data_4J6V
# 
_entry.id   4J6V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4J6V         
RCSB  RCSB077670   
WWPDB D_1000077670 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3NM8 . unspecified 
PDB 4J6T . unspecified 
PDB 4J6U . unspecified 
# 
_pdbx_database_status.entry_id                        4J6V 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-12 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kanteev, M.'   1 
'Goldfeder, M.' 2 
'Adir, N.'      3 
'Fishman, A.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The mechanism of copper uptake by tyrosinase from Bacillus megaterium.'       J.Biol.Inorg.Chem. 18  895 903 2013 JJBCFA 
GW 0949-8257 2154 ? 24061559 10.1007/s00775-013-1034-0 
1       'First structures of an active bacterial tyrosinase reveal copper plasticity.' J.Mol.Biol.        405 227 237 2011 JMOBAK 
UK 0022-2836 0070 ? 21040728 10.1016/j.jmb.2010.10.048 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kanteev, M.'     1  
primary 'Goldfeder, M.'   2  
primary 'Chojnacki, M.'   3  
primary 'Adir, N.'        4  
primary 'Fishman, A.'     5  
1       'Sendovski, M.'   6  
1       'Kanteev, M.'     7  
1       'Ben-Yosef, V.S.' 8  
1       'Adir, N.'        9  
1       'Fishman, A.'     10 
# 
_cell.length_a           54.900 
_cell.length_b           78.330 
_cell.length_c           82.160 
_cell.angle_alpha        90.000 
_cell.angle_beta         105.500 
_cell.angle_gamma        90.000 
_cell.entry_id           4J6V 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4J6V 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Tyrosinase        35255.461 2   1.14.18.1 N205D ? ? 
2 non-polymer syn 'COPPER (II) ION' 63.546    2   ?         ?     ? ? 
3 water       nat water             18.015    335 ?         ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDL
QSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAP
TLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHDRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSSHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDL
QSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAP
TLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHDRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSSHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ASN n 
1 4   LYS n 
1 5   TYR n 
1 6   ARG n 
1 7   VAL n 
1 8   ARG n 
1 9   LYS n 
1 10  ASN n 
1 11  VAL n 
1 12  LEU n 
1 13  HIS n 
1 14  LEU n 
1 15  THR n 
1 16  ASP n 
1 17  THR n 
1 18  GLU n 
1 19  LYS n 
1 20  ARG n 
1 21  ASP n 
1 22  PHE n 
1 23  VAL n 
1 24  ARG n 
1 25  THR n 
1 26  VAL n 
1 27  LEU n 
1 28  ILE n 
1 29  LEU n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  GLY n 
1 34  ILE n 
1 35  TYR n 
1 36  ASP n 
1 37  ARG n 
1 38  TYR n 
1 39  ILE n 
1 40  ALA n 
1 41  TRP n 
1 42  HIS n 
1 43  GLY n 
1 44  ALA n 
1 45  ALA n 
1 46  GLY n 
1 47  LYS n 
1 48  PHE n 
1 49  HIS n 
1 50  THR n 
1 51  PRO n 
1 52  PRO n 
1 53  GLY n 
1 54  SER n 
1 55  ASP n 
1 56  ARG n 
1 57  ASN n 
1 58  ALA n 
1 59  ALA n 
1 60  HIS n 
1 61  MET n 
1 62  SER n 
1 63  SER n 
1 64  ALA n 
1 65  PHE n 
1 66  LEU n 
1 67  PRO n 
1 68  TRP n 
1 69  HIS n 
1 70  ARG n 
1 71  GLU n 
1 72  TYR n 
1 73  LEU n 
1 74  LEU n 
1 75  ARG n 
1 76  PHE n 
1 77  GLU n 
1 78  ARG n 
1 79  ASP n 
1 80  LEU n 
1 81  GLN n 
1 82  SER n 
1 83  ILE n 
1 84  ASN n 
1 85  PRO n 
1 86  GLU n 
1 87  VAL n 
1 88  THR n 
1 89  LEU n 
1 90  PRO n 
1 91  TYR n 
1 92  TRP n 
1 93  GLU n 
1 94  TRP n 
1 95  GLU n 
1 96  THR n 
1 97  ASP n 
1 98  ALA n 
1 99  GLN n 
1 100 MET n 
1 101 GLN n 
1 102 ASP n 
1 103 PRO n 
1 104 SER n 
1 105 GLN n 
1 106 SER n 
1 107 GLN n 
1 108 ILE n 
1 109 TRP n 
1 110 SER n 
1 111 ALA n 
1 112 ASP n 
1 113 PHE n 
1 114 MET n 
1 115 GLY n 
1 116 GLY n 
1 117 ASN n 
1 118 GLY n 
1 119 ASN n 
1 120 PRO n 
1 121 ILE n 
1 122 LYS n 
1 123 ASP n 
1 124 PHE n 
1 125 ILE n 
1 126 VAL n 
1 127 ASP n 
1 128 THR n 
1 129 GLY n 
1 130 PRO n 
1 131 PHE n 
1 132 ALA n 
1 133 ALA n 
1 134 GLY n 
1 135 ARG n 
1 136 TRP n 
1 137 THR n 
1 138 THR n 
1 139 ILE n 
1 140 ASP n 
1 141 GLU n 
1 142 GLN n 
1 143 GLY n 
1 144 ASN n 
1 145 PRO n 
1 146 SER n 
1 147 GLY n 
1 148 GLY n 
1 149 LEU n 
1 150 LYS n 
1 151 ARG n 
1 152 ASN n 
1 153 PHE n 
1 154 GLY n 
1 155 ALA n 
1 156 THR n 
1 157 LYS n 
1 158 GLU n 
1 159 ALA n 
1 160 PRO n 
1 161 THR n 
1 162 LEU n 
1 163 PRO n 
1 164 THR n 
1 165 ARG n 
1 166 ASP n 
1 167 ASP n 
1 168 VAL n 
1 169 LEU n 
1 170 ASN n 
1 171 ALA n 
1 172 LEU n 
1 173 LYS n 
1 174 ILE n 
1 175 THR n 
1 176 GLN n 
1 177 TYR n 
1 178 ASP n 
1 179 THR n 
1 180 PRO n 
1 181 PRO n 
1 182 TRP n 
1 183 ASP n 
1 184 MET n 
1 185 THR n 
1 186 SER n 
1 187 GLN n 
1 188 ASN n 
1 189 SER n 
1 190 PHE n 
1 191 ARG n 
1 192 ASN n 
1 193 GLN n 
1 194 LEU n 
1 195 GLU n 
1 196 GLY n 
1 197 PHE n 
1 198 ILE n 
1 199 ASN n 
1 200 GLY n 
1 201 PRO n 
1 202 GLN n 
1 203 LEU n 
1 204 HIS n 
1 205 ASP n 
1 206 ARG n 
1 207 VAL n 
1 208 HIS n 
1 209 ARG n 
1 210 TRP n 
1 211 VAL n 
1 212 GLY n 
1 213 GLY n 
1 214 GLN n 
1 215 MET n 
1 216 GLY n 
1 217 VAL n 
1 218 VAL n 
1 219 PRO n 
1 220 THR n 
1 221 ALA n 
1 222 PRO n 
1 223 ASN n 
1 224 ASP n 
1 225 PRO n 
1 226 VAL n 
1 227 PHE n 
1 228 PHE n 
1 229 LEU n 
1 230 HIS n 
1 231 HIS n 
1 232 ALA n 
