14.506  1.00 66.46  ? 288 LEU C CB    1 
ATOM   5342 C CG    . LEU C 1 241 ? -0.267  -19.221 14.018  1.00 70.44  ? 288 LEU C CG    1 
ATOM   5343 C CD1   . LEU C 1 241 ? -0.561  -18.964 12.563  1.00 69.67  ? 288 LEU C CD1   1 
ATOM   5344 C CD2   . LEU C 1 241 ? -0.632  -18.019 14.885  1.00 72.09  ? 288 LEU C CD2   1 
ATOM   5345 N N     . ILE C 1 242 ? -2.107  -22.564 16.691  1.00 66.60  ? 289 ILE C N     1 
ATOM   5346 C CA    . ILE C 1 242 ? -2.978  -23.727 16.823  1.00 65.19  ? 289 ILE C CA    1 
ATOM   5347 C C     . ILE C 1 242 ? -4.247  -23.361 16.064  1.00 67.82  ? 289 ILE C C     1 
ATOM   5348 O O     . ILE C 1 242 ? -4.974  -22.477 16.494  1.00 68.35  ? 289 ILE C O     1 
ATOM   5349 C CB    . ILE C 1 242 ? -3.266  -24.201 18.273  1.00 67.69  ? 289 ILE C CB    1 
ATOM   5350 C CG1   . ILE C 1 242 ? -1.979  -24.639 18.973  1.00 69.41  ? 289 ILE C CG1   1 
ATOM   5351 C CG2   . ILE C 1 242 ? -4.254  -25.364 18.218  1.00 66.73  ? 289 ILE C CG2   1 
ATOM   5352 C CD1   . ILE C 1 242 ? -2.128  -24.991 20.417  1.00 79.64  ? 289 ILE C CD1   1 
ATOM   5353 N N     . ILE C 1 243 ? -4.484  -24.000 14.917  1.00 63.52  ? 290 ILE C N     1 
ATOM   5354 C CA    . ILE C 1 243 ? -5.679  -23.790 14.079  1.00 61.08  ? 290 ILE C CA    1 
ATOM   5355 C C     . ILE C 1 243 ? -6.871  -24.403 14.798  1.00 65.64  ? 290 ILE C C     1 
ATOM   5356 O O     . ILE C 1 243 ? -6.833  -25.572 15.186  1.00 65.71  ? 290 ILE C O     1 
ATOM   5357 C CB    . ILE C 1 243 ? -5.446  -24.398 12.683  1.00 63.20  ? 290 ILE C CB    1 
ATOM   5358 C CG1   . ILE C 1 243 ? -6.571  -24.025 11.707  1.00 61.45  ? 290 ILE C CG1   1 
ATOM   5359 C CG2   . ILE C 1 243 ? -5.121  -25.931 12.759  1.00 64.80  ? 290 ILE C CG2   1 
ATOM   5360 C CD1   . ILE C 1 243 ? -6.232  -24.174 10.277  1.00 58.34  ? 290 ILE C CD1   1 
ATOM   5361 N N     . ARG C 1 244 ? -7.897  -23.605 15.041  1.00 63.99  ? 291 ARG C N     1 
ATOM   5362 C CA    . ARG C 1 244 ? -9.065  -24.074 15.807  1.00 64.53  ? 291 ARG C CA    1 
ATOM   5363 C C     . ARG C 1 244 ? -10.365 -23.831 15.045  1.00 69.97  ? 291 ARG C C     1 
ATOM   5364 O O     . ARG C 1 244 ? -10.446 -22.881 14.274  1.00 71.01  ? 291 ARG C O     1 
ATOM   5365 C CB    . ARG C 1 244 ? -9.099  -23.397 17.204  1.00 59.48  ? 291 ARG C CB    1 
ATOM   5366 C CG    . ARG C 1 244 ? -7.780  -23.522 17.973  1.00 56.62  ? 291 ARG C CG    1 
ATOM   5367 C CD    . ARG C 1 244 ? -7.863  -22.891 19.321  1.00 63.01  ? 291 ARG C CD    1 
ATOM   5368 N NE    . ARG C 1 244 ? -6.981  -23.563 20.262  1.00 70.58  ? 291 ARG C NE    1 
ATOM   5369 C CZ    . ARG C 1 244 ? -6.550  -23.041 21.406  1.00 85.51  ? 291 ARG C CZ    1 
ATOM   5370 N NH1   . ARG C 1 244 ? -6.894  -21.805 21.754  1.00 75.74  ? 291 ARG C NH1   1 
ATOM   5371 N NH2   . ARG C 1 244 ? -5.759  -23.742 22.203  1.00 74.75  ? 291 ARG C NH2   1 
ATOM   5372 N N     . LYS C 1 245 ? -11.371 -24.675 15.270  1.00 65.19  ? 292 LYS C N     1 
ATOM   5373 C CA    . LYS C 1 245 ? -12.684 -24.548 14.648  1.00 64.86  ? 292 LYS C CA    1 
ATOM   5374 C C     . LYS C 1 245 ? -13.442 -23.355 15.255  1.00 68.80  ? 292 LYS C C     1 
ATOM   5375 O O     . LYS C 1 245 ? -13.457 -23.215 16.467  1.00 67.61  ? 292 LYS C O     1 
ATOM   5376 C CB    . LYS C 1 245 ? -13.488 -25.876 14.824  1.00 66.91  ? 292 LYS C CB    1 
ATOM   5377 C CG    . LYS C 1 245 ? -14.807 -25.937 14.051  1.00 63.04  ? 292 LYS C CG    1 
ATOM   5378 C CD    . LYS C 1 245 ? -15.129 -27.359 13.623  1.00 78.43  ? 292 LYS C CD    1 
ATOM   5379 C CE    . LYS C 1 245 ? -16.536 -27.531 13.109  1.00 95.40  ? 292 LYS C CE    1 
ATOM   5380 N NZ    . LYS C 1 245 ? -16.676 -28.725 12.217  1.00 109.97 ? 292 LYS C NZ    1 
ATOM   5381 N N     . VAL C 1 246 ? -14.112 -22.544 14.410  1.00 66.61  ? 293 VAL C N     1 
ATOM   5382 C CA    . VAL C 1 246 ? -14.931 -21.387 14.805  1.00 65.79  ? 293 VAL C CA    1 
ATOM   5383 C C     . VAL C 1 246 ? -16.392 -21.632 14.477  1.00 74.70  ? 293 VAL C C     1 
ATOM   5384 O O     . VAL C 1 246 ? -16.726 -22.012 13.355  1.00 72.30  ? 293 VAL C O     1 
ATOM   5385 C CB    . VAL C 1 246 ? -14.424 -20.066 14.165  1.00 66.38  ? 293 VAL C CB    1 
ATOM   5386 C CG1   . VAL C 1 246 ? -15.402 -18.911 14.350  1.00 65.15  ? 293 VAL C CG1   1 
ATOM   5387 C CG2   . VAL C 1 246 ? -13.077 -19.699 14.741  1.00 65.63  ? 293 VAL C CG2   1 
ATOM   5388 N N     . ASP C 1 247 ? -17.263 -21.343 15.458  1.00 77.82  ? 294 ASP C N     1 
ATOM   5389 C CA    . ASP C 1 247 ? -18.717 -21.399 15.361  1.00 80.91  ? 294 ASP C CA    1 
ATOM   5390 C C     . ASP C 1 247 ? -19.236 -20.008 15.782  1.00 87.19  ? 294 ASP C C     1 
ATOM   5391 O O     . ASP C 1 247 ? -19.135 -19.643 16.956  1.00 86.61  ? 294 ASP C O     1 
ATOM   5392 C CB    . ASP C 1 247 ? -19.276 -22.527 16.236  1.00 84.40  ? 294 ASP C CB    1 
ATOM   5393 C CG    . ASP C 1 247 ? -20.772 -22.704 16.085  1.00 108.40 ? 294 ASP C CG    1 
ATOM   5394 O OD1   . ASP C 1 247 ? -21.278 -22.572 14.939  1.00 109.32 ? 294 ASP C OD1   1 
ATOM   5395 O OD2   . ASP C 1 247 ? -21.444 -22.988 17.110  1.00 123.22 ? 294 ASP C OD2   1 
ATOM   5396 N N     . LYS C 1 248 ? -19.722 -19.211 14.795  1.00 86.07  ? 295 LYS C N     1 
ATOM   5397 C CA    . LYS C 1 248 ? -20.147 -17.805 14.955  1.00 87.03  ? 295 LYS C CA    1 
ATOM   5398 C C     . LYS C 1 248 ? -18.962 -16.960 15.524  1.00 88.24  ? 295 LYS C C     1 
ATOM   5399 O O     . LYS C 1 248 ? -18.011 -16.729 14.766  1.00 87.33  ? 295 LYS C O     1 
ATOM   5400 C CB    . LYS C 1 248 ? -21.493 -17.645 15.701  1.00 91.93  ? 295 LYS C CB    1 
ATOM   5401 C CG    . LYS C 1 248 ? -22.703 -17.841 14.790  1.00 111.54 ? 295 LYS C CG    1 
ATOM   5402 C CD    . LYS C 1 248 ? -24.017 -18.020 15.583  1.00 126.87 ? 295 LYS C CD    1 
ATOM   5403 C CE    . LYS C 1 248 ? -25.247 -18.147 14.696  1.00 135.31 ? 295 LYS C CE    1 
ATOM   5404 N NZ    . LYS C 1 248 ? -26.522 -17.978 15.460  1.00 138.53 ? 295 LYS C NZ    1 
ATOM   5405 N N     . GLN C 1 249 ? -18.963 -16.579 16.827  1.00 81.92  ? 296 GLN C N     1 
ATOM   5406 C CA    . GLN C 1 249 ? -17.818 -15.846 17.370  1.00 80.76  ? 296 GLN C CA    1 
ATOM   5407 C C     . GLN C 1 249 ? -17.077 -16.695 18.447  1.00 83.50  ? 296 GLN C C     1 
ATOM   5408 O O     . GLN C 1 249 ? -16.346 -16.146 19.289  1.00 83.51  ? 296 GLN C O     1 
ATOM   5409 C CB    . GLN C 1 249 ? -18.217 -14.474 17.959  1.00 83.46  ? 296 GLN C CB    1 
ATOM   5410 C CG    . GLN C 1 249 ? -19.435 -13.785 17.375  1.00 105.04 ? 296 GLN C CG    1 
ATOM   5411 C CD    . GLN C 1 249 ? -20.098 -12.953 18.448  1.00 128.22 ? 296 GLN C CD    1 
ATOM   5412 O OE1   . GLN C 1 249 ? -20.847 -13.456 19.309  1.00 123.93 ? 296 GLN C OE1   1 
ATOM   5413 N NE2   . GLN C 1 249 ? -19.794 -11.665 18.447  1.00 118.02 ? 296 GLN C NE2   1 
ATOM   5414 N N     . THR C 1 250 ? -17.283 -18.023 18.418  1.00 76.87  ? 297 THR C N     1 
ATOM   5415 C CA    . THR C 1 250 ? -16.766 -18.953 19.413  1.00 74.70  ? 297 THR C CA    1 
ATOM   5416 C C     . THR C 1 250 ? -15.736 -19.902 18.797  1.00 75.27  ? 297 THR C C     1 
ATOM   5417 O O     . THR C 1 250 ? -16.056 -20.573 17.816  1.00 76.06  ? 297 THR C O     1 
ATOM   5418 C CB    . THR C 1 250 ? -17.965 -19.742 20.022  1.00 83.41  ? 297 THR C CB    1 
ATOM   5419 O OG1   . THR C 1 250 ? -19.005 -18.851 20.448  1.00 87.44  ? 297 THR C OG1   1 
ATOM   5420 C CG2   . THR C 1 250 ? -17.570 -20.637 21.166  1.00 82.01  ? 297 THR C CG2   1 
ATOM   5421 N N     . ALA C 1 251 ? -14.515 -19.979 19.392  1.00 67.82  ? 298 ALA C N     1 
ATOM   5422 C CA    . ALA C 1 251 ? -13.472 -20.926 18.998  1.00 66.24  ? 298 ALA C CA    1 
ATOM   5423 C C     . ALA C 1 251 ? -13.802 -22.187 19.778  1.00 75.05  ? 298 ALA C C     1 
ATOM   5424 O O     . ALA C 1 251 ? -14.228 -22.081 20.935  1.00 77.01  ? 298 ALA C O     1 
ATOM   5425 C CB    . ALA C 1 251 ? -12.099 -20.416 19.393  1.00 65.79  ? 298 ALA C CB    1 
ATOM   5426 N N     . LEU C 1 252 ? -13.673 -23.377 19.131  1.00 71.95  ? 299 LEU C N     1 
ATOM   5427 C CA    . LEU C 1 252 ? -13.998 -24.695 19.687  1.00 71.93  ? 299 LEU C CA    1 
ATOM   5428 C C     . LEU C 1 252 ? -12.706 -25.452 19.901  1.00 79.76  ? 299 LEU C C     1 
ATOM   5429 O O     . LEU C 1 252 ? -12.194 -26.130 18.989  1.00 82.68  ? 299 LEU C O     1 
ATOM   5430 C CB    . LEU C 1 252 ? -14.986 -25.445 18.768  1.00 71.81  ? 299 LEU C CB    1 
ATOM   5431 C CG    . LEU C 1 252 ? -16.339 -24.706 18.482  1.00 74.95  ? 299 LEU C CG    1 
ATOM   5432 C CD1   . LEU C 1 252 ? -17.195 -25.476 17.573  1.00 74.38  ? 299 LEU C CD1   1 
ATOM   5433 C CD2   . LEU C 1 252 ? -17.123 -24.433 19.743  1.00 77.19  ? 299 LEU C CD2   1 
ATOM   5434 N N     . LEU C 1 253 ? -12.124 -25.244 21.105  1.00 74.26  ? 300 LEU C N     1 
ATOM   5435 C CA    . LEU C 1 253 ? -10.844 -25.811 21.549  1.00 72.51  ? 300 LEU C CA    1 
ATOM   5436 C C     . LEU C 1 253 ? -10.712 -27.343 21.462  1.00 78.72  ? 300 LEU C C     1 
ATOM   5437 O O     . LEU C 1 253 ? -9.622  -27.837 21.141  1.00 79.76  ? 300 LEU C O     1 
ATOM   5438 C CB    . LEU C 1 253 ? -10.461 -25.317 22.953  1.00 71.86  ? 300 LEU C CB    1 
ATOM   5439 C CG    . LEU C 1 253 ? -10.601 -23.824 23.305  1.00 73.96  ? 300 LEU C CG    1 
ATOM   5440 C CD1   . LEU C 1 253 ? -9.738  -23.494 24.458  1.00 72.69  ? 300 LEU C CD1   1 
ATOM   5441 C CD2   . LEU C 1 253 ? -10.206 -22.920 22.175  1.00 74.79  ? 300 LEU C CD2   1 
ATOM   5442 N N     . ASP C 1 254 ? -11.821 -28.085 21.689  1.00 75.63  ? 301 ASP C N     1 
ATOM   5443 C CA    . ASP C 1 254 ? -11.816 -29.545 21.672  1.00 75.92  ? 301 ASP C CA    1 
ATOM   5444 C C     . ASP C 1 254 ? -11.988 -30.237 20.289  1.00 76.45  ? 301 ASP C C     1 
ATOM   5445 O O     . ASP C 1 254 ? -11.736 -31.444 20.200  1.00 76.06  ? 301 ASP C O     1 
ATOM   5446 C CB    . ASP C 1 254 ? -12.741 -30.109 22.761  1.00 79.95  ? 301 ASP C CB    1 
ATOM   5447 C CG    . ASP C 1 254 ? -14.209 -29.790 22.542  1.00 105.10 ? 301 ASP C CG    1 
ATOM   5448 O OD1   . ASP C 1 254 ? -14.509 -28.680 21.984  1.00 107.59 ? 301 ASP C OD1   1 
ATOM   5449 O OD2   . ASP C 1 254 ? -15.073 -30.627 22.958  1.00 111.90 ? 301 ASP C OD2   1 
ATOM   5450 N N     . ALA C 1 255 ? -12.362 -29.483 19.215  1.00 70.89  ? 302 ALA C N     1 
ATOM   5451 C CA    . ALA C 1 255 ? -12.504 -30.023 17.845  1.00 70.13  ? 302 ALA C CA    1 
ATOM   5452 C C     . ALA C 1 255 ? -11.157 -30.536 17.314  1.00 78.43  ? 302 ALA C C     1 
ATOM   5453 O O     . ALA C 1 255 ? -10.100 -29.897 17.489  1.00 78.40  ? 302 ALA C O     1 
ATOM   5454 C CB    . ALA C 1 255 ? -13.059 -28.969 16.910  1.00 68.79  ? 302 ALA C CB    1 
ATOM   5455 N N     . ASP C 1 256 ? -11.211 -31.695 16.668  1.00 76.65  ? 303 ASP C N     1 
ATOM   5456 C CA    . ASP C 1 256 ? -10.055 -32.399 16.138  1.00 76.60  ? 303 ASP C CA    1 
ATOM   5457 C C     . ASP C 1 256 ? -10.269 -32.926 14.692  1.00 81.80  ? 303 ASP C C     1 
ATOM   5458 O O     . ASP C 1 256 ? -9.408  -33.639 14.165  1.00 83.98  ? 303 ASP C O     1 
ATOM   5459 C CB    . ASP C 1 256 ? -9.695  -33.544 17.108  1.00 80.27  ? 303 ASP C CB    1 
ATOM   5460 C CG    . ASP C 1 256 ? -10.808 -34.524 17.441  1.00 101.95 ? 303 ASP C CG    1 
ATOM   5461 O OD1   . ASP C 1 256 ? -11.952 -34.347 16.921  1.00 105.13 ? 303 ASP C OD1   1 
ATOM   5462 O OD2   . ASP C 1 256 ? -10.552 -35.462 18.226  1.00 113.88 ? 303 ASP C OD2   1 
ATOM   5463 N N     . ASP C 1 257 ? -11.392 -32.565 14.054  1.00 76.25  ? 304 ASP C N     1 
ATOM   5464 C CA    . ASP C 1 257 ? -11.708 -32.985 12.686  1.00 76.94  ? 304 ASP C CA    1 
ATOM   5465 C C     . ASP C 1 257 ? -10.824 -32.326 11.601  1.00 78.58  ? 304 ASP C C     1 
ATOM   5466 O O     . ASP C 1 257 ? -10.246 -31.258 11.848  1.00 76.71  ? 304 ASP C O     1 
ATOM   5467 C CB    . ASP C 1 257 ? -13.208 -32.769 12.365  1.00 80.21  ? 304 ASP C CB    1 
ATOM   5468 C CG    . ASP C 1 257 ? -13.858 -31.554 12.988  1.00 98.26  ? 304 ASP C CG    1 
ATOM   5469 O OD1   . ASP C 1 257 ? -13.849 -31.446 14.246  1.00 100.22 ? 304 ASP C OD1   1 
ATOM   5470 O OD2   . ASP C 1 257 ? -14.457 -30.756 12.233  1.00 107.72 ? 304 ASP C OD2   1 
ATOM   5471 N N     . PRO C 1 258 ? -10.706 -32.919 10.385  1.00 73.73  ? 305 PRO C N     1 
ATOM   5472 C CA    . PRO C 1 258 ? -9.922  -32.259 9.333   1.00 72.31  ? 305 PRO C CA    1 
ATOM   5473 C C     . PRO C 1 258 ? -10.483 -30.877 8.941   1.00 74.32  ? 305 PRO C C     1 
ATOM   5474 O O     . PRO C 1 258 ? -11.693 -30.671 8.886   1.00 74.58  ? 305 PRO C O     1 
ATOM   5475 C CB    . PRO C 1 258 ? -10.042 -33.245 8.153   1.00 75.05  ? 305 PRO C CB    1 
ATOM   5476 C CG    . PRO C 1 258 ? -10.408 -34.510 8.740   1.00 79.77  ? 305 PRO C CG    1 
ATOM   5477 C CD    . PRO C 1 258 ? -11.295 -34.169 9.872   1.00 75.34  ? 305 PRO C CD    1 
ATOM   5478 N N     . VAL C 1 259 ? -9.594  -29.946 8.655   1.00 69.64  ? 306 VAL C N     1 
ATOM   5479 C CA    . VAL C 1 259 ? -9.936  -28.609 8.183   1.00 68.04  ? 306 VAL C CA    1 
ATOM   5480 C C     . VAL C 1 259 ? -10.252 -28.789 6.693   1.00 75.73  ? 306 VAL C C     1 
ATOM   5481 O O     . VAL C 1 259 ? -9.481  -29.397 5.950   1.00 77.61  ? 306 VAL C O     1 
ATOM   5482 C CB    . VAL C 1 259 ? -8.797  -27.587 8.405   1.00 70.06  ? 306 VAL C CB    1 
ATOM   5483 C CG1   . VAL C 1 259 ? -9.261  -26.185 8.068   1.00 69.06  ? 306 VAL C CG1   1 
ATOM   5484 C CG2   . VAL C 1 259 ? -8.269  -27.645 9.833   1.00 69.73  ? 306 VAL C CG2   1 
ATOM   5485 N N     . SER C 1 260 ? -11.424 -28.311 6.296   1.00 72.34  ? 307 SER C N     1 
ATOM   5486 C CA    . SER C 1 260 ? -12.011 -28.412 4.978   1.00 70.95  ? 307 SER C CA    1 
ATOM   5487 C C     . SER C 1 260 ? -12.076 -27.039 4.317   1.00 72.32  ? 307 SER C C     1 
ATOM   5488 O O     . SER C 1 260 ? -12.148 -26.022 5.003   1.00 70.04  ? 307 SER C O     1 
ATOM   5489 C CB    . SER C 1 260 ? -13.427 -28.956 5.139   1.00 74.39  ? 307 SER C CB    1 
ATOM   5490 O OG    . SER C 1 260 ? -14.118 -29.084 3.907   1.00 93.22  ? 307 SER C OG    1 
ATOM   5491 N N     . GLN C 1 261 ? -12.111 -27.018 2.982   1.00 70.04  ? 308 GLN C N     1 
ATOM   5492 C CA    . GLN C 1 261 ? -12.283 -25.817 2.158   1.00 69.20  ? 308 GLN C CA    1 
ATOM   5493 C C     . GLN C 1 261 ? -13.435 -24.944 2.667   1.00 72.87  ? 308 GLN C C     1 
ATOM   5494 O O     . GLN C 1 261 ? -14.510 -25.461 2.989   1.00 75.54  ? 308 GLN C O     1 
ATOM   5495 C CB    . GLN C 1 261 ? -12.590 -26.201 0.692   1.00 71.00  ? 308 GLN C CB    1 
ATOM   5496 C CG    . GLN C 1 261 ? -11.511 -27.024 0.039   1.00 65.08  ? 308 GLN C CG    1 
ATOM   5497 C CD    . GLN C 1 261 ? -10.240 -26.262 0.003   1.00 84.33  ? 308 GLN C CD    1 
ATOM   5498 O OE1   . GLN C 1 261 ? -10.180 -25.135 -0.503  1.00 87.45  ? 308 GLN C OE1   1 
ATOM   5499 N NE2   . GLN C 1 261 ? -9.219  -26.831 0.602   1.00 74.46  ? 308 GLN C NE2   1 
ATOM   5500 N N     . LEU C 1 262 ? -13.200 -23.625 2.721   1.00 66.47  ? 309 LEU C N     1 
ATOM   5501 C CA    . LEU C 1 262 ? -14.170 -22.593 3.084   1.00 66.04  ? 309 LEU C CA    1 
ATOM   5502 C C     . LEU C 1 262 ? -14.630 -22.596 4.502   1.00 75.02  ? 309 LEU C C     1 
ATOM   5503 O O     . LEU C 1 262 ? -15.610 -21.918 4.814   1.00 76.05  ? 309 LEU C O     1 
ATOM   5504 C CB    . LEU C 1 262 ? -15.357 -22.570 2.122   1.00 66.32  ? 309 LEU C CB    1 
ATOM   5505 C CG    . LEU C 1 262 ? -14.992 -22.230 0.684   1.00 70.17  ? 309 LEU C CG    1 
ATOM   5506 C CD1   . LEU C 1 262 ? -16.166 -22.458 -0.241  1.00 71.51  ? 309 LEU C CD1   1 
ATOM   5507 C CD2   . LEU C 1 262 ? -14.403 -20.825 0.578   1.00 68.07  ? 309 LEU C CD2   1 
ATOM   5508 N N     . HIS C 1 263 ? -13.929 -23.332 5.379   1.00 73.30  ? 310 HIS C N     1 
ATOM   5509 C CA    . HIS C 1 263 ? -14.262 -23.366 6.787   1.00 73.54  ? 310 HIS C CA    1 
ATOM   5510 C C     . HIS C 1 263 ? -13.783 -22.102 7.426   1.00 75.67  ? 310 HIS C C     1 
ATOM   5511 O O     . HIS C 1 263 ? -12.714 -21.587 7.084   1.00 74.77  ? 310 HIS C O     1 
ATOM   5512 C CB    . HIS C 1 263 ? -13.621 -24.567 7.488   1.00 75.93  ? 310 HIS C CB    1 
ATOM   5513 C CG    . HIS C 1 263 ? -14.438 -25.823 7.433   1.00 83.52  ? 310 HIS C CG    1 
ATOM   5514 N ND1   . HIS C 1 263 ? -13.979 -27.017 8.020   1.00 87.38  ? 310 HIS C ND1   1 
ATOM   5515 C CD2   . HIS C 1 263 ? -15.637 -26.062 6.832   1.00 87.54  ? 310 HIS C CD2   1 
ATOM   5516 C CE1   . HIS C 1 263 ? -14.926 -27.916 7.782   1.00 88.53  ? 310 HIS C CE1   1 
ATOM   5517 N NE2   . HIS C 1 263 ? -15.939 -27.392 7.057   1.00 89.25  ? 310 HIS C NE2   1 
ATOM   5518 N N     . LYS C 1 264 ? -14.596 -21.580 8.337   1.00 72.47  ? 311 LYS C N     1 
ATOM   5519 C CA    . LYS C 1 264 ? -14.226 -20.436 9.146   1.00 71.02  ? 311 LYS C CA    1 
ATOM   5520 C C     . LYS C 1 264 ? -13.438 -21.048 10.307  1.00 76.75  ? 311 LYS C C     1 
ATOM   5521 O O     . LYS C 1 264 ? -13.859 -22.048 10.907  1.00 77.22  ? 311 LYS C O     1 
ATOM   5522 C CB    . LYS C 1 264 ? -15.448 -19.596 9.603   1.00 71.42  ? 311 LYS C CB    1 
ATOM   5523 C CG    . LYS C 1 264 ? -15.489 -18.244 8.899   1.00 82.53  ? 311 LYS C CG    1 
ATOM   5524 C CD    . LYS C 1 264 ? -16.569 -17.323 9.382   1.00 107.16 ? 311 LYS C CD    1 
ATOM   5525 C CE    . LYS C 1 264 ? -17.852 -17.463 8.576   1.00 139.09 ? 311 LYS C CE    1 
ATOM   5526 N NZ    . LYS C 1 264 ? -18.924 -16.534 9.043   1.00 154.86 ? 311 LYS C NZ    1 
ATOM   5527 N N     . CYS C 1 265 ? -12.256 -20.510 10.539  1.00 74.58  ? 312 CYS C N     1 
ATOM   5528 C CA    . CYS C 1 265 ? -11.370 -20.992 11.571  1.00 75.98  ? 312 CYS C CA    1 
ATOM   5529 C C     . CYS C 1 265 ? -10.542 -19.881 12.254  1.00 74.89  ? 312 CYS C C     1 
ATOM   5530 O O     . CYS C 1 265 ? -10.638 -18.716 11.886  1.00 72.81  ? 312 CYS C O     1 
ATOM   5531 C CB    . CYS C 1 265 ? -10.493 -22.106 11.020  1.00 78.52  ? 312 CYS C CB    1 
ATOM   5532 S SG    . CYS C 1 265 ? -9.545  -21.614 9.584   1.00 83.30  ? 312 CYS C SG    1 
ATOM   5533 N N     . ALA C 1 266 ? -9.818  -20.244 13.318  1.00 69.82  ? 313 ALA C N     1 
ATOM   5534 C CA    . ALA C 1 266 ? -9.085  -19.296 14.128  1.00 69.54  ? 313 ALA C CA    1 
ATOM   5535 C C     . ALA C 1 266 ? -7.669  -19.761 14.412  1.00 73.01  ? 313 ALA C C     1 
ATOM   5536 O O     . ALA C 1 266 ? -7.400  -20.956 14.401  1.00 74.65  ? 313 ALA C O     1 
ATOM   5537 C CB    . ALA C 1 266 ? -9.831  -19.042 15.420  1.00 70.74  ? 313 ALA C CB    1 
ATOM   5538 N N     . PHE C 1 267 ? -6.765  -18.830 14.656  1.00 67.36  ? 314 PHE C N     1 
ATOM   5539 C CA    . PHE C 1 267 ? -5.394  -19.196 14.868  1.00 68.04  ? 314 PHE C CA    1 
ATOM   5540 C C     . PHE C 1 267 ? -4.879  -18.735 16.212  1.00 72.78  ? 314 PHE C C     1 
ATOM   5541 O O     . PHE C 1 267 ? -4.519  -17.577 16.359  1.00 74.64  ? 314 PHE C O     1 
ATOM   5542 C CB    . PHE C 1 267 ? -4.549  -18.661 13.718  1.00 70.05  ? 314 PHE C CB    1 
ATOM   5543 C CG    . PHE C 1 267 ? -4.902  -19.294 12.398  1.00 71.06  ? 314 PHE C CG    1 
ATOM   5544 C CD1   . PHE C 1 267 ? -4.275  -20.459 11.978  1.00 75.52  ? 314 PHE C CD1   1 
ATOM   5545 C CD2   . PHE C 1 267 ? -5.823  -18.700 11.551  1.00 72.22  ? 314 PHE C CD2   1 
ATOM   5546 C CE1   . PHE C 1 267 ? -4.584  -21.032 10.738  1.00 76.49  ? 314 PHE C CE1   1 
ATOM   5547 C CE2   . PHE C 1 267 ? -6.149  -19.285 10.320  1.00 75.29  ? 314 PHE C CE2   1 
ATOM   5548 C CZ    . PHE C 1 267 ? -5.518  -20.436 9.914   1.00 73.98  ? 314 PHE C CZ    1 
ATOM   5549 N N     . TYR C 1 268 ? -4.883  -19.619 17.208  1.00 67.76  ? 315 TYR C N     1 
ATOM   5550 C CA    . TYR C 1 268 ? -4.383  -19.236 18.512  1.00 68.52  ? 315 TYR C CA    1 
ATOM   5551 C C     . TYR C 1 268 ? -2.876  -19.310 18.513  1.00 73.32  ? 315 TYR C C     1 
ATOM   5552 O O     . TYR C 1 268 ? -2.302  -20.339 18.183  1.00 74.22  ? 315 TYR C O     1 
ATOM   5553 C CB    . TYR C 1 268 ? -4.990  -20.098 19.643  1.00 70.14  ? 315 TYR C CB    1 
ATOM   5554 C CG    . TYR C 1 268 ? -4.117  -20.209 20.884  1.00 71.51  ? 315 TYR C CG    1 
ATOM   5555 C CD1   . TYR C 1 268 ? -4.105  -19.207 21.846  1.00 73.35  ? 315 TYR C CD1   1 
ATOM   5556 C CD2   . TYR C 1 268 ? -3.316  -21.326 21.099  1.00 72.77  ? 315 TYR C CD2   1 
ATOM   5557 C CE1   . TYR C 1 268 ? -3.316  -19.312 22.992  1.00 74.44  ? 315 TYR C CE1   1 
ATOM   5558 C CE2   . TYR C 1 268 ? -2.532  -21.445 22.244  1.00 74.27  ? 315 TYR C CE2   1 
ATOM   5559 C CZ    . TYR C 1 268 ? -2.539  -20.438 23.191  1.00 79.64  ? 315 TYR C CZ    1 
ATOM   5560 O OH    . TYR C 1 268 ? -1.749  -20.554 24.310  1.00 83.65  ? 315 TYR C OH    1 
ATOM   5561 N N     . LEU C 1 269 ? -2.248  -18.234 18.941  1.00 69.76  ? 316 LEU C N     1 
ATOM   5562 C CA    . LEU C 1 269 ? -0.805  -18.098 19.054  1.00 69.62  ? 316 LEU C CA    1 
ATOM   5563 C C     . LEU C 1 269 ? -0.314  -18.945 20.208  1.00 76.00  ? 316 LEU C C     1 
ATOM   5564 O O     . LEU C 1 269 ? -0.410  -18.560 21.373  1.00 76.18  ? 316 LEU C O     1 
ATOM   5565 C CB    . LEU C 1 269 ? -0.430  -16.626 19.235  1.00 69.50  ? 316 LEU C CB    1 
ATOM   5566 C CG    . LEU C 1 269 ? -0.625  -15.813 17.978  1.00 73.64  ? 316 LEU C CG    1 
ATOM   5567 C CD1   . LEU C 1 269 ? -1.647  -14.744 18.181  1.00 73.83  ? 316 LEU C CD1   1 
ATOM   5568 C CD2   . LEU C 1 269 ? 0.664   -15.250 17.514  1.00 76.89  ? 316 LEU C CD2   1 
ATOM   5569 N N     . LYS C 1 270 ? 0.153   -20.148 19.866  1.00 73.54  ? 317 LYS C N     1 
ATOM   5570 C CA    . LYS C 1 270 ? 0.714   -21.160 20.756  1.00 73.69  ? 317 LYS C CA    1 
ATOM   5571 C C     . LYS C 1 270 ? 1.611   -20.442 21.775  1.00 82.05  ? 317 LYS C C     1 
ATOM   5572 O O     . LYS C 1 270 ? 2.316   -19.492 21.417  1.00 80.91  ? 317 LYS C O     1 
ATOM   5573 C CB    . LYS C 1 270 ? 1.530   -22.157 19.900  1.00 74.90  ? 317 LYS C CB    1 
ATOM   5574 C CG    . LYS C 1 270 ? 2.123   -23.321 20.644  1.00 73.91  ? 317 LYS C CG    1 
ATOM   5575 C CD    . LYS C 1 270 ? 1.863   -24.616 19.955  1.00 73.41  ? 317 LYS C CD    1 
ATOM   5576 C CE    . LYS C 1 270 ? 2.196   -25.774 20.855  1.00 74.42  ? 317 LYS C CE    1 
ATOM   5577 N NZ    . LYS C 1 270 ? 2.660   -26.959 20.081  1.00 87.10  ? 317 LYS C NZ    1 
ATOM   5578 N N     . ASP C 1 271 ? 1.538   -20.890 23.044  1.00 82.81  ? 318 ASP C N     1 
ATOM   5579 C CA    . ASP C 1 271 ? 2.260   -20.388 24.211  1.00 84.67  ? 318 ASP C CA    1 
ATOM   5580 C C     . ASP C 1 271 ? 1.651   -19.120 24.817  1.00 85.68  ? 318 ASP C C     1 
ATOM   5581 O O     . ASP C 1 271 ? 2.034   -18.777 25.932  1.00 87.42  ? 318 ASP C O     1 
ATOM   5582 C CB    . ASP C 1 271 ? 3.763   -20.176 23.931  1.00 89.55  ? 318 ASP C CB    1 
ATOM   5583 C CG    . ASP C 1 271 ? 4.677   -21.385 24.049  1.00 107.23 ? 318 ASP C CG    1 
ATOM   5584 O OD1   . ASP C 1 271 ? 4.154   -22.530 24.114  1.00 106.60 ? 318 ASP C OD1   1 
ATOM   5585 O OD2   . ASP C 1 271 ? 5.929   -21.188 24.047  1.00 117.52 ? 318 ASP C OD2   1 
ATOM   5586 N N     . THR C 1 272 ? 0.710   -18.430 24.132  1.00 76.87  ? 319 THR C N     1 
ATOM   5587 C CA    . THR C 1 272 ? 0.133   -17.201 24.711  1.00 74.08  ? 319 THR C CA    1 
ATOM   5588 C C     . THR C 1 272 ? -1.034  -17.413 25.650  1.00 77.01  ? 319 THR C C     1 
ATOM   5589 O O     . THR C 1 272 ? -1.513  -18.527 25.823  1.00 76.76  ? 319 THR C O     1 
ATOM   5590 C CB    . THR C 1 272 ? -0.281  -16.209 23.660  1.00 64.10  ? 319 THR C CB    1 
ATOM   5591 O OG1   . THR C 1 272 ? -1.475  -16.678 23.042  1.00 71.52  ? 319 THR C OG1   1 
ATOM   5592 C CG2   . THR C 1 272 ? 0.781   -15.953 22.662  1.00 49.71  ? 319 THR C CG2   1 
ATOM   5593 N N     . GLU C 1 273 ? -1.516  -16.310 26.221  1.00 73.60  ? 320 GLU C N     1 
ATOM   5594 C CA    . GLU C 1 273 ? -2.648  -16.291 27.139  1.00 72.77  ? 320 GLU C CA    1 
ATOM   5595 C C     . GLU C 1 273 ? -3.918  -15.870 26.360  1.00 74.46  ? 320 GLU C C     1 
ATOM   5596 O O     . GLU C 1 273 ? -4.278  -14.693 26.387  1.00 73.98  ? 320 GLU C O     1 
ATOM   5597 C CB    . GLU C 1 273 ? -2.328  -15.340 28.330  1.00 75.01  ? 320 GLU C CB    1 
ATOM   5598 C CG    . GLU C 1 273 ? -1.799  -16.037 29.578  1.00 78.61  ? 320 GLU C CG    1 
ATOM   5599 C CD    . GLU C 1 273 ? -2.907  -16.562 30.479  1.00 121.32 ? 320 GLU C CD    1 
ATOM   5600 O OE1   . GLU C 1 273 ? -3.575  -15.737 31.152  1.00 121.44 ? 320 GLU C OE1   1 
ATOM   5601 O OE2   . GLU C 1 273 ? -3.143  -17.794 30.472  1.00 117.82 ? 320 GLU C OE2   1 
ATOM   5602 N N     . ARG C 1 274 ? -4.560  -16.840 25.627  1.00 69.51  ? 321 ARG C N     1 
ATOM   5603 C CA    . ARG C 1 274 ? -5.773  -16.681 24.767  1.00 67.77  ? 321 ARG C CA    1 
ATOM   5604 C C     . ARG C 1 274 ? -5.552  -15.697 23.603  1.00 74.17  ? 321 ARG C C     1 
ATOM   5605 O O     . ARG C 1 274 ? -6.523  -15.088 23.153  1.00 75.73  ? 321 ARG C O     1 
ATOM   5606 C CB    . ARG C 1 274 ? -7.026  -16.213 25.545  1.00 65.56  ? 321 ARG C CB    1 
ATOM   5607 C CG    . ARG C 1 274 ? -7.358  -16.961 26.822  1.00 73.67  ? 321 ARG C CG    1 
ATOM   5608 C CD    . ARG C 1 274 ? -8.716  -16.574 27.427  1.00 69.63  ? 321 ARG C CD    1 
ATOM   5609 N NE    . ARG C 1 274 ? -8.762  -15.305 28.172  1.00 71.38  ? 321 ARG C NE    1 
ATOM   5610 C CZ    . ARG C 1 274 ? -8.078  -15.029 29.285  1.00 85.96  ? 321 ARG C CZ    1 
ATOM   5611 N NH1   . ARG C 1 274 ? -7.190  -15.898 29.767  1.00 73.88  ? 321 ARG C NH1   1 
ATOM   5612 N NH2   . ARG C 1 274 ? -8.246  -13.865 29.902  1.00 61.35  ? 321 ARG C NH2   1 
ATOM   5613 N N     . MET C 1 275 ? -4.311  -15.521 23.109  1.00 69.66  ? 322 MET C N     1 
ATOM   5614 C CA    . MET C 1 275 ? -4.087  -14.564 22.014  1.00 68.24  ? 322 MET C CA    1 
ATOM   5615 C C     . MET C 1 275 ? -4.365  -15.193 20.687  1.00 72.87  ? 322 MET C C     1 
ATOM   5616 O O     . MET C 1 275 ? -3.854  -16.279 20.405  1.00 74.31  ? 322 MET C O     1 
ATOM   5617 C CB    . MET C 1 275 ? -2.680  -13.929 22.048  1.00 70.39  ? 322 MET C CB    1 
ATOM   5618 C CG    . MET C 1 275 ? -2.369  -13.226 23.349  1.00 72.99  ? 322 MET C CG    1 
ATOM   5619 S SD    . MET C 1 275 ? -3.526  -11.879 23.726  1.00 75.58  ? 322 MET C SD    1 
ATOM   5620 C CE    . MET C 1 275 ? -3.059  -11.563 25.420  1.00 74.44  ? 322 MET C CE    1 
ATOM   5621 N N     . TYR C 1 276 ? -5.237  -14.553 19.894  1.00 66.70  ? 323 TYR C N     1 
ATOM   5622 C CA    . TYR C 1 276 ? -5.602  -15.059 18.570  1.00 63.44  ? 323 TYR C CA    1 
ATOM   5623 C C     . TYR C 1 276 ? -5.184  -14.057 17.521  1.00 69.01  ? 323 TYR C C     1 
ATOM   5624 O O     . TYR C 1 276 ? -5.371  -12.829 17.708  1.00 67.29  ? 323 TYR C O     1 
ATOM   5625 C CB    . TYR C 1 276 ? -7.105  -15.282 18.474  1.00 61.80  ? 323 TYR C CB    1 
ATOM   5626 C CG    . TYR C 1 276 ? -7.563  -16.536 19.169  1.00 63.24  ? 323 TYR C CG    1 
ATOM   5627 C CD1   . TYR C 1 276 ? -7.798  -16.548 20.540  1.00 65.70  ? 323 TYR C CD1   1 
ATOM   5628 C CD2   . TYR C 1 276 ? -7.789  -17.714 18.454  1.00 63.53  ? 323 TYR C CD2   1 
ATOM   5629 C CE1   . TYR C 1 276 ? -8.223  -17.707 21.192  1.00 65.53  ? 323 TYR C CE1   1 
ATOM   5630 C CE2   . TYR C 1 276 ? -8.204  -18.879 19.097  1.00 63.97  ? 323 TYR C CE2   1 
ATOM   5631 C CZ    . TYR C 1 276 ? -8.421  -18.866 20.468  1.00 70.09  ? 323 TYR C CZ    1 
ATOM   5632 O OH    . TYR C 1 276 ? -8.857  -19.977 21.130  1.00 71.05  ? 323 TYR C OH    1 
ATOM   5633 N N     . LEU C 1 277 ? -4.592  -14.588 16.422  1.00 66.79  ? 324 LEU C N     1 
ATOM   5634 C CA    . LEU C 1 277 ? -4.164  -13.829 15.262  1.00 68.25  ? 324 LEU C CA    1 
ATOM   5635 C C     . LEU C 1 277 ? -5.440  -13.110 14.786  1.00 76.32  ? 324 LEU C C     1 
ATOM   5636 O O     . LEU C 1 277 ? -6.471  -13.754 14.491  1.00 76.37  ? 324 LEU C O     1 
ATOM   5637 C CB    . LEU C 1 277 ? -3.634  -14.788 14.209  1.00 68.27  ? 324 LEU C CB    1 
ATOM   5638 C CG    . LEU C 1 277 ? -3.101  -14.126 12.949  1.00 74.29  ? 324 LEU C CG    1 
ATOM   5639 C CD1   . LEU C 1 277 ? -1.669  -13.623 13.143  1.00 74.84  ? 324 LEU C CD1   1 
ATOM   5640 C CD2   . LEU C 1 277 ? -3.308  -15.038 11.711  1.00 76.15  ? 324 LEU C CD2   1 
ATOM   5641 N N     . CYS C 1 278 ? -5.394  -11.769 14.820  1.00 72.82  ? 325 CYS C N     1 
ATOM   5642 C CA    . CYS C 1 278 ? -6.561  -10.946 14.602  1.00 72.38  ? 325 CYS C CA    1 
ATOM   5643 C C     . CYS C 1 278 ? -6.228  -9.747  13.772  1.00 76.81  ? 325 CYS C C     1 
ATOM   5644 O O     . CYS C 1 278 ? -5.099  -9.303  13.784  1.00 77.46  ? 325 CYS C O     1 
ATOM   5645 C CB    . CYS C 1 278 ? -7.117  -10.550 15.968  1.00 73.42  ? 325 CYS C CB    1 
ATOM   5646 S SG    . CYS C 1 278 ? -8.611  -9.527  15.936  1.00 78.37  ? 325 CYS C SG    1 
ATOM   5647 N N     . LEU C 1 279 ? -7.203  -9.215  13.050  1.00 74.96  ? 326 LEU C N     1 
ATOM   5648 C CA    . LEU C 1 279 ? -6.987  -8.026  12.257  1.00 77.09  ? 326 LEU C CA    1 
ATOM   5649 C C     . LEU C 1 279 ? -7.730  -6.836  12.857  1.00 84.69  ? 326 LEU C C     1 
ATOM   5650 O O     . LEU C 1 279 ? -8.795  -6.987  13.463  1.00 84.45  ? 326 LEU C O     1 
ATOM   5651 C CB    . LEU C 1 279 ? -7.343  -8.240  10.770  1.00 77.14  ? 326 LEU C CB    1 
ATOM   5652 C CG    . LEU C 1 279 ? -8.822  -8.323  10.372  1.00 81.36  ? 326 LEU C CG    1 
ATOM   5653 C CD1   . LEU C 1 279 ? -9.403  -6.959  10.139  1.00 83.45  ? 326 LEU C CD1   1 
ATOM   5654 C CD2   . LEU C 1 279 ? -8.963  -9.007  9.086   1.00 81.94  ? 326 LEU C CD2   1 
ATOM   5655 N N     . SER C 1 280 ? -7.162  -5.652  12.661  1.00 83.93  ? 327 SER C N     1 
ATOM   5656 C CA    . SER C 1 280 ? -7.698  -4.378  13.112  1.00 85.44  ? 327 SER C CA    1 
ATOM   5657 C C     . SER C 1 280 ? -7.403  -3.433  11.946  1.00 94.93  ? 327 SER C C     1 
ATOM   5658 O O     . SER C 1 280 ? -6.257  -2.984  11.785  1.00 97.01  ? 327 SER C O     1 
ATOM   5659 C CB    . SER C 1 280 ? -6.999  -3.943  14.388  1.00 86.45  ? 327 SER C CB    1 
ATOM   5660 O OG    . SER C 1 280 ? -7.617  -2.755  14.838  1.00 98.88  ? 327 SER C OG    1 
ATOM   5661 N N     . GLN C 1 281 ? -8.418  -3.230  11.061  1.00 92.02  ? 328 GLN C N     1 
ATOM   5662 C CA    . GLN C 1 281 ? -8.299  -2.484  9.802   1.00 93.51  ? 328 GLN C CA    1 
ATOM   5663 C C     . GLN C 1 281 ? -7.265  -3.279  8.931   1.00 95.34  ? 328 GLN C C     1 
ATOM   5664 O O     . GLN C 1 281 ? -7.445  -4.486  8.752   1.00 92.74  ? 328 GLN C O     1 
ATOM   5665 C CB    . GLN C 1 281 ? -7.902  -0.997  10.020  1.00 98.01  ? 328 GLN C CB    1 
ATOM   5666 C CG    . GLN C 1 281 ? -8.731  -0.235  11.073  1.00 123.34 ? 328 GLN C CG    1 
ATOM   5667 C CD    . GLN C 1 281 ? -7.906  0.410   12.183  1.00 139.34 ? 328 GLN C CD    1 
ATOM   5668 O OE1   . GLN C 1 281 ? -7.309  -0.262  13.038  1.00 131.11 ? 328 GLN C OE1   1 
ATOM   5669 N NE2   . GLN C 1 281 ? -7.925  1.734   12.246  1.00 133.26 ? 328 GLN C NE2   1 
ATOM   5670 N N     . GLU C 1 282 ? -6.167  -2.645  8.473   1.00 92.16  ? 329 GLU C N     1 
ATOM   5671 C CA    . GLU C 1 282 ? -5.149  -3.314  7.656   1.00 90.96  ? 329 GLU C CA    1 
ATOM   5672 C C     . GLU C 1 282 ? -4.091  -4.027  8.520   1.00 90.55  ? 329 GLU C C     1 
ATOM   5673 O O     . GLU C 1 282 ? -3.369  -4.886  8.023   1.00 86.53  ? 329 GLU C O     1 
ATOM   5674 C CB    . GLU C 1 282 ? -4.508  -2.305  6.667   1.00 95.25  ? 329 GLU C CB    1 
ATOM   5675 C CG    . GLU C 1 282 ? -3.557  -2.922  5.651   1.00 109.42 ? 329 GLU C CG    1 
ATOM   5676 C CD    . GLU C 1 282 ? -3.437  -2.242  4.302   1.00 145.57 ? 329 GLU C CD    1 
ATOM   5677 O OE1   . GLU C 1 282 ? -2.327  -1.748  3.999   1.00 148.01 ? 329 GLU C OE1   1 
ATOM   5678 O OE2   . GLU C 1 282 ? -4.412  -2.286  3.514   1.00 146.36 ? 329 GLU C OE2   1 
ATOM   5679 N N     . ARG C 1 283 ? -4.031  -3.687  9.820   1.00 88.01  ? 330 ARG C N     1 
ATOM   5680 C CA    . ARG C 1 283 ? -3.058  -4.228  10.777  1.00 86.48  ? 330 ARG C CA    1 
ATOM   5681 C C     . ARG C 1 283 ? -3.392  -5.643  11.288  1.00 87.54  ? 330 ARG C C     1 
ATOM   5682 O O     . ARG C 1 283 ? -4.546  -5.919  11.650  1.00 86.35  ? 330 ARG C O     1 
ATOM   5683 C CB    . ARG C 1 283 ? -2.914  -3.297  11.991  1.00 86.15  ? 330 ARG C CB    1 
ATOM   5684 C CG    . ARG C 1 283 ? -3.155  -1.804  11.764  1.00 100.78 ? 330 ARG C CG    1 
ATOM   5685 C CD    . ARG C 1 283 ? -3.694  -1.104  13.015  1.00 111.69 ? 330 ARG C CD    1 
ATOM   5686 N NE    . ARG C 1 283 ? -2.881  -1.374  14.208  1.00 117.34 ? 330 ARG C NE    1 
ATOM   5687 C CZ    . ARG C 1 283 ? -3.372  -1.683  15.407  1.00 129.47 ? 330 ARG C CZ    1 
ATOM   5688 N NH1   . ARG C 1 283 ? -4.690  -1.740  15.601  1.00 111.17 ? 330 ARG C NH1   1 
ATOM   5689 N NH2   . ARG C 1 283 ? -2.554  -1.919  16.427  1.00 113.79 ? 330 ARG C NH2   1 
ATOM   5690 N N     . ILE C 1 284 ? -2.356  -6.515  11.381  1.00 81.31  ? 331 ILE C N     1 
ATOM   5691 C CA    . ILE C 1 284 ? -2.466  -7.867  11.949  1.00 77.12  ? 331 ILE C CA    1 
ATOM   5692 C C     . ILE C 1 284 ? -1.886  -7.840  13.384  1.00 81.87  ? 331 ILE C C     1 
ATOM   5693 O O     . ILE C 1 284 ? -0.687  -7.669  13.592  1.00 83.10  ? 331 ILE C O     1 
ATOM   5694 C CB    . ILE C 1 284 ? -1.864  -8.956  11.031  1.00 77.79  ? 331 ILE C CB    1 
ATOM   5695 C CG1   . ILE C 1 284 ? -2.623  -9.029  9.700   1.00 77.99  ? 331 ILE C CG1   1 
ATOM   5696 C CG2   . ILE C 1 284 ? -1.769  -10.322 11.704  1.00 74.02  ? 331 ILE C CG2   1 
ATOM   5697 C CD1   . ILE C 1 284 ? -4.065  -9.639  9.703   1.00 83.56  ? 331 ILE C CD1   1 
ATOM   5698 N N     . ILE C 1 285 ? -2.780  -7.966  14.362  1.00 76.53  ? 332 ILE C N     1 
ATOM   5699 C CA    . ILE C 1 285 ? -2.496  -7.910  15.787  1.00 75.31  ? 332 ILE C CA    1 
ATOM   5700 C C     . ILE C 1 285 ? -2.738  -9.269  16.466  1.00 78.82  ? 332 ILE C C     1 
ATOM   5701 O O     . ILE C 1 285 ? -3.116  -10.239 15.811  1.00 79.74  ? 332 ILE C O     1 
ATOM   5702 C CB    . ILE C 1 285 ? -3.369  -6.755  16.431  1.00 78.08  ? 332 ILE C CB    1 
ATOM   5703 C CG1   . ILE C 1 285 ? -4.878  -7.109  16.491  1.00 76.34  ? 332 ILE C CG1   1 
ATOM   5704 C CG2   . ILE C 1 285 ? -3.146  -5.412  15.742  1.00 79.35  ? 332 ILE C CG2   1 
ATOM   5705 C CD1   . ILE C 1 285 ? -5.788  -6.119  17.266  1.00 67.12  ? 332 ILE C CD1   1 
ATOM   5706 N N     . GLN C 1 286 ? -2.511  -9.311  17.793  1.00 73.59  ? 333 GLN C N     1 
ATOM   5707 C CA    . GLN C 1 286 ? -2.779  -10.361 18.776  1.00 69.60  ? 333 GLN C CA    1 
ATOM   5708 C C     . GLN C 1 286 ? -4.034  -9.821  19.497  1.00 70.86  ? 333 GLN C C     1 
ATOM   5709 O O     . GLN C 1 286 ? -4.036  -8.660  19.924  1.00 71.31  ? 333 GLN C O     1 
ATOM   5710 C CB    . GLN C 1 286 ? -1.666  -10.337 19.824  1.00 71.03  ? 333 GLN C CB    1 
ATOM   5711 C CG    . GLN C 1 286 ? -0.787  -11.541 19.856  1.00 90.10  ? 333 GLN C CG    1 
ATOM   5712 C CD    . GLN C 1 286 ? 0.401   -11.277 20.759  1.00 97.95  ? 333 GLN C CD    1 
ATOM   5713 O OE1   . GLN C 1 286 ? 0.374   -11.563 21.969  1.00 88.67  ? 333 GLN C OE1   1 
ATOM   5714 N NE2   . GLN C 1 286 ? 1.469   -10.709 20.183  1.00 80.96  ? 333 GLN C NE2   1 
ATOM   5715 N N     . PHE C 1 287 ? -5.075  -10.620 19.647  1.00 65.05  ? 334 PHE C N     1 
ATOM   5716 C CA    . PHE C 1 287 ? -6.238  -10.135 20.377  1.00 65.01  ? 334 PHE C CA    1 
ATOM   5717 C C     . PHE C 1 287 ? -6.689  -11.211 21.312  1.00 69.09  ? 334 PHE C C     1 
ATOM   5718 O O     . PHE C 1 287 ? -6.847  -12.366 20.897  1.00 69.41  ? 334 PHE C O     1 
ATOM   5719 C CB    . PHE C 1 287 ? -7.383  -9.664  19.455  1.00 66.68  ? 334 PHE C CB    1 
ATOM   5720 C CG    . PHE C 1 287 ? -8.286  -8.685  20.154  1.00 69.44  ? 334 PHE C CG    1 
ATOM   5721 C CD1   . PHE C 1 287 ? -9.307  -9.127  20.981  1.00 73.42  ? 334 PHE C CD1   1 
ATOM   5722 C CD2   . PHE C 1 287 ? -8.069  -7.323  20.049  1.00 74.48  ? 334 PHE C CD2   1 
ATOM   5723 C CE1   . PHE C 1 287 ? -10.097 -8.223  21.688  1.00 76.47  ? 334 PHE C CE1   1 
ATOM   5724 C CE2   . PHE C 1 287 ? -8.863  -6.413  20.753  1.00 79.40  ? 334 PHE C CE2   1 
ATOM   5725 C CZ    . PHE C 1 287 ? -9.878  -6.868  21.560  1.00 77.61  ? 334 PHE C CZ    1 
ATOM   5726 N N     . GLN C 1 288 ? -6.863  -10.851 22.582  1.00 65.28  ? 335 GLN C N     1 
ATOM   5727 C CA    . GLN C 1 288 ? -7.213  -11.817 23.614  1.00 64.83  ? 335 GLN C CA    1 
ATOM   5728 C C     . GLN C 1 288 ? -8.664  -12.239 23.604  1.00 74.22  ? 335 GLN C C     1 
ATOM   5729 O O     . GLN C 1 288 ? -9.560  -11.402 23.496  1.00 78.48  ? 335 GLN C O     1 
ATOM   5730 C CB    . GLN C 1 288 ? -6.785  -11.336 24.986  1.00 66.24  ? 335 GLN C CB    1 
ATOM   5731 C CG    . GLN C 1 288 ? -6.674  -12.445 26.010  1.00 76.54  ? 335 GLN C CG    1 
ATOM   5732 C CD    . GLN C 1 288 ? -6.347  -11.907 27.372  1.00 82.46  ? 335 GLN C CD    1 
ATOM   5733 O OE1   . GLN C 1 288 ? -5.452  -12.398 28.048  1.00 80.67  ? 335 GLN C OE1   1 
ATOM   5734 N NE2   . GLN C 1 288 ? -7.021  -10.853 27.787  1.00 72.79  ? 335 GLN C NE2   1 
ATOM   5735 N N     . ALA C 1 289 ? -8.887  -13.555 23.724  1.00 68.78  ? 336 ALA C N     1 
ATOM   5736 C CA    . ALA C 1 289 ? -10.197 -14.135 23.772  1.00 67.56  ? 336 ALA C CA    1 
ATOM   5737 C C     . ALA C 1 289 ? -10.730 -13.990 25.187  1.00 73.15  ? 336 ALA C C     1 
ATOM   5738 O O     . ALA C 1 289 ? -9.948  -13.911 26.115  1.00 74.20  ? 336 ALA C O     1 
ATOM   5739 C CB    . ALA C 1 289 ? -10.107 -15.586 23.393  1.00 67.16  ? 336 ALA C CB    1 
ATOM   5740 N N     . THR C 1 290 ? -12.066 -13.929 25.339  1.00 69.88  ? 337 THR C N     1 
ATOM   5741 C CA    . THR C 1 290 ? -12.836 -13.853 26.595  1.00 68.18  ? 337 THR C CA    1 
ATOM   5742 C C     . THR C 1 290 ? -13.404 -15.278 26.883  1.00 67.88  ? 337 THR C C     1 
ATOM   5743 O O     . THR C 1 290 ? -13.774 -16.011 25.953  1.00 65.59  ? 337 THR C O     1 
ATOM   5744 C CB    . THR C 1 290 ? -13.939 -12.774 26.487  1.00 67.98  ? 337 THR C CB    1 
ATOM   5745 O OG1   . THR C 1 290 ? -14.724 -13.020 25.307  1.00 64.70  ? 337 THR C OG1   1 
ATOM   5746 C CG2   . THR C 1 290 ? -13.362 -11.346 26.445  1.00 58.70  ? 337 THR C CG2   1 
ATOM   5747 N N     . PRO C 1 291 ? -13.442 -15.686 28.162  1.00 63.26  ? 338 PRO C N     1 
ATOM   5748 C CA    . PRO C 1 291 ? -13.862 -17.055 28.485  1.00 62.60  ? 338 PRO C CA    1 
ATOM   5749 C C     . PRO C 1 291 ? -15.336 -17.368 28.326  1.00 74.60  ? 338 PRO C C     1 
ATOM   5750 O O     . PRO C 1 291 ? -16.186 -16.478 28.296  1.00 77.69  ? 338 PRO C O     1 
ATOM   5751 C CB    . PRO C 1 291 ? -13.500 -17.180 29.970  1.00 64.88  ? 338 PRO C CB    1 
ATOM   5752 C CG    . PRO C 1 291 ? -13.500 -15.802 30.495  1.00 70.74  ? 338 PRO C CG    1 
ATOM   5753 C CD    . PRO C 1 291 ? -13.005 -14.950 29.369  1.00 65.64  ? 338 PRO C CD    1 
ATOM   5754 N N     . CYS C 1 292 ? -15.657 -18.663 28.355  1.00 72.49  ? 339 CYS C N     1 
ATOM   5755 C CA    . CYS C 1 292 ? -17.034 -19.089 28.350  1.00 72.76  ? 339 CYS C CA    1 
ATOM   5756 C C     . CYS C 1 292 ? -17.379 -19.693 29.695  1.00 76.15  ? 339 CYS C C     1 
ATOM   5757 O O     . CYS C 1 292 ? -17.039 -20.843 29.946  1.00 77.79  ? 339 CYS C O     1 
ATOM   5758 C CB    . CYS C 1 292 ? -17.288 -20.047 27.200  1.00 73.25  ? 339 CYS C CB    1 
ATOM   5759 S SG    . CYS C 1 292 ? -17.130 -19.255 25.588  1.00 76.53  ? 339 CYS C SG    1 
ATOM   5760 N N     . PRO C 1 293 ? -18.002 -18.944 30.621  1.00 71.28  ? 340 PRO C N     1 
ATOM   5761 C CA    . PRO C 1 293 ? -18.348 -19.543 31.919  1.00 72.83  ? 340 PRO C CA    1 
ATOM   5762 C C     . PRO C 1 293 ? -18.951 -20.937 31.790  1.00 78.60  ? 340 PRO C C     1 
ATOM   5763 O O     . PRO C 1 293 ? -19.832 -21.166 30.951  1.00 78.33  ? 340 PRO C O     1 
ATOM   5764 C CB    . PRO C 1 293 ? -19.342 -18.546 32.520  1.00 75.68  ? 340 PRO C CB    1 
ATOM   5765 C CG    . PRO C 1 293 ? -18.952 -17.259 31.952  1.00 78.46  ? 340 PRO C CG    1 
ATOM   5766 C CD    . PRO C 1 293 ? -18.461 -17.546 30.543  1.00 71.98  ? 340 PRO C CD    1 
ATOM   5767 N N     . LYS C 1 294 ? -18.413 -21.888 32.584  1.00 76.32  ? 341 LYS C N     1 
ATOM   5768 C CA    . LYS C 1 294 ? -18.849 -23.290 32.626  1.00 77.21  ? 341 LYS C CA    1 
ATOM   5769 C C     . LYS C 1 294 ? -18.580 -24.076 31.322  1.00 82.43  ? 341 LYS C C     1 
ATOM   5770 O O     . LYS C 1 294 ? -19.133 -25.163 31.172  1.00 85.52  ? 341 LYS C O     1 
ATOM   5771 C CB    . LYS C 1 294 ? -20.331 -23.422 33.077  1.00 79.41  ? 341 LYS C CB    1 
ATOM   5772 C CG    . LYS C 1 294 ? -20.852 -22.241 33.894  1.00 76.98  ? 341 LYS C CG    1 
ATOM   5773 C CD    . LYS C 1 294 ? -21.743 -22.626 35.047  1.00 83.65  ? 341 LYS C CD    1 
ATOM   5774 C CE    . LYS C 1 294 ? -22.398 -21.410 35.651  1.00 86.04  ? 341 LYS C CE    1 
ATOM   5775 N NZ    . LYS C 1 294 ? -23.571 -21.790 36.475  1.00 103.47 ? 341 LYS C NZ    1 
ATOM   5776 N N     . GLU C 1 295 ? -17.712 -23.567 30.407  1.00 76.08  ? 342 GLU C N     1 
ATOM   5777 C CA    . GLU C 1 295 ? -17.427 -24.204 29.116  1.00 75.37  ? 342 GLU C CA    1 
ATOM   5778 C C     . GLU C 1 295 ? -15.996 -24.067 28.650  1.00 79.86  ? 342 GLU C C     1 
ATOM   5779 O O     . GLU C 1 295 ? -15.729 -23.445 27.616  1.00 77.52  ? 342 GLU C O     1 
ATOM   5780 C CB    . GLU C 1 295 ? -18.308 -23.621 28.025  1.00 76.37  ? 342 GLU C CB    1 
ATOM   5781 C CG    . GLU C 1 295 ? -19.718 -24.134 27.973  1.00 86.30  ? 342 GLU C CG    1 
ATOM   5782 C CD    . GLU C 1 295 ? -20.544 -23.143 27.185  1.00 110.22 ? 342 GLU C CD    1 
ATOM   5783 O OE1   . GLU C 1 295 ? -21.170 -23.564 26.184  1.00 82.56  ? 342 GLU C OE1   1 
ATOM   5784 O OE2   . GLU C 1 295 ? -20.476 -21.930 27.508  1.00 113.61 ? 342 GLU C OE2   1 
ATOM   5785 N N     . GLN C 1 296 ? -15.090 -24.677 29.409  1.00 79.58  ? 343 GLN C N     1 
ATOM   5786 C CA    . GLN C 1 296 ? -13.635 -24.809 29.262  1.00 77.78  ? 343 GLN C CA    1 
ATOM   5787 C C     . GLN C 1 296 ? -13.169 -24.939 27.810  1.00 81.47  ? 343 GLN C C     1 
ATOM   5788 O O     . GLN C 1 296 ? -12.167 -24.351 27.442  1.00 81.90  ? 343 GLN C O     1 
ATOM   5789 C CB    . GLN C 1 296 ? -13.274 -26.099 30.014  1.00 80.21  ? 343 GLN C CB    1 
ATOM   5790 C CG    . GLN C 1 296 ? -11.832 -26.371 30.345  1.00 88.22  ? 343 GLN C CG    1 
ATOM   5791 C CD    . GLN C 1 296 ? -11.793 -27.636 31.165  1.00 108.43 ? 343 GLN C CD    1 
ATOM   5792 O OE1   . GLN C 1 296 ? -12.807 -28.353 31.312  1.00 93.31  ? 343 GLN C OE1   1 
ATOM   5793 N NE2   . GLN C 1 296 ? -10.636 -27.914 31.757  1.00 108.55 ? 343 GLN C NE2   1 
ATOM   5794 N N     . ASN C 1 297 ? -13.857 -25.733 27.000  1.00 78.41  ? 344 ASN C N     1 
ATOM   5795 C CA    . ASN C 1 297 ? -13.469 -26.005 25.610  1.00 77.32  ? 344 ASN C CA    1 
ATOM   5796 C C     . ASN C 1 297 ? -13.889 -24.911 24.579  1.00 78.23  ? 344 ASN C C     1 
ATOM   5797 O O     . ASN C 1 297 ? -13.836 -25.146 23.372  1.00 75.65  ? 344 ASN C O     1 
ATOM   5798 C CB    . ASN C 1 297 ? -14.056 -27.352 25.233  1.00 82.03  ? 344 ASN C CB    1 
ATOM   5799 C CG    . ASN C 1 297 ? -15.575 -27.305 25.163  1.00 122.25 ? 344 ASN C CG    1 
ATOM   5800 O OD1   . ASN C 1 297 ? -16.282 -27.280 26.185  1.00 114.60 ? 344 ASN C OD1   1 
ATOM   5801 N ND2   . ASN C 1 297 ? -16.104 -27.198 23.946  1.00 120.15 ? 344 ASN C ND2   1 
ATOM   5802 N N     . LYS C 1 298 ? -14.362 -23.745 25.060  1.00 75.06  ? 345 LYS C N     1 
ATOM   5803 C CA    . LYS C 1 298 ? -14.833 -22.637 24.213  1.00 72.89  ? 345 LYS C CA    1 
ATOM   5804 C C     . LYS C 1 298 ? -14.274 -21.297 24.684  1.00 76.43  ? 345 LYS C C     1 
ATOM   5805 O O     . LYS C 1 298 ? -14.119 -21.079 25.899  1.00 77.22  ? 345 LYS C O     1 
ATOM   5806 C CB    . LYS C 1 298 ? -16.351 -22.551 24.212  1.00 74.30  ? 345 LYS C CB    1 
ATOM   5807 C CG    . LYS C 1 298 ? -17.007 -23.724 23.575  1.00 83.90  ? 345 LYS C CG    1 
ATOM   5808 C CD    . LYS C 1 298 ? -18.487 -23.662 23.768  1.00 86.82  ? 345 LYS C CD    1 
ATOM   5809 C CE    . LYS C 1 298 ? -19.184 -24.770 23.030  1.00 82.74  ? 345 LYS C CE    1 
ATOM   5810 N NZ    . LYS C 1 298 ? -20.586 -24.918 23.498  1.00 99.48  ? 345 LYS C NZ    1 
ATOM   5811 N N     . GLU C 1 299 ? -13.955 -20.409 23.715  1.00 70.00  ? 346 GLU C N     1 
ATOM   5812 C CA    . GLU C 1 299 ? -13.476 -19.049 23.984  1.00 69.31  ? 346 GLU C CA    1 
ATOM   5813 C C     . GLU C 1 299 ? -14.145 -18.125 22.995  1.00 76.38  ? 346 GLU C C     1 
ATOM   5814 O O     . GLU C 1 299 ? -14.317 -18.492 21.830  1.00 76.42  ? 346 GLU C O     1 
ATOM   5815 C CB    . GLU C 1 299 ? -11.939 -18.898 23.869  1.00 69.04  ? 346 GLU C CB    1 
ATOM   5816 C CG    . GLU C 1 299 ? -11.149 -20.032 24.487  1.00 79.45  ? 346 GLU C CG    1 
ATOM   5817 C CD    . GLU C 1 299 ? -9.730  -19.717 24.916  1.00 94.97  ? 346 GLU C CD    1 
ATOM   5818 O OE1   . GLU C 1 299 ? -9.511  -19.542 26.142  1.00 76.54  ? 346 GLU C OE1   1 
ATOM   5819 O OE2   . GLU C 1 299 ? -8.830  -19.727 24.041  1.00 80.48  ? 346 GLU C OE2   1 
ATOM   5820 N N     . MET C 1 300 ? -14.523 -16.931 23.445  1.00 75.14  ? 347 MET C N     1 
ATOM   5821 C CA    . MET C 1 300 ? -15.148 -15.957 22.561  1.00 75.85  ? 347 MET C CA    1 
ATOM   5822 C C     . MET C 1 300 ? -14.055 -15.151 21.878  1.00 80.09  ? 347 MET C C     1 
ATOM   5823 O O     . MET C 1 300 ? -13.132 -14.671 22.549  1.00 79.65  ? 347 MET C O     1 
ATOM   5824 C CB    . MET C 1 300 ? -16.110 -15.068 23.334  1.00 79.90  ? 347 MET C CB    1 
ATOM   5825 C CG    . MET C 1 300 ? -17.224 -15.834 23.995  1.00 85.51  ? 347 MET C CG    1 
ATOM   5826 S SD    . MET C 1 300 ? -18.172 -16.824 22.811  1.00 91.41  ? 347 MET C SD    1 
ATOM   5827 C CE    . MET C 1 300 ? -19.012 -15.479 21.837  1.00 88.68  ? 347 MET C CE    1 
ATOM   5828 N N     . ILE C 1 301 ? -14.129 -15.049 20.533  1.00 74.40  ? 348 ILE C N     1 
ATOM   5829 C CA    . ILE C 1 301 ? -13.117 -14.360 19.720  1.00 71.85  ? 348 ILE C CA    1 
ATOM   5830 C C     . ILE C 1 301 ? -13.590 -13.069 19.052  1.00 75.16  ? 348 ILE C C     1 
ATOM   5831 O O     . ILE C 1 301 ? -14.790 -12.874 18.849  1.00 77.12  ? 348 ILE C O     1 
ATOM   5832 C CB    . ILE C 1 301 ? -12.403 -15.319 18.723  1.00 72.71  ? 348 ILE C CB    1 
ATOM   5833 C CG1   . ILE C 1 301 ? -13.378 -15.850 17.651  1.00 71.49  ? 348 ILE C CG1   1 
ATOM   5834 C CG2   . ILE C 1 301 ? -11.654 -16.449 19.475  1.00 72.05  ? 348 ILE C CG2   1 
ATOM   5835 C CD1   . ILE C 1 301 ? -12.722 -16.330 16.453  1.00 71.76  ? 348 ILE C CD1   1 
ATOM   5836 N N     . ASN C 1 302 ? -12.635 -12.202 18.690  1.00 69.20  ? 349 ASN C N     1 
ATOM   5837 C CA    . ASN C 1 302 ? -12.909 -10.954 18.002  1.00 69.65  ? 349 ASN C CA    1 
ATOM   5838 C C     . ASN C 1 302 ? -13.367 -11.267 16.598  1.00 75.44  ? 349 ASN C C     1 
ATOM   5839 O O     . ASN C 1 302 ? -12.930 -12.266 16.011  1.00 72.74  ? 349 ASN C O     1 
ATOM   5840 C CB    . ASN C 1 302 ? -11.651 -10.117 17.967  1.00 71.05  ? 349 ASN C CB    1 
ATOM   5841 C CG    . ASN C 1 302 ? -11.856 -8.704  17.519  1.00 87.62  ? 349 ASN C CG    1 
ATOM   5842 O OD1   . ASN C 1 302 ? -11.644 -8.376  16.348  1.00 83.93  ? 349 ASN C OD1   1 
ATOM   5843 N ND2   . ASN C 1 302 ? -12.216 -7.829  18.459  1.00 77.40  ? 349 ASN C ND2   1 
ATOM   5844 N N     . ASP C 1 303 ? -14.235 -10.412 16.041  1.00 76.79  ? 350 ASP C N     1 
ATOM   5845 C CA    . ASP C 1 303 ? -14.786 -10.597 14.688  1.00 77.59  ? 350 ASP C CA    1 
ATOM   5846 C C     . ASP C 1 303 ? -13.710 -10.592 13.628  1.00 78.52  ? 350 ASP C C     1 
ATOM   5847 O O     . ASP C 1 303 ? -13.921 -11.130 12.546  1.00 79.59  ? 350 ASP C O     1 
ATOM   5848 C CB    . ASP C 1 303 ? -15.884 -9.556  14.369  1.00 82.52  ? 350 ASP C CB    1 
ATOM   5849 C CG    . ASP C 1 303 ? -17.269 -9.810  14.973  1.00 103.35 ? 350 ASP C CG    1 
ATOM   5850 O OD1   . ASP C 1 303 ? -17.458 -10.884 15.642  1.00 104.96 ? 350 ASP C OD1   1 
ATOM   5851 O OD2   . ASP C 1 303 ? -18.167 -8.949  14.779  1.00 111.91 ? 350 ASP C OD2   1 
ATOM   5852 N N     . GLY C 1 304 ? -12.572 -9.997  13.958  1.00 71.88  ? 351 GLY C N     1 
ATOM   5853 C CA    . GLY C 1 304 ? -11.415 -9.931  13.084  1.00 70.81  ? 351 GLY C CA    1 
ATOM   5854 C C     . GLY C 1 304 ? -10.453 -11.071 13.308  1.00 74.60  ? 351 GLY C C     1 
ATOM   5855 O O     . GLY C 1 304 ? -9.360  -11.055 12.743  1.00 74.07  ? 351 GLY C O     1 
ATOM   5856 N N     . ALA C 1 305 ? -10.852 -12.068 14.139  1.00 70.88  ? 352 ALA C N     1 
ATOM   5857 C CA    . ALA C 1 305 ? -10.046 -13.233 14.503  1.00 69.24  ? 352 ALA C CA    1 
ATOM   5858 C C     . ALA C 1 305 ? -10.609 -14.516 13.925  1.00 72.98  ? 352 ALA C C     1 
ATOM   5859 O O     . ALA C 1 305 ? -10.135 -15.604 14.257  1.00 71.09  ? 352 ALA C O     1 
ATOM   5860 C CB    . ALA C 1 305 ? -9.941  -13.347 16.006  1.00 69.93  ? 352 ALA C CB    1 
ATOM   5861 N N     . SER C 1 306 ? -11.605 -14.389 13.038  1.00 71.25  ? 353 SER C N     1 
ATOM   5862 C CA    . SER C 1 306 ? -12.205 -15.502 12.315  1.00 70.88  ? 353 SER C CA    1 
ATOM   5863 C C     . SER C 1 306 ? -11.755 -15.377 10.863  1.00 77.70  ? 353 SER C C     1 
ATOM   5864 O O     . SER C 1 306 ? -11.957 -14.342 10.227  1.00 80.94  ? 353 SER C O     1 
ATOM   5865 C CB    . SER C 1 306 ? -13.716 -15.462 12.422  1.00 74.74  ? 353 SER C CB    1 
ATOM   5866 O OG    . SER C 1 306 ? -14.267 -16.626 11.827  1.00 89.93  ? 353 SER C OG    1 
ATOM   5867 N N     . TRP C 1 307 ? -11.101 -16.408 10.363  1.00 71.95  ? 354 TRP C N     1 
ATOM   5868 C CA    . TRP C 1 307 ? -10.532 -16.436 9.028   1.00 70.97  ? 354 TRP C CA    1 
ATOM   5869 C C     . TRP C 1 307 ? -11.154 -17.564 8.206   1.00 74.19  ? 354 TRP C C     1 
ATOM   5870 O O     . TRP C 1 307 ? -11.280 -18.679 8.708   1.00 74.07  ? 354 TRP C O     1 
ATOM   5871 C CB    . TRP C 1 307 ? -9.001  -16.661 9.148   1.00 68.88  ? 354 TRP C CB    1 
ATOM   5872 C CG    . TRP C 1 307 ? -8.285  -15.542 9.850   1.00 69.61  ? 354 TRP C CG    1 
ATOM   5873 C CD1   . TRP C 1 307 ? -7.976  -15.449 11.184  1.00 72.20  ? 354 TRP C CD1   1 
ATOM   5874 C CD2   . TRP C 1 307 ? -7.825  -14.327 9.244   1.00 69.36  ? 354 TRP C CD2   1 
ATOM   5875 N NE1   . TRP C 1 307 ? -7.342  -14.247 11.437  1.00 71.26  ? 354 TRP C NE1   1 
ATOM   5876 C CE2   . TRP C 1 307 ? -7.226  -13.550 10.260  1.00 72.18  ? 354 TRP C CE2   1 
ATOM   5877 C CE3   . TRP C 1 307 ? -7.869  -13.817 7.932   1.00 70.02  ? 354 TRP C CE3   1 
ATOM   5878 C CZ2   . TRP C 1 307 ? -6.682  -12.305 10.003  1.00 71.69  ? 354 TRP C CZ2   1 
ATOM   5879 C CZ3   . TRP C 1 307 ? -7.322  -12.580 7.682   1.00 71.10  ? 354 TRP C CZ3   1 
ATOM   5880 C CH2   . TRP C 1 307 ? -6.737  -11.841 8.705   1.00 71.93  ? 354 TRP C CH2   1 
ATOM   5881 N N     . THR C 1 308 ? -11.499 -17.295 6.937   1.00 70.09  ? 355 THR C N     1 
ATOM   5882 C CA    . THR C 1 308 ? -12.014 -18.320 6.025   1.00 69.38  ? 355 THR C CA    1 
ATOM   5883 C C     . THR C 1 308 ? -10.811 -18.893 5.251   1.00 73.33  ? 355 THR C C     1 
ATOM   5884 O O     . THR C 1 308 ? -10.112 -18.137 4.571   1.00 74.63  ? 355 THR C O     1 
ATOM   5885 C CB    . THR C 1 308 ? -13.030 -17.722 5.082   1.00 72.24  ? 355 THR C CB    1 
ATOM   5886 O OG1   . THR C 1 308 ? -14.006 -17.039 5.851   1.00 76.99  ? 355 THR C OG1   1 
ATOM   5887 C CG2   . THR C 1 308 ? -13.681 -18.756 4.205   1.00 68.13  ? 355 THR C CG2   1 
ATOM   5888 N N     . ILE C 1 309 ? -10.558 -20.213 5.382   1.00 67.03  ? 356 ILE C N     1 
ATOM   5889 C CA    . ILE C 1 309 ? -9.454  -20.897 4.713   1.00 64.97  ? 356 ILE C CA    1 
ATOM   5890 C C     . ILE C 1 309 ? -9.906  -21.492 3.378   1.00 68.58  ? 356 ILE C C     1 
ATOM   5891 O O     . ILE C 1 309 ? -11.030 -21.965 3.275   1.00 69.20  ? 356 ILE C O     1 
ATOM   5892 C CB    . ILE C 1 309 ? -8.797  -21.943 5.653   1.00 66.67  ? 356 ILE C CB    1 
ATOM   5893 C CG1   . ILE C 1 309 ? -7.397  -22.382 5.142   1.00 65.55  ? 356 ILE C CG1   1 
ATOM   5894 C CG2   . ILE C 1 309 ? -9.745  -23.121 5.924   1.00 67.94  ? 356 ILE C CG2   1 
ATOM   5895 C CD1   . ILE C 1 309 ? -6.613  -23.182 6.100   1.00 66.97  ? 356 ILE C CD1   1 
ATOM   5896 N N     . ILE C 1 310 ? -9.011  -21.491 2.376   1.00 64.58  ? 357 ILE C N     1 
ATOM   5897 C CA    . ILE C 1 310 ? -9.235  -22.018 1.031   1.00 64.61  ? 357 ILE C CA    1 
ATOM   5898 C C     . ILE C 1 310 ? -7.903  -22.347 0.343   1.00 69.77  ? 357 ILE C C     1 
ATOM   5899 O O     . ILE C 1 310 ? -7.007  -21.510 0.287   1.00 69.98  ? 357 ILE C O     1 
ATOM   5900 C CB    . ILE C 1 310 ? -10.146 -21.078 0.188   1.00 67.73  ? 357 ILE C CB    1 
ATOM   5901 C CG1   . ILE C 1 310 ? -10.487 -21.677 -1.197  1.00 69.25  ? 357 ILE C CG1   1 
ATOM   5902 C CG2   . ILE C 1 310 ? -9.595  -19.674 0.106   1.00 67.11  ? 357 ILE C CG2   1 
ATOM   5903 C CD1   . ILE C 1 310 ? -11.674 -21.105 -1.818  1.00 69.21  ? 357 ILE C CD1   1 
ATOM   5904 N N     . SER C 1 311 ? -7.785  -23.574 -0.173  1.00 66.99  ? 358 SER C N     1 
ATOM   5905 C CA    . SER C 1 311 ? -6.605  -24.061 -0.883  1.00 66.99  ? 358 SER C CA    1 
ATOM   5906 C C     . SER C 1 311 ? -6.449  -23.363 -2.234  1.00 70.62  ? 358 SER C C     1 
ATOM   5907 O O     . SER C 1 311 ? -7.430  -23.180 -2.948  1.00 70.17  ? 358 SER C O     1 
ATOM   5908 C CB    . SER C 1 311 ? -6.706  -25.567 -1.073  1.00 70.22  ? 358 SER C CB    1 
ATOM   5909 O OG    . SER C 1 311 ? -6.211  -26.232 0.079   1.00 79.33  ? 358 SER C OG    1 
ATOM   5910 N N     . THR C 1 312 ? -5.230  -22.927 -2.547  1.00 66.71  ? 359 THR C N     1 
ATOM   5911 C CA    . THR C 1 312 ? -4.925  -22.214 -3.790  1.00 66.87  ? 359 THR C CA    1 
ATOM   5912 C C     . THR C 1 312 ? -3.915  -23.012 -4.630  1.00 70.77  ? 359 THR C C     1 
ATOM   5913 O O     . THR C 1 312 ? -3.195  -23.881 -4.116  1.00 69.30  ? 359 THR C O     1 
ATOM   5914 C CB    . THR C 1 312 ? -4.274  -20.835 -3.509  1.00 73.87  ? 359 THR C CB    1 
ATOM   5915 O OG1   . THR C 1 312 ? -2.979  -21.020 -2.916  1.00 81.47  ? 359 THR C OG1   1 
ATOM   5916 C CG2   . THR C 1 312 ? -5.133  -19.920 -2.693  1.00 66.71  ? 359 THR C CG2   1 
ATOM   5917 N N     . ASP C 1 313 ? -3.799  -22.623 -5.899  1.00 66.55  ? 360 ASP C N     1 
ATOM   5918 C CA    . ASP C 1 313 ? -2.882  -23.236 -6.828  1.00 67.73  ? 360 ASP C CA    1 
ATOM   5919 C C     . ASP C 1 313 ? -2.430  -22.170 -7.819  1.00 69.73  ? 360 ASP C C     1 
ATOM   5920 O O     . ASP C 1 313 ? -2.952  -21.045 -7.801  1.00 67.85  ? 360 ASP C O     1 
ATOM   5921 C CB    . ASP C 1 313 ? -3.617  -24.384 -7.568  1.00 71.28  ? 360 ASP C CB    1 
ATOM   5922 C CG    . ASP C 1 313 ? -2.740  -25.506 -8.112  1.00 82.91  ? 360 ASP C CG    1 
ATOM   5923 O OD1   . ASP C 1 313 ? -1.474  -25.329 -8.146  1.00 81.69  ? 360 ASP C OD1   1 
ATOM   5924 O OD2   . ASP C 1 313 ? -3.310  -26.566 -8.505  1.00 88.53  ? 360 ASP C OD2   1 
ATOM   5925 N N     . LYS C 1 314 ? -1.443  -22.518 -8.673  1.00 65.70  ? 361 LYS C N     1 
ATOM   5926 C CA    . LYS C 1 314 ? -0.975  -21.627 -9.711  1.00 65.93  ? 361 LYS C CA    1 
ATOM   5927 C C     . LYS C 1 314 ? -0.607  -22.310 -10.991 1.00 74.48  ? 361 LYS C C     1 
ATOM   5928 O O     . LYS C 1 314 ? -0.133  -23.449 -10.976 1.00 75.80  ? 361 LYS C O     1 
ATOM   5929 C CB    . LYS C 1 314 ? 0.127   -20.690 -9.243  1.00 67.03  ? 361 LYS C CB    1 
ATOM   5930 C CG    . LYS C 1 314 ? 1.528   -21.246 -9.173  1.00 76.11  ? 361 LYS C CG    1 
ATOM   5931 C CD    . LYS C 1 314 ? 2.559   -20.117 -9.075  1.00 72.60  ? 361 LYS C CD    1 
ATOM   5932 C CE    . LYS C 1 314 ? 3.911   -20.645 -8.662  1.00 81.51  ? 361 LYS C CE    1 
ATOM   5933 N NZ    . LYS C 1 314 ? 4.843   -19.531 -8.345  1.00 100.83 ? 361 LYS C NZ    1 
ATOM   5934 N N     . ALA C 1 315 ? -0.882  -21.614 -12.098 1.00 71.99  ? 362 ALA C N     1 
ATOM   5935 C CA    . ALA C 1 315 ? -0.520  -21.964 -13.455 1.00 73.95  ? 362 ALA C CA    1 
ATOM   5936 C C     . ALA C 1 315 ? 0.596   -20.992 -13.784 1.00 78.76  ? 362 ALA C C     1 
ATOM   5937 O O     . ALA C 1 315 ? 0.627   -19.880 -13.248 1.00 78.76  ? 362 ALA C O     1 
ATOM   5938 C CB    . ALA C 1 315 ? -1.691  -21.766 -14.404 1.00 75.28  ? 362 ALA C CB    1 
ATOM   5939 N N     . GLU C 1 316 ? 1.526   -21.430 -14.634 1.00 76.14  ? 363 GLU C N     1 
ATOM   5940 C CA    . GLU C 1 316 ? 2.735   -20.722 -15.020 1.00 76.57  ? 363 GLU C CA    1 
ATOM   5941 C C     . GLU C 1 316 ? 3.085   -21.123 -16.432 1.00 83.35  ? 363 GLU C C     1 
ATOM   5942 O O     . GLU C 1 316 ? 3.124   -22.303 -16.741 1.00 84.59  ? 363 GLU C O     1 
ATOM   5943 C CB    . GLU C 1 316 ? 3.855   -21.173 -14.092 1.00 77.49  ? 363 GLU C CB    1 
ATOM   5944 C CG    . GLU C 1 316 ? 4.936   -20.152 -13.839 1.00 87.72  ? 363 GLU C CG    1 
ATOM   5945 C CD    . GLU C 1 316 ? 5.879   -20.637 -12.761 1.00 109.44 ? 363 GLU C CD    1 
ATOM   5946 O OE1   . GLU C 1 316 ? 5.437   -20.735 -11.592 1.00 101.19 ? 363 GLU C OE1   1 
ATOM   5947 O OE2   . GLU C 1 316 ? 7.030   -21.004 -13.099 1.00 104.23 ? 363 GLU C OE2   1 
ATOM   5948 N N     . TYR C 1 317 ? 3.314   -20.155 -17.297 1.00 81.60  ? 364 TYR C N     1 
ATOM   5949 C CA    . TYR C 1 317 ? 3.665   -20.410 -18.682 1.00 84.01  ? 364 TYR C CA    1 
ATOM   5950 C C     . TYR C 1 317 ? 4.723   -19.425 -19.071 1.00 91.47  ? 364 TYR C C     1 
ATOM   5951 O O     . TYR C 1 317 ? 4.517   -18.211 -19.018 1.00 92.37  ? 364 TYR C O     1 
ATOM   5952 C CB    . TYR C 1 317 ? 2.443   -20.296 -19.584 1.00 85.23  ? 364 TYR C CB    1 
ATOM   5953 C CG    . TYR C 1 317 ? 1.295   -21.175 -19.144 1.00 84.15  ? 364 TYR C CG    1 
ATOM   5954 C CD1   . TYR C 1 317 ? 1.271   -22.530 -19.456 1.00 85.02  ? 364 TYR C CD1   1 
ATOM   5955 C CD2   . TYR C 1 317 ? 0.225   -20.648 -18.419 1.00 83.38  ? 364 TYR C CD2   1 
ATOM   5956 C CE1   . TYR C 1 317 ? 0.206   -23.336 -19.082 1.00 83.28  ? 364 TYR C CE1   1 
ATOM   5957 C CE2   . TYR C 1 317 ? -0.838  -21.455 -18.011 1.00 82.80  ? 364 TYR C CE2   1 
ATOM   5958 C CZ    . TYR C 1 317 ? -0.843  -22.799 -18.352 1.00 88.92  ? 364 TYR C CZ    1 
ATOM   5959 O OH    . TYR C 1 317 ? -1.867  -23.617 -17.960 1.00 87.17  ? 364 TYR C OH    1 
ATOM   5960 N N     . THR C 1 318 ? 5.889   -19.951 -19.369 1.00 89.36  ? 365 THR C N     1 
ATOM   5961 C CA    . THR C 1 318 ? 7.054   -19.175 -19.713 1.00 91.00  ? 365 THR C CA    1 
ATOM   5962 C C     . THR C 1 318 ? 7.303   -19.481 -21.157 1.00 102.63 ? 365 THR C C     1 
ATOM   5963 O O     . THR C 1 318 ? 7.294   -20.653 -21.543 1.00 104.08 ? 365 THR C O     1 
ATOM   5964 C CB    . THR C 1 318 ? 8.201   -19.524 -18.742 1.00 81.79  ? 365 THR C CB    1 
ATOM   5965 O OG1   . THR C 1 318 ? 7.795   -19.255 -17.380 1.00 79.90  ? 365 THR C OG1   1 
ATOM   5966 C CG2   . THR C 1 318 ? 9.450   -18.772 -19.021 1.00 72.28  ? 365 THR C CG2   1 
ATOM   5967 N N     . PHE C 1 319 ? 7.439   -18.423 -21.966 1.00 104.17 ? 366 PHE C N     1 
ATOM   5968 C CA    . PHE C 1 319 ? 7.696   -18.494 -23.403 1.00 108.99 ? 366 PHE C CA    1 
ATOM   5969 C C     . PHE C 1 319 ? 8.689   -17.403 -23.823 1.00 117.83 ? 366 PHE C C     1 
ATOM   5970 O O     . PHE C 1 319 ? 8.973   -16.506 -23.032 1.00 116.60 ? 366 PHE C O     1 
ATOM   5971 C CB    . PHE C 1 319 ? 6.382   -18.418 -24.205 1.00 110.55 ? 366 PHE C CB    1 
ATOM   5972 C CG    . PHE C 1 319 ? 5.592   -17.143 -24.022 1.00 111.04 ? 366 PHE C CG    1 
ATOM   5973 C CD1   . PHE C 1 319 ? 4.673   -17.017 -22.984 1.00 110.12 ? 366 PHE C CD1   1 
ATOM   5974 C CD2   . PHE C 1 319 ? 5.751   -16.073 -24.904 1.00 115.83 ? 366 PHE C CD2   1 
ATOM   5975 C CE1   . PHE C 1 319 ? 3.950   -15.835 -22.810 1.00 110.23 ? 366 PHE C CE1   1 
ATOM   5976 C CE2   . PHE C 1 319 ? 5.016   -14.898 -24.740 1.00 117.59 ? 366 PHE C CE2   1 
ATOM   5977 C CZ    . PHE C 1 319 ? 4.110   -14.792 -23.701 1.00 112.28 ? 366 PHE C CZ    1 
ATOM   5978 N N     . TYR C 1 320 ? 9.214   -17.474 -25.054 1.00 91.80  ? 367 TYR C N     1 
ATOM   5979 C CA    . TYR C 1 320 ? 10.201  -16.507 -25.529 1.00 96.23  ? 367 TYR C CA    1 
ATOM   5980 C C     . TYR C 1 320 ? 10.225  -16.447 -27.063 1.00 102.08 ? 367 TYR C C     1 
ATOM   5981 O O     . TYR C 1 320 ? 10.355  -17.489 -27.707 1.00 98.64  ? 367 TYR C O     1 
ATOM   5982 C CB    . TYR C 1 320 ? 11.602  -16.874 -24.977 1.00 98.10  ? 367 TYR C CB    1 
ATOM   5983 C CG    . TYR C 1 320 ? 12.695  -15.862 -25.263 1.00 105.29 ? 367 TYR C CG    1 
ATOM   5984 C CD1   . TYR C 1 320 ? 12.847  -14.729 -24.469 1.00 110.57 ? 367 TYR C CD1   1 
ATOM   5985 C CD2   . TYR C 1 320 ? 13.618  -16.069 -26.290 1.00 106.87 ? 367 TYR C CD2   1 
ATOM   5986 C CE1   . TYR C 1 320 ? 13.868  -13.808 -24.708 1.00 115.03 ? 367 TYR C CE1   1 
ATOM   5987 C CE2   . TYR C 1 320 ? 14.634  -15.146 -26.547 1.00 111.46 ? 367 TYR C CE2   1 
ATOM   5988 C CZ    . TYR C 1 320 ? 14.757  -14.017 -25.749 1.00 119.76 ? 367 TYR C CZ    1 
ATOM   5989 O OH    . TYR C 1 320 ? 15.761  -13.100 -25.962 1.00 121.44 ? 367 TYR C OH    1 
ATOM   5990 N N     . GLU C 1 321 ? 10.126  -15.221 -27.641 1.00 103.68 ? 368 GLU C N     1 
ATOM   5991 C CA    . GLU C 1 321 ? 10.171  -14.999 -29.089 1.00 107.05 ? 368 GLU C CA    1 
ATOM   5992 C C     . GLU C 1 321 ? 11.628  -15.152 -29.530 1.00 113.16 ? 368 GLU C C     1 
ATOM   5993 O O     . GLU C 1 321 ? 12.330  -14.160 -29.739 1.00 117.01 ? 368 GLU C O     1 
ATOM   5994 C CB    . GLU C 1 321 ? 9.589   -13.617 -29.472 1.00 113.47 ? 368 GLU C CB    1 
ATOM   5995 C CG    . GLU C 1 321 ? 8.068   -13.552 -29.471 1.00 124.05 ? 368 GLU C CG    1 
ATOM   5996 C CD    . GLU C 1 321 ? 7.434   -12.334 -30.127 1.00 150.00 ? 368 GLU C CD    1 
ATOM   5997 O OE1   . GLU C 1 321 ? 8.077   -11.259 -30.165 1.00 139.21 ? 368 GLU C OE1   1 
ATOM   5998 O OE2   . GLU C 1 321 ? 6.283   -12.459 -30.606 1.00 145.76 ? 368 GLU C OE2   1 
ATOM   5999 N N     . GLY C 1 322 ? 12.056  -16.412 -29.613 1.00 107.36 ? 369 GLY C N     1 
ATOM   6000 C CA    . GLY C 1 322 ? 13.411  -16.853 -29.917 1.00 107.53 ? 369 GLY C CA    1 
ATOM   6001 C C     . GLY C 1 322 ? 13.999  -16.403 -31.229 1.00 117.62 ? 369 GLY C C     1 
ATOM   6002 O O     . GLY C 1 322 ? 15.217  -16.237 -31.313 1.00 119.22 ? 369 GLY C O     1 
ATOM   6003 N N     . MET C 1 323 ? 13.155  -16.222 -32.266 1.00 117.96 ? 370 MET C N     1 
ATOM   6004 C CA    . MET C 1 323 ? 13.629  -15.745 -33.574 1.00 123.60 ? 370 MET C CA    1 
ATOM   6005 C C     . MET C 1 323 ? 13.000  -14.397 -33.958 1.00 132.59 ? 370 MET C C     1 
ATOM   6006 O O     . MET C 1 323 ? 13.093  -13.973 -35.114 1.00 137.79 ? 370 MET C O     1 
ATOM   6007 C CB    . MET C 1 323 ? 13.444  -16.807 -34.675 1.00 126.33 ? 370 MET C CB    1 
ATOM   6008 C CG    . MET C 1 323 ? 14.392  -17.985 -34.546 1.00 127.19 ? 370 MET C CG    1 
ATOM   6009 S SD    . MET C 1 323 ? 16.143  -17.593 -34.808 1.00 134.43 ? 370 MET C SD    1 
ATOM   6010 C CE    . MET C 1 323 ? 16.224  -17.710 -36.543 1.00 137.32 ? 370 MET C CE    1 
ATOM   6011 N N     . GLY C 1 324 ? 12.412  -13.726 -32.967 1.00 127.64 ? 371 GLY C N     1 
ATOM   6012 C CA    . GLY C 1 324 ? 11.761  -12.433 -33.133 1.00 132.31 ? 371 GLY C CA    1 
ATOM   6013 C C     . GLY C 1 324 ? 10.251  -12.544 -33.186 1.00 135.69 ? 371 GLY C C     1 
ATOM   6014 O O     . GLY C 1 324 ? 9.719   -13.636 -32.963 1.00 130.67 ? 371 GLY C O     1 
ATOM   6015 N N     . PRO C 1 325 ? 9.524   -11.435 -33.491 1.00 137.99 ? 372 PRO C N     1 
ATOM   6016 C CA    . PRO C 1 325 ? 8.049   -11.507 -33.521 1.00 137.63 ? 372 PRO C CA    1 
ATOM   6017 C C     . PRO C 1 325 ? 7.443   -12.556 -34.451 1.00 141.52 ? 372 PRO C C     1 
ATOM   6018 O O     . PRO C 1 325 ? 7.601   -12.513 -35.666 1.00 145.09 ? 372 PRO C O     1 
ATOM   6019 C CB    . PRO C 1 325 ? 7.600   -10.069 -33.820 1.00 145.58 ? 372 PRO C CB    1 
ATOM   6020 C CG    . PRO C 1 325 ? 8.803   -9.383  -34.345 1.00 154.83 ? 372 PRO C CG    1 
ATOM   6021 C CD    . PRO C 1 325 ? 10.000  -10.061 -33.751 1.00 146.19 ? 372 PRO C CD    1 
ATOM   6022 N N     . VAL C 1 326 ? 6.796   -13.539 -33.831 1.00 134.75 ? 373 VAL C N     1 
ATOM   6023 C CA    . VAL C 1 326 ? 6.114   -14.652 -34.484 1.00 134.45 ? 373 VAL C CA    1 
ATOM   6024 C C     . VAL C 1 326 ? 4.667   -14.243 -34.732 1.00 143.75 ? 373 VAL C C     1 
ATOM   6025 O O     . VAL C 1 326 ? 3.998   -13.723 -33.830 1.00 142.82 ? 373 VAL C O     1 
ATOM   6026 C CB    . VAL C 1 326 ? 6.236   -16.002 -33.709 1.00 132.07 ? 373 VAL C CB    1 
ATOM   6027 C CG1   . VAL C 1 326 ? 7.674   -16.514 -33.713 1.00 129.66 ? 373 VAL C CG1   1 
ATOM   6028 C CG2   . VAL C 1 326 ? 5.695   -15.899 -32.275 1.00 128.58 ? 373 VAL C CG2   1 
ATOM   6029 N N     . LEU C 1 327 ? 4.198   -14.452 -35.962 1.00 146.05 ? 374 LEU C N     1 
ATOM   6030 C CA    . LEU C 1 327 ? 2.850   -14.079 -36.382 1.00 150.13 ? 374 LEU C CA    1 
ATOM   6031 C C     . LEU C 1 327 ? 1.755   -14.978 -35.788 1.00 150.34 ? 374 LEU C C     1 
ATOM   6032 O O     . LEU C 1 327 ? 0.598   -14.560 -35.713 1.00 152.51 ? 374 LEU C O     1 
ATOM   6033 C CB    . LEU C 1 327 ? 2.759   -13.996 -37.923 1.00 157.00 ? 374 LEU C CB    1 
ATOM   6034 C CG    . LEU C 1 327 ? 3.489   -12.832 -38.665 1.00 168.26 ? 374 LEU C CG    1 
ATOM   6035 C CD1   . LEU C 1 327 ? 3.067   -11.447 -38.159 1.00 171.04 ? 374 LEU C CD1   1 
ATOM   6036 C CD2   . LEU C 1 327 ? 5.016   -13.013 -38.710 1.00 169.71 ? 374 LEU C CD2   1 
ATOM   6037 N N     . ALA C 1 328 ? 2.134   -16.184 -35.328 1.00 141.25 ? 375 ALA C N     1 
ATOM   6038 C CA    . ALA C 1 328 ? 1.236   -17.167 -34.717 1.00 138.09 ? 375 ALA C CA    1 
ATOM   6039 C C     . ALA C 1 328 ? 1.158   -17.011 -33.181 1.00 136.61 ? 375 ALA C C     1 
ATOM   6040 O O     . ALA C 1 328 ? 2.102   -16.488 -32.576 1.00 135.17 ? 375 ALA C O     1 
ATOM   6041 C CB    . ALA C 1 328 ? 1.706   -18.574 -35.071 1.00 137.27 ? 375 ALA C CB    1 
ATOM   6042 N N     . PRO C 1 329 ? 0.064   -17.471 -32.522 1.00 130.06 ? 376 PRO C N     1 
ATOM   6043 C CA    . PRO C 1 329 ? 0.001   -17.367 -31.052 1.00 126.02 ? 376 PRO C CA    1 
ATOM   6044 C C     . PRO C 1 329 ? 0.955   -18.348 -30.378 1.00 124.49 ? 376 PRO C C     1 
ATOM   6045 O O     . PRO C 1 329 ? 1.050   -19.495 -30.818 1.00 124.34 ? 376 PRO C O     1 
ATOM   6046 C CB    . PRO C 1 329 ? -1.455  -17.724 -30.725 1.00 129.02 ? 376 PRO C CB    1 
ATOM   6047 C CG    . PRO C 1 329 ? -2.167  -17.838 -32.038 1.00 137.39 ? 376 PRO C CG    1 
ATOM   6048 C CD    . PRO C 1 329 ? -1.144  -18.126 -33.062 1.00 133.49 ? 376 PRO C CD    1 
ATOM   6049 N N     . VAL C 1 330 ? 1.648   -17.905 -29.307 1.00 116.83 ? 377 VAL C N     1 
ATOM   6050 C CA    . VAL C 1 330 ? 2.612   -18.713 -28.524 1.00 111.31 ? 377 VAL C CA    1 
ATOM   6051 C C     . VAL C 1 330 ? 1.991   -19.907 -27.778 1.00 109.80 ? 377 VAL C C     1 
ATOM   6052 O O     . VAL C 1 330 ? 2.700   -20.849 -27.444 1.00 106.48 ? 377 VAL C O     1 
ATOM   6053 C CB    . VAL C 1 330 ? 3.493   -17.855 -27.576 1.00 114.53 ? 377 VAL C CB    1 
ATOM   6054 C CG1   . VAL C 1 330 ? 4.435   -16.953 -28.357 1.00 116.21 ? 377 VAL C CG1   1 
ATOM   6055 C CG2   . VAL C 1 330 ? 2.647   -17.041 -26.600 1.00 116.00 ? 377 VAL C CG2   1 
ATOM   6056 N N     . THR C 1 331 ? 0.693   -19.849 -27.484 1.00 106.95 ? 378 THR C N     1 
ATOM   6057 C CA    . THR C 1 331 ? -0.024  -20.908 -26.776 1.00 106.09 ? 378 THR C CA    1 
ATOM   6058 C C     . THR C 1 331 ? -0.438  -22.038 -27.718 1.00 113.83 ? 378 THR C C     1 
ATOM   6059 O O     . THR C 1 331 ? -0.526  -21.798 -28.919 1.00 116.39 ? 378 THR C O     1 
ATOM   6060 C CB    . THR C 1 331 ? -1.254  -20.341 -26.112 1.00 110.02 ? 378 THR C CB    1 
ATOM   6061 O OG1   . THR C 1 331 ? -2.034  -19.688 -27.113 1.00 114.37 ? 378 THR C OG1   1 
ATOM   6062 C CG2   . THR C 1 331 ? -0.911  -19.424 -24.972 1.00 106.81 ? 378 THR C CG2   1 
ATOM   6063 N N     . PRO C 1 332 ? -0.762  -23.257 -27.224 1.00 111.55 ? 379 PRO C N     1 
ATOM   6064 C CA    . PRO C 1 332 ? -0.733  -23.726 -25.825 1.00 110.55 ? 379 PRO C CA    1 
ATOM   6065 C C     . PRO C 1 332 ? 0.702   -23.997 -25.388 1.00 113.03 ? 379 PRO C C     1 
ATOM   6066 O O     . PRO C 1 332 ? 1.412   -24.760 -26.045 1.00 113.72 ? 379 PRO C O     1 
ATOM   6067 C CB    . PRO C 1 332 ? -1.650  -24.966 -25.841 1.00 114.41 ? 379 PRO C CB    1 
ATOM   6068 C CG    . PRO C 1 332 ? -2.165  -25.107 -27.281 1.00 121.40 ? 379 PRO C CG    1 
ATOM   6069 C CD    . PRO C 1 332 ? -1.188  -24.342 -28.122 1.00 115.44 ? 379 PRO C CD    1 
ATOM   6070 N N     . VAL C 1 333 ? 1.151   -23.300 -24.331 1.00 107.94 ? 380 VAL C N     1 
ATOM   6071 C CA    . VAL C 1 333 ? 2.513   -23.387 -23.813 1.00 104.50 ? 380 VAL C CA    1 
ATOM   6072 C C     . VAL C 1 333 ? 2.731   -24.774 -23.219 1.00 106.57 ? 380 VAL C C     1 
ATOM   6073 O O     . VAL C 1 333 ? 1.950   -25.203 -22.359 1.00 106.66 ? 380 VAL C O     1 
ATOM   6074 C CB    . VAL C 1 333 ? 2.891   -22.212 -22.863 1.00 108.30 ? 380 VAL C CB    1 
ATOM   6075 C CG1   . VAL C 1 333 ? 4.320   -22.341 -22.348 1.00 106.06 ? 380 VAL C CG1   1 
ATOM   6076 C CG2   . VAL C 1 333 ? 2.710   -20.867 -23.560 1.00 109.61 ? 380 VAL C CG2   1 
ATOM   6077 N N     . PRO C 1 334 ? 3.730   -25.520 -23.766 1.00 101.52 ? 381 PRO C N     1 
ATOM   6078 C CA    . PRO C 1 334 ? 3.987   -26.890 -23.286 1.00 101.27 ? 381 PRO C CA    1 
ATOM   6079 C C     . PRO C 1 334 ? 4.574   -26.899 -21.885 1.00 104.39 ? 381 PRO C C     1 
ATOM   6080 O O     . PRO C 1 334 ? 5.573   -26.233 -21.605 1.00 102.69 ? 381 PRO C O     1 
ATOM   6081 C CB    . PRO C 1 334 ? 4.968   -27.464 -24.329 1.00 101.54 ? 381 PRO C CB    1 
ATOM   6082 C CG    . PRO C 1 334 ? 5.030   -26.455 -25.420 1.00 105.24 ? 381 PRO C CG    1 
ATOM   6083 C CD    . PRO C 1 334 ? 4.683   -25.151 -24.826 1.00 100.71 ? 381 PRO C CD    1 
ATOM   6084 N N     . VAL C 1 335 ? 3.950   -27.646 -21.007 1.00 103.42 ? 382 VAL C N     1 
ATOM   6085 C CA    . VAL C 1 335 ? 4.425   -27.724 -19.630 1.00 104.68 ? 382 VAL C CA    1 
ATOM   6086 C C     . VAL C 1 335 ? 5.125   -29.069 -19.363 1.00 111.00 ? 382 VAL C C     1 
ATOM   6087 O O     . VAL C 1 335 ? 4.582   -30.115 -19.713 1.00 112.36 ? 382 VAL C O     1 
ATOM   6088 C CB    . VAL C 1 335 ? 3.278   -27.402 -18.637 1.00 111.00 ? 382 VAL C CB    1 
ATOM   6089 C CG1   . VAL C 1 335 ? 3.663   -27.741 -17.199 1.00 112.27 ? 382 VAL C CG1   1 
ATOM   6090 C CG2   . VAL C 1 335 ? 2.864   -25.935 -18.756 1.00 110.84 ? 382 VAL C CG2   1 
ATOM   6091 N N     . VAL C 1 336 ? 6.334   -29.039 -18.771 1.00 107.05 ? 383 VAL C N     1 
ATOM   6092 C CA    . VAL C 1 336 ? 7.048   -30.280 -18.456 1.00 107.26 ? 383 VAL C CA    1 
ATOM   6093 C C     . VAL C 1 336 ? 7.040   -30.540 -16.942 1.00 115.10 ? 383 VAL C C     1 
ATOM   6094 O O     . VAL C 1 336 ? 7.547   -29.724 -16.166 1.00 114.68 ? 383 VAL C O     1 
ATOM   6095 C CB    . VAL C 1 336 ? 8.467   -30.366 -19.068 1.00 107.83 ? 383 VAL C CB    1 
ATOM   6096 C CG1   . VAL C 1 336 ? 9.003   -31.790 -18.981 1.00 108.73 ? 383 VAL C CG1   1 
ATOM   6097 C CG2   . VAL C 1 336 ? 8.475   -29.884 -20.513 1.00 105.40 ? 383 VAL C CG2   1 
ATOM   6098 N N     . GLU C 1 337 ? 6.451   -31.673 -16.536 1.00 115.78 ? 384 GLU C N     1 
ATOM   6099 C CA    . GLU C 1 337 ? 6.353   -32.078 -15.133 1.00 120.06 ? 384 GLU C CA    1 
ATOM   6100 C C     . GLU C 1 337 ? 7.640   -32.760 -14.652 1.00 124.05 ? 384 GLU C C     1 
ATOM   6101 O O     . GLU C 1 337 ? 8.105   -32.491 -13.541 1.00 125.30 ? 384 GLU C O     1 
ATOM   6102 C CB    . GLU C 1 337 ? 5.136   -32.992 -14.913 1.00 125.82 ? 384 GLU C CB    1 
ATOM   6103 C CG    . GLU C 1 337 ? 3.804   -32.273 -15.062 1.00 141.01 ? 384 GLU C CG    1 
ATOM   6104 C CD    . GLU C 1 337 ? 2.700   -32.989 -15.822 1.00 168.62 ? 384 GLU C CD    1 
ATOM   6105 O OE1   . GLU C 1 337 ? 2.812   -34.216 -16.051 1.00 159.87 ? 384 GLU C OE1   1 
ATOM   6106 O OE2   . GLU C 1 337 ? 1.701   -32.315 -16.169 1.00 165.84 ? 384 GLU C OE2   1 
ATOM   6107 N N     . SER C 1 338 ? 8.208   -33.646 -15.483 1.00 119.68 ? 385 SER C N     1 
ATOM   6108 C CA    . SER C 1 338 ? 9.430   -34.379 -15.147 1.00 120.04 ? 385 SER C CA    1 
ATOM   6109 C C     . SER C 1 338 ? 10.155  -34.926 -16.371 1.00 120.14 ? 385 SER C C     1 
ATOM   6110 O O     . SER C 1 338 ? 9.673   -34.826 -17.503 1.00 117.04 ? 385 SER C O     1 
ATOM   6111 C CB    . SER C 1 338 ? 9.138   -35.515 -14.158 1.00 129.53 ? 385 SER C CB    1 
ATOM   6112 O OG    . SER C 1 338 ? 8.336   -36.543 -14.721 1.00 141.28 ? 385 SER C OG    1 
ATOM   6113 N N     . LEU C 1 339 ? 11.329  -35.509 -16.112 1.00 117.36 ? 386 LEU C N     1 
ATOM   6114 C CA    . LEU C 1 339 ? 12.199  -36.151 -17.085 1.00 115.45 ? 386 LEU C CA    1 
ATOM   6115 C C     . LEU C 1 339 ? 12.635  -37.470 -16.501 1.00 125.14 ? 386 LEU C C     1 
ATOM   6116 O O     . LEU C 1 339 ? 12.698  -37.614 -15.273 1.00 127.93 ? 386 LEU C O     1 
ATOM   6117 C CB    . LEU C 1 339 ? 13.444  -35.288 -17.360 1.00 111.77 ? 386 LEU C CB    1 
ATOM   6118 C CG    . LEU C 1 339 ? 13.222  -33.909 -17.991 1.00 112.12 ? 386 LEU C CG    1 
ATOM   6119 C CD1   . LEU C 1 339 ? 14.420  -33.028 -17.792 1.00 109.60 ? 386 LEU C CD1   1 
ATOM   6120 C CD2   . LEU C 1 339 ? 12.912  -34.026 -19.455 1.00 113.01 ? 386 LEU C CD2   1 
ATOM   6121 N N     . GLN C 1 340 ? 12.935  -38.437 -17.371 1.00 123.98 ? 387 GLN C N     1 
ATOM   6122 C CA    . GLN C 1 340 ? 13.417  -39.747 -16.959 1.00 128.09 ? 387 GLN C CA    1 
ATOM   6123 C C     . GLN C 1 340 ? 14.143  -40.433 -18.087 1.00 133.82 ? 387 GLN C C     1 
ATOM   6124 O O     . GLN C 1 340 ? 13.651  -40.454 -19.217 1.00 132.42 ? 387 GLN C O     1 
ATOM   6125 C CB    . GLN C 1 340 ? 12.273  -40.637 -16.424 1.00 134.52 ? 387 GLN C CB    1 
ATOM   6126 C CG    . GLN C 1 340 ? 12.731  -41.861 -15.617 1.00 157.42 ? 387 GLN C CG    1 
ATOM   6127 C CD    . GLN C 1 340 ? 13.592  -41.506 -14.424 1.00 179.50 ? 387 GLN C CD    1 
ATOM   6128 O OE1   . GLN C 1 340 ? 13.106  -41.007 -13.404 1.00 176.44 ? 387 GLN C OE1   1 
ATOM   6129 N NE2   . GLN C 1 340 ? 14.895  -41.747 -14.533 1.00 171.15 ? 387 GLN C NE2   1 
ATOM   6130 N N     . LEU C 1 341 ? 15.313  -41.014 -17.768 1.00 133.55 ? 388 LEU C N     1 
ATOM   6131 C CA    . LEU C 1 341 ? 16.102  -41.801 -18.706 1.00 134.65 ? 388 LEU C CA    1 
ATOM   6132 C C     . LEU C 1 341 ? 15.366  -43.115 -18.888 1.00 147.03 ? 388 LEU C C     1 
ATOM   6133 O O     . LEU C 1 341 ? 14.671  -43.543 -17.959 1.00 149.42 ? 388 LEU C O     1 
ATOM   6134 C CB    . LEU C 1 341 ? 17.513  -42.038 -18.167 1.00 134.78 ? 388 LEU C CB    1 
ATOM   6135 C CG    . LEU C 1 341 ? 18.512  -40.928 -18.454 1.00 135.07 ? 388 LEU C CG    1 
ATOM   6136 C CD1   . LEU C 1 341 ? 19.536  -40.823 -17.352 1.00 136.08 ? 388 LEU C CD1   1 
ATOM   6137 C CD2   . LEU C 1 341 ? 19.189  -41.122 -19.802 1.00 135.75 ? 388 LEU C CD2   1 
ATOM   6138 N N     . ASN C 1 342 ? 15.474  -43.739 -20.078 1.00 148.17 ? 389 ASN C N     1 
ATOM   6139 C CA    . ASN C 1 342 ? 14.719  -44.958 -20.352 1.00 154.78 ? 389 ASN C CA    1 
ATOM   6140 C C     . ASN C 1 342 ? 15.169  -46.268 -19.617 1.00 166.86 ? 389 ASN C C     1 
ATOM   6141 O O     . ASN C 1 342 ? 14.576  -46.567 -18.577 1.00 170.03 ? 389 ASN C O     1 
ATOM   6142 C CB    . ASN C 1 342 ? 14.339  -45.110 -21.838 1.00 157.15 ? 389 ASN C CB    1 
ATOM   6143 C CG    . ASN C 1 342 ? 12.845  -45.102 -22.099 1.00 185.15 ? 389 ASN C CG    1 
ATOM   6144 O OD1   . ASN C 1 342 ? 12.041  -45.660 -21.338 1.00 184.46 ? 389 ASN C OD1   1 
ATOM   6145 N ND2   . ASN C 1 342 ? 12.442  -44.513 -23.213 1.00 173.36 ? 389 ASN C ND2   1 
ATOM   6146 N N     . GLY C 1 343 ? 16.166  -47.031 -20.098 1.00 166.43 ? 390 GLY C N     1 
ATOM   6147 C CA    . GLY C 1 343 ? 16.949  -46.808 -21.311 1.00 164.01 ? 390 GLY C CA    1 
ATOM   6148 C C     . GLY C 1 343 ? 18.246  -46.055 -21.084 1.00 162.46 ? 390 GLY C C     1 
ATOM   6149 O O     . GLY C 1 343 ? 18.299  -44.849 -21.354 1.00 156.45 ? 390 GLY C O     1 
ATOM   6150 N N     . GLY C 1 344 ? 19.303  -46.753 -20.625 1.00 160.17 ? 391 GLY C N     1 
ATOM   6151 C CA    . GLY C 1 344 ? 19.306  -48.166 -20.235 1.00 165.50 ? 391 GLY C CA    1 
ATOM   6152 C C     . GLY C 1 344 ? 19.502  -49.166 -21.357 1.00 172.19 ? 391 GLY C C     1 
ATOM   6153 O O     . GLY C 1 344 ? 18.635  -50.013 -21.594 1.00 176.67 ? 391 GLY C O     1 
ATOM   6154 N N     . GLY C 1 345 ? 20.655  -49.081 -22.012 1.00 165.98 ? 392 GLY C N     1 
ATOM   6155 C CA    . GLY C 1 345 ? 21.032  -49.927 -23.136 1.00 168.84 ? 392 GLY C CA    1 
ATOM   6156 C C     . GLY C 1 345 ? 21.402  -49.070 -24.326 1.00 168.15 ? 392 GLY C C     1 
ATOM   6157 O O     . GLY C 1 345 ? 20.556  -48.324 -24.831 1.00 164.99 ? 392 GLY C O     1 
ATOM   6158 N N     . ASP C 1 346 ? 22.689  -49.137 -24.741 1.00 164.27 ? 393 ASP C N     1 
ATOM   6159 C CA    . ASP C 1 346 ? 23.286  -48.380 -25.853 1.00 161.41 ? 393 ASP C CA    1 
ATOM   6160 C C     . ASP C 1 346 ? 22.943  -46.867 -25.810 1.00 158.29 ? 393 ASP C C     1 
ATOM   6161 O O     . ASP C 1 346 ? 23.339  -46.197 -24.848 1.00 154.57 ? 393 ASP C O     1 
ATOM   6162 C CB    . ASP C 1 346 ? 22.980  -49.040 -27.209 1.00 168.05 ? 393 ASP C CB    1 
ATOM   6163 C CG    . ASP C 1 346 ? 23.608  -50.408 -27.374 1.00 184.82 ? 393 ASP C CG    1 
ATOM   6164 O OD1   . ASP C 1 346 ? 24.690  -50.493 -27.994 1.00 186.90 ? 393 ASP C OD1   1 
ATOM   6165 O OD2   . ASP C 1 346 ? 23.011  -51.397 -26.894 1.00 194.37 ? 393 ASP C OD2   1 
ATOM   6166 N N     . VAL C 1 347 ? 22.189  -46.337 -26.805 1.00 152.78 ? 394 VAL C N     1 
ATOM   6167 C CA    . VAL C 1 347 ? 21.809  -44.919 -26.797 1.00 146.73 ? 394 VAL C CA    1 
ATOM   6168 C C     . VAL C 1 347 ? 20.815  -44.596 -25.693 1.00 145.78 ? 394 VAL C C     1 
ATOM   6169 O O     . VAL C 1 347 ? 19.971  -45.435 -25.350 1.00 148.10 ? 394 VAL C O     1 
ATOM   6170 C CB    . VAL C 1 347 ? 21.427  -44.283 -28.160 1.00 150.65 ? 394 VAL C CB    1 
ATOM   6171 C CG1   . VAL C 1 347 ? 22.640  -44.160 -29.080 1.00 151.81 ? 394 VAL C CG1   1 
ATOM   6172 C CG2   . VAL C 1 347 ? 20.281  -45.027 -28.833 1.00 154.53 ? 394 VAL C CG2   1 
ATOM   6173 N N     . ALA C 1 348 ? 20.959  -43.391 -25.111 1.00 135.71 ? 395 ALA C N     1 
ATOM   6174 C CA    . ALA C 1 348 ? 20.128  -42.925 -24.008 1.00 132.44 ? 395 ALA C CA    1 
ATOM   6175 C C     . ALA C 1 348 ? 18.917  -42.152 -24.494 1.00 131.81 ? 395 ALA C C     1 
ATOM   6176 O O     . ALA C 1 348 ? 19.018  -41.307 -25.391 1.00 129.72 ? 395 ALA C O     1 
ATOM   6177 C CB    . ALA C 1 348 ? 20.952  -42.088 -23.047 1.00 130.23 ? 395 ALA C CB    1 
ATOM   6178 N N     . MET C 1 349 ? 17.765  -42.463 -23.902 1.00 127.09 ? 396 MET C N     1 
ATOM   6179 C CA    . MET C 1 349 ? 16.494  -41.850 -24.248 1.00 124.80 ? 396 MET C CA    1 
ATOM   6180 C C     . MET C 1 349 ? 15.919  -41.122 -23.065 1.00 123.80 ? 396 MET C C     1 
ATOM   6181 O O     . MET C 1 349 ? 15.799  -41.707 -21.988 1.00 124.44 ? 396 MET C O     1 
ATOM   6182 C CB    . MET C 1 349 ? 15.512  -42.920 -24.733 1.00 131.87 ? 396 MET C CB    1 
ATOM   6183 C CG    . MET C 1 349 ? 15.866  -43.488 -26.080 1.00 138.39 ? 396 MET C CG    1 
ATOM   6184 S SD    . MET C 1 349 ? 15.581  -42.263 -27.370 1.00 140.24 ? 396 MET C SD    1 
ATOM   6185 C CE    . MET C 1 349 ? 14.711  -43.276 -28.574 1.00 143.01 ? 396 MET C CE    1 
ATOM   6186 N N     . LEU C 1 350 ? 15.575  -39.838 -23.260 1.00 116.01 ? 397 LEU C N     1 
ATOM   6187 C CA    . LEU C 1 350 ? 14.967  -39.009 -22.228 1.00 113.13 ? 397 LEU C CA    1 
ATOM   6188 C C     . LEU C 1 350 ? 13.484  -38.862 -22.519 1.00 118.96 ? 397 LEU C C     1 
ATOM   6189 O O     . LEU C 1 350 ? 13.118  -38.470 -23.631 1.00 118.14 ? 397 LEU C O     1 
ATOM   6190 C CB    . LEU C 1 350 ? 15.658  -37.648 -22.148 1.00 108.84 ? 397 LEU C CB    1 
ATOM   6191 C CG    . LEU C 1 350 ? 15.428  -36.843 -20.872 1.00 111.03 ? 397 LEU C CG    1 
ATOM   6192 C CD1   . LEU C 1 350 ? 16.198  -37.427 -19.701 1.00 112.35 ? 397 LEU C CD1   1 
ATOM   6193 C CD2   . LEU C 1 350 ? 15.875  -35.433 -21.066 1.00 108.85 ? 397 LEU C CD2   1 
ATOM   6194 N N     . GLU C 1 351 ? 12.638  -39.253 -21.542 1.00 118.85 ? 398 GLU C N     1 
ATOM   6195 C CA    . GLU C 1 351 ? 11.176  -39.188 -21.633 1.00 121.38 ? 398 GLU C CA    1 
ATOM   6196 C C     . GLU C 1 351 ? 10.690  -37.927 -20.920 1.00 123.98 ? 398 GLU C C     1 
ATOM   6197 O O     . GLU C 1 351 ? 10.966  -37.745 -19.725 1.00 124.78 ? 398 GLU C O     1 
ATOM   6198 C CB    . GLU C 1 351 ? 10.504  -40.420 -20.989 1.00 128.06 ? 398 GLU C CB    1 
ATOM   6199 C CG    . GLU C 1 351 ? 10.753  -41.742 -21.697 1.00 148.78 ? 398 GLU C CG    1 
ATOM   6200 C CD    . GLU C 1 351 ? 10.377  -42.991 -20.913 1.00 184.13 ? 398 GLU C CD    1 
ATOM   6201 O OE1   . GLU C 1 351 ? 10.892  -43.172 -19.784 1.00 180.68 ? 398 GLU C OE1   1 
ATOM   6202 O OE2   . GLU C 1 351 ? 9.626   -43.829 -21.463 1.00 182.08 ? 398 GLU C OE2   1 
ATOM   6203 N N     . LEU C 1 352 ? 9.957   -37.064 -21.655 1.00 117.42 ? 399 LEU C N     1 
ATOM   6204 C CA    . LEU C 1 352 ? 9.377   -35.824 -21.137 1.00 114.27 ? 399 LEU C CA    1 
ATOM   6205 C C     . LEU C 1 352 ? 7.890   -36.045 -20.878 1.00 118.74 ? 399 LEU C C     1 
ATOM   6206 O O     . LEU C 1 352 ? 7.152   -36.381 -21.807 1.00 119.43 ? 399 LEU C O     1 
ATOM   6207 C CB    . LEU C 1 352 ? 9.560   -34.663 -22.144 1.00 111.32 ? 399 LEU C CB    1 
ATOM   6208 C CG    . LEU C 1 352 ? 10.979  -34.177 -22.399 1.00 112.98 ? 399 LEU C CG    1 
ATOM   6209 C CD1   . LEU C 1 352 ? 11.575  -34.822 -23.632 1.00 113.71 ? 399 LEU C CD1   1 
ATOM   6210 C CD2   . LEU C 1 352 ? 11.017  -32.695 -22.528 1.00 111.74 ? 399 LEU C CD2   1 
ATOM   6211 N N     . THR C 1 353 ? 7.454   -35.882 -19.619 1.00 115.96 ? 400 THR C N     1 
ATOM   6212 C CA    . THR C 1 353 ? 6.037   -35.992 -19.256 1.00 118.70 ? 400 THR C CA    1 
ATOM   6213 C C     . THR C 1 353 ? 5.484   -34.612 -18.892 1.00 120.89 ? 400 THR C C     1 
ATOM   6214 O O     . THR C 1 353 ? 6.106   -33.878 -18.114 1.00 117.95 ? 400 THR C O     1 
ATOM   6215 C CB    . THR C 1 353 ? 5.747   -37.116 -18.239 1.00 126.78 ? 400 THR C CB    1 
ATOM   6216 O OG1   . THR C 1 353 ? 6.596   -36.981 -17.097 1.00 125.68 ? 400 THR C OG1   1 
ATOM   6217 C CG2   . THR C 1 353 ? 5.870   -38.514 -18.850 1.00 124.99 ? 400 THR C CG2   1 
ATOM   6218 N N     . GLY C 1 354 ? 4.357   -34.260 -19.515 1.00 119.03 ? 401 GLY C N     1 
ATOM   6219 C CA    . GLY C 1 354 ? 3.688   -32.979 -19.329 1.00 117.99 ? 401 GLY C CA    1 
ATOM   6220 C C     . GLY C 1 354 ? 2.385   -32.811 -20.083 1.00 123.63 ? 401 GLY C C     1 
ATOM   6221 O O     . GLY C 1 354 ? 1.573   -33.735 -20.117 1.00 127.30 ? 401 GLY C O     1 
ATOM   6222 N N     . GLN C 1 355 ? 2.149   -31.596 -20.630 1.00 118.07 ? 402 GLN C N     1 
ATOM   6223 C CA    . GLN C 1 355 ? 0.933   -31.202 -21.365 1.00 119.58 ? 402 GLN C CA    1 
ATOM   6224 C C     . GLN C 1 355 ? 1.270   -30.252 -22.499 1.00 122.58 ? 402 GLN C C     1 
ATOM   6225 O O     . GLN C 1 355 ? 2.329   -29.618 -22.480 1.00 119.33 ? 402 GLN C O     1 
ATOM   6226 C CB    . GLN C 1 355 ? -0.034  -30.438 -20.454 1.00 122.49 ? 402 GLN C CB    1 
ATOM   6227 C CG    . GLN C 1 355 ? -0.595  -31.196 -19.265 1.00 132.99 ? 402 GLN C CG    1 
ATOM   6228 C CD    . GLN C 1 355 ? -0.806  -30.273 -18.084 1.00 137.05 ? 402 GLN C CD    1 
ATOM   6229 O OE1   . GLN C 1 355 ? -0.751  -29.035 -18.193 1.00 112.78 ? 402 GLN C OE1   1 
ATOM   6230 N NE2   . GLN C 1 355 ? -1.026  -30.862 -16.914 1.00 138.94 ? 402 GLN C NE2   1 
ATOM   6231 N N     . ASN C 1 356 ? 0.316   -30.085 -23.441 1.00 121.86 ? 403 ASN C N     1 
ATOM   6232 C CA    . ASN C 1 356 ? 0.386   -29.164 -24.592 1.00 120.41 ? 403 ASN C CA    1 
ATOM   6233 C C     . ASN C 1 356 ? 1.549   -29.427 -25.584 1.00 122.14 ? 403 ASN C C     1 
ATOM   6234 O O     . ASN C 1 356 ? 1.981   -28.506 -26.295 1.00 120.38 ? 403 ASN C O     1 
ATOM   6235 C CB    . ASN C 1 356 ? 0.322   -27.692 -24.130 1.00 117.91 ? 403 ASN C CB    1 
ATOM   6236 C CG    . ASN C 1 356 ? -0.744  -27.410 -23.089 1.00 132.95 ? 403 ASN C CG    1 
ATOM   6237 O OD1   . ASN C 1 356 ? -1.951  -27.483 -23.359 1.00 130.15 ? 403 ASN C OD1   1 
ATOM   6238 N ND2   . ASN C 1 356 ? -0.320  -27.071 -21.875 1.00 117.35 ? 403 ASN C ND2   1 
ATOM   6239 N N     . PHE C 1 357 ? 2.027   -30.697 -25.651 1.00 118.70 ? 404 PHE C N     1 
ATOM   6240 C CA    . PHE C 1 357 ? 3.100   -31.109 -26.567 1.00 117.21 ? 404 PHE C CA    1 
ATOM   6241 C C     . PHE C 1 357 ? 2.520   -31.320 -27.968 1.00 124.90 ? 404 PHE C C     1 
ATOM   6242 O O     . PHE C 1 357 ? 1.509   -32.007 -28.098 1.00 129.08 ? 404 PHE C O     1 
ATOM   6243 C CB    . PHE C 1 357 ? 3.771   -32.429 -26.115 1.00 118.63 ? 404 PHE C CB    1 
ATOM   6244 C CG    . PHE C 1 357 ? 4.442   -32.536 -24.760 1.00 117.21 ? 404 PHE C CG    1 
ATOM   6245 C CD1   . PHE C 1 357 ? 4.891   -31.401 -24.091 1.00 117.33 ? 404 PHE C CD1   1 
ATOM   6246 C CD2   . PHE C 1 357 ? 4.707   -33.779 -24.196 1.00 119.67 ? 404 PHE C CD2   1 
ATOM   6247 C CE1   . PHE C 1 357 ? 5.534   -31.509 -22.851 1.00 116.92 ? 404 PHE C CE1   1 
ATOM   6248 C CE2   . PHE C 1 357 ? 5.365   -33.887 -22.966 1.00 120.76 ? 404 PHE C CE2   1 
ATOM   6249 C CZ    . PHE C 1 357 ? 5.777   -32.754 -22.302 1.00 116.34 ? 404 PHE C CZ    1 
ATOM   6250 N N     . THR C 1 358 ? 3.151   -30.736 -29.006 1.00 120.07 ? 405 THR C N     1 
ATOM   6251 C CA    . THR C 1 358 ? 2.748   -30.874 -30.417 1.00 122.92 ? 405 THR C CA    1 
ATOM   6252 C C     . THR C 1 358 ? 3.914   -31.490 -31.198 1.00 126.10 ? 405 THR C C     1 
ATOM   6253 O O     . THR C 1 358 ? 5.053   -31.339 -30.759 1.00 121.91 ? 405 THR C O     1 
ATOM   6254 C CB    . THR C 1 358 ? 2.340   -29.509 -31.044 1.00 129.88 ? 405 THR C CB    1 
ATOM   6255 O OG1   . THR C 1 358 ? 3.500   -28.722 -31.347 1.00 128.83 ? 405 THR C OG1   1 
ATOM   6256 C CG2   . THR C 1 358 ? 1.325   -28.729 -30.213 1.00 124.38 ? 405 THR C CG2   1 
ATOM   6257 N N     . PRO C 1 359 ? 3.704   -32.121 -32.379 1.00 127.69 ? 406 PRO C N     1 
ATOM   6258 C CA    . PRO C 1 359 ? 4.863   -32.651 -33.138 1.00 128.32 ? 406 PRO C CA    1 
ATOM   6259 C C     . PRO C 1 359 ? 5.856   -31.571 -33.600 1.00 130.23 ? 406 PRO C C     1 
ATOM   6260 O O     . PRO C 1 359 ? 6.993   -31.890 -33.935 1.00 129.38 ? 406 PRO C O     1 
ATOM   6261 C CB    . PRO C 1 359 ? 4.215   -33.354 -34.333 1.00 136.36 ? 406 PRO C CB    1 
ATOM   6262 C CG    . PRO C 1 359 ? 2.779   -33.547 -33.950 1.00 142.94 ? 406 PRO C CG    1 
ATOM   6263 C CD    . PRO C 1 359 ? 2.435   -32.390 -33.087 1.00 134.30 ? 406 PRO C CD    1 
ATOM   6264 N N     . ASN C 1 360 ? 5.434   -30.287 -33.552 1.00 125.73 ? 407 ASN C N     1 
ATOM   6265 C CA    . ASN C 1 360 ? 6.189   -29.092 -33.942 1.00 124.01 ? 407 ASN C CA    1 
ATOM   6266 C C     . ASN C 1 360 ? 7.278   -28.687 -32.930 1.00 122.27 ? 407 ASN C C     1 
ATOM   6267 O O     . ASN C 1 360 ? 7.952   -27.677 -33.137 1.00 122.00 ? 407 ASN C O     1 
ATOM   6268 C CB    . ASN C 1 360 ? 5.224   -27.915 -34.164 1.00 125.34 ? 407 ASN C CB    1 
ATOM   6269 C CG    . ASN C 1 360 ? 3.866   -28.294 -34.716 1.00 151.96 ? 407 ASN C CG    1 
ATOM   6270 O OD1   . ASN C 1 360 ? 3.740   -28.939 -35.768 1.00 144.25 ? 407 ASN C OD1   1 
ATOM   6271 N ND2   . ASN C 1 360 ? 2.816   -27.877 -34.019 1.00 145.93 ? 407 ASN C ND2   1 
ATOM   6272 N N     . LEU C 1 361 ? 7.452   -29.457 -31.845 1.00 114.67 ? 408 LEU C N     1 
ATOM   6273 C CA    . LEU C 1 361 ? 8.423   -29.139 -30.793 1.00 109.77 ? 408 LEU C CA    1 
ATOM   6274 C C     . LEU C 1 361 ? 9.633   -30.036 -30.810 1.00 112.05 ? 408 LEU C C     1 
ATOM   6275 O O     . LEU C 1 361 ? 9.486   -31.243 -30.971 1.00 113.12 ? 408 LEU C O     1 
ATOM   6276 C CB    . LEU C 1 361 ? 7.781   -29.247 -29.397 1.00 107.44 ? 408 LEU C CB    1 
ATOM   6277 C CG    . LEU C 1 361 ? 6.682   -28.285 -29.028 1.00 111.38 ? 408 LEU C CG    1 
ATOM   6278 C CD1   . LEU C 1 361 ? 5.842   -28.883 -27.956 1.00 111.14 ? 408 LEU C CD1   1 
ATOM   6279 C CD2   . LEU C 1 361 ? 7.246   -26.946 -28.579 1.00 110.97 ? 408 LEU C CD2   1 
ATOM   6280 N N     . ARG C 1 362 ? 10.816  -29.458 -30.543 1.00 106.78 ? 409 ARG C N     1 
ATOM   6281 C CA    . ARG C 1 362 ? 12.092  -30.179 -30.454 1.00 106.28 ? 409 ARG C CA    1 
ATOM   6282 C C     . ARG C 1 362 ? 12.749  -29.879 -29.116 1.00 106.48 ? 409 ARG C C     1 
ATOM   6283 O O     . ARG C 1 362 ? 12.688  -28.741 -28.645 1.00 105.64 ? 409 ARG C O     1 
ATOM   6284 C CB    . ARG C 1 362 ? 13.056  -29.826 -31.611 1.00 110.05 ? 409 ARG C CB    1 
ATOM   6285 C CG    . ARG C 1 362 ? 12.440  -29.810 -33.017 1.00 129.75 ? 409 ARG C CG    1 
ATOM   6286 C CD    . ARG C 1 362 ? 12.121  -31.192 -33.578 1.00 145.71 ? 409 ARG C CD    1 
ATOM   6287 N NE    . ARG C 1 362 ? 11.824  -31.142 -35.013 1.00 165.15 ? 409 ARG C NE    1 
ATOM   6288 C CZ    . ARG C 1 362 ? 10.634  -30.846 -35.533 1.00 185.42 ? 409 ARG C CZ    1 
ATOM   6289 N NH1   . ARG C 1 362 ? 9.606   -30.560 -34.741 1.00 173.20 ? 409 ARG C NH1   1 
ATOM   6290 N NH2   . ARG C 1 362 ? 10.464  -30.827 -36.850 1.00 175.85 ? 409 ARG C NH2   1 
ATOM   6291 N N     . VAL C 1 363 ? 13.354  -30.906 -28.499 1.00 101.25 ? 410 VAL C N     1 
ATOM   6292 C CA    . VAL C 1 363 ? 14.036  -30.804 -27.205 1.00 98.50  ? 410 VAL C CA    1 
ATOM   6293 C C     . VAL C 1 363 ? 15.449  -30.299 -27.435 1.00 102.16 ? 410 VAL C C     1 
ATOM   6294 O O     . VAL C 1 363 ? 16.133  -30.774 -28.339 1.00 103.66 ? 410 VAL C O     1 
ATOM   6295 C CB    . VAL C 1 363 ? 14.068  -32.154 -26.438 1.00 102.44 ? 410 VAL C CB    1 
ATOM   6296 C CG1   . VAL C 1 363 ? 14.589  -31.965 -25.015 1.00 100.36 ? 410 VAL C CG1   1 
ATOM   6297 C CG2   . VAL C 1 363 ? 12.697  -32.824 -26.428 1.00 103.87 ? 410 VAL C CG2   1 
ATOM   6298 N N     . TRP C 1 364 ? 15.902  -29.364 -26.605 1.00 96.51  ? 411 TRP C N     1 
ATOM   6299 C CA    . TRP C 1 364 ? 17.258  -28.850 -26.731 1.00 95.94  ? 411 TRP C CA    1 
ATOM   6300 C C     . TRP C 1 364 ? 18.048  -29.044 -25.444 1.00 97.03  ? 411 TRP C C     1 
ATOM   6301 O O     . TRP C 1 364 ? 17.603  -28.629 -24.362 1.00 96.91  ? 411 TRP C O     1 
ATOM   6302 C CB    . TRP C 1 364 ? 17.239  -27.364 -27.101 1.00 94.77  ? 411 TRP C CB    1 
ATOM   6303 C CG    . TRP C 1 364 ? 16.893  -27.077 -28.518 1.00 97.21  ? 411 TRP C CG    1 
ATOM   6304 C CD1   . TRP C 1 364 ? 15.736  -27.396 -29.166 1.00 100.54 ? 411 TRP C CD1   1 
ATOM   6305 C CD2   . TRP C 1 364 ? 17.660  -26.283 -29.430 1.00 99.64  ? 411 TRP C CD2   1 
ATOM   6306 N NE1   . TRP C 1 364 ? 15.745  -26.870 -30.440 1.00 103.01 ? 411 TRP C NE1   1 
ATOM   6307 C CE2   . TRP C 1 364 ? 16.911  -26.170 -30.623 1.00 105.50 ? 411 TRP C CE2   1 
ATOM   6308 C CE3   . TRP C 1 364 ? 18.923  -25.658 -29.362 1.00 101.76 ? 411 TRP C CE3   1 
ATOM   6309 C CZ2   . TRP C 1 364 ? 17.381  -25.460 -31.731 1.00 107.88 ? 411 TRP C CZ2   1 
ATOM   6310 C CZ3   . TRP C 1 364 ? 19.384  -24.952 -30.465 1.00 105.96 ? 411 TRP C CZ3   1 
ATOM   6311 C CH2   . TRP C 1 364 ? 18.609  -24.843 -31.619 1.00 108.49 ? 411 TRP C CH2   1 
ATOM   6312 N N     . PHE C 1 365 ? 19.234  -29.635 -25.573 1.00 90.70  ? 412 PHE C N     1 
ATOM   6313 C CA    . PHE C 1 365 ? 20.148  -29.820 -24.455 1.00 89.35  ? 412 PHE C CA    1 
ATOM   6314 C C     . PHE C 1 365 ? 21.120  -28.667 -24.627 1.00 95.20  ? 412 PHE C C     1 
ATOM   6315 O O     . PHE C 1 365 ? 21.854  -28.656 -25.606 1.00 95.73  ? 412 PHE C O     1 
ATOM   6316 C CB    . PHE C 1 365 ? 20.822  -31.200 -24.538 1.00 90.97  ? 412 PHE C CB    1 
ATOM   6317 C CG    . PHE C 1 365 ? 19.880  -32.361 -24.314 1.00 91.94  ? 412 PHE C CG    1 
ATOM   6318 C CD1   . PHE C 1 365 ? 18.886  -32.663 -25.240 1.00 95.80  ? 412 PHE C CD1   1 
ATOM   6319 C CD2   . PHE C 1 365 ? 20.010  -33.175 -23.200 1.00 94.32  ? 412 PHE C CD2   1 
ATOM   6320 C CE1   . PHE C 1 365 ? 17.998  -33.718 -25.019 1.00 97.18  ? 412 PHE C CE1   1 
ATOM   6321 C CE2   . PHE C 1 365 ? 19.136  -34.246 -22.993 1.00 98.07  ? 412 PHE C CE2   1 
ATOM   6322 C CZ    . PHE C 1 365 ? 18.130  -34.503 -23.900 1.00 96.54  ? 412 PHE C CZ    1 
ATOM   6323 N N     . GLY C 1 366 ? 21.008  -27.636 -23.781 1.00 93.36  ? 413 GLY C N     1 
ATOM   6324 C CA    . GLY C 1 366 ? 21.801  -26.424 -23.944 1.00 95.92  ? 413 GLY C CA    1 
ATOM   6325 C C     . GLY C 1 366 ? 21.589  -25.877 -25.348 1.00 104.25 ? 413 GLY C C     1 
ATOM   6326 O O     . GLY C 1 366 ? 20.436  -25.777 -25.798 1.00 104.91 ? 413 GLY C O     1 
ATOM   6327 N N     . ASP C 1 367 ? 22.702  -25.640 -26.094 1.00 102.44 ? 414 ASP C N     1 
ATOM   6328 C CA    . ASP C 1 367 ? 22.684  -25.138 -27.480 1.00 104.11 ? 414 ASP C CA    1 
ATOM   6329 C C     . ASP C 1 367 ? 22.604  -26.246 -28.563 1.00 105.14 ? 414 ASP C C     1 
ATOM   6330 O O     . ASP C 1 367 ? 22.700  -25.946 -29.744 1.00 106.18 ? 414 ASP C O     1 
ATOM   6331 C CB    . ASP C 1 367 ? 23.882  -24.194 -27.733 1.00 110.16 ? 414 ASP C CB    1 
ATOM   6332 C CG    . ASP C 1 367 ? 25.218  -24.851 -28.078 1.00 126.33 ? 414 ASP C CG    1 
ATOM   6333 O OD1   . ASP C 1 367 ? 25.476  -25.979 -27.594 1.00 125.40 ? 414 ASP C OD1   1 
ATOM   6334 O OD2   . ASP C 1 367 ? 26.027  -24.213 -28.793 1.00 137.55 ? 414 ASP C OD2   1 
ATOM   6335 N N     . VAL C 1 368 ? 22.392  -27.505 -28.150 1.00 98.53  ? 415 VAL C N     1 
ATOM   6336 C CA    . VAL C 1 368 ? 22.333  -28.711 -29.001 1.00 97.56  ? 415 VAL C CA    1 
ATOM   6337 C C     . VAL C 1 368 ? 20.867  -29.213 -29.199 1.00 98.03  ? 415 VAL C C     1 
ATOM   6338 O O     . VAL C 1 368 ? 20.231  -29.665 -28.239 1.00 94.68  ? 415 VAL C O     1 
ATOM   6339 C CB    . VAL C 1 368 ? 23.268  -29.801 -28.388 1.00 99.97  ? 415 VAL C CB    1 
ATOM   6340 C CG1   . VAL C 1 368 ? 23.251  -31.089 -29.202 1.00 101.02 ? 415 VAL C CG1   1 
ATOM   6341 C CG2   . VAL C 1 368 ? 24.696  -29.278 -28.220 1.00 101.33 ? 415 VAL C CG2   1 
ATOM   6342 N N     . GLU C 1 369 ? 20.329  -29.093 -30.433 1.00 95.83  ? 416 GLU C N     1 
ATOM   6343 C CA    . GLU C 1 369 ? 18.964  -29.546 -30.726 1.00 95.65  ? 416 GLU C CA    1 
ATOM   6344 C C     . GLU C 1 369 ? 18.940  -31.089 -30.686 1.00 104.24 ? 416 GLU C C     1 
ATOM   6345 O O     . GLU C 1 369 ? 19.937  -31.715 -31.049 1.00 106.52 ? 416 GLU C O     1 
ATOM   6346 C CB    . GLU C 1 369 ? 18.491  -29.004 -32.083 1.00 99.76  ? 416 GLU C CB    1 
ATOM   6347 C CG    . GLU C 1 369 ? 17.036  -29.302 -32.405 1.00 108.15 ? 416 GLU C CG    1 
ATOM   6348 C CD    . GLU C 1 369 ? 16.583  -28.914 -33.799 1.00 136.80 ? 416 GLU C CD    1 
ATOM   6349 O OE1   . GLU C 1 369 ? 16.483  -27.698 -34.081 1.00 140.06 ? 416 GLU C OE1   1 
ATOM   6350 O OE2   . GLU C 1 369 ? 16.277  -29.829 -34.595 1.00 133.27 ? 416 GLU C OE2   1 
ATOM   6351 N N     . ALA C 1 370 ? 17.842  -31.705 -30.216 1.00 101.58 ? 417 ALA C N     1 
ATOM   6352 C CA    . ALA C 1 370 ? 17.798  -33.166 -30.125 1.00 103.12 ? 417 ALA C CA    1 
ATOM   6353 C C     . ALA C 1 370 ? 16.782  -33.838 -31.045 1.00 112.18 ? 417 ALA C C     1 
ATOM   6354 O O     . ALA C 1 370 ? 15.805  -33.208 -31.472 1.00 111.46 ? 417 ALA C O     1 
ATOM   6355 C CB    . ALA C 1 370 ? 17.604  -33.610 -28.678 1.00 101.29 ? 417 ALA C CB    1 
ATOM   6356 N N     . GLU C 1 371 ? 17.043  -35.123 -31.368 1.00 113.61 ? 418 GLU C N     1 
ATOM   6357 C CA    . GLU C 1 371 ? 16.172  -35.938 -32.205 1.00 118.33 ? 418 GLU C CA    1 
ATOM   6358 C C     . GLU C 1 371 ? 14.934  -36.305 -31.359 1.00 124.35 ? 418 GLU C C     1 
ATOM   6359 O O     . GLU C 1 371 ? 14.983  -37.243 -30.556 1.00 124.99 ? 418 GLU C O     1 
ATOM   6360 C CB    . GLU C 1 371 ? 16.935  -37.181 -32.680 1.00 123.03 ? 418 GLU C CB    1 
ATOM   6361 C CG    . GLU C 1 371 ? 16.163  -38.072 -33.637 1.00 136.36 ? 418 GLU C CG    1 
ATOM   6362 C CD    . GLU C 1 371 ? 16.818  -39.408 -33.925 1.00 152.42 ? 418 GLU C CD    1 
ATOM   6363 O OE1   . GLU C 1 371 ? 18.031  -39.562 -33.646 1.00 123.49 ? 418 GLU C OE1   1 
ATOM   6364 O OE2   . GLU C 1 371 ? 16.112  -40.304 -34.444 1.00 155.20 ? 418 GLU C OE2   1 
ATOM   6365 N N     . THR C 1 372 ? 13.846  -35.525 -31.521 1.00 120.73 ? 419 THR C N     1 
ATOM   6366 C CA    . THR C 1 372 ? 12.587  -35.654 -30.778 1.00 119.58 ? 419 THR C CA    1 
ATOM   6367 C C     . THR C 1 372 ? 11.511  -36.443 -31.560 1.00 129.45 ? 419 THR C C     1 
ATOM   6368 O O     . THR C 1 372 ? 11.494  -36.417 -32.795 1.00 132.96 ? 419 THR C O     1 
ATOM   6369 C CB    . THR C 1 372 ? 12.112  -34.232 -30.374 1.00 118.27 ? 419 THR C CB    1 
ATOM   6370 O OG1   . THR C 1 372 ? 13.201  -33.530 -29.776 1.00 113.48 ? 419 THR C OG1   1 
ATOM   6371 C CG2   . THR C 1 372 ? 10.934  -34.228 -29.402 1.00 113.32 ? 419 THR C CG2   1 
ATOM   6372 N N     . MET C 1 373 ? 10.631  -37.155 -30.822 1.00 127.16 ? 420 MET C N     1 
ATOM   6373 C CA    . MET C 1 373 ? 9.466   -37.875 -31.342 1.00 132.03 ? 420 MET C CA    1 
ATOM   6374 C C     . MET C 1 373 ? 8.272   -37.675 -30.408 1.00 134.32 ? 420 MET C C     1 
ATOM   6375 O O     . MET C 1 373 ? 8.407   -37.774 -29.188 1.00 131.26 ? 420 MET C O     1 
ATOM   6376 C CB    . MET C 1 373 ? 9.725   -39.365 -31.597 1.00 139.29 ? 420 MET C CB    1 
ATOM   6377 C CG    . MET C 1 373 ? 8.764   -39.937 -32.642 1.00 150.11 ? 420 MET C CG    1 
ATOM   6378 S SD    . MET C 1 373 ? 8.319   -41.694 -32.492 1.00 161.64 ? 420 MET C SD    1 
ATOM   6379 C CE    . MET C 1 373 ? 7.117   -41.624 -31.150 1.00 156.80 ? 420 MET C CE    1 
ATOM   6380 N N     . TYR C 1 374 ? 7.111   -37.386 -30.994 1.00 133.33 ? 421 TYR C N     1 
ATOM   6381 C CA    . TYR C 1 374 ? 5.855   -37.132 -30.295 1.00 133.08 ? 421 TYR C CA    1 
ATOM   6382 C C     . TYR C 1 374 ? 5.018   -38.414 -30.217 1.00 142.52 ? 421 TYR C C     1 
ATOM   6383 O O     . TYR C 1 374 ? 4.790   -39.055 -31.246 1.00 147.28 ? 421 TYR C O     1 
ATOM   6384 C CB    . TYR C 1 374 ? 5.117   -35.989 -31.028 1.00 134.07 ? 421 TYR C CB    1 
ATOM   6385 C CG    . TYR C 1 374 ? 3.650   -35.800 -30.709 1.00 137.13 ? 421 TYR C CG    1 
ATOM   6386 C CD1   . TYR C 1 374 ? 3.244   -34.947 -29.687 1.00 135.48 ? 421 TYR C CD1   1 
ATOM   6387 C CD2   . TYR C 1 374 ? 2.665   -36.363 -31.515 1.00 143.59 ? 421 TYR C CD2   1 
ATOM   6388 C CE1   . TYR C 1 374 ? 1.893   -34.713 -29.435 1.00 138.06 ? 421 TYR C CE1   1 
ATOM   6389 C CE2   . TYR C 1 374 ? 1.311   -36.148 -31.264 1.00 146.68 ? 421 TYR C CE2   1 
ATOM   6390 C CZ    . TYR C 1 374 ? 0.928   -35.322 -30.221 1.00 149.33 ? 421 TYR C CZ    1 
ATOM   6391 O OH    . TYR C 1 374 ? -0.409  -35.115 -29.976 1.00 151.22 ? 421 TYR C OH    1 
ATOM   6392 N N     . ARG C 1 375 ? 4.579   -38.789 -28.994 1.00 138.76 ? 422 ARG C N     1 
ATOM   6393 C CA    . ARG C 1 375 ? 3.719   -39.960 -28.737 1.00 144.18 ? 422 ARG C CA    1 
ATOM   6394 C C     . ARG C 1 375 ? 2.253   -39.486 -28.641 1.00 148.89 ? 422 ARG C C     1 
ATOM   6395 O O     . ARG C 1 375 ? 1.379   -39.989 -29.348 1.00 153.95 ? 422 ARG C O     1 
ATOM   6396 C CB    . ARG C 1 375 ? 4.144   -40.693 -27.448 1.00 144.49 ? 422 ARG C CB    1 
ATOM   6397 C CG    . ARG C 1 375 ? 5.511   -41.360 -27.525 1.00 154.92 ? 422 ARG C CG    1 
ATOM   6398 C CD    . ARG C 1 375 ? 5.997   -41.791 -26.156 1.00 163.36 ? 422 ARG C CD    1 
ATOM   6399 N NE    . ARG C 1 375 ? 5.941   -43.243 -25.974 1.00 180.46 ? 422 ARG C NE    1 
ATOM   6400 C CZ    . ARG C 1 375 ? 6.441   -43.887 -24.923 1.00 197.01 ? 422 ARG C CZ    1 
ATOM   6401 N NH1   . ARG C 1 375 ? 7.045   -43.217 -23.948 1.00 181.65 ? 422 ARG C NH1   1 
ATOM   6402 N NH2   . ARG C 1 375 ? 6.347   -45.209 -24.841 1.00 189.29 ? 422 ARG C NH2   1 
ATOM   6403 N N     . CYS C 1 376 ? 2.016   -38.503 -27.763 1.00 140.94 ? 423 CYS C N     1 
ATOM   6404 C CA    . CYS C 1 376 ? 0.762   -37.791 -27.496 1.00 141.45 ? 423 CYS C CA    1 
ATOM   6405 C C     . CYS C 1 376 ? 1.138   -36.477 -26.789 1.00 136.68 ? 423 CYS C C     1 
ATOM   6406 O O     . CYS C 1 376 ? 2.320   -36.243 -26.527 1.00 131.54 ? 423 CYS C O     1 
ATOM   6407 C CB    . CYS C 1 376 ? -0.220  -38.636 -26.678 1.00 147.12 ? 423 CYS C CB    1 
ATOM   6408 S SG    . CYS C 1 376 ? 0.282   -38.943 -24.960 1.00 149.30 ? 423 CYS C SG    1 
ATOM   6409 N N     . GLY C 1 377 ? 0.161   -35.622 -26.523 1.00 132.22 ? 424 GLY C N     1 
ATOM   6410 C CA    . GLY C 1 377 ? 0.410   -34.337 -25.877 1.00 127.28 ? 424 GLY C CA    1 
ATOM   6411 C C     . GLY C 1 377 ? 0.987   -34.395 -24.474 1.00 128.15 ? 424 GLY C C     1 
ATOM   6412 O O     . GLY C 1 377 ? 1.413   -33.364 -23.943 1.00 124.46 ? 424 GLY C O     1 
ATOM   6413 N N     . GLU C 1 378 ? 1.025   -35.605 -23.876 1.00 126.32 ? 425 GLU C N     1 
ATOM   6414 C CA    . GLU C 1 378 ? 1.468   -35.854 -22.503 1.00 125.10 ? 425 GLU C CA    1 
ATOM   6415 C C     . GLU C 1 378 ? 2.856   -36.472 -22.369 1.00 127.53 ? 425 GLU C C     1 
ATOM   6416 O O     . GLU C 1 378 ? 3.543   -36.189 -21.387 1.00 124.33 ? 425 GLU C O     1 
ATOM   6417 C CB    . GLU C 1 378 ? 0.414   -36.651 -21.710 1.00 131.71 ? 425 GLU C CB    1 
ATOM   6418 C CG    . GLU C 1 378 ? -0.904  -35.915 -21.495 1.00 139.43 ? 425 GLU C CG    1 
ATOM   6419 C CD    . GLU C 1 378 ? -1.784  -35.772 -22.723 1.00 146.43 ? 425 GLU C CD    1 
ATOM   6420 O OE1   . GLU C 1 378 ? -1.976  -34.620 -23.174 1.00 123.04 ? 425 GLU C OE1   1 
ATOM   6421 O OE2   . GLU C 1 378 ? -2.209  -36.810 -23.283 1.00 138.91 ? 425 GLU C OE2   1 
ATOM   6422 N N     . SER C 1 379 ? 3.265   -37.326 -23.328 1.00 126.63 ? 426 SER C N     1 
ATOM   6423 C CA    . SER C 1 379 ? 4.610   -37.917 -23.323 1.00 125.15 ? 426 SER C CA    1 
ATOM   6424 C C     . SER C 1 379 ? 5.373   -37.570 -24.599 1.00 126.38 ? 426 SER C C     1 
ATOM   6425 O O     . SER C 1 379 ? 4.770   -37.333 -25.652 1.00 125.89 ? 426 SER C O     1 
ATOM   6426 C CB    . SER C 1 379 ? 4.591   -39.418 -23.035 1.00 133.45 ? 426 SER C CB    1 
ATOM   6427 O OG    . SER C 1 379 ? 3.935   -40.159 -24.048 1.00 148.02 ? 426 SER C OG    1 
ATOM   6428 N N     . MET C 1 380 ? 6.697   -37.467 -24.480 1.00 121.45 ? 427 MET C N     1 
ATOM   6429 C CA    . MET C 1 380 ? 7.551   -37.100 -25.603 1.00 120.66 ? 427 MET C CA    1 
ATOM   6430 C C     . MET C 1 380 ? 8.956   -37.626 -25.396 1.00 122.83 ? 427 MET C C     1 
ATOM   6431 O O     . MET C 1 380 ? 9.535   -37.437 -24.324 1.00 120.77 ? 427 MET C O     1 
ATOM   6432 C CB    . MET C 1 380 ? 7.566   -35.582 -25.764 1.00 120.22 ? 427 MET C CB    1 
ATOM   6433 C CG    . MET C 1 380 ? 7.825   -35.118 -27.168 1.00 124.77 ? 427 MET C CG    1 
ATOM   6434 S SD    . MET C 1 380 ? 7.485   -33.353 -27.287 1.00 127.04 ? 427 MET C SD    1 
ATOM   6435 C CE    . MET C 1 380 ? 8.843   -32.689 -26.326 1.00 119.62 ? 427 MET C CE    1 
ATOM   6436 N N     . LEU C 1 381 ? 9.505   -38.282 -26.426 1.00 120.12 ? 428 LEU C N     1 
ATOM   6437 C CA    . LEU C 1 381 ? 10.825  -38.890 -26.367 1.00 118.97 ? 428 LEU C CA    1 
ATOM   6438 C C     . LEU C 1 381 ? 11.882  -38.171 -27.174 1.00 118.11 ? 428 LEU C C     1 
ATOM   6439 O O     . LEU C 1 381 ? 11.597  -37.657 -28.252 1.00 116.35 ? 428 LEU C O     1 
ATOM   6440 C CB    . LEU C 1 381 ? 10.724  -40.339 -26.823 1.00 124.36 ? 428 LEU C CB    1 
ATOM   6441 C CG    . LEU C 1 381 ? 10.617  -41.357 -25.712 1.00 132.08 ? 428 LEU C CG    1 
ATOM   6442 C CD1   . LEU C 1 381 ? 9.692   -42.482 -26.105 1.00 138.41 ? 428 LEU C CD1   1 
ATOM   6443 C CD2   . LEU C 1 381 ? 11.984  -41.909 -25.356 1.00 134.44 ? 428 LEU C CD2   1 
ATOM   6444 N N     . CYS C 1 382 ? 13.119  -38.172 -26.666 1.00 114.18 ? 429 CYS C N     1 
ATOM   6445 C CA    . CYS C 1 382 ? 14.249  -37.578 -27.373 1.00 113.79 ? 429 CYS C CA    1 
ATOM   6446 C C     . CYS C 1 382 ? 15.552  -38.362 -27.188 1.00 116.78 ? 429 CYS C C     1 
ATOM   6447 O O     . CYS C 1 382 ? 15.763  -38.982 -26.138 1.00 117.59 ? 429 CYS C O     1 
ATOM   6448 C CB    . CYS C 1 382 ? 14.426  -36.115 -27.001 1.00 111.60 ? 429 CYS C CB    1 
ATOM   6449 S SG    . CYS C 1 382 ? 15.108  -35.862 -25.349 1.00 113.55 ? 429 CYS C SG    1 
ATOM   6450 N N     . VAL C 1 383 ? 16.430  -38.320 -28.212 1.00 110.74 ? 430 VAL C N     1 
ATOM   6451 C CA    . VAL C 1 383 ? 17.727  -38.985 -28.138 1.00 109.35 ? 430 VAL C CA    1 
ATOM   6452 C C     . VAL C 1 383 ? 18.699  -38.028 -27.461 1.00 109.04 ? 430 VAL C C     1 
ATOM   6453 O O     . VAL C 1 383 ? 18.955  -36.929 -27.979 1.00 108.32 ? 430 VAL C O     1 
ATOM   6454 C CB    . VAL C 1 383 ? 18.288  -39.504 -29.490 1.00 114.80 ? 430 VAL C CB    1 
ATOM   6455 C CG1   . VAL C 1 383 ? 19.457  -40.453 -29.254 1.00 115.54 ? 430 VAL C CG1   1 
ATOM   6456 C CG2   . VAL C 1 383 ? 17.208  -40.174 -30.332 1.00 118.31 ? 430 VAL C CG2   1 
ATOM   6457 N N     . VAL C 1 384 ? 19.230  -38.452 -26.296 1.00 102.36 ? 431 VAL C N     1 
ATOM   6458 C CA    . VAL C 1 384 ? 20.233  -37.710 -25.531 1.00 98.63  ? 431 VAL C CA    1 
ATOM   6459 C C     . VAL C 1 384 ? 21.523  -37.570 -26.418 1.00 103.69 ? 431 VAL C C     1 
ATOM   6460 O O     . VAL C 1 384 ? 22.090  -38.581 -26.903 1.00 105.40 ? 431 VAL C O     1 
ATOM   6461 C CB    . VAL C 1 384 ? 20.507  -38.366 -24.149 1.00 101.37 ? 431 VAL C CB    1 
ATOM   6462 C CG1   . VAL C 1 384 ? 21.661  -37.687 -23.425 1.00 99.66  ? 431 VAL C CG1   1 
ATOM   6463 C CG2   . VAL C 1 384 ? 19.258  -38.360 -23.281 1.00 100.70 ? 431 VAL C CG2   1 
ATOM   6464 N N     . PRO C 1 385 ? 21.952  -36.311 -26.684 1.00 97.45  ? 432 PRO C N     1 
ATOM   6465 C CA    . PRO C 1 385 ? 23.138  -36.113 -27.537 1.00 98.84  ? 432 PRO C CA    1 
ATOM   6466 C C     . PRO C 1 385 ? 24.448  -36.634 -26.928 1.00 104.98 ? 432 PRO C C     1 
ATOM   6467 O O     . PRO C 1 385 ? 24.617  -36.566 -25.713 1.00 103.91 ? 432 PRO C O     1 
ATOM   6468 C CB    . PRO C 1 385 ? 23.164  -34.597 -27.772 1.00 98.37  ? 432 PRO C CB    1 
ATOM   6469 C CG    . PRO C 1 385 ? 22.386  -34.018 -26.695 1.00 99.38  ? 432 PRO C CG    1 
ATOM   6470 C CD    . PRO C 1 385 ? 21.391  -35.026 -26.225 1.00 94.97  ? 432 PRO C CD    1 
ATOM   6471 N N     . ASP C 1 386 ? 25.376  -37.140 -27.769 1.00 104.81 ? 433 ASP C N     1 
ATOM   6472 C CA    . ASP C 1 386 ? 26.696  -37.616 -27.319 1.00 106.12 ? 433 ASP C CA    1 
ATOM   6473 C C     . ASP C 1 386 ? 27.450  -36.465 -26.624 1.00 107.16 ? 433 ASP C C     1 
ATOM   6474 O O     . ASP C 1 386 ? 27.341  -35.308 -27.054 1.00 105.93 ? 433 ASP C O     1 
ATOM   6475 C CB    . ASP C 1 386 ? 27.514  -38.186 -28.491 1.00 112.13 ? 433 ASP C CB    1 
ATOM   6476 C CG    . ASP C 1 386 ? 28.824  -38.829 -28.070 1.00 134.29 ? 433 ASP C CG    1 
ATOM   6477 O OD1   . ASP C 1 386 ? 28.805  -40.025 -27.683 1.00 137.89 ? 433 ASP C OD1   1 
ATOM   6478 O OD2   . ASP C 1 386 ? 29.872  -38.144 -28.137 1.00 144.22 ? 433 ASP C OD2   1 
ATOM   6479 N N     . ILE C 1 387 ? 28.168  -36.782 -25.527 1.00 101.82 ? 434 ILE C N     1 
ATOM   6480 C CA    . ILE C 1 387 ? 28.898  -35.795 -24.723 1.00 100.52 ? 434 ILE C CA    1 
ATOM   6481 C C     . ILE C 1 387 ? 29.840  -34.856 -25.515 1.00 108.11 ? 434 ILE C C     1 
ATOM   6482 O O     . ILE C 1 387 ? 30.007  -33.694 -25.131 1.00 107.29 ? 434 ILE C O     1 
ATOM   6483 C CB    . ILE C 1 387 ? 29.492  -36.405 -23.419 1.00 103.48 ? 434 ILE C CB    1 
ATOM   6484 C CG1   . ILE C 1 387 ? 29.996  -35.346 -22.420 1.00 103.69 ? 434 ILE C CG1   1 
ATOM   6485 C CG2   . ILE C 1 387 ? 30.522  -37.481 -23.675 1.00 106.39 ? 434 ILE C CG2   1 
ATOM   6486 C CD1   . ILE C 1 387 ? 28.914  -34.469 -21.816 1.00 106.17 ? 434 ILE C CD1   1 
ATOM   6487 N N     . SER C 1 388 ? 30.380  -35.341 -26.664 1.00 107.68 ? 435 SER C N     1 
ATOM   6488 C CA    . SER C 1 388 ? 31.264  -34.582 -27.556 1.00 109.78 ? 435 SER C CA    1 
ATOM   6489 C C     . SER C 1 388 ? 30.612  -33.286 -28.014 1.00 111.19 ? 435 SER C C     1 
ATOM   6490 O O     . SER C 1 388 ? 31.322  -32.321 -28.297 1.00 113.67 ? 435 SER C O     1 
ATOM   6491 C CB    . SER C 1 388 ? 31.691  -35.424 -28.755 1.00 116.57 ? 435 SER C CB    1 
ATOM   6492 O OG    . SER C 1 388 ? 30.574  -35.881 -29.499 1.00 124.74 ? 435 SER C OG    1 
ATOM   6493 N N     . ALA C 1 389 ? 29.259  -33.253 -28.032 1.00 103.42 ? 436 ALA C N     1 
ATOM   6494 C CA    . ALA C 1 389 ? 28.450  -32.088 -28.400 1.00 102.06 ? 436 ALA C CA    1 
ATOM   6495 C C     . ALA C 1 389 ? 28.746  -30.884 -27.510 1.00 105.62 ? 436 ALA C C     1 
ATOM   6496 O O     . ALA C 1 389 ? 28.699  -29.749 -27.995 1.00 107.23 ? 436 ALA C O     1 
ATOM   6497 C CB    . ALA C 1 389 ? 26.968  -32.430 -28.313 1.00 99.76  ? 436 ALA C CB    1 
ATOM   6498 N N     . PHE C 1 390 ? 29.055  -31.151 -26.209 1.00 99.78  ? 437 PHE C N     1 
ATOM   6499 C CA    . PHE C 1 390 ? 29.323  -30.179 -25.136 1.00 98.34  ? 437 PHE C CA    1 
ATOM   6500 C C     . PHE C 1 390 ? 30.802  -30.007 -24.762 1.00 105.19 ? 437 PHE C C     1 
ATOM   6501 O O     . PHE C 1 390 ? 31.191  -28.917 -24.321 1.00 107.91 ? 437 PHE C O     1 
ATOM   6502 C CB    . PHE C 1 390 ? 28.486  -30.519 -23.881 1.00 96.35  ? 437 PHE C CB    1 
ATOM   6503 C CG    . PHE C 1 390 ? 27.015  -30.640 -24.187 1.00 94.42  ? 437 PHE C CG    1 
ATOM   6504 C CD1   . PHE C 1 390 ? 26.241  -29.505 -24.432 1.00 96.70  ? 437 PHE C CD1   1 
ATOM   6505 C CD2   . PHE C 1 390 ? 26.416  -31.887 -24.312 1.00 94.55  ? 437 PHE C CD2   1 
ATOM   6506 C CE1   . PHE C 1 390 ? 24.891  -29.615 -24.759 1.00 94.80  ? 437 PHE C CE1   1 
ATOM   6507 C CE2   . PHE C 1 390 ? 25.062  -31.997 -24.643 1.00 95.31  ? 437 PHE C CE2   1 
ATOM   6508 C CZ    . PHE C 1 390 ? 24.313  -30.861 -24.872 1.00 92.69  ? 437 PHE C CZ    1 
ATOM   6509 N N     . ARG C 1 391 ? 31.607  -31.082 -24.887 1.00 100.62 ? 438 ARG C N     1 
ATOM   6510 C CA    . ARG C 1 391 ? 33.036  -31.088 -24.558 1.00 102.84 ? 438 ARG C CA    1 
ATOM   6511 C C     . ARG C 1 391 ? 33.748  -31.786 -25.705 1.00 109.11 ? 438 ARG C C     1 
ATOM   6512 O O     . ARG C 1 391 ? 33.593  -32.998 -25.850 1.00 108.72 ? 438 ARG C O     1 
ATOM   6513 C CB    . ARG C 1 391 ? 33.297  -31.849 -23.234 1.00 100.38 ? 438 ARG C CB    1 
ATOM   6514 C CG    . ARG C 1 391 ? 32.569  -31.344 -21.982 1.00 106.27 ? 438 ARG C CG    1 
ATOM   6515 C CD    . ARG C 1 391 ? 33.029  -29.972 -21.506 1.00 110.12 ? 438 ARG C CD    1 
ATOM   6516 N NE    . ARG C 1 391 ? 31.982  -29.272 -20.754 1.00 109.30 ? 438 ARG C NE    1 
ATOM   6517 C CZ    . ARG C 1 391 ? 31.973  -29.145 -19.430 1.00 133.98 ? 438 ARG C CZ    1 
ATOM   6518 N NH1   . ARG C 1 391 ? 32.955  -29.663 -18.696 1.00 130.06 ? 438 ARG C NH1   1 
ATOM   6519 N NH2   . ARG C 1 391 ? 30.987  -28.492 -18.828 1.00 124.12 ? 438 ARG C NH2   1 
ATOM   6520 N N     . GLU C 1 392 ? 34.472  -31.029 -26.550 1.00 108.48 ? 439 GLU C N     1 
ATOM   6521 C CA    . GLU C 1 392 ? 35.157  -31.572 -27.720 1.00 111.73 ? 439 GLU C CA    1 
ATOM   6522 C C     . GLU C 1 392 ? 36.242  -32.556 -27.311 1.00 120.41 ? 439 GLU C C     1 
ATOM   6523 O O     . GLU C 1 392 ? 37.005  -32.276 -26.385 1.00 122.84 ? 439 GLU C O     1 
ATOM   6524 C CB    . GLU C 1 392 ? 35.719  -30.455 -28.604 1.00 117.14 ? 439 GLU C CB    1 
ATOM   6525 C CG    . GLU C 1 392 ? 35.146  -30.459 -30.011 1.00 129.34 ? 439 GLU C CG    1 
ATOM   6526 C CD    . GLU C 1 392 ? 36.008  -29.782 -31.061 1.00 164.16 ? 439 GLU C CD    1 
ATOM   6527 O OE1   . GLU C 1 392 ? 37.053  -30.361 -31.440 1.00 166.94 ? 439 GLU C OE1   1 
ATOM   6528 O OE2   . GLU C 1 392 ? 35.617  -28.691 -31.538 1.00 159.99 ? 439 GLU C OE2   1 
ATOM   6529 N N     . GLY C 1 393 ? 36.250  -33.724 -27.948 1.00 117.12 ? 440 GLY C N     1 
ATOM   6530 C CA    . GLY C 1 393 ? 37.225  -34.765 -27.654 1.00 119.43 ? 440 GLY C CA    1 
ATOM   6531 C C     . GLY C 1 393 ? 36.928  -35.606 -26.431 1.00 121.13 ? 440 GLY C C     1 
ATOM   6532 O O     . GLY C 1 393 ? 37.825  -36.263 -25.898 1.00 123.19 ? 440 GLY C O     1 
ATOM   6533 N N     . TRP C 1 394 ? 35.686  -35.587 -25.962 1.00 113.75 ? 441 TRP C N     1 
ATOM   6534 C CA    . TRP C 1 394 ? 35.301  -36.416 -24.832 1.00 112.02 ? 441 TRP C CA    1 
ATOM   6535 C C     . TRP C 1 394 ? 34.517  -37.571 -25.407 1.00 117.31 ? 441 TRP C C     1 
ATOM   6536 O O     . TRP C 1 394 ? 33.429  -37.373 -25.968 1.00 115.31 ? 441 TRP C O     1 
ATOM   6537 C CB    . TRP C 1 394 ? 34.422  -35.657 -23.815 1.00 107.31 ? 441 TRP C CB    1 
ATOM   6538 C CG    . TRP C 1 394 ? 35.134  -34.857 -22.759 1.00 109.27 ? 441 TRP C CG    1 
ATOM   6539 C CD1   . TRP C 1 394 ? 36.319  -34.188 -22.887 1.00 115.29 ? 441 TRP C CD1   1 
ATOM   6540 C CD2   . TRP C 1 394 ? 34.599  -34.483 -21.477 1.00 107.56 ? 441 TRP C CD2   1 
ATOM   6541 N NE1   . TRP C 1 394 ? 36.591  -33.485 -21.736 1.00 115.35 ? 441 TRP C NE1   1 
ATOM   6542 C CE2   . TRP C 1 394 ? 35.543  -33.635 -20.860 1.00 113.91 ? 441 TRP C CE2   1 
ATOM   6543 C CE3   . TRP C 1 394 ? 33.399  -34.772 -20.795 1.00 105.84 ? 441 TRP C CE3   1 
ATOM   6544 C CZ2   . TRP C 1 394 ? 35.345  -33.104 -19.573 1.00 113.55 ? 441 TRP C CZ2   1 
ATOM   6545 C CZ3   . TRP C 1 394 ? 33.204  -34.245 -19.523 1.00 107.18 ? 441 TRP C CZ3   1 
ATOM   6546 C CH2   . TRP C 1 394 ? 34.167  -33.421 -18.927 1.00 110.74 ? 441 TRP C CH2   1 
ATOM   6547 N N     . ARG C 1 395 ? 35.075  -38.773 -25.308 1.00 116.69 ? 442 ARG C N     1 
ATOM   6548 C CA    . ARG C 1 395 ? 34.348  -39.937 -25.787 1.00 116.52 ? 442 ARG C CA    1 
ATOM   6549 C C     . ARG C 1 395 ? 33.608  -40.624 -24.630 1.00 117.37 ? 442 ARG C C     1 
ATOM   6550 O O     . ARG C 1 395 ? 32.765  -41.491 -24.862 1.00 117.77 ? 442 ARG C O     1 
ATOM   6551 C CB    . ARG C 1 395 ? 35.261  -40.878 -26.580 1.00 121.46 ? 442 ARG C CB    1 
ATOM   6552 C CG    . ARG C 1 395 ? 35.779  -40.286 -27.896 1.00 134.92 ? 442 ARG C CG    1 
ATOM   6553 C CD    . ARG C 1 395 ? 34.690  -40.057 -28.929 1.00 145.61 ? 442 ARG C CD    1 
ATOM   6554 N NE    . ARG C 1 395 ? 35.246  -39.849 -30.266 1.00 165.60 ? 442 ARG C NE    1 
ATOM   6555 C CZ    . ARG C 1 395 ? 35.564  -38.662 -30.777 1.00 182.09 ? 442 ARG C CZ    1 
ATOM   6556 N NH1   . ARG C 1 395 ? 35.407  -37.555 -30.057 1.00 163.24 ? 442 ARG C NH1   1 
ATOM   6557 N NH2   . ARG C 1 395 ? 36.062  -38.574 -32.004 1.00 173.27 ? 442 ARG C NH2   1 
ATOM   6558 N N     . TRP C 1 396 ? 33.908  -40.190 -23.386 1.00 110.85 ? 443 TRP C N     1 
ATOM   6559 C CA    . TRP C 1 396 ? 33.334  -40.636 -22.112 1.00 108.70 ? 443 TRP C CA    1 
ATOM   6560 C C     . TRP C 1 396 ? 33.022  -39.396 -21.282 1.00 107.95 ? 443 TRP C C     1 
ATOM   6561 O O     . TRP C 1 396 ? 33.674  -38.357 -21.459 1.00 106.72 ? 443 TRP C O     1 
ATOM   6562 C CB    . TRP C 1 396 ? 34.364  -41.441 -21.289 1.00 110.80 ? 443 TRP C CB    1 
ATOM   6563 C CG    . TRP C 1 396 ? 34.781  -42.797 -21.779 1.00 115.04 ? 443 TRP C CG    1 
ATOM   6564 C CD1   . TRP C 1 396 ? 34.426  -43.410 -22.946 1.00 118.95 ? 443 TRP C CD1   1 
ATOM   6565 C CD2   . TRP C 1 396 ? 35.654  -43.705 -21.096 1.00 118.63 ? 443 TRP C CD2   1 
ATOM   6566 N NE1   . TRP C 1 396 ? 35.045  -44.637 -23.045 1.00 123.16 ? 443 TRP C NE1   1 
ATOM   6567 C CE2   . TRP C 1 396 ? 35.806  -44.844 -21.922 1.00 126.16 ? 443 TRP C CE2   1 
ATOM   6568 C CE3   . TRP C 1 396 ? 36.357  -43.651 -19.880 1.00 121.50 ? 443 TRP C CE3   1 
ATOM   6569 C CZ2   . TRP C 1 396 ? 36.624  -45.925 -21.566 1.00 129.68 ? 443 TRP C CZ2   1 
ATOM   6570 C CZ3   . TRP C 1 396 ? 37.167  -44.719 -19.528 1.00 127.66 ? 443 TRP C CZ3   1 
ATOM   6571 C CH2   . TRP C 1 396 ? 37.295  -45.841 -20.364 1.00 130.93 ? 443 TRP C CH2   1 
ATOM   6572 N N     . VAL C 1 397 ? 32.089  -39.529 -20.314 1.00 102.64 ? 444 VAL C N     1 
ATOM   6573 C CA    . VAL C 1 397 ? 31.757  -38.460 -19.371 1.00 100.62 ? 444 VAL C CA    1 
ATOM   6574 C C     . VAL C 1 397 ? 32.920  -38.463 -18.363 1.00 108.89 ? 444 VAL C C     1 
ATOM   6575 O O     . VAL C 1 397 ? 32.921  -39.214 -17.379 1.00 109.95 ? 444 VAL C O     1 
ATOM   6576 C CB    . VAL C 1 397 ? 30.373  -38.651 -18.697 1.00 102.03 ? 444 VAL C CB    1 
ATOM   6577 C CG1   . VAL C 1 397 ? 30.014  -37.453 -17.829 1.00 100.50 ? 444 VAL C CG1   1 
ATOM   6578 C CG2   . VAL C 1 397 ? 29.283  -38.913 -19.731 1.00 99.40  ? 444 VAL C CG2   1 
ATOM   6579 N N     . ARG C 1 398 ? 33.962  -37.694 -18.695 1.00 107.78 ? 445 ARG C N     1 
ATOM   6580 C CA    . ARG C 1 398 ? 35.175  -37.572 -17.902 1.00 111.50 ? 445 ARG C CA    1 
ATOM   6581 C C     . ARG C 1 398 ? 34.832  -36.882 -16.566 1.00 118.52 ? 445 ARG C C     1 
ATOM   6582 O O     . ARG C 1 398 ? 35.399  -37.227 -15.531 1.00 122.11 ? 445 ARG C O     1 
ATOM   6583 C CB    . ARG C 1 398 ? 36.248  -36.815 -18.711 1.00 111.22 ? 445 ARG C CB    1 
ATOM   6584 C CG    . ARG C 1 398 ? 37.696  -37.108 -18.314 1.00 129.46 ? 445 ARG C CG    1 
ATOM   6585 C CD    . ARG C 1 398 ? 38.230  -36.227 -17.186 1.00 153.35 ? 445 ARG C CD    1 
ATOM   6586 N NE    . ARG C 1 398 ? 37.914  -34.807 -17.383 1.00 166.99 ? 445 ARG C NE    1 
ATOM   6587 C CZ    . ARG C 1 398 ? 38.354  -33.814 -16.615 1.00 186.05 ? 445 ARG C CZ    1 
ATOM   6588 N NH1   . ARG C 1 398 ? 39.156  -34.065 -15.586 1.00 177.90 ? 445 ARG C NH1   1 
ATOM   6589 N NH2   . ARG C 1 398 ? 38.008  -32.561 -16.879 1.00 173.42 ? 445 ARG C NH2   1 
ATOM   6590 N N     . GLN C 1 399 ? 33.862  -35.951 -16.589 1.00 113.57 ? 446 GLN C N     1 
ATOM   6591 C CA    . GLN C 1 399 ? 33.384  -35.224 -15.413 1.00 114.86 ? 446 GLN C CA    1 
ATOM   6592 C C     . GLN C 1 399 ? 31.899  -34.910 -15.586 1.00 116.32 ? 446 GLN C C     1 
ATOM   6593 O O     . GLN C 1 399 ? 31.468  -34.740 -16.727 1.00 112.85 ? 446 GLN C O     1 
ATOM   6594 C CB    . GLN C 1 399 ? 34.175  -33.919 -15.220 1.00 118.72 ? 446 GLN C CB    1 
ATOM   6595 C CG    . GLN C 1 399 ? 35.384  -34.056 -14.305 1.00 144.91 ? 446 GLN C CG    1 
ATOM   6596 C CD    . GLN C 1 399 ? 35.744  -32.736 -13.665 1.00 168.45 ? 446 GLN C CD    1 
ATOM   6597 O OE1   . GLN C 1 399 ? 35.033  -32.227 -12.790 1.00 167.01 ? 446 GLN C OE1   1 
ATOM   6598 N NE2   . GLN C 1 399 ? 36.869  -32.162 -14.070 1.00 158.05 ? 446 GLN C NE2   1 
ATOM   6599 N N     . PRO C 1 400 ? 31.099  -34.776 -14.498 1.00 114.87 ? 447 PRO C N     1 
ATOM   6600 C CA    . PRO C 1 400 ? 29.673  -34.444 -14.674 1.00 111.96 ? 447 PRO C CA    1 
ATOM   6601 C C     . PRO C 1 400 ? 29.419  -33.135 -15.434 1.00 114.13 ? 447 PRO C C     1 
ATOM   6602 O O     . PRO C 1 400 ? 30.014  -32.098 -15.124 1.00 115.15 ? 447 PRO C O     1 
ATOM   6603 C CB    . PRO C 1 400 ? 29.143  -34.381 -13.234 1.00 116.07 ? 447 PRO C CB    1 
ATOM   6604 C CG    . PRO C 1 400 ? 30.084  -35.205 -12.455 1.00 124.16 ? 447 PRO C CG    1 
ATOM   6605 C CD    . PRO C 1 400 ? 31.421  -34.941 -13.067 1.00 120.45 ? 447 PRO C CD    1 
ATOM   6606 N N     . VAL C 1 401 ? 28.562  -33.206 -16.465 1.00 107.50 ? 448 VAL C N     1 
ATOM   6607 C CA    . VAL C 1 401 ? 28.181  -32.043 -17.269 1.00 105.19 ? 448 VAL C CA    1 
ATOM   6608 C C     . VAL C 1 401 ? 26.674  -31.811 -17.102 1.00 108.04 ? 448 VAL C C     1 
ATOM   6609 O O     . VAL C 1 401 ? 25.877  -32.717 -17.368 1.00 106.09 ? 448 VAL C O     1 
ATOM   6610 C CB    . VAL C 1 401 ? 28.595  -32.174 -18.762 1.00 106.60 ? 448 VAL C CB    1 
ATOM   6611 C CG1   . VAL C 1 401 ? 28.196  -30.936 -19.557 1.00 104.62 ? 448 VAL C CG1   1 
ATOM   6612 C CG2   . VAL C 1 401 ? 30.093  -32.445 -18.899 1.00 109.00 ? 448 VAL C CG2   1 
ATOM   6613 N N     . GLN C 1 402 ? 26.292  -30.606 -16.644 1.00 105.23 ? 449 GLN C N     1 
ATOM   6614 C CA    . GLN C 1 402 ? 24.889  -30.241 -16.468 1.00 102.97 ? 449 GLN C CA    1 
ATOM   6615 C C     . GLN C 1 402 ? 24.492  -29.300 -17.592 1.00 104.69 ? 449 GLN C C     1 
ATOM   6616 O O     . GLN C 1 402 ? 25.208  -28.325 -17.855 1.00 105.67 ? 449 GLN C O     1 
ATOM   6617 C CB    . GLN C 1 402 ? 24.655  -29.602 -15.097 1.00 106.80 ? 449 GLN C CB    1 
ATOM   6618 C CG    . GLN C 1 402 ? 23.223  -29.744 -14.600 1.00 113.90 ? 449 GLN C CG    1 
ATOM   6619 C CD    . GLN C 1 402 ? 22.803  -28.550 -13.790 1.00 124.37 ? 449 GLN C CD    1 
ATOM   6620 O OE1   . GLN C 1 402 ? 22.219  -27.593 -14.312 1.00 115.29 ? 449 GLN C OE1   1 
ATOM   6621 N NE2   . GLN C 1 402 ? 23.119  -28.568 -12.506 1.00 115.69 ? 449 GLN C NE2   1 
ATOM   6622 N N     . VAL C 1 403 ? 23.390  -29.627 -18.303 1.00 98.08  ? 450 VAL C N     1 
ATOM   6623 C CA    . VAL C 1 403 ? 22.883  -28.832 -19.436 1.00 95.94  ? 450 VAL C CA    1 
ATOM   6624 C C     . VAL C 1 403 ? 21.392  -28.552 -19.293 1.00 100.56 ? 450 VAL C C     1 
ATOM   6625 O O     . VAL C 1 403 ? 20.665  -29.428 -18.808 1.00 99.16  ? 450 VAL C O     1 
ATOM   6626 C CB    . VAL C 1 403 ? 23.215  -29.418 -20.830 1.00 98.09  ? 450 VAL C CB    1 
ATOM   6627 C CG1   . VAL C 1 403 ? 24.713  -29.403 -21.091 1.00 99.72  ? 450 VAL C CG1   1 
ATOM   6628 C CG2   . VAL C 1 403 ? 22.636  -30.818 -21.017 1.00 96.55  ? 450 VAL C CG2   1 
ATOM   6629 N N     . PRO C 1 404 ? 20.906  -27.349 -19.707 1.00 98.45  ? 451 PRO C N     1 
ATOM   6630 C CA    . PRO C 1 404 ? 19.471  -27.068 -19.590 1.00 96.76  ? 451 PRO C CA    1 
ATOM   6631 C C     . PRO C 1 404 ? 18.651  -27.811 -20.631 1.00 100.09 ? 451 PRO C C     1 
ATOM   6632 O O     . PRO C 1 404 ? 19.100  -28.021 -21.765 1.00 99.25  ? 451 PRO C O     1 
ATOM   6633 C CB    . PRO C 1 404 ? 19.389  -25.566 -19.823 1.00 99.13  ? 451 PRO C CB    1 
ATOM   6634 C CG    . PRO C 1 404 ? 20.527  -25.242 -20.643 1.00 104.58 ? 451 PRO C CG    1 
ATOM   6635 C CD    . PRO C 1 404 ? 21.621  -26.198 -20.295 1.00 101.18 ? 451 PRO C CD    1 
ATOM   6636 N N     . VAL C 1 405 ? 17.446  -28.207 -20.227 1.00 96.67  ? 452 VAL C N     1 
ATOM   6637 C CA    . VAL C 1 405 ? 16.486  -28.868 -21.103 1.00 95.15  ? 452 VAL C CA    1 
ATOM   6638 C C     . VAL C 1 405 ? 15.434  -27.800 -21.484 1.00 97.97  ? 452 VAL C C     1 
ATOM   6639 O O     . VAL C 1 405 ? 14.799  -27.182 -20.611 1.00 97.03  ? 452 VAL C O     1 
ATOM   6640 C CB    . VAL C 1 405 ? 15.901  -30.153 -20.468 1.00 98.98  ? 452 VAL C CB    1 
ATOM   6641 C CG1   . VAL C 1 405 ? 14.872  -30.801 -21.389 1.00 98.43  ? 452 VAL C CG1   1 
ATOM   6642 C CG2   . VAL C 1 405 ? 17.018  -31.144 -20.132 1.00 99.20  ? 452 VAL C CG2   1 
ATOM   6643 N N     . THR C 1 406 ? 15.348  -27.513 -22.792 1.00 94.46  ? 453 THR C N     1 
ATOM   6644 C CA    . THR C 1 406 ? 14.446  -26.495 -23.321 1.00 94.50  ? 453 THR C CA    1 
ATOM   6645 C C     . THR C 1 406 ? 13.601  -27.054 -24.443 1.00 97.67  ? 453 THR C C     1 
ATOM   6646 O O     . THR C 1 406 ? 14.047  -27.940 -25.173 1.00 97.19  ? 453 THR C O     1 
ATOM   6647 C CB    . THR C 1 406 ? 15.209  -25.231 -23.808 1.00 102.68 ? 453 THR C CB    1 
ATOM   6648 O OG1   . THR C 1 406 ? 16.534  -25.165 -23.277 1.00 107.12 ? 453 THR C OG1   1 
ATOM   6649 C CG2   . THR C 1 406 ? 14.486  -23.972 -23.472 1.00 97.94  ? 453 THR C CG2   1 
ATOM   6650 N N     . LEU C 1 407 ? 12.383  -26.521 -24.586 1.00 94.82  ? 454 LEU C N     1 
ATOM   6651 C CA    . LEU C 1 407 ? 11.481  -26.889 -25.665 1.00 95.60  ? 454 LEU C CA    1 
ATOM   6652 C C     . LEU C 1 407 ? 11.423  -25.755 -26.669 1.00 101.90 ? 454 LEU C C     1 
ATOM   6653 O O     . LEU C 1 407 ? 11.353  -24.580 -26.290 1.00 100.73 ? 454 LEU C O     1 
ATOM   6654 C CB    . LEU C 1 407 ? 10.091  -27.305 -25.154 1.00 95.77  ? 454 LEU C CB    1 
ATOM   6655 C CG    . LEU C 1 407 ? 10.028  -28.641 -24.378 1.00 99.32  ? 454 LEU C CG    1 
ATOM   6656 C CD1   . LEU C 1 407 ? 8.602   -29.079 -24.160 1.00 99.54  ? 454 LEU C CD1   1 
ATOM   6657 C CD2   . LEU C 1 407 ? 10.797  -29.749 -25.108 1.00 102.94 ? 454 LEU C CD2   1 
ATOM   6658 N N     . VAL C 1 408 ? 11.572  -26.103 -27.954 1.00 101.27 ? 455 VAL C N     1 
ATOM   6659 C CA    . VAL C 1 408 ? 11.592  -25.105 -29.024 1.00 103.36 ? 455 VAL C CA    1 