1 233 ASN n 
1 234 VAL n 
1 235 ASP n 
1 236 ARG n 
1 237 ILE n 
1 238 TRP n 
1 239 ALA n 
1 240 VAL n 
1 241 TRP n 
1 242 GLN n 
1 243 ILE n 
1 244 ILE n 
1 245 HIS n 
1 246 ARG n 
1 247 ASN n 
1 248 GLN n 
1 249 ASN n 
1 250 TYR n 
1 251 GLN n 
1 252 PRO n 
1 253 MET n 
1 254 LYS n 
1 255 ASN n 
1 256 GLY n 
1 257 PRO n 
1 258 PHE n 
1 259 GLY n 
1 260 GLN n 
1 261 ASN n 
1 262 PHE n 
1 263 ARG n 
1 264 ASP n 
1 265 PRO n 
1 266 MET n 
1 267 TYR n 
1 268 PRO n 
1 269 TRP n 
1 270 ASN n 
1 271 THR n 
1 272 THR n 
1 273 PRO n 
1 274 GLU n 
1 275 ASP n 
1 276 VAL n 
1 277 MET n 
1 278 ASN n 
1 279 HIS n 
1 280 ARG n 
1 281 LYS n 
1 282 LEU n 
1 283 GLY n 
1 284 TYR n 
1 285 VAL n 
1 286 TYR n 
1 287 ASP n 
1 288 ILE n 
1 289 GLU n 
1 290 LEU n 
1 291 ARG n 
1 292 LYS n 
1 293 SER n 
1 294 LYS n 
1 295 ARG n 
1 296 SER n 
1 297 SER n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
1 302 HIS n 
1 303 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus megaterium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1404 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET9d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B2ZB02_BACME 
_struct_ref.pdbx_db_accession          B2ZB02 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDL
QSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAP
TLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4J6V A 1 ? 297 ? B2ZB02 1 ? 297 ? 1 297 
2 1 4J6V B 1 ? 297 ? B2ZB02 1 ? 297 ? 1 297 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4J6V GLY A 2   ? UNP B2ZB02 SER 2   'ENGINEERED MUTATION' 2   1  
1 4J6V ASP A 205 ? UNP B2ZB02 ASN 205 'ENGINEERED MUTATION' 205 2  
1 4J6V HIS A 298 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      298 3  
1 4J6V HIS A 299 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      299 4  
1 4J6V HIS A 300 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      300 5  
1 4J6V HIS A 301 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      301 6  
1 4J6V HIS A 302 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      302 7  
1 4J6V HIS A 303 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      303 8  
2 4J6V GLY B 2   ? UNP B2ZB02 SER 2   'ENGINEERED MUTATION' 2   9  
2 4J6V ASP B 205 ? UNP B2ZB02 ASN 205 'ENGINEERED MUTATION' 205 10 
2 4J6V HIS B 298 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      298 11 
2 4J6V HIS B 299 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      299 12 
2 4J6V HIS B 300 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      300 13 
2 4J6V HIS B 301 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      301 14 
2 4J6V HIS B 302 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      302 15 
2 4J6V HIS B 303 ? UNP B2ZB02 ?   ?   'EXPRESSION TAG'      303 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'           63.546  
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4J6V 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    '0.1 M sodium cacodylate, pH 6.5, 18% PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2011-07-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_wavelength_list        0.9763 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
# 
_reflns.entry_id                     4J6V 
_reflns.d_resolution_high            1.900 
_reflns.d_resolution_low             79.172 
_reflns.number_all                   51526 
_reflns.number_obs                   51526 
_reflns.pdbx_netI_over_sigmaI        11.7 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              3.5 
_reflns.percent_possible_obs         97.6 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.900 2.000  ? 26596 ? 0.251 1.60  0.251 ? 3.5 ? 7531 98.1 1  1 
2.000 2.120  ? 25927 ? 0.128 2.40  0.128 ? 3.6 ? 7144 98.4 2  1 
2.120 2.270  ? 23635 ? 0.123 3.80  0.123 ? 3.5 ? 6742 98.6 3  1 
2.270 2.450  ? 22553 ? 0.076 8.10  0.076 ? 3.6 ? 6298 98.9 4  1 
2.450 2.690  ? 21001 ? 0.060 7.60  0.060 ? 3.6 ? 5801 99.2 5  1 
2.690 3.000  ? 18840 ? 0.052 11.80 0.052 ? 3.6 ? 5272 99.3 6  1 
3.000 3.470  ? 16437 ? 0.053 11.20 0.053 ? 3.5 ? 4663 99.3 7  1 
3.470 4.250  ? 12799 ? 0.054 11.20 0.054 ? 3.3 ? 3938 98.7 8  1 
4.250 6.010  ? 8589  ? 0.054 10.60 0.054 ? 3.0 ? 2905 94.3 9  1 
6.010 43.841 ? 3775  ? 0.063 9.00  0.063 ? 3.1 ? 1232 71.1 10 1 
# 
_refine.entry_id                                 4J6V 
_refine.ls_d_res_high                            1.900 
_refine.ls_d_res_low                             39.392 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.33 
_refine.ls_number_reflns_obs                     51493 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1940 
_refine.ls_R_factor_R_work                       0.1931 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2101 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_number_reflns_R_free                  2618 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               25.0159 
_refine.solvent_model_param_bsol                 47.7800 
_refine.solvent_model_param_ksol                 0.3920 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            5.9169 
_refine.aniso_B[2][2]                            -4.2670 