ATOM   6660 C C     . VAL C 1 408 ? 10.567  -25.431 -30.101 1.00 109.48 ? 455 VAL C C     1 
ATOM   6661 O O     . VAL C 1 408 ? 10.504  -26.575 -30.554 1.00 109.94 ? 455 VAL C O     1 
ATOM   6662 C CB    . VAL C 1 408 ? 13.022  -24.906 -29.590 1.00 107.70 ? 455 VAL C CB    1 
ATOM   6663 C CG1   . VAL C 1 408 ? 13.042  -23.843 -30.686 1.00 110.62 ? 455 VAL C CG1   1 
ATOM   6664 C CG2   . VAL C 1 408 ? 13.998  -24.538 -28.476 1.00 105.81 ? 455 VAL C CG2   1 
ATOM   6665 N N     . ARG C 1 409 ? 9.763   -24.421 -30.500 1.00 107.13 ? 456 ARG C N     1 
ATOM   6666 C CA    . ARG C 1 409 ? 8.738   -24.559 -31.538 1.00 109.46 ? 456 ARG C CA    1 
ATOM   6667 C C     . ARG C 1 409 ? 9.334   -24.264 -32.919 1.00 115.98 ? 456 ARG C C     1 
ATOM   6668 O O     . ARG C 1 409 ? 10.317  -23.532 -33.012 1.00 115.96 ? 456 ARG C O     1 
ATOM   6669 C CB    . ARG C 1 409 ? 7.549   -23.625 -31.238 1.00 108.80 ? 456 ARG C CB    1 
ATOM   6670 C CG    . ARG C 1 409 ? 6.260   -23.976 -31.981 1.00 114.34 ? 456 ARG C CG    1 
ATOM   6671 C CD    . ARG C 1 409 ? 5.059   -23.251 -31.399 1.00 115.89 ? 456 ARG C CD    1 
ATOM   6672 N NE    . ARG C 1 409 ? 4.973   -21.859 -31.843 1.00 112.97 ? 456 ARG C NE    1 
ATOM   6673 C CZ    . ARG C 1 409 ? 3.979   -21.030 -31.544 1.00 115.60 ? 456 ARG C CZ    1 
ATOM   6674 N NH1   . ARG C 1 409 ? 2.966   -21.440 -30.792 1.00 89.45  ? 456 ARG C NH1   1 
ATOM   6675 N NH2   . ARG C 1 409 ? 3.981   -19.788 -32.010 1.00 103.96 ? 456 ARG C NH2   1 
ATOM   6676 N N     . ASN C 1 410 ? 8.723   -24.833 -33.982 1.00 115.66 ? 457 ASN C N     1 
ATOM   6677 C CA    . ASN C 1 410 ? 9.068   -24.682 -35.403 1.00 120.12 ? 457 ASN C CA    1 
ATOM   6678 C C     . ASN C 1 410 ? 9.275   -23.223 -35.831 1.00 126.46 ? 457 ASN C C     1 
ATOM   6679 O O     . ASN C 1 410 ? 10.160  -22.939 -36.632 1.00 127.79 ? 457 ASN C O     1 
ATOM   6680 C CB    . ASN C 1 410 ? 7.967   -25.313 -36.265 1.00 126.58 ? 457 ASN C CB    1 
ATOM   6681 C CG    . ASN C 1 410 ? 8.068   -26.817 -36.469 1.00 164.96 ? 457 ASN C CG    1 
ATOM   6682 O OD1   . ASN C 1 410 ? 8.926   -27.513 -35.902 1.00 158.14 ? 457 ASN C OD1   1 
ATOM   6683 N ND2   . ASN C 1 410 ? 7.197   -27.356 -37.322 1.00 164.35 ? 457 ASN C ND2   1 
ATOM   6684 N N     . ASP C 1 411 ? 8.457   -22.305 -35.294 1.00 124.57 ? 458 ASP C N     1 
ATOM   6685 C CA    . ASP C 1 411 ? 8.514   -20.870 -35.600 1.00 127.95 ? 458 ASP C CA    1 
ATOM   6686 C C     . ASP C 1 411 ? 9.547   -20.042 -34.793 1.00 130.58 ? 458 ASP C C     1 
ATOM   6687 O O     . ASP C 1 411 ? 9.691   -18.843 -35.053 1.00 134.42 ? 458 ASP C O     1 
ATOM   6688 C CB    . ASP C 1 411 ? 7.108   -20.236 -35.555 1.00 131.18 ? 458 ASP C CB    1 
ATOM   6689 C CG    . ASP C 1 411 ? 6.296   -20.571 -34.315 1.00 136.32 ? 458 ASP C CG    1 
ATOM   6690 O OD1   . ASP C 1 411 ? 6.911   -20.901 -33.266 1.00 131.31 ? 458 ASP C OD1   1 
ATOM   6691 O OD2   . ASP C 1 411 ? 5.046   -20.521 -34.395 1.00 143.06 ? 458 ASP C OD2   1 
ATOM   6692 N N     . GLY C 1 412 ? 10.267  -20.675 -33.866 1.00 121.23 ? 459 GLY C N     1 
ATOM   6693 C CA    . GLY C 1 412 ? 11.299  -19.994 -33.092 1.00 119.39 ? 459 GLY C CA    1 
ATOM   6694 C C     . GLY C 1 412 ? 11.005  -19.787 -31.622 1.00 119.46 ? 459 GLY C C     1 
ATOM   6695 O O     . GLY C 1 412 ? 11.925  -19.515 -30.847 1.00 117.62 ? 459 GLY C O     1 
ATOM   6696 N N     . VAL C 1 413 ? 9.732   -19.912 -31.214 1.00 114.82 ? 460 VAL C N     1 
ATOM   6697 C CA    . VAL C 1 413 ? 9.333   -19.742 -29.812 1.00 111.50 ? 460 VAL C CA    1 
ATOM   6698 C C     . VAL C 1 413 ? 10.047  -20.756 -28.908 1.00 112.25 ? 460 VAL C C     1 
ATOM   6699 O O     . VAL C 1 413 ? 10.065  -21.954 -29.210 1.00 111.02 ? 460 VAL C O     1 
ATOM   6700 C CB    . VAL C 1 413 ? 7.800   -19.755 -29.600 1.00 115.18 ? 460 VAL C CB    1 
ATOM   6701 C CG1   . VAL C 1 413 ? 7.441   -19.312 -28.183 1.00 114.16 ? 460 VAL C CG1   1 
ATOM   6702 C CG2   . VAL C 1 413 ? 7.095   -18.873 -30.615 1.00 118.59 ? 460 VAL C CG2   1 
ATOM   6703 N N     . ILE C 1 414 ? 10.659  -20.254 -27.823 1.00 107.66 ? 461 ILE C N     1 
ATOM   6704 C CA    . ILE C 1 414 ? 11.388  -21.046 -26.831 1.00 104.36 ? 461 ILE C CA    1 
ATOM   6705 C C     . ILE C 1 414 ? 10.555  -21.176 -25.557 1.00 107.72 ? 461 ILE C C     1 
ATOM   6706 O O     . ILE C 1 414 ? 10.194  -20.165 -24.946 1.00 109.37 ? 461 ILE C O     1 
ATOM   6707 C CB    . ILE C 1 414 ? 12.787  -20.434 -26.514 1.00 107.55 ? 461 ILE C CB    1 
ATOM   6708 C CG1   . ILE C 1 414 ? 13.666  -20.262 -27.779 1.00 109.18 ? 461 ILE C CG1   1 
ATOM   6709 C CG2   . ILE C 1 414 ? 13.500  -21.234 -25.420 1.00 104.59 ? 461 ILE C CG2   1 
ATOM   6710 C CD1   . ILE C 1 414 ? 14.860  -19.350 -27.575 1.00 113.59 ? 461 ILE C CD1   1 
ATOM   6711 N N     . TYR C 1 415 ? 10.309  -22.424 -25.125 1.00 102.11 ? 462 TYR C N     1 
ATOM   6712 C CA    . TYR C 1 415 ? 9.570   -22.725 -23.896 1.00 100.60 ? 462 TYR C CA    1 
ATOM   6713 C C     . TYR C 1 415 ? 10.499  -23.232 -22.804 1.00 100.50 ? 462 TYR C C     1 
ATOM   6714 O O     . TYR C 1 415 ? 10.853  -24.416 -22.755 1.00 97.38  ? 462 TYR C O     1 
ATOM   6715 C CB    . TYR C 1 415 ? 8.433   -23.712 -24.167 1.00 101.83 ? 462 TYR C CB    1 
ATOM   6716 C CG    . TYR C 1 415 ? 7.504   -23.239 -25.252 1.00 105.50 ? 462 TYR C CG    1 
ATOM   6717 C CD1   . TYR C 1 415 ? 6.642   -22.162 -25.038 1.00 109.93 ? 462 TYR C CD1   1 
ATOM   6718 C CD2   . TYR C 1 415 ? 7.498   -23.845 -26.502 1.00 106.28 ? 462 TYR C CD2   1 
ATOM   6719 C CE1   . TYR C 1 415 ? 5.771   -21.728 -26.034 1.00 113.43 ? 462 TYR C CE1   1 
ATOM   6720 C CE2   . TYR C 1 415 ? 6.632   -23.420 -27.505 1.00 109.74 ? 462 TYR C CE2   1 
ATOM   6721 C CZ    . TYR C 1 415 ? 5.774   -22.358 -27.268 1.00 121.32 ? 462 TYR C CZ    1 
ATOM   6722 O OH    . TYR C 1 415 ? 4.927   -21.932 -28.257 1.00 127.89 ? 462 TYR C OH    1 
ATOM   6723 N N     . SER C 1 416 ? 10.912  -22.312 -21.940 1.00 98.34  ? 463 SER C N     1 
ATOM   6724 C CA    . SER C 1 416 ? 11.803  -22.606 -20.839 1.00 98.80  ? 463 SER C CA    1 
ATOM   6725 C C     . SER C 1 416 ? 11.154  -23.675 -19.964 1.00 105.66 ? 463 SER C C     1 
ATOM   6726 O O     . SER C 1 416 ? 9.933   -23.655 -19.781 1.00 107.38 ? 463 SER C O     1 
ATOM   6727 C CB    . SER C 1 416 ? 12.067  -21.326 -20.049 1.00 105.48 ? 463 SER C CB    1 
ATOM   6728 O OG    . SER C 1 416 ? 12.502  -21.546 -18.716 1.00 118.67 ? 463 SER C OG    1 
ATOM   6729 N N     . THR C 1 417 ? 11.944  -24.654 -19.503 1.00 102.18 ? 464 THR C N     1 
ATOM   6730 C CA    . THR C 1 417 ? 11.467  -25.693 -18.584 1.00 102.63 ? 464 THR C CA    1 
ATOM   6731 C C     . THR C 1 417 ? 12.269  -25.546 -17.294 1.00 108.40 ? 464 THR C C     1 
ATOM   6732 O O     . THR C 1 417 ? 13.453  -25.212 -17.356 1.00 108.34 ? 464 THR C O     1 
ATOM   6733 C CB    . THR C 1 417 ? 11.598  -27.128 -19.161 1.00 105.33 ? 464 THR C CB    1 
ATOM   6734 O OG1   . THR C 1 417 ? 12.842  -27.722 -18.782 1.00 103.00 ? 464 THR C OG1   1 
ATOM   6735 C CG2   . THR C 1 417 ? 11.349  -27.214 -20.656 1.00 99.41  ? 464 THR C CG2   1 
ATOM   6736 N N     . SER C 1 418 ? 11.664  -25.840 -16.145 1.00 106.65 ? 465 SER C N     1 
ATOM   6737 C CA    . SER C 1 418 ? 12.372  -25.755 -14.864 1.00 109.98 ? 465 SER C CA    1 
ATOM   6738 C C     . SER C 1 418 ? 13.586  -26.706 -14.794 1.00 111.57 ? 465 SER C C     1 
ATOM   6739 O O     . SER C 1 418 ? 14.475  -26.516 -13.964 1.00 113.13 ? 465 SER C O     1 
ATOM   6740 C CB    . SER C 1 418 ? 11.424  -26.128 -13.721 1.00 120.76 ? 465 SER C CB    1 
ATOM   6741 O OG    . SER C 1 418 ? 10.227  -25.362 -13.690 1.00 140.52 ? 465 SER C OG    1 
ATOM   6742 N N     . LEU C 1 419 ? 13.614  -27.710 -15.688 1.00 104.19 ? 466 LEU C N     1 
ATOM   6743 C CA    . LEU C 1 419 ? 14.535  -28.841 -15.701 1.00 102.78 ? 466 LEU C CA    1 
ATOM   6744 C C     . LEU C 1 419 ? 15.855  -28.784 -16.484 1.00 103.01 ? 466 LEU C C     1 
ATOM   6745 O O     . LEU C 1 419 ? 15.987  -28.029 -17.453 1.00 100.75 ? 466 LEU C O     1 
ATOM   6746 C CB    . LEU C 1 419 ? 13.744  -30.106 -16.056 1.00 102.18 ? 466 LEU C CB    1 
ATOM   6747 C CG    . LEU C 1 419 ? 12.422  -30.310 -15.319 1.00 107.91 ? 466 LEU C CG    1 
ATOM   6748 C CD1   . LEU C 1 419 ? 11.448  -31.098 -16.161 1.00 106.89 ? 466 LEU C CD1   1 
ATOM   6749 C CD2   . LEU C 1 419 ? 12.638  -30.939 -13.965 1.00 113.52 ? 466 LEU C CD2   1 
ATOM   6750 N N     . THR C 1 420 ? 16.836  -29.619 -16.023 1.00 99.27  ? 467 THR C N     1 
ATOM   6751 C CA    . THR C 1 420 ? 18.199  -29.790 -16.561 1.00 97.99  ? 467 THR C CA    1 
ATOM   6752 C C     . THR C 1 420 ? 18.639  -31.270 -16.651 1.00 99.78  ? 467 THR C C     1 
ATOM   6753 O O     . THR C 1 420 ? 18.128  -32.123 -15.924 1.00 100.12 ? 467 THR C O     1 
ATOM   6754 C CB    . THR C 1 420 ? 19.251  -28.996 -15.757 1.00 108.56 ? 467 THR C CB    1 
ATOM   6755 O OG1   . THR C 1 420 ? 19.375  -29.553 -14.455 1.00 112.02 ? 467 THR C OG1   1 
ATOM   6756 C CG2   . THR C 1 420 ? 18.973  -27.497 -15.699 1.00 105.71 ? 467 THR C CG2   1 
ATOM   6757 N N     . PHE C 1 421 ? 19.604  -31.555 -17.546 1.00 94.43  ? 468 PHE C N     1 
ATOM   6758 C CA    . PHE C 1 421 ? 20.158  -32.894 -17.765 1.00 93.66  ? 468 PHE C CA    1 
ATOM   6759 C C     . PHE C 1 421 ? 21.605  -32.982 -17.274 1.00 98.05  ? 468 PHE C C     1 
ATOM   6760 O O     . PHE C 1 421 ? 22.425  -32.124 -17.608 1.00 97.64  ? 468 PHE C O     1 
ATOM   6761 C CB    . PHE C 1 421 ? 20.048  -33.319 -19.255 1.00 93.16  ? 468 PHE C CB    1 
ATOM   6762 C CG    . PHE C 1 421 ? 20.544  -34.728 -19.485 1.00 94.78  ? 468 PHE C CG    1 
ATOM   6763 C CD1   . PHE C 1 421 ? 19.777  -35.824 -19.105 1.00 97.92  ? 468 PHE C CD1   1 
ATOM   6764 C CD2   . PHE C 1 421 ? 21.813  -34.959 -20.008 1.00 96.60  ? 468 PHE C CD2   1 
ATOM   6765 C CE1   . PHE C 1 421 ? 20.277  -37.118 -19.231 1.00 100.85 ? 468 PHE C CE1   1 
ATOM   6766 C CE2   . PHE C 1 421 ? 22.312  -36.254 -20.131 1.00 100.17 ? 468 PHE C CE2   1 
ATOM   6767 C CZ    . PHE C 1 421 ? 21.539  -37.324 -19.750 1.00 99.50  ? 468 PHE C CZ    1 
ATOM   6768 N N     . THR C 1 422 ? 21.926  -34.023 -16.503 1.00 96.18  ? 469 THR C N     1 
ATOM   6769 C CA    . THR C 1 422 ? 23.295  -34.171 -16.016 1.00 97.88  ? 469 THR C CA    1 
ATOM   6770 C C     . THR C 1 422 ? 23.973  -35.449 -16.517 1.00 102.40 ? 469 THR C C     1 
ATOM   6771 O O     . THR C 1 422 ? 23.595  -36.543 -16.090 1.00 104.20 ? 469 THR C O     1 
ATOM   6772 C CB    . THR C 1 422 ? 23.387  -33.927 -14.495 1.00 107.44 ? 469 THR C CB    1 
ATOM   6773 O OG1   . THR C 1 422 ? 22.558  -32.817 -14.138 1.00 111.26 ? 469 THR C OG1   1 
ATOM   6774 C CG2   . THR C 1 422 ? 24.804  -33.645 -14.036 1.00 106.13 ? 469 THR C CG2   1 
ATOM   6775 N N     . TYR C 1 423 ? 24.967  -35.310 -17.429 1.00 97.70  ? 470 TYR C N     1 
ATOM   6776 C CA    . TYR C 1 423 ? 25.748  -36.446 -17.939 1.00 98.45  ? 470 TYR C CA    1 
ATOM   6777 C C     . TYR C 1 423 ? 26.585  -36.927 -16.776 1.00 108.33 ? 470 TYR C C     1 
ATOM   6778 O O     . TYR C 1 423 ? 27.188  -36.093 -16.088 1.00 109.85 ? 470 TYR C O     1 
ATOM   6779 C CB    . TYR C 1 423 ? 26.661  -36.033 -19.092 1.00 97.23  ? 470 TYR C CB    1 
ATOM   6780 C CG    . TYR C 1 423 ? 25.916  -35.705 -20.360 1.00 94.89  ? 470 TYR C CG    1 
ATOM   6781 C CD1   . TYR C 1 423 ? 25.421  -34.423 -20.589 1.00 95.22  ? 470 TYR C CD1   1 
ATOM   6782 C CD2   . TYR C 1 423 ? 25.748  -36.660 -21.359 1.00 94.86  ? 470 TYR C CD2   1 
ATOM   6783 C CE1   . TYR C 1 423 ? 24.754  -34.106 -21.772 1.00 95.17  ? 470 TYR C CE1   1 
ATOM   6784 C CE2   . TYR C 1 423 ? 25.093  -36.353 -22.553 1.00 94.15  ? 470 TYR C CE2   1 
ATOM   6785 C CZ    . TYR C 1 423 ? 24.603  -35.071 -22.757 1.00 102.04 ? 470 TYR C CZ    1 
ATOM   6786 O OH    . TYR C 1 423 ? 23.930  -34.762 -23.913 1.00 100.96 ? 470 TYR C OH    1 
ATOM   6787 N N     . THR C 1 424 ? 26.582  -38.246 -16.510 1.00 107.30 ? 471 THR C N     1 
ATOM   6788 C CA    . THR C 1 424 ? 27.291  -38.781 -15.350 1.00 111.47 ? 471 THR C CA    1 
ATOM   6789 C C     . THR C 1 424 ? 28.376  -39.785 -15.681 1.00 119.92 ? 471 THR C C     1 
ATOM   6790 O O     . THR C 1 424 ? 28.112  -40.703 -16.457 1.00 120.46 ? 471 THR C O     1 
ATOM   6791 C CB    . THR C 1 424 ? 26.302  -39.437 -14.370 1.00 121.03 ? 471 THR C CB    1 
ATOM   6792 O OG1   . THR C 1 424 ? 25.594  -40.483 -15.051 1.00 120.03 ? 471 THR C OG1   1 
ATOM   6793 C CG2   . THR C 1 424 ? 25.345  -38.428 -13.707 1.00 117.12 ? 471 THR C CG2   1 
ATOM   6794 N N     . PRO C 1 425 ? 29.560  -39.700 -15.020 1.00 120.44 ? 472 PRO C N     1 
ATOM   6795 C CA    . PRO C 1 425 ? 30.609  -40.712 -15.237 1.00 123.14 ? 472 PRO C CA    1 
ATOM   6796 C C     . PRO C 1 425 ? 30.158  -42.115 -14.823 1.00 130.33 ? 472 PRO C C     1 
ATOM   6797 O O     . PRO C 1 425 ? 29.537  -42.305 -13.775 1.00 132.20 ? 472 PRO C O     1 
ATOM   6798 C CB    . PRO C 1 425 ? 31.772  -40.215 -14.372 1.00 127.79 ? 472 PRO C CB    1 
ATOM   6799 C CG    . PRO C 1 425 ? 31.505  -38.776 -14.167 1.00 130.75 ? 472 PRO C CG    1 
ATOM   6800 C CD    . PRO C 1 425 ? 30.015  -38.678 -14.061 1.00 123.96 ? 472 PRO C CD    1 
ATOM   6801 N N     . GLU C 1 426 ? 30.455  -43.081 -15.692 1.00 127.40 ? 473 GLU C N     1 
ATOM   6802 C CA    . GLU C 1 426 ? 30.103  -44.497 -15.616 1.00 157.13 ? 473 GLU C CA    1 
ATOM   6803 C C     . GLU C 1 426 ? 31.181  -45.348 -14.939 1.00 172.83 ? 473 GLU C C     1 
ATOM   6804 O O     . GLU C 1 426 ? 31.702  -44.970 -13.893 1.00 128.50 ? 473 GLU C O     1 
ATOM   6805 C CB    . GLU C 1 426 ? 29.768  -45.030 -17.036 1.00 157.16 ? 473 GLU C CB    1 
ATOM   6806 C CG    . GLU C 1 426 ? 30.805  -44.741 -18.135 1.00 163.41 ? 473 GLU C CG    1 
ATOM   6807 C CD    . GLU C 1 426 ? 30.819  -43.385 -18.839 1.00 159.74 ? 473 GLU C CD    1 
ATOM   6808 O OE1   . GLU C 1 426 ? 30.442  -42.369 -18.211 1.00 135.34 ? 473 GLU C OE1   1 
ATOM   6809 O OE2   . GLU C 1 426 ? 31.273  -43.329 -20.005 1.00 138.05 ? 473 GLU C OE2   1 
ATOM   6810 N N     . SER D 2 1   ? 7.858   -35.352 6.203   1.00 115.69 ? 183 SER D N     1 
ATOM   6811 C CA    . SER D 2 1   ? 9.169   -35.019 6.775   1.00 114.28 ? 183 SER D CA    1 
ATOM   6812 C C     . SER D 2 1   ? 9.791   -33.770 6.130   1.00 113.53 ? 183 SER D C     1 
ATOM   6813 O O     . SER D 2 1   ? 9.308   -33.295 5.093   1.00 114.10 ? 183 SER D O     1 
ATOM   6814 C CB    . SER D 2 1   ? 10.128  -36.204 6.655   1.00 120.34 ? 183 SER D CB    1 
ATOM   6815 O OG    . SER D 2 1   ? 10.555  -36.405 5.316   1.00 133.88 ? 183 SER D OG    1 
ATOM   6816 N N     . GLY D 2 2   ? 10.853  -33.262 6.747   1.00 104.83 ? 184 GLY D N     1 
ATOM   6817 C CA    . GLY D 2 2   ? 11.581  -32.119 6.224   1.00 102.03 ? 184 GLY D CA    1 
ATOM   6818 C C     . GLY D 2 2   ? 11.763  -30.950 7.162   1.00 101.68 ? 184 GLY D C     1 
ATOM   6819 O O     . GLY D 2 2   ? 10.952  -30.725 8.060   1.00 100.66 ? 184 GLY D O     1 
ATOM   6820 N N     . LEU D 2 3   ? 12.848  -30.197 6.932   1.00 96.64  ? 185 LEU D N     1 
ATOM   6821 C CA    . LEU D 2 3   ? 13.192  -28.970 7.650   1.00 95.60  ? 185 LEU D CA    1 
ATOM   6822 C C     . LEU D 2 3   ? 12.798  -27.764 6.803   1.00 97.79  ? 185 LEU D C     1 
ATOM   6823 O O     . LEU D 2 3   ? 13.016  -27.755 5.578   1.00 98.52  ? 185 LEU D O     1 
ATOM   6824 C CB    . LEU D 2 3   ? 14.689  -28.891 7.980   1.00 95.64  ? 185 LEU D CB    1 
ATOM   6825 C CG    . LEU D 2 3   ? 15.174  -29.795 9.097   1.00 101.03 ? 185 LEU D CG    1 
ATOM   6826 C CD1   . LEU D 2 3   ? 16.580  -30.260 8.829   1.00 101.47 ? 185 LEU D CD1   1 
ATOM   6827 C CD2   . LEU D 2 3   ? 15.054  -29.128 10.459  1.00 104.08 ? 185 LEU D CD2   1 
ATOM   6828 N N     . VAL D 2 4   ? 12.208  -26.755 7.453   1.00 90.03  ? 186 VAL D N     1 
ATOM   6829 C CA    . VAL D 2 4   ? 11.804  -25.532 6.789   1.00 87.92  ? 186 VAL D CA    1 
ATOM   6830 C C     . VAL D 2 4   ? 12.359  -24.341 7.567   1.00 93.61  ? 186 VAL D C     1 
ATOM   6831 O O     . VAL D 2 4   ? 12.249  -24.306 8.786   1.00 93.52  ? 186 VAL D O     1 
ATOM   6832 C CB    . VAL D 2 4   ? 10.268  -25.479 6.607   1.00 89.18  ? 186 VAL D CB    1 
ATOM   6833 C CG1   . VAL D 2 4   ? 9.803   -24.099 6.171   1.00 88.42  ? 186 VAL D CG1   1 
ATOM   6834 C CG2   . VAL D 2 4   ? 9.809   -26.520 5.601   1.00 88.65  ? 186 VAL D CG2   1 
ATOM   6835 N N     . LYS D 2 5   ? 12.963  -23.379 6.863   1.00 92.43  ? 187 LYS D N     1 
ATOM   6836 C CA    . LYS D 2 5   ? 13.483  -22.151 7.460   1.00 94.36  ? 187 LYS D CA    1 
ATOM   6837 C C     . LYS D 2 5   ? 12.565  -21.038 6.989   1.00 99.47  ? 187 LYS D C     1 
ATOM   6838 O O     . LYS D 2 5   ? 12.319  -20.921 5.789   1.00 100.05 ? 187 LYS D O     1 
ATOM   6839 C CB    . LYS D 2 5   ? 14.924  -21.882 7.003   1.00 98.77  ? 187 LYS D CB    1 
ATOM   6840 C CG    . LYS D 2 5   ? 15.854  -21.445 8.115   1.00 116.85 ? 187 LYS D CG    1 
ATOM   6841 C CD    . LYS D 2 5   ? 17.317  -21.435 7.636   1.00 131.15 ? 187 LYS D CD    1 
ATOM   6842 C CE    . LYS D 2 5   ? 18.280  -20.872 8.668   1.00 141.89 ? 187 LYS D CE    1 
ATOM   6843 N NZ    . LYS D 2 5   ? 19.637  -20.624 8.102   1.00 145.03 ? 187 LYS D NZ    1 
ATOM   6844 N N     . ALA D 2 6   ? 12.028  -20.250 7.922   1.00 85.76  ? 188 ALA D N     1 
ATOM   6845 C CA    . ALA D 2 6   ? 11.114  -19.147 7.639   1.00 81.67  ? 188 ALA D CA    1 
ATOM   6846 C C     . ALA D 2 6   ? 11.154  -18.094 8.774   1.00 85.17  ? 188 ALA D C     1 
ATOM   6847 O O     . ALA D 2 6   ? 10.668  -18.373 9.879   1.00 85.17  ? 188 ALA D O     1 
ATOM   6848 C CB    . ALA D 2 6   ? 9.701   -19.682 7.464   1.00 79.22  ? 188 ALA D CB    1 
ATOM   6849 N N     . PRO D 2 7   ? 11.733  -16.889 8.529   1.00 81.26  ? 189 PRO D N     1 
ATOM   6850 C CA    . PRO D 2 7   ? 11.779  -15.857 9.586   1.00 80.41  ? 189 PRO D CA    1 
ATOM   6851 C C     . PRO D 2 7   ? 10.410  -15.476 10.137  1.00 83.70  ? 189 PRO D C     1 
ATOM   6852 O O     . PRO D 2 7   ? 9.447   -15.300 9.384   1.00 81.95  ? 189 PRO D O     1 
ATOM   6853 C CB    . PRO D 2 7   ? 12.446  -14.658 8.901   1.00 81.83  ? 189 PRO D CB    1 
ATOM   6854 C CG    . PRO D 2 7   ? 13.085  -15.195 7.703   1.00 87.80  ? 189 PRO D CG    1 
ATOM   6855 C CD    . PRO D 2 7   ? 12.327  -16.389 7.271   1.00 82.84  ? 189 PRO D CD    1 
ATOM   6856 N N     . VAL D 2 8   ? 10.331  -15.346 11.453  1.00 81.48  ? 190 VAL D N     1 
ATOM   6857 C CA    . VAL D 2 8   ? 9.078   -15.006 12.105  1.00 79.43  ? 190 VAL D CA    1 
ATOM   6858 C C     . VAL D 2 8   ? 8.743   -13.505 12.146  1.00 81.76  ? 190 VAL D C     1 
ATOM   6859 O O     . VAL D 2 8   ? 9.584   -12.630 12.375  1.00 82.97  ? 190 VAL D O     1 
ATOM   6860 C CB    . VAL D 2 8   ? 8.913   -15.738 13.459  1.00 85.10  ? 190 VAL D CB    1 
ATOM   6861 C CG1   . VAL D 2 8   ? 7.676   -15.265 14.205  1.00 83.31  ? 190 VAL D CG1   1 
ATOM   6862 C CG2   . VAL D 2 8   ? 8.843   -17.248 13.243  1.00 86.54  ? 190 VAL D CG2   1 
ATOM   6863 N N     . TRP D 2 9   ? 7.494   -13.229 11.904  1.00 76.31  ? 191 TRP D N     1 
ATOM   6864 C CA    . TRP D 2 9   ? 6.930   -11.902 11.991  1.00 75.23  ? 191 TRP D CA    1 
ATOM   6865 C C     . TRP D 2 9   ? 5.950   -11.953 13.162  1.00 79.22  ? 191 TRP D C     1 
ATOM   6866 O O     . TRP D 2 9   ? 5.007   -12.736 13.143  1.00 79.21  ? 191 TRP D O     1 
ATOM   6867 C CB    . TRP D 2 9   ? 6.255   -11.519 10.678  1.00 72.02  ? 191 TRP D CB    1 
ATOM   6868 C CG    . TRP D 2 9   ? 5.822   -10.099 10.691  1.00 72.39  ? 191 TRP D CG    1 
ATOM   6869 C CD1   . TRP D 2 9   ? 6.590   -9.009  10.404  1.00 76.29  ? 191 TRP D CD1   1 
ATOM   6870 C CD2   . TRP D 2 9   ? 4.556   -9.594  11.155  1.00 71.05  ? 191 TRP D CD2   1 
ATOM   6871 N NE1   . TRP D 2 9   ? 5.883   -7.855  10.662  1.00 76.09  ? 191 TRP D NE1   1 
ATOM   6872 C CE2   . TRP D 2 9   ? 4.619   -8.186  11.089  1.00 75.34  ? 191 TRP D CE2   1 
ATOM   6873 C CE3   . TRP D 2 9   ? 3.390   -10.196 11.648  1.00 71.18  ? 191 TRP D CE3   1 
ATOM   6874 C CZ2   . TRP D 2 9   ? 3.542   -7.374  11.430  1.00 73.84  ? 191 TRP D CZ2   1 
ATOM   6875 C CZ3   . TRP D 2 9   ? 2.320   -9.386  11.991  1.00 72.64  ? 191 TRP D CZ3   1 
ATOM   6876 C CH2   . TRP D 2 9   ? 2.402   -7.992  11.876  1.00 74.02  ? 191 TRP D CH2   1 
ATOM   6877 N N     . TRP D 2 10  ? 6.224   -11.185 14.205  1.00 76.82  ? 192 TRP D N     1 
ATOM   6878 C CA    . TRP D 2 10  ? 5.457   -11.192 15.436  1.00 77.61  ? 192 TRP D CA    1 
ATOM   6879 C C     . TRP D 2 10  ? 4.307   -10.193 15.442  1.00 83.53  ? 192 TRP D C     1 
ATOM   6880 O O     . TRP D 2 10  ? 4.558   -8.982  15.520  1.00 83.65  ? 192 TRP D O     1 
ATOM   6881 C CB    . TRP D 2 10  ? 6.379   -10.964 16.644  1.00 78.14  ? 192 TRP D CB    1 
ATOM   6882 C CG    . TRP D 2 10  ? 7.558   -11.889 16.689  1.00 80.75  ? 192 TRP D CG    1 
ATOM   6883 C CD1   . TRP D 2 10  ? 8.753   -11.724 16.048  1.00 84.54  ? 192 TRP D CD1   1 
ATOM   6884 C CD2   . TRP D 2 10  ? 7.615   -13.179 17.320  1.00 81.18  ? 192 TRP D CD2   1 
ATOM   6885 N NE1   . TRP D 2 10  ? 9.574   -12.808 16.285  1.00 85.46  ? 192 TRP D NE1   1 
ATOM   6886 C CE2   . TRP D 2 10  ? 8.906   -13.710 17.075  1.00 86.61  ? 192 TRP D CE2   1 
ATOM   6887 C CE3   . TRP D 2 10  ? 6.712   -13.926 18.101  1.00 82.09  ? 192 TRP D CE3   1 
ATOM   6888 C CZ2   . TRP D 2 10  ? 9.310   -14.959 17.564  1.00 87.09  ? 192 TRP D CZ2   1 
ATOM   6889 C CZ3   . TRP D 2 10  ? 7.116   -15.157 18.594  1.00 84.82  ? 192 TRP D CZ3   1 
ATOM   6890 C CH2   . TRP D 2 10  ? 8.400   -15.661 18.326  1.00 86.69  ? 192 TRP D CH2   1 
ATOM   6891 N N     . PRO D 2 11  ? 3.028   -10.669 15.415  1.00 80.49  ? 193 PRO D N     1 
ATOM   6892 C CA    . PRO D 2 11  ? 1.908   -9.729  15.536  1.00 81.99  ? 193 PRO D CA    1 
ATOM   6893 C C     . PRO D 2 11  ? 2.063   -8.908  16.814  1.00 95.43  ? 193 PRO D C     1 
ATOM   6894 O O     . PRO D 2 11  ? 2.558   -9.430  17.837  1.00 95.65  ? 193 PRO D O     1 
ATOM   6895 C CB    . PRO D 2 11  ? 0.684   -10.640 15.638  1.00 81.72  ? 193 PRO D CB    1 
ATOM   6896 C CG    . PRO D 2 11  ? 1.130   -11.938 15.174  1.00 83.31  ? 193 PRO D CG    1 
ATOM   6897 C CD    . PRO D 2 11  ? 2.554   -12.066 15.394  1.00 79.61  ? 193 PRO D CD    1 
ATOM   6898 N N     . MET D 2 12  ? 1.646   -7.636  16.771  1.00 97.82  ? 194 MET D N     1 
ATOM   6899 C CA    . MET D 2 12  ? 1.794   -6.844  17.979  1.00 102.48 ? 194 MET D CA    1 
ATOM   6900 C C     . MET D 2 12  ? 0.534   -6.497  18.735  1.00 108.10 ? 194 MET D C     1 
ATOM   6901 O O     . MET D 2 12  ? -0.570  -6.749  18.271  1.00 106.07 ? 194 MET D O     1 
ATOM   6902 C CB    . MET D 2 12  ? 2.697   -5.619  17.749  1.00 107.08 ? 194 MET D CB    1 
ATOM   6903 C CG    . MET D 2 12  ? 4.196   -5.960  17.529  1.00 111.13 ? 194 MET D CG    1 
ATOM   6904 S SD    . MET D 2 12  ? 4.941   -7.088  18.739  1.00 116.24 ? 194 MET D SD    1 
ATOM   6905 C CE    . MET D 2 12  ? 6.760   -6.829  18.348  1.00 113.29 ? 194 MET D CE    1 
ATOM   6906 N N     . LYS D 2 13  ? 0.724   -5.966  19.943  1.00 109.08 ? 195 LYS D N     1 
ATOM   6907 C CA    . LYS D 2 13  ? -0.323  -5.467  20.827  1.00 113.02 ? 195 LYS D CA    1 
ATOM   6908 C C     . LYS D 2 13  ? 0.202   -4.226  21.586  1.00 122.56 ? 195 LYS D C     1 
ATOM   6909 O O     . LYS D 2 13  ? 1.343   -3.770  21.358  1.00 121.27 ? 195 LYS D O     1 
ATOM   6910 C CB    . LYS D 2 13  ? -0.881  -6.569  21.765  1.00 115.51 ? 195 LYS D CB    1 
ATOM   6911 C CG    . LYS D 2 13  ? 0.173   -7.327  22.578  1.00 123.66 ? 195 LYS D CG    1 
ATOM   6912 C CD    . LYS D 2 13  ? -0.460  -8.226  23.653  1.00 132.74 ? 195 LYS D CD    1 
ATOM   6913 C CE    . LYS D 2 13  ? -0.656  -7.546  24.998  1.00 146.11 ? 195 LYS D CE    1 
ATOM   6914 N NZ    . LYS D 2 13  ? 0.630   -7.310  25.724  1.00 148.47 ? 195 LYS D NZ    1 
ATOM   6915 N N     . ASP D 2 14  ? -0.652  -3.674  22.467  1.00 123.42 ? 196 ASP D N     1 
ATOM   6916 C CA    . ASP D 2 14  ? -0.385  -2.499  23.308  1.00 125.91 ? 196 ASP D CA    1 
ATOM   6917 C C     . ASP D 2 14  ? 0.111   -2.967  24.730  1.00 128.42 ? 196 ASP D C     1 
ATOM   6918 O O     . ASP D 2 14  ? -0.112  -4.136  25.051  1.00 127.15 ? 196 ASP D O     1 
ATOM   6919 C CB    . ASP D 2 14  ? -1.681  -1.655  23.372  1.00 132.13 ? 196 ASP D CB    1 
ATOM   6920 C CG    . ASP D 2 14  ? -2.292  -1.367  22.000  1.00 142.53 ? 196 ASP D CG    1 
ATOM   6921 O OD1   . ASP D 2 14  ? -2.766  -2.333  21.338  1.00 140.08 ? 196 ASP D OD1   1 
ATOM   6922 O OD2   . ASP D 2 14  ? -2.267  -0.189  21.575  1.00 151.04 ? 196 ASP D OD2   1 
ATOM   6923 N N     . ASN D 2 15  ? 0.824   -2.157  25.571  1.00 124.90 ? 197 ASN D N     1 
ATOM   6924 C CA    . ASN D 2 15  ? 1.236   -0.748  25.504  1.00 153.00 ? 197 ASN D CA    1 
ATOM   6925 C C     . ASN D 2 15  ? 0.064   0.240   25.618  1.00 206.41 ? 197 ASN D C     1 
ATOM   6926 O O     . ASN D 2 15  ? -0.938  -0.052  26.278  1.00 173.69 ? 197 ASN D O     1 
ATOM   6927 C CB    . ASN D 2 15  ? 2.176   -0.436  24.314  1.00 148.80 ? 197 ASN D CB    1 
ATOM   6928 C CG    . ASN D 2 15  ? 3.607   -0.905  24.478  1.00 139.66 ? 197 ASN D CG    1 
ATOM   6929 O OD1   . ASN D 2 15  ? 3.940   -2.068  24.230  1.00 128.13 ? 197 ASN D OD1   1 
ATOM   6930 N ND2   . ASN D 2 15  ? 4.499   0.016   24.811  1.00 122.39 ? 197 ASN D ND2   1 
ATOM   6931 O "O5'" . DA  E 3 1   ? -37.776 -43.081 7.261   1.00 145.19 ? 1   DA  E "O5'" 1 
ATOM   6932 C "C5'" . DA  E 3 1   ? -37.362 -43.969 6.218   1.00 145.61 ? 1   DA  E "C5'" 1 
ATOM   6933 C "C4'" . DA  E 3 1   ? -37.084 -45.392 6.711   1.00 148.11 ? 1   DA  E "C4'" 1 
ATOM   6934 O "O4'" . DA  E 3 1   ? -36.862 -46.261 5.564   1.00 149.04 ? 1   DA  E "O4'" 1 
ATOM   6935 C "C3'" . DA  E 3 1   ? -35.822 -45.560 7.563   1.00 146.92 ? 1   DA  E "C3'" 1 
ATOM   6936 O "O3'" . DA  E 3 1   ? -36.103 -45.646 8.941   1.00 148.11 ? 1   DA  E "O3'" 1 
ATOM   6937 C "C2'" . DA  E 3 1   ? -35.182 -46.850 7.071   1.00 148.16 ? 1   DA  E "C2'" 1 
ATOM   6938 C "C1'" . DA  E 3 1   ? -35.513 -46.683 5.606   1.00 147.51 ? 1   DA  E "C1'" 1 
ATOM   6939 N N9    . DA  E 3 1   ? -34.570 -45.943 4.733   1.00 143.25 ? 1   DA  E N9    1 
ATOM   6940 C C8    . DA  E 3 1   ? -33.215 -45.791 4.921   1.00 141.02 ? 1   DA  E C8    1 
ATOM   6941 N N7    . DA  E 3 1   ? -32.569 -45.271 3.904   1.00 138.06 ? 1   DA  E N7    1 
ATOM   6942 C C5    . DA  E 3 1   ? -33.562 -45.081 2.965   1.00 137.96 ? 1   DA  E C5    1 
ATOM   6943 C C6    . DA  E 3 1   ? -33.543 -44.585 1.648   1.00 136.17 ? 1   DA  E C6    1 
ATOM   6944 N N6    . DA  E 3 1   ? -32.429 -44.161 1.068   1.00 134.58 ? 1   DA  E N6    1 
ATOM   6945 N N1    . DA  E 3 1   ? -34.703 -44.479 0.960   1.00 136.70 ? 1   DA  E N1    1 
ATOM   6946 C C2    . DA  E 3 1   ? -35.835 -44.853 1.564   1.00 139.20 ? 1   DA  E C2    1 
ATOM   6947 N N3    . DA  E 3 1   ? -35.976 -45.358 2.793   1.00 141.27 ? 1   DA  E N3    1 
ATOM   6948 C C4    . DA  E 3 1   ? -34.800 -45.463 3.454   1.00 140.88 ? 1   DA  E C4    1 
ATOM   6949 P P     . DA  E 3 2   ? -35.113 -44.885 9.938   1.00 146.75 ? 2   DA  E P     1 
ATOM   6950 O OP1   . DA  E 3 2   ? -35.307 -45.508 11.270  1.00 149.37 ? 2   DA  E OP1   1 
ATOM   6951 O OP2   . DA  E 3 2   ? -35.303 -43.420 9.730   1.00 143.90 ? 2   DA  E OP2   1 
ATOM   6952 O "O5'" . DA  E 3 2   ? -33.649 -45.293 9.412   1.00 145.41 ? 2   DA  E "O5'" 1 
ATOM   6953 C "C5'" . DA  E 3 2   ? -32.433 -44.936 10.056  1.00 144.20 ? 2   DA  E "C5'" 1 
ATOM   6954 C "C4'" . DA  E 3 2   ? -31.700 -43.808 9.348   1.00 140.70 ? 2   DA  E "C4'" 1 
ATOM   6955 O "O4'" . DA  E 3 2   ? -32.108 -43.648 7.966   1.00 138.12 ? 2   DA  E "O4'" 1 
ATOM   6956 C "C3'" . DA  E 3 2   ? -31.838 -42.440 10.011  1.00 140.38 ? 2   DA  E "C3'" 1 
ATOM   6957 O "O3'" . DA  E 3 2   ? -30.626 -42.184 10.760  1.00 141.89 ? 2   DA  E "O3'" 1 
ATOM   6958 C "C2'" . DA  E 3 2   ? -32.161 -41.459 8.871   1.00 136.82 ? 2   DA  E "C2'" 1 
ATOM   6959 C "C1'" . DA  E 3 2   ? -31.914 -42.289 7.618   1.00 135.23 ? 2   DA  E "C1'" 1 
ATOM   6960 N N9    . DA  E 3 2   ? -32.719 -41.934 6.444   1.00 132.53 ? 2   DA  E N9    1 
ATOM   6961 C C8    . DA  E 3 2   ? -34.043 -41.571 6.383   1.00 132.09 ? 2   DA  E C8    1 
ATOM   6962 N N7    . DA  E 3 2   ? -34.476 -41.337 5.164   1.00 130.33 ? 2   DA  E N7    1 
ATOM   6963 C C5    . DA  E 3 2   ? -33.368 -41.570 4.364   1.00 128.93 ? 2   DA  E C5    1 
ATOM   6964 C C6    . DA  E 3 2   ? -33.142 -41.493 2.965   1.00 127.01 ? 2   DA  E C6    1 
ATOM   6965 N N6    . DA  E 3 2   ? -34.079 -41.152 2.068   1.00 126.33 ? 2   DA  E N6    1 
ATOM   6966 N N1    . DA  E 3 2   ? -31.900 -41.795 2.511   1.00 126.19 ? 2   DA  E N1    1 
ATOM   6967 C C2    . DA  E 3 2   ? -30.945 -42.168 3.376   1.00 127.12 ? 2   DA  E C2    1 
ATOM   6968 N N3    . DA  E 3 2   ? -31.040 -42.271 4.701   1.00 129.07 ? 2   DA  E N3    1 
ATOM   6969 C C4    . DA  E 3 2   ? -32.278 -41.949 5.139   1.00 130.07 ? 2   DA  E C4    1 
ATOM   6970 P P     . DT  E 3 3   ? -29.991 -40.799 11.286  1.00 142.18 ? 3   DT  E P     1 
ATOM   6971 O OP1   . DT  E 3 3   ? -29.369 -41.076 12.608  1.00 146.07 ? 3   DT  E OP1   1 
ATOM   6972 O OP2   . DT  E 3 3   ? -30.958 -39.674 11.143  1.00 140.81 ? 3   DT  E OP2   1 
ATOM   6973 O "O5'" . DT  E 3 3   ? -28.807 -40.523 10.244  1.00 139.44 ? 3   DT  E "O5'" 1 
ATOM   6974 C "C5'" . DT  E 3 3   ? -28.135 -41.471 9.392   1.00 137.90 ? 3   DT  E "C5'" 1 
ATOM   6975 C "C4'" . DT  E 3 3   ? -27.546 -40.759 8.175   1.00 134.93 ? 3   DT  E "C4'" 1 
ATOM   6976 O "O4'" . DT  E 3 3   ? -28.517 -40.628 7.097   1.00 132.08 ? 3   DT  E "O4'" 1 
ATOM   6977 C "C3'" . DT  E 3 3   ? -27.000 -39.355 8.423   1.00 135.28 ? 3   DT  E "C3'" 1 
ATOM   6978 O "O3'" . DT  E 3 3   ? -25.717 -39.228 7.816   1.00 135.58 ? 3   DT  E "O3'" 1 
ATOM   6979 C "C2'" . DT  E 3 3   ? -28.058 -38.441 7.797   1.00 132.32 ? 3   DT  E "C2'" 1 
ATOM   6980 C "C1'" . DT  E 3 3   ? -28.484 -39.303 6.615   1.00 129.31 ? 3   DT  E "C1'" 1 
ATOM   6981 N N1    . DT  E 3 3   ? -29.734 -38.940 5.849   1.00 126.10 ? 3   DT  E N1    1 
ATOM   6982 C C2    . DT  E 3 3   ? -29.667 -38.926 4.463   1.00 123.77 ? 3   DT  E C2    1 
ATOM   6983 O O2    . DT  E 3 3   ? -28.663 -39.206 3.819   1.00 122.94 ? 3   DT  E O2    1 
ATOM   6984 N N3    . DT  E 3 3   ? -30.847 -38.580 3.833   1.00 122.86 ? 3   DT  E N3    1 
ATOM   6985 C C4    . DT  E 3 3   ? -32.071 -38.263 4.417   1.00 123.32 ? 3   DT  E C4    1 
ATOM   6986 O O4    . DT  E 3 3   ? -33.044 -38.012 3.691   1.00 122.24 ? 3   DT  E O4    1 
ATOM   6987 C C5    . DT  E 3 3   ? -32.064 -38.294 5.869   1.00 125.20 ? 3   DT  E C5    1 
ATOM   6988 C C7    . DT  E 3 3   ? -33.314 -37.970 6.637   1.00 126.49 ? 3   DT  E C7    1 
ATOM   6989 C C6    . DT  E 3 3   ? -30.920 -38.628 6.503   1.00 126.44 ? 3   DT  E C6    1 
ATOM   6990 P P     . DC  E 3 4   ? -24.609 -38.185 8.333   1.00 138.24 ? 4   DC  E P     1 
ATOM   6991 O OP1   . DC  E 3 4   ? -23.842 -38.875 9.396   1.00 142.16 ? 4   DC  E OP1   1 
ATOM   6992 O OP2   . DC  E 3 4   ? -25.230 -36.860 8.609   1.00 138.29 ? 4   DC  E OP2   1 
ATOM   6993 O "O5'" . DC  E 3 4   ? -23.634 -37.995 7.070   1.00 135.36 ? 4   DC  E "O5'" 1 
ATOM   6994 C "C5'" . DC  E 3 4   ? -23.651 -38.758 5.843   1.00 131.66 ? 4   DC  E "C5'" 1 
ATOM   6995 C "C4'" . DC  E 3 4   ? -23.984 -37.883 4.641   1.00 127.51 ? 4   DC  E "C4'" 1 
ATOM   6996 O "O4'" . DC  E 3 4   ? -25.424 -37.758 4.495   1.00 126.39 ? 4   DC  E "O4'" 1 
ATOM   6997 C "C3'" . DC  E 3 4   ? -23.436 -36.451 4.668   1.00 126.71 ? 4   DC  E "C3'" 1 
ATOM   6998 O "O3'" . DC  E 3 4   ? -22.660 -36.179 3.486   1.00 123.01 ? 4   DC  E "O3'" 1 
ATOM   6999 C "C2'" . DC  E 3 4   ? -24.692 -35.596 4.816   1.00 126.17 ? 4   DC  E "C2'" 1 
ATOM   7000 C "C1'" . DC  E 3 4   ? -25.688 -36.448 4.046   1.00 124.30 ? 4   DC  E "C1'" 1 
ATOM   7001 N N1    . DC  E 3 4   ? -27.141 -36.051 4.164   1.00 123.73 ? 4   DC  E N1    1 
ATOM   7002 C C2    . DC  E 3 4   ? -27.932 -35.894 3.007   1.00 121.57 ? 4   DC  E C2    1 
ATOM   7003 O O2    . DC  E 3 4   ? -27.468 -36.139 1.886   1.00 120.01 ? 4   DC  E O2    1 
ATOM   7004 N N3    . DC  E 3 4   ? -29.229 -35.494 3.151   1.00 121.90 ? 4   DC  E N3    1 
ATOM   7005 C C4    . DC  E 3 4   ? -29.743 -35.244 4.368   1.00 124.02 ? 4   DC  E C4    1 
ATOM   7006 N N4    . DC  E 3 4   ? -31.023 -34.858 4.454   1.00 124.22 ? 4   DC  E N4    1 
ATOM   7007 C C5    . DC  E 3 4   ? -28.954 -35.380 5.553   1.00 126.21 ? 4   DC  E C5    1 
ATOM   7008 C C6    . DC  E 3 4   ? -27.683 -35.781 5.398   1.00 126.09 ? 4   DC  E C6    1 
ATOM   7009 P P     . DT  E 3 5   ? -22.133 -34.771 2.903   1.00 119.68 ? 5   DT  E P     1 
ATOM   7010 O OP1   . DT  E 3 5   ? -20.786 -35.072 2.345   1.00 119.41 ? 5   DT  E OP1   1 
ATOM   7011 O OP2   . DT  E 3 5   ? -22.361 -33.599 3.804   1.00 120.48 ? 5   DT  E OP2   1 
ATOM   7012 O "O5'" . DT  E 3 5   ? -23.216 -34.660 1.733   1.00 114.62 ? 5   DT  E "O5'" 1 
ATOM   7013 C "C5'" . DT  E 3 5   ? -23.111 -35.325 0.480   1.00 110.41 ? 5   DT  E "C5'" 1 
ATOM   7014 C "C4'" . DT  E 3 5   ? -23.780 -34.472 -0.589  1.00 105.93 ? 5   DT  E "C4'" 1 
ATOM   7015 O "O4'" . DT  E 3 5   ? -25.148 -34.176 -0.209  1.00 105.28 ? 5   DT  E "O4'" 1 
ATOM   7016 C "C3'" . DT  E 3 5   ? -23.139 -33.136 -0.937  1.00 103.78 ? 5   DT  E "C3'" 1 
ATOM   7017 O "O3'" . DT  E 3 5   ? -23.055 -33.053 -2.347  1.00 101.33 ? 5   DT  E "O3'" 1 
ATOM   7018 C "C2'" . DT  E 3 5   ? -24.082 -32.111 -0.307  1.00 103.93 ? 5   DT  E "C2'" 1 
ATOM   7019 C "C1'" . DT  E 3 5   ? -25.435 -32.803 -0.341  1.00 103.18 ? 5   DT  E "C1'" 1 
ATOM   7020 N N1    . DT  E 3 5   ? -26.417 -32.473 0.753   1.00 103.62 ? 5   DT  E N1    1 
ATOM   7021 C C2    . DT  E 3 5   ? -27.760 -32.273 0.442   1.00 102.29 ? 5   DT  E C2    1 
ATOM   7022 O O2    . DT  E 3 5   ? -28.228 -32.266 -0.684  1.00 99.98  ? 5   DT  E O2    1 
ATOM   7023 N N3    . DT  E 3 5   ? -28.565 -32.055 1.538   1.00 104.40 ? 5   DT  E N3    1 
ATOM   7024 C C4    . DT  E 3 5   ? -28.183 -32.021 2.880   1.00 106.72 ? 5   DT  E C4    1 
ATOM   7025 O O4    . DT  E 3 5   ? -29.029 -31.835 3.748   1.00 108.66 ? 5   DT  E O4    1 
ATOM   7026 C C5    . DT  E 3 5   ? -26.786 -32.267 3.138   1.00 106.94 ? 5   DT  E C5    1 
ATOM   7027 C C7    . DT  E 3 5   ? -26.268 -32.289 4.543   1.00 109.98 ? 5   DT  E C7    1 
ATOM   7028 C C6    . DT  E 3 5   ? -25.986 -32.491 2.081   1.00 105.62 ? 5   DT  E C6    1 
ATOM   7029 P P     . DT  E 3 6   ? -22.800 -31.758 -3.249  1.00 101.05 ? 6   DT  E P     1 
ATOM   7030 O OP1   . DT  E 3 6   ? -22.280 -32.245 -4.541  1.00 100.97 ? 6   DT  E OP1   1 
ATOM   7031 O OP2   . DT  E 3 6   ? -22.021 -30.729 -2.505  1.00 102.12 ? 6   DT  E OP2   1 
ATOM   7032 O "O5'" . DT  E 3 6   ? -24.285 -31.230 -3.490  1.00 99.57  ? 6   DT  E "O5'" 1 
ATOM   7033 C "C5'" . DT  E 3 6   ? -25.269 -31.914 -4.234  1.00 98.23  ? 6   DT  E "C5'" 1 
ATOM   7034 C "C4'" . DT  E 3 6   ? -26.415 -30.976 -4.611  1.00 97.89  ? 6   DT  E "C4'" 1 
ATOM   7035 O "O4'" . DT  E 3 6   ? -27.364 -30.739 -3.539  1.00 99.61  ? 6   DT  E "O4'" 1 
ATOM   7036 C "C3'" . DT  E 3 6   ? -26.123 -29.613 -5.238  1.00 95.83  ? 6   DT  E "C3'" 1 
ATOM   7037 O "O3'" . DT  E 3 6   ? -27.088 -29.451 -6.277  1.00 95.26  ? 6   DT  E "O3'" 1 
ATOM   7038 C "C2'" . DT  E 3 6   ? -26.346 -28.654 -4.071  1.00 96.69  ? 6   DT  E "C2'" 1 
ATOM   7039 C "C1'" . DT  E 3 6   ? -27.481 -29.342 -3.319  1.00 98.59  ? 6   DT  E "C1'" 1 
ATOM   7040 N N1    . DT  E 3 6   ? -27.591 -29.104 -1.844  1.00 101.02 ? 6   DT  E N1    1 
ATOM   7041 C C2    . DT  E 3 6   ? -28.859 -29.051 -1.250  1.00 102.61 ? 6   DT  E C2    1 
ATOM   7042 O O2    . DT  E 3 6   ? -29.933 -29.108 -1.839  1.00 101.73 ? 6   DT  E O2    1 
ATOM   7043 N N3    . DT  E 3 6   ? -28.829 -28.910 0.116   1.00 105.53 ? 6   DT  E N3    1 
ATOM   7044 C C4    . DT  E 3 6   ? -27.702 -28.824 0.924   1.00 107.31 ? 6   DT  E C4    1 
ATOM   7045 O O4    . DT  E 3 6   ? -27.858 -28.672 2.128   1.00 110.93 ? 6   DT  E O4    1 
ATOM   7046 C C5    . DT  E 3 6   ? -26.426 -28.912 0.252   1.00 105.28 ? 6   DT  E C5    1 
ATOM   7047 C C7    . DT  E 3 6   ? -25.144 -28.846 1.031   1.00 107.58 ? 6   DT  E C7    1 
ATOM   7048 C C6    . DT  E 3 6   ? -26.432 -29.085 -1.077  1.00 102.27 ? 6   DT  E C6    1 
ATOM   7049 P P     . DT  E 3 7   ? -27.247 -28.278 -7.354  1.00 130.06 ? 7   DT  E P     1 
ATOM   7050 O OP1   . DT  E 3 7   ? -27.721 -28.930 -8.601  1.00 135.13 ? 7   DT  E OP1   1 
ATOM   7051 O OP2   . DT  E 3 7   ? -26.010 -27.471 -7.346  1.00 127.70 ? 7   DT  E OP2   1 
ATOM   7052 O "O5'" . DT  E 3 7   ? -28.425 -27.383 -6.759  1.00 124.73 ? 7   DT  E "O5'" 1 
ATOM   7053 C "C5'" . DT  E 3 7   ? -29.712 -27.975 -6.731  1.00 126.74 ? 7   DT  E "C5'" 1 
ATOM   7054 C "C4'" . DT  E 3 7   ? -30.674 -27.156 -5.907  1.00 124.23 ? 7   DT  E "C4'" 1 
ATOM   7055 O "O4'" . DT  E 3 7   ? -30.310 -27.229 -4.516  1.00 122.48 ? 7   DT  E "O4'" 1 
ATOM   7056 C "C3'" . DT  E 3 7   ? -30.785 -25.675 -6.255  1.00 121.26 ? 7   DT  E "C3'" 1 
ATOM   7057 O "O3'" . DT  E 3 7   ? -32.102 -25.431 -6.686  1.00 124.68 ? 7   DT  E "O3'" 1 
ATOM   7058 C "C2'" . DT  E 3 7   ? -30.477 -24.963 -4.945  1.00 116.89 ? 7   DT  E "C2'" 1 
ATOM   7059 C "C1'" . DT  E 3 7   ? -30.768 -26.043 -3.920  1.00 118.58 ? 7   DT  E "C1'" 1 
ATOM   7060 N N1    . DT  E 3 7   ? -30.032 -25.844 -2.661  1.00 116.62 ? 7   DT  E N1    1 
ATOM   7061 C C2    . DT  E 3 7   ? -30.716 -25.635 -1.478  1.00 116.92 ? 7   DT  E C2    1 
ATOM   7062 O O2    . DT  E 3 7   ? -31.926 -25.576 -1.375  1.00 118.70 ? 7   DT  E O2    1 
ATOM   7063 N N3    . DT  E 3 7   ? -29.910 -25.429 -0.388  1.00 116.24 ? 7   DT  E N3    1 
ATOM   7064 C C4    . DT  E 3 7   ? -28.517 -25.432 -0.360  1.00 115.15 ? 7   DT  E C4    1 
ATOM   7065 O O4    . DT  E 3 7   ? -27.952 -25.250 0.717   1.00 115.10 ? 7   DT  E O4    1 
ATOM   7066 C C5    . DT  E 3 7   ? -27.863 -25.665 -1.634  1.00 114.67 ? 7   DT  E C5    1 
ATOM   7067 C C7    . DT  E 3 7   ? -26.374 -25.670 -1.782  1.00 113.90 ? 7   DT  E C7    1 
ATOM   7068 C C6    . DT  E 3 7   ? -28.642 -25.852 -2.702  1.00 115.85 ? 7   DT  E C6    1 
ATOM   7069 P P     . DC  E 3 8   ? -32.755 -24.021 -7.075  1.00 125.59 ? 8   DC  E P     1 
ATOM   7070 O OP1   . DC  E 3 8   ? -33.819 -24.389 -8.053  1.00 129.30 ? 8   DC  E OP1   1 
ATOM   7071 O OP2   . DC  E 3 8   ? -31.719 -22.986 -7.402  1.00 122.62 ? 8   DC  E OP2   1 
ATOM   7072 O "O5'" . DC  E 3 8   ? -33.414 -23.508 -5.709  1.00 124.80 ? 8   DC  E "O5'" 1 
ATOM   7073 C "C5'" . DC  E 3 8   ? -34.249 -24.348 -4.925  1.00 128.27 ? 8   DC  E "C5'" 1 
ATOM   7074 C "C4'" . DC  E 3 8   ? -34.892 -23.591 -3.776  1.00 128.26 ? 8   DC  E "C4'" 1 
ATOM   7075 O "O4'" . DC  E 3 8   ? -34.056 -23.627 -2.599  1.00 126.27 ? 8   DC  E "O4'" 1 
ATOM   7076 C "C3'" . DC  E 3 8   ? -35.273 -22.140 -4.021  1.00 127.30 ? 8   DC  E "C3'" 1 
ATOM   7077 O "O3'" . DC  E 3 8   ? -36.611 -21.972 -3.575  1.00 132.23 ? 8   DC  E "O3'" 1 
ATOM   7078 C "C2'" . DC  E 3 8   ? -34.230 -21.362 -3.217  1.00 122.80 ? 8   DC  E "C2'" 1 
ATOM   7079 C "C1'" . DC  E 3 8   ? -33.875 -22.323 -2.091  1.00 122.85 ? 8   DC  E "C1'" 1 
ATOM   7080 N N1    . DC  E 3 8   ? -32.488 -22.232 -1.524  1.00 119.23 ? 8   DC  E N1    1 
ATOM   7081 C C2    . DC  E 3 8   ? -32.304 -22.104 -0.128  1.00 118.88 ? 8   DC  E C2    1 
ATOM   7082 O O2    . DC  E 3 8   ? -33.274 -21.985 0.633   1.00 120.69 ? 8   DC  E O2    1 
ATOM   7083 N N3    . DC  E 3 8   ? -31.028 -22.060 0.359   1.00 117.03 ? 8   DC  E N3    1 
ATOM   7084 C C4    . DC  E 3 8   ? -29.969 -22.158 -0.464  1.00 115.04 ? 8   DC  E C4    1 
ATOM   7085 N N4    . DC  E 3 8   ? -28.746 -22.105 0.080   1.00 113.54 ? 8   DC  E N4    1 
ATOM   7086 C C5    . DC  E 3 8   ? -30.132 -22.332 -1.878  1.00 115.34 ? 8   DC  E C5    1 
ATOM   7087 C C6    . DC  E 3 8   ? -31.390 -22.362 -2.353  1.00 117.30 ? 8   DC  E C6    1 
ATOM   7088 P P     . DC  E 3 9   ? -37.449 -20.605 -3.581  1.00 134.26 ? 9   DC  E P     1 
ATOM   7089 O OP1   . DC  E 3 9   ? -38.892 -20.965 -3.604  1.00 138.70 ? 9   DC  E OP1   1 
ATOM   7090 O OP2   . DC  E 3 9   ? -36.900 -19.710 -4.625  1.00 132.70 ? 9   DC  E OP2   1 
ATOM   7091 O "O5'" . DC  E 3 9   ? -37.049 -19.966 -2.171  1.00 132.25 ? 9   DC  E "O5'" 1 
ATOM   7092 C "C5'" . DC  E 3 9   ? -37.181 -20.661 -0.934  1.00 134.11 ? 9   DC  E "C5'" 1 
ATOM   7093 C "C4'" . DC  E 3 9   ? -36.948 -19.702 0.216   1.00 133.91 ? 9   DC  E "C4'" 1 
ATOM   7094 O "O4'" . DC  E 3 9   ? -35.589 -19.819 0.699   1.00 131.00 ? 9   DC  E "O4'" 1 
ATOM   7095 C "C3'" . DC  E 3 9   ? -37.183 -18.231 -0.104  1.00 133.71 ? 9   DC  E "C3'" 1 
ATOM   7096 O "O3'" . DC  E 3 9   ? -38.144 -17.686 0.807   1.00 138.37 ? 9   DC  E "O3'" 1 
ATOM   7097 C "C2'" . DC  E 3 9   ? -35.799 -17.586 -0.049  1.00 128.94 ? 9   DC  E "C2'" 1 
ATOM   7098 C "C1'" . DC  E 3 9   ? -35.019 -18.537 0.858   1.00 128.15 ? 9   DC  E "C1'" 1 
ATOM   7099 N N1    . DC  E 3 9   ? -33.535 -18.622 0.589   1.00 124.09 ? 9   DC  E N1    1 
ATOM   7100 C C2    . DC  E 3 9   ? -32.597 -18.610 1.662   1.00 123.19 ? 9   DC  E C2    1 
ATOM   7101 O O2    . DC  E 3 9   ? -32.966 -18.564 2.852   1.00 125.15 ? 9   DC  E O2    1 
ATOM   7102 N N3    . DC  E 3 9   ? -31.262 -18.669 1.361   1.00 120.53 ? 9   DC  E N3    1 
ATOM   7103 C C4    . DC  E 3 9   ? -30.848 -18.759 0.082   1.00 118.97 ? 9   DC  E C4    1 
ATOM   7104 N N4    . DC  E 3 9   ? -29.528 -18.825 -0.153  1.00 116.62 ? 9   DC  E N4    1 
ATOM   7105 C C5    . DC  E 3 9   ? -31.786 -18.769 -1.012  1.00 120.12 ? 9   DC  E C5    1 
ATOM   7106 C C6    . DC  E 3 9   ? -33.097 -18.707 -0.716  1.00 122.25 ? 9   DC  E C6    1 
ATOM   7107 P P     . DC  E 3 10  ? -38.690 -16.173 0.779   1.00 140.18 ? 10  DC  E P     1 
ATOM   7108 O OP1   . DC  E 3 10  ? -40.049 -16.159 1.383   1.00 146.17 ? 10  DC  E OP1   1 
ATOM   7109 O OP2   . DC  E 3 10  ? -38.487 -15.605 -0.582  1.00 138.59 ? 10  DC  E OP2   1 
ATOM   7110 O "O5'" . DC  E 3 10  ? -37.662 -15.446 1.771   1.00 135.98 ? 10  DC  E "O5'" 1 
ATOM   7111 C "C5'" . DC  E 3 10  ? -37.380 -15.932 3.092   1.00 135.74 ? 10  DC  E "C5'" 1 
ATOM   7112 C "C4'" . DC  E 3 10  ? -36.271 -15.122 3.754   1.00 131.87 ? 10  DC  E "C4'" 1 
ATOM   7113 O "O4'" . DC  E 3 10  ? -34.931 -15.576 3.390   1.00 125.84 ? 10  DC  E "O4'" 1 
ATOM   7114 C "C3'" . DC  E 3 10  ? -36.360 -13.620 3.483   1.00 131.74 ? 10  DC  E "C3'" 1 
ATOM   7115 O "O3'" . DC  E 3 10  ? -36.252 -12.892 4.683   1.00 134.30 ? 10  DC  E "O3'" 1 
ATOM   7116 C "C2'" . DC  E 3 10  ? -35.178 -13.369 2.561   1.00 126.11 ? 10  DC  E "C2'" 1 
ATOM   7117 C "C1'" . DC  E 3 10  ? -34.175 -14.446 2.997   1.00 122.59 ? 10  DC  E "C1'" 1 
ATOM   7118 N N1    . DC  E 3 10  ? -33.136 -14.786 1.958   1.00 117.42 ? 10  DC  E N1    1 
ATOM   7119 C C2    . DC  E 3 10  ? -31.799 -15.032 2.326   1.00 114.54 ? 10  DC  E C2    1 
ATOM   7120 O O2    . DC  E 3 10  ? -31.478 -15.022 3.521   1.00 115.29 ? 10  DC  E O2    1 
ATOM   7121 N N3    . DC  E 3 10  ? -30.886 -15.312 1.341   1.00 111.62 ? 10  DC  E N3    1 
ATOM   7122 C C4    . DC  E 3 10  ? -31.242 -15.328 0.039   1.00 110.97 ? 10  DC  E C4    1 
ATOM   7123 N N4    . DC  E 3 10  ? -30.315 -15.589 -0.896  1.00 108.51 ? 10  DC  E N4    1 
ATOM   7124 C C5    . DC  E 3 10  ? -32.587 -15.049 -0.354  1.00 113.71 ? 10  DC  E C5    1 
ATOM   7125 C C6    . DC  E 3 10  ? -33.474 -14.785 0.623   1.00 116.67 ? 10  DC  E C6    1 
ATOM   7126 P P     . DA  E 3 11  ? -37.105 -11.587 5.051   1.00 140.10 ? 11  DA  E P     1 
ATOM   7127 O OP1   . DA  E 3 11  ? -38.497 -12.002 5.389   1.00 145.95 ? 11  DA  E OP1   1 
ATOM   7128 O OP2   . DA  E 3 11  ? -36.881 -10.526 4.028   1.00 138.34 ? 11  DA  E OP2   1 
ATOM   7129 O "O5'" . DA  E 3 11  ? -36.327 -11.165 6.390   1.00 140.10 ? 11  DA  E "O5'" 1 
ATOM   7130 C "C5'" . DA  E 3 11  ? -35.707 -12.114 7.287   1.00 138.58 ? 11  DA  E "C5'" 1 
ATOM   7131 C "C4'" . DA  E 3 11  ? -34.318 -11.664 7.732   1.00 134.88 ? 11  DA  E "C4'" 1 
ATOM   7132 O "O4'" . DA  E 3 11  ? -33.272 -12.016 6.793   1.00 128.73 ? 11  DA  E "O4'" 1 
ATOM   7133 C "C3'" . DA  E 3 11  ? -34.126 -10.185 8.024   1.00 136.10 ? 11  DA  E "C3'" 1 
ATOM   7134 O "O3'" . DA  E 3 11  ? -33.366 -10.069 9.230   1.00 137.16 ? 11  DA  E "O3'" 1 
ATOM   7135 C "C2'" . DA  E 3 11  ? -33.410 -9.655  6.779   1.00 131.02 ? 11  DA  E "C2'" 1 
ATOM   7136 C "C1'" . DA  E 3 11  ? -32.582 -10.861 6.355   1.00 126.35 ? 11  DA  E "C1'" 1 
ATOM   7137 N N9    . DA  E 3 11  ? -32.340 -11.007 4.918   1.00 122.62 ? 11  DA  E N9    1 
ATOM   7138 C C8    . DA  E 3 11  ? -33.242 -10.851 3.897   1.00 123.19 ? 11  DA  E C8    1 
ATOM   7139 N N7    . DA  E 3 11  ? -32.752 -11.099 2.702   1.00 119.94 ? 11  DA  E N7    1 
ATOM   7140 C C5    . DA  E 3 11  ? -31.439 -11.465 2.952   1.00 116.86 ? 11  DA  E C5    1 
ATOM   7141 C C6    . DA  E 3 11  ? -30.366 -11.833 2.101   1.00 113.26 ? 11  DA  E C6    1 
ATOM   7142 N N6    . DA  E 3 11  ? -30.489 -11.921 0.774   1.00 112.53 ? 11  DA  E N6    1 
ATOM   7143 N N1    . DA  E 3 11  ? -29.158 -12.090 2.662   1.00 111.04 ? 11  DA  E N1    1 
ATOM   7144 C C2    . DA  E 3 11  ? -29.021 -11.975 3.994   1.00 112.41 ? 11  DA  E C2    1 
ATOM   7145 N N3    . DA  E 3 11  ? -29.956 -11.656 4.898   1.00 115.95 ? 11  DA  E N3    1 
ATOM   7146 C C4    . DA  E 3 11  ? -31.156 -11.402 4.314   1.00 118.22 ? 11  DA  E C4    1 
ATOM   7147 P P     . DC  E 3 12  ? -33.040 -8.678  9.970   1.00 139.39 ? 12  DC  E P     1 
ATOM   7148 O OP1   . DC  E 3 12  ? -33.066 -8.959  11.426  1.00 144.37 ? 12  DC  E OP1   1 
ATOM   7149 O OP2   . DC  E 3 12  ? -33.843 -7.554  9.404   1.00 141.29 ? 12  DC  E OP2   1 
ATOM   7150 O "O5'" . DC  E 3 12  ? -31.525 -8.476  9.506   1.00 131.73 ? 12  DC  E "O5'" 1 
ATOM   7151 C "C5'" . DC  E 3 12  ? -30.435 -9.264  9.964   1.00 127.07 ? 12  DC  E "C5'" 1 
ATOM   7152 C "C4'" . DC  E 3 12  ? -29.175 -8.726  9.327   1.00 121.23 ? 12  DC  E "C4'" 1 
ATOM   7153 O "O4'" . DC  E 3 12  ? -29.286 -8.888  7.903   1.00 117.39 ? 12  DC  E "O4'" 1 
ATOM   7154 C "C3'" . DC  E 3 12  ? -28.899 -7.244  9.546   1.00 122.44 ? 12  DC  E "C3'" 1 
ATOM   7155 O "O3'" . DC  E 3 12  ? -27.620 -7.154  10.105  1.00 121.47 ? 12  DC  E "O3'" 1 
ATOM   7156 C "C2'" . DC  E 3 12  ? -28.998 -6.579  8.169   1.00 119.90 ? 12  DC  E "C2'" 1 
ATOM   7157 C "C1'" . DC  E 3 12  ? -28.707 -7.769  7.274   1.00 115.81 ? 12  DC  E "C1'" 1 
ATOM   7158 N N1    . DC  E 3 12  ? -29.159 -7.806  5.857   1.00 114.16 ? 12  DC  E N1    1 
ATOM   7159 C C2    . DC  E 3 12  ? -28.223 -8.186  4.863   1.00 111.15 ? 12  DC  E C2    1 
ATOM   7160 O O2    . DC  E 3 12  ? -27.021 -8.351  5.142   1.00 109.90 ? 12  DC  E O2    1 
ATOM   7161 N N3    . DC  E 3 12  ? -28.657 -8.347  3.582   1.00 110.18 ? 12  DC  E N3    1 
ATOM   7162 C C4    . DC  E 3 12  ? -29.957 -8.195  3.288   1.00 112.42 ? 12  DC  E C4    1 
ATOM   7163 N N4    . DC  E 3 12  ? -30.306 -8.327  2.005   1.00 111.81 ? 12  DC  E N4    1 
ATOM   7164 C C5    . DC  E 3 12  ? -30.927 -7.829  4.282   1.00 115.54 ? 12  DC  E C5    1 
ATOM   7165 C C6    . DC  E 3 12  ? -30.493 -7.689  5.545   1.00 116.41 ? 12  DC  E C6    1 
ATOM   7166 P P     . DA  E 3 13  ? -27.071 -5.928  10.970  1.00 125.21 ? 13  DA  E P     1 
ATOM   7167 O OP1   . DA  E 3 13  ? -26.187 -6.563  11.982  1.00 125.44 ? 13  DA  E OP1   1 
ATOM   7168 O OP2   . DA  E 3 13  ? -28.164 -4.992  11.362  1.00 130.08 ? 13  DA  E OP2   1 
ATOM   7169 O "O5'" . DA  E 3 13  ? -26.210 -5.139  9.880   1.00 121.65 ? 13  DA  E "O5'" 1 
ATOM   7170 C "C5'" . DA  E 3 13  ? -25.129 -5.763  9.209   1.00 117.04 ? 13  DA  E "C5'" 1 
ATOM   7171 C "C4'" . DA  E 3 13  ? -24.867 -5.113  7.869   1.00 114.44 ? 13  DA  E "C4'" 1 
ATOM   7172 O "O4'" . DA  E 3 13  ? -25.956 -5.414  6.980   1.00 113.12 ? 13  DA  E "O4'" 1 
ATOM   7173 C "C3'" . DA  E 3 13  ? -24.705 -3.593  7.857   1.00 117.52 ? 13  DA  E "C3'" 1 
ATOM   7174 O "O3'" . DA  E 3 13  ? -23.602 -3.287  7.070   1.00 116.83 ? 13  DA  E "O3'" 1 
ATOM   7175 C "C2'" . DA  E 3 13  ? -25.942 -3.088  7.128   1.00 118.32 ? 13  DA  E "C2'" 1 
ATOM   7176 C "C1'" . DA  E 3 13  ? -26.128 -4.261  6.184   1.00 114.08 ? 13  DA  E "C1'" 1 
ATOM   7177 N N9    . DA  E 3 13  ? -27.346 -4.346  5.384   1.00 113.80 ? 13  DA  E N9    1 
ATOM   7178 C C8    . DA  E 3 13  ? -28.624 -4.053  5.759   1.00 116.64 ? 13  DA  E C8    1 
ATOM   7179 N N7    . DA  E 3 13  ? -29.504 -4.302  4.824   1.00 116.59 ? 13  DA  E N7    1 
ATOM   7180 C C5    . DA  E 3 13  ? -28.759 -4.825  3.780   1.00 112.34 ? 13  DA  E C5    1 
ATOM   7181 C C6    . DA  E 3 13  ? -29.095 -5.262  2.480   1.00 110.35 ? 13  DA  E C6    1 
ATOM   7182 N N6    . DA  E 3 13  ? -30.346 -5.280  2.020   1.00 112.56 ? 13  DA  E N6    1 
ATOM   7183 N N1    . DA  E 3 13  ? -28.113 -5.723  1.678   1.00 107.15 ? 13  DA  E N1    1 
ATOM   7184 C C2    . DA  E 3 13  ? -26.853 -5.708  2.130   1.00 106.08 ? 13  DA  E C2    1 
ATOM   7185 N N3    . DA  E 3 13  ? -26.412 -5.297  3.320   1.00 107.54 ? 13  DA  E N3    1 
ATOM   7186 C C4    . DA  E 3 13  ? -27.422 -4.862  4.107   1.00 110.72 ? 13  DA  E C4    1 
ATOM   7187 P P     . DG  E 3 14  ? -22.302 -2.521  7.555   1.00 119.90 ? 14  DG  E P     1 
ATOM   7188 O OP1   . DG  E 3 14  ? -21.272 -3.583  7.720   1.00 117.82 ? 14  DG  E OP1   1 
ATOM   7189 O OP2   . DG  E 3 14  ? -22.630 -1.605  8.677   1.00 124.30 ? 14  DG  E OP2   1 
ATOM   7190 O "O5'" . DG  E 3 14  ? -22.051 -1.592  6.259   1.00 121.00 ? 14  DG  E "O5'" 1 
ATOM   7191 C "C5'" . DG  E 3 14  ? -21.231 -1.897  5.104   1.00 119.33 ? 14  DG  E "C5'" 1 
ATOM   7192 C "C4'" . DG  E 3 14  ? -21.945 -1.988  3.751   1.00 119.45 ? 14  DG  E "C4'" 1 
ATOM   7193 O "O4'" . DG  E 3 14  ? -23.322 -2.374  3.910   1.00 120.73 ? 14  DG  E "O4'" 1 
ATOM   7194 C "C3'" . DG  E 3 14  ? -22.095 -0.778  2.840   1.00 122.57 ? 14  DG  E "C3'" 1 
ATOM   7195 O "O3'" . DG  E 3 14  ? -20.863 -0.457  2.224   1.00 124.16 ? 14  DG  E "O3'" 1 
ATOM   7196 C "C2'" . DG  E 3 14  ? -23.047 -1.364  1.807   1.00 121.03 ? 14  DG  E "C2'" 1 
ATOM   7197 C "C1'" . DG  E 3 14  ? -23.904 -2.316  2.629   1.00 119.93 ? 14  DG  E "C1'" 1 
ATOM   7198 N N9    . DG  E 3 14  ? -25.339 -2.059  2.741   1.00 121.72 ? 14  DG  E N9    1 
ATOM   7199 C C8    . DG  E 3 14  ? -26.026 -1.688  3.873   1.00 124.69 ? 14  DG  E C8    1 
ATOM   7200 N N7    . DG  E 3 14  ? -27.318 -1.583  3.703   1.00 126.79 ? 14  DG  E N7    1 
ATOM   7201 C C5    . DG  E 3 14  ? -27.508 -1.899  2.366   1.00 124.52 ? 14  DG  E C5    1 
ATOM   7202 C C6    . DG  E 3 14  ? -28.701 -1.961  1.602   1.00 125.59 ? 14  DG  E C6    1 
ATOM   7203 O O6    . DG  E 3 14  ? -29.864 -1.744  1.977   1.00 128.81 ? 14  DG  E O6    1 
ATOM   7204 N N1    . DG  E 3 14  ? -28.455 -2.331  0.275   1.00 123.34 ? 14  DG  E N1    1 
ATOM   7205 C C2    . DG  E 3 14  ? -27.208 -2.594  -0.252  1.00 119.99 ? 14  DG  E C2    1 
ATOM   7206 N N2    . DG  E 3 14  ? -27.153 -2.877  -1.557  1.00 118.83 ? 14  DG  E N2    1 
ATOM   7207 N N3    . DG  E 3 14  ? -26.080 -2.515  0.448   1.00 119.15 ? 14  DG  E N3    1 
ATOM   7208 C C4    . DG  E 3 14  ? -26.301 -2.211  1.760   1.00 121.42 ? 14  DG  E C4    1 
ATOM   7209 P P     . DT  E 3 15  ? -20.457 0.952   1.540   1.00 129.87 ? 15  DT  E P     1 
ATOM   7210 O OP1   . DT  E 3 15  ? -18.974 1.046   1.522   1.00 130.22 ? 15  DT  E OP1   1 
ATOM   7211 O OP2   . DT  E 3 15  ? -21.223 2.109   2.096   1.00 133.34 ? 15  DT  E OP2   1 
ATOM   7212 O "O5'" . DT  E 3 15  ? -20.974 0.652   0.045   1.00 129.16 ? 15  DT  E "O5'" 1 
ATOM   7213 C "C5'" . DT  E 3 15  ? -20.734 -0.543  -0.767  1.00 124.57 ? 15  DT  E "C5'" 1 
ATOM   7214 C "C4'" . DT  E 3 15  ? -21.476 -0.467  -2.107  1.00 124.83 ? 15  DT  E "C4'" 1 
ATOM   7215 O "O4'" . DT  E 3 15  ? -22.875 -0.829  -1.947  1.00 122.95 ? 15  DT  E "O4'" 1 
ATOM   7216 C "C3'" . DT  E 3 15  ? -21.449 0.910   -2.807  1.00 129.92 ? 15  DT  E "C3'" 1 
ATOM   7217 O "O3'" . DT  E 3 15  ? -21.182 0.831   -4.214  1.00 132.10 ? 15  DT  E "O3'" 1 
ATOM   7218 C "C2'" . DT  E 3 15  ? -22.817 1.524   -2.544  1.00 131.01 ? 15  DT  E "C2'" 1 
ATOM   7219 C "C1'" . DT  E 3 15  ? -23.686 0.278   -2.349  1.00 126.41 ? 15  DT  E "C1'" 1 
ATOM   7220 N N1    . DT  E 3 15  ? -24.880 0.485   -1.440  1.00 125.15 ? 15  DT  E N1    1 
ATOM   7221 C C2    . DT  E 3 15  ? -26.162 0.267   -1.927  1.00 124.75 ? 15  DT  E C2    1 
ATOM   7222 O O2    . DT  E 3 15  ? -26.424 -0.094  -3.063  1.00 123.93 ? 15  DT  E O2    1 
ATOM   7223 N N3    . DT  E 3 15  ? -27.159 0.514   -1.010  1.00 126.54 ? 15  DT  E N3    1 
ATOM   7224 C C4    . DT  E 3 15  ? -27.026 0.918   0.313   1.00 127.71 ? 15  DT  E C4    1 
ATOM   7225 O O4    . DT  E 3 15  ? -28.043 1.088   0.982   1.00 130.64 ? 15  DT  E O4    1 
ATOM   7226 C C5    . DT  E 3 15  ? -25.662 1.150   0.753   1.00 126.42 ? 15  DT  E C5    1 
ATOM   7227 C C7    . DT  E 3 15  ? -25.355 1.613   2.150   1.00 127.58 ? 15  DT  E C7    1 
ATOM   7228 C C6    . DT  E 3 15  ? -24.677 0.945   -0.140  1.00 125.18 ? 15  DT  E C6    1 
ATOM   7229 O "O5'" . DT  F 4 1   ? -36.622 10.876  0.124   1.00 162.04 ? 1   DT  F "O5'" 1 
ATOM   7230 C "C5'" . DT  F 4 1   ? -37.268 10.129  1.164   1.00 162.47 ? 1   DT  F "C5'" 1 
ATOM   7231 C "C4'" . DT  F 4 1   ? -36.951 8.639   1.072   1.00 159.70 ? 1   DT  F "C4'" 1 
ATOM   7232 O "O4'" . DT  F 4 1   ? -35.549 8.471   0.759   1.00 156.65 ? 1   DT  F "O4'" 1 
ATOM   7233 C "C3'" . DT  F 4 1   ? -37.188 7.762   2.311   1.00 159.69 ? 1   DT  F "C3'" 1 
ATOM   7234 O "O3'" . DT  F 4 1   ? -38.328 6.860   2.157   1.00 161.53 ? 1   DT  F "O3'" 1 
ATOM   7235 C "C2'" . DT  F 4 1   ? -35.837 7.098   2.608   1.00 155.80 ? 1   DT  F "C2'" 1 
ATOM   7236 C "C1'" . DT  F 4 1   ? -35.160 7.218   1.243   1.00 153.39 ? 1   DT  F "C1'" 1 
ATOM   7237 N N1    . DT  F 4 1   ? -33.673 7.171   1.072   1.00 150.09 ? 1   DT  F N1    1 
ATOM   7238 C C2    . DT  F 4 1   ? -33.182 7.081   -0.228  1.00 148.57 ? 1   DT  F C2    1 
ATOM   7239 O O2    . DT  F 4 1   ? -33.885 7.050   -1.235  1.00 149.03 ? 1   DT  F O2    1 
ATOM   7240 N N3    . DT  F 4 1   ? -31.801 7.032   -0.305  1.00 146.51 ? 1   DT  F N3    1 
ATOM   7241 C C4    . DT  F 4 1   ? -30.878 7.075   0.733   1.00 144.78 ? 1   DT  F C4    1 
ATOM   7242 O O4    . DT  F 4 1   ? -29.678 7.044   0.460   1.00 142.31 ? 1   DT  F O4    1 
ATOM   7243 C C5    . DT  F 4 1   ? -31.463 7.169   2.059   1.00 146.69 ? 1   DT  F C5    1 
ATOM   7244 C C7    . DT  F 4 1   ? -30.602 7.219   3.286   1.00 146.70 ? 1   DT  F C7    1 
ATOM   7245 C C6    . DT  F 4 1   ? -32.806 7.226   2.161   1.00 149.09 ? 1   DT  F C6    1 
ATOM   7246 P P     . DT  F 4 2   ? -38.550 5.479   1.341   1.00 160.63 ? 2   DT  F P     1 
ATOM   7247 O OP1   . DT  F 4 2   ? -40.020 5.359   1.155   1.00 163.21 ? 2   DT  F OP1   1 
ATOM   7248 O OP2   . DT  F 4 2   ? -37.807 4.368   2.008   1.00 158.40 ? 2   DT  F OP2   1 
ATOM   7249 O "O5'" . DT  F 4 2   ? -37.845 5.717   -0.084  1.00 158.25 ? 2   DT  F "O5'" 1 
ATOM   7250 C "C5'" . DT  F 4 2   ? -38.528 5.994   -1.312  1.00 158.20 ? 2   DT  F "C5'" 1 
ATOM   7251 C "C4'" . DT  F 4 2   ? -38.048 5.059   -2.416  1.00 154.80 ? 2   DT  F "C4'" 1 
ATOM   7252 O "O4'" . DT  F 4 2   ? -36.603 4.938   -2.414  1.00 151.15 ? 2   DT  F "O4'" 1 
ATOM   7253 C "C3'" . DT  F 4 2   ? -38.576 3.627   -2.416  1.00 153.83 ? 2   DT  F "C3'" 1 
ATOM   7254 O "O3'" . DT  F 4 2   ? -38.854 3.289   -3.798  1.00 154.49 ? 2   DT  F "O3'" 1 
ATOM   7255 C "C2'" . DT  F 4 2   ? -37.448 2.829   -1.743  1.00 150.45 ? 2   DT  F "C2'" 1 
ATOM   7256 C "C1'" . DT  F 4 2   ? -36.217 3.586   -2.238  1.00 148.10 ? 2   DT  F "C1'" 1 
ATOM   7257 N N1    . DT  F 4 2   ? -34.989 3.594   -1.379  1.00 144.08 ? 2   DT  F N1    1 
ATOM   7258 C C2    . DT  F 4 2   ? -33.755 3.763   -1.995  1.00 141.12 ? 2   DT  F C2    1 
ATOM   7259 O O2    . DT  F 4 2   ? -33.591 3.838   -3.204  1.00 140.79 ? 2   DT  F O2    1 
ATOM   7260 N N3    . DT  F 4 2   ? -32.693 3.824   -1.120  1.00 139.32 ? 2   DT  F N3    1 
ATOM   7261 C C4    . DT  F 4 2   ? -32.734 3.752   0.271   1.00 139.46 ? 2   DT  F C4    1 
ATOM   7262 O O4    . DT  F 4 2   ? -31.689 3.820   0.907   1.00 138.32 ? 2   DT  F O4    1 
ATOM   7263 C C5    . DT  F 4 2   ? -34.049 3.597   0.854   1.00 142.00 ? 2   DT  F C5    1 
ATOM   7264 C C7    . DT  F 4 2   ? -34.218 3.509   2.347   1.00 143.01 ? 2   DT  F C7    1 
ATOM   7265 C C6    . DT  F 4 2   ? -35.101 3.552   0.013   1.00 143.96 ? 2   DT  F C6    1 
ATOM   7266 P P     . DA  F 4 3   ? -38.785 1.856   -4.522  1.00 153.99 ? 3   DA  F P     1 
ATOM   7267 O OP1   . DA  F 4 3   ? -39.549 1.982   -5.796  1.00 156.63 ? 3   DA  F OP1   1 
ATOM   7268 O OP2   . DA  F 4 3   ? -39.122 0.784   -3.544  1.00 154.01 ? 3   DA  F OP2   1 
ATOM   7269 O "O5'" . DA  F 4 3   ? -37.222 1.682   -4.859  1.00 149.90 ? 3   DA  F "O5'" 1 
ATOM   7270 C "C5'" . DA  F 4 3   ? -36.556 2.210   -6.023  1.00 148.00 ? 3   DA  F "C5'" 1 
ATOM   7271 C "C4'" . DA  F 4 3   ? -35.387 1.329   -6.456  1.00 144.29 ? 3   DA  F "C4'" 1 
ATOM   7272 O "O4'" . DA  F 4 3   ? -34.278 1.507   -5.538  1.00 140.83 ? 3   DA  F "O4'" 1 
ATOM   7273 C "C3'" . DA  F 4 3   ? -35.672 -0.171  -6.544  1.00 143.58 ? 3   DA  F "C3'" 1 
ATOM   7274 O "O3'" . DA  F 4 3   ? -35.292 -0.719  -7.822  1.00 143.98 ? 3   DA  F "O3'" 1 
ATOM   7275 C "C2'" . DA  F 4 3   ? -34.923 -0.757  -5.344  1.00 141.37 ? 3   DA  F "C2'" 1 
ATOM   7276 C "C1'" . DA  F 4 3   ? -33.795 0.247   -5.120  1.00 139.08 ? 3   DA  F "C1'" 1 
ATOM   7277 N N9    . DA  F 4 3   ? -33.358 0.327   -3.727  1.00 136.29 ? 3   DA  F N9    1 
ATOM   7278 C C8    . DA  F 4 3   ? -34.163 0.376   -2.620  1.00 136.46 ? 3   DA  F C8    1 
ATOM   7279 N N7    . DA  F 4 3   ? -33.512 0.407   -1.483  1.00 135.19 ? 3   DA  F N7    1 
ATOM   7280 C C5    . DA  F 4 3   ? -32.175 0.384   -1.853  1.00 133.54 ? 3   DA  F C5    1 
ATOM   7281 C C6    . DA  F 4 3   ? -30.962 0.392   -1.099  1.00 131.48 ? 3   DA  F C6    1 
ATOM   7282 N N6    . DA  F 4 3   ? -30.903 0.417   0.240   1.00 131.13 ? 3   DA  F N6    1 
ATOM   7283 N N1    . DA  F 4 3   ? -29.797 0.349   -1.785  1.00 130.17 ? 3   DA  F N1    1 
ATOM   7284 C C2    . DA  F 4 3   ? -29.836 0.278   -3.128  1.00 131.09 ? 3   DA  F C2    1 
ATOM   7285 N N3    . DA  F 4 3   ? -30.901 0.276   -3.947  1.00 133.05 ? 3   DA  F N3    1 
ATOM   7286 C C4    . DA  F 4 3   ? -32.061 0.316   -3.244  1.00 134.12 ? 3   DA  F C4    1 
ATOM   7287 P P     . DC  F 4 4   ? -35.338 -2.289  -8.211  1.00 144.97 ? 4   DC  F P     1 
ATOM   7288 O OP1   . DC  F 4 4   ? -35.427 -2.367  -9.686  1.00 148.60 ? 4   DC  F OP1   1 
ATOM   7289 O OP2   . DC  F 4 4   ? -36.292 -3.046  -7.363  1.00 145.29 ? 4   DC  F OP2   1 
ATOM   7290 O "O5'" . DC  F 4 4   ? -33.900 -2.863  -7.797  1.00 140.89 ? 4   DC  F "O5'" 1 
ATOM   7291 C "C5'" . DC  F 4 4   ? -32.699 -2.150  -8.125  1.00 137.51 ? 4   DC  F "C5'" 1 
ATOM   7292 C "C4'" . DC  F 4 4   ? -31.496 -2.740  -7.419  1.00 133.49 ? 4   DC  F "C4'" 1 
ATOM   7293 O "O4'" . DC  F 4 4   ? -31.439 -2.332  -6.034  1.00 130.21 ? 4   DC  F "O4'" 1 
ATOM   7294 C "C3'" . DC  F 4 4   ? -31.429 -4.260  -7.442  1.00 133.57 ? 4   DC  F "C3'" 1 
ATOM   7295 O "O3'" . DC  F 4 4   ? -30.223 -4.612  -8.078  1.00 132.97 ? 4   DC  F "O3'" 1 
ATOM   7296 C "C2'" . DC  F 4 4   ? -31.484 -4.663  -5.974  1.00 131.76 ? 4   DC  F "C2'" 1 
ATOM   7297 C "C1'" . DC  F 4 4   ? -30.941 -3.416  -5.294  1.00 128.76 ? 4   DC  F "C1'" 1 
ATOM   7298 N N1    . DC  F 4 4   ? -31.276 -3.241  -3.849  1.00 127.02 ? 4   DC  F N1    1 
ATOM   7299 C C2    . DC  F 4 4   ? -30.230 -3.028  -2.925  1.00 124.79 ? 4   DC  F C2    1 
ATOM   7300 O O2    . DC  F 4 4   ? -29.059 -2.967  -3.332  1.00 123.50 ? 4   DC  F O2    1 
ATOM   7301 N N3    . DC  F 4 4   ? -30.542 -2.835  -1.602  1.00 124.79 ? 4   DC  F N3    1 
ATOM   7302 C C4    . DC  F 4 4   ? -31.826 -2.866  -1.188  1.00 126.63 ? 4   DC  F C4    1 
ATOM   7303 N N4    . DC  F 4 4   ? -32.090 -2.664  0.113   1.00 126.95 ? 4   DC  F N4    1 
ATOM   7304 C C5    . DC  F 4 4   ? -32.902 -3.068  -2.118  1.00 128.20 ? 4   DC  F C5    1 
ATOM   7305 C C6    . DC  F 4 4   ? -32.585 -3.241  -3.418  1.00 128.43 ? 4   DC  F C6    1 
ATOM   7306 P P     . DT  F 4 5   ? -29.803 -6.071  -8.570  1.00 136.19 ? 5   DT  F P     1 
ATOM   7307 O OP1   . DT  F 4 5   ? -29.243 -5.907  -9.931  1.00 140.64 ? 5   DT  F OP1   1 
ATOM   7308 O OP2   . DT  F 4 5   ? -30.894 -7.034  -8.272  1.00 136.11 ? 5   DT  F OP2   1 
ATOM   7309 O "O5'" . DT  F 4 5   ? -28.590 -6.426  -7.602  1.00 126.61 ? 5   DT  F "O5'" 1 
ATOM   7310 C "C5'" . DT  F 4 5   ? -27.488 -5.559  -7.394  1.00 124.99 ? 5   DT  F "C5'" 1 
ATOM   7311 C "C4'" . DT  F 4 5   ? -26.786 -5.984  -6.125  1.00 119.03 ? 5   DT  F "C4'" 1 
ATOM   7312 O "O4'" . DT  F 4 5   ? -27.602 -5.700  -4.970  1.00 118.70 ? 5   DT  F "O4'" 1 
ATOM   7313 C "C3'" . DT  F 4 5   ? -26.535 -7.484  -6.051  1.00 115.69 ? 5   DT  F "C3'" 1 
ATOM   7314 O "O3'" . DT  F 4 5   ? -25.164 -7.689  -5.838  1.00 112.96 ? 5   DT  F "O3'" 1 
ATOM   7315 C "C2'" . DT  F 4 5   ? -27.416 -8.000  -4.913  1.00 113.49 ? 5   DT  F "C2'" 1 
ATOM   7316 C "C1'" . DT  F 4 5   ? -27.448 -6.754  -4.048  1.00 114.04 ? 5   DT  F "C1'" 1 
ATOM   7317 N N1    . DT  F 4 5   ? -28.522 -6.652  -3.031  1.00 115.25 ? 5   DT  F N1    1 
ATOM   7318 C C2    . DT  F 4 5   ? -28.191 -6.288  -1.729  1.00 114.32 ? 5   DT  F C2    1 
ATOM   7319 O O2    . DT  F 4 5   ? -27.042 -6.123  -1.328  1.00 112.43 ? 5   DT  F O2    1 
ATOM   7320 N N3    . DT  F 4 5   ? -29.279 -6.138  -0.890  1.00 116.43 ? 5   DT  F N3    1 
ATOM   7321 C C4    . DT  F 4 5   ? -30.622 -6.279  -1.221  1.00 119.73 ? 5   DT  F C4    1 
ATOM   7322 O O4    . DT  F 4 5   ? -31.480 -6.116  -0.358  1.00 122.50 ? 5   DT  F O4    1 
ATOM   7323 C C5    . DT  F 4 5   ? -30.891 -6.622  -2.600  1.00 120.87 ? 5   DT  F C5    1 
ATOM   7324 C C7    . DT  F 4 5   ? -32.292 -6.838  -3.081  1.00 125.37 ? 5   DT  F C7    1 
ATOM   7325 C C6    . DT  F 4 5   ? -29.846 -6.782  -3.427  1.00 118.84 ? 5   DT  F C6    1 
ATOM   7326 P P     . DG  F 4 6   ? -24.401 -8.735  -6.761  1.00 112.37 ? 6   DG  F P     1 
ATOM   7327 O OP1   . DG  F 4 6   ? -24.203 -8.107  -8.091  1.00 116.89 ? 6   DG  F OP1   1 
ATOM   7328 O OP2   . DG  F 4 6   ? -25.090 -10.056 -6.586  1.00 111.31 ? 6   DG  F OP2   1 
ATOM   7329 O "O5'" . DG  F 4 6   ? -22.973 -8.736  -6.027  1.00 107.47 ? 6   DG  F "O5'" 1 
ATOM   7330 C "C5'" . DG  F 4 6   ? -22.498 -9.949  -5.484  1.00 101.86 ? 6   DG  F "C5'" 1 
ATOM   7331 C "C4'" . DG  F 4 6   ? -22.095 -9.845  -4.031  1.00 97.49  ? 6   DG  F "C4'" 1 
ATOM   7332 O "O4'" . DG  F 4 6   ? -23.121 -9.295  -3.181  1.00 97.73  ? 6   DG  F "O4'" 1 
ATOM   7333 C "C3'" . DG  F 4 6   ? -21.737 -11.186 -3.431  1.00 94.35  ? 6   DG  F "C3'" 1 
ATOM   7334 O "O3'" . DG  F 4 6   ? -20.552 -10.987 -2.719  1.00 92.63  ? 6   DG  F "O3'" 1 
ATOM   7335 C "C2'" . DG  F 4 6   ? -22.899 -11.524 -2.509  1.00 94.30  ? 6   DG  F "C2'" 1 
ATOM   7336 C "C1'" . DG  F 4 6   ? -23.405 -10.161 -2.104  1.00 96.05  ? 6   DG  F "C1'" 1 
ATOM   7337 N N9    . DG  F 4 6   ? -24.842 -10.119 -1.883  1.00 99.14  ? 6   DG  F N9    1 
ATOM   7338 C C8    . DG  F 4 6   ? -25.830 -10.293 -2.824  1.00 101.85 ? 6   DG  F C8    1 
ATOM   7339 N N7    . DG  F 4 6   ? -27.031 -10.124 -2.340  1.00 104.51 ? 6   DG  F N7    1 
ATOM   7340 C C5    . DG  F 4 6   ? -26.838 -9.801  -1.002  1.00 103.66 ? 6   DG  F C5    1 
ATOM   7341 C C6    . DG  F 4 6   ? -27.776 -9.535  0.036   1.00 106.04 ? 6   DG  F C6    1 
ATOM   7342 O O6    . DG  F 4 6   ? -29.009 -9.484  -0.054  1.00 109.58 ? 6   DG  F O6    1 
ATOM   7343 N N1    . DG  F 4 6   ? -27.170 -9.300  1.275   1.00 105.19 ? 6   DG  F N1    1 
ATOM   7344 C C2    . DG  F 4 6   ? -25.802 -9.309  1.482   1.00 103.07 ? 6   DG  F C2    1 
ATOM   7345 N N2    . DG  F 4 6   ? -25.356 -9.081  2.730   1.00 103.65 ? 6   DG  F N2    1 
ATOM   7346 N N3    . DG  F 4 6   ? -24.918 -9.565  0.515   1.00 101.34 ? 6   DG  F N3    1 
ATOM   7347 C C4    . DG  F 4 6   ? -25.492 -9.800  -0.703  1.00 101.09 ? 6   DG  F C4    1 
ATOM   7348 P P     . DT  F 4 7   ? -19.606 -12.122 -2.165  1.00 90.70  ? 7   DT  F P     1 
ATOM   7349 O OP1   . DT  F 4 7   ? -18.320 -11.398 -2.082  1.00 91.49  ? 7   DT  F OP1   1 
ATOM   7350 O OP2   . DT  F 4 7   ? -19.709 -13.390 -2.939  1.00 90.73  ? 7   DT  F OP2   1 
ATOM   7351 O "O5'" . DT  F 4 7   ? -20.249 -12.493 -0.739  1.00 89.26  ? 7   DT  F "O5'" 1 
ATOM   7352 C "C5'" . DT  F 4 7   ? -20.021 -11.785 0.472   1.00 88.57  ? 7   DT  F "C5'" 1 
ATOM   7353 C "C4'" . DT  F 4 7   ? -21.045 -12.133 1.540   1.00 87.87  ? 7   DT  F "C4'" 1 
ATOM   7354 O "O4'" . DT  F 4 7   ? -22.392 -11.968 1.061   1.00 86.70  ? 7   DT  F "O4'" 1 
ATOM   7355 C "C3'" . DT  F 4 7   ? -20.986 -13.541 2.110   1.00 87.99  ? 7   DT  F "C3'" 1 
ATOM   7356 O "O3'" . DT  F 4 7   ? -20.514 -13.524 3.454   1.00 91.45  ? 7   DT  F "O3'" 1 
ATOM   7357 C "C2'" . DT  F 4 7   ? -22.420 -14.048 2.071   1.00 87.45  ? 7   DT  F "C2'" 1 
ATOM   7358 C "C1'" . DT  F 4 7   ? -23.207 -12.770 1.880   1.00 87.39  ? 7   DT  F "C1'" 1 
ATOM   7359 N N1    . DT  F 4 7   ? -24.543 -12.918 1.220   1.00 88.34  ? 7   DT  F N1    1 
ATOM   7360 C C2    . DT  F 4 7   ? -25.699 -12.574 1.915   1.00 90.90  ? 7   DT  F C2    1 
ATOM   7361 O O2    . DT  F 4 7   ? -25.708 -12.193 3.085   1.00 92.13  ? 7   DT  F O2    1 
ATOM   7362 N N3    . DT  F 4 7   ? -26.860 -12.665 1.153   1.00 92.57  ? 7   DT  F N3    1 
ATOM   7363 C C4    . DT  F 4 7   ? -26.981 -13.113 -0.167  1.00 92.81  ? 7   DT  F C4    1 
ATOM   7364 O O4    . DT  F 4 7   ? -28.100 -13.179 -0.685  1.00 96.41  ? 7   DT  F O4    1 
ATOM   7365 C C5    . DT  F 4 7   ? -25.733 -13.495 -0.808  1.00 89.14  ? 7   DT  F C5    1 
ATOM   7366 C C7    . DT  F 4 7   ? -25.679 -13.971 -2.225  1.00 89.05  ? 7   DT  F C7    1 
ATOM   7367 C C6    . DT  F 4 7   ? -24.607 -13.371 -0.095  1.00 87.64  ? 7   DT  F C6    1 
ATOM   7368 P P     . DG  F 4 8   ? -19.688 -14.798 3.964   1.00 93.52  ? 8   DG  F P     1 
ATOM   7369 O OP1   . DG  F 4 8   ? -18.496 -14.366 4.740   1.00 96.47  ? 8   DG  F OP1   1 
ATOM   7370 O OP2   . DG  F 4 8   ? -19.549 -15.733 2.793   1.00 91.14  ? 8   DG  F OP2   1 
ATOM   7371 O "O5'" . DG  F 4 8   ? -20.680 -15.467 5.032   1.00 94.68  ? 8   DG  F "O5'" 1 
ATOM   7372 C "C5'" . DG  F 4 8   ? -21.299 -14.883 6.164   1.00 95.94  ? 8   DG  F "C5'" 1 
ATOM   7373 C "C4'" . DG  F 4 8   ? -22.559 -15.659 6.497   1.00 96.89  ? 8   DG  F "C4'" 1 
ATOM   7374 O "O4'" . DG  F 4 8   ? -23.525 -15.450 5.447   1.00 94.65  ? 8   DG  F "O4'" 1 
ATOM   7375 C "C3'" . DG  F 4 8   ? -22.432 -17.169 6.589   1.00 99.76  ? 8   DG  F "C3'" 1 
ATOM   7376 O "O3'" . DG  F 4 8   ? -23.198 -17.625 7.675   1.00 105.66 ? 8   DG  F "O3'" 1 
ATOM   7377 C "C2'" . DG  F 4 8   ? -23.061 -17.691 5.303   1.00 97.11  ? 8   DG  F "C2'" 1 
ATOM   7378 C "C1'" . DG  F 4 8   ? -24.156 -16.665 5.129   1.00 96.11  ? 8   DG  F "C1'" 1 
ATOM   7379 N N9    . DG  F 4 8   ? -24.812 -16.602 3.825   1.00 95.10  ? 8   DG  F N9    1 
ATOM   7380 C C8    . DG  F 4 8   ? -24.295 -16.940 2.599   1.00 93.55  ? 8   DG  F C8    1 
ATOM   7381 N N7    . DG  F 4 8   ? -25.128 -16.756 1.612   1.00 93.72  ? 8   DG  F N7    1 
ATOM   7382 C C5    . DG  F 4 8   ? -26.294 -16.302 2.213   1.00 94.92  ? 8   DG  F C5    1 
ATOM   7383 C C6    . DG  F 4 8   ? -27.552 -15.950 1.642   1.00 95.89  ? 8   DG  F C6    1 
ATOM   7384 O O6    . DG  F 4 8   ? -27.894 -15.985 0.447   1.00 95.67  ? 8   DG  F O6    1 
ATOM   7385 N N1    . DG  F 4 8   ? -28.467 -15.525 2.619   1.00 98.35  ? 8   DG  F N1    1 
ATOM   7386 C C2    . DG  F 4 8   ? -28.189 -15.447 3.972   1.00 99.06  ? 8   DG  F C2    1 
ATOM   7387 N N2    . DG  F 4 8   ? -29.191 -15.085 4.774   1.00 101.68 ? 8   DG  F N2    1 
ATOM   7388 N N3    . DG  F 4 8   ? -27.003 -15.723 4.506   1.00 98.20  ? 8   DG  F N3    1 
ATOM   7389 C C4    . DG  F 4 8   ? -26.107 -16.177 3.579   1.00 96.04  ? 8   DG  F C4    1 
ATOM   7390 P P     . DG  F 4 9   ? -22.581 -18.607 8.771   1.00 112.19 ? 9   DG  F P     1 
ATOM   7391 O OP1   . DG  F 4 9   ? -21.338 -17.944 9.237   1.00 114.12 ? 9   DG  F OP1   1 
ATOM   7392 O OP2   . DG  F 4 9   ? -22.572 -20.006 8.258   1.00 112.09 ? 9   DG  F OP2   1 
ATOM   7393 O "O5'" . DG  F 4 9   ? -23.648 -18.504 9.955   1.00 117.46 ? 9   DG  F "O5'" 1 
ATOM   7394 C "C5'" . DG  F 4 9   ? -24.705 -17.544 9.978   1.00 117.09 ? 9   DG  F "C5'" 1 
ATOM   7395 C "C4'" . DG  F 4 9   ? -26.073 -18.196 9.889   1.00 119.27 ? 9   DG  F "C4'" 1 
ATOM   7396 O "O4'" . DG  F 4 9   ? -26.663 -18.016 8.581   1.00 115.28 ? 9   DG  F "O4'" 1 
ATOM   7397 C "C3'" . DG  F 4 9   ? -26.190 -19.670 10.265  1.00 124.00 ? 9   DG  F "C3'" 1 
ATOM   7398 O "O3'" . DG  F 4 9   ? -27.018 -19.741 11.414  1.00 130.54 ? 9   DG  F "O3'" 1 
ATOM   7399 C "C2'" . DG  F 4 9   ? -26.767 -20.350 9.023   1.00 121.41 ? 9   DG  F "C2'" 1 
ATOM   7400 C "C1'" . DG  F 4 9   ? -27.357 -19.194 8.213   1.00 117.14 ? 9   DG  F "C1'" 1 
ATOM   7401 N N9    . DG  F 4 9   ? -27.243 -19.316 6.755   1.00 113.16 ? 9   DG  F N9    1 
ATOM   7402 C C8    . DG  F 4 9   ? -26.135 -19.699 6.017   1.00 110.31 ? 9   DG  F C8    1 
ATOM   7403 N N7    . DG  F 4 9   ? -26.311 -19.641 4.726   1.00 107.61 ? 9   DG  F N7    1 
ATOM   7404 C C5    . DG  F 4 9   ? -27.616 -19.181 4.583   1.00 108.34 ? 9   DG  F C5    1 
ATOM   7405 C C6    . DG  F 4 9   ? -28.381 -18.931 3.410   1.00 107.22 ? 9   DG  F C6    1 
ATOM   7406 O O6    . DG  F 4 9   ? -28.046 -19.047 2.229   1.00 105.20 ? 9   DG  F O6    1 
ATOM   7407 N N1    . DG  F 4 9   ? -29.667 -18.476 3.704   1.00 110.15 ? 9   DG  F N1    1 
ATOM   7408 C C2    . DG  F 4 9   ? -30.155 -18.266 4.981   1.00 112.93 ? 9   DG  F C2    1 
ATOM   7409 N N2    . DG  F 4 9   ? -31.418 -17.822 5.053   1.00 115.95 ? 9   DG  F N2    1 
ATOM   7410 N N3    . DG  F 4 9   ? -29.453 -18.491 6.097   1.00 113.27 ? 9   DG  F N3    1 
ATOM   7411 C C4    . DG  F 4 9   ? -28.198 -18.951 5.826   1.00 111.45 ? 9   DG  F C4    1 
ATOM   7412 P P     . DG  F 4 10  ? -27.555 -21.062 12.138  1.00 138.30 ? 10  DG  F P     1 
ATOM   7413 O OP1   . DG  F 4 10  ? -27.889 -20.682 13.533  1.00 144.84 ? 10  DG  F OP1   1 
ATOM   7414 O OP2   . DG  F 4 10  ? -26.629 -22.197 11.890  1.00 139.42 ? 10  DG  F OP2   1 
ATOM   7415 O "O5'" . DG  F 4 10  ? -28.907 -21.342 11.330  1.00 136.87 ? 10  DG  F "O5'" 1 
ATOM   7416 C "C5'" . DG  F 4 10  ? -29.994 -20.444 11.158  1.00 135.20 ? 10  DG  F "C5'" 1 
ATOM   7417 C "C4'" . DG  F 4 10  ? -31.061 -21.103 10.292  1.00 136.40 ? 10  DG  F "C4'" 1 
ATOM   7418 O "O4'" . DG  F 4 10  ? -30.778 -20.922 8.884   1.00 130.87 ? 10  DG  F "O4'" 1 
ATOM   7419 C "C3'" . DG  F 4 10  ? -31.324 -22.604 10.490  1.00 143.15 ? 10  DG  F "C3'" 1 
ATOM   7420 O "O3'" . DG  F 4 10  ? -32.727 -22.823 10.422  1.00 148.03 ? 10  DG  F "O3'" 1 
ATOM   7421 C "C2'" . DG  F 4 10  ? -30.623 -23.245 9.298   1.00 139.54 ? 10  DG  F "C2'" 1 
ATOM   7422 C "C1'" . DG  F 4 10  ? -30.886 -22.179 8.243   1.00 133.33 ? 10  DG  F "C1'" 1 
ATOM   7423 N N9    . DG  F 4 10  ? -29.996 -22.265 7.094   1.00 128.70 ? 10  DG  F N9    1 
ATOM   7424 C C8    . DG  F 4 10  ? -28.665 -22.602 7.090   1.00 126.84 ? 10  DG  F C8    1 
ATOM   7425 N N7    . DG  F 4 10  ? -28.147 -22.631 5.896   1.00 123.68 ? 10  DG  F N7    1 
ATOM   7426 C C5    . DG  F 4 10  ? -29.208 -22.347 5.050   1.00 123.58 ? 10  DG  F C5    1 
ATOM   7427 C C6    . DG  F 4 10  ? -29.257 -22.269 3.632   1.00 121.90 ? 10  DG  F C6    1 
ATOM   7428 O O6    . DG  F 4 10  ? -28.329 -22.420 2.824   1.00 119.50 ? 10  DG  F O6    1 
ATOM   7429 N N1    . DG  F 4 10  ? -30.542 -21.963 3.168   1.00 124.20 ? 10  DG  F N1    1 
ATOM   7430 C C2    . DG  F 4 10  ? -31.644 -21.747 3.978   1.00 127.52 ? 10  DG  F C2    1 
ATOM   7431 N N2    . DG  F 4 10  ? -32.796 -21.445 3.359   1.00 130.03 ? 10  DG  F N2    1 
ATOM   7432 N N3    . DG  F 4 10  ? -31.605 -21.811 5.309   1.00 128.84 ? 10  DG  F N3    1 
ATOM   7433 C C4    . DG  F 4 10  ? -30.361 -22.116 5.776   1.00 126.78 ? 10  DG  F C4    1 
ATOM   7434 P P     . DA  F 4 11  ? -33.562 -24.133 10.819  1.00 142.23 ? 11  DA  F P     1 
ATOM   7435 O OP1   . DA  F 4 11  ? -33.654 -24.144 12.298  1.00 144.62 ? 11  DA  F OP1   1 
ATOM   7436 O OP2   . DA  F 4 11  ? -33.061 -25.333 10.106  1.00 138.68 ? 11  DA  F OP2   1 
ATOM   7437 O "O5'" . DA  F 4 11  ? -34.987 -23.774 10.173  1.00 145.66 ? 11  DA  F "O5'" 1 
ATOM   7438 C "C5'" . DA  F 4 11  ? -35.177 -22.777 9.153   1.00 147.22 ? 11  DA  F "C5'" 1 
ATOM   7439 C "C4'" . DA  F 4 11  ? -35.692 -23.361 7.850   1.00 146.98 ? 11  DA  F "C4'" 1 
ATOM   7440 O "O4'" . DA  F 4 11  ? -34.658 -23.401 6.839   1.00 144.13 ? 11  DA  F "O4'" 1 
ATOM   7441 C "C3'" . DA  F 4 11  ? -36.297 -24.758 7.901   1.00 146.71 ? 11  DA  F "C3'" 1 
ATOM   7442 O "O3'" . DA  F 4 11  ? -37.586 -24.717 7.262   1.00 150.38 ? 11  DA  F "O3'" 1 
ATOM   7443 C "C2'" . DA  F 4 11  ? -35.241 -25.635 7.217   1.00 141.90 ? 11  DA  F "C2'" 1 
ATOM   7444 C "C1'" . DA  F 4 11  ? -34.673 -24.663 6.197   1.00 141.65 ? 11  DA  F "C1'" 1 
ATOM   7445 N N9    . DA  F 4 11  ? -33.323 -24.984 5.728   1.00 138.25 ? 11  DA  F N9    1 
ATOM   7446 C C8    . DA  F 4 11  ? -32.233 -25.333 6.488   1.00 135.51 ? 11  DA  F C8    1 
ATOM   7447 N N7    . DA  F 4 11  ? -31.146 -25.568 5.795   1.00 132.73 ? 11  DA  F N7    1 
ATOM   7448 C C5    . DA  F 4 11  ? -31.541 -25.319 4.490   1.00 134.12 ? 11  DA  F C5    1 
ATOM   7449 C C6    . DA  F 4 11  ? -30.843 -25.364 3.263   1.00 133.45 ? 11  DA  F C6    1 
ATOM   7450 N N6    . DA  F 4 11  ? -29.541 -25.671 3.205   1.00 131.34 ? 11  DA  F N6    1 
ATOM   7451 N N1    . DA  F 4 11  ? -31.518 -25.055 2.122   1.00 135.57 ? 11  DA  F N1    1 
ATOM   7452 C C2    . DA  F 4 11  ? -32.815 -24.718 2.205   1.00 138.53 ? 11  DA  F C2    1 
ATOM   7453 N N3    . DA  F 4 11  ? -33.576 -24.641 3.302   1.00 139.83 ? 11  DA  F N3    1 
ATOM   7454 C C4    . DA  F 4 11  ? -32.878 -24.954 4.422   1.00 137.42 ? 11  DA  F C4    1 
ATOM   7455 P P     . DA  F 4 12  ? -38.466 -25.971 6.796   1.00 150.67 ? 12  DA  F P     1 
ATOM   7456 O OP1   . DA  F 4 12  ? -39.876 -25.502 6.813   1.00 156.34 ? 12  DA  F OP1   1 
ATOM   7457 O OP2   . DA  F 4 12  ? -38.041 -27.190 7.548   1.00 148.36 ? 12  DA  F OP2   1 
ATOM   7458 O "O5'" . DA  F 4 12  ? -38.017 -26.189 5.272   1.00 147.51 ? 12  DA  F "O5'" 1 
ATOM   7459 C "C5'" . DA  F 4 12  ? -38.422 -25.390 4.148   1.00 149.23 ? 12  DA  F "C5'" 1 
ATOM   7460 C "C4'" . DA  F 4 12  ? -37.932 -26.027 2.849   1.00 146.18 ? 12  DA  F "C4'" 1 
ATOM   7461 O "O4'" . DA  F 4 12  ? -36.498 -26.274 2.909   1.00 141.68 ? 12  DA  F "O4'" 1 
ATOM   7462 C "C3'" . DA  F 4 12  ? -38.570 -27.366 2.462   1.00 145.43 ? 12  DA  F "C3'" 1 
ATOM   7463 O "O3'" . DA  F 4 12  ? -39.000 -27.344 1.094   1.00 146.63 ? 12  DA  F "O3'" 1 
ATOM   7464 C "C2'" . DA  F 4 12  ? -37.470 -28.402 2.712   1.00 140.99 ? 12  DA  F "C2'" 1 
ATOM   7465 C "C1'" . DA  F 4 12  ? -36.227 -27.574 2.408   1.00 138.75 ? 12  DA  F "C1'" 1 
ATOM   7466 N N9    . DA  F 4 12  ? -34.964 -28.055 2.969   1.00 134.97 ? 12  DA  F N9    1 
ATOM   7467 C C8    . DA  F 4 12  ? -34.716 -28.440 4.264   1.00 134.61 ? 12  DA  F C8    1 
ATOM   7468 N N7    . DA  F 4 12  ? -33.470 -28.782 4.500   1.00 131.57 ? 12  DA  F N7    1 
ATOM   7469 C C5    . DA  F 4 12  ? -32.848 -28.574 3.282   1.00 129.57 ? 12  DA  F C5    1 
ATOM   7470 C C6    . DA  F 4 12  ? -31.509 -28.729 2.875   1.00 126.35 ? 12  DA  F C6    1 
ATOM   7471 N N6    . DA  F 4 12  ? -30.563 -29.165 3.708   1.00 124.59 ? 12  DA  F N6    1 
ATOM   7472 N N1    . DA  F 4 12  ? -31.203 -28.465 1.581   1.00 126.04 ? 12  DA  F N1    1 
ATOM   7473 C C2    . DA  F 4 12  ? -32.173 -28.033 0.758   1.00 128.52 ? 12  DA  F C2    1 
ATOM   7474 N N3    . DA  F 4 12  ? -33.465 -27.820 1.032   1.00 131.12 ? 12  DA  F N3    1 
ATOM   7475 C C4    . DA  F 4 12  ? -33.746 -28.120 2.322   1.00 131.70 ? 12  DA  F C4    1 
ATOM   7476 P P     . DA  F 4 13  ? -40.037 -28.405 0.461   1.00 148.71 ? 13  DA  F P     1 
ATOM   7477 O OP1   . DA  F 4 13  ? -41.084 -27.580 -0.198  1.00 153.11 ? 13  DA  F OP1   1 
ATOM   7478 O OP2   . DA  F 4 13  ? -40.404 -29.472 1.438   1.00 148.80 ? 13  DA  F OP2   1 
ATOM   7479 O "O5'" . DA  F 4 13  ? -39.184 -29.183 -0.663  1.00 144.40 ? 13  DA  F "O5'" 1 
ATOM   7480 C "C5'" . DA  F 4 13  ? -38.593 -28.477 -1.769  1.00 141.86 ? 13  DA  F "C5'" 1 
ATOM   7481 C "C4'" . DA  F 4 13  ? -37.350 -29.174 -2.279  1.00 135.36 ? 13  DA  F "C4'" 1 
ATOM   7482 O "O4'" . DA  F 4 13  ? -36.418 -29.364 -1.194  1.00 130.76 ? 13  DA  F "O4'" 1 
ATOM   7483 C "C3'" . DA  F 4 13  ? -37.564 -30.541 -2.910  1.00 133.88 ? 13  DA  F "C3'" 1 
ATOM   7484 O "O3'" . DA  F 4 13  ? -37.244 -30.382 -4.285  1.00 134.92 ? 13  DA  F "O3'" 1 
ATOM   7485 C "C2'" . DA  F 4 13  ? -36.612 -31.478 -2.152  1.00 129.76 ? 13  DA  F "C2'" 1 
ATOM   7486 C "C1'" . DA  F 4 13  ? -35.654 -30.526 -1.442  1.00 126.82 ? 13  DA  F "C1'" 1 
ATOM   7487 N N9    . DA  F 4 13  ? -35.051 -30.971 -0.173  1.00 122.33 ? 13  DA  F N9    1 
ATOM   7488 C C8    . DA  F 4 13  ? -35.690 -31.128 1.031   1.00 122.50 ? 13  DA  F C8    1 
ATOM   7489 N N7    . DA  F 4 13  ? -34.915 -31.461 2.036   1.00 120.39 ? 13  DA  F N7    1 
ATOM   7490 C C5    . DA  F 4 13  ? -33.660 -31.502 1.463   1.00 117.96 ? 13  DA  F C5    1 
ATOM   7491 C C6    . DA  F 4 13  ? -32.385 -31.793 2.001   1.00 115.92 ? 13  DA  F C6    1 
ATOM   7492 N N6    . DA  F 4 13  ? -32.193 -32.117 3.282   1.00 116.58 ? 13  DA  F N6    1 
ATOM   7493 N N1    . DA  F 4 13  ? -31.317 -31.750 1.170   1.00 113.97 ? 13  DA  F N1    1 
ATOM   7494 C C2    . DA  F 4 13  ? -31.503 -31.420 -0.118  1.00 114.59 ? 13  DA  F C2    1 
ATOM   7495 N N3    . DA  F 4 13  ? -32.652 -31.114 -0.736  1.00 116.74 ? 13  DA  F N3    1 
ATOM   7496 C C4    . DA  F 4 13  ? -33.712 -31.185 0.108   1.00 118.55 ? 13  DA  F C4    1 
ATOM   7497 P P     . DG  F 4 14  ? -37.395 -31.438 -5.482  1.00 136.22 ? 14  DG  F P     1 
ATOM   7498 O OP1   . DG  F 4 14  ? -37.326 -30.635 -6.729  1.00 138.60 ? 14  DG  F OP1   1 
ATOM   7499 O OP2   . DG  F 4 14  ? -38.530 -32.369 -5.227  1.00 137.70 ? 14  DG  F OP2   1 
ATOM   7500 O "O5'" . DG  F 4 14  ? -36.059 -32.304 -5.358  1.00 132.95 ? 14  DG  F "O5'" 1 
ATOM   7501 C "C5'" . DG  F 4 14  ? -34.808 -31.656 -5.576  1.00 131.24 ? 14  DG  F "C5'" 1 
ATOM   7502 C "C4'" . DG  F 4 14  ? -33.648 -32.574 -5.267  1.00 128.65 ? 14  DG  F "C4'" 1 
ATOM   7503 O "O4'" . DG  F 4 14  ? -33.532 -32.759 -3.841  1.00 126.44 ? 14  DG  F "O4'" 1 
ATOM   7504 C "C3'" . DG  F 4 14  ? -33.762 -33.964 -5.866  1.00 129.98 ? 14  DG  F "C3'" 1 
ATOM   7505 O "O3'" . DG  F 4 14  ? -32.658 -34.115 -6.739  1.00 130.56 ? 14  DG  F "O3'" 1 
ATOM   7506 C "C2'" . DG  F 4 14  ? -33.833 -34.906 -4.655  1.00 129.00 ? 14  DG  F "C2'" 1 
ATOM   7507 C "C1'" . DG  F 4 14  ? -33.100 -34.079 -3.615  1.00 125.96 ? 14  DG  F "C1'" 1 
ATOM   7508 N N9    . DG  F 4 14  ? -33.328 -34.377 -2.205  1.00 124.62 ? 14  DG  F N9    1 
ATOM   7509 C C8    . DG  F 4 14  ? -34.511 -34.316 -1.504  1.00 125.41 ? 14  DG  F C8    1 
ATOM   7510 N N7    . DG  F 4 14  ? -34.376 -34.533 -0.224  1.00 125.26 ? 14  DG  F N7    1 
ATOM   7511 C C5    . DG  F 4 14  ? -33.001 -34.691 -0.055  1.00 123.74 ? 14  DG  F C5    1 
ATOM   7512 C C6    . DG  F 4 14  ? -32.236 -34.954 1.118   1.00 123.06 ? 14  DG  F C6    1 
ATOM   7513 O O6    . DG  F 4 14  ? -32.647 -35.079 2.282   1.00 124.04 ? 14  DG  F O6    1 
ATOM   7514 N N1    . DG  F 4 14  ? -30.870 -35.083 0.837   1.00 121.84 ? 14  DG  F N1    1 
ATOM   7515 C C2    . DG  F 4 14  ? -30.307 -34.944 -0.419  1.00 121.57 ? 14  DG  F C2    1 
ATOM   7516 N N2    . DG  F 4 14  ? -28.982 -35.105 -0.523  1.00 121.48 ? 14  DG  F N2    1 
ATOM   7517 N N3    . DG  F 4 14  ? -31.006 -34.693 -1.518  1.00 122.01 ? 14  DG  F N3    1 
ATOM   7518 C C4    . DG  F 4 14  ? -32.342 -34.588 -1.269  1.00 123.15 ? 14  DG  F C4    1 
ATOM   7519 P P     . DA  F 4 15  ? -32.185 -35.493 -7.390  1.00 133.13 ? 15  DA  F P     1 
ATOM   7520 O OP1   . DA  F 4 15  ? -31.435 -35.154 -8.627  1.00 135.34 ? 15  DA  F OP1   1 
ATOM   7521 O OP2   . DA  F 4 15  ? -33.280 -36.515 -7.443  1.00 134.30 ? 15  DA  F OP2   1 
ATOM   7522 O "O5'" . DA  F 4 15  ? -31.137 -35.895 -6.244  1.00 130.77 ? 15  DA  F "O5'" 1 
ATOM   7523 C "C5'" . DA  F 4 15  ? -29.816 -35.351 -6.118  1.00 127.91 ? 15  DA  F "C5'" 1 
ATOM   7524 C "C4'" . DA  F 4 15  ? -28.869 -36.382 -5.520  1.00 127.07 ? 15  DA  F "C4'" 1 
ATOM   7525 O "O4'" . DA  F 4 15  ? -29.208 -36.609 -4.133  1.00 125.73 ? 15  DA  F "O4'" 1 
ATOM   7526 C "C3'" . DA  F 4 15  ? -28.838 -37.757 -6.180  1.00 129.83 ? 15  DA  F "C3'" 1 
ATOM   7527 O "O3'" . DA  F 4 15  ? -27.484 -38.150 -6.339  1.00 130.99 ? 15  DA  F "O3'" 1 
ATOM   7528 C "C2'" . DA  F 4 15  ? -29.625 -38.677 -5.240  1.00 130.73 ? 15  DA  F "C2'" 1 
ATOM   7529 C "C1'" . DA  F 4 15  ? -29.500 -37.973 -3.891  1.00 127.85 ? 15  DA  F "C1'" 1 
ATOM   7530 N N9    . DA  F 4 15  ? -30.653 -38.011 -2.983  1.00 127.16 ? 15  DA  F N9    1 
ATOM   7531 C C8    . DA  F 4 15  ? -31.972 -37.812 -3.284  1.00 127.13 ? 15  DA  F C8    1 
ATOM   7532 N N7    . DA  F 4 15  ? -32.774 -37.831 -2.244  1.00 127.20 ? 15  DA  F N7    1 
ATOM   7533 C C5    . DA  F 4 15  ? -31.924 -38.009 -1.169  1.00 126.69 ? 15  DA  F C5    1 
ATOM   7534 C C6    . DA  F 4 15  ? -32.144 -38.137 0.228   1.00 126.99 ? 15  DA  F C6    1 
ATOM   7535 N N6    . DA  F 4 15  ? -33.350 -38.086 0.805   1.00 128.32 ? 15  DA  F N6    1 
ATOM   7536 N N1    . DA  F 4 15  ? -31.067 -38.304 1.032   1.00 126.95 ? 15  DA  F N1    1 
ATOM   7537 C C2    . DA  F 4 15  ? -29.840 -38.338 0.483   1.00 126.38 ? 15  DA  F C2    1 
ATOM   7538 N N3    . DA  F 4 15  ? -29.511 -38.264 -0.813  1.00 126.31 ? 15  DA  F N3    1 
ATOM   7539 C C4    . DA  F 4 15  ? -30.605 -38.095 -1.602  1.00 126.64 ? 15  DA  F C4    1 
ATOM   7540 O "O5'" . DA  G 3 1   ? -12.207 11.947  76.332  1.00 184.26 ? 1   DA  G "O5'" 1 
ATOM   7541 C "C5'" . DA  G 3 1   ? -12.605 10.624  75.984  1.00 181.80 ? 1   DA  G "C5'" 1 
ATOM   7542 C "C4'" . DA  G 3 1   ? -12.218 10.206  74.564  1.00 181.81 ? 1   DA  G "C4'" 1 
ATOM   7543 O "O4'" . DA  G 3 1   ? -10.774 10.206  74.352  1.00 179.52 ? 1   DA  G "O4'" 1 
ATOM   7544 C "C3'" . DA  G 3 1   ? -12.700 8.805   74.182  1.00 180.21 ? 1   DA  G "C3'" 1 
ATOM   7545 O "O3'" . DA  G 3 1   ? -13.462 8.816   72.953  1.00 183.93 ? 1   DA  G "O3'" 1 
ATOM   7546 C "C2'" . DA  G 3 1   ? -11.415 7.972   74.108  1.00 175.52 ? 1   DA  G "C2'" 1 
ATOM   7547 C "C1'" . DA  G 3 1   ? -10.409 9.024   73.656  1.00 176.49 ? 1   DA  G "C1'" 1 
ATOM   7548 N N9    . DA  G 3 1   ? -8.969  8.695   73.749  1.00 173.21 ? 1   DA  G N9    1 
ATOM   7549 C C8    . DA  G 3 1   ? -8.092  8.696   72.694  1.00 172.53 ? 1   DA  G C8    1 
ATOM   7550 N N7    . DA  G 3 1   ? -6.853  8.393   73.000  1.00 169.53 ? 1   DA  G N7    1 
ATOM   7551 C C5    . DA  G 3 1   ? -6.895  8.202   74.362  1.00 167.99 ? 1   DA  G C5    1 
ATOM   7552 C C6    . DA  G 3 1   ? -5.889  7.893   75.304  1.00 165.39 ? 1   DA  G C6    1 
ATOM   7553 N N6    . DA  G 3 1   ? -4.613  7.716   74.971  1.00 163.99 ? 1   DA  G N6    1 
ATOM   7554 N N1    . DA  G 3 1   ? -6.242  7.753   76.602  1.00 164.89 ? 1   DA  G N1    1 
ATOM   7555 C C2    . DA  G 3 1   ? -7.530  7.930   76.934  1.00 166.70 ? 1   DA  G C2    1 
ATOM   7556 N N3    . DA  G 3 1   ? -8.564  8.226   76.134  1.00 169.33 ? 1   DA  G N3    1 
ATOM   7557 C C4    . DA  G 3 1   ? -8.188  8.364   74.846  1.00 170.08 ? 1   DA  G C4    1 
ATOM   7558 P P     . DA  G 3 2   ? -14.207 7.539   72.299  1.00 184.42 ? 2   DA  G P     1 
ATOM   7559 O OP1   . DA  G 3 2   ? -15.315 8.043   71.449  1.00 189.56 ? 2   DA  G OP1   1 
ATOM   7560 O OP2   . DA  G 3 2   ? -14.491 6.509   73.331  1.00 181.92 ? 2   DA  G OP2   1 
ATOM   7561 O "O5'" . DA  G 3 2   ? -13.085 6.909   71.350  1.00 181.77 ? 2   DA  G "O5'" 1 
ATOM   7562 C "C5'" . DA  G 3 2   ? -12.412 7.621   70.305  1.00 183.21 ? 2   DA  G "C5'" 1 
ATOM   7563 C "C4'" . DA  G 3 2   ? -11.223 6.808   69.813  1.00 179.52 ? 2   DA  G "C4'" 1 
ATOM   7564 O "O4'" . DA  G 3 2   ? -10.228 6.709   70.866  1.00 176.46 ? 2   DA  G "O4'" 1 
ATOM   7565 C "C3'" . DA  G 3 2   ? -11.546 5.376   69.392  1.00 177.92 ? 2   DA  G "C3'" 1 
ATOM   7566 O "O3'" . DA  G 3 2   ? -11.108 5.143   68.056  1.00 177.99 ? 2   DA  G "O3'" 1 
ATOM   7567 C "C2'" . DA  G 3 2   ? -10.837 4.503   70.429  1.00 173.88 ? 2   DA  G "C2'" 1 
ATOM   7568 C "C1'" . DA  G 3 2   ? -9.697  5.401   70.884  1.00 172.75 ? 2   DA  G "C1'" 1 
ATOM   7569 N N9    . DA  G 3 2   ? -9.145  5.111   72.213  1.00 170.71 ? 2   DA  G N9    1 
ATOM   7570 C C8    . DA  G 3 2   ? -9.832  4.854   73.373  1.00 171.10 ? 2   DA  G C8    1 
ATOM   7571 N N7    . DA  G 3 2   ? -9.072  4.658   74.429  1.00 168.94 ? 2   DA  G N7    1 
ATOM   7572 C C5    . DA  G 3 2   ? -7.786  4.785   73.931  1.00 167.38 ? 2   DA  G C5    1 
ATOM   7573 C C6    . DA  G 3 2   ? -6.505  4.680   74.540  1.00 165.08 ? 2   DA  G C6    1 
ATOM   7574 N N6    . DA  G 3 2   ? -6.322  4.426   75.842  1.00 163.68 ? 2   DA  G N6    1 
ATOM   7575 N N1    . DA  G 3 2   ? -5.414  4.862   73.748  1.00 164.66 ? 2   DA  G N1    1 
ATOM   7576 C C2    . DA  G 3 2   ? -5.580  5.151   72.444  1.00 165.99 ? 2   DA  G C2    1 
ATOM   7577 N N3    . DA  G 3 2   ? -6.730  5.254   71.761  1.00 167.82 ? 2   DA  G N3    1 
ATOM   7578 C C4    . DA  G 3 2   ? -7.808  5.061   72.562  1.00 168.50 ? 2   DA  G C4    1 
ATOM   7579 P P     . DT  G 3 3   ? -11.414 3.815   67.189  1.00 178.23 ? 3   DT  G P     1 
ATOM   7580 O OP1   . DT  G 3 3   ? -12.015 4.248   65.895  1.00 182.28 ? 3   DT  G OP1   1 
ATOM   7581 O OP2   . DT  G 3 3   ? -12.120 2.790   68.007  1.00 178.40 ? 3   DT  G OP2   1 
ATOM   7582 O "O5'" . DT  G 3 3   ? -9.951  3.214   66.913  1.00 172.20 ? 3   DT  G "O5'" 1 
ATOM   7583 C "C5'" . DT  G 3 3   ? -8.960  3.989   66.229  1.00 169.56 ? 3   DT  G "C5'" 1 
ATOM   7584 C "C4'" . DT  G 3 3   ? -7.574  3.717   66.774  1.00 163.34 ? 3   DT  G "C4'" 1 
ATOM   7585 O "O4'" . DT  G 3 3   ? -7.603  3.733   68.215  1.00 161.72 ? 3   DT  G "O4'" 1 
ATOM   7586 C "C3'" . DT  G 3 3   ? -7.039  2.328   66.511  1.00 158.63 ? 3   DT  G "C3'" 1 
ATOM   7587 O "O3'" . DT  G 3 3   ? -6.549  2.265   65.198  1.00 157.19 ? 3   DT  G "O3'" 1 
ATOM   7588 C "C2'" . DT  G 3 3   ? -5.913  2.255   67.530  1.00 155.90 ? 3   DT  G "C2'" 1 
ATOM   7589 C "C1'" . DT  G 3 3   ? -6.402  3.137   68.657  1.00 157.39 ? 3   DT  G "C1'" 1 
ATOM   7590 N N1    . DT  G 3 3   ? -6.550  2.494   70.002  1.00 155.25 ? 3   DT  G N1    1 
ATOM   7591 C C2    . DT  G 3 3   ? -5.428  2.299   70.805  1.00 152.94 ? 3   DT  G C2    1 
ATOM   7592 O O2    . DT  G 3 3   ? -4.278  2.572   70.490  1.00 151.91 ? 3   DT  G O2    1 
ATOM   7593 N N3    . DT  G 3 3   ? -5.712  1.783   72.049  1.00 152.42 ? 3   DT  G N3    1 
ATOM   7594 C C4    . DT  G 3 3   ? -6.954  1.434   72.569  1.00 153.73 ? 3   DT  G C4    1 
ATOM   7595 O O4    . DT  G 3 3   ? -7.013  0.978   73.712  1.00 153.07 ? 3   DT  G O4    1 
ATOM   7596 C C5    . DT  G 3 3   ? -8.081  1.664   71.679  1.00 156.16 ? 3   DT  G C5    1 
ATOM   7597 C C7    . DT  G 3 3   ? -9.485  1.322   72.097  1.00 158.43 ? 3   DT  G C7    1 
ATOM   7598 C C6    . DT  G 3 3   ? -7.825  2.177   70.460  1.00 156.72 ? 3   DT  G C6    1 
ATOM   7599 P P     . DC  G 3 4   ? -6.371  0.867   64.444  1.00 154.98 ? 4   DC  G P     1 
ATOM   7600 O OP1   . DC  G 3 4   ? -6.346  1.179   62.997  1.00 157.03 ? 4   DC  G OP1   1 
ATOM   7601 O OP2   . DC  G 3 4   ? -7.347  -0.145  64.932  1.00 155.89 ? 4   DC  G OP2   1 
ATOM   7602 O "O5'" . DC  G 3 4   ? -4.924  0.398   64.944  1.00 149.49 ? 4   DC  G "O5'" 1 
ATOM   7603 C "C5'" . DC  G 3 4   ? -3.745  1.199   64.838  1.00 146.69 ? 4   DC  G "C5'" 1 
ATOM   7604 C "C4'" . DC  G 3 4   ? -2.688  0.704   65.813  1.00 142.18 ? 4   DC  G "C4'" 1 
ATOM   7605 O "O4'" . DC  G 3 4   ? -3.205  0.660   67.164  1.00 140.97 ? 4   DC  G "O4'" 1 
ATOM   7606 C "C3'" . DC  G 3 4   ? -2.123  -0.677  65.529  1.00 139.58 ? 4   DC  G "C3'" 1 
ATOM   7607 O "O3'" . DC  G 3 4   ? -0.730  -0.542  65.501  1.00 138.65 ? 4   DC  G "O3'" 1 
ATOM   7608 C "C2'" . DC  G 3 4   ? -2.621  -1.566  66.672  1.00 138.40 ? 4   DC  G "C2'" 1 
ATOM   7609 C "C1'" . DC  G 3 4   ? -2.892  -0.568  67.790  1.00 138.28 ? 4   DC  G "C1'" 1 
ATOM   7610 N N1    . DC  G 3 4   ? -3.958  -0.940  68.819  1.00 137.71 ? 4   DC  G N1    1 
ATOM   7611 C C2    . DC  G 3 4   ? -3.582  -1.266  70.144  1.00 136.40 ? 4   DC  G C2    1 
ATOM   7612 O O2    . DC  G 3 4   ? -2.380  -1.297  70.457  1.00 135.05 ? 4   DC  G O2    1 
ATOM   7613 N N3    . DC  G 3 4   ? -4.569  -1.578  71.047  1.00 136.73 ? 4   DC  G N3    1 
ATOM   7614 C C4    . DC  G 3 4   ? -5.867  -1.573  70.684  1.00 137.91 ? 4   DC  G C4    1 
ATOM   7615 N N4    . DC  G 3 4   ? -6.792  -1.875  71.603  1.00 138.64 ? 4   DC  G N4    1 
ATOM   7616 C C5    . DC  G 3 4   ? -6.272  -1.240  69.355  1.00 139.12 ? 4   DC  G C5    1 
ATOM   7617 C C6    . DC  G 3 4   ? -5.296  -0.952  68.476  1.00 138.76 ? 4   DC  G C6    1 
ATOM   7618 P P     . DT  G 3 5   ? 0.311   -1.676  65.071  1.00 138.13 ? 5   DT  G P     1 
ATOM   7619 O OP1   . DT  G 3 5   ? 1.485   -0.884  64.644  1.00 139.22 ? 5   DT  G OP1   1 
ATOM   7620 O OP2   . DT  G 3 5   ? -0.283  -2.696  64.162  1.00 137.84 ? 5   DT  G OP2   1 
ATOM   7621 O "O5'" . DT  G 3 5   ? 0.632   -2.423  66.450  1.00 136.94 ? 5   DT  G "O5'" 1 
ATOM   7622 C "C5'" . DT  G 3 5   ? 1.329   -1.763  67.506  1.00 136.48 ? 5   DT  G "C5'" 1 
ATOM   7623 C "C4'" . DT  G 3 5   ? 1.459   -2.659  68.722  1.00 135.18 ? 5   DT  G "C4'" 1 
ATOM   7624 O "O4'" . DT  G 3 5   ? 0.157   -2.801  69.327  1.00 135.36 ? 5   DT  G "O4'" 1 
ATOM   7625 C "C3'" . DT  G 3 5   ? 2.026   -4.060  68.480  1.00 134.28 ? 5   DT  G "C3'" 1 
ATOM   7626 O "O3'" . DT  G 3 5   ? 3.173   -4.251  69.308  1.00 134.68 ? 5   DT  G "O3'" 1 
ATOM   7627 C "C2'" . DT  G 3 5   ? 0.878   -5.006  68.821  1.00 134.50 ? 5   DT  G "C2'" 1 
ATOM   7628 C "C1'" . DT  G 3 5   ? 0.041   -4.140  69.752  1.00 135.27 ? 5   DT  G "C1'" 1 
ATOM   7629 N N1    . DT  G 3 5   ? -1.404  -4.474  69.950  1.00 136.94 ? 5   DT  G N1    1 
ATOM   7630 C C2    . DT  G 3 5   ? -1.863  -4.641  71.253  1.00 137.72 ? 5   DT  G C2    1 
ATOM   7631 O O2    . DT  G 3 5   ? -1.152  -4.604  72.248  1.00 136.95 ? 5   DT  G O2    1 
ATOM   7632 N N3    . DT  G 3 5   ? -3.218  -4.861  71.365  1.00 139.72 ? 5   DT  G N3    1 
ATOM   7633 C C4    . DT  G 3 5   ? -4.143  -4.948  70.331  1.00 141.21 ? 5   DT  G C4    1 
ATOM   7634 O O4    . DT  G 3 5   ? -5.317  -5.202  70.612  1.00 143.60 ? 5   DT  G O4    1 
ATOM   7635 C C5    . DT  G 3 5   ? -3.602  -4.759  68.996  1.00 139.93 ? 5   DT  G C5    1 
ATOM   7636 C C7    . DT  G 3 5   ? -4.505  -4.801  67.800  1.00 141.42 ? 5   DT  G C7    1 
ATOM   7637 C C6    . DT  G 3 5   ? -2.283  -4.511  68.870  1.00 138.03 ? 5   DT  G C6    1 
ATOM   7638 P P     . DT  G 3 6   ? 4.263   -5.429  69.207  1.00 135.33 ? 6   DT  G P     1 
ATOM   7639 O OP1   . DT  G 3 6   ? 5.594   -4.870  69.558  1.00 135.90 ? 6   DT  G OP1   1 
ATOM   7640 O OP2   . DT  G 3 6   ? 4.101   -6.177  67.930  1.00 135.24 ? 6   DT  G OP2   1 
ATOM   7641 O "O5'" . DT  G 3 6   ? 3.809   -6.422  70.381  1.00 135.62 ? 6   DT  G "O5'" 1 
ATOM   7642 C "C5'" . DT  G 3 6   ? 3.912   -6.089  71.764  1.00 136.12 ? 6   DT  G "C5'" 1 
ATOM   7643 C "C4'" . DT  G 3 6   ? 3.047   -6.970  72.655  1.00 137.12 ? 6   DT  G "C4'" 1 
ATOM   7644 O "O4'" . DT  G 3 6   ? 1.638   -6.793  72.396  1.00 137.38 ? 6   DT  G "O4'" 1 
ATOM   7645 C "C3'" . DT  G 3 6   ? 3.308   -8.468  72.621  1.00 138.55 ? 6   DT  G "C3'" 1 
ATOM   7646 O "O3'" . DT  G 3 6   ? 3.932   -8.783  73.847  1.00 139.78 ? 6   DT  G "O3'" 1 
ATOM   7647 C "C2'" . DT  G 3 6   ? 1.926   -9.112  72.500  1.00 139.54 ? 6   DT  G "C2'" 1 
ATOM   7648 C "C1'" . DT  G 3 6   ? 0.969   -7.963  72.803  1.00 138.96 ? 6   DT  G "C1'" 1 
ATOM   7649 N N1    . DT  G 3 6   ? -0.378  -8.024  72.124  1.00 140.50 ? 6   DT  G N1    1 
ATOM   7650 C C2    . DT  G 3 6   ? -1.559  -8.041  72.874  1.00 142.41 ? 6   DT  G C2    1 
ATOM   7651 O O2    . DT  G 3 6   ? -1.626  -8.041  74.094  1.00 143.12 ? 6   DT  G O2    1 
ATOM   7652 N N3    . DT  G 3 6   ? -2.715  -8.074  72.128  1.00 143.95 ? 6   DT  G N3    1 
ATOM   7653 C C4    . DT  G 3 6   ? -2.817  -8.094  70.745  1.00 144.31 ? 6   DT  G C4    1 
ATOM   7654 O O4    . DT  G 3 6   ? -3.940  -8.134  70.255  1.00 146.99 ? 6   DT  G O4    1 
ATOM   7655 C C5    . DT  G 3 6   ? -1.558  -8.051  70.015  1.00 141.84 ? 6   DT  G C5    1 
ATOM   7656 C C7    . DT  G 3 6   ? -1.509  -8.060  68.515  1.00 141.38 ? 6   DT  G C7    1 
ATOM   7657 C C6    . DT  G 3 6   ? -0.422  -8.010  70.731  1.00 140.50 ? 6   DT  G C6    1 
ATOM   7658 P P     . DT  G 3 7   ? 4.604   -10.174 74.258  1.00 156.43 ? 7   DT  G P     1 
ATOM   7659 O OP1   . DT  G 3 7   ? 5.816   -9.811  75.033  1.00 160.20 ? 7   DT  G OP1   1 
ATOM   7660 O OP2   . DT  G 3 7   ? 4.694   -11.034 73.043  1.00 153.91 ? 7   DT  G OP2   1 
ATOM   7661 O "O5'" . DT  G 3 7   ? 3.525   -10.830 75.252  1.00 153.93 ? 7   DT  G "O5'" 1 
ATOM   7662 C "C5'" . DT  G 3 7   ? 2.821   -10.078 76.232  1.00 156.77 ? 7   DT  G "C5'" 1 
ATOM   7663 C "C4'" . DT  G 3 7   ? 1.441   -10.643 76.491  1.00 155.22 ? 7   DT  G "C4'" 1 
ATOM   7664 O "O4'" . DT  G 3 7   ? 0.524   -10.393 75.403  1.00 154.31 ? 7   DT  G "O4'" 1 
ATOM   7665 C "C3'" . DT  G 3 7   ? 1.384   -12.141 76.755  1.00 152.26 ? 7   DT  G "C3'" 1 
ATOM   7666 O "O3'" . DT  G 3 7   ? 1.053   -12.332 78.127  1.00 154.74 ? 7   DT  G "O3'" 1 
ATOM   7667 C "C2'" . DT  G 3 7   ? 0.321   -12.669 75.790  1.00 149.38 ? 7   DT  G "C2'" 1 
ATOM   7668 C "C1'" . DT  G 3 7   ? -0.458  -11.402 75.486  1.00 152.55 ? 7   DT  G "C1'" 1 
ATOM   7669 N N1    . DT  G 3 7   ? -1.387  -11.444 74.289  1.00 152.34 ? 7   DT  G N1    1 
ATOM   7670 C C2    . DT  G 3 7   ? -2.764  -11.485 74.500  1.00 154.03 ? 7   DT  G C2    1 
ATOM   7671 O O2    . DT  G 3 7   ? -3.293  -11.503 75.595  1.00 156.46 ? 7   DT  G O2    1 
ATOM   7672 N N3    . DT  G 3 7   ? -3.540  -11.535 73.361  1.00 153.68 ? 7   DT  G N3    1 
ATOM   7673 C C4    . DT  G 3 7   ? -3.093  -11.527 72.039  1.00 152.30 ? 7   DT  G C4    1 
ATOM   7674 O O4    . DT  G 3 7   ? -3.901  -11.545 71.105  1.00 151.81 ? 7   DT  G O4    1 
ATOM   7675 C C5    . DT  G 3 7   ? -1.649  -11.508 71.882  1.00 151.54 ? 7   DT  G C5    1 
ATOM   7676 C C7    . DT  G 3 7   ? -1.075  -11.556 70.490  1.00 150.69 ? 7   DT  G C7    1 
ATOM   7677 C C6    . DT  G 3 7   ? -0.873  -11.457 72.994  1.00 151.63 ? 7   DT  G C6    1 
ATOM   7678 P P     . DC  G 3 8   ? 1.125   -13.723 78.910  1.00 153.47 ? 8   DC  G P     1 
ATOM   7679 O OP1   . DC  G 3 8   ? 1.290   -13.440 80.357  1.00 158.19 ? 8   DC  G OP1   1 
ATOM   7680 O OP2   . DC  G 3 8   ? 2.109   -14.583 78.216  1.00 151.19 ? 8   DC  G OP2   1 
ATOM   7681 O "O5'" . DC  G 3 8   ? -0.333  -14.322 78.637  1.00 151.19 ? 8   DC  G "O5'" 1 
ATOM   7682 C "C5'" . DC  G 3 8   ? -1.523  -13.595 78.937  1.00 154.12 ? 8   DC  G "C5'" 1 
ATOM   7683 C "C4'" . DC  G 3 8   ? -2.749  -14.388 78.543  1.00 152.93 ? 8   DC  G "C4'" 1 
ATOM   7684 O "O4'" . DC  G 3 8   ? -3.148  -14.086 77.186  1.00 151.11 ? 8   DC  G "O4'" 1 
ATOM   7685 C "C3'" . DC  G 3 8   ? -2.587  -15.899 78.619  1.00 150.51 ? 8   DC  G "C3'" 1 
ATOM   7686 O "O3'" . DC  G 3 8   ? -3.327  -16.356 79.740  1.00 154.02 ? 8   DC  G "O3'" 1 
ATOM   7687 C "C2'" . DC  G 3 8   ? -3.077  -16.427 77.268  1.00 146.73 ? 8   DC  G "C2'" 1 
ATOM   7688 C "C1'" . DC  G 3 8   ? -3.757  -15.228 76.613  1.00 148.12 ? 8   DC  G "C1'" 1 
ATOM   7689 N N1    . DC  G 3 8   ? -3.644  -15.146 75.100  1.00 145.88 ? 8   DC  G N1    1 
ATOM   7690 C C2    . DC  G 3 8   ? -4.776  -15.279 74.252  1.00 145.48 ? 8   DC  G C2    1 
ATOM   7691 O O2    . DC  G 3 8   ? -5.905  -15.498 74.725  1.00 147.27 ? 8   DC  G O2    1 
ATOM   7692 N N3    . DC  G 3 8   ? -4.596  -15.144 72.897  1.00 143.63 ? 8   DC  G N3    1 
ATOM   7693 C C4    . DC  G 3 8   ? -3.376  -14.906 72.374  1.00 142.33 ? 8   DC  G C4    1 
ATOM   7694 N N4    . DC  G 3 8   ? -3.235  -14.793 71.048  1.00 140.61 ? 8   DC  G N4    1 
ATOM   7695 C C5    . DC  G 3 8   ? -2.226  -14.772 73.213  1.00 143.53 ? 8   DC  G C5    1 
ATOM   7696 C C6    . DC  G 3 8   ? -2.410  -14.889 74.540  1.00 145.15 ? 8   DC  G C6    1 
ATOM   7697 P P     . DC  G 3 9   ? -3.494  -17.879 80.208  1.00 153.90 ? 9   DC  G P     1 
ATOM   7698 O OP1   . DC  G 3 9   ? -3.901  -17.836 81.633  1.00 159.73 ? 9   DC  G OP1   1 
ATOM   7699 O OP2   . DC  G 3 9   ? -2.308  -18.666 79.785  1.00 151.39 ? 9   DC  G OP2   1 
ATOM   7700 O "O5'" . DC  G 3 9   ? -4.725  -18.400 79.335  1.00 150.38 ? 9   DC  G "O5'" 1 
ATOM   7701 C "C5'" . DC  G 3 9   ? -6.013  -17.788 79.325  1.00 151.64 ? 9   DC  G "C5'" 1 
ATOM   7702 C "C4'" . DC  G 3 9   ? -6.899  -18.449 78.281  1.00 148.12 ? 9   DC  G "C4'" 1 
ATOM   7703 O "O4'" . DC  G 3 9   ? -6.596  -17.974 76.939  1.00 144.11 ? 9   DC  G "O4'" 1 
ATOM   7704 C "C3'" . DC  G 3 9   ? -6.791  -19.968 78.237  1.00 146.10 ? 9   DC  G "C3'" 1 
ATOM   7705 O "O3'" . DC  G 3 9   ? -8.083  -20.548 78.238  1.00 148.04 ? 9   DC  G "O3'" 1 
ATOM   7706 C "C2'" . DC  G 3 9   ? -6.034  -20.238 76.941  1.00 141.16 ? 9   DC  G "C2'" 1 
ATOM   7707 C "C1'" . DC  G 3 9   ? -6.527  -19.089 76.072  1.00 140.41 ? 9   DC  G "C1'" 1 
ATOM   7708 N N1    . DC  G 3 9   ? -5.700  -18.803 74.842  1.00 136.94 ? 9   DC  G N1    1 
ATOM   7709 C C2    . DC  G 3 9   ? -6.325  -18.500 73.610  1.00 135.53 ? 9   DC  G C2    1 
ATOM   7710 O O2    . DC  G 3 9   ? -7.562  -18.435 73.537  1.00 137.02 ? 9   DC  G O2    1 
ATOM   7711 N N3    . DC  G 3 9   ? -5.534  -18.265 72.520  1.00 133.21 ? 9   DC  G N3    1 
ATOM   7712 C C4    . DC  G 3 9   ? -4.193  -18.339 72.608  1.00 132.26 ? 9   DC  G C4    1 
ATOM   7713 N N4    . DC  G 3 9   ? -3.452  -18.099 71.521  1.00 130.86 ? 9   DC  G N4    1 
ATOM   7714 C C5    . DC  G 3 9   ? -3.544  -18.652 73.841  1.00 133.75 ? 9   DC  G C5    1 
ATOM   7715 C C6    . DC  G 3 9   ? -4.327  -18.886 74.906  1.00 135.86 ? 9   DC  G C6    1 
ATOM   7716 P P     . DC  G 3 10  ? -8.386  -22.057 78.694  1.00 149.37 ? 10  DC  G P     1 
ATOM   7717 O OP1   . DC  G 3 10  ? -8.864  -21.984 80.101  1.00 154.95 ? 10  DC  G OP1   1 
ATOM   7718 O OP2   . DC  G 3 10  ? -7.261  -22.959 78.320  1.00 146.18 ? 10  DC  G OP2   1 
ATOM   7719 O "O5'" . DC  G 3 10  ? -9.606  -22.460 77.743  1.00 148.50 ? 10  DC  G "O5'" 1 
ATOM   7720 C "C5'" . DC  G 3 10  ? -10.757 -21.642 77.550  1.00 150.46 ? 10  DC  G "C5'" 1 
ATOM   7721 C "C4'" . DC  G 3 10  ? -11.217 -21.794 76.113  1.00 147.56 ? 10  DC  G "C4'" 1 
ATOM   7722 O "O4'" . DC  G 3 10  ? -10.171 -21.337 75.211  1.00 142.65 ? 10  DC  G "O4'" 1 
ATOM   7723 C "C3'" . DC  G 3 10  ? -11.543 -23.234 75.731  1.00 147.83 ? 10  DC  G "C3'" 1 
ATOM   7724 O "O3'" . DC  G 3 10  ? -12.882 -23.319 75.209  1.00 150.79 ? 10  DC  G "O3'" 1 
ATOM   7725 C "C2'" . DC  G 3 10  ? -10.424 -23.639 74.763  1.00 142.97 ? 10  DC  G "C2'" 1 
ATOM   7726 C "C1'" . DC  G 3 10  ? -9.954  -22.297 74.201  1.00 139.87 ? 10  DC  G "C1'" 1 
ATOM   7727 N N1    . DC  G 3 10  ? -8.536  -22.202 73.648  1.00 135.70 ? 10  DC  G N1    1 
ATOM   7728 C C2    . DC  G 3 10  ? -8.322  -21.807 72.294  1.00 133.63 ? 10  DC  G C2    1 
ATOM   7729 O O2    . DC  G 3 10  ? -9.280  -21.572 71.532  1.00 134.02 ? 10  DC  G O2    1 
ATOM   7730 N N3    . DC  G 3 10  ? -7.035  -21.688 71.828  1.00 131.47 ? 10  DC  G N3    1 
ATOM   7731 C C4    . DC  G 3 10  ? -5.989  -21.962 72.628  1.00 131.44 ? 10  DC  G C4    1 
ATOM   7732 N N4    . DC  G 3 10  ? -4.758  -21.853 72.103  1.00 130.11 ? 10  DC  G N4    1 
ATOM   7733 C C5    . DC  G 3 10  ? -6.181  -22.374 73.999  1.00 132.93 ? 10  DC  G C5    1 
ATOM   7734 C C6    . DC  G 3 10  ? -7.448  -22.466 74.458  1.00 134.91 ? 10  DC  G C6    1 
ATOM   7735 P P     . DA  G 3 11  ? -13.683 -24.680 74.880  1.00 153.14 ? 11  DA  G P     1 
ATOM   7736 O OP1   . DA  G 3 11  ? -15.095 -24.474 75.286  1.00 158.60 ? 11  DA  G OP1   1 
ATOM   7737 O OP2   . DA  G 3 11  ? -12.916 -25.860 75.358  1.00 152.61 ? 11  DA  G OP2   1 
ATOM   7738 O "O5'" . DA  G 3 11  ? -13.612 -24.760 73.284  1.00 149.63 ? 11  DA  G "O5'" 1 
ATOM   7739 C "C5'" . DA  G 3 11  ? -14.018 -23.742 72.351  1.00 148.26 ? 11  DA  G "C5'" 1 
ATOM   7740 C "C4'" . DA  G 3 11  ? -13.501 -24.088 70.962  1.00 144.79 ? 11  DA  G "C4'" 1 
ATOM   7741 O "O4'" . DA  G 3 11  ? -12.058 -23.990 70.949  1.00 141.24 ? 11  DA  G "O4'" 1 
ATOM   7742 C "C3'" . DA  G 3 11  ? -13.809 -25.506 70.486  1.00 146.17 ? 11  DA  G "C3'" 1 
ATOM   7743 O "O3'" . DA  G 3 11  ? -14.578 -25.492 69.285  1.00 146.88 ? 11  DA  G "O3'" 1 
ATOM   7744 C "C2'" . DA  G 3 11  ? -12.456 -26.214 70.361  1.00 143.90 ? 11  DA  G "C2'" 1 
ATOM   7745 C "C1'" . DA  G 3 11  ? -11.516 -25.038 70.175  1.00 140.81 ? 11  DA  G "C1'" 1 
ATOM   7746 N N9    . DA  G 3 11  ? -10.130 -25.186 70.605  1.00 139.92 ? 11  DA  G N9    1 
ATOM   7747 C C8    . DA  G 3 11  ? -9.683  -25.478 71.864  1.00 140.97 ? 11  DA  G C8    1 
ATOM   7748 N N7    . DA  G 3 11  ? -8.379  -25.431 72.012  1.00 139.65 ? 11  DA  G N7    1 
ATOM   7749 C C5    . DA  G 3 11  ? -7.940  -25.042 70.764  1.00 138.27 ? 11  DA  G C5    1 
ATOM   7750 C C6    . DA  G 3 11  ? -6.646  -24.797 70.253  1.00 137.51 ? 11  DA  G C6    1 
ATOM   7751 N N6    . DA  G 3 11  ? -5.559  -24.912 71.020  1.00 136.97 ? 11  DA  G N6    1 
ATOM   7752 N N1    . DA  G 3 11  ? -6.531  -24.394 68.949  1.00 137.96 ? 11  DA  G N1    1 
ATOM   7753 C C2    . DA  G 3 11  ? -7.639  -24.278 68.184  1.00 138.50 ? 11  DA  G C2    1 
ATOM   7754 N N3    . DA  G 3 11  ? -8.908  -24.490 68.572  1.00 139.33 ? 11  DA  G N3    1 
ATOM   7755 C C4    . DA  G 3 11  ? -8.999  -24.871 69.878  1.00 138.88 ? 11  DA  G C4    1 
ATOM   7756 P P     . DC  G 3 12  ? -15.426 -26.755 68.770  1.00 149.99 ? 12  DC  G P     1 
ATOM   7757 O OP1   . DC  G 3 12  ? -16.544 -26.226 67.953  1.00 152.40 ? 12  DC  G OP1   1 
ATOM   7758 O OP2   . DC  G 3 12  ? -15.678 -27.706 69.889  1.00 152.02 ? 12  DC  G OP2   1 
ATOM   7759 O "O5'" . DC  G 3 12  ? -14.392 -27.474 67.792  1.00 148.11 ? 12  DC  G "O5'" 1 
ATOM   7760 C "C5'" . DC  G 3 12  ? -13.785 -26.817 66.694  1.00 145.57 ? 12  DC  G "C5'" 1 
ATOM   7761 C "C4'" . DC  G 3 12  ? -12.560 -27.585 66.241  1.00 144.96 ? 12  DC  G "C4'" 1 
ATOM   7762 O "O4'" . DC  G 3 12  ? -11.480 -27.368 67.181  1.00 142.21 ? 12  DC  G "O4'" 1 
ATOM   7763 C "C3'" . DC  G 3 12  ? -12.736 -29.102 66.105  1.00 149.07 ? 12  DC  G "C3'" 1 
ATOM   7764 O "O3'" . DC  G 3 12  ? -12.310 -29.513 64.817  1.00 152.29 ? 12  DC  G "O3'" 1 
ATOM   7765 C "C2'" . DC  G 3 12  ? -11.832 -29.684 67.190  1.00 147.90 ? 12  DC  G "C2'" 1 
ATOM   7766 C "C1'" . DC  G 3 12  ? -10.780 -28.589 67.279  1.00 143.53 ? 12  DC  G "C1'" 1 
ATOM   7767 N N1    . DC  G 3 12  ? -9.794  -28.575 68.412  1.00 141.41 ? 12  DC  G N1    1 
ATOM   7768 C C2    . DC  G 3 12  ? -8.466  -28.149 68.163  1.00 139.39 ? 12  DC  G C2    1 
ATOM   7769 O O2    . DC  G 3 12  ? -8.106  -27.810 67.030  1.00 139.47 ? 12  DC  G O2    1 
ATOM   7770 N N3    . DC  G 3 12  ? -7.569  -28.128 69.178  1.00 138.38 ? 12  DC  G N3    1 
ATOM   7771 C C4    . DC  G 3 12  ? -7.956  -28.490 70.401  1.00 139.86 ? 12  DC  G C4    1 
ATOM   7772 N N4    . DC  G 3 12  ? -7.044  -28.421 71.372  1.00 139.98 ? 12  DC  G N4    1 
ATOM   7773 C C5    . DC  G 3 12  ? -9.296  -28.916 70.690  1.00 141.87 ? 12  DC  G C5    1 
ATOM   7774 C C6    . DC  G 3 12  ? -10.177 -28.935 69.678  1.00 142.29 ? 12  DC  G C6    1 
ATOM   7775 P P     . DA  G 3 13  ? -13.020 -30.592 63.864  1.00 159.39 ? 13  DA  G P     1 
ATOM   7776 O OP1   . DA  G 3 13  ? -13.782 -29.822 62.857  1.00 160.01 ? 13  DA  G OP1   1 
ATOM   7777 O OP2   . DA  G 3 13  ? -13.696 -31.645 64.664  1.00 162.54 ? 13  DA  G OP2   1 
ATOM   7778 O "O5'" . DA  G 3 13  ? -11.760 -31.291 63.159  1.00 161.89 ? 13  DA  G "O5'" 1 
ATOM   7779 C "C5'" . DA  G 3 13  ? -10.798 -30.500 62.446  1.00 160.12 ? 13  DA  G "C5'" 1 
ATOM   7780 C "C4'" . DA  G 3 13  ? -9.357  -30.841 62.796  1.00 160.01 ? 13  DA  G "C4'" 1 
ATOM   7781 O "O4'" . DA  G 3 13  ? -9.009  -30.432 64.147  1.00 155.50 ? 13  DA  G "O4'" 1 
ATOM   7782 C "C3'" . DA  G 3 13  ? -8.939  -32.302 62.636  1.00 166.22 ? 13  DA  G "C3'" 1 
ATOM   7783 O "O3'" . DA  G 3 13  ? -7.866  -32.362 61.699  1.00 170.38 ? 13  DA  G "O3'" 1 
ATOM   7784 C "C2'" . DA  G 3 13  ? -8.512  -32.655 64.056  1.00 164.18 ? 13  DA  G "C2'" 1 
ATOM   7785 C "C1'" . DA  G 3 13  ? -7.999  -31.313 64.570  1.00 157.35 ? 13  DA  G "C1'" 1 
ATOM   7786 N N9    . DA  G 3 13  ? -7.778  -31.260 66.022  1.00 153.64 ? 13  DA  G N9    1 
ATOM   7787 C C8    . DA  G 3 13  ? -8.693  -31.515 67.010  1.00 153.11 ? 13  DA  G C8    1 
ATOM   7788 N N7    . DA  G 3 13  ? -8.209  -31.470 68.228  1.00 151.59 ? 13  DA  G N7    1 
ATOM   7789 C C5    . DA  G 3 13  ? -6.869  -31.193 68.032  1.00 150.46 ? 13  DA  G C5    1 
ATOM   7790 C C6    . DA  G 3 13  ? -5.799  -30.993 68.934  1.00 149.13 ? 13  DA  G C6    1 
ATOM   7791 N N6    . DA  G 3 13  ? -5.947  -31.088 70.261  1.00 148.76 ? 13  DA  G N6    1 
ATOM   7792 N N1    . DA  G 3 13  ? -4.569  -30.719 68.419  1.00 149.01 ? 13  DA  G N1    1 
ATOM   7793 C C2    . DA  G 3 13  ? -4.417  -30.664 67.084  1.00 150.07 ? 13  DA  G C2    1 
ATOM   7794 N N3    . DA  G 3 13  ? -5.360  -30.815 66.145  1.00 151.32 ? 13  DA  G N3    1 
ATOM   7795 C C4    . DA  G 3 13  ? -6.575  -31.080 66.679  1.00 151.54 ? 13  DA  G C4    1 
ATOM   7796 P P     . DG  G 3 14  ? -7.065  -33.634 61.131  1.00 179.65 ? 14  DG  G P     1 
ATOM   7797 O OP1   . DG  G 3 14  ? -7.281  -33.688 59.664  1.00 184.22 ? 14  DG  G OP1   1 
ATOM   7798 O OP2   . DG  G 3 14  ? -7.347  -34.856 61.932  1.00 182.80 ? 14  DG  G OP2   1 
ATOM   7799 O "O5'" . DG  G 3 14  ? -5.570  -33.108 61.429  1.00 179.32 ? 14  DG  G "O5'" 1 
ATOM   7800 C "C5'" . DG  G 3 14  ? -4.372  -33.496 60.717  1.00 185.75 ? 14  DG  G "C5'" 1 
ATOM   7801 C "C4'" . DG  G 3 14  ? -3.074  -33.117 61.447  1.00 184.48 ? 14  DG  G "C4'" 1 
ATOM   7802 O "O4'" . DG  G 3 14  ? -3.337  -32.649 62.796  1.00 177.58 ? 14  DG  G "O4'" 1 
ATOM   7803 C "C3'" . DG  G 3 14  ? -2.029  -34.231 61.604  1.00 192.39 ? 14  DG  G "C3'" 1 
ATOM   7804 O "O3'" . DG  G 3 14  ? -0.652  -33.770 61.482  1.00 194.88 ? 14  DG  G "O3'" 1 
ATOM   7805 C "C2'" . DG  G 3 14  ? -2.312  -34.809 62.991  1.00 190.04 ? 14  DG  G "C2'" 1 
ATOM   7806 C "C1'" . DG  G 3 14  ? -2.922  -33.630 63.738  1.00 180.32 ? 14  DG  G "C1'" 1 
ATOM   7807 N N9    . DG  G 3 14  ? -4.043  -33.988 64.609  1.00 177.16 ? 14  DG  G N9    1 
ATOM   7808 C C8    . DG  G 3 14  ? -5.334  -34.311 64.262  1.00 177.32 ? 14  DG  G C8    1 
ATOM   7809 N N7    . DG  G 3 14  ? -6.122  -34.551 65.272  1.00 175.19 ? 14  DG  G N7    1 
ATOM   7810 C C5    . DG  G 3 14  ? -5.304  -34.359 66.368  1.00 173.35 ? 14  DG  G C5    1 
ATOM   7811 C C6    . DG  G 3 14  ? -5.595  -34.483 67.751  1.00 172.25 ? 14  DG  G C6    1 
ATOM   7812 O O6    . DG  G 3 14  ? -6.687  -34.771 68.276  1.00 172.20 ? 14  DG  G O6    1 
ATOM   7813 N N1    . DG  G 3 14  ? -4.457  -34.243 68.540  1.00 171.84 ? 14  DG  G N1    1 
ATOM   7814 C C2    . DG  G 3 14  ? -3.204  -33.923 68.032  1.00 172.38 ? 14  DG  G C2    1 
ATOM   7815 N N2    . DG  G 3 14  ? -2.206  -33.742 68.902  1.00 172.47 ? 14  DG  G N2    1 
ATOM   7816 N N3    . DG  G 3 14  ? -2.926  -33.803 66.741  1.00 173.50 ? 14  DG  G N3    1 
ATOM   7817 C C4    . DG  G 3 14  ? -4.018  -34.035 65.974  1.00 174.17 ? 14  DG  G C4    1 
ATOM   7818 P P     . DT  G 3 15  ? 0.642   -34.714 61.191  1.00 205.03 ? 15  DT  G P     1 
ATOM   7819 O OP1   . DT  G 3 15  ? 1.741   -33.818 60.741  1.00 206.25 ? 15  DT  G OP1   1 
ATOM   7820 O OP2   . DT  G 3 15  ? 0.274   -35.851 60.295  1.00 209.11 ? 15  DT  G OP2   1 
ATOM   7821 O "O5'" . DT  G 3 15  ? 1.023   -35.364 62.630  1.00 203.28 ? 15  DT  G "O5'" 1 
ATOM   7822 C "C5'" . DT  G 3 15  ? 1.667   -34.693 63.753  1.00 195.37 ? 15  DT  G "C5'" 1 
ATOM   7823 C "C4'" . DT  G 3 15  ? 2.087   -35.586 64.928  1.00 195.32 ? 15  DT  G "C4'" 1 
ATOM   7824 O "O4'" . DT  G 3 15  ? 1.122   -35.487 66.008  1.00 187.07 ? 15  DT  G "O4'" 1 
ATOM   7825 C "C3'" . DT  G 3 15  ? 2.384   -37.067 64.676  1.00 204.59 ? 15  DT  G "C3'" 1 
ATOM   7826 O "O3'" . DT  G 3 15  ? 3.777   -37.359 64.770  1.00 211.26 ? 15  DT  G "O3'" 1 
ATOM   7827 C "C2'" . DT  G 3 15  ? 1.593   -37.823 65.739  1.00 202.87 ? 15  DT  G "C2'" 1 
ATOM   7828 C "C1'" . DT  G 3 15  ? 0.927   -36.751 66.609  1.00 191.15 ? 15  DT  G "C1'" 1 
ATOM   7829 N N1    . DT  G 3 15  ? -0.555  -36.968 66.945  1.00 185.07 ? 15  DT  G N1    1 
ATOM   7830 C C2    . DT  G 3 15  ? -0.987  -36.915 68.270  1.00 180.17 ? 15  DT  G C2    1 
ATOM   7831 O O2    . DT  G 3 15  ? -0.260  -36.690 69.225  1.00 179.34 ? 15  DT  G O2    1 
ATOM   7832 N N3    . DT  G 3 15  ? -2.339  -37.137 68.448  1.00 177.14 ? 15  DT  G N3    1 
ATOM   7833 C C4    . DT  G 3 15  ? -3.293  -37.406 67.471  1.00 177.39 ? 15  DT  G C4    1 
ATOM   7834 O O4    . DT  G 3 15  ? -4.463  -37.575 67.803  1.00 175.19 ? 15  DT  G O4    1 
ATOM   7835 C C5    . DT  G 3 15  ? -2.791  -37.456 66.114  1.00 181.57 ? 15  DT  G C5    1 
ATOM   7836 C C7    . DT  G 3 15  ? -3.721  -37.736 64.964  1.00 183.33 ? 15  DT  G C7    1 
ATOM   7837 C C6    . DT  G 3 15  ? -1.473  -37.233 65.925  1.00 185.00 ? 15  DT  G C6    1 
ATOM   7838 O "O5'" . DT  H 4 1   ? -13.217 -47.022 71.679  1.00 176.80 ? 1   DT  H "O5'" 1 
ATOM   7839 C "C5'" . DT  H 4 1   ? -12.333 -45.985 71.305  1.00 177.22 ? 1   DT  H "C5'" 1 
ATOM   7840 C "C4'" . DT  H 4 1   ? -11.286 -45.671 72.360  1.00 180.19 ? 1   DT  H "C4'" 1 
ATOM   7841 O "O4'" . DT  H 4 1   ? -9.979  -45.874 71.749  1.00 178.76 ? 1   DT  H "O4'" 1 
ATOM   7842 C "C3'" . DT  H 4 1   ? -11.315 -44.196 72.775  1.00 183.24 ? 1   DT  H "C3'" 1 
ATOM   7843 O "O3'" . DT  H 4 1   ? -11.699 -43.922 74.155  1.00 188.75 ? 1   DT  H "O3'" 1 
ATOM   7844 C "C2'" . DT  H 4 1   ? -9.943  -43.633 72.411  1.00 181.33 ? 1   DT  H "C2'" 1 
ATOM   7845 C "C1'" . DT  H 4 1   ? -9.084  -44.854 72.168  1.00 179.36 ? 1   DT  H "C1'" 1 
ATOM   7846 N N1    . DT  H 4 1   ? -7.906  -44.605 71.230  1.00 177.04 ? 1   DT  H N1    1 
ATOM   7847 C C2    . DT  H 4 1   ? -6.640  -44.288 71.738  1.00 177.37 ? 1   DT  H C2    1 
ATOM   7848 O O2    . DT  H 4 1   ? -6.365  -44.173 72.920  1.00 178.90 ? 1   DT  H O2    1 
ATOM   7849 N N3    . DT  H 4 1   ? -5.650  -44.111 70.800  1.00 176.41 ? 1   DT  H N3    1 
ATOM   7850 C C4    . DT  H 4 1   ? -5.788  -44.213 69.427  1.00 175.43 ? 1   DT  H C4    1 
ATOM   7851 O O4    . DT  H 4 1   ? -4.805  -44.027 68.716  1.00 175.48 ? 1   DT  H O4    1 
ATOM   7852 C C5    . DT  H 4 1   ? -7.125  -44.525 68.952  1.00 174.85 ? 1   DT  H C5    1 
ATOM   7853 C C7    . DT  H 4 1   ? -7.414  -44.631 67.477  1.00 173.77 ? 1   DT  H C7    1 
ATOM   7854 C C6    . DT  H 4 1   ? -8.101  -44.701 69.862  1.00 175.26 ? 1   DT  H C6    1 
ATOM   7855 P P     . DT  H 4 2   ? -11.819 -42.447 74.846  1.00 193.26 ? 2   DT  H P     1 
ATOM   7856 O OP1   . DT  H 4 2   ? -12.874 -42.549 75.888  1.00 196.78 ? 2   DT  H OP1   1 
ATOM   7857 O OP2   . DT  H 4 2   ? -11.919 -41.348 73.832  1.00 191.93 ? 2   DT  H OP2   1 
ATOM   7858 O "O5'" . DT  H 4 2   ? -10.390 -42.327 75.581  1.00 194.09 ? 2   DT  H "O5'" 1 
ATOM   7859 C "C5'" . DT  H 4 2   ? -9.787  -41.098 75.998  1.00 195.08 ? 2   DT  H "C5'" 1 
ATOM   7860 C "C4'" . DT  H 4 2   ? -8.324  -41.325 76.344  1.00 194.50 ? 2   DT  H "C4'" 1 
ATOM   7861 O "O4'" . DT  H 4 2   ? -7.661  -42.034 75.260  1.00 191.99 ? 2   DT  H "O4'" 1 
ATOM   7862 C "C3'" . DT  H 4 2   ? -7.538  -40.045 76.601  1.00 195.08 ? 2   DT  H "C3'" 1 
ATOM   7863 O "O3'" . DT  H 4 2   ? -7.333  -39.867 78.005  1.00 197.76 ? 2   DT  H "O3'" 1 
ATOM   7864 C "C2'" . DT  H 4 2   ? -6.212  -40.229 75.867  1.00 192.91 ? 2   DT  H "C2'" 1 
ATOM   7865 C "C1'" . DT  H 4 2   ? -6.448  -41.387 74.905  1.00 190.95 ? 2   DT  H "C1'" 1 
ATOM   7866 N N1    . DT  H 4 2   ? -6.311  -41.107 73.407  1.00 188.08 ? 2   DT  H N1    1 
ATOM   7867 C C2    . DT  H 4 2   ? -5.045  -40.980 72.828  1.00 187.01 ? 2   DT  H C2    1 
ATOM   7868 O O2    . DT  H 4 2   ? -3.985  -41.027 73.438  1.00 187.65 ? 2   DT  H O2    1 
ATOM   7869 N N3    . DT  H 4 2   ? -5.058  -40.777 71.465  1.00 185.40 ? 2   DT  H N3    1 
ATOM   7870 C C4    . DT  H 4 2   ? -6.167  -40.730 70.627  1.00 184.02 ? 2   DT  H C4    1 
ATOM   7871 O O4    . DT  H 4 2   ? -5.993  -40.564 69.422  1.00 182.85 ? 2   DT  H O4    1 
ATOM   7872 C C5    . DT  H 4 2   ? -7.452  -40.884 71.282  1.00 184.43 ? 2   DT  H C5    1 
ATOM   7873 C C7    . DT  H 4 2   ? -8.731  -40.831 70.497  1.00 183.05 ? 2   DT  H C7    1 
ATOM   7874 C C6    . DT  H 4 2   ? -7.457  -41.043 72.618  1.00 186.61 ? 2   DT  H C6    1 
ATOM   7875 P P     . DA  H 4 3   ? -7.194  -38.424 78.704  1.00 200.25 ? 3   DA  H P     1 
ATOM   7876 O OP1   . DA  H 4 3   ? -7.417  -38.652 80.155  1.00 203.23 ? 3   DA  H OP1   1 
ATOM   7877 O OP2   . DA  H 4 3   ? -8.011  -37.405 77.986  1.00 199.96 ? 3   DA  H OP2   1 
ATOM   7878 O "O5'" . DA  H 4 3   ? -5.651  -38.047 78.469  1.00 198.53 ? 3   DA  H "O5'" 1 
ATOM   7879 C "C5'" . DA  H 4 3   ? -4.530  -38.786 78.995  1.00 197.41 ? 3   DA  H "C5'" 1 
ATOM   7880 C "C4'" . DA  H 4 3   ? -3.237  -38.401 78.274  1.00 195.20 ? 3   DA  H "C4'" 1 
ATOM   7881 O "O4'" . DA  H 4 3   ? -3.390  -38.570 76.840  1.00 193.51 ? 3   DA  H "O4'" 1 
ATOM   7882 C "C3'" . DA  H 4 3   ? -2.671  -36.984 78.460  1.00 194.65 ? 3   DA  H "C3'" 1 
ATOM   7883 O "O3'" . DA  H 4 3   ? -1.226  -37.075 78.535  1.00 192.60 ? 3   DA  H "O3'" 1 
ATOM   7884 C "C2'" . DA  H 4 3   ? -3.143  -36.234 77.207  1.00 194.03 ? 3   DA  H "C2'" 1 
ATOM   7885 C "C1'" . DA  H 4 3   ? -3.100  -37.353 76.165  1.00 192.71 ? 3   DA  H "C1'" 1 
ATOM   7886 N N9    . DA  H 4 3   ? -4.001  -37.242 75.016  1.00 191.24 ? 3   DA  H N9    1 
ATOM   7887 C C8    . DA  H 4 3   ? -5.362  -37.075 75.028  1.00 191.46 ? 3   DA  H C8    1 
ATOM   7888 N N7    . DA  H 4 3   ? -5.926  -37.114 73.846  1.00 189.89 ? 3   DA  H N7    1 
ATOM   7889 C C5    . DA  H 4 3   ? -4.856  -37.304 72.994  1.00 188.79 ? 3   DA  H C5    1 
ATOM   7890 C C6    . DA  H 4 3   ? -4.776  -37.398 71.588  1.00 187.61 ? 3   DA  H C6    1 
ATOM   7891 N N6    . DA  H 4 3   ? -5.849  -37.302 70.792  1.00 186.66 ? 3   DA  H N6    1 
ATOM   7892 N N1    . DA  H 4 3   ? -3.549  -37.600 71.041  1.00 187.57 ? 3   DA  H N1    1 
ATOM   7893 C C2    . DA  H 4 3   ? -2.473  -37.679 71.849  1.00 188.34 ? 3   DA  H C2    1 
ATOM   7894 N N3    . DA  H 4 3   ? -2.424  -37.612 73.182  1.00 189.10 ? 3   DA  H N3    1 
ATOM   7895 C C4    . DA  H 4 3   ? -3.659  -37.408 73.695  1.00 189.51 ? 3   DA  H C4    1 
ATOM   7896 P P     . DC  H 4 4   ? -0.181  -35.868 78.716  1.00 191.30 ? 4   DC  H P     1 
ATOM   7897 O OP1   . DC  H 4 4   ? 0.990   -36.437 79.433  1.00 191.84 ? 4   DC  H OP1   1 
ATOM   7898 O OP2   . DC  H 4 4   ? -0.894  -34.691 79.276  1.00 192.30 ? 4   DC  H OP2   1 
ATOM   7899 O "O5'" . DC  H 4 4   ? 0.239   -35.492 77.209  1.00 187.76 ? 4   DC  H "O5'" 1 
ATOM   7900 C "C5'" . DC  H 4 4   ? 1.567   -35.696 76.684  1.00 184.81 ? 4   DC  H "C5'" 1 
ATOM   7901 C "C4'" . DC  H 4 4   ? 1.793   -34.981 75.358  1.00 181.13 ? 4   DC  H "C4'" 1 
ATOM   7902 O "O4'" . DC  H 4 4   ? 0.655   -35.185 74.480  1.00 178.72 ? 4   DC  H "O4'" 1 
ATOM   7903 C "C3'" . DC  H 4 4   ? 2.029   -33.473 75.441  1.00 179.58 ? 4   DC  H "C3'" 1 
ATOM   7904 O "O3'" . DC  H 4 4   ? 3.299   -33.128 74.868  1.00 178.79 ? 4   DC  H "O3'" 1 
ATOM   7905 C "C2'" . DC  H 4 4   ? 0.855   -32.857 74.684  1.00 178.28 ? 4   DC  H "C2'" 1 
ATOM   7906 C "C1'" . DC  H 4 4   ? 0.430   -33.993 73.761  1.00 176.76 ? 4   DC  H "C1'" 1 
ATOM   7907 N N1    . DC  H 4 4   ? -0.993  -33.953 73.269  1.00 173.95 ? 4   DC  H N1    1 
ATOM   7908 C C2    . DC  H 4 4   ? -1.264  -34.066 71.884  1.00 171.63 ? 4   DC  H C2    1 
ATOM   7909 O O2    . DC  H 4 4   ? -0.348  -34.197 71.054  1.00 170.81 ? 4   DC  H O2    1 
ATOM   7910 N N3    . DC  H 4 4   ? -2.566  -34.034 71.474  1.00 170.75 ? 4   DC  H N3    1 
ATOM   7911 C C4    . DC  H 4 4   ? -3.566  -33.890 72.355  1.00 171.63 ? 4   DC  H C4    1 
ATOM   7912 N N4    . DC  H 4 4   ? -4.814  -33.847 71.875  1.00 171.07 ? 4   DC  H N4    1 
ATOM   7913 C C5    . DC  H 4 4   ? -3.316  -33.777 73.763  1.00 173.41 ? 4   DC  H C5    1 
ATOM   7914 C C6    . DC  H 4 4   ? -2.034  -33.830 74.167  1.00 174.09 ? 4   DC  H C6    1 
ATOM   7915 P P     . DT  H 4 5   ? 3.960   -31.656 74.833  1.00 176.23 ? 5   DT  H P     1 
ATOM   7916 O OP1   . DT  H 4 5   ? 5.433   -31.802 74.897  1.00 180.67 ? 5   DT  H OP1   1 
ATOM   7917 O OP2   . DT  H 4 5   ? 3.280   -30.748 75.789  1.00 174.84 ? 5   DT  H OP2   1 
ATOM   7918 O "O5'" . DT  H 4 5   ? 3.577   -31.154 73.367  1.00 169.76 ? 5   DT  H "O5'" 1 
ATOM   7919 C "C5'" . DT  H 4 5   ? 3.908   -31.894 72.190  1.00 168.25 ? 5   DT  H "C5'" 1 
ATOM   7920 C "C4'" . DT  H 4 5   ? 3.162   -31.334 70.995  1.00 162.01 ? 5   DT  H "C4'" 1 
ATOM   7921 O "O4'" . DT  H 4 5   ? 1.746   -31.607 71.108  1.00 159.72 ? 5   DT  H "O4'" 1 
ATOM   7922 C "C3'" . DT  H 4 5   ? 3.286   -29.826 70.840  1.00 159.18 ? 5   DT  H "C3'" 1 
ATOM   7923 O "O3'" . DT  H 4 5   ? 4.005   -29.561 69.658  1.00 158.17 ? 5   DT  H "O3'" 1 
ATOM   7924 C "C2'" . DT  H 4 5   ? 1.860   -29.282 70.823  1.00 155.15 ? 5   DT  H "C2'" 1 
ATOM   7925 C "C1'" . DT  H 4 5   ? 1.020   -30.525 70.568  1.00 154.88 ? 5   DT  H "C1'" 1 
ATOM   7926 N N1    . DT  H 4 5   ? -0.385  -30.523 71.129  1.00 153.20 ? 5   DT  H N1    1 
ATOM   7927 C C2    . DT  H 4 5   ? -1.474  -30.693 70.274  1.00 151.07 ? 5   DT  H C2    1 
ATOM   7928 O O2    . DT  H 4 5   ? -1.394  -30.816 69.056  1.00 149.50 ? 5   DT  H O2    1 
ATOM   7929 N N3    . DT  H 4 5   ? -2.703  -30.690 70.902  1.00 151.18 ? 5   DT  H N3    1 
ATOM   7930 C C4    . DT  H 4 5   ? -2.958  -30.547 72.258  1.00 152.55 ? 5   DT  H C4    1 
ATOM   7931 O O4    . DT  H 4 5   ? -4.127  -30.591 72.641  1.00 152.69 ? 5   DT  H O4    1 
ATOM   7932 C C5    . DT  H 4 5   ? -1.779  -30.368 73.091  1.00 154.33 ? 5   DT  H C5    1 
ATOM   7933 C C7    . DT  H 4 5   ? -1.885  -30.181 74.579  1.00 156.57 ? 5   DT  H C7    1 
ATOM   7934 C C6    . DT  H 4 5   ? -0.576  -30.357 72.495  1.00 154.51 ? 5   DT  H C6    1 
ATOM   7935 P P     . DG  H 4 6   ? 4.535   -28.115 69.225  1.00 157.24 ? 6   DG  H P     1 
ATOM   7936 O OP1   . DG  H 4 6   ? 5.780   -28.340 68.451  1.00 158.78 ? 6   DG  H OP1   1 
ATOM   7937 O OP2   . DG  H 4 6   ? 4.517   -27.196 70.398  1.00 159.05 ? 6   DG  H OP2   1 
ATOM   7938 O "O5'" . DG  H 4 6   ? 3.386   -27.621 68.227  1.00 152.17 ? 6   DG  H "O5'" 1 
ATOM   7939 C "C5'" . DG  H 4 6   ? 2.802   -28.405 67.181  1.00 149.84 ? 6   DG  H "C5'" 1 
ATOM   7940 C "C4'" . DG  H 4 6   ? 1.570   -27.711 66.615  1.00 146.54 ? 6   DG  H "C4'" 1 
ATOM   7941 O "O4'" . DG  H 4 6   ? 0.410   -27.903 67.459  1.00 147.89 ? 6   DG  H "O4'" 1 
ATOM   7942 C "C3'" . DG  H 4 6   ? 1.689   -26.200 66.423  1.00 144.24 ? 6   DG  H "C3'" 1 
ATOM   7943 O "O3'" . DG  H 4 6   ? 1.235   -25.832 65.145  1.00 139.46 ? 6   DG  H "O3'" 1 
ATOM   7944 C "C2'" . DG  H 4 6   ? 0.805   -25.596 67.503  1.00 145.76 ? 6   DG  H "C2'" 1 
ATOM   7945 C "C1'" . DG  H 4 6   ? -0.264  -26.667 67.598  1.00 146.99 ? 6   DG  H "C1'" 1 
ATOM   7946 N N9    . DG  H 4 6   ? -0.990  -26.748 68.850  1.00 150.76 ? 6   DG  H N9    1 
ATOM   7947 C C8    . DG  H 4 6   ? -0.488  -26.800 70.134  1.00 154.25 ? 6   DG  H C8    1 
ATOM   7948 N N7    . DG  H 4 6   ? -1.387  -27.033 71.052  1.00 155.55 ? 6   DG  H N7    1 
ATOM   7949 C C5    . DG  H 4 6   ? -2.556  -27.179 70.317  1.00 154.03 ? 6   DG  H C5    1 
ATOM   7950 C C6    . DG  H 4 6   ? -3.872  -27.462 70.754  1.00 154.71 ? 6   DG  H C6    1 
ATOM   7951 O O6    . DG  H 4 6   ? -4.255  -27.580 71.927  1.00 155.87 ? 6   DG  H O6    1 
ATOM   7952 N N1    . DG  H 4 6   ? -4.783  -27.525 69.682  1.00 154.05 ? 6   DG  H N1    1 
ATOM   7953 C C2    . DG  H 4 6   ? -4.446  -27.353 68.347  1.00 152.19 ? 6   DG  H C2    1 
ATOM   7954 N N2    . DG  H 4 6   ? -5.431  -27.466 67.445  1.00 152.16 ? 6   DG  H N2    1 
ATOM   7955 N N3    . DG  H 4 6   ? -3.208  -27.101 67.923  1.00 150.55 ? 6   DG  H N3    1 
ATOM   7956 C C4    . DG  H 4 6   ? -2.325  -27.021 68.958  1.00 151.61 ? 6   DG  H C4    1 
ATOM   7957 P P     . DT  H 4 7   ? 2.224   -25.013 64.206  1.00 136.37 ? 7   DT  H P     1 
ATOM   7958 O OP1   . DT  H 4 7   ? 3.057   -26.029 63.508  1.00 135.98 ? 7   DT  H OP1   1 
ATOM   7959 O OP2   . DT  H 4 7   ? 2.850   -23.919 65.006  1.00 138.59 ? 7   DT  H OP2   1 
ATOM   7960 O "O5'" . DT  H 4 7   ? 1.170   -24.354 63.188  1.00 131.25 ? 7   DT  H "O5'" 1 
ATOM   7961 C "C5'" . DT  H 4 7   ? 0.280   -23.365 63.686  1.00 128.91 ? 7   DT  H "C5'" 1 
ATOM   7962 C "C4'" . DT  H 4 7   ? -1.066  -23.404 62.993  1.00 124.56 ? 7   DT  H "C4'" 1 
ATOM   7963 O "O4'" . DT  H 4 7   ? -2.066  -23.966 63.883  1.00 124.73 ? 7   DT  H "O4'" 1 
ATOM   7964 C "C3'" . DT  H 4 7   ? -1.590  -22.037 62.601  1.00 122.66 ? 7   DT  H "C3'" 1 
ATOM   7965 O "O3'" . DT  H 4 7   ? -2.288  -22.137 61.350  1.00 121.22 ? 7   DT  H "O3'" 1 
ATOM   7966 C "C2'" . DT  H 4 7   ? -2.477  -21.658 63.787  1.00 123.70 ? 7   DT  H "C2'" 1 
ATOM   7967 C "C1'" . DT  H 4 7   ? -3.002  -22.988 64.327  1.00 124.16 ? 7   DT  H "C1'" 1 
ATOM   7968 N N1    . DT  H 4 7   ? -3.173  -23.137 65.846  1.00 124.55 ? 7   DT  H N1    1 
ATOM   7969 C C2    . DT  H 4 7   ? -4.382  -23.551 66.455  1.00 124.16 ? 7   DT  H C2    1 
ATOM   7970 O O2    . DT  H 4 7   ? -5.470  -23.750 65.923  1.00 122.57 ? 7   DT  H O2    1 
ATOM   7971 N N3    . DT  H 4 7   ? -4.300  -23.707 67.818  1.00 126.75 ? 7   DT  H N3    1 
ATOM   7972 C C4    . DT  H 4 7   ? -3.188  -23.546 68.643  1.00 129.25 ? 7   DT  H C4    1 
ATOM   7973 O O4    . DT  H 4 7   ? -3.300  -23.738 69.868  1.00 131.04 ? 7   DT  H O4    1 
ATOM   7974 C C5    . DT  H 4 7   ? -1.984  -23.101 67.946  1.00 129.22 ? 7   DT  H C5    1 
ATOM   7975 C C7    . DT  H 4 7   ? -0.716  -22.799 68.702  1.00 132.34 ? 7   DT  H C7    1 
ATOM   7976 C C6    . DT  H 4 7   ? -2.028  -22.955 66.613  1.00 126.06 ? 7   DT  H C6    1 
ATOM   7977 P P     . DG  H 4 8   ? -2.826  -20.906 60.469  1.00 121.82 ? 8   DG  H P     1 