_refine.aniso_B[3][3]                            -1.6500 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -5.7336 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1900 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.8600 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8608 
_refine.B_iso_max                                114.380 
_refine.B_iso_min                                6.560 
_refine.pdbx_overall_phase_error                 21.2800 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.360 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4700 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             335 
_refine_hist.number_atoms_total               5037 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        39.392 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           4860 0.019  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          6624 1.396  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     660  0.109  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      878  0.012  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1774 16.328 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.9000 1.9346  19 98.0 2535 . 0.2753 0.3373 . 142 . 2677 . . 'X-RAY DIFFRACTION' 
1.9346 1.9718  19 98.0 2584 . 0.2310 0.2439 . 133 . 2717 . . 'X-RAY DIFFRACTION' 
1.9718 2.0120  19 98.0 2583 . 0.2164 0.2164 . 133 . 2716 . . 'X-RAY DIFFRACTION' 
2.0120 2.0558  19 98.0 2569 . 0.2064 0.2478 . 161 . 2730 . . 'X-RAY DIFFRACTION' 
2.0558 2.1036  19 98.0 2613 . 0.2099 0.2181 . 129 . 2742 . . 'X-RAY DIFFRACTION' 
2.1036 2.1562  19 98.0 2569 . 0.2092 0.2554 . 137 . 2706 . . 'X-RAY DIFFRACTION' 
2.1562 2.2145  19 99.0 2596 . 0.2117 0.2280 . 138 . 2734 . . 'X-RAY DIFFRACTION' 
2.2145 2.2796  19 99.0 2633 . 0.2235 0.2675 . 113 . 2746 . . 'X-RAY DIFFRACTION' 
2.2796 2.3532  19 99.0 2551 . 0.2087 0.2539 . 147 . 2698 . . 'X-RAY DIFFRACTION' 
2.3532 2.4373  19 99.0 2592 . 0.1938 0.1867 . 154 . 2746 . . 'X-RAY DIFFRACTION' 
2.4373 2.5349  19 99.0 2632 . 0.1932 0.2162 . 124 . 2756 . . 'X-RAY DIFFRACTION' 
2.5349 2.6502  19 99.0 2618 . 0.1907 0.2266 . 155 . 2773 . . 'X-RAY DIFFRACTION' 
2.6502 2.7899  19 99.0 2620 . 0.1931 0.2043 . 125 . 2745 . . 'X-RAY DIFFRACTION' 
2.7899 2.9646  19 99.0 2628 . 0.1977 0.2198 . 137 . 2765 . . 'X-RAY DIFFRACTION' 
2.9646 3.1934  19 99.0 2625 . 0.1891 0.1958 . 145 . 2770 . . 'X-RAY DIFFRACTION' 
3.1934 3.5146  19 99.0 2610 . 0.1831 0.1837 . 141 . 2751 . . 'X-RAY DIFFRACTION' 
3.5146 4.0228  19 99.0 2629 . 0.1685 0.1808 . 133 . 2762 . . 'X-RAY DIFFRACTION' 
4.0228 5.0666  19 95.0 2549 . 0.1587 0.1762 . 136 . 2685 . . 'X-RAY DIFFRACTION' 
5.0666 39.4004 19 79.0 2139 . 0.1951 0.1986 . 135 . 2274 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4J6V 
_struct.title                     'Crystal Structure of Tyrosinase from Bacillus megaterium N205D mutant' 
_struct.pdbx_descriptor           'Tyrosinase (E.C.1.14.18.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4J6V 
_struct_keywords.text            'type 3 copper proteins, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 10  ? LEU A 14  ? ASN A 10  LEU A 14  5 ? 5  
HELX_P HELX_P2  2  THR A 15  ? LYS A 32  ? THR A 15  LYS A 32  1 ? 18 
HELX_P HELX_P3  3  ILE A 34  ? LYS A 47  ? ILE A 34  LYS A 47  1 ? 14 
HELX_P HELX_P4  4  ALA A 64  ? ASN A 84  ? ALA A 64  ASN A 84  1 ? 21 
HELX_P HELX_P5  5  GLU A 93  ? ALA A 98  ? GLU A 93  ALA A 98  1 ? 6  
HELX_P HELX_P6  6  ASP A 102 ? SER A 110 ? ASP A 102 SER A 110 5 ? 9  
HELX_P HELX_P7  7  ASN A 119 ? ASP A 123 ? ASN A 119 ASP A 123 5 ? 5  
HELX_P HELX_P8  8  THR A 164 ? LYS A 173 ? THR A 164 LYS A 173 1 ? 10 
HELX_P HELX_P9  9  SER A 189 ? GLY A 196 ? SER A 189 GLY A 196 1 ? 8  
HELX_P HELX_P10 10 LEU A 203 ? GLY A 212 ? LEU A 203 GLY A 212 1 ? 10 
HELX_P HELX_P11 11 GLY A 213 ? ASP A 224 ? GLY A 213 ASP A 224 5 ? 12 
HELX_P HELX_P12 12 PRO A 225 ? HIS A 245 ? PRO A 225 HIS A 245 1 ? 21 
HELX_P HELX_P13 13 PRO A 273 ? MET A 277 ? PRO A 273 MET A 277 5 ? 5  
HELX_P HELX_P14 14 HIS A 279 ? LEU A 282 ? HIS A 279 LEU A 282 5 ? 4  
HELX_P HELX_P15 15 ASN B 10  ? LEU B 14  ? ASN B 10  LEU B 14  5 ? 5  
HELX_P HELX_P16 16 THR B 15  ? LYS B 32  ? THR B 15  LYS B 32  1 ? 18 
HELX_P HELX_P17 17 GLY B 33  ? LYS B 47  ? GLY B 33  LYS B 47  1 ? 15 
HELX_P HELX_P18 18 ALA B 64  ? ASN B 84  ? ALA B 64  ASN B 84  1 ? 21 
HELX_P HELX_P19 19 GLU B 93  ? ALA B 98  ? GLU B 93  ALA B 98  1 ? 6  
HELX_P HELX_P20 20 ASP B 102 ? SER B 110 ? ASP B 102 SER B 110 5 ? 9  
HELX_P HELX_P21 21 ASN B 119 ? ASP B 123 ? ASN B 119 ASP B 123 5 ? 5  
HELX_P HELX_P22 22 THR B 164 ? LYS B 173 ? THR B 164 LYS B 173 1 ? 10 
HELX_P HELX_P23 23 SER B 189 ? GLY B 196 ? SER B 189 GLY B 196 1 ? 8  
HELX_P HELX_P24 24 LEU B 203 ? GLY B 212 ? LEU B 203 GLY B 212 1 ? 10 
HELX_P HELX_P25 25 GLY B 213 ? ASP B 224 ? GLY B 213 ASP B 224 5 ? 12 
HELX_P HELX_P26 26 PRO B 225 ? HIS B 245 ? PRO B 225 HIS B 245 1 ? 21 
HELX_P HELX_P27 27 PRO B 273 ? MET B 277 ? PRO B 273 MET B 277 5 ? 5  
HELX_P HELX_P28 28 HIS B 279 ? LEU B 282 ? HIS B 279 LEU B 282 5 ? 4  
HELX_P HELX_P29 29 ILE B 288 ? LEU B 290 ? ILE B 288 LEU B 290 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 42 NE2 ? ? ? 1_555 C CU  . CU ? ? A HIS 42  A CU  401 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc2 metalc ? ? B HIS 42 NE2 ? ? ? 1_555 D CU  . CU ? ? B HIS 42  B CU  401 1_555 ? ? ? ? ? ? ? 1.912 ? 
metalc3 metalc ? ? C CU  .  CU  ? ? ? 1_555 E HOH . O  ? ? A CU  401 A HOH 509 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc4 metalc ? ? B HIS 60 NE2 ? ? ? 1_555 D CU  . CU ? ? B HIS 60  B CU  401 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc5 metalc ? ? D CU  .  CU  ? ? ? 1_555 F HOH . O  ? ? B CU  401 B HOH 635 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc6 metalc ? ? A HIS 60 NE2 ? ? ? 1_555 C CU  . CU ? ? A HIS 60  A CU  401 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc7 metalc ? ? A HIS 69 NE2 ? ? ? 1_555 C CU  . CU ? ? A HIS 69  A CU  401 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc8 metalc ? ? B HIS 69 NE2 ? ? ? 1_555 D CU  . CU ? ? B HIS 69  B CU  401 1_555 ? ? ? ? ? ? ? 2.613 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  THR 50  A . ? THR 50  A PRO 51  A ? PRO 51  A 1 -1.70 
2  PRO 180 A . ? PRO 180 A PRO 181 A ? PRO 181 A 1 7.69  
3  GLY 200 A . ? GLY 200 A PRO 201 A ? PRO 201 A 1 0.56  
4  GLN 251 A . ? GLN 251 A PRO 252 A ? PRO 252 A 1 5.65  
5  TYR 267 A . ? TYR 267 A PRO 268 A ? PRO 268 A 1 9.82  
6  THR 50  B . ? THR 50  B PRO 51  B ? PRO 51  B 1 -3.11 
7  PRO 180 B . ? PRO 180 B PRO 181 B ? PRO 181 B 1 3.49  
8  GLY 200 B . ? GLY 200 B PRO 201 B ? PRO 201 B 1 2.94  
9  GLN 251 B . ? GLN 251 B PRO 252 B ? PRO 252 B 1 4.73  
10 TYR 267 B . ? TYR 267 B PRO 268 B ? PRO 268 B 1 13.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 6   ? ARG A 8   ? ARG A 6   ARG A 8   
A 2 TYR A 284 ? TYR A 286 ? TYR A 284 TYR A 286 
B 1 ARG B 6   ? ARG B 8   ? ARG B 6   ARG B 8   
B 2 TYR B 284 ? TYR B 286 ? TYR B 284 TYR B 286 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 8 ? N ARG A 8 O VAL A 285 ? O VAL A 285 
B 1 2 N ARG B 6 ? N ARG B 6 O VAL B 285 ? O VAL B 285 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU A 401' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU B 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 42 ? HIS A 42  . ? 1_555 ? 
2 AC1 4 HIS A 60 ? HIS A 60  . ? 1_555 ? 
3 AC1 4 HIS A 69 ? HIS A 69  . ? 1_555 ? 
4 AC1 4 HOH E .  ? HOH A 509 . ? 1_555 ? 
5 AC2 4 HIS B 42 ? HIS B 42  . ? 1_555 ? 
6 AC2 4 HIS B 60 ? HIS B 60  . ? 1_555 ? 
7 AC2 4 HIS B 69 ? HIS B 69  . ? 1_555 ? 
8 AC2 4 HOH F .  ? HOH B 635 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4J6V 
_atom_sites.fract_transf_matrix[1][1]   0.018215 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005051 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012767 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012631 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CU 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 4   ? -1.409  13.405  38.802 1.00 61.49  ? 4   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 4   ? -0.150  13.657  39.478 1.00 61.21  ? 4   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 4   ? 0.885   13.536  38.429 1.00 64.03  ? 4   LYS A C   1 
ATOM   4    O  O   . LYS A 1 4   ? 0.726   12.920  37.430 1.00 71.49  ? 4   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 4   ? 0.005   12.826  40.713 1.00 70.42  ? 4   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 4   ? -1.181  13.006  41.614 1.00 72.88  ? 4   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 4   ? -2.427  13.383  40.857 1.00 70.91  ? 4   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 4   ? -3.600  12.708  41.496 1.00 81.18  ? 4   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 4   ? -3.593  12.849  42.975 1.00 76.62  ? 4   LYS A NZ  1 
ATOM   10   N  N   . TYR A 1 5   ? 1.990   14.146  38.715 1.00 95.09  ? 5   TYR A N   1 
ATOM   11   C  CA  . TYR A 1 5   ? 2.587   15.040  37.832 1.00 93.39  ? 5   TYR A CA  1 
ATOM   12   C  C   . TYR A 1 5   ? 4.024   14.706  37.703 1.00 89.38  ? 5   TYR A C   1 
ATOM   13   O  O   . TYR A 1 5   ? 4.723   15.308  36.972 1.00 88.79  ? 5   TYR A O   1 
ATOM   14   C  CB  . TYR A 1 5   ? 2.419   16.563  38.057 1.00 93.86  ? 5   TYR A CB  1 
ATOM   15   C  CG  . TYR A 1 5   ? 2.464   17.141  39.446 1.00 98.88  ? 5   TYR A CG  1 
ATOM   16   C  CD1 . TYR A 1 5   ? 1.727   18.299  39.725 1.00 99.96  ? 5   TYR A CD1 1 
ATOM   17   C  CD2 . TYR A 1 5   ? 3.300   16.620  40.432 1.00 96.39  ? 5   TYR A CD2 1 
ATOM   18   C  CE1 . TYR A 1 5   ? 1.758   18.896  40.985 1.00 101.93 ? 5   TYR A CE1 1 