ATOM   7978 O OP1   . DG  H 4 8   ? -3.189  -21.464 59.154  1.00 120.92 ? 8   DG  H OP1   1 
ATOM   7979 O OP2   . DG  H 4 8   ? -1.878  -19.768 60.462  1.00 122.25 ? 8   DG  H OP2   1 
ATOM   7980 O "O5'" . DG  H 4 8   ? -4.105  -20.382 61.288  1.00 123.70 ? 8   DG  H "O5'" 1 
ATOM   7981 C "C5'" . DG  H 4 8   ? -5.337  -21.101 61.327  1.00 124.76 ? 8   DG  H "C5'" 1 
ATOM   7982 C "C4'" . DG  H 4 8   ? -6.308  -20.567 62.369  1.00 126.68 ? 8   DG  H "C4'" 1 
ATOM   7983 O "O4'" . DG  H 4 8   ? -5.834  -20.867 63.697  1.00 127.71 ? 8   DG  H "O4'" 1 
ATOM   7984 C "C3'" . DG  H 4 8   ? -6.581  -19.077 62.353  1.00 127.59 ? 8   DG  H "C3'" 1 
ATOM   7985 O "O3'" . DG  H 4 8   ? -7.966  -18.821 62.405  1.00 128.71 ? 8   DG  H "O3'" 1 
ATOM   7986 C "C2'" . DG  H 4 8   ? -5.887  -18.564 63.605  1.00 129.75 ? 8   DG  H "C2'" 1 
ATOM   7987 C "C1'" . DG  H 4 8   ? -6.067  -19.761 64.528  1.00 130.75 ? 8   DG  H "C1'" 1 
ATOM   7988 N N9    . DG  H 4 8   ? -5.136  -19.838 65.654  1.00 133.70 ? 8   DG  H N9    1 
ATOM   7989 C C8    . DG  H 4 8   ? -3.789  -19.544 65.682  1.00 134.35 ? 8   DG  H C8    1 
ATOM   7990 N N7    . DG  H 4 8   ? -3.203  -19.723 66.832  1.00 136.22 ? 8   DG  H N7    1 
ATOM   7991 C C5    . DG  H 4 8   ? -4.249  -20.108 67.648  1.00 137.84 ? 8   DG  H C5    1 
ATOM   7992 C C6    . DG  H 4 8   ? -4.233  -20.436 69.026  1.00 140.98 ? 8   DG  H C6    1 
ATOM   7993 O O6    . DG  H 4 8   ? -3.247  -20.454 69.787  1.00 142.43 ? 8   DG  H O6    1 
ATOM   7994 N N1    . DG  H 4 8   ? -5.509  -20.813 69.481  1.00 142.49 ? 8   DG  H N1    1 
ATOM   7995 C C2    . DG  H 4 8   ? -6.651  -20.844 68.685  1.00 142.41 ? 8   DG  H C2    1 
ATOM   7996 N N2    . DG  H 4 8   ? -7.794  -21.212 69.287  1.00 144.54 ? 8   DG  H N2    1 
ATOM   7997 N N3    . DG  H 4 8   ? -6.681  -20.502 67.392  1.00 139.60 ? 8   DG  H N3    1 
ATOM   7998 C C4    . DG  H 4 8   ? -5.445  -20.170 66.942  1.00 136.81 ? 8   DG  H C4    1 
ATOM   7999 P P     . DG  H 4 9   ? -8.514  -17.608 61.522  1.00 129.87 ? 9   DG  H P     1 
ATOM   8000 O OP1   . DG  H 4 9   ? -9.124  -18.184 60.305  1.00 130.76 ? 9   DG  H OP1   1 
ATOM   8001 O OP2   . DG  H 4 9   ? -7.482  -16.540 61.429  1.00 128.25 ? 9   DG  H OP2   1 
ATOM   8002 O "O5'" . DG  H 4 9   ? -9.718  -17.024 62.384  1.00 133.33 ? 9   DG  H "O5'" 1 
ATOM   8003 C "C5'" . DG  H 4 9   ? -10.709 -17.805 63.046  1.00 134.16 ? 9   DG  H "C5'" 1 
ATOM   8004 C "C4'" . DG  H 4 9   ? -10.934 -17.244 64.445  1.00 134.93 ? 9   DG  H "C4'" 1 
ATOM   8005 O "O4'" . DG  H 4 9   ? -9.774  -17.506 65.266  1.00 131.68 ? 9   DG  H "O4'" 1 
ATOM   8006 C "C3'" . DG  H 4 9   ? -11.177 -15.741 64.558  1.00 137.38 ? 9   DG  H "C3'" 1 
ATOM   8007 O "O3'" . DG  H 4 9   ? -12.559 -15.535 64.811  1.00 142.10 ? 9   DG  H "O3'" 1 
ATOM   8008 C "C2'" . DG  H 4 9   ? -10.283 -15.268 65.707  1.00 135.71 ? 9   DG  H "C2'" 1 
ATOM   8009 C "C1'" . DG  H 4 9   ? -9.719  -16.557 66.294  1.00 132.29 ? 9   DG  H "C1'" 1 
ATOM   8010 N N9    . DG  H 4 9   ? -8.328  -16.556 66.745  1.00 129.50 ? 9   DG  H N9    1 
ATOM   8011 C C8    . DG  H 4 9   ? -7.206  -16.190 66.041  1.00 127.48 ? 9   DG  H C8    1 
ATOM   8012 N N7    . DG  H 4 9   ? -6.089  -16.326 66.696  1.00 126.96 ? 9   DG  H N7    1 
ATOM   8013 C C5    . DG  H 4 9   ? -6.485  -16.861 67.912  1.00 128.74 ? 9   DG  H C5    1 
ATOM   8014 C C6    . DG  H 4 9   ? -5.712  -17.319 69.025  1.00 129.50 ? 9   DG  H C6    1 
ATOM   8015 O O6    . DG  H 4 9   ? -4.483  -17.272 69.190  1.00 129.98 ? 9   DG  H O6    1 
ATOM   8016 N N1    . DG  H 4 9   ? -6.504  -17.846 70.052  1.00 129.87 ? 9   DG  H N1    1 
ATOM   8017 C C2    . DG  H 4 9   ? -7.878  -17.953 70.005  1.00 130.41 ? 9   DG  H C2    1 
ATOM   8018 N N2    . DG  H 4 9   ? -8.467  -18.495 71.081  1.00 130.93 ? 9   DG  H N2    1 
ATOM   8019 N N3    . DG  H 4 9   ? -8.610  -17.576 68.952  1.00 130.93 ? 9   DG  H N3    1 
ATOM   8020 C C4    . DG  H 4 9   ? -7.858  -17.043 67.942  1.00 129.76 ? 9   DG  H C4    1 
ATOM   8021 P P     . DG  H 4 10  ? -13.345 -14.136 64.843  1.00 147.42 ? 10  DG  H P     1 
ATOM   8022 O OP1   . DG  H 4 10  ? -14.704 -14.413 64.327  1.00 151.32 ? 10  DG  H OP1   1 
ATOM   8023 O OP2   . DG  H 4 10  ? -12.527 -13.073 64.214  1.00 147.11 ? 10  DG  H OP2   1 
ATOM   8024 O "O5'" . DG  H 4 10  ? -13.419 -13.839 66.414  1.00 148.96 ? 10  DG  H "O5'" 1 
ATOM   8025 C "C5'" . DG  H 4 10  ? -14.055 -14.718 67.341  1.00 149.98 ? 10  DG  H "C5'" 1 
ATOM   8026 C "C4'" . DG  H 4 10  ? -13.604 -14.429 68.762  1.00 150.89 ? 10  DG  H "C4'" 1 
ATOM   8027 O "O4'" . DG  H 4 10  ? -12.195 -14.727 68.922  1.00 148.18 ? 10  DG  H "O4'" 1 
ATOM   8028 C "C3'" . DG  H 4 10  ? -13.774 -12.979 69.208  1.00 154.72 ? 10  DG  H "C3'" 1 
ATOM   8029 O "O3'" . DG  H 4 10  ? -14.474 -12.924 70.425  1.00 156.37 ? 10  DG  H "O3'" 1 
ATOM   8030 C "C2'" . DG  H 4 10  ? -12.363 -12.438 69.380  1.00 153.57 ? 10  DG  H "C2'" 1 
ATOM   8031 C "C1'" . DG  H 4 10  ? -11.620 -13.717 69.729  1.00 149.94 ? 10  DG  H "C1'" 1 
ATOM   8032 N N9    . DG  H 4 10  ? -10.177 -13.697 69.515  1.00 148.40 ? 10  DG  H N9    1 
ATOM   8033 C C8    . DG  H 4 10  ? -9.483  -13.260 68.406  1.00 147.92 ? 10  DG  H C8    1 
ATOM   8034 N N7    . DG  H 4 10  ? -8.193  -13.419 68.497  1.00 146.39 ? 10  DG  H N7    1 
ATOM   8035 C C5    . DG  H 4 10  ? -8.023  -14.010 69.742  1.00 145.90 ? 10  DG  H C5    1 
ATOM   8036 C C6    . DG  H 4 10  ? -6.837  -14.394 70.417  1.00 144.92 ? 10  DG  H C6    1 
ATOM   8037 O O6    . DG  H 4 10  ? -5.674  -14.301 70.004  1.00 144.13 ? 10  DG  H O6    1 
ATOM   8038 N N1    . DG  H 4 10  ? -7.095  -14.926 71.693  1.00 145.38 ? 10  DG  H N1    1 
ATOM   8039 C C2    . DG  H 4 10  ? -8.352  -15.079 72.251  1.00 145.77 ? 10  DG  H C2    1 
ATOM   8040 N N2    . DG  H 4 10  ? -8.413  -15.599 73.488  1.00 145.54 ? 10  DG  H N2    1 
ATOM   8041 N N3    . DG  H 4 10  ? -9.473  -14.730 71.618  1.00 146.83 ? 10  DG  H N3    1 
ATOM   8042 C C4    . DG  H 4 10  ? -9.234  -14.189 70.385  1.00 146.97 ? 10  DG  H C4    1 
ATOM   8043 P P     . DA  H 4 11  ? -15.558 -11.774 70.644  1.00 169.60 ? 11  DA  H P     1 
ATOM   8044 O OP1   . DA  H 4 11  ? -16.863 -12.459 70.808  1.00 175.78 ? 11  DA  H OP1   1 
ATOM   8045 O OP2   . DA  H 4 11  ? -15.388 -10.713 69.615  1.00 166.80 ? 11  DA  H OP2   1 
ATOM   8046 O "O5'" . DA  H 4 11  ? -15.098 -11.157 72.046  1.00 166.73 ? 11  DA  H "O5'" 1 
ATOM   8047 C "C5'" . DA  H 4 11  ? -14.981 -11.968 73.217  1.00 167.78 ? 11  DA  H "C5'" 1 
ATOM   8048 C "C4'" . DA  H 4 11  ? -13.779 -11.547 74.038  1.00 163.37 ? 11  DA  H "C4'" 1 
ATOM   8049 O "O4'" . DA  H 4 11  ? -12.563 -11.946 73.351  1.00 160.22 ? 11  DA  H "O4'" 1 
ATOM   8050 C "C3'" . DA  H 4 11  ? -13.677 -10.038 74.264  1.00 160.90 ? 11  DA  H "C3'" 1 
ATOM   8051 O "O3'" . DA  H 4 11  ? -14.083 -9.649  75.595  1.00 162.66 ? 11  DA  H "O3'" 1 
ATOM   8052 C "C2'" . DA  H 4 11  ? -12.260 -9.686  73.812  1.00 156.33 ? 11  DA  H "C2'" 1 
ATOM   8053 C "C1'" . DA  H 4 11  ? -11.557 -11.044 73.757  1.00 156.51 ? 11  DA  H "C1'" 1 
ATOM   8054 N N9    . DA  H 4 11  ? -10.407 -11.033 72.844  1.00 153.38 ? 11  DA  H N9    1 
ATOM   8055 C C8    . DA  H 4 11  ? -10.417 -10.629 71.533  1.00 152.08 ? 11  DA  H C8    1 
ATOM   8056 N N7    . DA  H 4 11  ? -9.249  -10.630 70.941  1.00 149.39 ? 11  DA  H N7    1 
ATOM   8057 C C5    . DA  H 4 11  ? -8.390  -11.009 71.951  1.00 148.60 ? 11  DA  H C5    1 
ATOM   8058 C C6    . DA  H 4 11  ? -6.994  -11.187 71.964  1.00 146.34 ? 11  DA  H C6    1 
ATOM   8059 N N6    . DA  H 4 11  ? -6.255  -10.950 70.881  1.00 144.16 ? 11  DA  H N6    1 
ATOM   8060 N N1    . DA  H 4 11  ? -6.405  -11.579 73.126  1.00 147.19 ? 11  DA  H N1    1 
ATOM   8061 C C2    . DA  H 4 11  ? -7.181  -11.799 74.204  1.00 149.18 ? 11  DA  H C2    1 
ATOM   8062 N N3    . DA  H 4 11  ? -8.510  -11.639 74.314  1.00 150.93 ? 11  DA  H N3    1 
ATOM   8063 C C4    . DA  H 4 11  ? -9.072  -11.259 73.140  1.00 150.97 ? 11  DA  H C4    1 
ATOM   8064 P P     . DA  H 4 12  ? -13.208 -9.050  76.808  1.00 161.18 ? 12  DA  H P     1 
ATOM   8065 O OP1   . DA  H 4 12  ? -14.106 -8.988  77.989  1.00 165.48 ? 12  DA  H OP1   1 
ATOM   8066 O OP2   . DA  H 4 12  ? -12.558 -7.789  76.353  1.00 158.31 ? 12  DA  H OP2   1 
ATOM   8067 O "O5'" . DA  H 4 12  ? -12.091 -10.186 77.048  1.00 159.10 ? 12  DA  H "O5'" 1 
ATOM   8068 C "C5'" . DA  H 4 12  ? -11.628 -10.666 78.318  1.00 159.68 ? 12  DA  H "C5'" 1 
ATOM   8069 C "C4'" . DA  H 4 12  ? -10.242 -10.135 78.652  1.00 156.47 ? 12  DA  H "C4'" 1 
ATOM   8070 O "O4'" . DA  H 4 12  ? -9.358  -10.198 77.501  1.00 153.13 ? 12  DA  H "O4'" 1 
ATOM   8071 C "C3'" . DA  H 4 12  ? -10.183 -8.699  79.158  1.00 156.46 ? 12  DA  H "C3'" 1 
ATOM   8072 O "O3'" . DA  H 4 12  ? -9.253  -8.654  80.244  1.00 158.14 ? 12  DA  H "O3'" 1 
ATOM   8073 C "C2'" . DA  H 4 12  ? -9.677  -7.924  77.942  1.00 152.59 ? 12  DA  H "C2'" 1 
ATOM   8074 C "C1'" . DA  H 4 12  ? -8.722  -8.942  77.326  1.00 150.34 ? 12  DA  H "C1'" 1 
ATOM   8075 N N9    . DA  H 4 12  ? -8.346  -8.674  75.925  1.00 146.74 ? 12  DA  H N9    1 
ATOM   8076 C C8    . DA  H 4 12  ? -9.172  -8.326  74.885  1.00 146.17 ? 12  DA  H C8    1 
ATOM   8077 N N7    . DA  H 4 12  ? -8.562  -8.108  73.745  1.00 143.43 ? 12  DA  H N7    1 
ATOM   8078 C C5    . DA  H 4 12  ? -7.229  -8.296  74.060  1.00 141.83 ? 12  DA  H C5    1 
ATOM   8079 C C6    . DA  H 4 12  ? -6.049  -8.223  73.282  1.00 139.67 ? 12  DA  H C6    1 
ATOM   8080 N N6    . DA  H 4 12  ? -6.056  -7.919  71.980  1.00 138.38 ? 12  DA  H N6    1 
ATOM   8081 N N1    . DA  H 4 12  ? -4.864  -8.468  73.894  1.00 139.39 ? 12  DA  H N1    1 
ATOM   8082 C C2    . DA  H 4 12  ? -4.864  -8.801  75.193  1.00 141.02 ? 12  DA  H C2    1 
ATOM   8083 N N3    . DA  H 4 12  ? -5.904  -8.891  76.028  1.00 142.99 ? 12  DA  H N3    1 
ATOM   8084 C C4    . DA  H 4 12  ? -7.071  -8.625  75.400  1.00 143.52 ? 12  DA  H C4    1 
ATOM   8085 P P     . DA  H 4 13  ? -8.907  -7.382  81.170  1.00 160.15 ? 13  DA  H P     1 
ATOM   8086 O OP1   . DA  H 4 13  ? -9.886  -7.400  82.288  1.00 164.34 ? 13  DA  H OP1   1 
ATOM   8087 O OP2   . DA  H 4 13  ? -8.785  -6.118  80.388  1.00 158.28 ? 13  DA  H OP2   1 
ATOM   8088 O "O5'" . DA  H 4 13  ? -7.434  -7.758  81.728  1.00 159.64 ? 13  DA  H "O5'" 1 
ATOM   8089 C "C5'" . DA  H 4 13  ? -6.427  -8.625  81.124  1.00 157.37 ? 13  DA  H "C5'" 1 
ATOM   8090 C "C4'" . DA  H 4 13  ? -5.127  -7.942  80.673  1.00 155.01 ? 13  DA  H "C4'" 1 
ATOM   8091 O "O4'" . DA  H 4 13  ? -5.086  -7.767  79.231  1.00 152.12 ? 13  DA  H "O4'" 1 
ATOM   8092 C "C3'" . DA  H 4 13  ? -4.690  -6.607  81.287  1.00 155.64 ? 13  DA  H "C3'" 1 
ATOM   8093 O "O3'" . DA  H 4 13  ? -3.292  -6.676  81.638  1.00 156.12 ? 13  DA  H "O3'" 1 
ATOM   8094 C "C2'" . DA  H 4 13  ? -4.971  -5.589  80.179  1.00 153.49 ? 13  DA  H "C2'" 1 
ATOM   8095 C "C1'" . DA  H 4 13  ? -4.751  -6.424  78.912  1.00 151.11 ? 13  DA  H "C1'" 1 
ATOM   8096 N N9    . DA  H 4 13  ? -5.499  -6.001  77.715  1.00 149.55 ? 13  DA  H N9    1 
ATOM   8097 C C8    . DA  H 4 13  ? -6.855  -5.802  77.599  1.00 150.59 ? 13  DA  H C8    1 
ATOM   8098 N N7    . DA  H 4 13  ? -7.264  -5.430  76.409  1.00 148.94 ? 13  DA  H N7    1 
ATOM   8099 C C5    . DA  H 4 13  ? -6.090  -5.374  75.679  1.00 146.45 ? 13  DA  H C5    1 
ATOM   8100 C C6    . DA  H 4 13  ? -5.833  -5.068  74.324  1.00 144.41 ? 13  DA  H C6    1 
ATOM   8101 N N6    . DA  H 4 13  ? -6.792  -4.725  73.454  1.00 144.37 ? 13  DA  H N6    1 
ATOM   8102 N N1    . DA  H 4 13  ? -4.544  -5.132  73.897  1.00 143.00 ? 13  DA  H N1    1 
ATOM   8103 C C2    . DA  H 4 13  ? -3.575  -5.488  74.761  1.00 143.59 ? 13  DA  H C2    1 
ATOM   8104 N N3    . DA  H 4 13  ? -3.698  -5.793  76.056  1.00 145.52 ? 13  DA  H N3    1 
ATOM   8105 C C4    . DA  H 4 13  ? -4.988  -5.714  76.463  1.00 146.87 ? 13  DA  H C4    1 
ATOM   8106 P P     . DG  H 4 14  ? -2.427  -5.566  82.430  1.00 158.20 ? 14  DG  H P     1 
ATOM   8107 O OP1   . DG  H 4 14  ? -1.517  -6.258  83.379  1.00 160.89 ? 14  DG  H OP1   1 
ATOM   8108 O OP2   . DG  H 4 14  ? -3.296  -4.453  82.902  1.00 159.85 ? 14  DG  H OP2   1 
ATOM   8109 O "O5'" . DG  H 4 14  ? -1.541  -4.949  81.257  1.00 154.95 ? 14  DG  H "O5'" 1 
ATOM   8110 C "C5'" . DG  H 4 14  ? -0.552  -5.674  80.521  1.00 152.35 ? 14  DG  H "C5'" 1 
ATOM   8111 C "C4'" . DG  H 4 14  ? -0.070  -4.817  79.362  1.00 148.98 ? 14  DG  H "C4'" 1 
ATOM   8112 O "O4'" . DG  H 4 14  ? -1.180  -4.547  78.474  1.00 146.50 ? 14  DG  H "O4'" 1 
ATOM   8113 C "C3'" . DG  H 4 14  ? 0.515   -3.455  79.734  1.00 149.84 ? 14  DG  H "C3'" 1 
ATOM   8114 O "O3'" . DG  H 4 14  ? 1.755   -3.328  79.064  1.00 148.19 ? 14  DG  H "O3'" 1 
ATOM   8115 C "C2'" . DG  H 4 14  ? -0.532  -2.429  79.283  1.00 149.51 ? 14  DG  H "C2'" 1 
ATOM   8116 C "C1'" . DG  H 4 14  ? -1.159  -3.181  78.121  1.00 146.58 ? 14  DG  H "C1'" 1 
ATOM   8117 N N9    . DG  H 4 14  ? -2.488  -2.805  77.651  1.00 146.19 ? 14  DG  H N9    1 
ATOM   8118 C C8    . DG  H 4 14  ? -3.691  -2.816  78.319  1.00 147.78 ? 14  DG  H C8    1 
ATOM   8119 N N7    . DG  H 4 14  ? -4.715  -2.520  77.565  1.00 147.33 ? 14  DG  H N7    1 
ATOM   8120 C C5    . DG  H 4 14  ? -4.160  -2.357  76.298  1.00 145.40 ? 14  DG  H C5    1 
ATOM   8121 C C6    . DG  H 4 14  ? -4.755  -2.038  75.038  1.00 144.77 ? 14  DG  H C6    1 
ATOM   8122 O O6    . DG  H 4 14  ? -5.952  -1.855  74.771  1.00 145.99 ? 14  DG  H O6    1 
ATOM   8123 N N1    . DG  H 4 14  ? -3.816  -1.986  73.995  1.00 142.89 ? 14  DG  H N1    1 
ATOM   8124 C C2    . DG  H 4 14  ? -2.462  -2.226  74.151  1.00 142.51 ? 14  DG  H C2    1 
ATOM   8125 N N2    . DG  H 4 14  ? -1.686  -2.109  73.067  1.00 141.65 ? 14  DG  H N2    1 
ATOM   8126 N N3    . DG  H 4 14  ? -1.890  -2.495  75.319  1.00 143.47 ? 14  DG  H N3    1 
ATOM   8127 C C4    . DG  H 4 14  ? -2.790  -2.541  76.343  1.00 144.64 ? 14  DG  H C4    1 
ATOM   8128 P P     . DA  H 4 15  ? 2.885   -2.255  79.412  1.00 150.24 ? 15  DA  H P     1 
ATOM   8129 O OP1   . DA  H 4 15  ? 4.153   -3.017  79.544  1.00 152.14 ? 15  DA  H OP1   1 
ATOM   8130 O OP2   . DA  H 4 15  ? 2.425   -1.344  80.488  1.00 153.15 ? 15  DA  H OP2   1 
ATOM   8131 O "O5'" . DA  H 4 15  ? 2.925   -1.379  78.071  1.00 147.13 ? 15  DA  H "O5'" 1 
ATOM   8132 C "C5'" . DA  H 4 15  ? 3.468   -1.843  76.822  1.00 143.51 ? 15  DA  H "C5'" 1 
ATOM   8133 C "C4'" . DA  H 4 15  ? 3.061   -0.938  75.670  1.00 140.44 ? 15  DA  H "C4'" 1 
ATOM   8134 O "O4'" . DA  H 4 15  ? 1.616   -0.924  75.648  1.00 138.14 ? 15  DA  H "O4'" 1 
ATOM   8135 C "C3'" . DA  H 4 15  ? 3.510   0.526   75.763  1.00 142.77 ? 15  DA  H "C3'" 1 
ATOM   8136 O "O3'" . DA  H 4 15  ? 4.544   0.825   74.834  1.00 142.60 ? 15  DA  H "O3'" 1 
ATOM   8137 C "C2'" . DA  H 4 15  ? 2.251   1.362   75.534  1.00 142.02 ? 15  DA  H "C2'" 1 
ATOM   8138 C "C1'" . DA  H 4 15  ? 1.205   0.321   75.130  1.00 138.12 ? 15  DA  H "C1'" 1 
ATOM   8139 N N9    . DA  H 4 15  ? -0.190  0.575   75.515  1.00 136.95 ? 15  DA  H N9    1 
ATOM   8140 C C8    . DA  H 4 15  ? -0.714  0.564   76.780  1.00 138.29 ? 15  DA  H C8    1 
ATOM   8141 N N7    . DA  H 4 15  ? -2.003  0.806   76.833  1.00 138.06 ? 15  DA  H N7    1 
ATOM   8142 C C5    . DA  H 4 15  ? -2.367  0.929   75.505  1.00 135.48 ? 15  DA  H C5    1 
ATOM   8143 C C6    . DA  H 4 15  ? -3.616  1.162   74.882  1.00 134.42 ? 15  DA  H C6    1 
ATOM   8144 N N6    . DA  H 4 15  ? -4.755  1.295   75.582  1.00 136.11 ? 15  DA  H N6    1 
ATOM   8145 N N1    . DA  H 4 15  ? -3.639  1.194   73.513  1.00 131.96 ? 15  DA  H N1    1 
ATOM   8146 C C2    . DA  H 4 15  ? -2.502  1.036   72.803  1.00 129.76 ? 15  DA  H C2    1 
ATOM   8147 N N3    . DA  H 4 15  ? -1.277  0.794   73.290  1.00 130.48 ? 15  DA  H N3    1 
ATOM   8148 C C4    . DA  H 4 15  ? -1.267  0.773   74.660  1.00 134.14 ? 15  DA  H C4    1 
HETATM 8149 C C1    . EDO I 5 .   ? -0.955  -18.652 43.053  1.00 85.57  ? 501 EDO A C1    1 
HETATM 8150 O O1    . EDO I 5 .   ? -2.021  -17.772 42.666  1.00 89.24  ? 501 EDO A O1    1 
HETATM 8151 C C2    . EDO I 5 .   ? -1.465  -20.012 43.649  1.00 83.68  ? 501 EDO A C2    1 
HETATM 8152 O O2    . EDO I 5 .   ? -2.147  -20.866 42.709  1.00 83.87  ? 501 EDO A O2    1 
HETATM 8153 O O     . HOH J 6 .   ? -9.248  -28.590 46.277  1.00 83.82  ? 601 HOH A O     1 
HETATM 8154 O O     . HOH J 6 .   ? 5.698   -25.597 51.468  1.00 78.58  ? 602 HOH A O     1 
HETATM 8155 O O     . HOH J 6 .   ? 17.907  -19.433 28.003  1.00 75.04  ? 603 HOH A O     1 
HETATM 8156 O O     . HOH K 6 .   ? -10.115 -18.413 -7.240  1.00 74.14  ? 501 HOH C O     1 
HETATM 8157 O O     . HOH K 6 .   ? -13.762 -11.621 23.085  1.00 69.53  ? 502 HOH C O     1 
HETATM 8158 O O     . HOH K 6 .   ? -11.808 -3.710  3.269   1.00 67.23  ? 503 HOH C O     1 
HETATM 8159 O O     . HOH K 6 .   ? -7.606  -15.969 14.760  1.00 66.56  ? 504 HOH C O     1 
HETATM 8160 O O     . HOH K 6 .   ? 2.832   -19.572 11.508  1.00 70.78  ? 505 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . PRO A 6   ? 0.8754 2.1249 2.4229 0.1292  -0.1979 0.0420  53  PRO A N     
2    C CA    . PRO A 6   ? 0.8549 2.1453 2.4481 0.0791  -0.1875 0.0271  53  PRO A CA    
3    C C     . PRO A 6   ? 0.8956 2.0933 2.4191 0.0453  -0.1623 0.0138  53  PRO A C     
4    O O     . PRO A 6   ? 0.8973 2.0553 2.4069 0.0554  -0.1204 0.0153  53  PRO A O     
5    C CB    . PRO A 6   ? 0.8740 2.2407 2.5562 0.0978  -0.1562 0.0351  53  PRO A CB    
6    C CG    . PRO A 6   ? 0.9513 2.2804 2.6090 0.1577  -0.1364 0.0520  53  PRO A CG    
7    C CD    . PRO A 6   ? 0.9044 2.1473 2.4690 0.1735  -0.1592 0.0546  53  PRO A CD    
8    N N     . PRO A 7   ? 0.8339 1.9975 2.3122 0.0070  -0.1863 0.0015  54  PRO A N     
9    C CA    . PRO A 7   ? 0.8199 1.8961 2.2299 -0.0205 -0.1634 -0.0081 54  PRO A CA    
10   C C     . PRO A 7   ? 0.8164 1.8842 2.2449 -0.0381 -0.1172 -0.0122 54  PRO A C     
11   O O     . PRO A 7   ? 0.8183 1.9576 2.3239 -0.0519 -0.1046 -0.0143 54  PRO A O     
12   C CB    . PRO A 7   ? 0.8454 1.9144 2.2311 -0.0604 -0.1956 -0.0205 54  PRO A CB    
13   C CG    . PRO A 7   ? 0.9053 2.0689 2.3566 -0.0619 -0.2333 -0.0204 54  PRO A CG    
14   C CD    . PRO A 7   ? 0.8528 2.0504 2.3322 -0.0089 -0.2352 -0.0029 54  PRO A CD    
15   N N     . LYS A 8   ? 0.7075 1.6887 2.0635 -0.0378 -0.0922 -0.0127 55  LYS A N     
16   C CA    . LYS A 8   ? 0.6832 1.6358 2.0322 -0.0490 -0.0473 -0.0141 55  LYS A CA    
17   C C     . LYS A 8   ? 0.6889 1.5663 1.9662 -0.0762 -0.0392 -0.0198 55  LYS A C     
18   O O     . LYS A 8   ? 0.6659 1.4880 1.8771 -0.0704 -0.0567 -0.0192 55  LYS A O     
19   C CB    . LYS A 8   ? 0.7167 1.6405 2.0458 -0.0102 -0.0181 -0.0053 55  LYS A CB    
20   C CG    . LYS A 8   ? 0.8728 1.8653 2.2767 0.0181  -0.0047 0.0022  55  LYS A CG    
21   C CD    . LYS A 8   ? 0.9755 1.9235 2.3466 0.0539  0.0301  0.0087  55  LYS A CD    
22   C CE    . LYS A 8   ? 1.1249 2.0359 2.4525 0.0911  0.0130  0.0149  55  LYS A CE    
23   N NZ    . LYS A 8   ? 1.2060 2.0385 2.4453 0.0797  -0.0048 0.0103  55  LYS A NZ    
24   N N     . ARG A 9   ? 0.6251 1.5001 1.9162 -0.1026 -0.0084 -0.0235 56  ARG A N     
25   C CA    . ARG A 9   ? 0.6241 1.4323 1.8539 -0.1248 0.0066  -0.0257 56  ARG A CA    
26   C C     . ARG A 9   ? 0.6848 1.4313 1.8489 -0.0998 0.0276  -0.0178 56  ARG A C     
27   O O     . ARG A 9   ? 0.6887 1.4465 1.8654 -0.0727 0.0431  -0.0130 56  ARG A O     
28   C CB    . ARG A 9   ? 0.6009 1.4257 1.8678 -0.1577 0.0374  -0.0300 56  ARG A CB    
29   C CG    . ARG A 9   ? 0.6607 1.5145 1.9586 -0.1959 0.0158  -0.0416 56  ARG A CG    
30   C CD    . ARG A 9   ? 0.8330 1.6357 2.0981 -0.2294 0.0410  -0.0455 56  ARG A CD    
31   N NE    . ARG A 9   ? 1.0429 1.8221 2.2785 -0.2547 0.0127  -0.0553 56  ARG A NE    
32   C CZ    . ARG A 9   ? 1.2952 2.0120 2.4816 -0.2779 0.0281  -0.0577 56  ARG A CZ    
33   N NH1   . ARG A 9   ? 1.0378 1.7117 2.1994 -0.2785 0.0705  -0.0495 56  ARG A NH1   
34   N NH2   . ARG A 9   ? 1.2068 1.9008 2.3645 -0.2985 0.0027  -0.0673 56  ARG A NH2   
35   N N     . LEU A 10  ? 0.6405 1.3237 1.7343 -0.1081 0.0283  -0.0165 57  LEU A N     
36   C CA    . LEU A 10  ? 0.6434 1.2760 1.6761 -0.0879 0.0457  -0.0098 57  LEU A CA    
37   C C     . LEU A 10  ? 0.7123 1.3384 1.7478 -0.0905 0.0889  -0.0057 57  LEU A C     
38   O O     . LEU A 10  ? 0.7302 1.3595 1.7828 -0.1146 0.1064  -0.0061 57  LEU A O     
39   C CB    . LEU A 10  ? 0.6397 1.2165 1.6007 -0.0929 0.0316  -0.0077 57  LEU A CB    
40   C CG    . LEU A 10  ? 0.7045 1.2389 1.6034 -0.0720 0.0373  -0.0026 57  LEU A CG    
41   C CD1   . LEU A 10  ? 0.7016 1.2383 1.5958 -0.0507 0.0136  -0.0047 57  LEU A CD1   
42   C CD2   . LEU A 10  ? 0.7006 1.1893 1.5373 -0.0812 0.0338  0.0021  57  LEU A CD2   
43   N N     . THR A 11  ? 0.6698 1.2845 1.6872 -0.0662 0.1079  -0.0021 58  THR A N     
44   C CA    . THR A 11  ? 0.6831 1.2862 1.6921 -0.0645 0.1499  0.0025  58  THR A CA    
45   C C     . THR A 11  ? 0.7096 1.2547 1.6365 -0.0608 0.1571  0.0078  58  THR A C     
46   O O     . THR A 11  ? 0.6916 1.2117 1.5750 -0.0530 0.1320  0.0068  58  THR A O     
47   C CB    . THR A 11  ? 0.8655 1.4983 1.9125 -0.0417 0.1713  0.0023  58  THR A CB    
48   O OG1   . THR A 11  ? 0.9865 1.6064 2.0238 -0.0440 0.2142  0.0068  58  THR A OG1   
49   C CG2   . THR A 11  ? 0.8310 1.4390 1.8392 -0.0129 0.1608  0.0010  58  THR A CG2   
50   N N     . ARG A 12  ? 0.6781 1.2040 1.5836 -0.0668 0.1913  0.0143  59  ARG A N     
51   C CA    . ARG A 12  ? 0.6819 1.1604 1.5101 -0.0620 0.1997  0.0218  59  ARG A CA    
52   C C     . ARG A 12  ? 0.7554 1.2168 1.5414 -0.0406 0.1934  0.0182  59  ARG A C     
53   O O     . ARG A 12  ? 0.7226 1.1562 1.4532 -0.0390 0.1753  0.0197  59  ARG A O     
54   C CB    . ARG A 12  ? 0.6513 1.1150 1.4654 -0.0677 0.2403  0.0312  59  ARG A CB    
55   C CG    . ARG A 12  ? 0.7556 1.2159 1.5882 -0.0911 0.2478  0.0359  59  ARG A CG    
56   C CD    . ARG A 12  ? 0.9227 1.3558 1.7263 -0.0942 0.2889  0.0484  59  ARG A CD    
57   N NE    . ARG A 12  ? 1.0752 1.4685 1.8000 -0.0821 0.2877  0.0602  59  ARG A NE    
58   C CZ    . ARG A 12  ? 1.3762 1.7437 2.0569 -0.0750 0.3195  0.0735  59  ARG A CZ    
59   N NH1   . ARG A 12  ? 1.2402 1.6114 1.9450 -0.0790 0.3584  0.0764  59  ARG A NH1   
60   N NH2   . ARG A 12  ? 1.3174 1.6586 1.9297 -0.0630 0.3128  0.0850  59  ARG A NH2   
61   N N     . GLU A 13  ? 0.7419 1.2212 1.5575 -0.0248 0.2075  0.0126  60  GLU A N     
62   C CA    . GLU A 13  ? 0.7626 1.2198 1.5397 -0.0050 0.2059  0.0068  60  GLU A CA    
63   C C     . GLU A 13  ? 0.7987 1.2451 1.5581 -0.0029 0.1662  0.0020  60  GLU A C     
64   O O     . GLU A 13  ? 0.7934 1.2053 1.4907 -0.0015 0.1568  0.0000  60  GLU A O     
65   C CB    . GLU A 13  ? 0.7973 1.2777 1.6202 0.0127  0.2285  0.0031  60  GLU A CB    
66   C CG    . GLU A 13  ? 0.9833 1.4326 1.7647 0.0343  0.2339  -0.0039 60  GLU A CG    
67   C CD    . GLU A 13  ? 1.4271 1.8956 2.2512 0.0559  0.2637  -0.0056 60  GLU A CD    
68   O OE1   . GLU A 13  ? 1.1880 1.7088 2.0917 0.0583  0.2646  -0.0023 60  GLU A OE1   
69   O OE2   . GLU A 13  ? 1.4381 1.8701 2.2148 0.0701  0.2870  -0.0105 60  GLU A OE2   
70   N N     . ALA A 14  ? 0.7278 1.2057 1.5412 -0.0048 0.1431  0.0005  61  ALA A N     
71   C CA    . ALA A 14  ? 0.6913 1.1604 1.4916 -0.0036 0.1065  -0.0023 61  ALA A CA    
72   C C     . ALA A 14  ? 0.6962 1.1395 1.4485 -0.0202 0.0910  0.0013  61  ALA A C     
73   O O     . ALA A 14  ? 0.7007 1.1171 1.4080 -0.0175 0.0726  -0.0007 61  ALA A O     
74   C CB    . ALA A 14  ? 0.6782 1.1913 1.5455 -0.0049 0.0860  -0.0030 61  ALA A CB    
75   N N     . MET A 15  ? 0.6168 1.0663 1.3773 -0.0368 0.1007  0.0072  62  MET A N     
76   C CA    . MET A 15  ? 0.5933 1.0177 1.3074 -0.0479 0.0892  0.0132  62  MET A CA    
77   C C     . MET A 15  ? 0.6771 1.0734 1.3273 -0.0408 0.0972  0.0158  62  MET A C     
78   O O     . MET A 15  ? 0.6860 1.0662 1.2991 -0.0412 0.0761  0.0152  62  MET A O     
79   C CB    . MET A 15  ? 0.6057 1.0322 1.3329 -0.0644 0.1020  0.0202  62  MET A CB    
80   C CG    . MET A 15  ? 0.6338 1.0328 1.3114 -0.0702 0.0924  0.0287  62  MET A CG    
81   S SD    . MET A 15  ? 0.6444 1.0387 1.3234 -0.0794 0.0560  0.0257  62  MET A SD    
82   C CE    . MET A 15  ? 0.5867 0.9700 1.2276 -0.0675 0.0370  0.0238  62  MET A CE    
83   N N     . ARG A 16  ? 0.6460 1.0387 1.2843 -0.0348 0.1273  0.0173  63  ARG A N     
84   C CA    . ARG A 16  ? 0.6558 1.0252 1.2315 -0.0295 0.1366  0.0181  63  ARG A CA    
85   C C     . ARG A 16  ? 0.7364 1.0900 1.2833 -0.0246 0.1164  0.0080  63  ARG A C     
86   O O     . ARG A 16  ? 0.7699 1.1098 1.2688 -0.0301 0.1015  0.0092  63  ARG A O     
87   C CB    . ARG A 16  ? 0.6558 1.0236 1.2289 -0.0220 0.1728  0.0184  63  ARG A CB    
88   C CG    . ARG A 16  ? 0.8059 1.1767 1.3819 -0.0280 0.1974  0.0313  63  ARG A CG    
89   C CD    . ARG A 16  ? 0.9426 1.3098 1.5137 -0.0200 0.2355  0.0317  63  ARG A CD    
90   N NE    . ARG A 16  ? 1.0422 1.4115 1.6261 -0.0263 0.2629  0.0442  63  ARG A NE    
91   C CZ    . ARG A 16  ? 1.5148 1.9040 2.1586 -0.0308 0.2853  0.0438  63  ARG A CZ    
92   N NH1   . ARG A 16  ? 1.4791 1.8940 2.1774 -0.0263 0.2829  0.0330  63  ARG A NH1   
93   N NH2   . ARG A 16  ? 1.5561 1.9402 2.2054 -0.0392 0.3124  0.0552  63  ARG A NH2   
94   N N     . ASN A 17  ? 0.6955 1.0528 1.2742 -0.0145 0.1150  -0.0009 64  ASN A N     
95   C CA    . ASN A 17  ? 0.7107 1.0459 1.2650 -0.0079 0.1002  -0.0106 64  ASN A CA    
96   C C     . ASN A 17  ? 0.7666 1.0949 1.3052 -0.0170 0.0674  -0.0098 64  ASN A C     
97   O O     . ASN A 17  ? 0.7955 1.0984 1.2858 -0.0208 0.0585  -0.0154 64  ASN A O     
98   C CB    . ASN A 17  ? 0.6897 1.0325 1.2877 0.0097  0.1082  -0.0161 64  ASN A CB    
99   C CG    . ASN A 17  ? 1.0212 1.3580 1.6158 0.0213  0.1439  -0.0195 64  ASN A CG    
100  O OD1   . ASN A 17  ? 0.9856 1.2977 1.5254 0.0172  0.1597  -0.0223 64  ASN A OD1   
101  N ND2   . ASN A 17  ? 0.9868 1.3492 1.6399 0.0361  0.1577  -0.0187 64  ASN A ND2   
102  N N     . TYR A 18  ? 0.6825 1.0318 1.2585 -0.0228 0.0513  -0.0035 65  TYR A N     
103  C CA    . TYR A 18  ? 0.6564 0.9988 1.2181 -0.0309 0.0229  -0.0015 65  TYR A CA    
104  C C     . TYR A 18  ? 0.7109 1.0431 1.2228 -0.0413 0.0214  0.0041  65  TYR A C     
105  O O     . TYR A 18  ? 0.7129 1.0302 1.1898 -0.0462 0.0055  0.0017  65  TYR A O     
106  C CB    . TYR A 18  ? 0.6466 1.0113 1.2539 -0.0364 0.0102  0.0030  65  TYR A CB    
107  C CG    . TYR A 18  ? 0.6692 1.0241 1.2545 -0.0461 -0.0123 0.0073  65  TYR A CG    
108  C CD1   . TYR A 18  ? 0.6968 1.0371 1.2669 -0.0437 -0.0346 0.0037  65  TYR A CD1   
109  C CD2   . TYR A 18  ? 0.6819 1.0374 1.2553 -0.0558 -0.0077 0.0162  65  TYR A CD2   
110  C CE1   . TYR A 18  ? 0.6956 1.0259 1.2428 -0.0523 -0.0521 0.0081  65  TYR A CE1   
111  C CE2   . TYR A 18  ? 0.6817 1.0273 1.2341 -0.0623 -0.0249 0.0212  65  TYR A CE2   
112  C CZ    . TYR A 18  ? 0.7370 1.0716 1.2772 -0.0610 -0.0471 0.0167  65  TYR A CZ    
113  O OH    . TYR A 18  ? 0.7191 1.0441 1.2386 -0.0669 -0.0609 0.0221  65  TYR A OH    
114  N N     . LEU A 19  ? 0.6594 1.0014 1.1688 -0.0442 0.0388  0.0128  66  LEU A N     
115  C CA    . LEU A 19  ? 0.6648 1.0045 1.1299 -0.0498 0.0386  0.0220  66  LEU A CA    
116  C C     . LEU A 19  ? 0.7630 1.0915 1.1774 -0.0513 0.0391  0.0156  66  LEU A C     
117  O O     . LEU A 19  ? 0.7529 1.0846 1.1334 -0.0581 0.0266  0.0202  66  LEU A O     
118  C CB    . LEU A 19  ? 0.6688 1.0167 1.1394 -0.0489 0.0608  0.0342  66  LEU A CB    
119  C CG    . LEU A 19  ? 0.6807 1.0343 1.1902 -0.0534 0.0606  0.0405  66  LEU A CG    
120  C CD1   . LEU A 19  ? 0.6936 1.0490 1.2149 -0.0529 0.0907  0.0489  66  LEU A CD1   
121  C CD2   . LEU A 19  ? 0.6075 0.9568 1.0994 -0.0576 0.0423  0.0487  66  LEU A CD2   
122  N N     . LYS A 20  ? 0.7951 1.1108 1.2046 -0.0458 0.0531  0.0040  67  LYS A N     
123  C CA    . LYS A 20  ? 0.8462 1.1428 1.2034 -0.0501 0.0552  -0.0068 67  LYS A CA    
124  C C     . LYS A 20  ? 0.9375 1.2204 1.2762 -0.0596 0.0305  -0.0144 67  LYS A C     
125  O O     . LYS A 20  ? 0.9582 1.2425 1.2550 -0.0722 0.0210  -0.0154 67  LYS A O     
126  C CB    . LYS A 20  ? 0.9010 1.1795 1.2599 -0.0397 0.0797  -0.0180 67  LYS A CB    
127  C CG    . LYS A 20  ? 0.9525 1.2403 1.3112 -0.0336 0.1080  -0.0113 67  LYS A CG    
128  C CD    . LYS A 20  ? 1.0754 1.3544 1.4604 -0.0195 0.1349  -0.0185 67  LYS A CD    
129  C CE    . LYS A 20  ? 1.1573 1.4429 1.5377 -0.0149 0.1659  -0.0115 67  LYS A CE    
130  N NZ    . LYS A 20  ? 1.1744 1.4625 1.5985 -0.0006 0.1933  -0.0151 67  LYS A NZ    
131  N N     . GLU A 21  ? 0.9175 1.1912 1.2880 -0.0542 0.0196  -0.0180 68  GLU A N     
132  C CA    . GLU A 21  ? 0.9409 1.1978 1.2956 -0.0621 -0.0016 -0.0230 68  GLU A CA    
133  C C     . GLU A 21  ? 0.9995 1.2711 1.3911 -0.0601 -0.0196 -0.0133 68  GLU A C     
134  O O     . GLU A 21  ? 1.0253 1.2974 1.4558 -0.0487 -0.0214 -0.0136 68  GLU A O     
135  C CB    . GLU A 21  ? 0.9975 1.2180 1.3435 -0.0549 0.0043  -0.0366 68  GLU A CB    
136  C CG    . GLU A 21  ? 1.1586 1.3810 1.5537 -0.0338 0.0123  -0.0356 68  GLU A CG    
137  C CD    . GLU A 21  ? 1.5330 1.7304 1.9182 -0.0206 0.0373  -0.0456 68  GLU A CD    
138  O OE1   . GLU A 21  ? 1.5137 1.6702 1.8651 -0.0199 0.0398  -0.0559 68  GLU A OE1   
139  O OE2   . GLU A 21  ? 1.3969 1.6124 1.8065 -0.0111 0.0571  -0.0431 68  GLU A OE2   
140  N N     . ARG A 22  ? 0.9064 1.1919 1.2863 -0.0701 -0.0324 -0.0043 69  ARG A N     
141  C CA    . ARG A 22  ? 0.8590 1.1537 1.2677 -0.0687 -0.0467 0.0044  69  ARG A CA    
142  C C     . ARG A 22  ? 0.9170 1.1911 1.3266 -0.0687 -0.0650 -0.0005 69  ARG A C     
143  O O     . ARG A 22  ? 0.9088 1.1823 1.3090 -0.0755 -0.0792 0.0048  69  ARG A O     
144  C CB    . ARG A 22  ? 0.7873 1.1025 1.1877 -0.0739 -0.0475 0.0184  69  ARG A CB    
145  C CG    . ARG A 22  ? 0.8335 1.1630 1.2359 -0.0692 -0.0263 0.0248  69  ARG A CG    
146  C CD    . ARG A 22  ? 0.7102 1.0576 1.0899 -0.0704 -0.0227 0.0401  69  ARG A CD    
147  N NE    . ARG A 22  ? 0.8375 1.1921 1.2149 -0.0638 -0.0003 0.0469  69  ARG A NE    
148  C CZ    . ARG A 22  ? 1.0709 1.4360 1.4423 -0.0583 0.0103  0.0641  69  ARG A CZ    
149  N NH1   . ARG A 22  ? 0.9517 1.3230 1.3207 -0.0574 0.0010  0.0763  69  ARG A NH1   
150  N NH2   . ARG A 22  ? 0.7989 1.1651 1.1646 -0.0519 0.0328  0.0702  69  ARG A NH2   
151  N N     . GLY A 23  ? 0.8652 1.1223 1.2865 -0.0582 -0.0619 -0.0090 70  GLY A N     
152  C CA    . GLY A 23  ? 0.8616 1.0937 1.2798 -0.0530 -0.0746 -0.0127 70  GLY A CA    
153  C C     . GLY A 23  ? 0.8762 1.1184 1.3260 -0.0466 -0.0914 -0.0064 70  GLY A C     
154  O O     . GLY A 23  ? 0.8831 1.1253 1.3593 -0.0318 -0.0943 -0.0078 70  GLY A O     
155  N N     . ASP A 24  ? 0.7547 1.0060 1.2000 -0.0568 -0.1026 0.0009  71  ASP A N     
156  C CA    . ASP A 24  ? 0.6917 0.9491 1.1591 -0.0540 -0.1184 0.0053  71  ASP A CA    
157  C C     . ASP A 24  ? 0.7020 0.9336 1.1504 -0.0509 -0.1343 0.0052  71  ASP A C     
158  O O     . ASP A 24  ? 0.6946 0.9028 1.1084 -0.0567 -0.1329 0.0034  71  ASP A O     
159  C CB    . ASP A 24  ? 0.6749 0.9445 1.1402 -0.0644 -0.1193 0.0131  71  ASP A CB    
160  C CG    . ASP A 24  ? 0.7315 1.0221 1.2129 -0.0668 -0.1026 0.0164  71  ASP A CG    
161  O OD1   . ASP A 24  ? 0.7696 1.0744 1.2858 -0.0632 -0.0979 0.0139  71  ASP A OD1   
162  O OD2   . ASP A 24  ? 0.8421 1.1369 1.3023 -0.0723 -0.0947 0.0233  71  ASP A OD2   
163  N N     . GLN A 25  ? 0.6514 0.8880 1.1207 -0.0438 -0.1495 0.0071  72  GLN A N     
164  C CA    . GLN A 25  ? 0.6630 0.8764 1.1147 -0.0383 -0.1666 0.0093  72  GLN A CA    
165  C C     . GLN A 25  ? 0.7005 0.9171 1.1457 -0.0489 -0.1770 0.0138  72  GLN A C     
166  O O     . GLN A 25  ? 0.7221 0.9610 1.1943 -0.0516 -0.1807 0.0134  72  GLN A O     
167  C CB    . GLN A 25  ? 0.6911 0.9138 1.1716 -0.0195 -0.1769 0.0089  72  GLN A CB    
168  C CG    . GLN A 25  ? 0.6889 0.9072 1.1787 -0.0044 -0.1624 0.0055  72  GLN A CG    
169  C CD    . GLN A 25  ? 0.8338 1.0732 1.3613 0.0176  -0.1714 0.0080  72  GLN A CD    
170  O OE1   . GLN A 25  ? 0.7655 0.9863 1.2800 0.0328  -0.1841 0.0129  72  GLN A OE1   
171  N NE2   . GLN A 25  ? 0.6019 0.8821 1.1771 0.0215  -0.1631 0.0059  72  GLN A NE2   
172  N N     . THR A 26  ? 0.6348 0.8288 1.0440 -0.0567 -0.1783 0.0176  73  THR A N     
173  C CA    . THR A 26  ? 0.6302 0.8207 1.0259 -0.0652 -0.1839 0.0228  73  THR A CA    
174  C C     . THR A 26  ? 0.7310 0.8931 1.1012 -0.0607 -0.1991 0.0252  73  THR A C     
175  O O     . THR A 26  ? 0.7436 0.8812 1.0920 -0.0563 -0.1994 0.0255  73  THR A O     
176  C CB    . THR A 26  ? 0.7320 0.9257 1.1083 -0.0764 -0.1703 0.0280  73  THR A CB    
177  O OG1   . THR A 26  ? 0.7449 0.9640 1.1405 -0.0785 -0.1571 0.0282  73  THR A OG1   
178  C CG2   . THR A 26  ? 0.6885 0.8740 1.0465 -0.0817 -0.1719 0.0354  73  THR A CG2   
179  N N     . VAL A 27  ? 0.6911 0.8519 1.0589 -0.0629 -0.2097 0.0266  74  VAL A N     
180  C CA    . VAL A 27  ? 0.7156 0.8483 1.0527 -0.0593 -0.2236 0.0298  74  VAL A CA    
181  C C     . VAL A 27  ? 0.7795 0.9009 1.0931 -0.0698 -0.2169 0.0343  74  VAL A C     
182  O O     . VAL A 27  ? 0.7717 0.9053 1.0976 -0.0760 -0.2133 0.0327  74  VAL A O     
183  C CB    . VAL A 27  ? 0.7659 0.9047 1.1145 -0.0499 -0.2453 0.0269  74  VAL A CB    
184  C CG1   . VAL A 27  ? 0.7877 0.8951 1.0957 -0.0475 -0.2586 0.0311  74  VAL A CG1   
185  C CG2   . VAL A 27  ? 0.7718 0.9202 1.1414 -0.0337 -0.2499 0.0262  74  VAL A CG2   
186  N N     . LEU A 28  ? 0.7516 0.8480 1.0317 -0.0718 -0.2123 0.0402  75  LEU A N     
187  C CA    . LEU A 28  ? 0.7476 0.8324 1.0039 -0.0788 -0.2037 0.0466  75  LEU A CA    
188  C C     . LEU A 28  ? 0.8479 0.8982 1.0686 -0.0749 -0.2147 0.0488  75  LEU A C     
189  O O     . LEU A 28  ? 0.8784 0.9076 1.0812 -0.0695 -0.2201 0.0505  75  LEU A O     
190  C CB    . LEU A 28  ? 0.7334 0.8216 0.9797 -0.0857 -0.1883 0.0528  75  LEU A CB    
191  C CG    . LEU A 28  ? 0.7412 0.8632 1.0102 -0.0911 -0.1754 0.0538  75  LEU A CG    
192  C CD1   . LEU A 28  ? 0.7445 0.8708 0.9993 -0.1005 -0.1658 0.0589  75  LEU A CD1   
193  C CD2   . LEU A 28  ? 0.7073 0.8460 0.9877 -0.0904 -0.1665 0.0586  75  LEU A CD2   
194  N N     . ILE A 29  ? 0.7894 0.8281 0.9938 -0.0777 -0.2149 0.0494  76  ILE A N     
195  C CA    . ILE A 29  ? 0.8055 0.8084 0.9680 -0.0750 -0.2228 0.0518  76  ILE A CA    
196  C C     . ILE A 29  ? 0.8774 0.8681 1.0188 -0.0801 -0.2025 0.0594  76  ILE A C     
197  O O     . ILE A 29  ? 0.8814 0.8775 1.0284 -0.0835 -0.1932 0.0584  76  ILE A O     
198  C CB    . ILE A 29  ? 0.8505 0.8471 1.0057 -0.0736 -0.2435 0.0438  76  ILE A CB    
199  C CG1   . ILE A 29  ? 0.8385 0.8608 1.0260 -0.0664 -0.2629 0.0381  76  ILE A CG1   
200  C CG2   . ILE A 29  ? 0.8886 0.8450 0.9918 -0.0701 -0.2508 0.0474  76  ILE A CG2   
201  C CD1   . ILE A 29  ? 0.8412 0.8837 1.0480 -0.0721 -0.2779 0.0280  76  ILE A CD1   
202  N N     . LEU A 30  ? 0.8399 0.8160 0.9601 -0.0806 -0.1927 0.0677  77  LEU A N     
203  C CA    . LEU A 30  ? 0.8378 0.8074 0.9405 -0.0839 -0.1718 0.0776  77  LEU A CA    
204  C C     . LEU A 30  ? 0.9537 0.8781 1.0072 -0.0805 -0.1730 0.0805  77  LEU A C     
205  O O     . LEU A 30  ? 0.9796 0.8784 1.0090 -0.0775 -0.1831 0.0810  77  LEU A O     
206  C CB    . LEU A 30  ? 0.8217 0.8095 0.9358 -0.0905 -0.1605 0.0836  77  LEU A CB    
207  C CG    . LEU A 30  ? 0.8303 0.8647 0.9823 -0.0949 -0.1510 0.0852  77  LEU A CG    
208  C CD1   . LEU A 30  ? 0.8228 0.8723 0.9933 -0.1001 -0.1577 0.0788  77  LEU A CD1   
209  C CD2   . LEU A 30  ? 0.8219 0.8756 0.9744 -0.0998 -0.1322 0.0966  77  LEU A CD2   
210  N N     . HIS A 31  ? 0.9117 0.8214 0.9459 -0.0795 -0.1613 0.0827  78  HIS A N     
211  C CA    . HIS A 31  ? 0.9515 0.8146 0.9333 -0.0765 -0.1619 0.0836  78  HIS A CA    
212  C C     . HIS A 31  ? 1.0183 0.8644 0.9779 -0.0748 -0.1367 0.0902  78  HIS A C     
213  O O     . HIS A 31  ? 0.9970 0.8683 0.9836 -0.0740 -0.1204 0.0942  78  HIS A O     
214  C CB    . HIS A 31  ? 0.9788 0.8269 0.9467 -0.0758 -0.1878 0.0708  78  HIS A CB    
215  C CG    . HIS A 31  ? 1.0050 0.8652 0.9913 -0.0812 -0.1865 0.0617  78  HIS A CG    
216  N ND1   . HIS A 31  ? 0.9827 0.8833 1.0198 -0.0841 -0.1893 0.0576  78  HIS A ND1   
217  C CD2   . HIS A 31  ? 1.0472 0.8787 1.0037 -0.0851 -0.1795 0.0559  78  HIS A CD2   
218  C CE1   . HIS A 31  ? 0.9747 0.8701 1.0128 -0.0900 -0.1839 0.0503  78  HIS A CE1   
219  N NE2   . HIS A 31  ? 1.0224 0.8752 1.0123 -0.0914 -0.1774 0.0484  78  HIS A NE2   
220  N N     . ALA A 32  ? 1.0256 0.8258 0.9324 -0.0720 -0.1334 0.0912  79  ALA A N     
221  C CA    . ALA A 32  ? 1.0376 0.8102 0.9132 -0.0682 -0.1078 0.0964  79  ALA A CA    
222  C C     . ALA A 32  ? 1.1020 0.8509 0.9590 -0.0710 -0.1135 0.0830  79  ALA A C     
223  O O     . ALA A 32  ? 1.1036 0.8480 0.9554 -0.0769 -0.1413 0.0697  79  ALA A O     
224  C CB    . ALA A 32  ? 1.0915 0.8215 0.9143 -0.0650 -0.1001 0.1028  79  ALA A CB    
225  N N     . LYS A 33  ? 1.0868 0.8220 0.9352 -0.0671 -0.0863 0.0867  80  LYS A N     
226  C CA    . LYS A 33  ? 1.1118 0.8162 0.9383 -0.0725 -0.0848 0.0732  80  LYS A CA    
227  C C     . LYS A 33  ? 1.2357 0.8798 0.9913 -0.0770 -0.0911 0.0625  80  LYS A C     
228  O O     . LYS A 33  ? 1.2687 0.8888 1.0023 -0.0886 -0.1034 0.0452  80  LYS A O     
229  C CB    . LYS A 33  ? 1.1311 0.8370 0.9712 -0.0640 -0.0499 0.0827  80  LYS A CB    
230  C CG    . LYS A 33  ? 1.2696 1.0249 1.1698 -0.0647 -0.0519 0.0844  80  LYS A CG    
231  C CD    . LYS A 33  ? 1.4132 1.1734 1.3254 -0.0503 -0.0151 0.0998  80  LYS A CD    
232  C CE    . LYS A 33  ? 1.5771 1.3692 1.5335 -0.0515 -0.0149 0.0992  80  LYS A CE    
233  N NZ    . LYS A 33  ? 1.6221 1.4413 1.6027 -0.0324 0.0159  0.1211  80  LYS A NZ    
234  N N     . VAL A 34  ? 1.2127 0.8334 0.9316 -0.0699 -0.0836 0.0720  81  VAL A N     
235  C CA    . VAL A 34  ? 1.2750 0.8372 0.9198 -0.0721 -0.0887 0.0643  81  VAL A CA    
236  C C     . VAL A 34  ? 1.2968 0.8586 0.9240 -0.0702 -0.1133 0.0677  81  VAL A C     
237  O O     . VAL A 34  ? 1.2479 0.8487 0.9181 -0.0668 -0.1197 0.0773  81  VAL A O     
238  C CB    . VAL A 34  ? 1.3758 0.8886 0.9713 -0.0633 -0.0488 0.0719  81  VAL A CB    
239  C CG1   . VAL A 34  ? 1.3623 0.8693 0.9719 -0.0612 -0.0210 0.0706  81  VAL A CG1   
240  C CG2   . VAL A 34  ? 1.3637 0.8899 0.9681 -0.0509 -0.0257 0.0936  81  VAL A CG2   
241  N N     . ALA A 35  ? 1.2869 0.8007 0.8459 -0.0723 -0.1263 0.0596  82  ALA A N     
242  C CA    . ALA A 35  ? 1.2857 0.7875 0.8126 -0.0676 -0.1499 0.0635  82  ALA A CA    
243  C C     . ALA A 35  ? 1.4110 0.8471 0.8493 -0.0663 -0.1436 0.0604  82  ALA A C     
244  O O     . ALA A 35  ? 1.4414 0.8482 0.8427 -0.0758 -0.1458 0.0445  82  ALA A O     
245  C CB    . ALA A 35  ? 1.2691 0.8036 0.8205 -0.0728 -0.1937 0.0521  82  ALA A CB    
246  N N     . GLN A 36  ? 1.4024 0.8115 0.8037 -0.0561 -0.1322 0.0751  83  GLN A N     
247  C CA    . GLN A 36  ? 1.4880 0.8319 0.7994 -0.0527 -0.1248 0.0748  83  GLN A CA    
248  C C     . GLN A 36  ? 1.6014 0.9363 0.8725 -0.0519 -0.1687 0.0685  83  GLN A C     
249  O O     . GLN A 36  ? 1.5740 0.9392 0.8765 -0.0450 -0.1897 0.0769  83  GLN A O     
250  C CB    . GLN A 36  ? 1.5163 0.8382 0.8108 -0.0420 -0.0887 0.0957  83  GLN A CB    
251  C CG    . GLN A 36  ? 1.6708 0.9210 0.8716 -0.0373 -0.0696 0.0970  83  GLN A CG    
252  C CD    . GLN A 36  ? 1.7895 1.0198 0.9764 -0.0280 -0.0303 0.1181  83  GLN A CD    
253  O OE1   . GLN A 36  ? 1.7683 0.9453 0.8815 -0.0221 -0.0235 0.1237  83  GLN A OE1   
254  N NE2   . GLN A 36  ? 1.6290 0.9030 0.8848 -0.0274 -0.0030 0.1306  83  GLN A NE2   
255  N N     . LYS A 37  ? 1.6569 0.9499 0.8565 -0.0581 -0.1821 0.0542  84  LYS A N     
256  C CA    . LYS A 37  ? 1.7071 0.9971 0.8649 -0.0566 -0.2267 0.0486  84  LYS A CA    
257  C C     . LYS A 37  ? 1.8284 1.0712 0.9123 -0.0408 -0.2250 0.0646  84  LYS A C     
258  O O     . LYS A 37  ? 1.8647 1.0584 0.9033 -0.0356 -0.1871 0.0743  84  LYS A O     
259  C CB    . LYS A 37  ? 1.7947 1.0783 0.9205 -0.0756 -0.2529 0.0225  84  LYS A CB    
260  C CG    . LYS A 37  ? 2.0064 1.2161 1.0326 -0.0824 -0.2368 0.0120  84  LYS A CG    
261  C CD    . LYS A 37  ? 2.1316 1.3308 1.1509 -0.1069 -0.2359 -0.0148 84  LYS A CD    
262  C CE    . LYS A 37  ? 2.3242 1.5419 1.3208 -0.1257 -0.2867 -0.0370 84  LYS A CE    
263  N NZ    . LYS A 37  ? 2.4498 1.6396 1.4229 -0.1536 -0.2786 -0.0648 84  LYS A NZ    
264  N N     . SER A 38  ? 1.8070 1.0665 0.8804 -0.0315 -0.2651 0.0686  85  SER A N     
265  C CA    . SER A 38  ? 1.8727 1.0923 0.8769 -0.0133 -0.2722 0.0853  85  SER A CA    
266  C C     . SER A 38  ? 2.0429 1.2348 0.9627 -0.0174 -0.3045 0.0716  85  SER A C     
267  O O     . SER A 38  ? 2.0412 1.2631 0.9761 -0.0345 -0.3317 0.0497  85  SER A O     
268  C CB    . SER A 38  ? 1.8760 1.1356 0.9266 0.0030  -0.2967 0.0999  85  SER A CB    
269  O OG    . SER A 38  ? 1.9237 1.2253 1.0643 0.0007  -0.2792 0.1049  85  SER A OG    
270  N N     . TYR A 39  ? 2.0984 1.2340 0.9280 -0.0033 -0.3020 0.0840  86  TYR A N     
271  C CA    . TYR A 39  ? 2.1905 1.2928 0.9256 -0.0066 -0.3305 0.0725  86  TYR A CA    
272  C C     . TYR A 39  ? 2.3540 1.4475 1.0318 0.0174  -0.3647 0.0902  86  TYR A C     
273  O O     . TYR A 39  ? 2.3483 1.4941 1.0474 0.0215  -0.4138 0.0867  86  TYR A O     
274  C CB    . TYR A 39  ? 2.2520 1.2783 0.9064 -0.0153 -0.2893 0.0657  86  TYR A CB    
275  C CG    . TYR A 39  ? 2.1950 1.2220 0.8842 -0.0374 -0.2615 0.0456  86  TYR A CG    
276  C CD1   . TYR A 39  ? 2.2601 1.2819 0.9191 -0.0605 -0.2816 0.0169  86  TYR A CD1   
277  C CD2   . TYR A 39  ? 2.1277 1.1523 0.8682 -0.0349 -0.2115 0.0560  86  TYR A CD2   
278  C CE1   . TYR A 39  ? 2.2381 1.2514 0.9234 -0.0789 -0.2521 -0.0003 86  TYR A CE1   
279  C CE2   . TYR A 39  ? 2.1033 1.1260 0.8719 -0.0501 -0.1839 0.0409  86  TYR A CE2   
280  C CZ    . TYR A 39  ? 2.2051 1.2172 0.9434 -0.0711 -0.2026 0.0132  86  TYR A CZ    
281  O OH    . TYR A 39  ? 2.1447 1.1453 0.9035 -0.0848 -0.1723 -0.0010 86  TYR A OH    
282  N N     . GLY A 40  ? 2.4061 1.4336 1.0092 0.0338  -0.3376 0.1096  87  GLY A N     
283  C CA    . GLY A 40  ? 2.5056 1.5090 1.0361 0.0588  -0.3633 0.1286  87  GLY A CA    
284  C C     . GLY A 40  ? 2.5483 1.5798 1.1277 0.0842  -0.3727 0.1538  87  GLY A C     
285  O O     . GLY A 40  ? 2.5999 1.5804 1.1360 0.1043  -0.3477 0.1787  87  GLY A O     
286  N N     . ASN A 41  ? 2.4139 1.5233 1.0798 0.0838  -0.4078 0.1475  88  ASN A N     
287  C CA    . ASN A 41  ? 2.3549 1.4977 1.0786 0.1074  -0.4177 0.1681  88  ASN A CA    
288  C C     . ASN A 41  ? 2.2985 1.4370 1.0916 0.1017  -0.3704 0.1752  88  ASN A C     
289  O O     . ASN A 41  ? 2.2588 1.4242 1.1091 0.1158  -0.3727 0.1881  88  ASN A O     
290  C CB    . ASN A 41  ? 2.4263 1.5299 1.0723 0.1416  -0.4316 0.1953  88  ASN A CB    
291  C CG    . ASN A 41  ? 2.8005 1.9225 1.3848 0.1486  -0.4847 0.1895  88  ASN A CG    
292  O OD1   . ASN A 41  ? 2.7135 1.9067 1.3451 0.1563  -0.5303 0.1866  88  ASN A OD1   
293  N ND2   . ASN A 41  ? 2.7798 1.8421 1.2586 0.1446  -0.4799 0.1865  88  ASN A ND2   
294  N N     . GLU A 42  ? 2.1910 1.2990 0.9803 0.0807  -0.3278 0.1662  89  GLU A N     
295  C CA    . GLU A 42  ? 2.0898 1.1994 0.9426 0.0713  -0.2825 0.1713  89  GLU A CA    
296  C C     . GLU A 42  ? 1.9831 1.1659 0.9434 0.0611  -0.2944 0.1600  89  GLU A C     
297  O O     . GLU A 42  ? 1.9393 1.1691 0.9269 0.0539  -0.3298 0.1429  89  GLU A O     
298  C CB    . GLU A 42  ? 2.1149 1.1832 0.9399 0.0549  -0.2361 0.1662  89  GLU A CB    
299  C CG    . GLU A 42  ? 2.2381 1.2951 1.0189 0.0405  -0.2451 0.1443  89  GLU A CG    
300  C CD    . GLU A 42  ? 2.3373 1.3677 1.1158 0.0256  -0.1972 0.1378  89  GLU A CD    
301  O OE1   . GLU A 42  ? 2.2828 1.3297 1.0773 0.0092  -0.2009 0.1165  89  GLU A OE1   
302  O OE2   . GLU A 42  ? 2.1925 1.1852 0.9529 0.0305  -0.1544 0.1545  89  GLU A OE2   
303  N N     . LYS A 43  ? 1.8666 1.0589 0.8850 0.0607  -0.2665 0.1704  90  LYS A N     
304  C CA    . LYS A 43  ? 1.7523 1.0085 0.8706 0.0525  -0.2718 0.1626  90  LYS A CA    
305  C C     . LYS A 43  ? 1.7692 1.0271 0.9295 0.0344  -0.2271 0.1615  90  LYS A C     
306  O O     . LYS A 43  ? 1.7495 0.9921 0.9236 0.0351  -0.1993 0.1750  90  LYS A O     
307  C CB    . LYS A 43  ? 1.7475 1.0162 0.8923 0.0725  -0.2866 0.1771  90  LYS A CB    
308  C CG    . LYS A 43  ? 1.7235 1.0050 0.8379 0.0950  -0.3339 0.1809  90  LYS A CG    
309  C CD    . LYS A 43  ? 1.6810 0.9704 0.8209 0.1195  -0.3430 0.1978  90  LYS A CD    
310  C CE    . LYS A 43  ? 2.0559 1.3472 1.1505 0.1489  -0.3835 0.2093  90  LYS A CE    
311  N NZ    . LYS A 43  ? 2.4041 1.6189 1.3984 0.1676  -0.3717 0.2302  90  LYS A NZ    
312  N N     . ARG A 44  ? 1.7154 0.9884 0.8894 0.0179  -0.2189 0.1457  91  ARG A N     
313  C CA    . ARG A 44  ? 1.6620 0.9465 0.8784 0.0031  -0.1793 0.1445  91  ARG A CA    
314  C C     . ARG A 44  ? 1.6320 0.9836 0.9438 -0.0051 -0.1883 0.1368  91  ARG A C     
315  O O     . ARG A 44  ? 1.6179 1.0031 0.9630 -0.0146 -0.1989 0.1212  91  ARG A O     
316  C CB    . ARG A 44  ? 1.6466 0.9102 0.8269 -0.0060 -0.1658 0.1326  91  ARG A CB    
317  C CG    . ARG A 44  ? 1.7015 0.8956 0.7874 0.0012  -0.1481 0.1410  91  ARG A CG    
318  C CD    . ARG A 44  ? 1.6520 0.8177 0.7023 -0.0069 -0.1226 0.1312  91  ARG A CD    
319  N NE    . ARG A 44  ? 1.7669 0.8613 0.7175 0.0011  -0.1078 0.1384  91  ARG A NE    
320  C CZ    . ARG A 44  ? 2.0041 1.0623 0.9287 0.0060  -0.0659 0.1557  91  ARG A CZ    
321  N NH1   . ARG A 44  ? 1.9337 1.0247 0.9273 0.0015  -0.0359 0.1668  91  ARG A NH1   
322  N NH2   . ARG A 44  ? 1.8209 0.8118 0.6498 0.0138  -0.0532 0.1616  91  ARG A NH2   
323  N N     . PHE A 45  ? 1.5326 0.8984 0.8826 -0.0018 -0.1833 0.1471  92  PHE A N     
324  C CA    . PHE A 45  ? 1.4424 0.8657 0.8755 -0.0078 -0.1909 0.1414  92  PHE A CA    
325  C C     . PHE A 45  ? 1.4656 0.9300 0.9551 -0.0236 -0.1727 0.1326  92  PHE A C     
326  O O     . PHE A 45  ? 1.4785 0.9290 0.9573 -0.0303 -0.1405 0.1376  92  PHE A O     
327  C CB    . PHE A 45  ? 1.4437 0.8601 0.8938 -0.0041 -0.1803 0.1537  92  PHE A CB    
328  C CG    . PHE A 45  ? 1.5215 0.8993 0.9218 0.0165  -0.1992 0.1645  92  PHE A CG    
329  C CD1   . PHE A 45  ? 1.5719 0.9685 0.9696 0.0315  -0.2394 0.1596  92  PHE A CD1   
330  C CD2   . PHE A 45  ? 1.5829 0.9059 0.9373 0.0218  -0.1759 0.1810  92  PHE A CD2   
331  C CE1   . PHE A 45  ? 1.6416 1.0057 0.9915 0.0553  -0.2574 0.1728  92  PHE A CE1   
332  C CE2   . PHE A 45  ? 1.6771 0.9590 0.9793 0.0449  -0.1914 0.1939  92  PHE A CE2   
333  C CZ    . PHE A 45  ? 1.6680 0.9721 0.9681 0.0634  -0.2327 0.1907  92  PHE A CZ    
334  N N     . PHE A 46  ? 1.3772 0.8931 0.9264 -0.0277 -0.1923 0.1210  93  PHE A N     
335  C CA    . PHE A 46  ? 1.3155 0.8732 0.9205 -0.0399 -0.1777 0.1138  93  PHE A CA    
336  C C     . PHE A 46  ? 1.3622 0.9379 1.0044 -0.0469 -0.1498 0.1236  93  PHE A C     
337  O O     . PHE A 46  ? 1.3479 0.9319 1.0109 -0.0464 -0.1546 0.1275  93  PHE A O     
338  C CB    . PHE A 46  ? 1.2804 0.8856 0.9375 -0.0423 -0.2046 0.1005  93  PHE A CB    
339  C CG    . PHE A 46  ? 1.3322 0.9324 0.9636 -0.0416 -0.2333 0.0876  93  PHE A CG    
340  C CD1   . PHE A 46  ? 1.4266 0.9811 0.9897 -0.0417 -0.2314 0.0853  93  PHE A CD1   
341  C CD2   . PHE A 46  ? 1.3321 0.9756 1.0084 -0.0436 -0.2606 0.0765  93  PHE A CD2   
342  C CE1   . PHE A 46  ? 1.4671 1.0193 1.0052 -0.0463 -0.2588 0.0705  93  PHE A CE1   
343  C CE2   . PHE A 46  ? 1.3883 1.0340 1.0450 -0.0478 -0.2877 0.0631  93  PHE A CE2   
344  C CZ    . PHE A 46  ? 1.4221 1.0223 1.0088 -0.0504 -0.2878 0.0594  93  PHE A CZ    
345  N N     . CYS A 47  ? 1.3301 0.9096 0.9766 -0.0532 -0.1193 0.1281  94  CYS A N     
346  C CA    A CYS A 47  ? 1.2919 0.8981 0.9757 -0.0624 -0.0916 0.1376  94  CYS A CA    
347  C CA    B CYS A 47  ? 1.2926 0.8989 0.9767 -0.0625 -0.0918 0.1376  94  CYS A CA    
348  C C     . CYS A 47  ? 1.2945 0.9471 1.0259 -0.0667 -0.0770 0.1361  94  CYS A C     
349  O O     . CYS A 47  ? 1.3210 0.9580 1.0300 -0.0618 -0.0636 0.1362  94  CYS A O     
350  C CB    A CYS A 47  ? 1.3421 0.9084 0.9819 -0.0633 -0.0640 0.1508  94  CYS A CB    
351  C CB    B CYS A 47  ? 1.3434 0.9100 0.9840 -0.0635 -0.0644 0.1510  94  CYS A CB    
352  S SG    A CYS A 47  ? 1.3534 0.9607 1.0428 -0.0797 -0.0317 0.1618  94  CYS A SG    
353  S SG    B CYS A 47  ? 1.4394 0.9602 1.0414 -0.0614 -0.0720 0.1579  94  CYS A SG    
354  N N     . PRO A 48  ? 1.1822 0.8888 0.9754 -0.0744 -0.0784 0.1350  95  PRO A N     
355  C CA    . PRO A 48  ? 1.1532 0.8778 0.9744 -0.0817 -0.0908 0.1329  95  PRO A CA    
356  C C     . PRO A 48  ? 1.2004 0.9152 1.0181 -0.0742 -0.1236 0.1224  95  PRO A C     
357  O O     . PRO A 48  ? 1.2046 0.9203 1.0188 -0.0679 -0.1398 0.1140  95  PRO A O     
358  C CB    . PRO A 48  ? 1.1073 0.8946 0.9900 -0.0908 -0.0814 0.1334  95  PRO A CB    
359  C CG    . PRO A 48  ? 1.1369 0.9382 1.0284 -0.0827 -0.0784 0.1315  95  PRO A CG    
360  C CD    . PRO A 48  ? 1.1423 0.8953 0.9797 -0.0752 -0.0648 0.1364  95  PRO A CD    
361  N N     . PRO A 49  ? 1.1288 0.8313 0.9445 -0.0744 -0.1326 0.1229  96  PRO A N     
362  C CA    . PRO A 49  ? 1.1153 0.8149 0.9327 -0.0633 -0.1622 0.1155  96  PRO A CA    
363  C C     . PRO A 49  ? 1.1061 0.8581 0.9810 -0.0664 -0.1733 0.1053  96  PRO A C     
364  O O     . PRO A 49  ? 1.0329 0.8190 0.9473 -0.0771 -0.1608 0.1049  96  PRO A O     
365  C CB    . PRO A 49  ? 1.1539 0.8259 0.9576 -0.0616 -0.1605 0.1208  96  PRO A CB    
366  C CG    . PRO A 49  ? 1.1940 0.8730 1.0101 -0.0792 -0.1330 0.1256  96  PRO A CG    
367  C CD    . PRO A 49  ? 1.1429 0.8345 0.9569 -0.0851 -0.1148 0.1299  96  PRO A CD    
368  N N     . PRO A 50  ? 1.0919 0.8520 0.9706 -0.0582 -0.1970 0.0969  97  PRO A N     
369  C CA    . PRO A 50  ? 1.0508 0.8577 0.9832 -0.0608 -0.2070 0.0874  97  PRO A CA    
370  C C     . PRO A 50  ? 1.0942 0.9183 1.0580 -0.0606 -0.2084 0.0868  97  PRO A C     
371  O O     . PRO A 50  ? 1.1247 0.9201 1.0664 -0.0535 -0.2117 0.0913  97  PRO A O     
372  C CB    . PRO A 50  ? 1.0951 0.9005 1.0183 -0.0528 -0.2343 0.0794  97  PRO A CB    
373  C CG    . PRO A 50  ? 1.2046 0.9667 1.0684 -0.0499 -0.2345 0.0829  97  PRO A CG    
374  C CD    . PRO A 50  ? 1.1685 0.8977 1.0025 -0.0478 -0.2168 0.0953  97  PRO A CD    
375  N N     . CYS A 51  ? 1.0052 0.8711 1.0158 -0.0679 -0.2035 0.0816  98  CYS A N     
376  C CA    . CYS A 51  ? 0.9739 0.8529 1.0095 -0.0698 -0.2015 0.0794  98  CYS A CA    
377  C C     . CYS A 51  ? 0.9646 0.8816 1.0443 -0.0668 -0.2125 0.0707  98  CYS A C     
378  O O     . CYS A 51  ? 0.9406 0.8889 1.0462 -0.0726 -0.2084 0.0676  98  CYS A O     
379  C CB    . CYS A 51  ? 0.9667 0.8569 1.0095 -0.0858 -0.1789 0.0832  98  CYS A CB    
380  S SG    . CYS A 51  ? 1.0234 0.9122 1.0781 -0.0937 -0.1729 0.0787  98  CYS A SG    
381  N N     . VAL A 52  ? 0.8916 0.8038 0.9785 -0.0560 -0.2237 0.0681  99  VAL A N     
382  C CA    . VAL A 52  ? 0.8435 0.7901 0.9728 -0.0512 -0.2319 0.0606  99  VAL A CA    
383  C C     . VAL A 52  ? 0.9256 0.8773 1.0689 -0.0581 -0.2167 0.0581  99  VAL A C     
384  O O     . VAL A 52  ? 0.9510 0.8689 1.0703 -0.0560 -0.2106 0.0607  99  VAL A O     
385  C CB    . VAL A 52  ? 0.9019 0.8440 1.0316 -0.0319 -0.2535 0.0605  99  VAL A CB    
386  C CG1   . VAL A 52  ? 0.8700 0.8478 1.0465 -0.0253 -0.2576 0.0541  99  VAL A CG1   
387  C CG2   . VAL A 52  ? 0.9121 0.8563 1.0286 -0.0298 -0.2715 0.0598  99  VAL A CG2   
388  N N     . TYR A 53  ? 0.8714 0.8615 1.0485 -0.0675 -0.2091 0.0530  100 TYR A N     
389  C CA    . TYR A 53  ? 0.8676 0.8698 1.0589 -0.0761 -0.1964 0.0482  100 TYR A CA    
390  C C     . TYR A 53  ? 0.8954 0.9248 1.1227 -0.0670 -0.2019 0.0416  100 TYR A C     
391  O O     . TYR A 53  ? 0.8737 0.9317 1.1253 -0.0658 -0.2072 0.0405  100 TYR A O     
392  C CB    . TYR A 53  ? 0.8667 0.8990 1.0675 -0.0934 -0.1828 0.0495  100 TYR A CB    
393  C CG    . TYR A 53  ? 0.9258 0.9446 1.1008 -0.1063 -0.1724 0.0559  100 TYR A CG    
394  C CD1   . TYR A 53  ? 0.9682 0.9791 1.1280 -0.1043 -0.1721 0.0639  100 TYR A CD1   
395  C CD2   . TYR A 53  ? 0.9612 0.9768 1.1273 -0.1224 -0.1612 0.0532  100 TYR A CD2   
396  C CE1   . TYR A 53  ? 1.0197 1.0221 1.1594 -0.1156 -0.1596 0.0710  100 TYR A CE1   
397  C CE2   . TYR A 53  ? 1.0047 1.0125 1.1513 -0.1370 -0.1506 0.0590  100 TYR A CE2   
398  C CZ    . TYR A 53  ? 1.1394 1.1431 1.2752 -0.1324 -0.1492 0.0690  100 TYR A CZ    
399  O OH    . TYR A 53  ? 1.2218 1.2227 1.3426 -0.1461 -0.1360 0.0759  100 TYR A OH    
400  N N     . LEU A 54  ? 0.8498 0.8686 1.0794 -0.0622 -0.1968 0.0369  101 LEU A N     
401  C CA    . LEU A 54  ? 0.8173 0.8606 1.0805 -0.0535 -0.1966 0.0308  101 LEU A CA    
402  C C     . LEU A 54  ? 0.8518 0.9098 1.1183 -0.0695 -0.1804 0.0251  101 LEU A C     
403  O O     . LEU A 54  ? 0.8784 0.9114 1.1216 -0.0779 -0.1700 0.0213  101 LEU A O     
404  C CB    . LEU A 54  ? 0.8423 0.8605 1.1021 -0.0332 -0.1998 0.0306  101 LEU A CB    
405  C CG    . LEU A 54  ? 0.9257 0.9262 1.1726 -0.0157 -0.2171 0.0385  101 LEU A CG    
406  C CD1   . LEU A 54  ? 0.9466 0.9330 1.1986 0.0096  -0.2192 0.0408  101 LEU A CD1   
407  C CD2   . LEU A 54  ? 0.9599 0.9957 1.2295 -0.0158 -0.2344 0.0393  101 LEU A CD2   
408  N N     . MET A 55  ? 0.7696 0.8661 1.0607 -0.0753 -0.1780 0.0248  102 MET A N     
409  C CA    . MET A 55  ? 0.7552 0.8727 1.0478 -0.0893 -0.1651 0.0216  102 MET A CA    
410  C C     . MET A 55  ? 0.7562 0.8945 1.0744 -0.0830 -0.1590 0.0157  102 MET A C     
411  O O     . MET A 55  ? 0.7668 0.9177 1.1123 -0.0706 -0.1645 0.0161  102 MET A O     
412  C CB    . MET A 55  ? 0.7690 0.9141 1.0654 -0.0982 -0.1633 0.0294  102 MET A CB    
413  C CG    . MET A 55  ? 0.8566 0.9845 1.1305 -0.1030 -0.1665 0.0364  102 MET A CG    
414  S SD    . MET A 55  ? 0.9724 1.0860 1.2172 -0.1222 -0.1580 0.0344  102 MET A SD    
415  C CE    . MET A 55  ? 0.9003 1.0717 1.1605 -0.1352 -0.1493 0.0388  102 MET A CE    
416  N N     . GLY A 56  ? 0.6543 0.7981 0.9631 -0.0933 -0.1474 0.0100  103 GLY A N     
417  C CA    . GLY A 56  ? 0.6446 0.8074 0.9721 -0.0885 -0.1381 0.0048  103 GLY A CA    
418  C C     . GLY A 56  ? 0.7680 0.9050 1.0872 -0.0819 -0.1289 -0.0052 103 GLY A C     
419  O O     . GLY A 56  ? 0.8332 0.9387 1.1465 -0.0700 -0.1320 -0.0062 103 GLY A O     
420  N N     . SER A 57  ? 0.7090 0.8590 1.0270 -0.0866 -0.1160 -0.0114 104 SER A N     
421  C CA    . SER A 57  ? 0.7303 0.8552 1.0359 -0.0815 -0.1018 -0.0223 104 SER A CA    
422  C C     . SER A 57  ? 0.8273 0.9467 1.1633 -0.0557 -0.0999 -0.0212 104 SER A C     
423  O O     . SER A 57  ? 0.8941 0.9828 1.2185 -0.0454 -0.0873 -0.0282 104 SER A O     
424  C CB    . SER A 57  ? 0.7348 0.8808 1.0327 -0.0916 -0.0893 -0.0276 104 SER A CB    
425  O OG    . SER A 57  ? 0.7607 0.9430 1.0943 -0.0814 -0.0874 -0.0206 104 SER A OG    
426  N N     . GLY A 58  ? 0.7379 0.8869 1.1115 -0.0460 -0.1118 -0.0126 105 GLY A N     
427  C CA    . GLY A 58  ? 0.7320 0.8917 1.1435 -0.0236 -0.1141 -0.0103 105 GLY A CA    
428  C C     . GLY A 58  ? 0.7954 0.9241 1.1988 -0.0063 -0.1218 -0.0078 105 GLY A C     
429  O O     . GLY A 58  ? 0.8081 0.9402 1.2356 0.0158  -0.1176 -0.0068 105 GLY A O     
430  N N     . TRP A 59  ? 0.7609 0.8613 1.1318 -0.0141 -0.1321 -0.0049 106 TRP A N     
431  C CA    . TRP A 59  ? 0.7889 0.8534 1.1443 0.0034  -0.1383 -0.0002 106 TRP A CA    
432  C C     . TRP A 59  ? 0.9123 0.9331 1.2446 0.0151  -0.1178 -0.0061 106 TRP A C     
433  O O     . TRP A 59  ? 0.9589 0.9723 1.3062 0.0433  -0.1165 -0.0009 106 TRP A O     
434  C CB    . TRP A 59  ? 0.7719 0.8125 1.0944 -0.0087 -0.1503 0.0047  106 TRP A CB    
435  C CG    . TRP A 59  ? 0.7533 0.8292 1.0955 -0.0152 -0.1684 0.0107  106 TRP A CG    
436  C CD1   . TRP A 59  ? 0.7662 0.8620 1.1061 -0.0360 -0.1685 0.0105  106 TRP A CD1   
437  C CD2   . TRP A 59  ? 0.7489 0.8432 1.1139 -0.0004 -0.1878 0.0175  106 TRP A CD2   
438  N NE1   . TRP A 59  ? 0.7467 0.8640 1.1031 -0.0351 -0.1837 0.0160  106 TRP A NE1   
439  C CE2   . TRP A 59  ? 0.7773 0.8948 1.1482 -0.0159 -0.1970 0.0190  106 TRP A CE2   
440  C CE3   . TRP A 59  ? 0.7992 0.8963 1.1811 0.0252  -0.1985 0.0227  106 TRP A CE3   
441  C CZ2   . TRP A 59  ? 0.7746 0.9111 1.1616 -0.0111 -0.2164 0.0227  106 TRP A CZ2   
442  C CZ3   . TRP A 59  ? 0.8100 0.9365 1.2132 0.0304  -0.2210 0.0274  106 TRP A CZ3   
443  C CH2   . TRP A 59  ? 0.7920 0.9354 1.1956 0.0104  -0.2297 0.0259  106 TRP A CH2   
444  N N     . LYS A 60  ? 0.8616 0.8581 1.1596 -0.0057 -0.1011 -0.0169 107 LYS A N     
445  C CA    . LYS A 60  ? 0.9095 0.8575 1.1767 -0.0008 -0.0775 -0.0265 107 LYS A CA    
446  C C     . LYS A 60  ? 0.9442 0.9154 1.2460 0.0203  -0.0644 -0.0282 107 LYS A C     
447  O O     . LYS A 60  ? 0.9777 0.9178 1.2765 0.0454  -0.0505 -0.0273 107 LYS A O     
448  C CB    . LYS A 60  ? 0.9581 0.8860 1.1819 -0.0351 -0.0664 -0.0399 107 LYS A CB    
449  C CG    . LYS A 60  ? 1.1715 1.0396 1.3510 -0.0384 -0.0405 -0.0540 107 LYS A CG    
450  C CD    . LYS A 60  ? 1.3687 1.2550 1.5456 -0.0491 -0.0256 -0.0664 107 LYS A CD    
451  C CE    . LYS A 60  ? 1.5624 1.3922 1.6798 -0.0712 -0.0042 -0.0852 107 LYS A CE    
452  N NZ    . LYS A 60  ? 1.6457 1.4944 1.7546 -0.0822 0.0085  -0.0971 107 LYS A NZ    
453  N N     . LYS A 61  ? 0.8602 0.8846 1.1951 0.0121  -0.0665 -0.0290 108 LYS A N     
454  C CA    . LYS A 61  ? 0.8539 0.9052 1.2252 0.0296  -0.0520 -0.0300 108 LYS A CA    
455  C C     . LYS A 61  ? 0.9408 1.0080 1.3549 0.0629  -0.0587 -0.0191 108 LYS A C     
456  O O     . LYS A 61  ? 0.9969 1.0522 1.4204 0.0867  -0.0398 -0.0197 108 LYS A O     
457  C CB    . LYS A 61  ? 0.8124 0.9172 1.2123 0.0147  -0.0542 -0.0298 108 LYS A CB    
458  C CG    . LYS A 61  ? 0.9767 1.0936 1.3923 0.0236  -0.0299 -0.0350 108 LYS A CG    
459  C CD    . LYS A 61  ? 1.0816 1.2485 1.5269 0.0125  -0.0285 -0.0324 108 LYS A CD    
460  C CE    . LYS A 61  ? 1.2780 1.4931 1.7884 0.0264  -0.0354 -0.0236 108 LYS A CE    
461  N NZ    . LYS A 61  ? 1.3506 1.5734 1.8941 0.0522  -0.0178 -0.0235 108 LYS A NZ    
462  N N     . LYS A 62  ? 0.8619 0.9538 1.2973 0.0654  -0.0851 -0.0091 109 LYS A N     
463  C CA    . LYS A 62  ? 0.8592 0.9745 1.3335 0.0945  -0.0985 0.0022  109 LYS A CA    
464  C C     . LYS A 62  ? 0.9998 1.0595 1.4418 0.1201  -0.0914 0.0075  109 LYS A C     
465  O O     . LYS A 62  ? 1.0225 1.0931 1.4933 0.1527  -0.0858 0.0150  109 LYS A O     
466  C CB    . LYS A 62  ? 0.8322 0.9861 1.3288 0.0848  -0.1288 0.0089  109 LYS A CB    
467  C CG    . LYS A 62  ? 0.8373 1.0262 1.3745 0.1108  -0.1490 0.0201  109 LYS A CG    
468  C CD    . LYS A 62  ? 0.8261 1.0755 1.4292 0.1243  -0.1441 0.0212  109 LYS A CD    
469  C CE    . LYS A 62  ? 0.8540 1.1521 1.5010 0.1430  -0.1699 0.0314  109 LYS A CE    
470  N NZ    . LYS A 62  ? 1.0691 1.4300 1.7844 0.1559  -0.1626 0.0327  109 LYS A NZ    
471  N N     . LYS A 63  ? 0.9933 0.9933 1.3765 0.1062  -0.0886 0.0041  110 LYS A N     
472  C CA    . LYS A 63  ? 1.0643 0.9985 1.4075 0.1276  -0.0763 0.0085  110 LYS A CA    
473  C C     . LYS A 63  ? 1.1777 1.0845 1.5161 0.1449  -0.0442 0.0020  110 LYS A C     
474  O O     . LYS A 63  ? 1.2328 1.1162 1.5733 0.1810  -0.0338 0.0115  110 LYS A O     
475  C CB    . LYS A 63  ? 1.1234 0.9968 1.4026 0.0999  -0.0728 0.0021  110 LYS A CB    
476  C CG    . LYS A 63  ? 1.2038 0.9975 1.4336 0.1181  -0.0565 0.0062  110 LYS A CG    
477  C CD    . LYS A 63  ? 1.2990 1.0292 1.4659 0.0832  -0.0401 -0.0077 110 LYS A CD    
478  C CE    . LYS A 63  ? 1.4626 1.1254 1.5806 0.0864  -0.0376 -0.0001 110 LYS A CE    
479  N NZ    . LYS A 63  ? 1.6433 1.2433 1.7382 0.1249  -0.0163 0.0083  110 LYS A NZ    
480  N N     . GLU A 64  ? 1.1289 1.0384 1.4586 0.1212  -0.0276 -0.0130 111 GLU A N     
481  C CA    . GLU A 64  ? 1.1806 1.0615 1.4990 0.1333  0.0052  -0.0218 111 GLU A CA    
482  C C     . GLU A 64  ? 1.2300 1.1613 1.6118 0.1696  0.0096  -0.0113 111 GLU A C     
483  O O     . GLU A 64  ? 1.2753 1.1726 1.6520 0.2030  0.0312  -0.0067 111 GLU A O     
484  C CB    . GLU A 64  ? 1.1921 1.0743 1.4871 0.0983  0.0172  -0.0392 111 GLU A CB    
485  C CG    . GLU A 64  ? 1.3845 1.2081 1.6106 0.0645  0.0227  -0.0529 111 GLU A CG    
486  C CD    . GLU A 64  ? 1.7495 1.5818 1.9511 0.0303  0.0311  -0.0692 111 GLU A CD    
487  O OE1   . GLU A 64  ? 1.6965 1.5903 1.9354 0.0249  0.0229  -0.0668 111 GLU A OE1   
488  O OE2   . GLU A 64  ? 1.7484 1.5251 1.8907 0.0075  0.0457  -0.0843 111 GLU A OE2   
489  N N     . GLN A 65  ? 1.1231 1.1344 1.5650 0.1636  -0.0097 -0.0068 112 GLN A N     
490  C CA    . GLN A 65  ? 1.1072 1.1827 1.6203 0.1911  -0.0092 0.0028  112 GLN A CA    
491  C C     . GLN A 65  ? 1.1916 1.2713 1.7273 0.2322  -0.0183 0.0199  112 GLN A C     
492  O O     . GLN A 65  ? 1.2298 1.3165 1.7925 0.2671  0.0015  0.0266  112 GLN A O     
493  C CB    . GLN A 65  ? 1.0591 1.2111 1.6240 0.1698  -0.0331 0.0042  112 GLN A CB    
494  C CG    . GLN A 65  ? 1.3300 1.5571 1.9751 0.1936  -0.0375 0.0143  112 GLN A CG    
495  C CD    . GLN A 65  ? 1.3848 1.6725 2.0738 0.1864  -0.0742 0.0221  112 GLN A CD    
496  O OE1   . GLN A 65  ? 1.3306 1.6372 2.0198 0.1542  -0.0882 0.0165  112 GLN A OE1   
497  N NE2   . GLN A 65  ? 0.9326 1.2564 1.6622 0.2172  -0.0890 0.0353  112 GLN A NE2   
498  N N     . MET A 66  ? 1.1191 1.1970 1.6437 0.2297  -0.0478 0.0283  113 MET A N     
499  C CA    . MET A 66  ? 1.1373 1.2212 1.6765 0.2672  -0.0624 0.0466  113 MET A CA    
500  C C     . MET A 66  ? 1.2784 1.2871 1.7749 0.3004  -0.0335 0.0519  113 MET A C     
501  O O     . MET A 66  ? 1.2968 1.3252 1.8269 0.3440  -0.0271 0.0667  113 MET A O     
502  C CB    . MET A 66  ? 1.1431 1.2272 1.6628 0.2527  -0.0969 0.0523  113 MET A CB    
503  C CG    . MET A 66  ? 1.1114 1.2756 1.6826 0.2323  -0.1270 0.0516  113 MET A CG    
504  S SD    . MET A 66  ? 1.1485 1.3069 1.6909 0.2193  -0.1645 0.0584  113 MET A SD    
505  C CE    . MET A 66  ? 1.1244 1.3328 1.7101 0.2622  -0.1876 0.0780  113 MET A CE    
506  N N     . GLU A 67  ? 1.2826 1.2064 1.7059 0.2796  -0.0145 0.0397  114 GLU A N     
507  C CA    . GLU A 67  ? 1.3679 1.2029 1.7375 0.3046  0.0176  0.0415  114 GLU A CA    
508  C C     . GLU A 67  ? 1.4467 1.2719 1.8298 0.3298  0.0552  0.0377  114 GLU A C     
509  O O     . GLU A 67  ? 1.5175 1.2949 1.8837 0.3705  0.0781  0.0485  114 GLU A O     
510  C CB    . GLU A 67  ? 1.4203 1.1690 1.7086 0.2691  0.0275  0.0273  114 GLU A CB    
511  C CG    . GLU A 67  ? 1.5096 1.2410 1.7724 0.2628  0.0015  0.0377  114 GLU A CG    
512  C CD    . GLU A 67  ? 1.6693 1.3335 1.8636 0.2208  0.0077  0.0236  114 GLU A CD    
513  O OE1   . GLU A 67  ? 1.6419 1.2635 1.8002 0.1963  0.0334  0.0046  114 GLU A OE1   
514  O OE2   . GLU A 67  ? 1.4623 1.1181 1.6385 0.2115  -0.0130 0.0314  114 GLU A OE2   
515  N N     . THR A 68  ? 1.3565 1.2251 1.7688 0.3091  0.0634  0.0244  115 THR A N     
516  C CA    . THR A 68  ? 1.3934 1.2555 1.8191 0.3325  0.1009  0.0207  115 THR A CA    
517  C C     . THR A 68  ? 1.4567 1.3928 1.9625 0.3797  0.0961  0.0419  115 THR A C     
518  O O     . THR A 68  ? 1.5157 1.4290 2.0263 0.4198  0.1284  0.0487  115 THR A O     
519  C CB    . THR A 68  ? 1.3989 1.2824 1.8267 0.2974  0.1131  0.0014  115 THR A CB    
520  O OG1   . THR A 68  ? 1.3348 1.3165 1.8350 0.2874  0.0872  0.0068  115 THR A OG1   
521  C CG2   . THR A 68  ? 1.3379 1.1613 1.6909 0.2496  0.1157  -0.0194 115 THR A CG2   
522  N N     . ASP A 69  ? 1.3494 1.3748 1.9172 0.3740  0.0565  0.0519  116 ASP A N     
523  C CA    . ASP A 69  ? 1.3269 1.4398 1.9777 0.4111  0.0428  0.0714  116 ASP A CA    
524  C C     . ASP A 69  ? 1.4532 1.5401 2.0947 0.4610  0.0409  0.0935  116 ASP A C     
525  O O     . ASP A 69  ? 1.4750 1.6139 2.1742 0.5054  0.0464  0.1109  116 ASP A O     
526  C CB    . ASP A 69  ? 1.2704 1.4748 1.9771 0.3836  0.0002  0.0724  116 ASP A CB    
527  C CG    . ASP A 69  ? 1.3801 1.6195 2.1071 0.3419  0.0046  0.0552  116 ASP A CG    
528  O OD1   . ASP A 69  ? 1.4103 1.6400 2.1410 0.3455  0.0395  0.0476  116 ASP A OD1   
529  O OD2   . ASP A 69  ? 1.3915 1.6657 2.1281 0.3072  -0.0253 0.0503  116 ASP A OD2   
530  N N     . GLY A 70  ? 1.4498 1.4562 2.0186 0.4551  0.0361  0.0938  117 GLY A N     
531  C CA    . GLY A 70  ? 1.5216 1.4849 2.0659 0.5024  0.0390  0.1154  117 GLY A CA    
532  C C     . GLY A 70  ? 1.5925 1.5254 2.0936 0.4927  0.0084  0.1230  117 GLY A C     
533  O O     . GLY A 70  ? 1.6548 1.5478 2.1301 0.5330  0.0108  0.1429  117 GLY A O     
534  N N     . CYS A 71  ? 1.5056 1.4548 1.9964 0.4422  -0.0182 0.1089  118 CYS A N     
535  C CA    . CYS A 71  ? 1.5124 1.4354 1.9623 0.4297  -0.0464 0.1151  118 CYS A CA    
536  C C     . CYS A 71  ? 1.6138 1.4173 1.9725 0.4194  -0.0209 0.1089  118 CYS A C     
537  O O     . CYS A 71  ? 1.6259 1.3750 1.9485 0.3951  0.0096  0.0896  118 CYS A O     
538  C CB    . CYS A 71  ? 1.4385 1.4210 1.9110 0.3823  -0.0809 0.1035  118 CYS A CB    
539  S SG    . CYS A 71  ? 1.4171 1.5360 1.9934 0.3870  -0.1117 0.1088  118 CYS A SG    
540  N N     . SER A 72  ? 1.5996 1.3628 1.9193 0.4367  -0.0333 0.1253  119 SER A N     
541  C CA    . SER A 72  ? 1.6632 1.3140 1.8962 0.4235  -0.0116 0.1209  119 SER A CA    
542  C C     . SER A 72  ? 1.6591 1.3151 1.8713 0.3657  -0.0329 0.1047  119 SER A C     
543  O O     . SER A 72  ? 1.5839 1.3248 1.8460 0.3475  -0.0647 0.1020  119 SER A O     
544  C CB    . SER A 72  ? 1.7807 1.3902 1.9827 0.4687  -0.0159 0.1482  119 SER A CB    
545  O OG    . SER A 72  ? 1.8630 1.5338 2.0868 0.4679  -0.0605 0.1611  119 SER A OG    
546  N N     . GLU A 73  ? 1.6524 1.2194 1.7924 0.3372  -0.0146 0.0945  120 GLU A N     
547  C CA    . GLU A 73  ? 1.6055 1.1771 1.7255 0.2853  -0.0321 0.0815  120 GLU A CA    
548  C C     . GLU A 73  ? 1.6069 1.2253 1.7437 0.2929  -0.0711 0.0982  120 GLU A C     
549  O O     . GLU A 73  ? 1.5372 1.2054 1.6926 0.2590  -0.0950 0.0902  120 GLU A O     
550  C CB    . GLU A 73  ? 1.6960 1.1641 1.7371 0.2577  -0.0043 0.0708  120 GLU A CB    
551  C CG    . GLU A 73  ? 1.9052 1.3435 1.9268 0.2231  0.0242  0.0447  120 GLU A CG    
552  C CD    . GLU A 73  ? 2.2853 1.6229 2.2299 0.1917  0.0528  0.0314  120 GLU A CD    
553  O OE1   . GLU A 73  ? 2.2253 1.4757 2.1228 0.2176  0.0812  0.0388  120 GLU A OE1   
554  O OE2   . GLU A 73  ? 2.2155 1.5620 2.1472 0.1407  0.0485  0.0133  120 GLU A OE2   
555  N N     . GLN A 74  ? 1.6020 1.2045 1.7306 0.3399  -0.0767 0.1223  121 GLN A N     
556  C CA    . GLN A 74  ? 1.5813 1.2227 1.7182 0.3551  -0.1133 0.1407  121 GLN A CA    
557  C C     . GLN A 74  ? 1.5290 1.2856 1.7435 0.3527  -0.1477 0.1391  121 GLN A C     
558  O O     . GLN A 74  ? 1.4654 1.2627 1.6880 0.3281  -0.1772 0.1363  121 GLN A O     
559  C CB    . GLN A 74  ? 1.6803 1.2811 1.7925 0.4125  -0.1078 0.1682  121 GLN A CB    
560  C CG    . GLN A 74  ? 1.9784 1.5468 2.0421 0.4181  -0.1266 0.1849  121 GLN A CG    
561  C CD    . GLN A 74  ? 2.4128 1.8862 2.4152 0.4603  -0.1004 0.2064  121 GLN A CD    
562  O OE1   . GLN A 74  ? 2.4278 1.9164 2.4458 0.5161  -0.1040 0.2301  121 GLN A OE1   
563  N NE2   . GLN A 74  ? 2.3251 1.6990 2.2563 0.4349  -0.0728 0.1996  121 GLN A NE2   
564  N N     . GLU A 75  ? 1.4603 1.2648 1.7297 0.3758  -0.1400 0.1394  122 GLU A N     
565  C CA    . GLU A 75  ? 1.3805 1.2932 1.7291 0.3749  -0.1658 0.1374  122 GLU A CA    
566  C C     . GLU A 75  ? 1.3496 1.2973 1.7196 0.3229  -0.1689 0.1137  122 GLU A C     
567  O O     . GLU A 75  ? 1.3024 1.3257 1.7179 0.3085  -0.1975 0.1113  122 GLU A O     
568  C CB    . GLU A 75  ? 1.4129 1.3581 1.8109 0.4162  -0.1487 0.1456  122 GLU A CB    
569  C CG    . GLU A 75  ? 1.5949 1.5310 1.9884 0.4753  -0.1517 0.1739  122 GLU A CG    
570  C CD    . GLU A 75  ? 1.7756 1.7332 2.2120 0.5222  -0.1281 0.1848  122 GLU A CD    
571  O OE1   . GLU A 75  ? 1.6453 1.6834 2.1386 0.5589  -0.1512 0.2038  122 GLU A OE1   
572  O OE2   . GLU A 75  ? 1.6307 1.5247 2.0422 0.5231  -0.0863 0.1748  122 GLU A OE2   
573  N N     . SER A 76  ? 1.2908 1.1842 1.6271 0.2951  -0.1393 0.0967  123 SER A N     
574  C CA    . SER A 76  ? 1.2185 1.1407 1.5700 0.2500  -0.1384 0.0764  123 SER A CA    
575  C C     . SER A 76  ? 1.2341 1.1453 1.5531 0.2109  -0.1553 0.0702  123 SER A C     
576  O O     . SER A 76  ? 1.1731 1.1197 1.5100 0.1774  -0.1605 0.0576  123 SER A O     
577  C CB    . SER A 76  ? 1.2783 1.1555 1.6089 0.2394  -0.1012 0.0614  123 SER A CB    
578  O OG    . SER A 76  ? 1.4178 1.2096 1.6779 0.2207  -0.0828 0.0546  123 SER A OG    
579  N N     . GLN A 77  ? 1.2122 1.0733 1.4829 0.2180  -0.1615 0.0808  124 GLN A N     
580  C CA    . GLN A 77  ? 1.1765 1.0193 1.4118 0.1869  -0.1732 0.0778  124 GLN A CA    
581  C C     . GLN A 77  ? 1.1569 1.0668 1.4258 0.1794  -0.2074 0.0808  124 GLN A C     
582  O O     . GLN A 77  ? 1.1337 1.0698 1.4172 0.2072  -0.2291 0.0946  124 GLN A O     
583  C CB    . GLN A 77  ? 1.2629 1.0262 1.4343 0.2003  -0.1649 0.0897  124 GLN A CB    
584  C CG    . GLN A 77  ? 1.3682 1.1110 1.5012 0.1737  -0.1766 0.0906  124 GLN A CG    
585  C CD    . GLN A 77  ? 1.5245 1.2581 1.6439 0.1277  -0.1634 0.0733  124 GLN A CD    
586  O OE1   . GLN A 77  ? 1.4843 1.1736 1.5792 0.1129  -0.1366 0.0630  124 GLN A OE1   
587  N NE2   . GLN A 77  ? 1.3568 1.1308 1.4884 0.1044  -0.1819 0.0704  124 GLN A NE2   
588  N N     . PRO A 78  ? 1.0797 1.0161 1.3573 0.1420  -0.2123 0.0683  125 PRO A N     
589  C CA    . PRO A 78  ? 1.0365 1.0248 1.3371 0.1321  -0.2413 0.0695  125 PRO A CA    
590  C C     . PRO A 78  ? 1.1179 1.0721 1.3723 0.1377  -0.2567 0.0807  125 PRO A C     
591  O O     . PRO A 78  ? 1.1597 1.0491 1.3622 0.1354  -0.2412 0.0842  125 PRO A O     
592  C CB    . PRO A 78  ? 1.0009 1.0048 1.3075 0.0938  -0.2339 0.0556  125 PRO A CB    
593  C CG    . PRO A 78  ? 1.0574 1.0420 1.3628 0.0873  -0.2061 0.0466  125 PRO A CG    
594  C CD    . PRO A 78  ? 1.0728 0.9939 1.3382 0.1085  -0.1917 0.0534  125 PRO A CD    
595  N N     . CYS A 79  ? 1.0489 1.0454 1.3202 0.1448  -0.2863 0.0861  126 CYS A N     
596  C CA    . CYS A 79  ? 1.0842 1.0555 1.3113 0.1510  -0.3046 0.0966  126 CYS A CA    
597  C C     . CYS A 79  ? 1.1139 1.1204 1.3491 0.1244  -0.3232 0.0882  126 CYS A C     
598  O O     . CYS A 79  ? 1.0712 1.1359 1.3560 0.1142  -0.3330 0.0792  126 CYS A O     
599  C CB    . CYS A 79  ? 1.1345 1.1183 1.3644 0.1912  -0.3242 0.1132  126 CYS A CB    
600  S SG    . CYS A 79  ? 1.2296 1.1871 1.4681 0.2300  -0.3003 0.1236  126 CYS A SG    
601  N N     . ALA A 80  ? 1.0994 1.0662 1.2835 0.1131  -0.3252 0.0912  127 ALA A N     
602  C CA    . ALA A 80  ? 1.0742 1.0595 1.2533 0.0893  -0.3385 0.0839  127 ALA A CA    
603  C C     . ALA A 80  ? 1.1968 1.1552 1.3257 0.1010  -0.3574 0.0945  127 ALA A C     
604  O O     . ALA A 80  ? 1.2432 1.1526 1.3300 0.1208  -0.3513 0.1078  127 ALA A O     
605  C CB    . ALA A 80  ? 1.0537 1.0146 1.2174 0.0601  -0.3149 0.0761  127 ALA A CB    
606  N N     . PHE A 81  ? 1.1419 1.1303 1.2726 0.0889  -0.3797 0.0885  128 PHE A N     
607  C CA    . PHE A 81  ? 1.1740 1.1420 1.2538 0.0947  -0.4004 0.0953  128 PHE A CA    
608  C C     . PHE A 81  ? 1.1989 1.1704 1.2687 0.0636  -0.4008 0.0821  128 PHE A C     
609  O O     . PHE A 81  ? 1.1654 1.1781 1.2808 0.0451  -0.4001 0.0689  128 PHE A O     
610  C CB    . PHE A 81  ? 1.2118 1.2255 1.3095 0.1181  -0.4346 0.1014  128 PHE A CB    
611  C CG    . PHE A 81  ? 1.2699 1.2623 1.3530 0.1569  -0.4347 0.1208  128 PHE A CG    
612  C CD1   . PHE A 81  ? 1.2824 1.2907 1.4101 0.1746  -0.4207 0.1241  128 PHE A CD1   
613  C CD2   . PHE A 81  ? 1.3549 1.3105 1.3777 0.1785  -0.4483 0.1367  128 PHE A CD2   
614  C CE1   . PHE A 81  ? 1.3355 1.3170 1.4460 0.2136  -0.4171 0.1432  128 PHE A CE1   
615  C CE2   . PHE A 81  ? 1.4253 1.3573 1.4320 0.2182  -0.4465 0.1572  128 PHE A CE2   
616  C CZ    . PHE A 81  ? 1.3795 1.3229 1.4303 0.2359  -0.4298 0.1603  128 PHE A CZ    
617  N N     . ILE A 82  ? 1.1667 1.0906 1.1752 0.0585  -0.3981 0.0862  129 ILE A N     
618  C CA    . ILE A 82  ? 1.1500 1.0660 1.1403 0.0319  -0.3931 0.0753  129 ILE A CA    
619  C C     . ILE A 82  ? 1.2462 1.1517 1.1875 0.0321  -0.4185 0.0745  129 ILE A C     
620  O O     . ILE A 82  ? 1.2737 1.1551 1.1723 0.0533  -0.4321 0.0873  129 ILE A O     
621  C CB    . ILE A 82  ? 1.1760 1.0466 1.1419 0.0198  -0.3582 0.0784  129 ILE A CB    
622  C CG1   . ILE A 82  ? 1.1368 1.0073 1.0997 -0.0055 -0.3453 0.0678  129 ILE A CG1   
623  C CG2   . ILE A 82  ? 1.2573 1.0681 1.1603 0.0333  -0.3502 0.0933  129 ILE A CG2   
624  C CD1   . ILE A 82  ? 0.9745 0.8621 0.9767 -0.0183 -0.3220 0.0637  129 ILE A CD1   
625  N N     . GLY A 83  ? 1.1974 1.1157 1.1400 0.0081  -0.4224 0.0596  130 GLY A N     
626  C CA    . GLY A 83  ? 1.2552 1.1595 1.1464 0.0019  -0.4438 0.0545  130 GLY A CA    
627  C C     . GLY A 83  ? 1.3181 1.2160 1.2031 -0.0276 -0.4334 0.0375  130 GLY A C     
628  O O     . GLY A 83  ? 1.2656 1.1710 1.1873 -0.0406 -0.4090 0.0322  130 GLY A O     
629  N N     . ILE A 84  ? 1.3599 1.2413 1.1943 -0.0374 -0.4515 0.0293  131 ILE A N     
630  C CA    . ILE A 84  ? 1.3823 1.2475 1.1977 -0.0655 -0.4426 0.0115  131 ILE A CA    
631  C C     . ILE A 84  ? 1.5246 1.4412 1.3692 -0.0842 -0.4744 -0.0071 131 ILE A C     
632  O O     . ILE A 84  ? 1.5232 1.4845 1.3875 -0.0717 -0.5075 -0.0035 131 ILE A O     
633  C CB    . ILE A 84  ? 1.4631 1.2588 1.1947 -0.0670 -0.4275 0.0143  131 ILE A CB    
634  C CG1   . ILE A 84  ? 1.5330 1.3151 1.2027 -0.0593 -0.4601 0.0154  131 ILE A CG1   
635  C CG2   . ILE A 84  ? 1.4517 1.2119 1.1730 -0.0511 -0.3955 0.0329  131 ILE A CG2   
636  C CD1   . ILE A 84  ? 1.6417 1.3532 1.2250 -0.0609 -0.4439 0.0175  131 ILE A CD1   
637  N N     . GLY A 85  ? 1.5526 1.4665 1.4070 -0.1126 -0.4618 -0.0252 132 GLY A N     
638  C CA    . GLY A 85  ? 1.6004 1.5636 1.4919 -0.1366 -0.4849 -0.0447 132 GLY A CA    
639  C C     . GLY A 85  ? 1.8316 1.7917 1.6745 -0.1582 -0.5153 -0.0625 132 GLY A C     
640  O O     . GLY A 85  ? 1.8656 1.7871 1.6744 -0.1854 -0.5006 -0.0799 132 GLY A O     
641  N N     . ASN A 86  ? 1.8797 1.8834 1.7202 -0.1481 -0.5585 -0.0598 133 ASN A N     
642  C CA    . ASN A 86  ? 1.8751 1.9235 1.7534 -0.1132 -0.5766 -0.0386 133 ASN A CA    
643  C C     . ASN A 86  ? 2.0197 2.0466 1.8321 -0.0865 -0.6008 -0.0229 133 ASN A C     
644  O O     . ASN A 86  ? 2.0118 2.0563 1.8424 -0.0526 -0.6075 -0.0016 133 ASN A O     
645  C CB    . ASN A 86  ? 1.8848 2.0241 1.8473 -0.1188 -0.6024 -0.0450 133 ASN A CB    
646  C CG    . ASN A 86  ? 2.2068 2.3874 2.2250 -0.0823 -0.6048 -0.0233 133 ASN A CG    
647  O OD1   . ASN A 86  ? 2.0994 2.2505 2.1305 -0.0657 -0.5723 -0.0106 133 ASN A OD1   
648  N ND2   . ASN A 86  ? 2.0832 2.3333 2.1336 -0.0687 -0.6432 -0.0184 133 ASN A ND2   
649  N N     . SER A 87  ? 2.0558 2.0380 1.7865 -0.1007 -0.6105 -0.0326 134 SER A N     
650  C CA    . SER A 87  ? 2.1270 2.0832 1.7833 -0.0780 -0.6334 -0.0188 134 SER A CA    
651  C C     . SER A 87  ? 2.2175 2.2522 1.9044 -0.0586 -0.6825 -0.0101 134 SER A C     
652  O O     . SER A 87  ? 2.1876 2.2953 1.9348 -0.0778 -0.7064 -0.0249 134 SER A O     
653  C CB    . SER A 87  ? 2.1428 2.0344 1.7625 -0.0487 -0.6006 0.0049  134 SER A CB    
654  O OG    . SER A 87  ? 2.1959 2.0173 1.7703 -0.0655 -0.5624 -0.0023 134 SER A OG    
655  N N     . ASP A 88  ? 2.2305 2.2510 1.8763 -0.0205 -0.6962 0.0147  135 ASP A N     
656  C CA    . ASP A 88  ? 2.2494 2.3421 1.9203 0.0061  -0.7407 0.0284  135 ASP A CA    
657  C C     . ASP A 88  ? 2.2356 2.3585 1.9751 0.0440  -0.7292 0.0522  135 ASP A C     
658  O O     . ASP A 88  ? 2.2603 2.4169 2.0021 0.0807  -0.7553 0.0735  135 ASP A O     
659  C CB    . ASP A 88  ? 2.3702 2.4365 1.9472 0.0233  -0.7706 0.0393  135 ASP A CB    
660  C CG    . ASP A 88  ? 2.5706 2.6800 2.1219 -0.0081 -0.8146 0.0161  135 ASP A CG    
661  O OD1   . ASP A 88  ? 2.6050 2.6696 2.1122 -0.0471 -0.8021 -0.0089 135 ASP A OD1   
662  O OD2   . ASP A 88  ? 2.6671 2.8548 2.2406 0.0065  -0.8610 0.0232  135 ASP A OD2   
663  N N     . GLN A 89  ? 2.1023 2.2130 1.8963 0.0349  -0.6897 0.0479  136 GLN A N     
664  C CA    . GLN A 89  ? 2.0313 2.1633 1.8927 0.0613  -0.6706 0.0636  136 GLN A CA    
665  C C     . GLN A 89  ? 2.0611 2.1270 1.8859 0.0968  -0.6428 0.0893  136 GLN A C     
666  O O     . GLN A 89  ? 2.0434 2.1294 1.9091 0.1274  -0.6383 0.1061  136 GLN A O     
667  C CB    . GLN A 89  ? 2.0277 2.2598 1.9687 0.0743  -0.7028 0.0663  136 GLN A CB    
668  C CG    . GLN A 89  ? 2.0677 2.3533 2.0941 0.0443  -0.6924 0.0462  136 GLN A CG    
669  C CD    . GLN A 89  ? 2.1389 2.3966 2.2040 0.0524  -0.6487 0.0520  136 GLN A CD    
670  O OE1   . GLN A 89  ? 2.0018 2.2705 2.0972 0.0867  -0.6413 0.0706  136 GLN A OE1   
671  N NE2   . GLN A 89  ? 2.0404 2.2596 2.1017 0.0214  -0.6182 0.0363  136 GLN A NE2   
672  N N     . GLU A 90  ? 2.0045 1.9888 1.7536 0.0903  -0.6200 0.0911  137 GLU A N     
673  C CA    . GLU A 90  ? 1.9861 1.9017 1.6972 0.1152  -0.5891 0.1124  137 GLU A CA    
674  C C     . GLU A 90  ? 1.8769 1.7807 1.6395 0.1019  -0.5482 0.1067  137 GLU A C     
675  O O     . GLU A 90  ? 1.8477 1.7221 1.6002 0.0739  -0.5237 0.0936  137 GLU A O     
676  C CB    . GLU A 90  ? 2.0693 1.9081 1.6829 0.1112  -0.5795 0.1162  137 GLU A CB    
677  C CG    . GLU A 90  ? 2.3041 2.1449 1.8538 0.1296  -0.6182 0.1259  137 GLU A CG    
678  C CD    . GLU A 90  ? 2.5851 2.4782 2.1320 0.1058  -0.6585 0.1053  137 GLU A CD    
679  O OE1   . GLU A 90  ? 2.3601 2.2680 1.9365 0.0684  -0.6506 0.0803  137 GLU A OE1   
680  O OE2   . GLU A 90  ? 2.5557 2.4733 2.0673 0.1242  -0.6976 0.1144  137 GLU A OE2   
681  N N     . MET A 91  ? 1.7341 1.6661 1.5536 0.1223  -0.5421 0.1160  138 MET A N     
682  C CA    . MET A 91  ? 1.6355 1.5619 1.5033 0.1119  -0.5068 0.1112  138 MET A CA    
683  C C     . MET A 91  ? 1.6145 1.4871 1.4611 0.1357  -0.4798 0.1298  138 MET A C     
684  O O     . MET A 91  ? 1.6396 1.5148 1.4839 0.1695  -0.4904 0.1468  138 MET A O     
685  C CB    . MET A 91  ? 1.6087 1.6112 1.5642 0.1076  -0.5161 0.1010  138 MET A CB    
686  C CG    . MET A 91  ? 1.6256 1.6674 1.6105 0.0714  -0.5245 0.0778  138 MET A CG    
687  S SD    . MET A 91  ? 1.6058 1.7042 1.6867 0.0583  -0.5083 0.0659  138 MET A SD    
688  C CE    . MET A 91  ? 1.5544 1.6803 1.6472 0.0148  -0.5176 0.0401  138 MET A CE    
689  N N     . GLN A 92  ? 1.4935 1.3178 1.3246 0.1177  -0.4438 0.1267  139 GLN A N     
690  C CA    . GLN A 92  ? 1.4781 1.2464 1.2874 0.1299  -0.4132 0.1400  139 GLN A CA    
691  C C     . GLN A 92  ? 1.4302 1.2197 1.3001 0.1291  -0.3946 0.1357  139 GLN A C     
692  O O     . GLN A 92  ? 1.3472 1.1735 1.2652 0.1059  -0.3881 0.1201  139 GLN A O     
693  C CB    . GLN A 92  ? 1.5057 1.2157 1.2655 0.1092  -0.3850 0.1394  139 GLN A CB    
694  C CG    . GLN A 92  ? 1.7098 1.3682 1.3895 0.1225  -0.3918 0.1530  139 GLN A CG    
695  C CD    . GLN A 92  ? 1.8544 1.5040 1.5007 0.0992  -0.3930 0.1425  139 GLN A CD    
696  O OE1   . GLN A 92  ? 1.7975 1.3998 1.4068 0.0863  -0.3651 0.1448  139 GLN A OE1   
697  N NE2   . GLN A 92  ? 1.7205 1.4147 1.3786 0.0924  -0.4235 0.1304  139 GLN A NE2   
698  N N     . GLN A 93  ? 1.4171 1.1783 1.2797 0.1557  -0.3841 0.1499  140 GLN A N     
699  C CA    . GLN A 93  ? 1.3698 1.1409 1.2799 0.1573  -0.3641 0.1460  140 GLN A CA    
700  C C     . GLN A 93  ? 1.4046 1.1351 1.3033 0.1302  -0.3291 0.1390  140 GLN A C     
701  O O     . GLN A 93  ? 1.4555 1.1245 1.2993 0.1282  -0.3118 0.1477  140 GLN A O     
702  C CB    . GLN A 93  ? 1.4263 1.1730 1.3267 0.1966  -0.3615 0.1638  140 GLN A CB    
703  C CG    . GLN A 93  ? 1.3612 1.1187 1.3101 0.1983  -0.3404 0.1575  140 GLN A CG    
704  C CD    . GLN A 93  ? 1.5080 1.2498 1.4578 0.2399  -0.3368 0.1737  140 GLN A CD    
705  O OE1   . GLN A 93  ? 1.4404 1.1633 1.3546 0.2735  -0.3507 0.1934  140 GLN A OE1   
706  N NE2   . GLN A 93  ? 1.3130 1.0614 1.3017 0.2401  -0.3163 0.1663  140 GLN A NE2   
707  N N     . LEU A 94  ? 1.2842 1.0510 1.2349 0.1095  -0.3183 0.1241  141 LEU A N     
708  C CA    . LEU A 94  ? 1.2643 1.0055 1.2125 0.0837  -0.2874 0.1170  141 LEU A CA    
709  C C     . LEU A 94  ? 1.3420 1.0581 1.2975 0.0957  -0.2681 0.1191  141 LEU A C     
710  O O     . LEU A 94  ? 1.3169 1.0633 1.3092 0.1156  -0.2768 0.1190  141 LEU A O     
711  C CB    . LEU A 94  ? 1.1977 0.9905 1.1930 0.0563  -0.2854 0.1010  141 LEU A CB    
712  C CG    . LEU A 94  ? 1.2406 1.0564 1.2324 0.0411  -0.2986 0.0958  141 LEU A CG    
713  C CD1   . LEU A 94  ? 1.1667 1.0285 1.2066 0.0202  -0.2930 0.0826  141 LEU A CD1   
714  C CD2   . LEU A 94  ? 1.3306 1.1003 1.2696 0.0292  -0.2844 0.1013  141 LEU A CD2   
715  N N     . ASN A 95  ? 1.3488 1.0088 1.2691 0.0825  -0.2403 0.1205  142 ASN A N     
716  C CA    . ASN A 95  ? 1.3861 1.0136 1.3066 0.0888  -0.2185 0.1194  142 ASN A CA    
717  C C     . ASN A 95  ? 1.4232 1.0705 1.3734 0.0565  -0.2000 0.1024  142 ASN A C     
718  O O     . ASN A 95  ? 1.4322 1.0572 1.3615 0.0280  -0.1821 0.0981  142 ASN A O     
719  C CB    . ASN A 95  ? 1.4763 1.0204 1.3345 0.1003  -0.1989 0.1326  142 ASN A CB    
720  C CG    . ASN A 95  ? 1.8226 1.3279 1.6786 0.1109  -0.1760 0.1310  142 ASN A CG    
721  O OD1   . ASN A 95  ? 1.7356 1.2502 1.6087 0.1449  -0.1838 0.1377  142 ASN A OD1   
722  N ND2   . ASN A 95  ? 1.7200 1.1884 1.5599 0.0799  -0.1471 0.1202  142 ASN A ND2   
723  N N     . LEU A 96  ? 1.3585 1.0514 1.3579 0.0614  -0.2045 0.0934  143 LEU A N     
724  C CA    . LEU A 96  ? 1.3272 1.0428 1.3543 0.0346  -0.1889 0.0777  143 LEU A CA    
725  C C     . LEU A 96  ? 1.4688 1.1430 1.4853 0.0419  -0.1665 0.0736  143 LEU A C     
726  O O     . LEU A 96  ? 1.4607 1.1562 1.5018 0.0269  -0.1559 0.0604  143 LEU A O     
727  C CB    . LEU A 96  ? 1.2514 1.0409 1.3361 0.0326  -0.2044 0.0696  143 LEU A CB    
728  C CG    . LEU A 96  ? 1.2664 1.0977 1.3669 0.0325  -0.2283 0.0725  143 LEU A CG    
729  C CD1   . LEU A 96  ? 1.2323 1.1184 1.3831 0.0477  -0.2454 0.0697  143 LEU A CD1   
730  C CD2   . LEU A 96  ? 1.2379 1.0879 1.3407 0.0025  -0.2225 0.0664  143 LEU A CD2   
731  N N     . GLU A 97  ? 1.4878 1.1008 1.4653 0.0668  -0.1583 0.0854  144 GLU A N     
732  C CA    . GLU A 97  ? 1.5428 1.1042 1.5025 0.0763  -0.1331 0.0822  144 GLU A CA    
733  C C     . GLU A 97  ? 1.6025 1.1298 1.5372 0.0350  -0.1073 0.0671  144 GLU A C     
734  O O     . GLU A 97  ? 1.6390 1.1231 1.5332 0.0163  -0.0967 0.0701  144 GLU A O     
735  C CB    . GLU A 97  ? 1.6464 1.1418 1.5628 0.1131  -0.1267 0.1007  144 GLU A CB    
736  C CG    . GLU A 97  ? 1.7817 1.3032 1.7276 0.1598  -0.1401 0.1123  144 GLU A CG    
737  C CD    . GLU A 97  ? 2.1394 1.5906 2.0530 0.1935  -0.1157 0.1223  144 GLU A CD    
738  O OE1   . GLU A 97  ? 2.1459 1.5178 2.0095 0.1771  -0.0846 0.1173  144 GLU A OE1   
739  O OE2   . GLU A 97  ? 2.0540 1.5303 1.9934 0.2362  -0.1261 0.1350  144 GLU A OE2   
740  N N     . GLY A 98  ? 1.5071 1.0620 1.4689 0.0191  -0.0991 0.0509  145 GLY A N     
741  C CA    . GLY A 98  ? 1.4983 1.0362 1.4434 -0.0220 -0.0783 0.0336  145 GLY A CA    
742  C C     . GLY A 98  ? 1.4754 1.0657 1.4377 -0.0578 -0.0879 0.0279  145 GLY A C     
743  O O     . GLY A 98  ? 1.4901 1.0744 1.4393 -0.0941 -0.0735 0.0150  145 GLY A O     
744  N N     . LYS A 99  ? 1.3590 1.0015 1.3498 -0.0481 -0.1117 0.0375  146 LYS A N     
745  C CA    . LYS A 99  ? 1.2938 0.9863 1.3021 -0.0746 -0.1200 0.0358  146 LYS A CA    
746  C C     . LYS A 99  ? 1.2573 1.0222 1.3165 -0.0669 -0.1385 0.0341  146 LYS A C     
747  O O     . LYS A 99  ? 1.2285 1.0076 1.3080 -0.0385 -0.1526 0.0397  146 LYS A O     
748  C CB    . LYS A 99  ? 1.3324 1.0074 1.3170 -0.0717 -0.1265 0.0494  146 LYS A CB    
749  C CG    . LYS A 99  ? 1.4848 1.0821 1.4157 -0.0711 -0.1096 0.0563  146 LYS A CG    
750  C CD    . LYS A 99  ? 1.6410 1.2257 1.5503 -0.0570 -0.1208 0.0723  146 LYS A CD    
751  C CE    . LYS A 99  ? 1.7230 1.3324 1.6326 -0.0851 -0.1177 0.0729  146 LYS A CE    
752  N NZ    . LYS A 99  ? 1.7578 1.3782 1.6610 -0.0684 -0.1347 0.0851  146 LYS A NZ    
753  N N     . ASN A 100 ? 1.1637 0.9755 1.2435 -0.0919 -0.1380 0.0278  147 ASN A N     
754  C CA    . ASN A 100 ? 1.0986 0.9732 1.2223 -0.0868 -0.1513 0.0270  147 ASN A CA    
755  C C     . ASN A 100 ? 1.1193 1.0124 1.2489 -0.0795 -0.1665 0.0376  147 ASN A C     
756  O O     . ASN A 100 ? 1.0837 1.0194 1.2450 -0.0736 -0.1774 0.0381  147 ASN A O     
757  C CB    . ASN A 100 ? 1.0656 0.9813 1.2049 -0.1126 -0.1437 0.0184  147 ASN A CB    
758  C CG    . ASN A 100 ? 1.8552 1.7429 1.9666 -0.1375 -0.1265 0.0081  147 ASN A CG    
759  O OD1   . ASN A 100 ? 1.9198 1.7765 2.0188 -0.1344 -0.1164 -0.0012 147 ASN A OD1   
760  N ND2   . ASN A 100 ? 1.8454 1.7409 1.9445 -0.1634 -0.1215 0.0092  147 ASN A ND2   
761  N N     . TYR A 101 ? 1.0744 0.9306 1.1697 -0.0809 -0.1651 0.0456  148 TYR A N     
762  C CA    . TYR A 101 ? 1.0392 0.9039 1.1298 -0.0760 -0.1763 0.0546  148 TYR A CA    
763  C C     . TYR A 101 ? 1.0959 0.9073 1.1437 -0.0648 -0.1772 0.0641  148 TYR A C     
764  O O     . TYR A 101 ? 1.1089 0.8744 1.1283 -0.0668 -0.1642 0.0646  148 TYR A O     
765  C CB    . TYR A 101 ? 1.0226 0.9157 1.1183 -0.0993 -0.1672 0.0555  148 TYR A CB    
766  C CG    . TYR A 101 ? 1.0848 0.9475 1.1493 -0.1184 -0.1508 0.0581  148 TYR A CG    
767  C CD1   . TYR A 101 ? 1.1384 0.9934 1.1986 -0.1387 -0.1366 0.0497  148 TYR A CD1   
768  C CD2   . TYR A 101 ? 1.1082 0.9502 1.1467 -0.1191 -0.1478 0.0680  148 TYR A CD2   
769  C CE1   . TYR A 101 ? 1.1811 1.0109 1.2151 -0.1614 -0.1204 0.0507  148 TYR A CE1   
770  C CE2   . TYR A 101 ? 1.1536 0.9699 1.1665 -0.1387 -0.1301 0.0709  148 TYR A CE2   
771  C CZ    . TYR A 101 ? 1.3450 1.1570 1.3578 -0.1611 -0.1167 0.0620  148 TYR A CZ    
772  O OH    . TYR A 101 ? 1.5034 1.2922 1.4931 -0.1851 -0.0982 0.0635  148 TYR A OH    
773  N N     . CYS A 102 ? 1.0582 0.8715 1.0958 -0.0554 -0.1902 0.0716  149 CYS A N     
774  C CA    . CYS A 102 ? 1.1263 0.8903 1.1174 -0.0441 -0.1922 0.0822  149 CYS A CA    
775  C C     . CYS A 102 ? 1.1558 0.9288 1.1348 -0.0458 -0.1997 0.0870  149 CYS A C     
776  O O     . CYS A 102 ? 1.1426 0.9546 1.1488 -0.0430 -0.2136 0.0826  149 CYS A O     
777  C CB    . CYS A 102 ? 1.1834 0.9270 1.1661 -0.0145 -0.2071 0.0871  149 CYS A CB    
778  S SG    . CYS A 102 ? 1.3192 0.9952 1.2363 0.0035  -0.2079 0.1032  149 CYS A SG    
779  N N     . THR A 103 ? 1.1133 0.8451 1.0476 -0.0493 -0.1896 0.0959  150 THR A N     
780  C CA    . THR A 103 ? 1.0938 0.8249 1.0074 -0.0489 -0.1942 0.1006  150 THR A CA    
781  C C     . THR A 103 ? 1.1459 0.8444 1.0190 -0.0265 -0.2131 0.1077  150 THR A C     
782  O O     . THR A 103 ? 1.1553 0.8135 0.9986 -0.0118 -0.2142 0.1154  150 THR A O     
783  C CB    . THR A 103 ? 1.1562 0.8739 1.0505 -0.0677 -0.1699 0.1059  150 THR A CB    
784  O OG1   . THR A 103 ? 1.2164 0.8796 1.0691 -0.0678 -0.1565 0.1138  150 THR A OG1   
785  C CG2   . THR A 103 ? 1.0390 0.8030 0.9758 -0.0892 -0.1554 0.1002  150 THR A CG2   
786  N N     . ALA A 104 ? 1.0913 0.8059 0.9602 -0.0244 -0.2273 0.1053  151 ALA A N     
787  C CA    . ALA A 104 ? 1.1255 0.8186 0.9549 -0.0075 -0.2487 0.1096  151 ALA A CA    
788  C C     . ALA A 104 ? 1.2202 0.8655 0.9914 -0.0115 -0.2327 0.1187  151 ALA A C     
789  O O     . ALA A 104 ? 1.2120 0.8576 0.9680 -0.0198 -0.2284 0.1162  151 ALA A O     
790  C CB    . ALA A 104 ? 1.1045 0.8391 0.9596 -0.0092 -0.2699 0.0988  151 ALA A CB    
791  N N     . LYS A 105 ? 1.2125 0.8120 0.9500 -0.0058 -0.2193 0.1297  152 LYS A N     
792  C CA    . LYS A 105 ? 1.2508 0.7993 0.9343 -0.0102 -0.1975 0.1404  152 LYS A CA    
793  C C     . LYS A 105 ? 1.3898 0.9026 1.0113 0.0050  -0.2110 0.1475  152 LYS A C     
794  O O     . LYS A 105 ? 1.4245 0.9042 1.0051 -0.0018 -0.1914 0.1536  152 LYS A O     
795  C CB    . LYS A 105 ? 1.2987 0.8058 0.9658 -0.0100 -0.1784 0.1490  152 LYS A CB    
796  C CG    . LYS A 105 ? 1.3528 0.8833 1.0638 -0.0346 -0.1556 0.1420  152 LYS A CG    
797  C CD    . LYS A 105 ? 1.4779 0.9954 1.2017 -0.0278 -0.1562 0.1404  152 LYS A CD    
798  C CE    . LYS A 105 ? 1.7109 1.2259 1.4525 -0.0547 -0.1290 0.1352  152 LYS A CE    
799  N NZ    . LYS A 105 ? 1.9534 1.4094 1.6470 -0.0662 -0.1014 0.1450  152 LYS A NZ    
800  N N     . THR A 106 ? 1.3783 0.8996 0.9919 0.0254  -0.2438 0.1471  153 THR A N     
801  C CA    . THR A 106 ? 1.4432 0.9330 0.9929 0.0412  -0.2620 0.1539  153 THR A CA    
802  C C     . THR A 106 ? 1.4884 1.0145 1.0430 0.0403  -0.2927 0.1413  153 THR A C     
803  O O     . THR A 106 ? 1.5518 1.0684 1.0661 0.0566  -0.3194 0.1452  153 THR A O     
804  C CB    . THR A 106 ? 1.6376 1.0886 1.1486 0.0686  -0.2710 0.1703  153 THR A CB    
805  O OG1   . THR A 106 ? 1.6668 1.1547 1.2298 0.0808  -0.2866 0.1680  153 THR A OG1   
806  C CG2   . THR A 106 ? 1.6462 1.0341 1.1173 0.0665  -0.2359 0.1842  153 THR A CG2   
807  N N     . LEU A 107 ? 1.3852 0.9493 0.9829 0.0204  -0.2876 0.1268  154 LEU A N     
808  C CA    . LEU A 107 ? 1.3769 0.9692 0.9782 0.0141  -0.3114 0.1126  154 LEU A CA    
809  C C     . LEU A 107 ? 1.5129 1.0649 1.0523 0.0056  -0.3006 0.1104  154 LEU A C     
810  O O     . LEU A 107 ? 1.5414 1.0664 1.0671 -0.0024 -0.2673 0.1156  154 LEU A O     
811  C CB    . LEU A 107 ? 1.2943 0.9399 0.9681 -0.0023 -0.3076 0.0986  154 LEU A CB    
812  C CG    . LEU A 107 ? 1.2991 0.9951 1.0358 0.0044  -0.3262 0.0948  154 LEU A CG    
813  C CD1   . LEU A 107 ? 1.2422 0.9827 1.0391 -0.0132 -0.3186 0.0816  154 LEU A CD1   
814  C CD2   . LEU A 107 ? 1.3278 1.0443 1.0571 0.0183  -0.3649 0.0930  154 LEU A CD2   
815  N N     . TYR A 108 ? 1.4929 1.0435 0.9962 0.0061  -0.3278 0.1018  155 TYR A N     
816  C CA    . TYR A 108 ? 1.5405 1.0487 0.9789 -0.0028 -0.3182 0.0967  155 TYR A CA    
817  C C     . TYR A 108 ? 1.6183 1.1487 1.0486 -0.0131 -0.3503 0.0779  155 TYR A C     
818  O O     . TYR A 108 ? 1.6050 1.1830 1.0729 -0.0090 -0.3836 0.0732  155 TYR A O     
819  C CB    . TYR A 108 ? 1.6296 1.0769 0.9866 0.0127  -0.3121 0.1129  155 TYR A CB    
820  C CG    . TYR A 108 ? 1.6916 1.1427 1.0205 0.0332  -0.3506 0.1200  155 TYR A CG    
821  C CD1   . TYR A 108 ? 1.7085 1.1775 1.0720 0.0516  -0.3586 0.1330  155 TYR A CD1   
822  C CD2   . TYR A 108 ? 1.7487 1.1889 1.0179 0.0346  -0.3800 0.1132  155 TYR A CD2   
823  C CE1   . TYR A 108 ? 1.7850 1.2638 1.1280 0.0750  -0.3941 0.1419  155 TYR A CE1   
824  C CE2   . TYR A 108 ? 1.7951 1.2508 1.0439 0.0553  -0.4191 0.1211  155 TYR A CE2   
825  C CZ    . TYR A 108 ? 1.8981 1.3736 1.1848 0.0778  -0.4254 0.1371  155 TYR A CZ    
826  O OH    . TYR A 108 ? 1.9498 1.4416 1.2168 0.1037  -0.4620 0.1486  155 TYR A OH    
827  N N     . ILE A 109 ? 1.5953 1.0905 0.9752 -0.0272 -0.3392 0.0668  156 ILE A N     
828  C CA    . ILE A 109 ? 1.6060 1.1098 0.9646 -0.0433 -0.3653 0.0457  156 ILE A CA    
829  C C     . ILE A 109 ? 1.7384 1.1817 0.9946 -0.0430 -0.3688 0.0438  156 ILE A C     
830  O O     . ILE A 109 ? 1.7573 1.1467 0.9682 -0.0431 -0.3328 0.0489  156 ILE A O     
831  C CB    . ILE A 109 ? 1.5837 1.1073 0.9906 -0.0658 -0.3475 0.0285  156 ILE A CB    
832  C CG1   . ILE A 109 ? 1.6131 1.1598 1.0186 -0.0860 -0.3790 0.0051  156 ILE A CG1   
833  C CG2   . ILE A 109 ? 1.5836 1.0580 0.9619 -0.0711 -0.3008 0.0304  156 ILE A CG2   
834  C CD1   . ILE A 109 ? 1.6537 1.2375 1.1287 -0.1043 -0.3696 -0.0085 156 ILE A CD1   
835  N N     . SER A 110 ? 1.7500 1.2043 0.9691 -0.0412 -0.4116 0.0377  157 SER A N     
836  C CA    . SER A 110 ? 1.8504 1.2484 0.9658 -0.0409 -0.4188 0.0353  157 SER A CA    
837  C C     . SER A 110 ? 1.9792 1.3561 1.0534 -0.0702 -0.4214 0.0074  157 SER A C     
838  O O     . SER A 110 ? 1.9277 1.3452 1.0569 -0.0912 -0.4300 -0.0113 157 SER A O     
839  C CB    . SER A 110 ? 1.9190 1.3333 1.0017 -0.0205 -0.4622 0.0466  157 SER A CB    
840  O OG    . SER A 110 ? 2.1212 1.4842 1.0997 -0.0217 -0.4729 0.0427  157 SER A OG    
841  N N     . ASP A 111 ? 2.0581 1.3663 1.0308 -0.0719 -0.4116 0.0044  158 ASP A N     
842  C CA    . ASP A 111 ? 2.1374 1.4084 1.0494 -0.0992 -0.4113 -0.0226 158 ASP A CA    
843  C C     . ASP A 111 ? 2.2363 1.5617 1.1626 -0.1198 -0.4641 -0.0445 158 ASP A C     
844  O O     . ASP A 111 ? 2.2657 1.5853 1.1879 -0.1506 -0.4630 -0.0712 158 ASP A O     
845  C CB    . ASP A 111 ? 2.2761 1.4658 1.0686 -0.0931 -0.3982 -0.0196 158 ASP A CB    
846  C CG    . ASP A 111 ? 2.5918 1.7803 1.3220 -0.0741 -0.4372 -0.0066 158 ASP A CG    
847  O OD1   . ASP A 111 ? 2.5815 1.8256 1.3650 -0.0547 -0.4646 0.0101  158 ASP A OD1   
848  O OD2   . ASP A 111 ? 2.7782 1.9053 1.4025 -0.0754 -0.4366 -0.0110 158 ASP A OD2   
849  N N     . SER A 112 ? 2.1887 1.5691 1.1356 -0.1024 -0.5085 -0.0321 159 SER A N     
850  C CA    . SER A 112 ? 2.1852 1.6380 1.1611 -0.1158 -0.5640 -0.0467 159 SER A CA    
851  C C     . SER A 112 ? 2.1385 1.6431 1.2084 -0.1415 -0.5599 -0.0653 159 SER A C     
852  O O     . SER A 112 ? 2.1554 1.6944 1.2319 -0.1713 -0.5897 -0.0903 159 SER A O     
853  C CB    . SER A 112 ? 2.2118 1.7185 1.2171 -0.0823 -0.5988 -0.0216 159 SER A CB    
854  O OG    . SER A 112 ? 2.2898 1.7579 1.2853 -0.0491 -0.5686 0.0081  159 SER A OG    
855  N N     . ASP A 113 ? 1.9910 1.4976 1.1288 -0.1325 -0.5210 -0.0538 160 ASP A N     
856  C CA    . ASP A 113 ? 1.9172 1.4623 1.1368 -0.1546 -0.5098 -0.0690 160 ASP A CA    
857  C C     . ASP A 113 ? 2.0110 1.4946 1.1857 -0.1840 -0.4775 -0.0919 160 ASP A C     
858  O O     . ASP A 113 ? 2.0288 1.4464 1.1616 -0.1753 -0.4343 -0.0839 160 ASP A O     
859  C CB    . ASP A 113 ? 1.8328 1.4025 1.1347 -0.1344 -0.4817 -0.0489 160 ASP A CB    
860  C CG    . ASP A 113 ? 1.7918 1.4345 1.1902 -0.1478 -0.4946 -0.0586 160 ASP A CG    
861  O OD1   . ASP A 113 ? 1.7678 1.4074 1.1780 -0.1776 -0.4849 -0.0807 160 ASP A OD1   
862  O OD2   . ASP A 113 ? 1.7991 1.4995 1.2571 -0.1288 -0.5145 -0.0448 160 ASP A OD2   
863  N N     . LYS A 114 ? 1.9832 1.4870 1.1646 -0.2189 -0.4970 -0.1202 161 LYS A N     
864  C CA    . LYS A 114 ? 2.0313 1.4696 1.1634 -0.2485 -0.4661 -0.1440 161 LYS A CA    
865  C C     . LYS A 114 ? 2.0267 1.4656 1.2256 -0.2587 -0.4264 -0.1479 161 LYS A C     
866  O O     . LYS A 114 ? 2.0615 1.4345 1.2173 -0.2753 -0.3902 -0.1619 161 LYS A O     
867  C CB    . LYS A 114 ? 2.1387 1.5705 1.2087 -0.2849 -0.5020 -0.1753 161 LYS A CB    
868  C CG    . LYS A 114 ? 2.2200 1.6282 1.1966 -0.2737 -0.5325 -0.1712 161 LYS A CG    
869  C CD    . LYS A 114 ? 2.3360 1.6533 1.2313 -0.2498 -0.4898 -0.1552 161 LYS A CD    
870  C CE    . LYS A 114 ? 2.4266 1.7202 1.2306 -0.2343 -0.5177 -0.1467 161 LYS A CE    
871  N NZ    . LYS A 114 ? 2.4474 1.6609 1.1876 -0.2078 -0.4723 -0.1265 161 LYS A NZ    
872  N N     . ARG A 115 ? 1.8888 1.3967 1.1876 -0.2453 -0.4300 -0.1335 162 ARG A N     
873  C CA    . ARG A 115 ? 1.8111 1.3309 1.1808 -0.2502 -0.3959 -0.1329 162 ARG A CA    
874  C C     . ARG A 115 ? 1.8609 1.3147 1.2021 -0.2341 -0.3412 -0.1195 162 ARG A C     
875  O O     . ARG A 115 ? 1.8433 1.2795 1.1622 -0.2066 -0.3304 -0.0980 162 ARG A O     
876  C CB    . ARG A 115 ? 1.7011 1.2999 1.1684 -0.2306 -0.4089 -0.1146 162 ARG A CB    
877  C CG    . ARG A 115 ? 1.7546 1.4329 1.2788 -0.2459 -0.4542 -0.1264 162 ARG A CG    
878  C CD    . ARG A 115 ? 1.6657 1.4115 1.2769 -0.2207 -0.4614 -0.1058 162 ARG A CD    
879  N NE    . ARG A 115 ? 1.7337 1.4800 1.3225 -0.1874 -0.4752 -0.0831 162 ARG A NE    
880  C CZ    . ARG A 115 ? 1.7978 1.5659 1.4323 -0.1593 -0.4652 -0.0606 162 ARG A CZ    
881  N NH1   . ARG A 115 ? 1.6234 1.4203 1.3298 -0.1594 -0.4441 -0.0575 162 ARG A NH1   
882  N NH2   . ARG A 115 ? 1.6030 1.3614 1.2078 -0.1317 -0.4757 -0.0414 162 ARG A NH2   
883  N N     . LYS A 116 ? 1.8356 1.2531 1.1775 -0.2507 -0.3054 -0.1314 163 LYS A N     
884  C CA    . LYS A 116 ? 1.8306 1.1924 1.1537 -0.2335 -0.2507 -0.1173 163 LYS A CA    
885  C C     . LYS A 116 ? 1.7471 1.1601 1.1570 -0.2092 -0.2336 -0.0922 163 LYS A C     
886  O O     . LYS A 116 ? 1.7148 1.1085 1.1194 -0.1849 -0.2022 -0.0712 163 LYS A O     
887  C CB    . LYS A 116 ? 1.9245 1.2235 1.2093 -0.2573 -0.2180 -0.1381 163 LYS A CB    
888  C CG    . LYS A 116 ? 2.2082 1.4140 1.3886 -0.2556 -0.1890 -0.1432 163 LYS A CG    
889  C CD    . LYS A 116 ? 2.3871 1.5727 1.4889 -0.2673 -0.2264 -0.1574 163 LYS A CD    
890  C CE    . LYS A 116 ? 2.5712 1.6595 1.5673 -0.2653 -0.1925 -0.1628 163 LYS A CE    
891  N NZ    . LYS A 116 ? 2.7099 1.7825 1.6303 -0.2651 -0.2256 -0.1666 163 LYS A NZ    
892  N N     . HIS A 117 ? 1.6184 1.0991 1.1065 -0.2176 -0.2560 -0.0957 164 HIS A N     
893  C CA    A HIS A 117 ? 1.5086 1.0442 1.0795 -0.1995 -0.2473 -0.0764 164 HIS A CA    
894  C CA    B HIS A 117 ? 1.5231 1.0593 1.0948 -0.1998 -0.2475 -0.0767 164 HIS A CA    
895  C C     . HIS A 117 ? 1.5122 1.1200 1.1351 -0.1976 -0.2926 -0.0754 164 HIS A C     
896  O O     . HIS A 117 ? 1.5570 1.1787 1.1619 -0.2134 -0.3288 -0.0911 164 HIS A O     
897  C CB    A HIS A 117 ? 1.4842 1.0216 1.0973 -0.2106 -0.2186 -0.0816 164 HIS A CB    
898  C CB    B HIS A 117 ? 1.5126 1.0518 1.1277 -0.2113 -0.2194 -0.0821 164 HIS A CB    
899  C CG    A HIS A 117 ? 1.5741 1.0375 1.1340 -0.2122 -0.1738 -0.0840 164 HIS A CG    
900  C CG    B HIS A 117 ? 1.5334 1.1253 1.2047 -0.2336 -0.2459 -0.0977 164 HIS A CG    
901  N ND1   A HIS A 117 ? 1.5648 1.0141 1.1337 -0.1872 -0.1331 -0.0617 164 HIS A ND1   
902  N ND1   B HIS A 117 ? 1.6158 1.1870 1.2616 -0.2674 -0.2549 -0.1246 164 HIS A ND1   
903  C CD2   A HIS A 117 ? 1.6720 1.0730 1.1687 -0.2351 -0.1638 -0.1058 164 HIS A CD2   
904  C CD2   B HIS A 117 ? 1.4800 1.1424 1.2297 -0.2277 -0.2623 -0.0903 164 HIS A CD2   
905  C CE1   A HIS A 117 ? 1.6214 1.0004 1.1343 -0.1917 -0.0982 -0.0685 164 HIS A CE1   
906  C CE1   B HIS A 117 ? 1.5654 1.2004 1.2793 -0.2808 -0.2772 -0.1316 164 HIS A CE1   
907  N NE2   A HIS A 117 ? 1.6957 1.0384 1.1605 -0.2211 -0.1139 -0.0958 164 HIS A NE2   
908  N NE2   B HIS A 117 ? 1.4895 1.1796 1.2666 -0.2561 -0.2815 -0.1111 164 HIS A NE2   
909  N N     . PHE A 118 ? 1.3639 1.0186 1.0505 -0.1780 -0.2903 -0.0569 165 PHE A N     
910  C CA    . PHE A 118 ? 1.2909 1.0109 1.0307 -0.1708 -0.3259 -0.0529 165 PHE A CA    
911  C C     . PHE A 118 ? 1.2750 1.0366 1.0874 -0.1553 -0.3097 -0.0368 165 PHE A C     
912  O O     . PHE A 118 ? 1.2205 0.9633 1.0378 -0.1482 -0.2745 -0.0265 165 PHE A O     
913  C CB    . PHE A 118 ? 1.3277 1.0405 1.0234 -0.1552 -0.3526 -0.0445 165 PHE A CB    
914  C CG    . PHE A 118 ? 1.3178 1.0127 1.0041 -0.1295 -0.3330 -0.0213 165 PHE A CG    
915  C CD1   . PHE A 118 ? 1.3851 1.0216 1.0159 -0.1247 -0.3017 -0.0144 165 PHE A CD1   
916  C CD2   . PHE A 118 ? 1.2865 1.0221 1.0206 -0.1116 -0.3428 -0.0068 165 PHE A CD2   
917  C CE1   . PHE A 118 ? 1.3757 1.0008 1.0034 -0.1049 -0.2820 0.0063  165 PHE A CE1   
918  C CE2   . PHE A 118 ? 1.3006 1.0180 1.0273 -0.0934 -0.3218 0.0123  165 PHE A CE2   
919  C CZ    . PHE A 118 ? 1.3083 0.9735 0.9837 -0.0914 -0.2926 0.0187  165 PHE A CZ    
920  N N     . MET A 119 ? 1.2220 1.0410 1.0885 -0.1497 -0.3355 -0.0347 166 MET A N     
921  C CA    . MET A 119 ? 1.1622 1.0198 1.0913 -0.1362 -0.3244 -0.0220 166 MET A CA    
922  C C     . MET A 119 ? 1.2186 1.1015 1.1598 -0.1158 -0.3473 -0.0103 166 MET A C     
923  O O     . MET A 119 ? 1.2566 1.1547 1.1866 -0.1140 -0.3797 -0.0145 166 MET A O     
924  C CB    . MET A 119 ? 1.1618 1.0643 1.1533 -0.1507 -0.3268 -0.0328 166 MET A CB    
925  C CG    . MET A 119 ? 1.2294 1.1069 1.2190 -0.1665 -0.2962 -0.0398 166 MET A CG    
926  S SD    . MET A 119 ? 1.2699 1.2007 1.3319 -0.1843 -0.3007 -0.0520 166 MET A SD    
927  C CE    . MET A 119 ? 1.2461 1.1319 1.2957 -0.1949 -0.2542 -0.0530 166 MET A CE    
928  N N     . LEU A 120 ? 1.1427 1.0314 1.1068 -0.1004 -0.3307 0.0045  167 LEU A N     
929  C CA    . LEU A 120 ? 1.1232 1.0288 1.0979 -0.0808 -0.3479 0.0153  167 LEU A CA    
930  C C     . LEU A 120 ? 1.1376 1.1012 1.1784 -0.0806 -0.3634 0.0100  167 LEU A C     
931  O O     . LEU A 120 ? 1.1066 1.0932 1.1892 -0.0929 -0.3500 0.0030  167 LEU A O     
932  C CB    . LEU A 120 ? 1.0897 0.9774 1.0626 -0.0685 -0.3230 0.0307  167 LEU A CB    
933  C CG    . LEU A 120 ? 1.1638 1.0029 1.0855 -0.0701 -0.2991 0.0375  167 LEU A CG    
934  C CD1   . LEU A 120 ? 1.1253 0.9650 1.0650 -0.0658 -0.2724 0.0495  167 LEU A CD1   
935  C CD2   . LEU A 120 ? 1.2728 1.0730 1.1317 -0.0614 -0.3128 0.0423  167 LEU A CD2   
936  N N     . SER A 121 ? 1.0869 1.0736 1.1365 -0.0652 -0.3896 0.0145  168 SER A N     
937  C CA    . SER A 121 ? 1.0464 1.0903 1.1612 -0.0617 -0.4016 0.0113  168 SER A CA    
938  C C     . SER A 121 ? 1.0657 1.1124 1.1957 -0.0365 -0.3976 0.0259  168 SER A C     
939  O O     . SER A 121 ? 1.1087 1.1260 1.1976 -0.0190 -0.4047 0.0373  168 SER A O     
940  C CB    . SER A 121 ? 1.1385 1.2202 1.2617 -0.0665 -0.4375 0.0022  168 SER A CB    
941  O OG    . SER A 121 ? 1.3042 1.4366 1.4768 -0.0475 -0.4544 0.0085  168 SER A OG    
942  N N     . VAL A 122 ? 0.9571 1.0328 1.1405 -0.0352 -0.3832 0.0256  169 VAL A N     
943  C CA    . VAL A 122 ? 0.9515 1.0263 1.1491 -0.0137 -0.3758 0.0367  169 VAL A CA    
944  C C     . VAL A 122 ? 1.0082 1.1375 1.2612 -0.0008 -0.3921 0.0358  169 VAL A C     
945  O O     . VAL A 122 ? 0.9728 1.1387 1.2765 -0.0104 -0.3835 0.0281  169 VAL A O     
946  C CB    . VAL A 122 ? 0.9693 1.0255 1.1727 -0.0200 -0.3432 0.0387  169 VAL A CB    
947  C CG1   . VAL A 122 ? 0.9617 1.0098 1.1728 -0.0009 -0.3348 0.0473  169 VAL A CG1   
948  C CG2   . VAL A 122 ? 0.9853 0.9957 1.1387 -0.0303 -0.3274 0.0419  169 VAL A CG2   
949  N N     . LYS A 123 ? 1.0068 1.1419 1.2499 0.0231  -0.4140 0.0453  170 LYS A N     
950  C CA    . LYS A 123 ? 1.0006 1.1911 1.2978 0.0412  -0.4290 0.0480  170 LYS A CA    
951  C C     . LYS A 123 ? 1.0333 1.2081 1.3453 0.0604  -0.4049 0.0564  170 LYS A C     
952  O O     . LYS A 123 ? 1.0524 1.1750 1.3203 0.0748  -0.3942 0.0670  170 LYS A O     
953  C CB    . LYS A 123 ? 1.0677 1.2772 1.3491 0.0625  -0.4638 0.0570  170 LYS A CB    
954  C CG    . LYS A 123 ? 1.2022 1.4881 1.5507 0.0769  -0.4833 0.0581  170 LYS A CG    
955  C CD    . LYS A 123 ? 1.4082 1.7215 1.7432 0.1025  -0.5201 0.0703  170 LYS A CD    
956  C CE    . LYS A 123 ? 1.4820 1.8567 1.8371 0.0812  -0.5550 0.0578  170 LYS A CE    
957  N NZ    . LYS A 123 ? 1.5358 1.9292 1.8608 0.1043  -0.5926 0.0703  170 LYS A NZ    
958  N N     . MET A 124 ? 0.9477 1.1630 1.3180 0.0583  -0.3937 0.0506  171 MET A N     
959  C CA    . MET A 124 ? 0.9355 1.1357 1.3189 0.0743  -0.3694 0.0557  171 MET A CA    
960  C C     . MET A 124 ? 1.0060 1.2557 1.4462 0.0966  -0.3723 0.0591  171 MET A C     
961  O O     . MET A 124 ? 0.9958 1.3061 1.4889 0.0874  -0.3825 0.0518  171 MET A O     
962  C CB    . MET A 124 ? 0.9270 1.1070 1.3089 0.0513  -0.3410 0.0471  171 MET A CB    
963  C CG    . MET A 124 ? 0.9831 1.1040 1.3059 0.0420  -0.3297 0.0501  171 MET A CG    
964  S SD    . MET A 124 ? 0.9849 1.0944 1.3128 0.0207  -0.2982 0.0428  171 MET A SD    
965  C CE    . MET A 124 ? 0.9613 1.0472 1.2890 0.0413  -0.2801 0.0473  171 MET A CE    
966  N N     . PHE A 125 ? 0.9818 1.2031 1.4101 0.1260  -0.3605 0.0705  172 PHE A N     
967  C CA    . PHE A 125 ? 0.9898 1.2470 1.4649 0.1555  -0.3574 0.0774  172 PHE A CA    
968  C C     . PHE A 125 ? 1.0253 1.2213 1.4690 0.1763  -0.3292 0.0847  172 PHE A C     
969  O O     . PHE A 125 ? 1.0630 1.1946 1.4478 0.1714  -0.3205 0.0874  172 PHE A O     
970  C CB    . PHE A 125 ? 1.0563 1.3580 1.5474 0.1826  -0.3906 0.0900  172 PHE A CB    
971  C CG    . PHE A 125 ? 1.1376 1.3910 1.5631 0.1968  -0.4058 0.1026  172 PHE A CG    
972  C CD1   . PHE A 125 ? 1.2268 1.4242 1.6136 0.2297  -0.3918 0.1185  172 PHE A CD1   
973  C CD2   . PHE A 125 ? 1.1761 1.4330 1.5731 0.1765  -0.4309 0.0981  172 PHE A CD2   
974  C CE1   . PHE A 125 ? 1.2897 1.4367 1.6117 0.2420  -0.4024 0.1311  172 PHE A CE1   
975  C CE2   . PHE A 125 ? 1.2587 1.4664 1.5897 0.1893  -0.4420 0.1100  172 PHE A CE2   
976  C CZ    . PHE A 125 ? 1.2766 1.4302 1.5711 0.2219  -0.4275 0.1270  172 PHE A CZ    
977  N N     . TYR A 126 ? 0.9358 1.1489 1.4161 0.1989  -0.3133 0.0877  173 TYR A N     
978  C CA    . TYR A 126 ? 0.9581 1.1070 1.4048 0.2189  -0.2841 0.0931  173 TYR A CA    
979  C C     . TYR A 126 ? 1.0977 1.2248 1.5207 0.2611  -0.2943 0.1137  173 TYR A C     
980  O O     . TYR A 126 ? 1.0992 1.2700 1.5362 0.2742  -0.3259 0.1233  173 TYR A O     
981  C CB    . TYR A 126 ? 0.9360 1.1047 1.4253 0.2250  -0.2582 0.0867  173 TYR A CB    
982  C CG    . TYR A 126 ? 0.8940 1.0831 1.4025 0.1865  -0.2480 0.0690  173 TYR A CG    
983  C CD1   . TYR A 126 ? 0.9159 1.0518 1.3791 0.1594  -0.2290 0.0590  173 TYR A CD1   
984  C CD2   . TYR A 126 ? 0.8519 1.1152 1.4229 0.1761  -0.2578 0.0631  173 TYR A CD2   
985  C CE1   . TYR A 126 ? 0.8735 1.0303 1.3520 0.1275  -0.2204 0.0457  173 TYR A CE1   
986  C CE2   . TYR A 126 ? 0.8164 1.0932 1.4000 0.1425  -0.2467 0.0491  173 TYR A CE2   
987  C CZ    . TYR A 126 ? 0.9107 1.1345 1.4470 0.1204  -0.2287 0.0416  173 TYR A CZ    
988  O OH    . TYR A 126 ? 0.8493 1.0880 1.3961 0.0919  -0.2179 0.0308  173 TYR A OH    
989  N N     . GLY A 127 ? 1.1188 1.1755 1.5013 0.2808  -0.2671 0.1202  174 GLY A N     
990  C CA    . GLY A 127 ? 1.1851 1.2053 1.5364 0.3242  -0.2687 0.1418  174 GLY A CA    
991  C C     . GLY A 127 ? 1.2666 1.3581 1.6764 0.3652  -0.2846 0.1565  174 GLY A C     
992  O O     . GLY A 127 ? 1.3245 1.4316 1.7260 0.3944  -0.3095 0.1751  174 GLY A O     
993  N N     . ASN A 128 ? 1.1779 1.3198 1.6493 0.3669  -0.2718 0.1488  175 ASN A N     
994  C CA    . ASN A 128 ? 1.1735 1.3954 1.7126 0.4045  -0.2842 0.1624  175 ASN A CA    
995  C C     . ASN A 128 ? 1.1927 1.5108 1.7797 0.3925  -0.3295 0.1626  175 ASN A C     
996  O O     . ASN A 128 ? 1.1967 1.5901 1.8384 0.4231  -0.3478 0.1761  175 ASN A O     
997  C CB    . ASN A 128 ? 1.1209 1.3656 1.7095 0.4069  -0.2537 0.1532  175 ASN A CB    
998  C CG    . ASN A 128 ? 1.3147 1.5930 1.9325 0.3577  -0.2519 0.1298  175 ASN A CG    
999  O OD1   . ASN A 128 ? 1.2041 1.4819 1.8025 0.3196  -0.2701 0.1189  175 ASN A OD1   
1000 N ND2   . ASN A 128 ? 1.2222 1.5276 1.8851 0.3597  -0.2275 0.1228  175 ASN A ND2   
1001 N N     . SER A 129 ? 1.1185 1.4320 1.6823 0.3475  -0.3463 0.1475  176 SER A N     
1002 C CA    . SER A 129 ? 1.0781 1.4598 1.6669 0.3234  -0.3858 0.1416  176 SER A CA    
1003 C C     . SER A 129 ? 1.0663 1.5142 1.7177 0.2860  -0.3869 0.1218  176 SER A C     
1004 O O     . SER A 129 ? 1.0347 1.5356 1.7064 0.2616  -0.4167 0.1142  176 SER A O     
1005 C CB    . SER A 129 ? 1.1242 1.5569 1.7247 0.3584  -0.4220 0.1616  176 SER A CB    
1006 O OG    . SER A 129 ? 1.1720 1.6318 1.7581 0.3295  -0.4578 0.1541  176 SER A OG    
1007 N N     . ASP A 130 ? 1.0003 1.4371 1.6746 0.2794  -0.3522 0.1127  177 ASP A N     
1008 C CA    . ASP A 130 ? 0.9452 1.4309 1.6709 0.2448  -0.3454 0.0951  177 ASP A CA    
1009 C C     . ASP A 130 ? 0.9791 1.4365 1.6651 0.2012  -0.3547 0.0810  177 ASP A C     
1010 O O     . ASP A 130 ? 0.9806 1.3637 1.6035 0.1932  -0.3422 0.0796  177 ASP A O     
1011 C CB    . ASP A 130 ? 0.9582 1.4158 1.6931 0.2461  -0.3033 0.0888  177 ASP A CB    
1012 C CG    . ASP A 130 ? 1.1739 1.6599 1.9533 0.2880  -0.2864 0.1007  177 ASP A CG    
1013 O OD1   . ASP A 130 ? 1.2184 1.7682 2.0412 0.3157  -0.3091 0.1145  177 ASP A OD1   
1014 O OD2   . ASP A 130 ? 1.2551 1.7019 2.0258 0.2934  -0.2502 0.0965  177 ASP A OD2   
1015 N N     . ASP A 131 ? 0.9235 1.4395 1.6444 0.1742  -0.3771 0.0714  178 ASP A N     
1016 C CA    . ASP A 131 ? 0.9064 1.3983 1.5913 0.1351  -0.3861 0.0586  178 ASP A CA    
1017 C C     . ASP A 131 ? 0.9045 1.3602 1.5777 0.1071  -0.3552 0.0461  178 ASP A C     
1018 O O     . ASP A 131 ? 0.8831 1.3547 1.5927 0.1081  -0.3311 0.0427  178 ASP A O     
1019 C CB    . ASP A 131 ? 0.9349 1.4979 1.6601 0.1130  -0.4167 0.0503  178 ASP A CB    
1020 C CG    . ASP A 131 ? 1.2311 1.7668 1.9080 0.0817  -0.4346 0.0406  178 ASP A CG    
1021 O OD1   . ASP A 131 ? 1.2828 1.7490 1.8920 0.0846  -0.4303 0.0449  178 ASP A OD1   
1022 O OD2   . ASP A 131 ? 1.3283 1.9108 2.0336 0.0536  -0.4517 0.0283  178 ASP A OD2   
1023 N N     . ILE A 132 ? 0.8407 1.2467 1.4597 0.0846  -0.3553 0.0409  179 ILE A N     
1024 C CA    . ILE A 132 ? 0.7941 1.1708 1.3974 0.0564  -0.3317 0.0306  179 ILE A CA    
1025 C C     . ILE A 132 ? 0.8479 1.2479 1.4562 0.0268  -0.3493 0.0207  179 ILE A C     
1026 O O     . ILE A 132 ? 0.8396 1.2817 1.4937 0.0093  -0.3450 0.0120  179 ILE A O     
1027 C CB    . ILE A 132 ? 0.8349 1.1386 1.3737 0.0569  -0.3159 0.0342  179 ILE A CB    
1028 C CG1   . ILE A 132 ? 0.8598 1.1359 1.3904 0.0850  -0.2986 0.0422  179 ILE A CG1   
1029 C CG2   . ILE A 132 ? 0.7810 1.0668 1.3079 0.0289  -0.2954 0.0255  179 ILE A CG2   
1030 C CD1   . ILE A 132 ? 0.9039 1.1104 1.3705 0.0905  -0.2904 0.0481  179 ILE A CD1   
1031 N N     . GLY A 133 ? 0.8174 1.1927 1.3808 0.0232  -0.3698 0.0224  180 GLY A N     
1032 C CA    . GLY A 133 ? 0.8111 1.1999 1.3698 -0.0046 -0.3862 0.0117  180 GLY A CA    
1033 C C     . GLY A 133 ? 0.8816 1.2167 1.3717 -0.0112 -0.3945 0.0130  180 GLY A C     
1034 O O     . GLY A 133 ? 0.9247 1.2170 1.3727 0.0076  -0.3916 0.0238  180 GLY A O     
1035 N N     . VAL A 134 ? 0.7998 1.1334 1.2763 -0.0387 -0.4021 0.0016  181 VAL A N     
1036 C CA    . VAL A 134 ? 0.8293 1.1130 1.2399 -0.0465 -0.4089 0.0014  181 VAL A CA    
1037 C C     . VAL A 134 ? 0.8953 1.1463 1.2897 -0.0691 -0.3824 -0.0054 181 VAL A C     
1038 O O     . VAL A 134 ? 0.9112 1.1836 1.3338 -0.0912 -0.3768 -0.0168 181 VAL A O     
1039 C CB    . VAL A 134 ? 0.9197 1.2245 1.3161 -0.0547 -0.4440 -0.0051 181 VAL A CB    
1040 C CG1   . VAL A 134 ? 0.9446 1.1948 1.2735 -0.0720 -0.4436 -0.0106 181 VAL A CG1   
1041 C CG2   . VAL A 134 ? 0.9460 1.2718 1.3411 -0.0233 -0.4703 0.0082  181 VAL A CG2   
1042 N N     . PHE A 135 ? 0.8373 1.0375 1.1881 -0.0628 -0.3641 0.0028  182 PHE A N     
1043 C CA    . PHE A 135 ? 0.7968 0.9655 1.1292 -0.0771 -0.3364 0.0016  182 PHE A CA    
1044 C C     . PHE A 135 ? 0.8857 1.0095 1.1591 -0.0858 -0.3380 0.0007  182 PHE A C     
1045 O O     . PHE A 135 ? 0.9145 1.0117 1.1476 -0.0735 -0.3483 0.0080  182 PHE A O     
1046 C CB    . PHE A 135 ? 0.7873 0.9407 1.1181 -0.0640 -0.3152 0.0118  182 PHE A CB    
1047 C CG    . PHE A 135 ? 0.7647 0.9534 1.1449 -0.0541 -0.3097 0.0124  182 PHE A CG    
1048 C CD1   . PHE A 135 ? 0.8096 1.0097 1.2008 -0.0327 -0.3227 0.0178  182 PHE A CD1   
1049 C CD2   . PHE A 135 ? 0.7576 0.9645 1.1697 -0.0640 -0.2890 0.0087  182 PHE A CD2   
1050 C CE1   . PHE A 135 ? 0.8015 1.0310 1.2365 -0.0218 -0.3143 0.0182  182 PHE A CE1   
1051 C CE2   . PHE A 135 ? 0.7760 1.0128 1.2300 -0.0546 -0.2818 0.0088  182 PHE A CE2   
1052 C CZ    . PHE A 135 ? 0.7618 1.0091 1.2272 -0.0337 -0.2938 0.0130  182 PHE A CZ    
1053 N N     . LEU A 136 ? 0.8432 0.9542 1.1087 -0.1061 -0.3252 -0.0078 183 LEU A N     
1054 C CA    . LEU A 136 ? 0.8685 0.9328 1.0766 -0.1153 -0.3214 -0.0101 183 LEU A CA    
1055 C C     . LEU A 136 ? 0.9277 0.9566 1.1104 -0.1125 -0.2909 -0.0007 183 LEU A C     
1056 O O     . LEU A 136 ? 0.8832 0.9235 1.0935 -0.1141 -0.2689 0.0025  183 LEU A O     
1057 C CB    . LEU A 136 ? 0.8841 0.9476 1.0900 -0.1397 -0.3253 -0.0263 183 LEU A CB    
1058 C CG    . LEU A 136 ? 0.9488 1.0516 1.1752 -0.1483 -0.3594 -0.0379 183 LEU A CG    
1059 C CD1   . LEU A 136 ? 0.9513 1.0521 1.1784 -0.1791 -0.3580 -0.0564 183 LEU A CD1   
1060 C CD2   . LEU A 136 ? 1.0347 1.1262 1.2181 -0.1352 -0.3877 -0.0336 183 LEU A CD2   
1061 N N     . SER A 137 ? 0.9408 0.9287 1.0700 -0.1079 -0.2891 0.0047  184 SER A N     
1062 C CA    . SER A 137 ? 0.9431 0.9005 1.0469 -0.1051 -0.2603 0.0146  184 SER A CA    
1063 C C     . SER A 137 ? 1.0432 0.9800 1.1342 -0.1193 -0.2430 0.0071  184 SER A C     
1064 O O     . SER A 137 ? 1.0586 0.9979 1.1522 -0.1342 -0.2554 -0.0075 184 SER A O     
1065 C CB    . SER A 137 ? 1.0246 0.9428 1.0733 -0.0969 -0.2631 0.0218  184 SER A CB    
1066 O OG    . SER A 137 ? 1.1034 0.9848 1.1033 -0.1055 -0.2664 0.0140  184 SER A OG    
1067 N N     . LYS A 138 ? 1.0050 0.9193 1.0790 -0.1150 -0.2136 0.0171  185 LYS A N     
1068 C CA    . LYS A 138 ? 1.0257 0.9075 1.0764 -0.1235 -0.1916 0.0130  185 LYS A CA    
1069 C C     . LYS A 138 ? 1.1446 0.9786 1.1330 -0.1296 -0.2006 0.0045  185 LYS A C     
1070 O O     . LYS A 138 ? 1.1462 0.9769 1.1130 -0.1240 -0.2218 0.0057  185 LYS A O     
1071 C CB    . LYS A 138 ? 1.0179 0.8957 1.0705 -0.1116 -0.1578 0.0298  185 LYS A CB    
1072 C CG    . LYS A 138 ? 1.0117 0.9355 1.1181 -0.1069 -0.1502 0.0373  185 LYS A CG    
1073 C CD    . LYS A 138 ? 1.0908 1.0262 1.2262 -0.1187 -0.1491 0.0265  185 LYS A CD    
1074 C CE    . LYS A 138 ? 1.1508 1.1164 1.3241 -0.1123 -0.1301 0.0367  185 LYS A CE    
1075 N NZ    . LYS A 138 ? 1.2631 1.2193 1.4215 -0.0980 -0.1014 0.0546  185 LYS A NZ    
1076 N N     . ARG A 139 ? 1.1372 0.9318 1.0943 -0.1413 -0.1846 -0.0048 186 ARG A N     
1077 C CA    . ARG A 139 ? 1.1963 0.9396 1.0880 -0.1495 -0.1894 -0.0151 186 ARG A CA    
1078 C C     . ARG A 139 ? 1.2172 0.9323 1.0672 -0.1319 -0.1774 0.0000  186 ARG A C     
1079 O O     . ARG A 139 ? 1.2000 0.9155 1.0599 -0.1183 -0.1488 0.0161  186 ARG A O     
1080 C CB    . ARG A 139 ? 1.2575 0.9559 1.1228 -0.1636 -0.1629 -0.0258 186 ARG A CB    
1081 C CG    . ARG A 139 ? 1.5084 1.1478 1.3021 -0.1784 -0.1659 -0.0421 186 ARG A CG    
1082 C CD    . ARG A 139 ? 1.8377 1.4320 1.6116 -0.1953 -0.1377 -0.0548 186 ARG A CD    
1083 N NE    . ARG A 139 ? 2.1346 1.7268 1.9012 -0.2279 -0.1619 -0.0817 186 ARG A NE    
1084 C CZ    . ARG A 139 ? 2.3614 2.0055 2.1865 -0.2434 -0.1811 -0.0907 186 ARG A CZ    
1085 N NH1   . ARG A 139 ? 2.2042 1.9022 2.0956 -0.2280 -0.1792 -0.0752 186 ARG A NH1   
1086 N NH2   . ARG A 139 ? 2.2207 1.8651 2.0381 -0.2757 -0.2023 -0.1157 186 ARG A NH2   
1087 N N     . ILE A 140 ? 1.1759 0.8714 0.9822 -0.1319 -0.1994 -0.0039 187 ILE A N     
1088 C CA    . ILE A 140 ? 1.1852 0.8478 0.9454 -0.1177 -0.1874 0.0093  187 ILE A CA    
1089 C C     . ILE A 140 ? 1.3119 0.9114 0.9946 -0.1262 -0.1832 -0.0024 187 ILE A C     
1090 O O     . ILE A 140 ? 1.3377 0.9317 0.9973 -0.1410 -0.2121 -0.0196 187 ILE A O     
1091 C CB    . ILE A 140 ? 1.1992 0.8857 0.9677 -0.1067 -0.2119 0.0185  187 ILE A CB    
1092 C CG1   . ILE A 140 ? 1.1270 0.8701 0.9670 -0.1012 -0.2155 0.0261  187 ILE A CG1   
1093 C CG2   . ILE A 140 ? 1.2433 0.8928 0.9646 -0.0940 -0.1940 0.0330  187 ILE A CG2   
1094 C CD1   . ILE A 140 ? 1.2504 1.0106 1.0991 -0.0901 -0.2338 0.0350  187 ILE A CD1   
1095 N N     . LYS A 141 ? 1.2997 0.8542 0.9427 -0.1172 -0.1470 0.0068  188 LYS A N     
1096 C CA    . LYS A 141 ? 1.3847 0.8708 0.9483 -0.1238 -0.1353 -0.0040 188 LYS A CA    
1097 C C     . LYS A 141 ? 1.5248 0.9850 1.0333 -0.1157 -0.1472 0.0015  188 LYS A C     
1098 O O     . LYS A 141 ? 1.5178 0.9860 1.0347 -0.0990 -0.1328 0.0211  188 LYS A O     
1099 C CB    . LYS A 141 ? 1.4219 0.8699 0.9695 -0.1143 -0.0855 0.0049  188 LYS A CB    
1100 C CG    . LYS A 141 ? 1.6784 1.0477 1.1417 -0.1213 -0.0670 -0.0080 188 LYS A CG    
1101 C CD    . LYS A 141 ? 1.8516 1.1831 1.3055 -0.1120 -0.0172 -0.0016 188 LYS A CD    
1102 C CE    . LYS A 141 ? 2.1885 1.4422 1.5680 -0.1295 -0.0045 -0.0245 188 LYS A CE    
1103 N NZ    . LYS A 141 ? 2.3639 1.5554 1.6573 -0.1262 0.0037  -0.0275 188 LYS A NZ    
1104 N N     . VAL A 142 ? 1.5478 0.9767 0.9975 -0.1289 -0.1728 -0.0157 189 VAL A N     
1105 C CA    . VAL A 142 ? 1.5942 0.9912 0.9796 -0.1206 -0.1846 -0.0107 189 VAL A CA    
1106 C C     . VAL A 142 ? 1.6971 1.0254 1.0168 -0.1146 -0.1423 -0.0068 189 VAL A C     
1107 O O     . VAL A 142 ? 1.7344 1.0253 1.0294 -0.1252 -0.1209 -0.0198 189 VAL A O     
1108 C CB    . VAL A 142 ? 1.6967 1.0936 1.0436 -0.1350 -0.2312 -0.0288 189 VAL A CB    
1109 C CG1   . VAL A 142 ? 1.7386 1.1105 1.0254 -0.1208 -0.2452 -0.0180 189 VAL A CG1   
1110 C CG2   . VAL A 142 ? 1.6366 1.1061 1.0577 -0.1420 -0.2681 -0.0343 189 VAL A CG2   
1111 N N     . ILE A 143 ? 1.6692 0.9806 0.9640 -0.0971 -0.1263 0.0119  190 ILE A N     
1112 C CA    . ILE A 143 ? 1.7293 0.9831 0.9697 -0.0866 -0.0821 0.0208  190 ILE A CA    
1113 C C     . ILE A 143 ? 1.9107 1.1205 1.0730 -0.0810 -0.0905 0.0243  190 ILE A C     
1114 O O     . ILE A 143 ? 1.9023 1.1387 1.0760 -0.0750 -0.1174 0.0335  190 ILE A O     
1115 C CB    . ILE A 143 ? 1.6940 0.9856 1.0002 -0.0704 -0.0481 0.0443  190 ILE A CB    
1116 C CG1   . ILE A 143 ? 1.6749 0.9810 1.0251 -0.0725 -0.0257 0.0410  190 ILE A CG1   
1117 C CG2   . ILE A 143 ? 1.7265 0.9852 0.9959 -0.0542 -0.0103 0.0634  190 ILE A CG2   
1118 C CD1   . ILE A 143 ? 1.8396 1.1857 1.2491 -0.0570 0.0046  0.0629  190 ILE A CD1   
1119 N N     . SER A 144 ? 1.9828 1.1207 1.0609 -0.0819 -0.0665 0.0173  191 SER A N     
1120 C CA    . SER A 144 ? 2.0740 1.1612 1.0658 -0.0759 -0.0704 0.0208  191 SER A CA    
1121 C C     . SER A 144 ? 2.1101 1.2079 1.1212 -0.0559 -0.0454 0.0491  191 SER A C     
1122 O O     . SER A 144 ? 2.1128 1.2160 1.1090 -0.0498 -0.0676 0.0587  191 SER A O     
1123 C CB    . SER A 144 ? 2.2350 1.2394 1.1325 -0.0812 -0.0430 0.0069  191 SER A CB    
1124 O OG    . SER A 144 ? 2.3692 1.3557 1.2852 -0.0750 0.0069  0.0109  191 SER A OG    
1125 N N     . LYS A 145 ? 2.0320 1.1382 1.0825 -0.0463 0.0003  0.0629  192 LYS A N     
1126 C CA    . LYS A 145 ? 2.0007 1.1257 1.0826 -0.0315 0.0318  0.0887  192 LYS A CA    
1127 C C     . LYS A 145 ? 2.0422 1.1845 1.1713 -0.0242 0.0750  0.0965  192 LYS A C     
1128 O O     . LYS A 145 ? 2.0656 1.1832 1.1783 -0.0288 0.0823  0.0817  192 LYS A O     
1129 C CB    . LYS A 145 ? 2.1109 1.1715 1.1058 -0.0227 0.0531  0.0977  192 LYS A CB    
1130 C CG    . LYS A 145 ? 2.2041 1.1989 1.1333 -0.0172 0.0967  0.0939  192 LYS A CG    
1131 C CD    . LYS A 145 ? 2.2666 1.2283 1.1591 -0.0023 0.1410  0.1150  192 LYS A CD    
1132 C CE    . LYS A 145 ? 2.2533 1.1508 1.0454 -0.0019 0.1297  0.1131  192 LYS A CE    
1133 N NZ    . LYS A 145 ? 2.3819 1.2399 1.1340 0.0120  0.1804  0.1325  192 LYS A NZ    
1134 N N     . PRO A 146 ? 1.9663 1.5477 1.1205 -0.0428 -0.0725 -0.0550 193 PRO A N     
1135 C CA    . PRO A 146 ? 1.9547 1.5201 1.1328 -0.0383 -0.0439 -0.0676 193 PRO A CA    
1136 C C     . PRO A 146 ? 2.0932 1.6273 1.2073 -0.0298 -0.0209 -0.0875 193 PRO A C     
1137 O O     . PRO A 146 ? 2.1254 1.6564 1.1814 -0.0239 -0.0160 -0.0826 193 PRO A O     
1138 C CB    . PRO A 146 ? 1.9124 1.5019 1.1405 -0.0300 -0.0221 -0.0402 193 PRO A CB    
1139 C CG    . PRO A 146 ? 1.9799 1.5822 1.1817 -0.0276 -0.0254 -0.0164 193 PRO A CG    
1140 C CD    . PRO A 146 ? 1.9600 1.5607 1.1269 -0.0347 -0.0615 -0.0214 193 PRO A CD    
1141 N N     . SER A 147 ? 2.0875 1.5959 1.2107 -0.0279 -0.0058 -0.1095 194 SER A N     
1142 C CA    . SER A 147 ? 2.1679 1.6399 1.2372 -0.0177 0.0189  -0.1324 194 SER A CA    
1143 C C     . SER A 147 ? 2.2538 1.7363 1.3077 0.0025  0.0558  -0.1161 194 SER A C     
1144 O O     . SER A 147 ? 2.2064 1.7039 1.3082 0.0139  0.0793  -0.1047 194 SER A O     
1145 C CB    . SER A 147 ? 2.2157 1.6574 1.3112 -0.0180 0.0284  -0.1533 194 SER A CB    
1146 O OG    . SER A 147 ? 2.4603 1.8595 1.5009 -0.0073 0.0521  -0.1778 194 SER A OG    
1147 N N     . LYS A 148 ? 2.2766 1.7549 1.2634 0.0068  0.0609  -0.1150 195 LYS A N     
1148 C CA    . LYS A 148 ? 2.2874 1.7768 1.2522 0.0235  0.0969  -0.1003 195 LYS A CA    
1149 C C     . LYS A 148 ? 2.3576 1.8284 1.3208 0.0417  0.1328  -0.1168 195 LYS A C     
1150 O O     . LYS A 148 ? 2.3214 1.8185 1.3158 0.0554  0.1626  -0.1008 195 LYS A O     
1151 C CB    . LYS A 148 ? 2.3804 1.8621 1.2646 0.0241  0.0941  -0.0988 195 LYS A CB    
1152 C CG    . LYS A 148 ? 2.5107 2.0108 1.3773 0.0369  0.1296  -0.0763 195 LYS A CG    
1153 C CD    . LYS A 148 ? 2.7194 2.2009 1.4921 0.0420  0.1345  -0.0823 195 LYS A CD    
1154 C CE    . LYS A 148 ? 2.7962 2.2952 1.5486 0.0528  0.1717  -0.0589 195 LYS A CE    
1155 N NZ    . LYS A 148 ? 2.9399 2.4194 1.5961 0.0584  0.1761  -0.0637 195 LYS A NZ    
1156 N N     . LYS A 149 ? 2.3638 1.7904 1.2930 0.0418  0.1297  -0.1492 196 LYS A N     
1157 C CA    . LYS A 149 ? 2.3920 1.7906 1.3141 0.0615  0.1623  -0.1670 196 LYS A CA    
1158 C C     . LYS A 149 ? 2.3949 1.7849 1.3808 0.0619  0.1599  -0.1708 196 LYS A C     
1159 O O     . LYS A 149 ? 2.3233 1.7357 1.3622 0.0465  0.1348  -0.1577 196 LYS A O     
1160 C CB    . LYS A 149 ? 2.5267 1.8743 1.3630 0.0642  0.1681  -0.2004 196 LYS A CB    
1161 C CG    . LYS A 149 ? 2.7052 2.0619 1.4798 0.0770  0.1906  -0.1947 196 LYS A CG    
1162 C CD    . LYS A 149 ? 2.8424 2.1497 1.5260 0.0779  0.1924  -0.2293 196 LYS A CD    
1163 C CE    . LYS A 149 ? 2.9242 2.2395 1.5454 0.0935  0.2196  -0.2234 196 LYS A CE    
1164 N NZ    . LYS A 149 ? 2.9830 2.2931 1.6068 0.1222  0.2666  -0.2266 196 LYS A NZ    
1165 N N     . LYS A 150 ? 2.3838 1.7419 1.3634 0.0822  0.1882  -0.1865 197 LYS A N     
1166 C CA    . LYS A 150 ? 2.3447 1.6889 1.3761 0.0889  0.1928  -0.1882 197 LYS A CA    
1167 C C     . LYS A 150 ? 2.4002 1.7144 1.4442 0.0634  0.1614  -0.2027 197 LYS A C     
1168 O O     . LYS A 150 ? 2.4400 1.7251 1.4370 0.0434  0.1407  -0.2246 197 LYS A O     
1169 C CB    . LYS A 150 ? 2.4205 1.7316 1.4330 0.1201  0.2316  -0.2011 197 LYS A CB    
1170 C CG    . LYS A 150 ? 2.5309 1.8926 1.5659 0.1477  0.2637  -0.1795 197 LYS A CG    
1171 C CD    . LYS A 150 ? 2.6774 2.0071 1.6742 0.1808  0.3027  -0.1952 197 LYS A CD    
1172 C CE    . LYS A 150 ? 2.7406 2.1261 1.7483 0.2043  0.3337  -0.1772 197 LYS A CE    
1173 N NZ    . LYS A 150 ? 2.7750 2.1978 1.8468 0.2314  0.3541  -0.1611 197 LYS A NZ    
1174 N N     . GLN A 151 ? 2.3126 1.6405 1.4227 0.0634  0.1574  -0.1893 198 GLN A N     
1175 C CA    . GLN A 151 ? 2.2934 1.6032 1.4321 0.0401  0.1311  -0.1970 198 GLN A CA    
1176 C C     . GLN A 151 ? 2.3826 1.6350 1.5216 0.0497  0.1497  -0.2136 198 GLN A C     
1177 O O     . GLN A 151 ? 2.3924 1.6343 1.5318 0.0801  0.1820  -0.2094 198 GLN A O     
1178 C CB    . GLN A 151 ? 2.2101 1.5779 1.4211 0.0323  0.1131  -0.1675 198 GLN A CB    
1179 C CG    . GLN A 151 ? 2.3074 1.6732 1.5512 0.0047  0.0808  -0.1711 198 GLN A CG    
1180 C CD    . GLN A 151 ? 2.5177 1.8649 1.7184 -0.0217 0.0528  -0.1932 198 GLN A CD    
1181 O OE1   . GLN A 151 ? 2.4361 1.8020 1.6009 -0.0255 0.0415  -0.1916 198 GLN A OE1   
1182 N NE2   . GLN A 151 ? 2.4400 1.7516 1.6436 -0.0411 0.0411  -0.2142 198 GLN A NE2   
1183 N N     . SER A 152 ? 2.3608 1.5754 1.4975 0.0239  0.1303  -0.2329 199 SER A N     
1184 C CA    . SER A 152 ? 2.3990 1.5506 1.5341 0.0276  0.1471  -0.2486 199 SER A CA    
1185 C C     . SER A 152 ? 2.3878 1.5502 1.5842 0.0103  0.1302  -0.2370 199 SER A C     