ATOM   19   C  CE2 . TYR A 1 5   ? 3.348   17.188  41.710 1.00 95.28  ? 5   TYR A CE2 1 
ATOM   20   C  CZ  . TYR A 1 5   ? 2.579   18.341  41.996 1.00 101.98 ? 5   TYR A CZ  1 
ATOM   21   O  OH  . TYR A 1 5   ? 2.615   18.948  43.254 1.00 99.30  ? 5   TYR A OH  1 
ATOM   22   N  N   . ARG A 1 6   ? 4.474   13.649  38.328 1.00 33.03  ? 6   ARG A N   1 
ATOM   23   C  CA  . ARG A 1 6   ? 5.655   12.983  37.694 1.00 31.26  ? 6   ARG A CA  1 
ATOM   24   C  C   . ARG A 1 6   ? 4.929   12.044  36.709 1.00 29.69  ? 6   ARG A C   1 
ATOM   25   O  O   . ARG A 1 6   ? 4.000   11.429  37.092 1.00 24.66  ? 6   ARG A O   1 
ATOM   26   C  CB  . ARG A 1 6   ? 6.539   12.246  38.705 1.00 33.57  ? 6   ARG A CB  1 
ATOM   27   C  CG  . ARG A 1 6   ? 7.383   13.048  39.661 1.00 37.29  ? 6   ARG A CG  1 
ATOM   28   C  CD  . ARG A 1 6   ? 8.535   12.224  40.200 1.00 37.20  ? 6   ARG A CD  1 
ATOM   29   N  NE  . ARG A 1 6   ? 8.151   11.143  41.091 1.00 34.73  ? 6   ARG A NE  1 
ATOM   30   C  CZ  . ARG A 1 6   ? 7.588   11.333  42.266 1.00 34.15  ? 6   ARG A CZ  1 
ATOM   31   N  NH1 . ARG A 1 6   ? 7.346   12.538  42.678 1.00 35.30  ? 6   ARG A NH1 1 
ATOM   32   N  NH2 . ARG A 1 6   ? 7.275   10.321  43.022 1.00 31.15  ? 6   ARG A NH2 1 
ATOM   33   N  N   . VAL A 1 7   ? 5.386   11.923  35.469 1.00 22.05  ? 7   VAL A N   1 
ATOM   34   C  CA  . VAL A 1 7   ? 4.691   11.087  34.487 1.00 23.08  ? 7   VAL A CA  1 
ATOM   35   C  C   . VAL A 1 7   ? 5.682   10.019  34.049 1.00 20.41  ? 7   VAL A C   1 
ATOM   36   O  O   . VAL A 1 7   ? 6.739   10.333  33.505 1.00 19.26  ? 7   VAL A O   1 
ATOM   37   C  CB  . VAL A 1 7   ? 4.145   11.781  33.203 1.00 24.06  ? 7   VAL A CB  1 
ATOM   38   C  CG1 . VAL A 1 7   ? 3.627   10.734  32.235 1.00 21.94  ? 7   VAL A CG1 1 
ATOM   39   C  CG2 . VAL A 1 7   ? 3.047   12.768  33.554 1.00 28.96  ? 7   VAL A CG2 1 
ATOM   40   N  N   . ARG A 1 8   ? 5.356   8.755   34.295 1.00 16.97  ? 8   ARG A N   1 
ATOM   41   C  CA  . ARG A 1 8   ? 6.211   7.671   33.819 1.00 16.55  ? 8   ARG A CA  1 
ATOM   42   C  C   . ARG A 1 8   ? 5.730   7.222   32.450 1.00 17.56  ? 8   ARG A C   1 
ATOM   43   O  O   . ARG A 1 8   ? 4.591   6.795   32.307 1.00 18.22  ? 8   ARG A O   1 
ATOM   44   C  CB  . ARG A 1 8   ? 6.197   6.490   34.799 1.00 14.58  ? 8   ARG A CB  1 
ATOM   45   C  CG  . ARG A 1 8   ? 6.692   6.855   36.176 1.00 15.86  ? 8   ARG A CG  1 
ATOM   46   C  CD  . ARG A 1 8   ? 6.832   5.611   37.064 1.00 14.63  ? 8   ARG A CD  1 
ATOM   47   N  NE  . ARG A 1 8   ? 7.434   5.972   38.338 1.00 15.64  ? 8   ARG A NE  1 
ATOM   48   C  CZ  . ARG A 1 8   ? 7.565   5.142   39.366 1.00 13.61  ? 8   ARG A CZ  1 
ATOM   49   N  NH1 . ARG A 1 8   ? 7.127   3.888   39.283 1.00 13.42  ? 8   ARG A NH1 1 
ATOM   50   N  NH2 . ARG A 1 8   ? 8.123   5.576   40.474 1.00 15.26  ? 8   ARG A NH2 1 
ATOM   51   N  N   . LYS A 1 9   ? 6.606   7.307   31.453 1.00 17.38  ? 9   LYS A N   1 
ATOM   52   C  CA  . LYS A 1 9   ? 6.219   7.055   30.062 1.00 19.63  ? 9   LYS A CA  1 
ATOM   53   C  C   . LYS A 1 9   ? 6.638   5.689   29.533 1.00 19.17  ? 9   LYS A C   1 
ATOM   54   O  O   . LYS A 1 9   ? 7.629   5.117   29.977 1.00 18.95  ? 9   LYS A O   1 
ATOM   55   C  CB  . LYS A 1 9   ? 6.822   8.128   29.142 1.00 21.73  ? 9   LYS A CB  1 
ATOM   56   C  CG  . LYS A 1 9   ? 6.367   9.554   29.412 1.00 22.47  ? 9   LYS A CG  1 
ATOM   57   C  CD  . LYS A 1 9   ? 6.885   10.485  28.318 1.00 24.16  ? 9   LYS A CD  1 
ATOM   58   C  CE  . LYS A 1 9   ? 6.656   11.950  28.664 1.00 28.98  ? 9   LYS A CE  1 
ATOM   59   N  NZ  . LYS A 1 9   ? 7.185   12.826  27.578 1.00 30.08  ? 9   LYS A NZ  1 
ATOM   60   N  N   . ASN A 1 10  ? 5.878   5.177   28.568 1.00 19.60  ? 10  ASN A N   1 
ATOM   61   C  CA  . ASN A 1 10  ? 6.273   3.998   27.812 1.00 16.56  ? 10  ASN A CA  1 
ATOM   62   C  C   . ASN A 1 10  ? 7.629   4.281   27.199 1.00 17.77  ? 10  ASN A C   1 
ATOM   63   O  O   . ASN A 1 10  ? 7.832   5.365   26.653 1.00 21.13  ? 10  ASN A O   1 
ATOM   64   C  CB  . ASN A 1 10  ? 5.246   3.748   26.701 1.00 19.64  ? 10  ASN A CB  1 
ATOM   65   C  CG  . ASN A 1 10  ? 5.463   2.433   25.960 1.00 19.07  ? 10  ASN A CG  1 
ATOM   66   O  OD1 . ASN A 1 10  ? 6.592   2.035   25.645 1.00 19.25  ? 10  ASN A OD1 1 
ATOM   67   N  ND2 . ASN A 1 10  ? 4.365   1.755   25.665 1.00 21.87  ? 10  ASN A ND2 1 
ATOM   68   N  N   . VAL A 1 11  ? 8.554   3.330   27.286 1.00 13.45  ? 11  VAL A N   1 
ATOM   69   C  CA  . VAL A 1 11  ? 9.884   3.529   26.706 1.00 16.14  ? 11  VAL A CA  1 
ATOM   70   C  C   . VAL A 1 11  ? 9.790   3.939   25.227 1.00 21.17  ? 11  VAL A C   1 
ATOM   71   O  O   . VAL A 1 11  ? 10.540  4.793   24.750 1.00 19.58  ? 11  VAL A O   1 
ATOM   72   C  CB  . VAL A 1 11  ? 10.757  2.271   26.843 1.00 20.65  ? 11  VAL A CB  1 
ATOM   73   C  CG1 . VAL A 1 11  ? 11.945  2.332   25.899 1.00 21.03  ? 11  VAL A CG1 1 
ATOM   74   C  CG2 . VAL A 1 11  ? 11.225  2.111   28.286 1.00 18.08  ? 11  VAL A CG2 1 
ATOM   75   N  N   . LEU A 1 12  ? 8.836   3.353   24.518 1.00 23.08  ? 12  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 12  ? 8.685   3.607   23.091 1.00 23.71  ? 12  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 12  ? 8.168   5.011   22.757 1.00 23.83  ? 12  LEU A C   1 
ATOM   78   O  O   . LEU A 1 12  ? 8.182   5.414   21.595 1.00 29.81  ? 12  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 12  ? 7.789   2.540   22.452 1.00 23.27  ? 12  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 12  ? 8.326   1.108   22.535 1.00 28.31  ? 12  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 12  ? 7.465   0.156   21.715 1.00 32.59  ? 12  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 12  ? 9.795   1.019   22.107 1.00 28.34  ? 12  LEU A CD2 1 
ATOM   83   N  N   . HIS A 1 13  ? 7.709   5.752   23.761 1.00 26.64  ? 13  HIS A N   1 
ATOM   84   C  CA  . HIS A 1 13  ? 7.197   7.099   23.537 1.00 27.99  ? 13  HIS A CA  1 
ATOM   85   C  C   . HIS A 1 13  ? 8.205   8.153   23.993 1.00 30.24  ? 13  HIS A C   1 
ATOM   86   O  O   . HIS A 1 13  ? 7.914   9.346   23.972 1.00 28.96  ? 13  HIS A O   1 
ATOM   87   C  CB  . HIS A 1 13  ? 5.862   7.306   24.263 1.00 28.07  ? 13  HIS A CB  1 
ATOM   88   C  CG  . HIS A 1 13  ? 4.800   6.322   23.872 1.00 30.39  ? 13  HIS A CG  1 
ATOM   89   N  ND1 . HIS A 1 13  ? 3.583   6.247   24.516 1.00 36.57  ? 13  HIS A ND1 1 
ATOM   90   C  CD2 . HIS A 1 13  ? 4.780   5.367   22.913 1.00 34.10  ? 13  HIS A CD2 1 
ATOM   91   C  CE1 . HIS A 1 13  ? 2.854   5.290   23.964 1.00 38.68  ? 13  HIS A CE1 1 
ATOM   92   N  NE2 . HIS A 1 13  ? 3.557   4.741   22.988 1.00 35.12  ? 13  HIS A NE2 1 
ATOM   93   N  N   . LEU A 1 14  ? 9.383   7.707   24.416 1.00 21.03  ? 14  LEU A N   1 
ATOM   94   C  CA  . LEU A 1 14  ? 10.427  8.626   24.857 1.00 24.03  ? 14  LEU A CA  1 
ATOM   95   C  C   . LEU A 1 14  ? 11.120  9.253   23.653 1.00 24.04  ? 14  LEU A C   1 
ATOM   96   O  O   . LEU A 1 14  ? 11.386  8.571   22.665 1.00 24.77  ? 14  LEU A O   1 
ATOM   97   C  CB  . LEU A 1 14  ? 11.476  7.889   25.686 1.00 21.78  ? 14  LEU A CB  1 
ATOM   98   C  CG  . LEU A 1 14  ? 11.092  7.306   27.043 1.00 21.00  ? 14  LEU A CG  1 
ATOM   99   C  CD1 . LEU A 1 14  ? 12.224  6.431   27.569 1.00 20.12  ? 14  LEU A CD1 1 
ATOM   100  C  CD2 . LEU A 1 14  ? 10.768  8.412   28.035 1.00 22.83  ? 14  LEU A CD2 1 
ATOM   101  N  N   . THR A 1 15  ? 11.429  10.543  23.745 1.00 25.80  ? 15  THR A N   1 
ATOM   102  C  CA  . THR A 1 15  ? 12.238  11.195  22.720 1.00 25.23  ? 15  THR A CA  1 
ATOM   103  C  C   . THR A 1 15  ? 13.690  10.742  22.850 1.00 27.85  ? 15  THR A C   1 
ATOM   104  O  O   . THR A 1 15  ? 14.082  10.181  23.887 1.00 25.42  ? 15  THR A O   1 
ATOM   105  C  CB  . THR A 1 15  ? 12.148  12.725  22.824 1.00 26.57  ? 15  THR A CB  1 
ATOM   106  O  OG1 . THR A 1 15  ? 12.731  13.169  24.059 1.00 25.78  ? 15  THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 15  ? 10.684  13.168  22.758 1.00 30.08  ? 15  THR A CG2 1 
ATOM   108  N  N   . ASP A 1 16  ? 14.490  10.985  21.830 1.00 25.09  ? 16  ASP A N   1 
ATOM   109  C  CA  . ASP A 1 16  ? 15.887  10.651  21.911 1.00 27.42  ? 16  ASP A CA  1 
ATOM   110  C  C   . ASP A 1 16  ? 16.527  11.370  23.086 1.00 24.74  ? 16  ASP A C   1 
ATOM   111  O  O   . ASP A 1 16  ? 17.326  10.853  23.763 1.00 24.12  ? 16  ASP A O   1 
ATOM   112  C  CB  . ASP A 1 16  ? 16.624  11.040  20.653 1.00 28.96  ? 16  ASP A CB  1 
ATOM   113  C  CG  . ASP A 1 16  ? 16.272  10.181  19.511 1.00 43.57  ? 16  ASP A CG  1 
ATOM   114  O  OD1 . ASP A 1 16  ? 15.679  9.116   19.756 1.00 41.21  ? 16  ASP A OD1 1 
ATOM   115  O  OD2 . ASP A 1 16  ? 16.597  10.547  18.367 1.00 48.35  ? 16  ASP A OD2 1 