1186 O O     . SER A 152 ? 2.3205 1.5240 1.5456 -0.0147 0.0986  -0.2301 199 SER A O     
1187 C CB    . SER A 152 ? 2.5338 1.6165 1.6015 0.0105  0.1465  -0.2879 199 SER A CB    
1188 O OG    . SER A 152 ? 2.6650 1.7057 1.6812 0.0395  0.1810  -0.3005 199 SER A OG    
1189 N N     . LEU A 153 ? 2.3658 1.4904 1.5804 0.0260  0.1527  -0.2340 200 LEU A N     
1190 C CA    . LEU A 153 ? 2.3206 1.4488 1.5899 0.0135  0.1433  -0.2218 200 LEU A CA    
1191 C C     . LEU A 153 ? 2.4114 1.4997 1.6703 -0.0272 0.1228  -0.2477 200 LEU A C     
1192 O O     . LEU A 153 ? 2.3578 1.4603 1.6640 -0.0458 0.1085  -0.2387 200 LEU A O     
1193 C CB    . LEU A 153 ? 2.3283 1.4254 1.6125 0.0463  0.1762  -0.2091 200 LEU A CB    
1194 C CG    . LEU A 153 ? 2.3099 1.4690 1.6344 0.0809  0.1885  -0.1771 200 LEU A CG    
1195 C CD1   . LEU A 153 ? 2.3440 1.5060 1.6321 0.1133  0.2137  -0.1791 200 LEU A CD1   
1196 C CD2   . LEU A 153 ? 2.3307 1.4720 1.6866 0.1018  0.2064  -0.1611 200 LEU A CD2   
1197 N N     . LYS A 154 ? 2.4497 1.4913 1.6466 -0.0420 0.1216  -0.2810 201 LYS A N     
1198 C CA    . LYS A 154 ? 2.4944 1.5007 1.6732 -0.0840 0.1011  -0.3124 201 LYS A CA    
1199 C C     . LYS A 154 ? 2.4764 1.5538 1.7010 -0.1134 0.0600  -0.3024 201 LYS A C     
1200 O O     . LYS A 154 ? 2.4717 1.5442 1.7289 -0.1420 0.0463  -0.3086 201 LYS A O     
1201 C CB    . LYS A 154 ? 2.6035 1.5695 1.7054 -0.0917 0.1018  -0.3477 201 LYS A CB    
1202 C CG    . LYS A 154 ? 2.6563 1.5719 1.7065 -0.0549 0.1405  -0.3543 201 LYS A CG    
1203 C CD    . LYS A 154 ? 2.7412 1.6447 1.7193 -0.0622 0.1338  -0.3832 201 LYS A CD    
1204 C CE    . LYS A 154 ? 2.7226 1.5666 1.6386 -0.0309 0.1717  -0.3989 201 LYS A CE    
1205 N NZ    . LYS A 154 ? 2.6737 1.5077 1.5173 -0.0420 0.1621  -0.4288 201 LYS A NZ    
1206 N N     . ASN A 155 ? 2.3665 1.5087 1.5941 -0.1045 0.0431  -0.2854 202 ASN A N     
1207 C CA    . ASN A 155 ? 2.2865 1.4979 1.5545 -0.1234 0.0070  -0.2712 202 ASN A CA    
1208 C C     . ASN A 155 ? 2.1878 1.4501 1.5158 -0.1010 0.0131  -0.2322 202 ASN A C     
1209 O O     . ASN A 155 ? 2.1252 1.4377 1.4599 -0.0889 0.0054  -0.2123 202 ASN A O     
1210 C CB    . ASN A 155 ? 2.3363 1.5759 1.5581 -0.1293 -0.0152 -0.2801 202 ASN A CB    
1211 C CG    . ASN A 155 ? 2.4632 1.7691 1.7156 -0.1467 -0.0540 -0.2679 202 ASN A CG    
1212 O OD1   . ASN A 155 ? 2.3210 1.6576 1.6331 -0.1582 -0.0681 -0.2546 202 ASN A OD1   
1213 N ND2   . ASN A 155 ? 2.3098 1.6392 1.5195 -0.1465 -0.0710 -0.2708 202 ASN A ND2   
1214 N N     . ALA A 156 ? 2.0962 1.3412 1.4646 -0.0960 0.0285  -0.2225 203 ALA A N     
1215 C CA    . ALA A 156 ? 2.0029 1.2878 1.4276 -0.0760 0.0367  -0.1898 203 ALA A CA    
1216 C C     . ALA A 156 ? 1.9689 1.3209 1.4433 -0.0904 0.0065  -0.1718 203 ALA A C     
1217 O O     . ALA A 156 ? 1.9056 1.2975 1.4242 -0.0754 0.0099  -0.1458 203 ALA A O     
1218 C CB    . ALA A 156 ? 2.0206 1.2634 1.4670 -0.0715 0.0575  -0.1879 203 ALA A CB    
1219 N N     . ASP A 157 ? 1.9196 1.2845 1.3848 -0.1184 -0.0231 -0.1869 204 ASP A N     
1220 C CA    . ASP A 157 ? 1.8427 1.2673 1.3453 -0.1325 -0.0547 -0.1743 204 ASP A CA    
1221 C C     . ASP A 157 ? 1.7791 1.2459 1.2770 -0.1117 -0.0562 -0.1518 204 ASP A C     
1222 O O     . ASP A 157 ? 1.7225 1.2373 1.2583 -0.1122 -0.0725 -0.1320 204 ASP A O     
1223 C CB    . ASP A 157 ? 1.9225 1.3480 1.4022 -0.1634 -0.0844 -0.2000 204 ASP A CB    
1224 C CG    . ASP A 157 ? 2.1947 1.5608 1.6419 -0.1858 -0.0785 -0.2349 204 ASP A CG    
1225 O OD1   . ASP A 157 ? 2.2352 1.5443 1.6527 -0.1723 -0.0479 -0.2431 204 ASP A OD1   
1226 O OD2   . ASP A 157 ? 2.3198 1.6966 1.7662 -0.2160 -0.1047 -0.2554 204 ASP A OD2   
1227 N N     . LEU A 158 ? 1.7124 1.1578 1.1636 -0.0933 -0.0361 -0.1551 205 LEU A N     
1228 C CA    . LEU A 158 ? 1.6673 1.1439 1.1075 -0.0748 -0.0303 -0.1361 205 LEU A CA    
1229 C C     . LEU A 158 ? 1.6774 1.1555 1.1342 -0.0480 0.0017  -0.1208 205 LEU A C     
1230 O O     . LEU A 158 ? 1.6608 1.1663 1.1134 -0.0338 0.0107  -0.1053 205 LEU A O     
1231 C CB    . LEU A 158 ? 1.7282 1.1886 1.1000 -0.0750 -0.0324 -0.1511 205 LEU A CB    
1232 C CG    . LEU A 158 ? 1.8335 1.2842 1.1719 -0.0998 -0.0612 -0.1748 205 LEU A CG    
1233 C CD1   . LEU A 158 ? 1.9117 1.3484 1.1792 -0.0942 -0.0587 -0.1863 205 LEU A CD1   
1234 C CD2   . LEU A 158 ? 1.7943 1.2933 1.1679 -0.1140 -0.0951 -0.1620 205 LEU A CD2   
1235 N N     . CYS A 159 ? 1.6252 1.0756 1.1000 -0.0406 0.0193  -0.1243 206 CYS A N     
1236 C CA    . CYS A 159 ? 1.5989 1.0565 1.0909 -0.0120 0.0482  -0.1095 206 CYS A CA    
1237 C C     . CYS A 159 ? 1.5561 1.0582 1.1117 -0.0089 0.0434  -0.0863 206 CYS A C     
1238 O O     . CYS A 159 ? 1.5346 1.0500 1.1200 -0.0284 0.0211  -0.0841 206 CYS A O     
1239 C CB    . CYS A 159 ? 1.6608 1.0608 1.1286 0.0013  0.0734  -0.1243 206 CYS A CB    
1240 S SG    . CYS A 159 ? 1.8089 1.1586 1.1976 0.0081  0.0892  -0.1502 206 CYS A SG    
1241 N N     . ILE A 160 ? 1.4406 0.9697 1.0177 0.0155  0.0637  -0.0701 207 ILE A N     
1242 C CA    . ILE A 160 ? 1.3323 0.9063 0.9673 0.0191  0.0596  -0.0498 207 ILE A CA    
1243 C C     . ILE A 160 ? 1.3653 0.9265 1.0205 0.0383  0.0780  -0.0450 207 ILE A C     
1244 O O     . ILE A 160 ? 1.3871 0.9489 1.0334 0.0646  0.1017  -0.0418 207 ILE A O     
1245 C CB    . ILE A 160 ? 1.3057 0.9347 0.9595 0.0250  0.0607  -0.0332 207 ILE A CB    
1246 C CG1   . ILE A 160 ? 1.3046 0.9425 0.9401 0.0050  0.0398  -0.0337 207 ILE A CG1   
1247 C CG2   . ILE A 160 ? 1.2268 0.8982 0.9371 0.0288  0.0580  -0.0164 207 ILE A CG2   
1248 C CD1   . ILE A 160 ? 1.3602 1.0245 0.9818 0.0109  0.0496  -0.0247 207 ILE A CD1   
1249 N N     . ALA A 161 ? 1.2907 0.8413 0.9723 0.0267  0.0682  -0.0436 208 ALA A N     
1250 C CA    . ALA A 161 ? 1.2704 0.8045 0.9684 0.0450  0.0856  -0.0365 208 ALA A CA    
1251 C C     . ALA A 161 ? 1.2519 0.8445 0.9947 0.0613  0.0880  -0.0155 208 ALA A C     
1252 O O     . ALA A 161 ? 1.1851 0.8181 0.9611 0.0466  0.0696  -0.0074 208 ALA A O     
1253 C CB    . ALA A 161 ? 1.2806 0.7803 0.9880 0.0239  0.0762  -0.0429 208 ALA A CB    
1254 N N     . SER A 162 ? 1.2113 0.8088 0.9544 0.0926  0.1106  -0.0074 209 SER A N     
1255 C CA    . SER A 162 ? 1.1501 0.8032 0.9333 0.1113  0.1145  0.0106  209 SER A CA    
1256 C C     . SER A 162 ? 1.1700 0.8313 0.9877 0.0972  0.1000  0.0187  209 SER A C     
1257 O O     . SER A 162 ? 1.2017 0.8150 1.0102 0.0899  0.1016  0.0147  209 SER A O     
1258 C CB    . SER A 162 ? 1.2018 0.8426 0.9737 0.1488  0.1406  0.0165  209 SER A CB    
1259 O OG    . SER A 162 ? 1.2453 0.9379 1.0541 0.1682  0.1429  0.0333  209 SER A OG    
1260 N N     . GLY A 163 ? 1.0594 0.7784 0.9146 0.0916  0.0874  0.0285  210 GLY A N     
1261 C CA    . GLY A 163 ? 1.0251 0.7577 0.9131 0.0810  0.0753  0.0362  210 GLY A CA    
1262 C C     . GLY A 163 ? 1.0784 0.8107 0.9773 0.0492  0.0524  0.0305  210 GLY A C     
1263 O O     . GLY A 163 ? 1.0655 0.8149 0.9943 0.0398  0.0420  0.0365  210 GLY A O     
1264 N N     . THR A 164 ? 1.0292 0.7439 0.9026 0.0345  0.0448  0.0192  211 THR A N     
1265 C CA    . THR A 164 ? 0.9864 0.7047 0.8656 0.0079  0.0218  0.0141  211 THR A CA    
1266 C C     . THR A 164 ? 1.0071 0.7697 0.8990 0.0067  0.0147  0.0211  211 THR A C     
1267 O O     . THR A 164 ? 0.9907 0.7765 0.8827 0.0225  0.0282  0.0260  211 THR A O     
1268 C CB    . THR A 164 ? 1.0325 0.7072 0.8717 -0.0056 0.0172  -0.0021 211 THR A CB    
1269 O OG1   . THR A 164 ? 1.1089 0.7797 0.9145 0.0054  0.0278  -0.0062 211 THR A OG1   
1270 C CG2   . THR A 164 ? 0.8535 0.4771 0.6798 -0.0106 0.0247  -0.0120 211 THR A CG2   
1271 N N     . LYS A 165 ? 0.9680 0.7417 0.8700 -0.0119 -0.0056 0.0213  212 LYS A N     
1272 C CA    . LYS A 165 ? 0.9379 0.7460 0.8523 -0.0156 -0.0125 0.0291  212 LYS A CA    
1273 C C     . LYS A 165 ? 1.0460 0.8432 0.9260 -0.0233 -0.0180 0.0256  212 LYS A C     
1274 O O     . LYS A 165 ? 1.1115 0.8801 0.9635 -0.0325 -0.0279 0.0162  212 LYS A O     
1275 C CB    . LYS A 165 ? 0.9387 0.7675 0.8894 -0.0262 -0.0289 0.0351  212 LYS A CB    
1276 C CG    . LYS A 165 ? 0.9592 0.8063 0.9440 -0.0179 -0.0226 0.0406  212 LYS A CG    
1277 C CD    . LYS A 165 ? 1.0275 0.8940 1.0435 -0.0281 -0.0379 0.0451  212 LYS A CD    
1278 C CE    . LYS A 165 ? 1.2007 1.0544 1.2306 -0.0355 -0.0447 0.0426  212 LYS A CE    
1279 N NZ    . LYS A 165 ? 1.4113 1.2845 1.4701 -0.0264 -0.0365 0.0494  212 LYS A NZ    
1280 N N     . VAL A 166 ? 0.9688 0.7900 0.8499 -0.0203 -0.0110 0.0331  213 VAL A N     
1281 C CA    . VAL A 166 ? 0.9741 0.7877 0.8216 -0.0256 -0.0119 0.0340  213 VAL A CA    
1282 C C     . VAL A 166 ? 0.9974 0.8347 0.8628 -0.0331 -0.0168 0.0458  213 VAL A C     
1283 O O     . VAL A 166 ? 0.9456 0.8098 0.8483 -0.0324 -0.0140 0.0512  213 VAL A O     
1284 C CB    . VAL A 166 ? 1.0254 0.8348 0.8436 -0.0135 0.0105  0.0302  213 VAL A CB    
1285 C CG1   . VAL A 166 ? 1.0579 0.8309 0.8461 -0.0065 0.0159  0.0169  213 VAL A CG1   
1286 C CG2   . VAL A 166 ? 0.9884 0.8355 0.8367 -0.0018 0.0288  0.0362  213 VAL A CG2   
1287 N N     . ALA A 167 ? 0.9952 0.8195 0.8299 -0.0398 -0.0229 0.0495  214 ALA A N     
1288 C CA    . ALA A 167 ? 0.9979 0.8319 0.8357 -0.0463 -0.0234 0.0621  214 ALA A CA    
1289 C C     . ALA A 167 ? 1.0768 0.9068 0.8799 -0.0440 -0.0042 0.0637  214 ALA A C     
1290 O O     . ALA A 167 ? 1.1129 0.9248 0.8804 -0.0385 0.0000  0.0551  214 ALA A O     
1291 C CB    . ALA A 167 ? 1.0267 0.8449 0.8507 -0.0526 -0.0462 0.0673  214 ALA A CB    
1292 N N     . LEU A 168 ? 1.0057 0.8522 0.8192 -0.0491 0.0093  0.0734  215 LEU A N     
1293 C CA    . LEU A 168 ? 1.0118 0.8610 0.7987 -0.0490 0.0312  0.0766  215 LEU A CA    
1294 C C     . LEU A 168 ? 1.0646 0.9068 0.8442 -0.0606 0.0332  0.0911  215 LEU A C     
1295 O O     . LEU A 168 ? 1.0389 0.8956 0.8542 -0.0687 0.0339  0.0960  215 LEU A O     
1296 C CB    . LEU A 168 ? 0.9819 0.8685 0.7997 -0.0441 0.0529  0.0722  215 LEU A CB    
1297 C CG    . LEU A 168 ? 1.0024 0.8972 0.8297 -0.0282 0.0561  0.0606  215 LEU A CG    
1298 C CD1   . LEU A 168 ? 0.9526 0.8927 0.8235 -0.0235 0.0688  0.0597  215 LEU A CD1   
1299 C CD2   . LEU A 168 ? 1.0739 0.9508 0.8581 -0.0172 0.0692  0.0539  215 LEU A CD2   
1300 N N     . PHE A 169 ? 1.0754 0.8920 0.8059 -0.0610 0.0343  0.0978  216 PHE A N     
1301 C CA    . PHE A 169 ? 1.0951 0.8959 0.8091 -0.0698 0.0378  0.1148  216 PHE A CA    
1302 C C     . PHE A 169 ? 1.1936 0.9874 0.8673 -0.0722 0.0621  0.1221  216 PHE A C     
1303 O O     . PHE A 169 ? 1.2092 1.0045 0.8558 -0.0642 0.0711  0.1132  216 PHE A O     
1304 C CB    . PHE A 169 ? 1.1306 0.9045 0.8237 -0.0666 0.0105  0.1222  216 PHE A CB    
1305 C CG    . PHE A 169 ? 1.1849 0.9394 0.8265 -0.0586 -0.0026 0.1177  216 PHE A CG    
1306 C CD1   . PHE A 169 ? 1.2254 0.9825 0.8715 -0.0538 -0.0199 0.1010  216 PHE A CD1   
1307 C CD2   . PHE A 169 ? 1.2562 0.9887 0.8430 -0.0569 0.0024  0.1297  216 PHE A CD2   
1308 C CE1   . PHE A 169 ? 1.2783 1.0178 0.8761 -0.0496 -0.0333 0.0934  216 PHE A CE1   
1309 C CE2   . PHE A 169 ? 1.3309 1.0481 0.8665 -0.0498 -0.0111 0.1231  216 PHE A CE2   
1310 C CZ    . PHE A 169 ? 1.2982 1.0197 0.8407 -0.0472 -0.0299 0.1037  216 PHE A CZ    
1311 N N     . ASN A 170 ? 1.1758 0.9590 0.8441 -0.0832 0.0745  0.1384  217 ASN A N     
1312 C CA    . ASN A 170 ? 1.2229 0.9978 0.8542 -0.0886 0.1009  0.1490  217 ASN A CA    
1313 C C     . ASN A 170 ? 1.3694 1.1035 0.9594 -0.0906 0.0962  0.1702  217 ASN A C     
1314 O O     . ASN A 170 ? 1.3619 1.0817 0.9704 -0.0941 0.0841  0.1790  217 ASN A O     
1315 C CB    . ASN A 170 ? 1.1315 0.9395 0.8029 -0.1031 0.1288  0.1476  217 ASN A CB    
1316 C CG    . ASN A 170 ? 1.4080 1.2120 1.0490 -0.1120 0.1593  0.1587  217 ASN A CG    
1317 O OD1   . ASN A 170 ? 1.4660 1.2408 1.0868 -0.1231 0.1681  0.1766  217 ASN A OD1   
1318 N ND2   . ASN A 170 ? 1.3136 1.1463 0.9514 -0.1068 0.1782  0.1491  217 ASN A ND2   
1319 N N     . ARG A 171 ? 1.4179 1.1325 0.9495 -0.0862 0.1069  0.1789  218 ARG A N     
1320 C CA    . ARG A 171 ? 1.4897 1.1641 0.9676 -0.0826 0.1029  0.2009  218 ARG A CA    
1321 C C     . ARG A 171 ? 1.6850 1.3509 1.1245 -0.0898 0.1378  0.2132  218 ARG A C     
1322 O O     . ARG A 171 ? 1.6851 1.3698 1.1100 -0.0868 0.1531  0.2019  218 ARG A O     
1323 C CB    . ARG A 171 ? 1.4846 1.1479 0.9197 -0.0655 0.0734  0.1943  218 ARG A CB    
1324 C CG    . ARG A 171 ? 1.6724 1.3029 1.0615 -0.0555 0.0539  0.2141  218 ARG A CG    
1325 C CD    . ARG A 171 ? 1.6825 1.3185 1.0961 -0.0470 0.0162  0.2075  218 ARG A CD    
1326 N NE    . ARG A 171 ? 1.6183 1.2688 1.0198 -0.0400 -0.0062 0.1856  218 ARG A NE    
1327 C CZ    . ARG A 171 ? 1.8156 1.4773 1.2404 -0.0354 -0.0379 0.1757  218 ARG A CZ    
1328 N NH1   . ARG A 171 ? 1.7181 1.3896 1.1300 -0.0330 -0.0550 0.1543  218 ARG A NH1   
1329 N NH2   . ARG A 171 ? 1.6797 1.3422 1.1410 -0.0339 -0.0511 0.1861  218 ARG A NH2   
1330 N N     . LEU A 172 ? 1.7633 1.3995 1.1865 -0.0989 0.1530  0.2368  219 LEU A N     
1331 C CA    . LEU A 172 ? 1.8542 1.4789 1.2394 -0.1079 0.1889  0.2514  219 LEU A CA    
1332 C C     . LEU A 172 ? 2.0160 1.5956 1.3232 -0.0953 0.1855  0.2750  219 LEU A C     
1333 O O     . LEU A 172 ? 2.0260 1.5735 1.3191 -0.0872 0.1656  0.2908  219 LEU A O     
1334 C CB    . LEU A 172 ? 1.8613 1.4881 1.2870 -0.1333 0.2193  0.2599  219 LEU A CB    
1335 C CG    . LEU A 172 ? 1.8790 1.5614 1.3747 -0.1496 0.2352  0.2382  219 LEU A CG    
1336 C CD1   . LEU A 172 ? 1.9196 1.6075 1.4252 -0.1755 0.2767  0.2479  219 LEU A CD1   
1337 C CD2   . LEU A 172 ? 1.8783 1.6038 1.3792 -0.1354 0.2315  0.2157  219 LEU A CD2   
1338 N N     . ARG A 173 ? 2.0539 1.6327 1.3090 -0.0918 0.2062  0.2779  220 ARG A N     
1339 C CA    . ARG A 173 ? 2.1521 1.6922 1.3234 -0.0796 0.2096  0.3006  220 ARG A CA    
1340 C C     . ARG A 173 ? 2.2417 1.7636 1.3721 -0.0565 0.1669  0.3026  220 ARG A C     
1341 O O     . ARG A 173 ? 2.3067 1.7909 1.3861 -0.0464 0.1621  0.3291  220 ARG A O     
1342 C CB    . ARG A 173 ? 2.2103 1.7117 1.3658 -0.0929 0.2387  0.3321  220 ARG A CB    
1343 C CG    . ARG A 173 ? 2.3350 1.8518 1.5069 -0.1163 0.2863  0.3342  220 ARG A CG    
1344 C CD    . ARG A 173 ? 2.4674 1.9436 1.6406 -0.1350 0.3122  0.3614  220 ARG A CD    
1345 N NE    . ARG A 173 ? 2.4871 1.9635 1.7266 -0.1460 0.2980  0.3547  220 ARG A NE    
1346 C CZ    . ARG A 173 ? 2.6228 2.1219 1.9265 -0.1740 0.3202  0.3447  220 ARG A CZ    
1347 N NH1   . ARG A 173 ? 2.3933 1.9203 1.7081 -0.1946 0.3582  0.3413  220 ARG A NH1   
1348 N NH2   . ARG A 173 ? 2.4571 1.9539 1.8142 -0.1817 0.3048  0.3373  220 ARG A NH2   
1349 N N     . SER A 174 ? 2.1460 1.6956 1.2979 -0.0481 0.1370  0.2749  221 SER A N     
1350 C CA    . SER A 174 ? 2.1510 1.6955 1.2752 -0.0301 0.0944  0.2702  221 SER A CA    
1351 C C     . SER A 174 ? 2.1778 1.7038 1.3201 -0.0244 0.0717  0.2894  221 SER A C     
1352 O O     . SER A 174 ? 2.2242 1.7379 1.3240 -0.0069 0.0439  0.2994  221 SER A O     
1353 C CB    . SER A 174 ? 2.2833 1.8112 1.3183 -0.0157 0.0918  0.2765  221 SER A CB    
1354 O OG    . SER A 174 ? 2.4046 1.9488 1.4190 -0.0164 0.1056  0.2538  221 SER A OG    
1355 N N     . GLN A 175 ? 2.0547 1.5810 1.2594 -0.0378 0.0834  0.2935  222 GLN A N     
1356 C CA    . GLN A 175 ? 2.0332 1.5378 1.2562 -0.0319 0.0675  0.3113  222 GLN A CA    
1357 C C     . GLN A 175 ? 1.9863 1.5188 1.2785 -0.0328 0.0414  0.2914  222 GLN A C     
1358 O O     . GLN A 175 ? 1.9219 1.4785 1.2706 -0.0484 0.0534  0.2736  222 GLN A O     
1359 C CB    . GLN A 175 ? 2.0717 1.5421 1.3011 -0.0459 0.1026  0.3350  222 GLN A CB    
1360 C CG    . GLN A 175 ? 2.2039 1.6391 1.3625 -0.0456 0.1323  0.3609  222 GLN A CG    
1361 C CD    . GLN A 175 ? 2.4259 1.8331 1.5089 -0.0188 0.1112  0.3833  222 GLN A CD    
1362 O OE1   . GLN A 175 ? 2.3597 1.7491 1.4409 -0.0020 0.0868  0.3976  222 GLN A OE1   
1363 N NE2   . GLN A 175 ? 2.3290 1.7348 1.3469 -0.0124 0.1201  0.3865  222 GLN A NE2   
1364 N N     . THR A 176 ? 1.9387 1.4697 1.2271 -0.0156 0.0066  0.2960  223 THR A N     
1365 C CA    . THR A 176 ? 1.8670 1.4233 1.2188 -0.0148 -0.0185 0.2801  223 THR A CA    
1366 C C     . THR A 176 ? 1.8610 1.4048 1.2660 -0.0256 -0.0023 0.2871  223 THR A C     
1367 O O     . THR A 176 ? 1.7923 1.3604 1.2570 -0.0306 -0.0129 0.2704  223 THR A O     
1368 C CB    . THR A 176 ? 2.0255 1.5883 1.3581 0.0068  -0.0586 0.2845  223 THR A CB    
1369 O OG1   . THR A 176 ? 2.0070 1.5993 1.4029 0.0057  -0.0808 0.2670  223 THR A OG1   
1370 C CG2   . THR A 176 ? 2.0417 1.5678 1.3340 0.0253  -0.0610 0.3186  223 THR A CG2   
1371 N N     . VAL A 177 ? 1.8401 1.3434 1.2191 -0.0294 0.0242  0.3117  224 VAL A N     
1372 C CA    . VAL A 177 ? 1.8176 1.2951 1.2308 -0.0413 0.0448  0.3215  224 VAL A CA    
1373 C C     . VAL A 177 ? 1.7377 1.2431 1.2043 -0.0681 0.0683  0.2997  224 VAL A C     
1374 O O     . VAL A 177 ? 1.6762 1.1853 1.1948 -0.0783 0.0710  0.2918  224 VAL A O     
1375 C CB    . VAL A 177 ? 1.9694 1.3892 1.3264 -0.0389 0.0700  0.3551  224 VAL A CB    
1376 C CG1   . VAL A 177 ? 1.9835 1.3662 1.3711 -0.0509 0.0905  0.3654  224 VAL A CG1   
1377 C CG2   . VAL A 177 ? 2.0283 1.4264 1.3231 -0.0084 0.0463  0.3782  224 VAL A CG2   
1378 N N     . SER A 178 ? 1.6684 1.1948 1.1199 -0.0778 0.0853  0.2901  225 SER A N     
1379 C CA    . SER A 178 ? 1.6132 1.1729 1.1092 -0.1002 0.1091  0.2712  225 SER A CA    
1380 C C     . SER A 178 ? 1.5887 1.1968 1.1365 -0.0989 0.0902  0.2428  225 SER A C     
1381 O O     . SER A 178 ? 1.5696 1.2106 1.1588 -0.1139 0.1068  0.2271  225 SER A O     
1382 C CB    . SER A 178 ? 1.6805 1.2441 1.1377 -0.1070 0.1365  0.2744  225 SER A CB    
1383 O OG    . SER A 178 ? 1.7772 1.3533 1.1968 -0.0896 0.1183  0.2666  225 SER A OG    
1384 N N     . THR A 179 ? 1.4827 1.0970 1.0280 -0.0810 0.0562  0.2368  226 THR A N     
1385 C CA    . THR A 179 ? 1.3885 1.0412 0.9768 -0.0785 0.0376  0.2124  226 THR A CA    
1386 C C     . THR A 179 ? 1.3481 1.0180 0.9998 -0.0899 0.0419  0.2033  226 THR A C     
1387 O O     . THR A 179 ? 1.3527 1.0068 1.0221 -0.0869 0.0309  0.2105  226 THR A O     
1388 C CB    . THR A 179 ? 1.4416 1.0953 1.0164 -0.0609 0.0016  0.2091  226 THR A CB    
1389 O OG1   . THR A 179 ? 1.6024 1.2334 1.1119 -0.0497 -0.0044 0.2228  226 THR A OG1   
1390 C CG2   . THR A 179 ? 1.2624 0.9495 0.8631 -0.0598 -0.0118 0.1839  226 THR A CG2   
1391 N N     . ARG A 180 ? 1.2138 0.9179 0.8977 -0.1012 0.0584  0.1872  227 ARG A N     
1392 C CA    . ARG A 180 ? 1.1309 0.8643 0.8744 -0.1120 0.0630  0.1735  227 ARG A CA    
1393 C C     . ARG A 180 ? 1.1190 0.8888 0.8836 -0.1029 0.0508  0.1539  227 ARG A C     
1394 O O     . ARG A 180 ? 1.1211 0.8972 0.8586 -0.0969 0.0556  0.1494  227 ARG A O     
1395 C CB    . ARG A 180 ? 1.1166 0.8633 0.8751 -0.1325 0.0954  0.1731  227 ARG A CB    
1396 C CG    . ARG A 180 ? 1.2436 0.9479 0.9787 -0.1452 0.1137  0.1929  227 ARG A CG    
1397 C CD    . ARG A 180 ? 1.2147 0.9215 0.9952 -0.1635 0.1225  0.1873  227 ARG A CD    
1398 N NE    . ARG A 180 ? 1.3536 1.0099 1.1123 -0.1757 0.1399  0.2057  227 ARG A NE    
1399 C CZ    . ARG A 180 ? 1.6319 1.2697 1.4178 -0.1890 0.1450  0.2039  227 ARG A CZ    
1400 N NH1   . ARG A 180 ? 1.3028 0.9720 1.1378 -0.1905 0.1317  0.1844  227 ARG A NH1   
1401 N NH2   . ARG A 180 ? 1.6300 1.2136 1.3908 -0.2001 0.1643  0.2217  227 ARG A NH2   
1402 N N     . TYR A 181 ? 1.0286 0.8189 0.8388 -0.1015 0.0374  0.1427  228 TYR A N     
1403 C CA    . TYR A 181 ? 0.9835 0.8026 0.8163 -0.0924 0.0261  0.1263  228 TYR A CA    
1404 C C     . TYR A 181 ? 0.9849 0.8431 0.8660 -0.0989 0.0373  0.1144  228 TYR A C     
1405 O O     . TYR A 181 ? 0.9694 0.8317 0.8801 -0.1087 0.0391  0.1148  228 TYR A O     
1406 C CB    . TYR A 181 ? 0.9799 0.7912 0.8253 -0.0833 -0.0017 0.1249  228 TYR A CB    
1407 C CG    . TYR A 181 ? 1.0569 0.8384 0.8613 -0.0752 -0.0189 0.1355  228 TYR A CG    
1408 C CD1   . TYR A 181 ? 1.1146 0.8682 0.9023 -0.0752 -0.0205 0.1527  228 TYR A CD1   
1409 C CD2   . TYR A 181 ? 1.0756 0.8559 0.8547 -0.0670 -0.0327 0.1282  228 TYR A CD2   
1410 C CE1   . TYR A 181 ? 1.1245 0.8555 0.8716 -0.0644 -0.0374 0.1641  228 TYR A CE1   
1411 C CE2   . TYR A 181 ? 1.1241 0.8837 0.8641 -0.0600 -0.0505 0.1363  228 TYR A CE2   
1412 C CZ    . TYR A 181 ? 1.2131 0.9512 0.9377 -0.0573 -0.0538 0.1550  228 TYR A CZ    
1413 O OH    . TYR A 181 ? 1.3183 1.0411 1.0032 -0.0471 -0.0729 0.1644  228 TYR A OH    
1414 N N     . LEU A 182 ? 0.9083 0.7945 0.7975 -0.0911 0.0422  0.1029  229 LEU A N     
1415 C CA    . LEU A 182 ? 0.8616 0.7906 0.7963 -0.0923 0.0488  0.0920  229 LEU A CA    
1416 C C     . LEU A 182 ? 0.9583 0.8871 0.9223 -0.0896 0.0292  0.0887  229 LEU A C     
1417 O O     . LEU A 182 ? 0.9826 0.8894 0.9350 -0.0811 0.0107  0.0903  229 LEU A O     
1418 C CB    . LEU A 182 ? 0.8298 0.7846 0.7643 -0.0785 0.0567  0.0826  229 LEU A CB    
1419 C CG    . LEU A 182 ? 0.8137 0.8196 0.7912 -0.0767 0.0660  0.0736  229 LEU A CG    
1420 C CD1   . LEU A 182 ? 0.8095 0.8442 0.7999 -0.0920 0.0868  0.0741  229 LEU A CD1   
1421 C CD2   . LEU A 182 ? 0.8024 0.8251 0.7779 -0.0561 0.0695  0.0667  229 LEU A CD2   
1422 N N     . HIS A 183 ? 0.9005 0.8548 0.9017 -0.0986 0.0339  0.0837  230 HIS A N     
1423 C CA    . HIS A 183 ? 0.8692 0.8248 0.8978 -0.0977 0.0196  0.0804  230 HIS A CA    
1424 C C     . HIS A 183 ? 0.8686 0.8622 0.9347 -0.1080 0.0290  0.0706  230 HIS A C     
1425 O O     . HIS A 183 ? 0.8583 0.8621 0.9282 -0.1237 0.0451  0.0696  230 HIS A O     
1426 C CB    . HIS A 183 ? 0.9112 0.8246 0.9238 -0.1026 0.0112  0.0913  230 HIS A CB    
1427 C CG    . HIS A 183 ? 0.9348 0.8448 0.9731 -0.1015 -0.0011 0.0891  230 HIS A CG    
1428 N ND1   . HIS A 183 ? 0.9346 0.8461 0.9815 -0.0886 -0.0187 0.0874  230 HIS A ND1   
1429 C CD2   . HIS A 183 ? 0.9589 0.8594 1.0121 -0.1120 0.0035  0.0887  230 HIS A CD2   
1430 C CE1   . HIS A 183 ? 0.9124 0.8197 0.9804 -0.0898 -0.0243 0.0864  230 HIS A CE1   
1431 N NE2   . HIS A 183 ? 0.9334 0.8326 1.0050 -0.1031 -0.0113 0.0863  230 HIS A NE2   
1432 N N     . VAL A 184 ? 0.7883 0.8020 0.8813 -0.1008 0.0188  0.0632  231 VAL A N     
1433 C CA    . VAL A 184 ? 0.7403 0.7926 0.8675 -0.1085 0.0232  0.0518  231 VAL A CA    
1434 C C     . VAL A 184 ? 0.7626 0.7936 0.9014 -0.1148 0.0145  0.0504  231 VAL A C     
1435 O O     . VAL A 184 ? 0.7457 0.7598 0.8838 -0.1029 0.0004  0.0538  231 VAL A O     
1436 C CB    . VAL A 184 ? 0.7511 0.8433 0.8956 -0.0913 0.0191  0.0452  231 VAL A CB    
1437 C CG1   . VAL A 184 ? 0.7294 0.8685 0.9067 -0.0973 0.0216  0.0327  231 VAL A CG1   
1438 C CG2   . VAL A 184 ? 0.7486 0.8554 0.8790 -0.0798 0.0281  0.0472  231 VAL A CG2   
1439 N N     . GLU A 185 ? 0.7372 0.7699 0.8877 -0.1337 0.0240  0.0442  232 GLU A N     
1440 C CA    . GLU A 185 ? 0.7446 0.7595 0.9077 -0.1399 0.0192  0.0392  232 GLU A CA    
1441 C C     . GLU A 185 ? 0.8013 0.8430 0.9859 -0.1617 0.0317  0.0239  232 GLU A C     
1442 O O     . GLU A 185 ? 0.8465 0.9073 1.0313 -0.1759 0.0458  0.0219  232 GLU A O     
1443 C CB    . GLU A 185 ? 0.8044 0.7601 0.9445 -0.1387 0.0152  0.0528  232 GLU A CB    
1444 C CG    . GLU A 185 ? 1.1162 1.0373 1.2416 -0.1583 0.0312  0.0576  232 GLU A CG    
1445 C CD    . GLU A 185 ? 1.4926 1.3537 1.5940 -0.1521 0.0269  0.0729  232 GLU A CD    
1446 O OE1   . GLU A 185 ? 1.5077 1.3329 1.5895 -0.1655 0.0415  0.0812  232 GLU A OE1   
1447 O OE2   . GLU A 185 ? 1.2525 1.1035 1.3550 -0.1336 0.0102  0.0775  232 GLU A OE2   
1448 N N     . GLY A 186 ? 0.7129 0.7612 0.9164 -0.1648 0.0269  0.0116  233 GLY A N     
1449 C CA    . GLY A 186 ? 0.7117 0.7881 0.9369 -0.1873 0.0363  -0.0077 233 GLY A CA    
1450 C C     . GLY A 186 ? 0.7873 0.9345 1.0328 -0.1912 0.0404  -0.0191 233 GLY A C     
1451 O O     . GLY A 186 ? 0.8210 0.9943 1.0811 -0.2157 0.0525  -0.0321 233 GLY A O     
1452 N N     . GLY A 187 ? 0.7228 0.9008 0.9693 -0.1668 0.0313  -0.0138 234 GLY A N     
1453 C CA    . GLY A 187 ? 0.6952 0.9412 0.9587 -0.1609 0.0336  -0.0209 234 GLY A CA    
1454 C C     . GLY A 187 ? 0.7676 1.0263 1.0240 -0.1635 0.0461  -0.0136 234 GLY A C     
1455 O O     . GLY A 187 ? 0.7627 1.0824 1.0360 -0.1588 0.0502  -0.0199 234 GLY A O     
1456 N N     . ASN A 188 ? 0.7599 0.9648 0.9911 -0.1702 0.0532  -0.0004 235 ASN A N     
1457 C CA    . ASN A 188 ? 0.7699 0.9837 0.9905 -0.1741 0.0679  0.0066  235 ASN A CA    
1458 C C     . ASN A 188 ? 0.8083 0.9736 0.9932 -0.1584 0.0659  0.0243  235 ASN A C     
1459 O O     . ASN A 188 ? 0.8160 0.9309 0.9828 -0.1527 0.0553  0.0327  235 ASN A O     
1460 C CB    . ASN A 188 ? 0.7807 0.9876 1.0057 -0.2071 0.0860  0.0022  235 ASN A CB    
1461 C CG    . ASN A 188 ? 0.9338 1.1864 1.1936 -0.2308 0.0899  -0.0189 235 ASN A CG    
1462 O OD1   . ASN A 188 ? 0.7324 1.0517 1.0172 -0.2376 0.0973  -0.0296 235 ASN A OD1   
1463 N ND2   . ASN A 188 ? 0.8856 1.1030 1.1473 -0.2449 0.0860  -0.0263 235 ASN A ND2   
1464 N N     . PHE A 189 ? 0.7491 0.9326 0.9238 -0.1521 0.0768  0.0289  236 PHE A N     
1465 C CA    . PHE A 189 ? 0.7551 0.8970 0.8923 -0.1404 0.0780  0.0430  236 PHE A CA    
1466 C C     . PHE A 189 ? 0.8323 0.9389 0.9510 -0.1628 0.0920  0.0505  236 PHE A C     
1467 O O     . PHE A 189 ? 0.8528 0.9884 0.9881 -0.1834 0.1094  0.0447  236 PHE A O     
1468 C CB    . PHE A 189 ? 0.7721 0.9505 0.9058 -0.1239 0.0875  0.0427  236 PHE A CB    
1469 C CG    . PHE A 189 ? 0.7577 0.9429 0.8897 -0.0954 0.0752  0.0424  236 PHE A CG    
1470 C CD1   . PHE A 189 ? 0.7485 0.9807 0.9110 -0.0851 0.0693  0.0338  236 PHE A CD1   
1471 C CD2   . PHE A 189 ? 0.7770 0.9195 0.8744 -0.0795 0.0699  0.0504  236 PHE A CD2   
1472 C CE1   . PHE A 189 ? 0.7440 0.9758 0.9017 -0.0585 0.0606  0.0360  236 PHE A CE1   
1473 C CE2   . PHE A 189 ? 0.7867 0.9292 0.8819 -0.0561 0.0612  0.0497  236 PHE A CE2   
1474 C CZ    . PHE A 189 ? 0.7307 0.9150 0.8553 -0.0452 0.0576  0.0438  236 PHE A CZ    
1475 N N     . HIS A 190 ? 0.7957 0.8418 0.8819 -0.1598 0.0846  0.0634  237 HIS A N     
1476 C CA    . HIS A 190 ? 0.8502 0.8539 0.9105 -0.1764 0.0978  0.0749  237 HIS A CA    
1477 C C     . HIS A 190 ? 0.9476 0.9077 0.9621 -0.1603 0.0907  0.0901  237 HIS A C     
1478 O O     . HIS A 190 ? 0.9231 0.8886 0.9315 -0.1400 0.0762  0.0883  237 HIS A O     
1479 C CB    . HIS A 190 ? 0.8807 0.8544 0.9516 -0.1940 0.0976  0.0739  237 HIS A CB    
1480 C CG    . HIS A 190 ? 0.9446 0.8744 1.0026 -0.1795 0.0776  0.0814  237 HIS A CG    
1481 N ND1   . HIS A 190 ? 0.9444 0.8909 1.0157 -0.1599 0.0573  0.0758  237 HIS A ND1   
1482 C CD2   . HIS A 190 ? 1.0183 0.8913 1.0530 -0.1813 0.0762  0.0944  237 HIS A CD2   
1483 C CE1   . HIS A 190 ? 0.9482 0.8528 1.0073 -0.1518 0.0440  0.0844  237 HIS A CE1   
1484 N NE2   . HIS A 190 ? 0.9991 0.8593 1.0360 -0.1622 0.0539  0.0959  237 HIS A NE2   
1485 N N     . ALA A 191 ? 0.9598 0.8785 0.9398 -0.1693 0.1022  0.1045  238 ALA A N     
1486 C CA    . ALA A 191 ? 0.9868 0.8663 0.9189 -0.1544 0.0946  0.1186  238 ALA A CA    
1487 C C     . ALA A 191 ? 1.0724 0.8989 0.9856 -0.1545 0.0848  0.1322  238 ALA A C     
1488 O O     . ALA A 191 ? 1.0957 0.8918 0.9946 -0.1690 0.1009  0.1429  238 ALA A O     
1489 C CB    . ALA A 191 ? 1.0374 0.9164 0.9393 -0.1603 0.1172  0.1259  238 ALA A CB    
1490 N N     . SER A 192 ? 1.0339 0.8515 0.9514 -0.1384 0.0598  0.1314  239 SER A N     
1491 C CA    . SER A 192 ? 1.0720 0.8477 0.9787 -0.1330 0.0476  0.1431  239 SER A CA    
1492 C C     . SER A 192 ? 1.2191 0.9595 1.0759 -0.1197 0.0389  0.1603  239 SER A C     
1493 O O     . SER A 192 ? 1.2608 1.0128 1.0987 -0.1087 0.0289  0.1577  239 SER A O     
1494 C CB    . SER A 192 ? 1.0802 0.8706 1.0186 -0.1216 0.0255  0.1336  239 SER A CB    
1495 O OG    . SER A 192 ? 1.2475 1.0028 1.1856 -0.1192 0.0200  0.1426  239 SER A OG    
1496 N N     . SER A 193 ? 1.2031 0.8997 1.0376 -0.1190 0.0412  0.1772  240 SER A N     
1497 C CA    . SER A 193 ? 1.2640 0.9276 1.0488 -0.1032 0.0304  0.1959  240 SER A CA    
1498 C C     . SER A 193 ? 1.3272 0.9884 1.1217 -0.0836 0.0006  0.1975  240 SER A C     
1499 O O     . SER A 193 ? 1.3415 0.9856 1.1007 -0.0670 -0.0157 0.2109  240 SER A O     
1500 C CB    . SER A 193 ? 1.3789 0.9930 1.1329 -0.1101 0.0504  0.2168  240 SER A CB    
1501 O OG    . SER A 193 ? 1.5009 1.0922 1.2796 -0.1121 0.0510  0.2185  240 SER A OG    
1502 N N     . GLN A 194 ? 1.2515 0.9326 1.0941 -0.0854 -0.0059 0.1841  241 GLN A N     
1503 C CA    . GLN A 194 ? 1.2391 0.9208 1.0985 -0.0688 -0.0293 0.1853  241 GLN A CA    
1504 C C     . GLN A 194 ? 1.2240 0.9478 1.1214 -0.0654 -0.0456 0.1672  241 GLN A C     
1505 O O     . GLN A 194 ? 1.2265 0.9576 1.1305 -0.0509 -0.0676 0.1686  241 GLN A O     
1506 C CB    . GLN A 194 ? 1.2890 0.9365 1.1581 -0.0684 -0.0212 0.1940  241 GLN A CB    
1507 C CG    . GLN A 194 ? 1.7783 1.3775 1.5999 -0.0552 -0.0208 0.2199  241 GLN A CG    
1508 C CD    . GLN A 194 ? 2.2859 1.8370 2.1062 -0.0581 -0.0031 0.2306  241 GLN A CD    
1509 O OE1   . GLN A 194 ? 2.2713 1.8200 2.1232 -0.0534 -0.0070 0.2240  241 GLN A OE1   
1510 N NE2   . GLN A 194 ? 2.2759 1.7834 2.0562 -0.0651 0.0180  0.2480  241 GLN A NE2   
1511 N N     . GLN A 195 ? 1.1321 0.8856 1.0528 -0.0776 -0.0346 0.1512  242 GLN A N     
1512 C CA    . GLN A 195 ? 1.0696 0.8603 1.0223 -0.0743 -0.0460 0.1353  242 GLN A CA    
1513 C C     . GLN A 195 ? 1.0763 0.8867 1.0165 -0.0772 -0.0406 0.1269  242 GLN A C     
1514 O O     . GLN A 195 ? 1.1089 0.9113 1.0237 -0.0840 -0.0246 0.1308  242 GLN A O     
1515 C CB    . GLN A 195 ? 1.0513 0.8611 1.0468 -0.0819 -0.0378 0.1236  242 GLN A CB    
1516 C CG    . GLN A 195 ? 1.1488 0.9381 1.1584 -0.0776 -0.0417 0.1285  242 GLN A CG    
1517 C CD    . GLN A 195 ? 1.4517 1.2687 1.5028 -0.0776 -0.0443 0.1142  242 GLN A CD    
1518 O OE1   . GLN A 195 ? 1.5429 1.3824 1.6107 -0.0679 -0.0589 0.1094  242 GLN A OE1   
1519 N NE2   . GLN A 195 ? 1.1480 0.9650 1.2153 -0.0903 -0.0292 0.1062  242 GLN A NE2   
1520 N N     . TRP A 196 ? 0.9527 0.7862 0.9095 -0.0716 -0.0517 0.1157  243 TRP A N     
1521 C CA    . TRP A 196 ? 0.9177 0.7650 0.8629 -0.0712 -0.0456 0.1068  243 TRP A CA    
1522 C C     . TRP A 196 ? 0.9126 0.7862 0.8906 -0.0677 -0.0487 0.0945  243 TRP A C     
1523 O O     . TRP A 196 ? 0.8812 0.7595 0.8815 -0.0639 -0.0625 0.0929  243 TRP A O     
1524 C CB    . TRP A 196 ? 0.9226 0.7517 0.8248 -0.0659 -0.0558 0.1096  243 TRP A CB    
1525 C CG    . TRP A 196 ? 0.9206 0.7466 0.8238 -0.0594 -0.0808 0.1090  243 TRP A CG    
1526 C CD1   . TRP A 196 ? 0.9825 0.7955 0.8752 -0.0541 -0.0966 0.1203  243 TRP A CD1   
1527 C CD2   . TRP A 196 ? 0.8956 0.7333 0.8098 -0.0577 -0.0921 0.0967  243 TRP A CD2   
1528 N NE1   . TRP A 196 ? 0.9695 0.7938 0.8727 -0.0501 -0.1184 0.1144  243 TRP A NE1   
1529 C CE2   . TRP A 196 ? 0.9638 0.8009 0.8794 -0.0543 -0.1153 0.0994  243 TRP A CE2   
1530 C CE3   . TRP A 196 ? 0.8861 0.7335 0.8089 -0.0582 -0.0838 0.0841  243 TRP A CE3   
1531 C CZ2   . TRP A 196 ? 0.9413 0.7888 0.8683 -0.0559 -0.1298 0.0882  243 TRP A CZ2   
1532 C CZ3   . TRP A 196 ? 0.8889 0.7391 0.8213 -0.0583 -0.0966 0.0747  243 TRP A CZ3   
1533 C CH2   . TRP A 196 ? 0.9104 0.7614 0.8461 -0.0593 -0.1190 0.0759  243 TRP A CH2   
1534 N N     . GLY A 197 ? 0.8607 0.7527 0.8419 -0.0678 -0.0339 0.0872  244 GLY A N     
1535 C CA    . GLY A 197 ? 0.8275 0.7431 0.8345 -0.0616 -0.0330 0.0777  244 GLY A CA    
1536 C C     . GLY A 197 ? 0.9200 0.8254 0.9061 -0.0542 -0.0358 0.0724  244 GLY A C     
1537 O O     . GLY A 197 ? 0.9728 0.8592 0.9232 -0.0544 -0.0344 0.0734  244 GLY A O     
1538 N N     . ALA A 198 ? 0.8490 0.7642 0.8549 -0.0478 -0.0384 0.0665  245 ALA A N     
1539 C CA    . ALA A 198 ? 0.8631 0.7641 0.8521 -0.0414 -0.0380 0.0601  245 ALA A CA    
1540 C C     . ALA A 198 ? 0.9146 0.8367 0.9164 -0.0304 -0.0211 0.0571  245 ALA A C     
1541 O O     . ALA A 198 ? 0.9025 0.8478 0.9348 -0.0266 -0.0200 0.0577  245 ALA A O     
1542 C CB    . ALA A 198 ? 0.8629 0.7544 0.8641 -0.0437 -0.0536 0.0576  245 ALA A CB    
1543 N N     . PHE A 199 ? 0.8544 0.7716 0.8318 -0.0235 -0.0077 0.0542  246 PHE A N     
1544 C CA    . PHE A 199 ? 0.8329 0.7744 0.8212 -0.0093 0.0086  0.0528  246 PHE A CA    
1545 C C     . PHE A 199 ? 0.9281 0.8445 0.8982 0.0038  0.0141  0.0480  246 PHE A C     
1546 O O     . PHE A 199 ? 0.9656 0.8484 0.9022 0.0021  0.0137  0.0429  246 PHE A O     
1547 C CB    . PHE A 199 ? 0.8643 0.8258 0.8433 -0.0093 0.0240  0.0537  246 PHE A CB    
1548 C CG    . PHE A 199 ? 0.8601 0.8380 0.8542 -0.0255 0.0213  0.0582  246 PHE A CG    
1549 C CD1   . PHE A 199 ? 0.9180 0.8682 0.8898 -0.0380 0.0136  0.0627  246 PHE A CD1   
1550 C CD2   . PHE A 199 ? 0.8387 0.8577 0.8681 -0.0282 0.0261  0.0578  246 PHE A CD2   
1551 C CE1   . PHE A 199 ? 0.9344 0.8910 0.9180 -0.0519 0.0132  0.0682  246 PHE A CE1   
1552 C CE2   . PHE A 199 ? 0.8508 0.8770 0.8931 -0.0453 0.0247  0.0601  246 PHE A CE2   
1553 C CZ    . PHE A 199 ? 0.8719 0.8639 0.8908 -0.0566 0.0198  0.0661  246 PHE A CZ    
1554 N N     . TYR A 200 ? 0.8825 0.8124 0.8716 0.0173  0.0198  0.0495  247 TYR A N     
1555 C CA    . TYR A 200 ? 0.9056 0.8082 0.8761 0.0329  0.0301  0.0467  247 TYR A CA    
1556 C C     . TYR A 200 ? 0.9717 0.8827 0.9225 0.0471  0.0478  0.0448  247 TYR A C     
1557 O O     . TYR A 200 ? 0.9717 0.9275 0.9405 0.0515  0.0549  0.0481  247 TYR A O     
1558 C CB    . TYR A 200 ? 0.8955 0.8164 0.8897 0.0488  0.0356  0.0524  247 TYR A CB    
1559 C CG    . TYR A 200 ? 0.8985 0.8103 0.9113 0.0380  0.0225  0.0546  247 TYR A CG    
1560 C CD1   . TYR A 200 ? 0.9584 0.8263 0.9577 0.0336  0.0209  0.0518  247 TYR A CD1   
1561 C CD2   . TYR A 200 ? 0.8623 0.8096 0.9065 0.0310  0.0134  0.0584  247 TYR A CD2   
1562 C CE1   . TYR A 200 ? 0.9707 0.8354 0.9907 0.0231  0.0109  0.0541  247 TYR A CE1   
1563 C CE2   . TYR A 200 ? 0.8573 0.7996 0.9195 0.0238  0.0039  0.0606  247 TYR A CE2   
1564 C CZ    . TYR A 200 ? 1.0119 0.9149 1.0632 0.0194  0.0026  0.0591  247 TYR A CZ    
1565 O OH    . TYR A 200 ? 1.0816 0.9847 1.1541 0.0103  -0.0058 0.0614  247 TYR A OH    
1566 N N     . ILE A 201 ? 0.9388 0.8093 0.8539 0.0529  0.0553  0.0383  248 ILE A N     
1567 C CA    . ILE A 201 ? 0.9470 0.8229 0.8415 0.0701  0.0748  0.0361  248 ILE A CA    
1568 C C     . ILE A 201 ? 1.0292 0.8846 0.9160 0.0956  0.0891  0.0364  248 ILE A C     
1569 O O     . ILE A 201 ? 1.0654 0.8685 0.9310 0.0932  0.0875  0.0309  248 ILE A O     
1570 C CB    . ILE A 201 ? 1.0069 0.8529 0.8615 0.0590  0.0748  0.0283  248 ILE A CB    
1571 C CG1   . ILE A 201 ? 1.0300 0.8770 0.8596 0.0788  0.0977  0.0248  248 ILE A CG1   
1572 C CG2   . ILE A 201 ? 1.0676 0.8597 0.8965 0.0453  0.0612  0.0194  248 ILE A CG2   
1573 C CD1   . ILE A 201 ? 1.1003 0.9530 0.9080 0.0679  0.1007  0.0232  248 ILE A CD1   
1574 N N     . HIS A 202 ? 0.9608 0.8597 0.8687 0.1190  0.1016  0.0437  249 HIS A N     
1575 C CA    . HIS A 202 ? 0.9768 0.8625 0.8790 0.1495  0.1166  0.0482  249 HIS A CA    
1576 C C     . HIS A 202 ? 1.0601 0.9512 0.9425 0.1751  0.1380  0.0462  249 HIS A C     
1577 O O     . HIS A 202 ? 1.0439 0.9883 0.9413 0.1772  0.1429  0.0470  249 HIS A O     
1578 C CB    . HIS A 202 ? 0.9440 0.8819 0.8842 0.1628  0.1141  0.0594  249 HIS A CB    
1579 C CG    . HIS A 202 ? 0.9519 0.8878 0.9132 0.1423  0.0958  0.0623  249 HIS A CG    
1580 N ND1   . HIS A 202 ? 0.9890 0.8732 0.9387 0.1394  0.0937  0.0635  249 HIS A ND1   
1581 C CD2   . HIS A 202 ? 0.9231 0.9035 0.9167 0.1252  0.0815  0.0638  249 HIS A CD2   
1582 C CE1   . HIS A 202 ? 0.9419 0.8443 0.9180 0.1218  0.0780  0.0663  249 HIS A CE1   
1583 N NE2   . HIS A 202 ? 0.9097 0.8675 0.9113 0.1140  0.0702  0.0663  249 HIS A NE2   
1584 N N     . LEU A 203 ? 1.0737 0.9107 0.9238 0.1953  0.1527  0.0436  250 LEU A N     
1585 C CA    . LEU A 203 ? 1.1138 0.9510 0.9424 0.2252  0.1759  0.0416  250 LEU A CA    
1586 C C     . LEU A 203 ? 1.1731 1.0499 1.0231 0.2631  0.1880  0.0550  250 LEU A C     
1587 O O     . LEU A 203 ? 1.1775 1.0305 1.0299 0.2732  0.1867  0.0632  250 LEU A O     
1588 C CB    . LEU A 203 ? 1.1819 0.9338 0.9599 0.2285  0.1872  0.0301  250 LEU A CB    
1589 C CG    . LEU A 203 ? 1.2829 1.0191 1.0326 0.2657  0.2149  0.0279  250 LEU A CG    
1590 C CD1   . LEU A 203 ? 1.2715 1.0492 1.0173 0.2654  0.2225  0.0223  250 LEU A CD1   
1591 C CD2   . LEU A 203 ? 1.3750 1.0181 1.0769 0.2687  0.2257  0.0165  250 LEU A CD2   
1592 N N     . LEU A 204 ? 1.1217 1.0619 0.9875 0.2840  0.1998  0.0579  251 LEU A N     
1593 C CA    . LEU A 204 ? 1.1228 1.1116 1.0088 0.3248  0.2111  0.0703  251 LEU A CA    
1594 C C     . LEU A 204 ? 1.2413 1.2135 1.0990 0.3614  0.2375  0.0685  251 LEU A C     
1595 O O     . LEU A 204 ? 1.2722 1.2342 1.1110 0.3508  0.2452  0.0574  251 LEU A O     
1596 C CB    . LEU A 204 ? 1.0572 1.1510 0.9934 0.3221  0.2029  0.0746  251 LEU A CB    
1597 C CG    . LEU A 204 ? 1.0324 1.1621 0.9976 0.2788  0.1823  0.0696  251 LEU A CG    
1598 C CD1   . LEU A 204 ? 0.9729 1.2016 0.9849 0.2841  0.1787  0.0732  251 LEU A CD1   
1599 C CD2   . LEU A 204 ? 1.0061 1.0927 0.9704 0.2551  0.1633  0.0709  251 LEU A CD2   
1600 N N     . ASP A 205 ? 1.2330 1.2072 1.0875 0.4067  0.2526  0.0801  252 ASP A N     
1601 C CA    . ASP A 205 ? 1.2937 1.2588 1.1237 0.4442  0.2793  0.0780  252 ASP A CA    
1602 C C     . ASP A 205 ? 1.3179 1.3831 1.1826 0.4504  0.2839  0.0769  252 ASP A C     
1603 O O     . ASP A 205 ? 1.2368 1.3814 1.1470 0.4337  0.2674  0.0805  252 ASP A O     
1604 C CB    . ASP A 205 ? 1.3835 1.3031 1.1888 0.4948  0.2991  0.0900  252 ASP A CB    
1605 C CG    . ASP A 205 ? 1.5288 1.4887 1.3605 0.5205  0.2925  0.1098  252 ASP A CG    
1606 O OD1   . ASP A 205 ? 1.5737 1.5057 1.4089 0.4973  0.2765  0.1140  252 ASP A OD1   
1607 O OD2   . ASP A 205 ? 1.5624 1.5736 1.4053 0.5681  0.3057  0.1217  252 ASP A OD2   
1608 N N     . ASP A 206 ? 1.3458 1.4046 1.1880 0.4687  0.3064  0.0694  253 ASP A N     
1609 C CA    . ASP A 206 ? 1.3287 1.4803 1.2022 0.4725  0.3150  0.0672  253 ASP A CA    
1610 C C     . ASP A 206 ? 1.3275 1.5842 1.2531 0.5017  0.3127  0.0803  253 ASP A C     
1611 O O     . ASP A 206 ? 1.2560 1.6030 1.2271 0.4809  0.3035  0.0786  253 ASP A O     
1612 C CB    . ASP A 206 ? 1.4182 1.5412 1.2547 0.4945  0.3435  0.0581  253 ASP A CB    
1613 C CG    . ASP A 206 ? 1.6163 1.6782 1.4137 0.4553  0.3429  0.0421  253 ASP A CG    
1614 O OD1   . ASP A 206 ? 1.5907 1.6819 1.4079 0.4112  0.3252  0.0389  253 ASP A OD1   
1615 O OD2   . ASP A 206 ? 1.7188 1.7063 1.4643 0.4705  0.3613  0.0325  253 ASP A OD2   
1616 N N     . ASP A 207 ? 1.3138 1.5549 1.2314 0.5462  0.3190  0.0933  254 ASP A N     
1617 C CA    . ASP A 207 ? 1.2927 1.6285 1.2522 0.5813  0.3161  0.1070  254 ASP A CA    
1618 C C     . ASP A 207 ? 1.2752 1.6702 1.2767 0.5518  0.2875  0.1104  254 ASP A C     
1619 O O     . ASP A 207 ? 1.2416 1.7389 1.2863 0.5690  0.2817  0.1162  254 ASP A O     
1620 C CB    . ASP A 207 ? 1.3898 1.6841 1.3207 0.6426  0.3341  0.1221  254 ASP A CB    
1621 C CG    . ASP A 207 ? 1.7696 2.0564 1.6783 0.6848  0.3655  0.1195  254 ASP A CG    
1622 O OD1   . ASP A 207 ? 1.7985 2.0612 1.6902 0.6606  0.3755  0.1035  254 ASP A OD1   
1623 O OD2   . ASP A 207 ? 1.9596 2.2665 1.8667 0.7439  0.3808  0.1339  254 ASP A OD2   
1624 N N     . GLU A 208 ? 1.2201 1.5575 1.2108 0.5059  0.2694  0.1046  255 GLU A N     
1625 C CA    . GLU A 208 ? 1.1614 1.5415 1.1863 0.4759  0.2431  0.1061  255 GLU A CA    
1626 C C     . GLU A 208 ? 1.1421 1.6254 1.2180 0.4467  0.2316  0.0977  255 GLU A C     
1627 O O     . GLU A 208 ? 1.1017 1.5852 1.1811 0.4103  0.2324  0.0859  255 GLU A O     
1628 C CB    . GLU A 208 ? 1.1716 1.4629 1.1723 0.4395  0.2283  0.1035  255 GLU A CB    
1629 C CG    . GLU A 208 ? 1.1768 1.5026 1.2062 0.4224  0.2051  0.1084  255 GLU A CG    
1630 C CD    . GLU A 208 ? 1.5002 1.7552 1.5043 0.4323  0.2014  0.1194  255 GLU A CD    
1631 O OE1   . GLU A 208 ? 1.1645 1.4600 1.1886 0.4401  0.1893  0.1285  255 GLU A OE1   
1632 O OE2   . GLU A 208 ? 1.6114 1.7711 1.5755 0.4297  0.2109  0.1180  255 GLU A OE2   
1633 N N     . SER A 209 ? 1.0898 1.6557 1.2024 0.4619  0.2200  0.1042  256 SER A N     
1634 C CA    . SER A 209 ? 1.0418 1.7159 1.2075 0.4394  0.2059  0.0967  256 SER A CA    
1635 C C     . SER A 209 ? 1.0671 1.7198 1.2420 0.3827  0.1860  0.0867  256 SER A C     
1636 O O     . SER A 209 ? 1.0647 1.6337 1.2109 0.3695  0.1778  0.0895  256 SER A O     
1637 C CB    . SER A 209 ? 1.0714 1.8177 1.2601 0.4753  0.1961  0.1073  256 SER A CB    
1638 O OG    . SER A 209 ? 1.1513 1.8290 1.3096 0.4908  0.1891  0.1200  256 SER A OG    
1639 N N     . GLU A 210 ? 0.9877 1.7195 1.2047 0.3501  0.1791  0.0749  257 GLU A N     
1640 C CA    . GLU A 210 ? 0.9378 1.6629 1.1695 0.2979  0.1618  0.0646  257 GLU A CA    
1641 C C     . GLU A 210 ? 0.9388 1.6924 1.1867 0.2998  0.1412  0.0666  257 GLU A C     
1642 O O     . GLU A 210 ? 0.9286 1.7356 1.1869 0.3379  0.1396  0.0743  257 GLU A O     
1643 C CB    . GLU A 210 ? 0.9348 1.7354 1.2053 0.2652  0.1659  0.0513  257 GLU A CB    
1644 C CG    . GLU A 210 ? 1.0389 1.7809 1.2941 0.2199  0.1692  0.0443  257 GLU A CG    
1645 C CD    . GLU A 210 ? 1.1281 1.8211 1.3784 0.1838  0.1496  0.0409  257 GLU A CD    
1646 O OE1   . GLU A 210 ? 1.3822 2.1296 1.6669 0.1606  0.1374  0.0323  257 GLU A OE1   
1647 O OE2   . GLU A 210 ? 0.8057 1.4077 1.0180 0.1796  0.1464  0.0458  257 GLU A OE2   
1648 N N     . GLY A 211 ? 0.8836 1.6019 1.1315 0.2608  0.1260  0.0603  258 GLY A N     
1649 C CA    . GLY A 211 ? 0.8544 1.5951 1.1154 0.2577  0.1069  0.0601  258 GLY A CA    
1650 C C     . GLY A 211 ? 0.8884 1.5393 1.1227 0.2386  0.0974  0.0630  258 GLY A C     
1651 O O     . GLY A 211 ? 0.9235 1.4932 1.1258 0.2364  0.1051  0.0676  258 GLY A O     
1652 N N     . GLU A 212 ? 0.8104 1.4794 1.0582 0.2253  0.0807  0.0593  259 GLU A N     
1653 C CA    . GLU A 212 ? 0.7855 1.3875 1.0174 0.2057  0.0696  0.0605  259 GLU A CA    
1654 C C     . GLU A 212 ? 0.8678 1.3932 1.0631 0.2319  0.0747  0.0765  259 GLU A C     
1655 O O     . GLU A 212 ? 0.8639 1.3184 1.0419 0.2125  0.0710  0.0772  259 GLU A O     
1656 C CB    . GLU A 212 ? 0.7706 1.4283 1.0263 0.1968  0.0536  0.0531  259 GLU A CB    
1657 C CG    . GLU A 212 ? 0.9111 1.5172 1.1579 0.1757  0.0421  0.0518  259 GLU A CG    
1658 C CD    . GLU A 212 ? 1.1023 1.7615 1.3635 0.1797  0.0290  0.0472  259 GLU A CD    
1659 O OE1   . GLU A 212 ? 1.0389 1.6597 1.2919 0.1682  0.0212  0.0474  259 GLU A OE1   
1660 O OE2   . GLU A 212 ? 1.0614 1.8040 1.3422 0.1948  0.0263  0.0428  259 GLU A OE2   
1661 N N     . GLU A 213 ? 0.8582 1.3991 1.0426 0.2758  0.0836  0.0893  260 GLU A N     
1662 C CA    . GLU A 213 ? 0.8862 1.3536 1.0348 0.3026  0.0923  0.1052  260 GLU A CA    
1663 C C     . GLU A 213 ? 0.9224 1.3511 1.0480 0.3214  0.1108  0.1088  260 GLU A C     
1664 O O     . GLU A 213 ? 0.9282 1.4132 1.0665 0.3403  0.1191  0.1074  260 GLU A O     
1665 C CB    . GLU A 213 ? 0.9209 1.4235 1.0664 0.3433  0.0917  0.1198  260 GLU A CB    
1666 C CG    . GLU A 213 ? 1.0460 1.5377 1.1902 0.3341  0.0793  0.1235  260 GLU A CG    
1667 C CD    . GLU A 213 ? 1.4451 2.0161 1.6011 0.3623  0.0715  0.1295  260 GLU A CD    
1668 O OE1   . GLU A 213 ? 1.6285 2.2244 1.7744 0.4071  0.0809  0.1435  260 GLU A OE1   
1669 O OE2   . GLU A 213 ? 1.2787 1.8890 1.4530 0.3410  0.0560  0.1197  260 GLU A OE2   
1670 N N     . PHE A 214 ? 0.8784 1.2141 0.9707 0.3170  0.1180  0.1125  261 PHE A N     
1671 C CA    . PHE A 214 ? 0.9209 1.2080 0.9844 0.3350  0.1366  0.1141  261 PHE A CA    
1672 C C     . PHE A 214 ? 1.0387 1.2282 1.0635 0.3427  0.1454  0.1218  261 PHE A C     
1673 O O     . PHE A 214 ? 0.9980 1.1501 1.0195 0.3246  0.1361  0.1243  261 PHE A O     
1674 C CB    . PHE A 214 ? 0.9325 1.2190 0.9983 0.3072  0.1389  0.0999  261 PHE A CB    
1675 C CG    . PHE A 214 ? 0.9275 1.1766 0.9939 0.2612  0.1247  0.0905  261 PHE A CG    
1676 C CD1   . PHE A 214 ? 0.9206 1.2193 1.0194 0.2326  0.1088  0.0838  261 PHE A CD1   
1677 C CD2   . PHE A 214 ? 0.9902 1.1551 1.0241 0.2470  0.1270  0.0876  261 PHE A CD2   
1678 C CE1   . PHE A 214 ? 0.9205 1.1828 1.0186 0.1947  0.0966  0.0770  261 PHE A CE1   
1679 C CE2   . PHE A 214 ? 1.0057 1.1421 1.0410 0.2081  0.1126  0.0801  261 PHE A CE2   
1680 C CZ    . PHE A 214 ? 0.9443 1.1284 1.0115 0.1842  0.0979  0.0762  261 PHE A CZ    
1681 N N     . THR A 215 ? 1.0745 1.2240 1.0704 0.3709  0.1653  0.1253  262 THR A N     
1682 C CA    . THR A 215 ? 1.1286 1.1802 1.0843 0.3790  0.1780  0.1302  262 THR A CA    
1683 C C     . THR A 215 ? 1.1799 1.1759 1.1160 0.3478  0.1791  0.1141  262 THR A C     
1684 O O     . THR A 215 ? 1.1840 1.2033 1.1199 0.3477  0.1849  0.1052  262 THR A O     
1685 C CB    . THR A 215 ? 1.3161 1.3525 1.2486 0.4328  0.2002  0.1448  262 THR A CB    
1686 O OG1   . THR A 215 ? 1.3134 1.4456 1.2745 0.4634  0.1971  0.1541  262 THR A OG1   
1687 C CG2   . THR A 215 ? 1.3452 1.3022 1.2481 0.4454  0.2094  0.1584  262 THR A CG2   
1688 N N     . VAL A 216 ? 1.1192 1.0494 1.0411 0.3191  0.1720  0.1100  263 VAL A N     
1689 C CA    . VAL A 216 ? 1.1222 0.9976 1.0226 0.2881  0.1698  0.0944  263 VAL A CA    
1690 C C     . VAL A 216 ? 1.2384 1.0283 1.0948 0.3053  0.1900  0.0931  263 VAL A C     
1691 O O     . VAL A 216 ? 1.2647 1.0211 1.1089 0.3297  0.2020  0.1056  263 VAL A O     
1692 C CB    . VAL A 216 ? 1.1366 0.9996 1.0509 0.2444  0.1480  0.0881  263 VAL A CB    
1693 C CG1   . VAL A 216 ? 1.0729 1.0134 1.0262 0.2276  0.1309  0.0872  263 VAL A CG1   
1694 C CG2   . VAL A 216 ? 1.1438 0.9670 1.0561 0.2431  0.1472  0.0972  263 VAL A CG2   
1695 N N     . ARG A 217 ? 1.2138 0.9674 1.0436 0.2943  0.1956  0.0781  264 ARG A N     
1696 C CA    . ARG A 217 ? 1.2761 0.9441 1.0601 0.3068  0.2154  0.0717  264 ARG A CA    
1697 C C     . ARG A 217 ? 1.3304 0.9408 1.0944 0.2648  0.2042  0.0540  264 ARG A C     
1698 O O     . ARG A 217 ? 1.2838 0.9275 1.0628 0.2345  0.1852  0.0459  264 ARG A O     
1699 C CB    . ARG A 217 ? 1.2861 0.9639 1.0505 0.3392  0.2359  0.0682  264 ARG A CB    
1700 C CG    . ARG A 217 ? 1.3985 1.1259 1.1779 0.3886  0.2502  0.0863  264 ARG A CG    
1701 C CD    . ARG A 217 ? 1.6132 1.2744 1.3662 0.4210  0.2689  0.0991  264 ARG A CD    
1702 N NE    . ARG A 217 ? 1.6351 1.3463 1.3990 0.4738  0.2824  0.1178  264 ARG A NE    
1703 C CZ    . ARG A 217 ? 1.7347 1.5185 1.5342 0.4857  0.2707  0.1338  264 ARG A CZ    
1704 N NH1   . ARG A 217 ? 1.4824 1.3155 1.2896 0.5358  0.2821  0.1498  264 ARG A NH1   
1705 N NH2   . ARG A 217 ? 1.6673 1.4782 1.4945 0.4487  0.2471  0.1330  264 ARG A NH2   
1706 N N     . ASP A 218 ? 1.3609 0.8855 1.0906 0.2627  0.2161  0.0479  265 ASP A N     
1707 C CA    . ASP A 218 ? 1.3931 0.8595 1.1010 0.2229  0.2062  0.0284  265 ASP A CA    
1708 C C     . ASP A 218 ? 1.4496 0.8864 1.1183 0.2200  0.2132  0.0084  265 ASP A C     
1709 O O     . ASP A 218 ? 1.4327 0.8814 1.0870 0.2525  0.2313  0.0101  265 ASP A O     
1710 C CB    . ASP A 218 ? 1.4780 0.8672 1.1698 0.2155  0.2156  0.0287  265 ASP A CB    
1711 C CG    . ASP A 218 ? 1.6951 1.1097 1.4241 0.2040  0.2038  0.0442  265 ASP A CG    
1712 O OD1   . ASP A 218 ? 1.6205 1.0950 1.3845 0.1802  0.1793  0.0446  265 ASP A OD1   
1713 O OD2   . ASP A 218 ? 1.8577 1.2299 1.5788 0.2198  0.2205  0.0567  265 ASP A OD2   
1714 N N     . GLY A 219 ? 1.4164 0.8240 1.0704 0.1813  0.1973  -0.0101 266 GLY A N     
1715 C CA    . GLY A 219 ? 1.4612 0.8392 1.0737 0.1735  0.2006  -0.0310 266 GLY A CA    
1716 C C     . GLY A 219 ? 1.4568 0.8854 1.0775 0.1491  0.1785  -0.0369 266 GLY A C     
1717 O O     . GLY A 219 ? 1.3893 0.8797 1.0508 0.1385  0.1607  -0.0246 266 GLY A O     
1718 N N     . TYR A 220 ? 1.4419 0.8408 1.0195 0.1422  0.1817  -0.0557 267 TYR A N     
1719 C CA    . TYR A 220 ? 1.4034 0.8386 0.9765 0.1213  0.1638  -0.0615 267 TYR A CA    
1720 C C     . TYR A 220 ? 1.4338 0.9285 1.0172 0.1437  0.1749  -0.0501 267 TYR A C     
1721 O O     . TYR A 220 ? 1.4578 0.9472 1.0273 0.1765  0.2006  -0.0486 267 TYR A O     
1722 C CB    . TYR A 220 ? 1.4664 0.8443 0.9858 0.1006  0.1596  -0.0877 267 TYR A CB    
1723 C CG    . TYR A 220 ? 1.4887 0.8304 1.0107 0.0669  0.1400  -0.0993 267 TYR A CG    
1724 C CD1   . TYR A 220 ? 1.4456 0.8289 1.0014 0.0391  0.1103  -0.0935 267 TYR A CD1   
1725 C CD2   . TYR A 220 ? 1.5739 0.8405 1.0672 0.0633  0.1527  -0.1158 267 TYR A CD2   
1726 C CE1   . TYR A 220 ? 1.4600 0.8189 1.0237 0.0086  0.0928  -0.1041 267 TYR A CE1   
1727 C CE2   . TYR A 220 ? 1.5984 0.8362 1.0981 0.0289  0.1358  -0.1277 267 TYR A CE2   
1728 C CZ    . TYR A 220 ? 1.6612 0.9495 1.1982 0.0019  0.1054  -0.1217 267 TYR A CZ    
1729 O OH    . TYR A 220 ? 1.7133 0.9809 1.2613 -0.0315 0.0895  -0.1335 267 TYR A OH    
1730 N N     . ILE A 221 ? 1.3422 0.8942 0.9518 0.1260  0.1564  -0.0417 268 ILE A N     
1731 C CA    . ILE A 221 ? 1.3130 0.9255 0.9366 0.1388  0.1655  -0.0314 268 ILE A CA    
1732 C C     . ILE A 221 ? 1.4223 1.0158 0.9959 0.1415  0.1778  -0.0443 268 ILE A C     
1733 O O     . ILE A 221 ? 1.4328 0.9949 0.9725 0.1183  0.1638  -0.0571 268 ILE A O     
1734 C CB    . ILE A 221 ? 1.2750 0.9480 0.9417 0.1185  0.1452  -0.0179 268 ILE A CB    
1735 C CG1   . ILE A 221 ? 1.2246 0.9132 0.9365 0.1126  0.1308  -0.0075 268 ILE A CG1   
1736 C CG2   . ILE A 221 ? 1.2639 0.9984 0.9489 0.1313  0.1592  -0.0080 268 ILE A CG2   
1737 C CD1   . ILE A 221 ? 1.2682 0.9943 1.0150 0.1406  0.1447  0.0057  268 ILE A CD1   
1738 N N     . HIS A 222 ? 1.4011 1.0194 0.9720 0.1712  0.2041  -0.0405 269 HIS A N     
1739 C CA    . HIS A 222 ? 1.4472 1.0596 0.9761 0.1828  0.2241  -0.0496 269 HIS A CA    
1740 C C     . HIS A 222 ? 1.4447 1.1316 1.0017 0.1871  0.2329  -0.0361 269 HIS A C     
1741 O O     . HIS A 222 ? 1.3810 1.1242 0.9890 0.1969  0.2345  -0.0217 269 HIS A O     
1742 C CB    . HIS A 222 ? 1.5148 1.0902 1.0179 0.2196  0.2532  -0.0573 269 HIS A CB    
1743 C CG    . HIS A 222 ? 1.6172 1.1073 1.0813 0.2142  0.2510  -0.0746 269 HIS A CG    
1744 N ND1   . HIS A 222 ? 1.6193 1.0861 1.1066 0.2033  0.2363  -0.0710 269 HIS A ND1   
1745 C CD2   . HIS A 222 ? 1.7169 1.1415 1.1204 0.2138  0.2609  -0.0968 269 HIS A CD2   
1746 C CE1   . HIS A 222 ? 1.6791 1.0672 1.1220 0.1957  0.2390  -0.0908 269 HIS A CE1   
1747 N NE2   . HIS A 222 ? 1.7453 1.1046 1.1362 0.2016  0.2530  -0.1080 269 HIS A NE2   
1748 N N     . TYR A 223 ? 1.4350 1.1231 0.9570 0.1806  0.2409  -0.0416 270 TYR A N     
1749 C CA    . TYR A 223 ? 1.4121 1.1680 0.9580 0.1830  0.2541  -0.0296 270 TYR A CA    
1750 C C     . TYR A 223 ? 1.4591 1.2516 1.0274 0.2209  0.2822  -0.0257 270 TYR A C     
1751 O O     . TYR A 223 ? 1.5181 1.2685 1.0550 0.2477  0.2993  -0.0361 270 TYR A O     
1752 C CB    . TYR A 223 ? 1.4828 1.2257 0.9791 0.1709  0.2609  -0.0356 270 TYR A CB    
1753 C CG    . TYR A 223 ? 1.5206 1.2400 0.9992 0.1366  0.2319  -0.0354 270 TYR A CG    
1754 C CD1   . TYR A 223 ? 1.4950 1.2566 1.0112 0.1146  0.2172  -0.0193 270 TYR A CD1   
1755 C CD2   . TYR A 223 ? 1.5819 1.2378 1.0060 0.1269  0.2191  -0.0522 270 TYR A CD2   
1756 C CE1   . TYR A 223 ? 1.5033 1.2439 1.0025 0.0878  0.1913  -0.0173 270 TYR A CE1   
1757 C CE2   . TYR A 223 ? 1.5870 1.2290 0.9963 0.0985  0.1909  -0.0513 270 TYR A CE2   
1758 C CZ    . TYR A 223 ? 1.6191 1.3033 1.0663 0.0811  0.1773  -0.0326 270 TYR A CZ    
1759 O OH    . TYR A 223 ? 1.6135 1.2845 1.0458 0.0577  0.1504  -0.0299 270 TYR A OH    
1760 N N     . GLY A 224 ? 1.3269 1.1961 0.9509 0.2231  0.2851  -0.0115 271 GLY A N     
1761 C CA    . GLY A 224 ? 1.3088 1.2296 0.9628 0.2588  0.3082  -0.0061 271 GLY A CA    
1762 C C     . GLY A 224 ? 1.3241 1.2574 1.0172 0.2745  0.2981  0.0016  271 GLY A C     
1763 O O     . GLY A 224 ? 1.3271 1.3154 1.0535 0.3044  0.3122  0.0089  271 GLY A O     
1764 N N     . GLN A 225 ? 1.2362 1.1222 0.9254 0.2560  0.2742  0.0005  272 GLN A N     
1765 C CA    . GLN A 225 ? 1.1993 1.0917 0.9204 0.2704  0.2658  0.0088  272 GLN A CA    
1766 C C     . GLN A 225 ? 1.2297 1.1992 1.0103 0.2557  0.2507  0.0210  272 GLN A C     
1767 O O     . GLN A 225 ? 1.2122 1.2028 1.0033 0.2231  0.2389  0.0214  272 GLN A O     
1768 C CB    . GLN A 225 ? 1.2231 1.0357 0.9179 0.2554  0.2489  0.0024  272 GLN A CB    
1769 C CG    . GLN A 225 ? 1.3120 1.0467 0.9575 0.2786  0.2660  -0.0088 272 GLN A CG    
1770 C CD    . GLN A 225 ? 1.5446 1.2044 1.1685 0.2577  0.2495  -0.0167 272 GLN A CD    
1771 O OE1   . GLN A 225 ? 1.5441 1.2064 1.1812 0.2230  0.2243  -0.0167 272 GLN A OE1   
1772 N NE2   . GLN A 225 ? 1.2218 0.8132 0.8131 0.2784  0.2647  -0.0238 272 GLN A NE2   
1773 N N     . THR A 226 ? 1.1759 1.1849 0.9928 0.2794  0.2509  0.0306  273 THR A N     
1774 C CA    . THR A 226 ? 1.1052 1.1833 0.9753 0.2628  0.2345  0.0390  273 THR A CA    
1775 C C     . THR A 226 ? 1.1307 1.1676 1.0026 0.2379  0.2094  0.0402  273 THR A C     
1776 O O     . THR A 226 ? 1.1609 1.1498 1.0185 0.2518  0.2073  0.0418  273 THR A O     
1777 C CB    . THR A 226 ? 1.2191 1.3709 1.1290 0.2955  0.2426  0.0479  273 THR A CB    
1778 O OG1   . THR A 226 ? 1.2454 1.4399 1.1558 0.3191  0.2669  0.0462  273 THR A OG1   
1779 C CG2   . THR A 226 ? 1.1634 1.3873 1.1259 0.2737  0.2246  0.0526  273 THR A CG2   
1780 N N     . VAL A 227 ? 1.0279 1.0813 0.9164 0.2014  0.1924  0.0396  274 VAL A N     
1781 C CA    . VAL A 227 ? 0.9892 1.0146 0.8850 0.1761  0.1684  0.0408  274 VAL A CA    
1782 C C     . VAL A 227 ? 0.9998 1.0897 0.9453 0.1651  0.1564  0.0470  274 VAL A C     
1783 O O     . VAL A 227 ? 0.9954 1.1528 0.9693 0.1694  0.1650  0.0485  274 VAL A O     
1784 C CB    . VAL A 227 ? 1.0434 1.0189 0.9093 0.1444  0.1561  0.0344  274 VAL A CB    
1785 C CG1   . VAL A 227 ? 1.1099 1.0182 0.9230 0.1532  0.1654  0.0248  274 VAL A CG1   
1786 C CG2   . VAL A 227 ? 1.0134 1.0257 0.8885 0.1219  0.1566  0.0355  274 VAL A CG2   
1787 N N     . LYS A 228 ? 0.9196 0.9896 0.8756 0.1497  0.1370  0.0492  275 LYS A N     
1788 C CA    . LYS A 228 ? 0.8653 0.9823 0.8622 0.1348  0.1229  0.0526  275 LYS A CA    
1789 C C     . LYS A 228 ? 0.9270 1.0035 0.9181 0.1046  0.1038  0.0510  275 LYS A C     
1790 O O     . LYS A 228 ? 0.9478 0.9682 0.9158 0.1035  0.0974  0.0498  275 LYS A O     
1791 C CB    . LYS A 228 ? 0.8747 1.0169 0.8926 0.1587  0.1214  0.0589  275 LYS A CB    
1792 C CG    . LYS A 228 ? 0.8958 1.1150 0.9579 0.1525  0.1147  0.0596  275 LYS A CG    
1793 C CD    . LYS A 228 ? 0.9223 1.2117 1.0035 0.1755  0.1294  0.0601  275 LYS A CD    
1794 C CE    . LYS A 228 ? 0.9053 1.2712 1.0297 0.1711  0.1199  0.0589  275 LYS A CE    
1795 N NZ    . LYS A 228 ? 0.8498 1.2495 0.9970 0.1354  0.1165  0.0505  275 LYS A NZ    
1796 N N     . LEU A 229 ? 0.8575 0.9608 0.8678 0.0795  0.0963  0.0503  276 LEU A N     
1797 C CA    . LEU A 229 ? 0.8266 0.8968 0.8329 0.0533  0.0790  0.0502  276 LEU A CA    
1798 C C     . LEU A 229 ? 0.8017 0.9014 0.8444 0.0457  0.0666  0.0520  276 LEU A C     
1799 O O     . LEU A 229 ? 0.7384 0.8882 0.8087 0.0395  0.0696  0.0507  276 LEU A O     
1800 C CB    . LEU A 229 ? 0.8337 0.9014 0.8277 0.0322  0.0819  0.0498  276 LEU A CB    
1801 C CG    . LEU A 229 ? 0.9112 0.9483 0.8629 0.0368  0.0941  0.0477  276 LEU A CG    
1802 C CD1   . LEU A 229 ? 0.9080 0.9536 0.8522 0.0176  0.1004  0.0502  276 LEU A CD1   
1803 C CD2   . LEU A 229 ? 0.9596 0.9353 0.8761 0.0346  0.0824  0.0447  276 LEU A CD2   
1804 N N     . VAL A 230 ? 0.7684 0.8388 0.8116 0.0457  0.0539  0.0536  277 VAL A N     
1805 C CA    . VAL A 230 ? 0.7232 0.8174 0.7973 0.0398  0.0427  0.0548  277 VAL A CA    
1806 C C     . VAL A 230 ? 0.8049 0.8664 0.8777 0.0189  0.0270  0.0549  277 VAL A C     
1807 O O     . VAL A 230 ? 0.8470 0.8656 0.9009 0.0185  0.0209  0.0555  277 VAL A O     
1808 C CB    . VAL A 230 ? 0.7276 0.8276 0.8090 0.0618  0.0440  0.0588  277 VAL A CB    
1809 C CG1   . VAL A 230 ? 0.6718 0.8060 0.7838 0.0569  0.0345  0.0589  277 VAL A CG1   
1810 C CG2   . VAL A 230 ? 0.7363 0.8629 0.8134 0.0893  0.0601  0.0608  277 VAL A CG2   
1811 N N     . CYS A 231 ? 0.7300 0.8116 0.8232 0.0020  0.0208  0.0537  278 CYS A N     
1812 C CA    . CYS A 231 ? 0.7274 0.7817 0.8224 -0.0139 0.0063  0.0550  278 CYS A CA    
1813 C C     . CYS A 231 ? 0.7883 0.8331 0.8943 -0.0073 -0.0029 0.0564  278 CYS A C     
1814 O O     . CYS A 231 ? 0.7837 0.8580 0.9094 0.0022  -0.0006 0.0559  278 CYS A O     
1815 C CB    . CYS A 231 ? 0.7208 0.7953 0.8350 -0.0302 0.0052  0.0530  278 CYS A CB    
1816 S SG    . CYS A 231 ? 0.7620 0.8111 0.8862 -0.0417 -0.0113 0.0549  278 CYS A SG    
1817 N N     . SER A 232 ? 0.7252 0.7322 0.8181 -0.0123 -0.0130 0.0580  279 SER A N     
1818 C CA    . SER A 232 ? 0.7101 0.7055 0.8130 -0.0092 -0.0202 0.0593  279 SER A CA    
1819 C C     . SER A 232 ? 0.7604 0.7726 0.8915 -0.0152 -0.0288 0.0600  279 SER A C     
1820 O O     . SER A 232 ? 0.7656 0.7722 0.9074 -0.0132 -0.0332 0.0617  279 SER A O     
1821 C CB    . SER A 232 ? 0.7747 0.7309 0.8571 -0.0157 -0.0283 0.0583  279 SER A CB    
1822 O OG    . SER A 232 ? 0.9105 0.8562 0.9885 -0.0288 -0.0411 0.0589  279 SER A OG    
1823 N N     . VAL A 233 ? 0.7066 0.7376 0.8490 -0.0228 -0.0292 0.0582  280 VAL A N     
1824 C CA    . VAL A 233 ? 0.6691 0.7115 0.8346 -0.0284 -0.0357 0.0568  280 VAL A CA    
1825 C C     . VAL A 233 ? 0.7665 0.8478 0.9486 -0.0256 -0.0281 0.0512  280 VAL A C     
1826 O O     . VAL A 233 ? 0.7960 0.8950 0.9933 -0.0186 -0.0289 0.0499  280 VAL A O     
1827 C CB    . VAL A 233 ? 0.6652 0.6875 0.8268 -0.0411 -0.0430 0.0582  280 VAL A CB    
1828 C CG1   . VAL A 233 ? 0.6346 0.6679 0.8178 -0.0453 -0.0450 0.0548  280 VAL A CG1   
1829 C CG2   . VAL A 233 ? 0.6572 0.6504 0.8070 -0.0424 -0.0548 0.0631  280 VAL A CG2   
1830 N N     . THR A 234 ? 0.7016 0.7984 0.8810 -0.0325 -0.0208 0.0474  281 THR A N     
1831 C CA    . THR A 234 ? 0.6721 0.8124 0.8686 -0.0342 -0.0145 0.0393  281 THR A CA    
1832 C C     . THR A 234 ? 0.7470 0.9209 0.9454 -0.0157 -0.0084 0.0398  281 THR A C     
1833 O O     . THR A 234 ? 0.7748 0.9892 0.9896 -0.0115 -0.0078 0.0338  281 THR A O     
1834 C CB    . THR A 234 ? 0.6675 0.8137 0.8615 -0.0499 -0.0070 0.0354  281 THR A CB    
1835 O OG1   . THR A 234 ? 0.7743 0.9206 0.9515 -0.0430 0.0010  0.0397  281 THR A OG1   
1836 C CG2   . THR A 234 ? 0.6162 0.7239 0.8032 -0.0658 -0.0107 0.0377  281 THR A CG2   
1837 N N     . GLY A 235 ? 0.6982 0.8566 0.8784 -0.0040 -0.0034 0.0461  282 GLY A N     
1838 C CA    . GLY A 235 ? 0.7018 0.8864 0.8800 0.0181  0.0045  0.0489  282 GLY A CA    
1839 C C     . GLY A 235 ? 0.7796 1.0063 0.9624 0.0210  0.0143  0.0446  282 GLY A C     
1840 O O     . GLY A 235 ? 0.8062 1.0669 0.9920 0.0418  0.0205  0.0465  282 GLY A O     
1841 N N     . MET A 236 ? 0.7321 0.9576 0.9153 0.0013  0.0170  0.0401  283 MET A N     
1842 C CA    . MET A 236 ? 0.7393 1.0061 0.9299 -0.0012 0.0282  0.0354  283 MET A CA    
1843 C C     . MET A 236 ? 0.8224 1.0683 0.9888 0.0076  0.0388  0.0408  283 MET A C     
1844 O O     . MET A 236 ? 0.8502 1.0437 0.9921 0.0020  0.0367  0.0452  283 MET A O     
1845 C CB    . MET A 236 ? 0.7720 1.0465 0.9757 -0.0304 0.0288  0.0276  283 MET A CB    
1846 C CG    . MET A 236 ? 0.8155 1.1571 1.0466 -0.0366 0.0346  0.0169  283 MET A CG    
1847 S SD    . MET A 236 ? 0.8916 1.2293 1.1350 -0.0749 0.0384  0.0070  283 MET A SD    
1848 C CE    . MET A 236 ? 0.8483 1.1720 1.1017 -0.0808 0.0242  0.0004  283 MET A CE    
1849 N N     . ALA A 237 ? 0.7678 1.0591 0.9414 0.0210  0.0504  0.0393  284 ALA A N     
1850 C CA    . ALA A 237 ? 0.7715 1.0491 0.9227 0.0321  0.0636  0.0429  284 ALA A CA    
1851 C C     . ALA A 237 ? 0.8239 1.1426 0.9875 0.0180  0.0763  0.0379  284 ALA A C     
1852 O O     . ALA A 237 ? 0.8135 1.1794 1.0069 0.0021  0.0753  0.0305  284 ALA A O     
1853 C CB    . ALA A 237 ? 0.7802 1.0722 0.9263 0.0666  0.0700  0.0476  284 ALA A CB    
1854 N N     . LEU A 238 ? 0.7774 1.0765 0.9170 0.0218  0.0892  0.0407  285 LEU A N     
1855 C CA    . LEU A 238 ? 0.7800 1.1187 0.9286 0.0125  0.1058  0.0376  285 LEU A CA    
1856 C C     . LEU A 238 ? 0.8519 1.2393 1.0090 0.0447  0.1175  0.0378  285 LEU A C     
1857 O O     . LEU A 238 ? 0.8714 1.2339 1.0118 0.0720  0.1147  0.0425  285 LEU A O     
1858 C CB    . LEU A 238 ? 0.8116 1.0983 0.9230 0.0032  0.1144  0.0419  285 LEU A CB    
1859 C CG    . LEU A 238 ? 0.8793 1.1239 0.9794 -0.0263 0.1074  0.0442  285 LEU A CG    
1860 C CD1   . LEU A 238 ? 0.9285 1.1164 0.9829 -0.0256 0.1114  0.0500  285 LEU A CD1   
1861 C CD2   . LEU A 238 ? 0.8621 1.1463 0.9900 -0.0543 0.1167  0.0400  285 LEU A CD2   
1862 N N     . PRO A 239 ? 0.7912 1.2441 0.9715 0.0438  0.1326  0.0336  286 PRO A N     
1863 C CA    . PRO A 239 ? 0.7936 1.2931 0.9806 0.0796  0.1444  0.0352  286 PRO A CA    
1864 C C     . PRO A 239 ? 0.8768 1.3186 1.0200 0.1040  0.1556  0.0413  286 PRO A C     
1865 O O     . PRO A 239 ? 0.9191 1.2921 1.0285 0.0887  0.1534  0.0428  286 PRO A O     
1866 C CB    . PRO A 239 ? 0.8098 1.3859 1.0298 0.0654  0.1592  0.0285  286 PRO A CB    
1867 C CG    . PRO A 239 ? 0.8680 1.4087 1.0788 0.0256  0.1621  0.0267  286 PRO A CG    
1868 C CD    . PRO A 239 ? 0.7996 1.2877 1.0018 0.0107  0.1414  0.0275  286 PRO A CD    
1869 N N     . ARG A 240 ? 0.8029 1.2688 0.9439 0.1427  0.1669  0.0444  287 ARG A N     
1870 C CA    . ARG A 240 ? 0.8344 1.2360 0.9300 0.1649  0.1782  0.0478  287 ARG A CA    
1871 C C     . ARG A 240 ? 0.9195 1.2982 0.9904 0.1486  0.1930  0.0448  287 ARG A C     
1872 O O     . ARG A 240 ? 0.9153 1.3501 1.0081 0.1374  0.2061  0.0422  287 ARG A O     
1873 C CB    . ARG A 240 ? 0.8488 1.2722 0.9422 0.2116  0.1908  0.0523  287 ARG A CB    
1874 C CG    . ARG A 240 ? 0.8597 1.3037 0.9708 0.2341  0.1784  0.0584  287 ARG A CG    
1875 C CD    . ARG A 240 ? 0.8971 1.4039 1.0232 0.2778  0.1930  0.0630  287 ARG A CD    
1876 N NE    . ARG A 240 ? 0.9808 1.5627 1.1353 0.2688  0.2058  0.0566  287 ARG A NE    
1877 C CZ    . ARG A 240 ? 1.0636 1.7075 1.2329 0.3022  0.2229  0.0585  287 ARG A CZ    
1878 N NH1   . ARG A 240 ? 0.8577 1.4967 1.0146 0.3508  0.2290  0.0677  287 ARG A NH1   
1879 N NH2   . ARG A 240 ? 0.9329 1.6447 1.1301 0.2881  0.2353  0.0519  287 ARG A NH2   
1880 N N     . LEU A 241 ? 0.9031 1.2003 0.9285 0.1444  0.1903  0.0448  288 LEU A N     
1881 C CA    . LEU A 241 ? 0.9378 1.2058 0.9310 0.1303  0.2026  0.0426  288 LEU A CA    
1882 C C     . LEU A 241 ? 1.0597 1.2758 1.0065 0.1581  0.2157  0.0401  288 LEU A C     
1883 O O     . LEU A 241 ? 1.0801 1.2620 1.0149 0.1803  0.2109  0.0404  288 LEU A O     
1884 C CB    . LEU A 241 ? 0.9342 1.1495 0.9095 0.0955  0.1850  0.0433  288 LEU A CB    
1885 C CG    . LEU A 241 ? 0.9463 1.1931 0.9588 0.0655  0.1719  0.0449  288 LEU A CG    
1886 C CD1   . LEU A 241 ? 0.9414 1.1267 0.9308 0.0417  0.1540  0.0472  288 LEU A CD1   
1887 C CD2   . LEU A 241 ? 0.9863 1.2909 1.0231 0.0479  0.1888  0.0443  288 LEU A CD2   
1888 N N     . ILE A 242 ? 1.0500 1.2586 0.9692 0.1564  0.2341  0.0373  289 ILE A N     
1889 C CA    . ILE A 242 ? 1.1064 1.2586 0.9735 0.1773  0.2478  0.0319  289 ILE A CA    
1890 C C     . ILE A 242 ? 1.1893 1.2853 1.0151 0.1476  0.2394  0.0294  289 ILE A C     
1891 O O     . ILE A 242 ? 1.1801 1.2989 1.0092 0.1245  0.2445  0.0328  289 ILE A O     
1892 C CB    . ILE A 242 ? 1.1710 1.3656 1.0368 0.2045  0.2784  0.0302  289 ILE A CB    
1893 C CG1   . ILE A 242 ? 1.1611 1.4036 1.0599 0.2429  0.2856  0.0334  289 ILE A CG1   
1894 C CG2   . ILE A 242 ? 1.2265 1.3538 1.0291 0.2167  0.2928  0.0222  289 ILE A CG2   
1895 C CD1   . ILE A 242 ? 1.1774 1.5072 1.1108 0.2570  0.3070  0.0349  289 ILE A CD1   
1896 N N     . ILE A 243 ? 1.1669 1.1910 0.9547 0.1474  0.2261  0.0240  290 ILE A N     
1897 C CA    . ILE A 243 ? 1.1977 1.1715 0.9438 0.1228  0.2155  0.0211  290 ILE A CA    
1898 C C     . ILE A 243 ? 1.3311 1.2837 1.0273 0.1342  0.2382  0.0141  290 ILE A C     
1899 O O     . ILE A 243 ? 1.3473 1.2825 1.0238 0.1627  0.2540  0.0064  290 ILE A O     
1900 C CB    . ILE A 243 ? 1.2317 1.1484 0.9639 0.1115  0.1890  0.0173  290 ILE A CB    
1901 C CG1   . ILE A 243 ? 1.2563 1.1338 0.9509 0.0853  0.1739  0.0159  290 ILE A CG1   
1902 C CG2   . ILE A 243 ? 1.2535 1.1262 0.9663 0.1359  0.1929  0.0083  290 ILE A CG2   
1903 C CD1   . ILE A 243 ? 1.3150 1.1537 1.0084 0.0694  0.1447  0.0136  290 ILE A CD1   
1904 N N     . ARG A 244 ? 1.3197 1.2774 0.9969 0.1141  0.2429  0.0181  291 ARG A N     
1905 C CA    . ARG A 244 ? 1.3770 1.3222 1.0067 0.1221  0.2662  0.0133  291 ARG A CA    
1906 C C     . ARG A 244 ? 1.5004 1.3982 1.0776 0.1002  0.2549  0.0130  291 ARG A C     
1907 O O     . ARG A 244 ? 1.4893 1.3883 1.0793 0.0753  0.2363  0.0226  291 ARG A O     
1908 C CB    . ARG A 244 ? 1.3246 1.3407 0.9862 0.1247  0.2928  0.0210  291 ARG A CB    
1909 C CG    . ARG A 244 ? 1.3375 1.3966 1.0303 0.1579  0.3111  0.0177  291 ARG A CG    
1910 C CD    . ARG A 244 ? 1.3902 1.5352 1.1301 0.1578  0.3329  0.0248  291 ARG A CD    
1911 N NE    . ARG A 244 ? 1.4292 1.6185 1.1973 0.1952  0.3488  0.0219  291 ARG A NE    
1912 C CZ    . ARG A 244 ? 1.5198 1.7967 1.3401 0.2025  0.3650  0.0261  291 ARG A CZ    
1913 N NH1   . ARG A 244 ? 1.1893 1.5164 1.0393 0.1713  0.3701  0.0319  291 ARG A NH1   
1914 N NH2   . ARG A 244 ? 1.4291 1.7444 1.2717 0.2412  0.3770  0.0245  291 ARG A NH2   
1915 N N     . LYS A 245 ? 1.5268 1.3826 1.0425 0.1114  0.2664  0.0017  292 LYS A N     
1916 C CA    . LYS A 245 ? 1.5704 1.3807 1.0247 0.0958  0.2567  -0.0009 292 LYS A CA    
1917 C C     . LYS A 245 ? 1.6129 1.4535 1.0609 0.0821  0.2725  0.0137  292 LYS A C     
1918 O O     . LYS A 245 ? 1.5981 1.4871 1.0715 0.0901  0.3001  0.0191  292 LYS A O     
1919 C CB    . LYS A 245 ? 1.6744 1.4327 1.0637 0.1138  0.2667  -0.0209 292 LYS A CB    
1920 C CG    . LYS A 245 ? 1.8281 1.5348 1.1487 0.0990  0.2500  -0.0287 292 LYS A CG    
1921 C CD    . LYS A 245 ? 1.9433 1.6241 1.2708 0.0776  0.2104  -0.0291 292 LYS A CD    
1922 C CE    . LYS A 245 ? 2.0067 1.6752 1.2946 0.0580  0.1929  -0.0211 292 LYS A CE    
1923 N NZ    . LYS A 245 ? 1.8550 1.5164 1.1659 0.0392  0.1564  -0.0162 292 LYS A NZ    
1924 N N     . VAL A 246 ? 1.5816 1.3956 0.9978 0.0615  0.2553  0.0212  293 VAL A N     
1925 C CA    . VAL A 246 ? 1.6006 1.4302 1.0020 0.0465  0.2691  0.0377  293 VAL A CA    
1926 C C     . VAL A 246 ? 1.7732 1.5572 1.0918 0.0488  0.2704  0.0327  293 VAL A C     
1927 O O     . VAL A 246 ? 1.7856 1.5276 1.0704 0.0440  0.2419  0.0259  293 VAL A O     
1928 C CB    . VAL A 246 ? 1.5963 1.4344 1.0339 0.0221  0.2480  0.0546  293 VAL A CB    
1929 C CG1   . VAL A 246 ? 1.6284 1.4644 1.0377 0.0058  0.2603  0.0731  293 VAL A CG1   
1930 C CG2   . VAL A 246 ? 1.5198 1.4084 1.0357 0.0193  0.2507  0.0579  293 VAL A CG2   
1931 N N     . ASP A 247 ? 1.8146 1.6105 1.1005 0.0568  0.3037  0.0347  294 ASP A N     
1932 C CA    . ASP A 247 ? 1.9069 1.6635 1.1091 0.0603  0.3090  0.0303  294 ASP A CA    
1933 C C     . ASP A 247 ? 1.9866 1.7340 1.1633 0.0398  0.3012  0.0527  294 ASP A C     
1934 O O     . ASP A 247 ? 2.0392 1.7460 1.1602 0.0364  0.2782  0.0511  294 ASP A O     
1935 C CB    . ASP A 247 ? 1.9850 1.7574 1.1606 0.0795  0.3499  0.0234  294 ASP A CB    
1936 C CG    . ASP A 247 ? 2.2541 1.9803 1.3387 0.0893  0.3547  0.0104  294 ASP A CG    
1937 O OD1   . ASP A 247 ? 2.2956 1.9788 1.3482 0.0966  0.3338  -0.0109 294 ASP A OD1   
1938 O OD2   . ASP A 247 ? 2.3819 2.1159 1.4269 0.0897  0.3818  0.0200  294 ASP A OD2   
1939 N N     . LYS A 248 ? 1.8971 1.6820 1.1149 0.0261  0.3200  0.0733  295 LYS A N     
1940 C CA    . LYS A 248 ? 1.9044 1.6778 1.1046 0.0064  0.3170  0.0978  295 LYS A CA    
1941 C C     . LYS A 248 ? 1.8599 1.6746 1.1357 -0.0118 0.3266  0.1126  295 LYS A C     
1942 O O     . LYS A 248 ? 1.7858 1.5979 1.1021 -0.0222 0.3001  0.1162  295 LYS A O     
1943 C CB    . LYS A 248 ? 2.0150 1.7742 1.1431 0.0089  0.3448  0.1076  295 LYS A CB    
1944 C CG    . LYS A 248 ? 2.2276 1.9351 1.2767 0.0101  0.3201  0.1117  295 LYS A CG    
1945 C CD    . LYS A 248 ? 2.3432 2.0363 1.3751 -0.0064 0.3197  0.1429  295 LYS A CD    
1946 C CE    . LYS A 248 ? 2.5013 2.1493 1.4508 -0.0008 0.2959  0.1494  295 LYS A CE    
1947 N NZ    . LYS A 248 ? 2.6396 2.2733 1.5068 0.0107  0.3205  0.1482  295 LYS A NZ    
1948 N N     . GLN A 249 ? 1.8076 1.6630 1.1035 -0.0161 0.3651  0.1190  296 GLN A N     
1949 C CA    . GLN A 249 ? 1.7479 1.6507 1.1167 -0.0355 0.3792  0.1287  296 GLN A CA    
1950 C C     . GLN A 249 ? 1.7302 1.6928 1.1516 -0.0214 0.3984  0.1128  296 GLN A C     
1951 O O     . GLN A 249 ? 1.6962 1.7140 1.1739 -0.0342 0.4199  0.1171  296 GLN A O     
1952 C CB    . GLN A 249 ? 1.8127 1.7144 1.1616 -0.0567 0.4083  0.1516  296 GLN A CB    
1953 C CG    . GLN A 249 ? 2.1056 1.9523 1.4182 -0.0703 0.3868  0.1711  296 GLN A CG    
1954 C CD    . GLN A 249 ? 2.4308 2.2635 1.7138 -0.0895 0.4165  0.1965  296 GLN A CD    
1955 O OE1   . GLN A 249 ? 2.4338 2.2802 1.6875 -0.0881 0.4521  0.2007  296 GLN A OE1   
1956 N NE2   . GLN A 249 ? 2.3171 2.1171 1.6022 -0.1063 0.4034  0.2150  296 GLN A NE2   
1957 N N     . THR A 250 ? 1.6691 1.6197 1.0716 0.0054  0.3895  0.0938  297 THR A N     
1958 C CA    . THR A 250 ? 1.6360 1.6306 1.0737 0.0284  0.4055  0.0782  297 THR A CA    
1959 C C     . THR A 250 ? 1.6245 1.6114 1.0943 0.0408  0.3754  0.0651  297 THR A C     
1960 O O     . THR A 250 ? 1.6150 1.5554 1.0662 0.0342  0.3433  0.0644  297 THR A O     
1961 C CB    . THR A 250 ? 1.7611 1.7330 1.1342 0.0534  0.4254  0.0666  297 THR A CB    
1962 O OG1   . THR A 250 ? 1.7965 1.6986 1.1021 0.0549  0.3995  0.0615  297 THR A OG1   
1963 C CG2   . THR A 250 ? 1.7682 1.7677 1.1202 0.0492  0.4669  0.0767  297 THR A CG2   
1964 N N     . ALA A 251 ? 1.5395 1.5729 1.0558 0.0605  0.3868  0.0553  298 ALA A N     
1965 C CA    . ALA A 251 ? 1.4879 1.5167 1.0336 0.0773  0.3647  0.0439  298 ALA A CA    
1966 C C     . ALA A 251 ? 1.5727 1.6061 1.1016 0.1129  0.3863  0.0298  298 ALA A C     
1967 O O     . ALA A 251 ? 1.5648 1.6568 1.1218 0.1254  0.4158  0.0309  298 ALA A O     
1968 C CB    . ALA A 251 ? 1.4212 1.5093 1.0469 0.0672  0.3579  0.0494  298 ALA A CB    
1969 N N     . LEU A 252 ? 1.5708 1.5409 1.0509 0.1285  0.3732  0.0161  299 LEU A N     
1970 C CA    . LEU A 252 ? 1.6209 1.5750 1.0728 0.1633  0.3924  0.0006  299 LEU A CA    
1971 C C     . LEU A 252 ? 1.6433 1.6202 1.1458 0.1871  0.3888  -0.0038 299 LEU A C     
1972 O O     . LEU A 252 ? 1.6181 1.5667 1.1345 0.1816  0.3607  -0.0056 299 LEU A O     
1973 C CB    . LEU A 252 ? 1.6866 1.5582 1.0606 0.1655  0.3805  -0.0144 299 LEU A CB    
1974 C CG    . LEU A 252 ? 1.7987 1.6474 1.1135 0.1475  0.3845  -0.0100 299 LEU A CG    
1975 C CD1   . LEU A 252 ? 1.8165 1.6049 1.0905 0.1285  0.3487  -0.0145 299 LEU A CD1   
1976 C CD2   . LEU A 252 ? 1.9052 1.7444 1.1658 0.1700  0.4184  -0.0207 299 LEU A CD2   
1977 N N     . LEU A 253 ? 1.5966 1.6278 1.1268 0.2147  0.4180  -0.0041 300 LEU A N     
1978 C CA    . LEU A 253 ? 1.5557 1.6208 1.1353 0.2429  0.4187  -0.0049 300 LEU A CA    
1979 C C     . LEU A 253 ? 1.6751 1.6783 1.2147 0.2777  0.4234  -0.0192 300 LEU A C     
1980 O O     . LEU A 253 ? 1.6550 1.6386 1.2137 0.2874  0.4062  -0.0200 300 LEU A O     
1981 C CB    . LEU A 253 ? 1.5247 1.6880 1.1605 0.2566  0.4455  0.0028  300 LEU A CB    
1982 C CG    . LEU A 253 ? 1.5488 1.7699 1.2139 0.2214  0.4525  0.0142  300 LEU A CG    
1983 C CD1   . LEU A 253 ? 1.5505 1.8642 1.2605 0.2371  0.4845  0.0173  300 LEU A CD1   
1984 C CD2   . LEU A 253 ? 1.4807 1.7156 1.1893 0.1877  0.4226  0.0229  300 LEU A CD2   
1985 N N     . ASP A 254 ? 1.7148 1.6826 1.1959 0.2952  0.4475  -0.0309 301 ASP A N     
1986 C CA    . ASP A 254 ? 1.7783 1.6781 1.2112 0.3276  0.4577  -0.0476 301 ASP A CA    
1987 C C     . ASP A 254 ? 1.8360 1.6439 1.2260 0.3101  0.4283  -0.0597 301 ASP A C     
1988 O O     . ASP A 254 ? 1.9002 1.6464 1.2552 0.3335  0.4350  -0.0743 301 ASP A O     
1989 C CB    . ASP A 254 ? 1.8825 1.7709 1.2612 0.3473  0.4924  -0.0583 301 ASP A CB    
1990 C CG    . ASP A 254 ? 2.0876 1.9283 1.4009 0.3176  0.4859  -0.0655 301 ASP A CG    
1991 O OD1   . ASP A 254 ? 2.0576 1.9326 1.3871 0.2847  0.4753  -0.0520 301 ASP A OD1   
1992 O OD2   . ASP A 254 ? 2.2466 2.0138 1.4906 0.3274  0.4908  -0.0850 301 ASP A OD2   
1993 N N     . ALA A 255 ? 1.7217 1.5198 1.1137 0.2697  0.3975  -0.0544 302 ALA A N     
1994 C CA    . ALA A 255 ? 1.7263 1.4503 1.0851 0.2503  0.3681  -0.0656 302 ALA A CA    
1995 C C     . ALA A 255 ? 1.7745 1.4870 1.1735 0.2582  0.3527  -0.0633 302 ALA A C     
1996 O O     . ALA A 255 ? 1.7072 1.4796 1.1692 0.2623  0.3497  -0.0476 302 ALA A O     
1997 C CB    . ALA A 255 ? 1.7049 1.4313 1.0584 0.2103  0.3417  -0.0582 302 ALA A CB    
1998 N N     . ASP A 256 ? 1.7982 1.4330 1.1582 0.2606  0.3448  -0.0800 303 ASP A N     
1999 C CA    . ASP A 256 ? 1.7797 1.3881 1.1662 0.2680  0.3335  -0.0791 303 ASP A CA    
2000 C C     . ASP A 256 ? 1.8690 1.4017 1.2194 0.2416  0.3090  -0.0951 303 ASP A C     
2001 O O     . ASP A 256 ? 1.9026 1.3885 1.2537 0.2484  0.3064  -0.1009 303 ASP A O     
2002 C CB    . ASP A 256 ? 1.8419 1.4384 1.2264 0.3140  0.3638  -0.0815 303 ASP A CB    
2003 C CG    . ASP A 256 ? 2.0757 1.5963 1.3895 0.3321  0.3858  -0.1045 303 ASP A CG    
2004 O OD1   . ASP A 256 ? 2.1353 1.6338 1.3999 0.3146  0.3853  -0.1181 303 ASP A OD1   
2005 O OD2   . ASP A 256 ? 2.1687 1.6520 1.4741 0.3660  0.4051  -0.1085 303 ASP A OD2   
2006 N N     . ASP A 257 ? 1.8097 1.3336 1.1299 0.2111  0.2912  -0.1012 304 ASP A N     
2007 C CA    . ASP A 257 ? 1.8294 1.2959 1.1161 0.1822  0.2648  -0.1174 304 ASP A CA    
2008 C C     . ASP A 257 ? 1.7871 1.2703 1.1271 0.1605  0.2354  -0.1052 304 ASP A C     
2009 O O     . ASP A 257 ? 1.7184 1.2623 1.1132 0.1622  0.2327  -0.0841 304 ASP A O     
2010 C CB    . ASP A 257 ? 1.8888 1.3561 1.1296 0.1610  0.2549  -0.1233 304 ASP A CB    
2011 C CG    . ASP A 257 ? 2.1133 1.6321 1.3529 0.1751  0.2788  -0.1108 304 ASP A CG    
2012 O OD1   . ASP A 257 ? 2.0818 1.6625 1.3717 0.1681  0.2746  -0.0886 304 ASP A OD1   
2013 O OD2   . ASP A 257 ? 2.2501 1.7481 1.4424 0.1949  0.3052  -0.1235 304 ASP A OD2   
2014 N N     . PRO A 258 ? 1.7364 1.1700 1.0639 0.1392  0.2139  -0.1187 305 PRO A N     
2015 C CA    . PRO A 258 ? 1.6603 1.1151 1.0400 0.1197  0.1880  -0.1062 305 PRO A CA    
2016 C C     . PRO A 258 ? 1.6567 1.1566 1.0511 0.0947  0.1636  -0.0945 305 PRO A C     
2017 O O     . PRO A 258 ? 1.6911 1.1769 1.0421 0.0795  0.1530  -0.1043 305 PRO A O     
2018 C CB    . PRO A 258 ? 1.7232 1.1115 1.0804 0.1031  0.1758  -0.1266 305 PRO A CB    
2019 C CG    . PRO A 258 ? 1.8693 1.1982 1.1627 0.1153  0.1967  -0.1504 305 PRO A CG    
2020 C CD    . PRO A 258 ? 1.8300 1.1905 1.0975 0.1289  0.2114  -0.1469 305 PRO A CD    
2021 N N     . VAL A 259 ? 1.5286 1.0822 0.9820 0.0928  0.1561  -0.0730 306 VAL A N     
2022 C CA    . VAL A 259 ? 1.4581 1.0538 0.9349 0.0718  0.1353  -0.0584 306 VAL A CA    
2023 C C     . VAL A 259 ? 1.5047 1.0739 0.9716 0.0449  0.1036  -0.0669 306 VAL A C     
2024 O O     . VAL A 259 ? 1.5062 1.0548 0.9928 0.0389  0.0936  -0.0725 306 VAL A O     
2025 C CB    . VAL A 259 ? 1.4115 1.0639 0.9543 0.0765  0.1364  -0.0376 306 VAL A CB    
2026 C CG1   . VAL A 259 ? 1.3659 1.0531 0.9294 0.0552  0.1177  -0.0237 306 VAL A CG1   
2027 C CG2   . VAL A 259 ? 1.4032 1.0905 0.9586 0.1028  0.1663  -0.0310 306 VAL A CG2   
2028 N N     . SER A 260 ? 1.4603 1.0310 0.8951 0.0297  0.0888  -0.0678 307 SER A N     
2029 C CA    . SER A 260 ? 1.4562 1.0119 0.8823 0.0061  0.0569  -0.0755 307 SER A CA    
2030 C C     . SER A 260 ? 1.4267 1.0206 0.8790 -0.0076 0.0348  -0.0565 307 SER A C     
2031 O O     . SER A 260 ? 1.3896 1.0154 0.8551 -0.0021 0.0449  -0.0385 307 SER A O     
2032 C CB    . SER A 260 ? 1.5902 1.1033 0.9486 -0.0003 0.0525  -0.0991 307 SER A CB    
2033 O OG    . SER A 260 ? 1.7278 1.2523 1.0539 -0.0122 0.0334  -0.0960 307 SER A OG    
2034 N N     . GLN A 261 ? 1.3662 0.9556 0.8264 -0.0256 0.0056  -0.0614 308 GLN A N     
2035 C CA    . GLN A 261 ? 1.3268 0.9452 0.8084 -0.0376 -0.0193 -0.0462 308 GLN A CA    
2036 C C     . GLN A 261 ? 1.4148 1.0421 0.8568 -0.0356 -0.0193 -0.0351 308 GLN A C     
2037 O O     . GLN A 261 ? 1.5023 1.1074 0.8859 -0.0346 -0.0175 -0.0473 308 GLN A O     
2038 C CB    . GLN A 261 ? 1.3521 0.9605 0.8339 -0.0558 -0.0497 -0.0602 308 GLN A CB    
2039 C CG    . GLN A 261 ? 1.2795 0.8808 0.8058 -0.0616 -0.0510 -0.0676 308 GLN A CG    
2040 C CD    . GLN A 261 ? 1.4509 1.0858 1.0375 -0.0568 -0.0488 -0.0467 308 GLN A CD    
2041 O OE1   . GLN A 261 ? 1.4624 1.1268 1.0686 -0.0601 -0.0631 -0.0308 308 GLN A OE1   
2042 N NE2   . GLN A 261 ? 1.2901 0.9199 0.9038 -0.0471 -0.0296 -0.0460 308 GLN A NE2   
2043 N N     . LEU A 262 ? 1.3041 0.9610 0.7757 -0.0353 -0.0198 -0.0120 309 LEU A N     
2044 C CA    . LEU A 262 ? 1.3098 0.9746 0.7515 -0.0341 -0.0175 0.0047  309 LEU A CA    
2045 C C     . LEU A 262 ? 1.4181 1.0785 0.8249 -0.0235 0.0137  0.0062  309 LEU A C     
2046 O O     . LEU A 262 ? 1.4496 1.1090 0.8185 -0.0231 0.0179  0.0179  309 LEU A O     
2047 C CB    . LEU A 262 ? 1.3407 0.9972 0.7430 -0.0413 -0.0467 0.0039  309 LEU A CB    
2048 C CG    . LEU A 262 ? 1.3407 1.0123 0.7799 -0.0504 -0.0784 0.0077  309 LEU A CG    
2049 C CD1   . LEU A 262 ? 1.3953 1.0635 0.7887 -0.0540 -0.1062 0.0046  309 LEU A CD1   
2050 C CD2   . LEU A 262 ? 1.2828 0.9766 0.7673 -0.0489 -0.0763 0.0319  309 LEU A CD2   
2051 N N     . HIS A 263 ? 1.4042 1.0639 0.8242 -0.0135 0.0370  -0.0035 310 HIS A N     
2052 C CA    . HIS A 263 ? 1.4718 1.1354 0.8670 -0.0016 0.0690  -0.0018 310 HIS A CA    
2053 C C     . HIS A 263 ? 1.4543 1.1557 0.8914 -0.0026 0.0846  0.0198  310 HIS A C     
2054 O O     . HIS A 263 ? 1.3947 1.1168 0.8864 -0.0081 0.0753  0.0276  310 HIS A O     
2055 C CB    . HIS A 263 ? 1.5304 1.1842 0.9324 0.0130  0.0883  -0.0184 310 HIS A CB    
2056 C CG    . HIS A 263 ? 1.6809 1.2915 1.0249 0.0176  0.0894  -0.0422 310 HIS A CG    
2057 N ND1   . HIS A 263 ? 1.7330 1.3212 1.0785 0.0310  0.1046  -0.0590 310 HIS A ND1   
2058 C CD2   . HIS A 263 ? 1.7917 1.3767 1.0732 0.0115  0.0785  -0.0521 310 HIS A CD2   
2059 C CE1   . HIS A 263 ? 1.8083 1.3552 1.0932 0.0305  0.1033  -0.0801 310 HIS A CE1   
2060 N NE2   . HIS A 263 ? 1.8473 1.3934 1.0921 0.0183  0.0865  -0.0779 310 HIS A NE2   
2061 N N     . LYS A 264 ? 1.4271 1.1385 0.8398 0.0017  0.1102  0.0280  311 LYS A N     
2062 C CA    . LYS A 264 ? 1.3794 1.1283 0.8309 -0.0020 0.1302  0.0454  311 LYS A CA    
2063 C C     . LYS A 264 ? 1.4165 1.1938 0.9038 0.0120  0.1537  0.0374  311 LYS A C     
2064 O O     . LYS A 264 ? 1.4443 1.2093 0.9015 0.0278  0.1693  0.0238  311 LYS A O     
2065 C CB    . LYS A 264 ? 1.4440 1.1913 0.8526 -0.0057 0.1488  0.0586  311 LYS A CB    
2066 C CG    . LYS A 264 ? 1.6303 1.3562 1.0108 -0.0175 0.1281  0.0738  311 LYS A CG    
2067 C CD    . LYS A 264 ? 1.9632 1.6842 1.2976 -0.0201 0.1510  0.0898  311 LYS A CD    
2068 C CE    . LYS A 264 ? 2.2470 1.9454 1.5090 -0.0087 0.1610  0.0789  311 LYS A CE    
2069 N NZ    . LYS A 264 ? 2.3686 2.0759 1.6020 -0.0086 0.1966  0.0919  311 LYS A NZ    
2070 N N     . CYS A 265 ? 1.3241 1.1399 0.8744 0.0077  0.1556  0.0454  312 CYS A N     
2071 C CA    . CYS A 265 ? 1.2898 1.1439 0.8852 0.0214  0.1728  0.0408  312 CYS A CA    
2072 C C     . CYS A 265 ? 1.2738 1.1788 0.9064 0.0142  0.1932  0.0520  312 CYS A C     
2073 O O     . CYS A 265 ? 1.2739 1.1814 0.9096 -0.0055 0.1907  0.0647  312 CYS A O     
2074 C CB    . CYS A 265 ? 1.2618 1.1177 0.8994 0.0231  0.1522  0.0367  312 CYS A CB    
2075 S SG    . CYS A 265 ? 1.3516 1.1503 0.9536 0.0290  0.1311  0.0207  312 CYS A SG    
2076 N N     . ALA A 266 ? 1.1710 1.1182 0.8366 0.0299  0.2121  0.0472  313 ALA A N     
2077 C CA    . ALA A 266 ? 1.1358 1.1449 0.8488 0.0231  0.2307  0.0542  313 ALA A CA    
2078 C C     . ALA A 266 ? 1.1470 1.1954 0.9130 0.0375  0.2264  0.0489  313 ALA A C     
2079 O O     . ALA A 266 ? 1.1647 1.2004 0.9215 0.0623  0.2271  0.0403  313 ALA A O     
2080 C CB    . ALA A 266 ? 1.1833 1.2155 0.8766 0.0318  0.2634  0.0540  313 ALA A CB    
2081 N N     . PHE A 267 ? 1.0475 1.1405 0.8660 0.0221  0.2222  0.0540  314 PHE A N     
2082 C CA    . PHE A 267 ? 0.9996 1.1363 0.8677 0.0354  0.2170  0.0499  314 PHE A CA    
2083 C C     . PHE A 267 ? 1.0761 1.2927 0.9882 0.0401  0.2390  0.0492  314 PHE A C     
2084 O O     . PHE A 267 ? 1.0580 1.3181 1.0106 0.0178  0.2391  0.0515  314 PHE A O     
2085 C CB    . PHE A 267 ? 0.9657 1.0915 0.8593 0.0204  0.1902  0.0521  314 PHE A CB    
2086 C CG    . PHE A 267 ? 0.9859 1.0460 0.8444 0.0254  0.1696  0.0499  314 PHE A CG    
2087 C CD1   . PHE A 267 ? 1.0188 1.0634 0.8728 0.0494  0.1655  0.0435  314 PHE A CD1   
2088 C CD2   . PHE A 267 ? 1.0170 1.0316 0.8470 0.0063  0.1549  0.0544  314 PHE A CD2   
2089 C CE1   . PHE A 267 ? 1.0414 1.0271 0.8655 0.0498  0.1477  0.0396  314 PHE A CE1   
2090 C CE2   . PHE A 267 ? 1.0643 1.0271 0.8661 0.0093  0.1347  0.0507  314 PHE A CE2   
2091 C CZ    . PHE A 267 ? 1.0395 0.9887 0.8399 0.0288  0.1315  0.0423  314 PHE A CZ    
2092 N N     . TYR A 268 ? 1.0456 1.2826 0.9498 0.0693  0.2584  0.0449  315 TYR A N     
2093 C CA    . TYR A 268 ? 1.0286 1.3495 0.9769 0.0773  0.2789  0.0439  315 TYR A CA    
2094 C C     . TYR A 268 ? 1.0392 1.4097 1.0386 0.0893  0.2650  0.0418  315 TYR A C     
2095 O O     . TYR A 268 ? 1.0438 1.3898 1.0336 0.1166  0.2555  0.0405  315 TYR A O     
2096 C CB    . TYR A 268 ? 1.0874 1.4173 1.0107 0.1071  0.3061  0.0407  315 TYR A CB    
2097 C CG    . TYR A 268 ? 1.0909 1.5118 1.0640 0.1288  0.3232  0.0389  315 TYR A CG    
2098 C CD1   . TYR A 268 ? 1.1039 1.6018 1.1206 0.1075  0.3382  0.0398  315 TYR A CD1   
2099 C CD2   . TYR A 268 ? 1.0909 1.5227 1.0694 0.1705  0.3240  0.0364  315 TYR A CD2   
2100 C CE1   . TYR A 268 ? 1.1065 1.6989 1.1749 0.1266  0.3509  0.0370  315 TYR A CE1   
2101 C CE2   . TYR A 268 ? 1.0797 1.6019 1.1066 0.1935  0.3365  0.0360  315 TYR A CE2   
2102 C CZ    . TYR A 268 ? 1.1985 1.8049 1.2716 0.1715  0.3491  0.0356  315 TYR A CZ    
2103 O OH    . TYR A 268 ? 1.2779 1.9825 1.4011 0.1945  0.3608  0.0340  315 TYR A OH    
2104 N N     . LEU A 269 ? 0.9499 1.3870 1.0009 0.0670  0.2641  0.0413  316 LEU A N     
2105 C CA    . LEU A 269 ? 0.8988 1.3945 0.9997 0.0747  0.2509  0.0382  316 LEU A CA    
2106 C C     . LEU A 269 ? 1.0109 1.5632 1.1274 0.1147  0.2660  0.0368  316 LEU A C     
2107 O O     . LEU A 269 ? 1.0375 1.6505 1.1734 0.1158  0.2883  0.0350  316 LEU A O     
2108 C CB    . LEU A 269 ? 0.8617 1.4143 1.0094 0.0377  0.2491  0.0346  316 LEU A CB    
2109 C CG    . LEU A 269 ? 0.9138 1.4161 1.0569 0.0069  0.2273  0.0356  316 LEU A CG    
2110 C CD1   . LEU A 269 ? 0.9541 1.3978 1.0615 -0.0209 0.2347  0.0414  316 LEU A CD1   
2111 C CD2   . LEU A 269 ? 0.9316 1.4961 1.1273 -0.0163 0.2196  0.0282  316 LEU A CD2   
2112 N N     . LYS A 270 ? 0.9775 1.5042 1.0808 0.1496  0.2566  0.0387  317 LYS A N     
2113 C CA    . LYS A 270 ? 0.9870 1.5551 1.0977 0.1955  0.2711  0.0397  317 LYS A CA    
2114 C C     . LYS A 270 ? 1.0296 1.7151 1.2019 0.1977  0.2776  0.0371  317 LYS A C     
2115 O O     . LYS A 270 ? 0.9907 1.7186 1.2012 0.1744  0.2610  0.0341  317 LYS A O     
2116 C CB    . LYS A 270 ? 0.9999 1.5219 1.0926 0.2274  0.2571  0.0440  317 LYS A CB    
2117 C CG    . LYS A 270 ? 0.9349 1.4726 1.0201 0.2806  0.2739  0.0476  317 LYS A CG    
2118 C CD    . LYS A 270 ? 0.9669 1.4034 0.9981 0.3034  0.2732  0.0499  317 LYS A CD    
2119 C CE    . LYS A 270 ? 1.0128 1.4596 1.0407 0.3580  0.2853  0.0562  317 LYS A CE    
2120 N NZ    . LYS A 270 ? 1.2082 1.5819 1.2106 0.3718  0.2726  0.0618  317 LYS A NZ    
2121 N N     . ASP A 271 ? 1.0245 1.7636 1.2060 0.2237  0.3023  0.0367  318 ASP A N     
2122 C CA    . ASP A 271 ? 1.0089 1.8705 1.2509 0.2310  0.3109  0.0335  318 ASP A CA    
2123 C C     . ASP A 271 ? 1.0566 1.9744 1.3383 0.1787  0.3136  0.0262  318 ASP A C     
2124 O O     . ASP A 271 ? 1.0407 2.0352 1.3736 0.1636  0.3010  0.0203  318 ASP A O     
2125 C CB    . ASP A 271 ? 0.9970 1.9090 1.2696 0.2615  0.2922  0.0360  318 ASP A CB    
2126 C CG    . ASP A 271 ? 1.0467 1.9191 1.2869 0.3186  0.2961  0.0450  318 ASP A CG    
2127 O OD1   . ASP A 271 ? 1.0831 1.9391 1.2981 0.3473  0.3204  0.0468  318 ASP A OD1   
2128 O OD2   . ASP A 271 ? 0.9943 1.8554 1.2351 0.3364  0.2771  0.0503  318 ASP A OD2   
2129 N N     . THR A 272 ? 1.0133 1.8897 1.2684 0.1504  0.3304  0.0263  319 THR A N     
2130 C CA    . THR A 272 ? 0.9884 1.9008 1.2716 0.0996  0.3390  0.0216  319 THR A CA    
2131 C C     . THR A 272 ? 1.0791 1.9897 1.3409 0.0977  0.3720  0.0242  319 THR A C     
2132 O O     . THR A 272 ? 1.1073 1.9616 1.3200 0.1289  0.3824  0.0287  319 THR A O     
2133 C CB    . THR A 272 ? 0.9668 1.8020 1.2294 0.0572  0.3193  0.0225  319 THR A CB    
2134 O OG1   . THR A 272 ? 0.9198 1.6485 1.1166 0.0610  0.3199  0.0298  319 THR A OG1   
2135 C CG2   . THR A 272 ? 0.8390 1.6776 1.1234 0.0556  0.2883  0.0190  319 THR A CG2   
2136 N N     . GLU A 273 ? 1.0456 2.0151 1.3419 0.0603  0.3902  0.0206  320 GLU A N     
2137 C CA    . GLU A 273 ? 1.0844 2.0560 1.3608 0.0558  0.4248  0.0241  320 GLU A CA    
2138 C C     . GLU A 273 ? 1.1431 2.0015 1.3538 0.0318  0.4256  0.0320  320 GLU A C     
2139 O O     . GLU A 273 ? 1.1523 2.0005 1.3665 -0.0131 0.4327  0.0342  320 GLU A O     
2140 C CB    . GLU A 273 ? 1.0952 2.1744 1.4337 0.0242  0.4474  0.0181  320 GLU A CB    
2141 C CG    . GLU A 273 ? 1.2297 2.4316 1.6258 0.0575  0.4567  0.0116  320 GLU A CG    
2142 C CD    . GLU A 273 ? 1.5744 2.8137 1.9632 0.0879  0.4923  0.0146  320 GLU A CD    
2143 O OE1   . GLU A 273 ? 1.4387 2.6707 1.8147 0.0600  0.5206  0.0174  320 GLU A OE1   
2144 O OE2   . GLU A 273 ? 1.5236 2.8047 1.9216 0.1408  0.4936  0.0144  320 GLU A OE2   
2145 N N     . ARG A 274 ? 1.0958 1.8680 1.2461 0.0620  0.4173  0.0360  321 ARG A N     
2146 C CA    . ARG A 274 ? 1.1234 1.7886 1.2051 0.0478  0.4144  0.0427  321 ARG A CA    
2147 C C     . ARG A 274 ? 1.1445 1.7636 1.2255 0.0061  0.3919  0.0462  321 ARG A C     
2148 O O     . ARG A 274 ? 1.1742 1.7412 1.2192 -0.0203 0.3993  0.0536  321 ARG A O     
2149 C CB    . ARG A 274 ? 1.1694 1.8287 1.2172 0.0423  0.4494  0.0472  321 ARG A CB    
2150 C CG    . ARG A 274 ? 1.2338 1.9547 1.2922 0.0809  0.4771  0.0430  321 ARG A CG    
2151 C CD    . ARG A 274 ? 1.2826 2.0038 1.3102 0.0737  0.5138  0.0472  321 ARG A CD    
2152 N NE    . ARG A 274 ? 1.3978 2.1657 1.4600 0.0269  0.5310  0.0517  321 ARG A NE    
2153 C CZ    . ARG A 274 ? 1.5432 2.4197 1.6755 0.0162  0.5483  0.0472  321 ARG A CZ    
2154 N NH1   . ARG A 274 ? 1.3922 2.3483 1.5699 0.0521  0.5478  0.0393  321 ARG A NH1   
2155 N NH2   . ARG A 274 ? 1.2798 2.1869 1.4380 -0.0310 0.5658  0.0507  321 ARG A NH2   
2156 N N     . MET A 275 ? 1.0565 1.6932 1.1743 0.0029  0.3654  0.0417  322 MET A N     
2157 C CA    . MET A 275 ? 1.0351 1.6297 1.1549 -0.0324 0.3437  0.0436  322 MET A CA    
2158 C C     . MET A 275 ? 1.0843 1.5847 1.1541 -0.0204 0.3188  0.0478  322 MET A C     
2159 O O     . MET A 275 ? 1.0741 1.5634 1.1366 0.0125  0.3059  0.0449  322 MET A O     
2160 C CB    . MET A 275 ? 1.0135 1.6765 1.1974 -0.0452 0.3287  0.0348  322 MET A CB    
2161 C CG    . MET A 275 ? 1.0561 1.8193 1.2949 -0.0616 0.3504  0.0280  322 MET A CG    
2162 S SD    . MET A 275 ? 1.1375 1.8856 1.3767 -0.1189 0.3717  0.0317  322 MET A SD    
2163 C CE    . MET A 275 ? 1.0883 1.9734 1.4003 -0.1298 0.3979  0.0205  322 MET A CE    
2164 N N     . TYR A 276 ? 1.0512 1.4847 1.0870 -0.0469 0.3131  0.0552  323 TYR A N     
2165 C CA    . TYR A 276 ? 1.0550 1.4035 1.0445 -0.0397 0.2894  0.0592  323 TYR A CA    
2166 C C     . TYR A 276 ? 1.1027 1.4234 1.1056 -0.0672 0.2675  0.0618  323 TYR A C     
2167 O O     . TYR A 276 ? 1.0947 1.4353 1.1216 -0.0987 0.2764  0.0637  323 TYR A O     
2168 C CB    . TYR A 276 ? 1.1189 1.4058 1.0428 -0.0387 0.3013  0.0667  323 TYR A CB    
2169 C CG    . TYR A 276 ? 1.1640 1.4539 1.0586 -0.0061 0.3185  0.0624  323 TYR A CG    
2170 C CD1   . TYR A 276 ? 1.2002 1.5490 1.1101 -0.0012 0.3501  0.0613  323 TYR A CD1   
2171 C CD2   . TYR A 276 ? 1.1958 1.4262 1.0444 0.0182  0.3050  0.0587  323 TYR A CD2   
2172 C CE1   . TYR A 276 ? 1.2425 1.5915 1.1233 0.0313  0.3680  0.0569  323 TYR A CE1   
2173 C CE2   . TYR A 276 ? 1.2483 1.4732 1.0651 0.0479  0.3226  0.0529  323 TYR A CE2   
2174 C CZ    . TYR A 276 ? 1.3569 1.6401 1.1888 0.0561  0.3545  0.0523  323 TYR A CZ    
2175 O OH    . TYR A 276 ? 1.3889 1.6656 1.1880 0.0878  0.3742  0.0462  323 TYR A OH    
2176 N N     . LEU A 277 ? 1.0586 1.3300 1.0445 -0.0556 0.2406  0.0616  324 LEU A N     
2177 C CA    . LEU A 277 ? 1.0479 1.2843 1.0398 -0.0745 0.2179  0.0642  324 LEU A CA    
2178 C C     . LEU A 277 ? 1.1821 1.3601 1.1310 -0.0944 0.2221  0.0759  324 LEU A C     
2179 O O     . LEU A 277 ? 1.2323 1.3593 1.1298 -0.0824 0.2185  0.0809  324 LEU A O     
2180 C CB    . LEU A 277 ? 1.0282 1.2302 1.0088 -0.0529 0.1926  0.0615  324 LEU A CB    
2181 C CG    . LEU A 277 ? 1.0614 1.2354 1.0534 -0.0662 0.1685  0.0629  324 LEU A CG    
2182 C CD1   . LEU A 277 ? 1.0248 1.2557 1.0722 -0.0733 0.1643  0.0553  324 LEU A CD1   
2183 C CD2   . LEU A 277 ? 1.0821 1.2093 1.0486 -0.0475 0.1478  0.0625  324 LEU A CD2   
2184 N N     . CYS A 278 ? 1.1303 1.3181 1.0990 -0.1247 0.2319  0.0799  325 CYS A N     
2185 C CA    . CYS A 278 ? 1.1613 1.3003 1.0934 -0.1451 0.2424  0.0935  325 CYS A CA    
2186 C C     . CYS A 278 ? 1.1899 1.2974 1.1335 -0.1668 0.2291  0.0978  325 CYS A C     
2187 O O     . CYS A 278 ? 1.1288 1.2669 1.1179 -0.1749 0.2196  0.0879  325 CYS A O     
2188 C CB    . CYS A 278 ? 1.1909 1.3678 1.1302 -0.1615 0.2770  0.0960  325 CYS A CB    
2189 S SG    . CYS A 278 ? 1.3067 1.4210 1.1899 -0.1825 0.2970  0.1166  325 CYS A SG    
2190 N N     . LEU A 279 ? 1.2250 1.2717 1.1247 -0.1750 0.2302  0.1129  326 LEU A N     
2191 C CA    . LEU A 279 ? 1.2534 1.2529 1.1485 -0.1916 0.2208  0.1219  326 LEU A CA    
2192 C C     . LEU A 279 ? 1.3711 1.3583 1.2599 -0.2211 0.2503  0.1326  326 LEU A C     
2193 O O     . LEU A 279 ? 1.4154 1.3973 1.2714 -0.2222 0.2724  0.1422  326 LEU A O     
2194 C CB    . LEU A 279 ? 1.2850 1.2220 1.1241 -0.1727 0.2015  0.1343  326 LEU A CB    
2195 C CG    . LEU A 279 ? 1.3493 1.2307 1.1729 -0.1761 0.1837  0.1459  326 LEU A CG    
2196 C CD1   . LEU A 279 ? 1.3462 1.1939 1.1292 -0.1520 0.1586  0.1505  326 LEU A CD1   
2197 C CD2   . LEU A 279 ? 1.4461 1.2855 1.2394 -0.1947 0.2048  0.1647  326 LEU A CD2   
2198 N N     . SER A 280 ? 1.3331 1.3097 1.2490 -0.2450 0.2515  0.1314  327 SER A N     
2199 C CA    . SER A 280 ? 1.3852 1.3330 1.2929 -0.2759 0.2782  0.1425  327 SER A CA    
2200 C C     . SER A 280 ? 1.4485 1.3415 1.3554 -0.2823 0.2624  0.1470  327 SER A C     
2201 O O     . SER A 280 ? 1.3998 1.3160 1.3522 -0.2944 0.2543  0.1310  327 SER A O     
2202 C CB    . SER A 280 ? 1.4136 1.4265 1.3718 -0.3051 0.3040  0.1284  327 SER A CB    
2203 O OG    . SER A 280 ? 1.5412 1.5194 1.4847 -0.3364 0.3340  0.1410  327 SER A OG    
2204 N N     . GLN A 281 ? 1.4604 1.2831 1.3131 -0.2693 0.2553  0.1682  328 GLN A N     
2205 C CA    . GLN A 281 ? 1.4802 1.2446 1.3226 -0.2662 0.2389  0.1767  328 GLN A CA    
2206 C C     . GLN A 281 ? 1.4566 1.2441 1.3278 -0.2455 0.2046  0.1616  328 GLN A C     
2207 O O     . GLN A 281 ? 1.4323 1.2281 1.2857 -0.2196 0.1853  0.1619  328 GLN A O     
2208 C CB    . GLN A 281 ? 1.5374 1.2744 1.3983 -0.2997 0.2608  0.1771  328 GLN A CB    
2209 C CG    . GLN A 281 ? 1.9535 1.6535 1.7797 -0.3212 0.2969  0.1964  328 GLN A CG    
2210 C CD    . GLN A 281 ? 2.2463 2.0070 2.1033 -0.3483 0.3264  0.1846  328 GLN A CD    
2211 O OE1   . GLN A 281 ? 2.1485 1.9758 2.0628 -0.3618 0.3247  0.1599  328 GLN A OE1   
2212 N NE2   . GLN A 281 ? 2.1586 1.8997 1.9779 -0.3571 0.3554  0.2027  328 GLN A NE2   
2213 N N     . GLU A 282 ? 1.3660 1.1651 1.2805 -0.2578 0.1986  0.1471  329 GLU A N     
2214 C CA    . GLU A 282 ? 1.2991 1.1204 1.2404 -0.2392 0.1692  0.1338  329 GLU A CA    
2215 C C     . GLU A 282 ? 1.2796 1.1781 1.2658 -0.2408 0.1684  0.1120  329 GLU A C     
2216 O O     . GLU A 282 ? 1.2369 1.1596 1.2414 -0.2223 0.1463  0.1022  329 GLU A O     
2217 C CB    . GLU A 282 ? 1.3221 1.1108 1.2806 -0.2481 0.1630  0.1304  329 GLU A CB    
2218 C CG    . GLU A 282 ? 1.4079 1.1883 1.3718 -0.2230 0.1324  0.1283  329 GLU A CG    
2219 C CD    . GLU A 282 ? 1.7291 1.4912 1.7184 -0.2319 0.1286  0.1192  329 GLU A CD    
2220 O OE1   . GLU A 282 ? 1.5506 1.3434 1.5693 -0.2212 0.1100  0.1050  329 GLU A OE1   
2221 O OE2   . GLU A 282 ? 1.6474 1.3632 1.6261 -0.2499 0.1462  0.1257  329 GLU A OE2   
2222 N N     . ARG A 283 ? 1.2160 1.1548 1.2199 -0.2619 0.1934  0.1056  330 ARG A N     
2223 C CA    . ARG A 283 ? 1.1503 1.1697 1.1992 -0.2638 0.1957  0.0859  330 ARG A CA    
2224 C C     . ARG A 283 ? 1.1541 1.2084 1.1930 -0.2371 0.1918  0.0861  330 ARG A C     
2225 O O     . ARG A 283 ? 1.1969 1.2284 1.1965 -0.2299 0.2025  0.0992  330 ARG A O     
2226 C CB    . ARG A 283 ? 1.1457 1.2017 1.2231 -0.2989 0.2244  0.0775  330 ARG A CB    
2227 C CG    . ARG A 283 ? 1.2523 1.2658 1.3357 -0.3308 0.2349  0.0765  330 ARG A CG    
2228 C CD    . ARG A 283 ? 1.3086 1.3711 1.4347 -0.3696 0.2579  0.0594  330 ARG A CD    
2229 N NE    . ARG A 283 ? 1.3955 1.5212 1.5357 -0.3760 0.2786  0.0574  330 ARG A NE    
2230 C CZ    . ARG A 283 ? 1.5675 1.6703 1.6755 -0.3816 0.3030  0.0748  330 ARG A CZ    
2231 N NH1   . ARG A 283 ? 1.4887 1.5052 1.5440 -0.3789 0.3079  0.0974  330 ARG A NH1   
2232 N NH2   . ARG A 283 ? 1.2901 1.4582 1.4163 -0.3864 0.3222  0.0706  330 ARG A NH2   
2233 N N     . ILE A 284 ? 1.0103 1.1200 1.0834 -0.2223 0.1786  0.0711  331 ILE A N     
2234 C CA    . ILE A 284 ? 0.9636 1.1096 1.0325 -0.1968 0.1782  0.0689  331 ILE A CA    
2235 C C     . ILE A 284 ? 1.0199 1.2441 1.1295 -0.2083 0.1977  0.0569  331 ILE A C     
2236 O O     . ILE A 284 ? 1.0053 1.2774 1.1590 -0.2181 0.1927  0.0425  331 ILE A O     
2237 C CB    . ILE A 284 ? 0.9475 1.0924 1.0179 -0.1679 0.1521  0.0648  331 ILE A CB    
2238 C CG1   . ILE A 284 ? 0.9589 1.0328 0.9913 -0.1585 0.1333  0.0762  331 ILE A CG1   
2239 C CG2   . ILE A 284 ? 0.9301 1.1100 0.9974 -0.1424 0.1556  0.0615  331 ILE A CG2   
2240 C CD1   . ILE A 284 ? 0.9890 1.0208 0.9689 -0.1458 0.1351  0.0886  331 ILE A CD1   
2241 N N     . ILE A 285 ? 0.9944 1.2329 1.0889 -0.2093 0.2209  0.0626  332 ILE A N     
2242 C CA    . ILE A 285 ? 0.9805 1.2979 1.1132 -0.2199 0.2426  0.0528  332 ILE A CA    
2243 C C     . ILE A 285 ? 1.0536 1.4089 1.1797 -0.1882 0.2490  0.0525  332 ILE A C     
2244 O O     . ILE A 285 ? 1.0602 1.3797 1.1534 -0.1588 0.2354  0.0574  332 ILE A O     
2245 C CB    . ILE A 285 ? 1.0495 1.3661 1.1858 -0.2582 0.2717  0.0567  332 ILE A CB    
2246 C CG1   . ILE A 285 ? 1.1045 1.3529 1.1816 -0.2577 0.2861  0.0768  332 ILE A CG1   
2247 C CG2   . ILE A 285 ? 1.0648 1.3683 1.2265 -0.2916 0.2682  0.0492  332 ILE A CG2   
2248 C CD1   . ILE A 285 ? 1.1987 1.4777 1.2758 -0.2724 0.3192  0.0806  332 ILE A CD1   
2249 N N     . GLN A 286 ? 1.0084 1.4366 1.1667 -0.1951 0.2710  0.0458  333 GLN A N     
2250 C CA    . GLN A 286 ? 0.9969 1.4734 1.1568 -0.1660 0.2831  0.0442  333 GLN A CA    
2251 C C     . GLN A 286 ? 1.0812 1.5624 1.2243 -0.1814 0.3167  0.0519  333 GLN A C     
2252 O O     . GLN A 286 ? 1.0597 1.5936 1.2402 -0.2108 0.3365  0.0467  333 GLN A O     
2253 C CB    . GLN A 286 ? 0.9674 1.5415 1.1891 -0.1612 0.2802  0.0290  333 GLN A CB    
2254 C CG    . GLN A 286 ? 0.9177 1.5251 1.1425 -0.1159 0.2716  0.0265  333 GLN A CG    
2255 C CD    . GLN A 286 ? 0.9052 1.6176 1.1920 -0.1145 0.2715  0.0131  333 GLN A CD    
2256 O OE1   . GLN A 286 ? 0.7730 1.5080 1.0907 -0.1289 0.2540  0.0038  333 GLN A OE1   
2257 N NE2   . GLN A 286 ? 0.8020 1.5856 1.1092 -0.0985 0.2918  0.0111  333 GLN A NE2   
2258 N N     . PHE A 287 ? 1.0950 1.5206 1.1811 -0.1640 0.3236  0.0636  334 PHE A N     
2259 C CA    . PHE A 287 ? 1.1550 1.5814 1.2189 -0.1766 0.3565  0.0722  334 PHE A CA    
2260 C C     . PHE A 287 ? 1.2272 1.6956 1.2843 -0.1451 0.3741  0.0695  334 PHE A C     
2261 O O     . PHE A 287 ? 1.2185 1.6571 1.2438 -0.1103 0.3611  0.0689  334 PHE A O     
2262 C CB    . PHE A 287 ? 1.2332 1.5663 1.2333 -0.1869 0.3572  0.0888  334 PHE A CB    
2263 C CG    . PHE A 287 ? 1.3238 1.6534 1.3022 -0.2082 0.3928  0.1000  334 PHE A CG    
2264 C CD1   . PHE A 287 ? 1.3924 1.7235 1.3922 -0.2498 0.4096  0.1043  334 PHE A CD1   
2265 C CD2   . PHE A 287 ? 1.3987 1.7191 1.3322 -0.1874 0.4115  0.1062  334 PHE A CD2   
2266 C CE1   . PHE A 287 ? 1.4604 1.7843 1.4380 -0.2707 0.4455  0.1167  334 PHE A CE1   
2267 C CE2   . PHE A 287 ? 1.4852 1.8011 1.3950 -0.2066 0.4463  0.1181  334 PHE A CE2   
2268 C CZ    . PHE A 287 ? 1.4802 1.7981 1.4128 -0.2484 0.4636  0.1244  334 PHE A CZ    
2269 N N     . GLN A 288 ? 1.2098 1.7462 1.2968 -0.1582 0.4054  0.0674  335 GLN A N     
2270 C CA    . GLN A 288 ? 1.2245 1.8121 1.3120 -0.1290 0.4273  0.0645  335 GLN A CA    
2271 C C     . GLN A 288 ? 1.3844 1.9126 1.4026 -0.1199 0.4473  0.0762  335 GLN A C     
2272 O O     . GLN A 288 ? 1.4252 1.9230 1.4201 -0.1496 0.4657  0.0873  335 GLN A O     
2273 C CB    . GLN A 288 ? 1.2209 1.9164 1.3751 -0.1466 0.4522  0.0563  335 GLN A CB    
2274 C CG    . GLN A 288 ? 1.2257 1.9860 1.3892 -0.1098 0.4732  0.0522  335 GLN A CG    
2275 C CD    . GLN A 288 ? 1.2403 2.1146 1.4718 -0.1276 0.4985  0.0444  335 GLN A CD    
2276 O OE1   . GLN A 288 ? 0.9662 1.9189 1.2602 -0.1287 0.4853  0.0323  335 GLN A OE1   
2277 N NE2   . GLN A 288 ? 1.2608 2.1513 1.4812 -0.1402 0.5358  0.0507  335 GLN A NE2   
2278 N N     . ALA A 289 ? 1.3818 1.8930 1.3651 -0.0783 0.4452  0.0735  336 ALA A N     
2279 C CA    . ALA A 289 ? 1.4508 1.9089 1.3644 -0.0639 0.4626  0.0806  336 ALA A CA    
2280 C C     . ALA A 289 ? 1.5736 2.0965 1.4999 -0.0604 0.5033  0.0804  336 ALA A C     
2281 O O     . ALA A 289 ? 1.5451 2.1564 1.5305 -0.0497 0.5132  0.0714  336 ALA A O     
2282 C CB    . ALA A 289 ? 1.4609 1.8737 1.3343 -0.0228 0.4440  0.0741  336 ALA A CB    
2283 N N     . THR A 290 ? 1.6165 2.0986 1.4864 -0.0672 0.5270  0.0907  337 THR A N     
2284 C CA    . THR A 290 ? 1.6655 2.2004 1.5363 -0.0621 0.5692  0.0918  337 THR A CA    
2285 C C     . THR A 290 ? 1.7709 2.2781 1.5895 -0.0151 0.5731  0.0851  337 THR A C     
2286 O O     . THR A 290 ? 1.8000 2.2206 1.5494 -0.0060 0.5573  0.0877  337 THR A O     
2287 C CB    . THR A 290 ? 1.8316 2.3378 1.6698 -0.0982 0.5959  0.1080  337 THR A CB    
2288 O OG1   . THR A 290 ? 1.8618 2.2754 1.6516 -0.1137 0.5706  0.1188  337 THR A OG1   
2289 C CG2   . THR A 290 ? 1.7880 2.3708 1.6957 -0.1377 0.6193  0.1095  337 THR A CG2   
2290 N N     . PRO A 291 ? 1.7326 2.3095 1.5828 0.0170  0.5911  0.0749  338 PRO A N     
2291 C CA    . PRO A 291 ? 1.7672 2.3066 1.5630 0.0625  0.5958  0.0672  338 PRO A CA    
2292 C C     . PRO A 291 ? 1.8923 2.3992 1.6212 0.0639  0.6284  0.0727  338 PRO A C     
2293 O O     . PRO A 291 ? 1.9010 2.4504 1.6451 0.0390  0.6594  0.0817  338 PRO A O     
2294 C CB    . PRO A 291 ? 1.7580 2.3853 1.6133 0.0973  0.6057  0.0567  338 PRO A CB    
2295 C CG    . PRO A 291 ? 1.7669 2.4910 1.7070 0.0673  0.6115  0.0587  338 PRO A CG    
2296 C CD    . PRO A 291 ? 1.7170 2.4099 1.6509 0.0142  0.6093  0.0697  338 PRO A CD    
2297 N N     . CYS A 292 ? 1.9080 2.3373 1.5609 0.0907  0.6216  0.0669  339 CYS A N     
2298 C CA    . CYS A 292 ? 1.9965 2.3869 1.5744 0.0962  0.6495  0.0699  339 CYS A CA    
2299 C C     . CYS A 292 ? 2.0782 2.5411 1.6733 0.1194  0.6947  0.0656  339 CYS A C     
2300 O O     . CYS A 292 ? 2.0551 2.5619 1.6857 0.1546  0.6978  0.0538  339 CYS A O     
2301 C CB    . CYS A 292 ? 2.0494 2.3428 1.5442 0.1175  0.6279  0.0608  339 CYS A CB    
2302 S SG    . CYS A 292 ? 2.1056 2.3106 1.5526 0.0835  0.5889  0.0719  339 CYS A SG    
2303 N N     . PRO A 293 ? 2.0762 2.5570 1.6507 0.1005  0.7314  0.0767  340 PRO A N     
2304 C CA    . PRO A 293 ? 2.0996 2.6599 1.6981 0.1202  0.7773  0.0734  340 PRO A CA    
2305 C C     . PRO A 293 ? 2.2051 2.7427 1.7541 0.1725  0.7912  0.0579  340 PRO A C     
2306 O O     . PRO A 293 ? 2.1891 2.7996 1.7847 0.2038  0.8113  0.0496  340 PRO A O     
2307 C CB    . PRO A 293 ? 2.1690 2.7313 1.7410 0.0849  0.8108  0.0904  340 PRO A CB    
2308 C CG    . PRO A 293 ? 2.2002 2.7093 1.7658 0.0422  0.7814  0.1040  340 PRO A CG    
2309 C CD    . PRO A 293 ? 2.1244 2.5570 1.6550 0.0610  0.7349  0.0944  340 PRO A CD    
2310 N N     . LYS A 294 ? 2.2217 2.6594 1.6769 0.1826  0.7801  0.0532  341 LYS A N     
2311 C CA    . LYS A 294 ? 2.2752 2.6742 1.6709 0.2290  0.7927  0.0358  341 LYS A CA    
2312 C C     . LYS A 294 ? 2.3155 2.6647 1.7073 0.2573  0.7566  0.0196  341 LYS A C     
2313 O O     . LYS A 294 ? 2.3733 2.6950 1.7268 0.2984  0.7689  0.0033  341 LYS A O     
2314 C CB    . LYS A 294 ? 2.3765 2.7015 1.6679 0.2251  0.8067  0.0366  341 LYS A CB    
2315 C CG    . LYS A 294 ? 2.4380 2.8149 1.7190 0.2233  0.8595  0.0453  341 LYS A CG    
2316 C CD    . LYS A 294 ? 2.5696 2.8694 1.7392 0.2244  0.8719  0.0451  341 LYS A CD    
2317 C CE    . LYS A 294 ? 2.6171 2.9648 1.7702 0.2239  0.9270  0.0544  341 LYS A CE    
2318 N NZ    . LYS A 294 ? 2.7398 3.0129 1.7775 0.2339  0.9402  0.0504  341 LYS A NZ    
2319 N N     . GLU A 295 ? 2.1872 2.5217 1.6162 0.2360  0.7147  0.0237  342 GLU A N     
2320 C CA    . GLU A 295 ? 2.1592 2.4452 1.5860 0.2587  0.6812  0.0105  342 GLU A CA    
2321 C C     . GLU A 295 ? 2.1268 2.4748 1.6451 0.2580  0.6614  0.0144  342 GLU A C     
2322 O O     . GLU A 295 ? 2.0719 2.4438 1.6335 0.2211  0.6425  0.0262  342 GLU A O     
2323 C CB    . GLU A 295 ? 2.1913 2.3763 1.5532 0.2389  0.6441  0.0077  342 GLU A CB    
2324 C CG    . GLU A 295 ? 2.3769 2.4975 1.6427 0.2362  0.6561  0.0037  342 GLU A CG    
2325 C CD    . GLU A 295 ? 2.5623 2.6798 1.8089 0.1957  0.6565  0.0233  342 GLU A CD    
2326 O OE1   . GLU A 295 ? 2.4324 2.4795 1.6214 0.1796  0.6294  0.0241  342 GLU A OE1   
2327 O OE2   . GLU A 295 ? 2.4378 2.6234 1.7273 0.1801  0.6839  0.0381  342 GLU A OE2   
2328 N N     . GLN A 296 ? 2.0663 2.4336 1.6083 0.3006  0.6650  0.0041  343 GLN A N     
2329 C CA    . GLN A 296 ? 1.9844 2.4084 1.6052 0.3097  0.6463  0.0067  343 GLN A CA    
2330 C C     . GLN A 296 ? 1.9752 2.3282 1.5867 0.2975  0.6005  0.0048  343 GLN A C     
2331 O O     . GLN A 296 ? 1.9055 2.2989 1.5789 0.2926  0.5791  0.0097  343 GLN A O     
2332 C CB    . GLN A 296 ? 2.0197 2.4832 1.6590 0.3658  0.6694  -0.0016 343 GLN A CB    
2333 C CG    . GLN A 296 ? 2.0777 2.6384 1.8086 0.3794  0.6626  0.0043  343 GLN A CG    
2334 C CD    . GLN A 296 ? 2.2500 2.8022 1.9817 0.4368  0.6654  -0.0027 343 GLN A CD    
2335 O OE1   . GLN A 296 ? 2.2195 2.8192 1.9597 0.4780  0.6979  -0.0056 343 GLN A OE1   
2336 N NE2   . GLN A 296 ? 2.0653 2.5578 1.7893 0.4418  0.6329  -0.0042 343 GLN A NE2   
2337 N N     . ASN A 297 ? 1.9493 2.2009 1.4836 0.2922  0.5862  -0.0030 344 ASN A N     
2338 C CA    . ASN A 297 ? 1.9106 2.0901 1.4283 0.2815  0.5459  -0.0069 344 ASN A CA    
2339 C C     . ASN A 297 ? 1.8870 2.0362 1.3934 0.2339  0.5186  0.0025  344 ASN A C     
2340 O O     . ASN A 297 ? 1.8571 1.9451 1.3440 0.2234  0.4859  -0.0011 344 ASN A O     
2341 C CB    . ASN A 297 ? 1.9792 2.0696 1.4243 0.3095  0.5465  -0.0249 344 ASN A CB    
2342 C CG    . ASN A 297 ? 2.1936 2.2319 1.5566 0.3047  0.5626  -0.0332 344 ASN A CG    
2343 O OD1   . ASN A 297 ? 2.0706 2.1341 1.4234 0.2811  0.5752  -0.0233 344 ASN A OD1   
2344 N ND2   . ASN A 297 ? 2.1254 2.0862 1.4245 0.3262  0.5630  -0.0521 344 ASN A ND2   
2345 N N     . LYS A 298 ? 1.8142 2.0057 1.3329 0.2063  0.5338  0.0151  345 LYS A N     
2346 C CA    . LYS A 298 ? 1.7844 1.9506 1.2922 0.1641  0.5142  0.0272  345 LYS A CA    
2347 C C     . LYS A 298 ? 1.7715 2.0148 1.3495 0.1357  0.5219  0.0416  345 LYS A C     
2348 O O     . LYS A 298 ? 1.7738 2.0868 1.3828 0.1405  0.5548  0.0442  345 LYS A O     
2349 C CB    . LYS A 298 ? 1.8819 1.9976 1.3087 0.1555  0.5280  0.0287  345 LYS A CB    
2350 C CG    . LYS A 298 ? 2.0481 2.0722 1.3998 0.1623  0.5043  0.0163  345 LYS A CG    
2351 C CD    . LYS A 298 ? 2.1650 2.1451 1.4460 0.1412  0.5051  0.0242  345 LYS A CD    
2352 C CE    . LYS A 298 ? 2.2518 2.1597 1.4454 0.1577  0.5004  0.0066  345 LYS A CE    
2353 N NZ    . LYS A 298 ? 2.2885 2.1463 1.4215 0.1343  0.4800  0.0142  345 LYS A NZ    
2354 N N     . GLU A 299 ? 1.6669 1.8967 1.2688 0.1050  0.4923  0.0499  346 GLU A N     
2355 C CA    . GLU A 299 ? 1.6065 1.8936 1.2696 0.0716  0.4948  0.0617  346 GLU A CA    
2356 C C     . GLU A 299 ? 1.6423 1.8733 1.2729 0.0365  0.4785  0.0744  346 GLU A C     
2357 O O     . GLU A 299 ? 1.6348 1.8062 1.2407 0.0358  0.4455  0.0727  346 GLU A O     
2358 C CB    . GLU A 299 ? 1.5490 1.8801 1.2839 0.0742  0.4721  0.0573  346 GLU A CB    
2359 C CG    . GLU A 299 ? 1.6981 2.0986 1.4765 0.1090  0.4873  0.0484  346 GLU A CG    
2360 C CD    . GLU A 299 ? 2.0342 2.4713 1.8727 0.1167  0.4625  0.0447  346 GLU A CD    
2361 O OE1   . GLU A 299 ? 1.9935 2.4467 1.8413 0.1556  0.4639  0.0375  346 GLU A OE1   
2362 O OE2   . GLU A 299 ? 1.9975 2.4448 1.8708 0.0855  0.4427  0.0494  346 GLU A OE2   
2363 N N     . MET A 300 ? 1.5916 1.8419 1.2239 0.0078  0.5019  0.0880  347 MET A N     
2364 C CA    . MET A 300 ? 1.5936 1.7924 1.1978 -0.0245 0.4902  0.1035  347 MET A CA    
2365 C C     . MET A 300 ? 1.5495 1.7610 1.2131 -0.0465 0.4634  0.1052  347 MET A C     
2366 O O     . MET A 300 ? 1.5002 1.7799 1.2317 -0.0606 0.4739  0.1033  347 MET A O     
2367 C CB    . MET A 300 ? 1.6714 1.8861 1.2627 -0.0488 0.5271  0.1187  347 MET A CB    
2368 C CG    . MET A 300 ? 1.8009 1.9931 1.3227 -0.0306 0.5533  0.1198  347 MET A CG    
2369 S SD    . MET A 300 ? 1.9041 2.1597 1.4461 -0.0523 0.6082  0.1320  347 MET A SD    
2370 C CE    . MET A 300 ? 1.8226 2.1763 1.4310 -0.0226 0.6279  0.1126  347 MET A CE    
2371 N N     . ILE A 301 ? 1.4786 1.6276 1.1166 -0.0491 0.4288  0.1074  348 ILE A N     
2372 C CA    . ILE A 301 ? 1.4195 1.5698 1.1046 -0.0670 0.4015  0.1084  348 ILE A CA    
2373 C C     . ILE A 301 ? 1.5225 1.6241 1.1849 -0.0967 0.3952  0.1258  348 ILE A C     
2374 O O     . ILE A 301 ? 1.5795 1.6279 1.1760 -0.0961 0.3985  0.1369  348 ILE A O     
2375 C CB    . ILE A 301 ? 1.4072 1.5377 1.0995 -0.0442 0.3664  0.0957  348 ILE A CB    
2376 C CG1   . ILE A 301 ? 1.4541 1.5107 1.0745 -0.0292 0.3481  0.0944  348 ILE A CG1   
2377 C CG2   . ILE A 301 ? 1.3626 1.5492 1.0932 -0.0176 0.3745  0.0815  348 ILE A CG2   
2378 C CD1   . ILE A 301 ? 1.5260 1.5354 1.1391 -0.0395 0.3132  0.0988  348 ILE A CD1   
2379 N N     . ASN A 302 ? 1.4528 1.5714 1.1676 -0.1208 0.3857  0.1280  349 ASN A N     
2380 C CA    . ASN A 302 ? 1.4730 1.5445 1.1744 -0.1475 0.3794  0.1437  349 ASN A CA    
2381 C C     . ASN A 302 ? 1.5438 1.5437 1.1931 -0.1330 0.3460  0.1487  349 ASN A C     
2382 O O     . ASN A 302 ? 1.5101 1.5050 1.1543 -0.1093 0.3234  0.1363  349 ASN A O     
2383 C CB    . ASN A 302 ? 1.4577 1.5639 1.2292 -0.1706 0.3719  0.1383  349 ASN A CB    
2384 C CG    . ASN A 302 ? 1.7721 1.8317 1.5372 -0.1992 0.3698  0.1529  349 ASN A CG    
2385 O OD1   . ASN A 302 ? 1.7058 1.7147 1.4537 -0.1947 0.3414  0.1574  349 ASN A OD1   
2386 N ND2   . ASN A 302 ? 1.6613 1.7386 1.4435 -0.2295 0.4010  0.1599  349 ASN A ND2   
2387 N N     . ASP A 303 ? 1.5557 1.5015 1.1666 -0.1471 0.3442  0.1673  350 ASP A N     
2388 C CA    . ASP A 303 ? 1.5798 1.4633 1.1411 -0.1347 0.3136  0.1745  350 ASP A CA    
2389 C C     . ASP A 303 ? 1.5770 1.4587 1.1802 -0.1325 0.2785  0.1655  350 ASP A C     
2390 O O     . ASP A 303 ? 1.5859 1.4386 1.1648 -0.1156 0.2491  0.1615  350 ASP A O     
2391 C CB    . ASP A 303 ? 1.6737 1.5052 1.1846 -0.1481 0.3246  0.1998  350 ASP A CB    
2392 C CG    . ASP A 303 ? 1.9272 1.7640 1.4001 -0.1533 0.3641  0.2102  350 ASP A CG    
2393 O OD1   . ASP A 303 ? 1.9165 1.7958 1.4310 -0.1734 0.3953  0.2094  350 ASP A OD1   
2394 O OD2   . ASP A 303 ? 2.1046 1.9068 1.5067 -0.1376 0.3640  0.2180  350 ASP A OD2   
2395 N N     . GLY A 304 ? 1.4631 1.3811 1.1302 -0.1499 0.2828  0.1602  351 GLY A N     
2396 C CA    . GLY A 304 ? 1.3891 1.3133 1.1004 -0.1488 0.2543  0.1505  351 GLY A CA    
2397 C C     . GLY A 304 ? 1.3505 1.3212 1.0977 -0.1307 0.2450  0.1307  351 GLY A C     
2398 O O     . GLY A 304 ? 1.2848 1.2698 1.0730 -0.1297 0.2251  0.1220  351 GLY A O     
2399 N N     . ALA A 305 ? 1.3187 1.3114 1.0486 -0.1147 0.2610  0.1242  352 ALA A N     
2400 C CA    . ALA A 305 ? 1.2790 1.3104 1.0346 -0.0925 0.2570  0.1075  352 ALA A CA    
2401 C C     . ALA A 305 ? 1.3312 1.3209 1.0400 -0.0678 0.2385  0.1014  352 ALA A C     
2402 O O     . ALA A 305 ? 1.2926 1.2993 1.0152 -0.0475 0.2336  0.0884  352 ALA A O     
2403 C CB    . ALA A 305 ? 1.2992 1.3870 1.0724 -0.0898 0.2898  0.1031  352 ALA A CB    
2404 N N     . SER A 306 ? 1.3307 1.2649 0.9839 -0.0702 0.2279  0.1108  353 SER A N     
2405 C CA    . SER A 306 ? 1.3560 1.2488 0.9632 -0.0530 0.2071  0.1039  353 SER A CA    
2406 C C     . SER A 306 ? 1.3736 1.2425 0.9960 -0.0561 0.1721  0.1039  353 SER A C     
2407 O O     . SER A 306 ? 1.3770 1.2297 1.0020 -0.0703 0.1635  0.1171  353 SER A O     
2408 C CB    . SER A 306 ? 1.4801 1.3353 1.0163 -0.0521 0.2151  0.1126  353 SER A CB    
2409 O OG    . SER A 306 ? 1.6495 1.4698 1.1415 -0.0371 0.1948  0.1017  353 SER A OG    
2410 N N     . TRP A 307 ? 1.2908 1.1577 0.9248 -0.0423 0.1545  0.0896  354 TRP A N     
2411 C CA    . TRP A 307 ? 1.2494 1.1008 0.9034 -0.0444 0.1236  0.0877  354 TRP A CA    
2412 C C     . TRP A 307 ? 1.3119 1.1283 0.9277 -0.0339 0.1037  0.0771  354 TRP A C     
2413 O O     . TRP A 307 ? 1.3364 1.1514 0.9407 -0.0204 0.1113  0.0634  354 TRP A O     
2414 C CB    . TRP A 307 ? 1.1717 1.0598 0.8872 -0.0413 0.1218  0.0802  354 TRP A CB    
2415 C CG    . TRP A 307 ? 1.1520 1.0795 0.9122 -0.0549 0.1362  0.0867  354 TRP A CG    
2416 C CD1   . TRP A 307 ? 1.1819 1.1544 0.9653 -0.0544 0.1617  0.0843  354 TRP A CD1   
2417 C CD2   . TRP A 307 ? 1.1205 1.0474 0.9089 -0.0719 0.1260  0.0948  354 TRP A CD2   
2418 N NE1   . TRP A 307 ? 1.1486 1.1491 0.9722 -0.0738 0.1675  0.0893  354 TRP A NE1   
2419 C CE2   . TRP A 307 ? 1.1493 1.1191 0.9756 -0.0843 0.1463  0.0953  354 TRP A CE2   
2420 C CE3   . TRP A 307 ? 1.1194 1.0154 0.9060 -0.0771 0.1019  0.1005  354 TRP A CE3   
2421 C CZ2   . TRP A 307 ? 1.1127 1.0887 0.9714 -0.1035 0.1438  0.0998  354 TRP A CZ2   
2422 C CZ3   . TRP A 307 ? 1.1091 1.0106 0.9273 -0.0925 0.1004  0.1068  354 TRP A CZ3   
2423 C CH2   . TRP A 307 ? 1.1046 1.0421 0.9562 -0.1065 0.1215  0.1058  354 TRP A CH2   
2424 N N     . THR A 308 ? 1.2413 1.0304 0.8395 -0.0398 0.0782  0.0822  355 THR A N     
2425 C CA    . THR A 308 ? 1.2446 1.0067 0.8127 -0.0339 0.0567  0.0695  355 THR A CA    
2426 C C     . THR A 308 ? 1.2577 1.0296 0.8737 -0.0322 0.0425  0.0595  355 THR A C     
2427 O O     . THR A 308 ? 1.2284 1.0171 0.8889 -0.0385 0.0344  0.0670  355 THR A O     
2428 C CB    . THR A 308 ? 1.2651 1.0025 0.7937 -0.0388 0.0357  0.0784  355 THR A CB    
2429 O OG1   . THR A 308 ? 1.3031 1.0307 0.7841 -0.0384 0.0534  0.0889  355 THR A OG1   
2430 C CG2   . THR A 308 ? 1.2271 0.9433 0.7273 -0.0362 0.0112  0.0625  355 THR A CG2   
2431 N N     . ILE A 309 ? 1.1952 0.9543 0.8003 -0.0235 0.0426  0.0427  356 ILE A N     
2432 C CA    . ILE A 309 ? 1.1392 0.9020 0.7833 -0.0212 0.0328  0.0343  356 ILE A CA    
2433 C C     . ILE A 309 ? 1.1836 0.9203 0.8119 -0.0284 0.0058  0.0250  356 ILE A C     
2434 O O     . ILE A 309 ? 1.2138 0.9251 0.7935 -0.0292 0.0007  0.0153  356 ILE A O     
2435 C CB    . ILE A 309 ? 1.1783 0.9450 0.8284 -0.0054 0.0549  0.0239  356 ILE A CB    
2436 C CG1   . ILE A 309 ? 1.1423 0.9206 0.8410 -0.0017 0.0491  0.0221  356 ILE A CG1   
2437 C CG2   . ILE A 309 ? 1.2357 0.9644 0.8315 0.0019  0.0602  0.0075  356 ILE A CG2   
2438 C CD1   . ILE A 309 ? 1.2590 1.0580 0.9802 0.0157  0.0704  0.0207  356 ILE A CD1   
2439 N N     . ILE A 310 ? 1.1125 0.8586 0.7821 -0.0343 -0.0113 0.0269  357 ILE A N     
2440 C CA    . ILE A 310 ? 1.1259 0.8562 0.7906 -0.0432 -0.0370 0.0177  357 ILE A CA    
2441 C C     . ILE A 310 ? 1.1795 0.9185 0.8933 -0.0449 -0.0423 0.0146  357 ILE A C     
2442 O O     . ILE A 310 ? 1.1477 0.9118 0.9033 -0.0426 -0.0379 0.0256  357 ILE A O     
2443 C CB    . ILE A 310 ? 1.1644 0.8979 0.8147 -0.0509 -0.0595 0.0278  357 ILE A CB    
2444 C CG1   . ILE A 310 ? 1.1801 0.9064 0.8263 -0.0603 -0.0879 0.0161  357 ILE A CG1   
2445 C CG2   . ILE A 310 ? 1.1115 0.8681 0.7996 -0.0514 -0.0592 0.0469  357 ILE A CG2   
2446 C CD1   . ILE A 310 ? 1.2815 1.0117 0.9028 -0.0630 -0.1100 0.0242  357 ILE A CD1   
2447 N N     . SER A 311 ? 1.1613 0.8781 0.8677 -0.0498 -0.0499 -0.0011 358 SER A N     
2448 C CA    . SER A 311 ? 1.1215 0.8416 0.8692 -0.0528 -0.0536 -0.0037 358 SER A CA    
2449 C C     . SER A 311 ? 1.1326 0.8742 0.9116 -0.0637 -0.0774 0.0033  358 SER A C     
2450 O O     . SER A 311 ? 1.1386 0.8802 0.8981 -0.0718 -0.0969 0.0016  358 SER A O     
2451 C CB    . SER A 311 ? 1.1774 0.8618 0.9052 -0.0573 -0.0513 -0.0228 358 SER A CB    
2452 O OG    . SER A 311 ? 1.3013 0.9740 1.0322 -0.0417 -0.0258 -0.0232 358 SER A OG    
2453 N N     . THR A 312 ? 1.0505 0.8134 0.8767 -0.0614 -0.0753 0.0121  359 THR A N     
2454 C CA    . THR A 312 ? 1.0206 0.8058 0.8823 -0.0687 -0.0944 0.0191  359 THR A CA    
2455 C C     . THR A 312 ? 1.0683 0.8530 0.9618 -0.0749 -0.0969 0.0125  359 THR A C     
2456 O O     . THR A 312 ? 1.0693 0.8377 0.9628 -0.0699 -0.0798 0.0075  359 THR A O     
2457 C CB    . THR A 312 ? 1.0504 0.8616 0.9411 -0.0618 -0.0888 0.0349  359 THR A CB    
2458 O OG1   . THR A 312 ? 1.1024 0.9245 1.0242 -0.0552 -0.0739 0.0362  359 THR A OG1   
2459 C CG2   . THR A 312 ? 0.9663 0.7769 0.8304 -0.0572 -0.0798 0.0429  359 THR A CG2   
2460 N N     . ASP A 313 ? 1.0004 0.8042 0.9220 -0.0839 -0.1163 0.0145  360 ASP A N     
2461 C CA    . ASP A 313 ? 0.9864 0.7968 0.9440 -0.0916 -0.1188 0.0109  360 ASP A CA    
2462 C C     . ASP A 313 ? 0.9992 0.8439 0.9971 -0.0909 -0.1315 0.0221  360 ASP A C     
2463 O O     . ASP A 313 ? 0.9923 0.8498 0.9855 -0.0859 -0.1412 0.0308  360 ASP A O     
2464 C CB    . ASP A 313 ? 1.0562 0.8498 1.0010 -0.1091 -0.1299 -0.0063 360 ASP A CB    
2465 C CG    . ASP A 313 ? 1.1785 0.9592 1.1464 -0.1179 -0.1196 -0.0129 360 ASP A CG    
2466 O OD1   . ASP A 313 ? 1.1266 0.9158 1.1225 -0.1080 -0.1055 -0.0019 360 ASP A OD1   
2467 O OD2   . ASP A 313 ? 1.2590 1.0194 1.2146 -0.1352 -0.1245 -0.0293 360 ASP A OD2   
2468 N N     . LYS A 314 ? 0.9205 0.7773 0.9558 -0.0950 -0.1297 0.0222  361 LYS A N     
2469 C CA    . LYS A 314 ? 0.8798 0.7687 0.9549 -0.0929 -0.1388 0.0313  361 LYS A CA    
2470 C C     . LYS A 314 ? 0.9562 0.8583 1.0604 -0.1069 -0.1484 0.0245  361 LYS A C     
2471 O O     . LYS A 314 ? 0.9877 0.8717 1.0927 -0.1154 -0.1370 0.0169  361 LYS A O     
2472 C CB    . LYS A 314 ? 0.8721 0.7689 0.9667 -0.0803 -0.1209 0.0407  361 LYS A CB    
2473 C CG    . LYS A 314 ? 0.9903 0.9139 1.1283 -0.0790 -0.1224 0.0463  361 LYS A CG    
2474 C CD    . LYS A 314 ? 0.9830 0.9187 1.1329 -0.0661 -0.1105 0.0547  361 LYS A CD    
2475 C CE    . LYS A 314 ? 0.9980 0.9364 1.1626 -0.0611 -0.0936 0.0557  361 LYS A CE    
2476 N NZ    . LYS A 314 ? 1.1325 1.0942 1.3187 -0.0514 -0.0881 0.0616  361 LYS A NZ    
2477 N N     . ALA A 315 ? 0.8824 0.8158 1.0107 -0.1090 -0.1679 0.0275  362 ALA A N     
2478 C CA    . ALA A 315 ? 0.8662 0.8241 1.0315 -0.1224 -0.1767 0.0219  362 ALA A CA    
2479 C C     . ALA A 315 ? 0.8713 0.8574 1.0775 -0.1110 -0.1722 0.0339  362 ALA A C     
2480 O O     . ALA A 315 ? 0.8628 0.8579 1.0686 -0.0960 -0.1761 0.0441  362 ALA A O     
2481 C CB    . ALA A 315 ? 0.8976 0.8777 1.0610 -0.1316 -0.2034 0.0148  362 ALA A CB    
2482 N N     . GLU A 316 ? 0.7902 0.7852 1.0278 -0.1178 -0.1612 0.0328  363 GLU A N     
2483 C CA    . GLU A 316 ? 0.7502 0.7701 1.0237 -0.1073 -0.1537 0.0425  363 GLU A CA    
2484 C C     . GLU A 316 ? 0.8170 0.8683 1.1326 -0.1203 -0.1579 0.0389  363 GLU A C     
2485 O O     . GLU A 316 ? 0.8526 0.8933 1.1713 -0.1390 -0.1518 0.0303  363 GLU A O     
2486 C CB    . GLU A 316 ? 0.7622 0.7610 1.0272 -0.0991 -0.1297 0.0470  363 GLU A CB    
2487 C CG    . GLU A 316 ? 0.9490 0.9681 1.2381 -0.0847 -0.1205 0.0562  363 GLU A CG    
2488 C CD    . GLU A 316 ? 1.2066 1.2101 1.4830 -0.0751 -0.0996 0.0601  363 GLU A CD    
2489 O OE1   . GLU A 316 ? 1.2350 1.2112 1.4809 -0.0748 -0.0924 0.0578  363 GLU A OE1   
2490 O OE2   . GLU A 316 ? 1.1014 1.1223 1.3978 -0.0663 -0.0903 0.0653  363 GLU A OE2   
2491 N N     . TYR A 317 ? 0.7265 0.8159 1.0745 -0.1107 -0.1677 0.0450  364 TYR A N     
2492 C CA    . TYR A 317 ? 0.6943 0.8251 1.0880 -0.1198 -0.1732 0.0428  364 TYR A CA    
2493 C C     . TYR A 317 ? 0.7538 0.9076 1.1771 -0.1027 -0.1638 0.0527  364 TYR A C     
2494 O O     . TYR A 317 ? 0.7934 0.9507 1.2121 -0.0833 -0.1695 0.0598  364 TYR A O     
2495 C CB    . TYR A 317 ? 0.7049 0.8669 1.1063 -0.1234 -0.2008 0.0382  364 TYR A CB    
2496 C CG    . TYR A 317 ? 0.7281 0.8672 1.0942 -0.1402 -0.2118 0.0261  364 TYR A CG    
2497 C CD1   . TYR A 317 ? 0.7488 0.8769 1.1172 -0.1666 -0.2059 0.0125  364 TYR A CD1   
2498 C CD2   . TYR A 317 ? 0.7461 0.8708 1.0736 -0.1299 -0.2264 0.0279  364 TYR A CD2   
2499 C CE1   . TYR A 317 ? 0.7665 0.8701 1.0996 -0.1822 -0.2150 -0.0012 364 TYR A CE1   
2500 C CE2   . TYR A 317 ? 0.7764 0.8800 1.0678 -0.1444 -0.2358 0.0156  364 TYR A CE2   
2501 C CZ    . TYR A 317 ? 0.8099 0.9022 1.1036 -0.1703 -0.2301 0.0000  364 TYR A CZ    
2502 O OH    . TYR A 317 ? 0.8433 0.9103 1.0981 -0.1849 -0.2379 -0.0148 364 TYR A OH    
2503 N N     . THR A 318 ? 0.6793 0.8451 1.1302 -0.1097 -0.1476 0.0531  365 THR A N     
2504 C CA    . THR A 318 ? 0.6421 0.8283 1.1184 -0.0939 -0.1352 0.0611  365 THR A CA    
2505 C C     . THR A 318 ? 0.7052 0.9367 1.2302 -0.1037 -0.1351 0.0595  365 THR A C     
2506 O O     . THR A 318 ? 0.7506 0.9820 1.2866 -0.1264 -0.1274 0.0542  365 THR A O     
2507 C CB    . THR A 318 ? 0.6133 0.7683 1.0687 -0.0895 -0.1115 0.0650  365 THR A CB    
2508 O OG1   . THR A 318 ? 0.6013 0.7218 1.0152 -0.0821 -0.1137 0.0650  365 THR A OG1   
2509 C CG2   . THR A 318 ? 0.5370 0.7107 1.0118 -0.0734 -0.0977 0.0714  365 THR A CG2   
2510 N N     . PHE A 319 ? 0.5991 0.8680 1.1532 -0.0866 -0.1417 0.0641  366 PHE A N     
2511 C CA    . PHE A 319 ? 0.5801 0.9029 1.1861 -0.0911 -0.1425 0.0634  366 PHE A CA    
2512 C C     . PHE A 319 ? 0.6225 0.9684 1.2515 -0.0660 -0.1322 0.0708  366 PHE A C     
2513 O O     . PHE A 319 ? 0.5926 0.9140 1.1973 -0.0450 -0.1300 0.0751  366 PHE A O     
2514 C CB    . PHE A 319 ? 0.6135 0.9725 1.2368 -0.0974 -0.1705 0.0579  366 PHE A CB    
2515 C CG    . PHE A 319 ? 0.6374 0.9951 1.2428 -0.0726 -0.1901 0.0635  366 PHE A CG    
2516 C CD1   . PHE A 319 ? 0.6962 1.0100 1.2522 -0.0714 -0.1993 0.0633  366 PHE A CD1   
2517 C CD2   . PHE A 319 ? 0.6494 1.0473 1.2858 -0.0491 -0.1974 0.0701  366 PHE A CD2   
2518 C CE1   . PHE A 319 ? 0.7198 1.0270 1.2560 -0.0488 -0.2143 0.0707  366 PHE A CE1   
2519 C CE2   . PHE A 319 ? 0.7062 1.0946 1.3219 -0.0244 -0.2129 0.0776  366 PHE A CE2   
2520 C CZ    . PHE A 319 ? 0.7051 1.0461 1.2698 -0.0251 -0.2204 0.0785  366 PHE A CZ    
2521 N N     . TYR A 320 ? 0.5867 0.9797 1.2629 -0.0697 -0.1243 0.0711  367 TYR A N     
2522 C CA    . TYR A 320 ? 0.5738 0.9919 1.2743 -0.0465 -0.1119 0.0765  367 TYR A CA    
2523 C C     . TYR A 320 ? 0.6054 1.0904 1.3644 -0.0508 -0.1143 0.0754  367 TYR A C     
2524 O O     . TYR A 320 ? 0.5827 1.0872 1.3647 -0.0779 -0.1085 0.0713  367 TYR A O     
2525 C CB    . TYR A 320 ? 0.5813 0.9717 1.2643 -0.0449 -0.0835 0.0796  367 TYR A CB    
2526 C CG    . TYR A 320 ? 0.6061 1.0207 1.3101 -0.0227 -0.0682 0.0829  367 TYR A CG    
2527 C CD1   . TYR A 320 ? 0.6232 1.0169 1.3051 0.0027  -0.0681 0.0833  367 TYR A CD1   
2528 C CD2   . TYR A 320 ? 0.6275 1.0853 1.3733 -0.0282 -0.0524 0.0844  367 TYR A CD2   
2529 C CE1   . TYR A 320 ? 0.6057 1.0183 1.3040 0.0235  -0.0534 0.0839  367 TYR A CE1   
2530 C CE2   . TYR A 320 ? 0.6396 1.1191 1.4019 -0.0064 -0.0365 0.0866  367 TYR A CE2   
2531 C CZ    . TYR A 320 ? 0.6975 1.1529 1.4344 0.0200  -0.0373 0.0856  367 TYR A CZ    
2532 O OH    . TYR A 320 ? 0.7203 1.1949 1.4717 0.0420  -0.0214 0.0853  367 TYR A OH    
2533 N N     . GLU A 321 ? 0.5833 1.1034 1.3672 -0.0242 -0.1218 0.0790  368 GLU A N     
2534 C CA    . GLU A 321 ? 0.5753 1.1687 1.4197 -0.0233 -0.1246 0.0785  368 GLU A CA    
2535 C C     . GLU A 321 ? 0.6374 1.2472 1.5059 -0.0218 -0.0932 0.0809  368 GLU A C     
2536 O O     . GLU A 321 ? 0.6324 1.2571 1.5131 0.0067  -0.0836 0.0847  368 GLU A O     
2537 C CB    . GLU A 321 ? 0.5889 1.2134 1.4491 0.0096  -0.1440 0.0831  368 GLU A CB    
2538 C CG    . GLU A 321 ? 0.7163 1.3191 1.5445 0.0157  -0.1729 0.0842  368 GLU A CG    
2539 C CD    . GLU A 321 ? 0.9936 1.6157 1.8285 0.0531  -0.1893 0.0924  368 GLU A CD    
2540 O OE1   . GLU A 321 ? 0.6810 1.3156 1.5346 0.0806  -0.1757 0.0972  368 GLU A OE1   
2541 O OE2   . GLU A 321 ? 0.9340 1.5534 1.7502 0.0565  -0.2149 0.0946  368 GLU A OE2   
2542 N N     . GLY A 322 ? 0.5850 1.1864 1.4551 -0.0517 -0.0763 0.0789  369 GLY A N     
2543 C CA    . GLY A 322 ? 0.5669 1.1775 1.4523 -0.0552 -0.0444 0.0828  369 GLY A CA    
2544 C C     . GLY A 322 ? 0.6030 1.2855 1.5480 -0.0458 -0.0360 0.0841  369 GLY A C     
2545 O O     . GLY A 322 ? 0.5830 1.2718 1.5335 -0.0319 -0.0109 0.0884  369 GLY A O     
2546 N N     . MET A 323 ? 0.5773 1.3181 1.5671 -0.0526 -0.0574 0.0797  370 MET A N     
2547 C CA    . MET A 323 ? 0.5627 1.3850 1.6177 -0.0442 -0.0529 0.0802  370 MET A CA    
2548 C C     . MET A 323 ? 0.6132 1.4691 1.6832 -0.0084 -0.0782 0.0816  370 MET A C     
2549 O O     . MET A 323 ? 0.6255 1.5583 1.7524 -0.0006 -0.0855 0.0811  370 MET A O     
2550 C CB    . MET A 323 ? 0.5971 1.4690 1.6992 -0.0859 -0.0519 0.0738  370 MET A CB    
2551 C CG    . MET A 323 ? 0.6484 1.5734 1.8010 -0.0926 -0.0218 0.0768  370 MET A CG    
2552 S SD    . MET A 323 ? 0.7136 1.5731 1.8225 -0.0953 0.0204  0.0857  370 MET A SD    
2553 C CE    . MET A 323 ? 0.6695 1.5940 1.8267 -0.0701 0.0471  0.0912  370 MET A CE    
2554 N N     . GLY A 324 ? 0.5660 1.3633 1.5844 0.0147  -0.0890 0.0844  371 GLY A N     
2555 C CA    . GLY A 324 ? 0.5684 1.3765 1.5864 0.0509  -0.1102 0.0884  371 GLY A CA    
2556 C C     . GLY A 324 ? 0.6212 1.4369 1.6322 0.0412  -0.1449 0.0864  371 GLY A C     
2557 O O     . GLY A 324 ? 0.5939 1.4074 1.6021 0.0042  -0.1515 0.0793  371 GLY A O     
2558 N N     . PRO A 325 ? 0.6058 1.4282 1.6109 0.0751  -0.1666 0.0926  372 PRO A N     
2559 C CA    . PRO A 325 ? 0.6152 1.4510 1.6117 0.0692  -0.2011 0.0919  372 PRO A CA    
2560 C C     . PRO A 325 ? 0.6520 1.5671 1.7022 0.0385  -0.2146 0.0827  372 PRO A C     
2561 O O     . PRO A 325 ? 0.6106 1.5939 1.7202 0.0366  -0.2032 0.0809  372 PRO A O     
2562 C CB    . PRO A 325 ? 0.6512 1.4976 1.6466 0.1168  -0.2157 0.1032  372 PRO A CB    
2563 C CG    . PRO A 325 ? 0.7020 1.5042 1.6809 0.1434  -0.1883 0.1079