ATOM   116  N  N   . THR A 1 17  ? 16.152  12.610  23.261 1.00 19.93  ? 17  THR A N   1 
ATOM   117  C  CA  . THR A 1 17  ? 16.723  13.397  24.350 1.00 21.20  ? 17  THR A CA  1 
ATOM   118  C  C   . THR A 1 17  ? 16.380  12.801  25.716 1.00 21.44  ? 17  THR A C   1 
ATOM   119  O  O   . THR A 1 17  ? 17.236  12.728  26.595 1.00 20.13  ? 17  THR A O   1 
ATOM   120  C  CB  . THR A 1 17  ? 16.276  14.865  24.276 1.00 25.17  ? 17  THR A CB  1 
ATOM   121  O  OG1 . THR A 1 17  ? 16.869  15.474  23.120 1.00 25.74  ? 17  THR A OG1 1 
ATOM   122  C  CG2 . THR A 1 17  ? 16.702  15.622  25.524 1.00 25.55  ? 17  THR A CG2 1 
ATOM   123  N  N   . GLU A 1 18  ? 15.127  12.389  25.894 1.00 21.25  ? 18  GLU A N   1 
ATOM   124  C  CA  . GLU A 1 18  ? 14.706  11.739  27.139 1.00 22.86  ? 18  GLU A CA  1 
ATOM   125  C  C   . GLU A 1 18  ? 15.487  10.441  27.369 1.00 21.23  ? 18  GLU A C   1 
ATOM   126  O  O   . GLU A 1 18  ? 15.882  10.132  28.489 1.00 19.14  ? 18  GLU A O   1 
ATOM   127  C  CB  . GLU A 1 18  ? 13.202  11.449  27.133 1.00 20.40  ? 18  GLU A CB  1 
ATOM   128  C  CG  . GLU A 1 18  ? 12.323  12.664  27.390 1.00 26.11  ? 18  GLU A CG  1 
ATOM   129  C  CD  . GLU A 1 18  ? 10.833  12.340  27.289 1.00 28.62  ? 18  GLU A CD  1 
ATOM   130  O  OE1 . GLU A 1 18  ? 10.408  11.788  26.248 1.00 24.82  ? 18  GLU A OE1 1 
ATOM   131  O  OE2 . GLU A 1 18  ? 10.087  12.637  28.250 1.00 30.34  ? 18  GLU A OE2 1 
ATOM   132  N  N   . LYS A 1 19  ? 15.726  9.699   26.337 1.00 22.92  ? 19  LYS A N   1 
ATOM   133  C  CA  . LYS A 1 19  ? 16.509  8.502   26.469 1.00 23.57  ? 19  LYS A CA  1 
ATOM   134  C  C   . LYS A 1 19  ? 17.934  8.763   26.893 1.00 25.72  ? 19  LYS A C   1 
ATOM   135  O  O   . LYS A 1 19  ? 18.444  8.117   27.772 1.00 19.83  ? 19  LYS A O   1 
ATOM   136  C  CB  . LYS A 1 19  ? 16.450  7.726   25.201 1.00 23.28  ? 19  LYS A CB  1 
ATOM   137  C  CG  . LYS A 1 19  ? 15.181  6.937   25.090 1.00 25.37  ? 19  LYS A CG  1 
ATOM   138  C  CD  . LYS A 1 19  ? 14.752  6.793   23.677 1.00 30.99  ? 19  LYS A CD  1 
ATOM   139  C  CE  . LYS A 1 19  ? 14.743  5.393   23.229 1.00 36.42  ? 19  LYS A CE  1 
ATOM   140  N  NZ  . LYS A 1 19  ? 14.021  5.298   21.938 1.00 37.39  ? 19  LYS A NZ  1 
ATOM   141  N  N   . ARG A 1 20  ? 18.555  9.753   26.278 1.00 20.09  ? 20  ARG A N   1 
ATOM   142  C  CA  . ARG A 1 20  ? 19.935  10.082  26.599 1.00 22.46  ? 20  ARG A CA  1 
ATOM   143  C  C   . ARG A 1 20  ? 20.039  10.589  28.021 1.00 20.63  ? 20  ARG A C   1 
ATOM   144  O  O   . ARG A 1 20  ? 20.936  10.287  28.714 1.00 19.76  ? 20  ARG A O   1 
ATOM   145  C  CB  . ARG A 1 20  ? 20.520  11.117  25.623 1.00 26.33  ? 20  ARG A CB  1 
ATOM   146  C  CG  . ARG A 1 20  ? 20.988  10.552  24.285 1.00 34.98  ? 20  ARG A CG  1 
ATOM   147  C  CD  . ARG A 1 20  ? 21.955  11.470  23.499 1.00 37.93  ? 20  ARG A CD  1 
ATOM   148  N  NE  . ARG A 1 20  ? 21.444  12.811  23.507 1.00 35.07  ? 20  ARG A NE  1 
ATOM   149  C  CZ  . ARG A 1 20  ? 20.492  13.239  22.709 1.00 34.01  ? 20  ARG A CZ  1 
ATOM   150  N  NH1 . ARG A 1 20  ? 20.013  12.415  21.828 1.00 31.45  ? 20  ARG A NH1 1 
ATOM   151  N  NH2 . ARG A 1 20  ? 20.024  14.487  22.795 1.00 30.75  ? 20  ARG A NH2 1 
ATOM   152  N  N   . ASP A 1 21  ? 19.070  11.390  28.412 1.00 21.19  ? 21  ASP A N   1 
ATOM   153  C  CA  . ASP A 1 21  ? 19.065  11.946  29.763 1.00 20.67  ? 21  ASP A CA  1 
ATOM   154  C  C   . ASP A 1 21  ? 18.879  10.850  30.816 1.00 20.22  ? 21  ASP A C   1 
ATOM   155  O  O   . ASP A 1 21  ? 19.476  10.913  31.892 1.00 17.80  ? 21  ASP A O   1 
ATOM   156  C  CB  . ASP A 1 21  ? 17.984  13.016  29.924 1.00 20.37  ? 21  ASP A CB  1 
ATOM   157  C  CG  . ASP A 1 21  ? 18.294  14.300  29.141 1.00 32.62  ? 21  ASP A CG  1 
ATOM   158  O  OD1 . ASP A 1 21  ? 19.441  14.463  28.656 1.00 30.65  ? 21  ASP A OD1 1 
ATOM   159  O  OD2 . ASP A 1 21  ? 17.382  15.151  29.015 1.00 30.73  ? 21  ASP A OD2 1 
ATOM   160  N  N   . PHE A 1 22  ? 18.033  9.867   30.522 1.00 20.43  ? 22  PHE A N   1 
ATOM   161  C  CA  . PHE A 1 22  ? 17.820  8.766   31.462 1.00 19.74  ? 22  PHE A CA  1 
ATOM   162  C  C   . PHE A 1 22  ? 19.110  7.976   31.641 1.00 18.48  ? 22  PHE A C   1 
ATOM   163  O  O   . PHE A 1 22  ? 19.579  7.775   32.761 1.00 18.96  ? 22  PHE A O   1 
ATOM   164  C  CB  . PHE A 1 22  ? 16.680  7.845   31.008 1.00 20.03  ? 22  PHE A CB  1 
ATOM   165  C  CG  . PHE A 1 22  ? 16.480  6.652   31.905 1.00 19.38  ? 22  PHE A CG  1 
ATOM   166  C  CD1 . PHE A 1 22  ? 15.752  6.764   33.075 1.00 18.31  ? 22  PHE A CD1 1 
ATOM   167  C  CD2 . PHE A 1 22  ? 17.040  5.426   31.585 1.00 19.11  ? 22  PHE A CD2 1 
ATOM   168  C  CE1 . PHE A 1 22  ? 15.581  5.677   33.902 1.00 19.60  ? 22  PHE A CE1 1 
ATOM   169  C  CE2 . PHE A 1 22  ? 16.878  4.325   32.416 1.00 18.84  ? 22  PHE A CE2 1 
ATOM   170  C  CZ  . PHE A 1 22  ? 16.146  4.454   33.575 1.00 15.94  ? 22  PHE A CZ  1 
ATOM   171  N  N   . VAL A 1 23  ? 19.691  7.550   30.528 1.00 16.07  ? 23  VAL A N   1 
ATOM   172  C  CA  . VAL A 1 23  ? 20.967  6.854   30.553 1.00 17.87  ? 23  VAL A CA  1 
ATOM   173  C  C   . VAL A 1 23  ? 22.059  7.634   31.295 1.00 16.79  ? 23  VAL A C   1 
ATOM   174  O  O   . VAL A 1 23  ? 22.741  7.091   32.171 1.00 16.88  ? 23  VAL A O   1 
ATOM   175  C  CB  . VAL A 1 23  ? 21.429  6.532   29.130 1.00 20.01  ? 23  VAL A CB  1 
ATOM   176  C  CG1 . VAL A 1 23  ? 22.888  6.118   29.127 1.00 22.26  ? 23  VAL A CG1 1 
ATOM   177  C  CG2 . VAL A 1 23  ? 20.548  5.433   28.538 1.00 18.71  ? 23  VAL A CG2 1 
ATOM   178  N  N   . ARG A 1 24  ? 22.232  8.907   30.948 1.00 19.23  ? 24  ARG A N   1 
ATOM   179  C  CA  . ARG A 1 24  ? 23.267  9.722   31.578 1.00 17.92  ? 24  ARG A CA  1 
ATOM   180  C  C   . ARG A 1 24  ? 23.073  9.756   33.090 1.00 17.36  ? 24  ARG A C   1 
ATOM   181  O  O   . ARG A 1 24  ? 24.029  9.705   33.862 1.00 16.32  ? 24  ARG A O   1 
ATOM   182  C  CB  . ARG A 1 24  ? 23.236  11.154  31.030 1.00 23.48  ? 24  ARG A CB  1 
ATOM   183  C  CG  . ARG A 1 24  ? 24.479  11.977  31.374 1.00 28.11  ? 24  ARG A CG  1 
ATOM   184  C  CD  . ARG A 1 24  ? 24.345  13.451  30.931 1.00 35.31  ? 24  ARG A CD  1 
ATOM   185  N  NE  . ARG A 1 24  ? 23.716  13.595  29.621 1.00 35.36  ? 24  ARG A NE  1 
ATOM   186  C  CZ  . ARG A 1 24  ? 22.511  14.124  29.426 1.00 36.04  ? 24  ARG A CZ  1 
ATOM   187  N  NH1 . ARG A 1 24  ? 21.804  14.572  30.458 1.00 35.81  ? 24  ARG A NH1 1 
ATOM   188  N  NH2 . ARG A 1 24  ? 22.012  14.212  28.197 1.00 38.77  ? 24  ARG A NH2 1 
ATOM   189  N  N   . THR A 1 25  ? 21.820  9.851   33.508 1.00 17.53  ? 25  THR A N   1 
ATOM   190  C  CA  . THR A 1 25  ? 21.509  9.955   34.925 1.00 19.18  ? 25  THR A CA  1 
ATOM   191  C  C   . THR A 1 25  ? 21.794  8.645   35.661 1.00 17.82  ? 25  THR A C   1 
ATOM   192  O  O   . THR A 1 25  ? 22.293  8.643   36.791 1.00 19.63  ? 25  THR A O   1 
ATOM   193  C  CB  . THR A 1 25  ? 20.046  10.378  35.120 1.00 18.84  ? 25  THR A CB  1 
ATOM   194  O  OG1 . THR A 1 25  ? 19.840  11.658  34.493 1.00 20.14  ? 25  THR A OG1 1 
ATOM   195  C  CG2 . THR A 1 25  ? 19.737  10.507  36.581 1.00 19.78  ? 25  THR A CG2 1 
ATOM   196  N  N   . VAL A 1 26  ? 21.486  7.525   35.018 1.00 14.26  ? 26  VAL A N   1 
ATOM   197  C  CA  . VAL A 1 26  ? 21.774  6.221   35.625 1.00 15.35  ? 26  VAL A CA  1 
ATOM   198  C  C   . VAL A 1 26  ? 23.278  6.027   35.801 1.00 16.33  ? 26  VAL A C   1 
ATOM   199  O  O   . VAL A 1 26  ? 23.739  5.519   36.825 1.00 15.33  ? 26  VAL A O   1 
ATOM   200  C  CB  . VAL A 1 26  ? 21.190  5.073   34.784 1.00 13.95  ? 26  VAL A CB  1 
ATOM   201  C  CG1 . VAL A 1 26  ? 21.707  3.726   35.268 1.00 16.07  ? 26  VAL A CG1 1 
ATOM   202  C  CG2 . VAL A 1 26  ? 19.653  5.117   34.827 1.00 12.55  ? 26  VAL A CG2 1 
ATOM   203  N  N   . LEU A 1 27  ? 24.045  6.450   34.802 1.00 14.56  ? 27  LEU A N   1 
ATOM   204  C  CA  . LEU A 1 27  ? 25.503  6.361   34.876 1.00 17.21  ? 27  LEU A CA  1 
ATOM   205  C  C   . LEU A 1 27  ? 26.075  7.254   35.986 1.00 15.94  ? 27  LEU A C   1 
ATOM   206  O  O   . LEU A 1 27  ? 27.051  6.894   36.637 1.00 17.02  ? 27  LEU A O   1 
ATOM   207  C  CB  . LEU A 1 27  ? 26.143  6.700   33.517 1.00 17.56  ? 27  LEU A CB  1 
ATOM   208  C  CG  . LEU A 1 27  ? 25.958  5.664   32.407 1.00 19.13  ? 27  LEU A CG  1 
ATOM   209  C  CD1 . LEU A 1 27  ? 26.334  6.259   31.057 1.00 25.28  ? 27  LEU A CD1 1 
ATOM   210  C  CD2 . LEU A 1 27  ? 26.779  4.405   32.681 1.00 19.06  ? 27  LEU A CD2 1 
ATOM   211  N  N   . ILE A 1 28  ? 25.479  8.419   36.202 1.00 18.70  ? 28  ILE A N   1 
ATOM   212  C  CA  . ILE A 1 28  ? 25.920  9.281   37.302 1.00 19.68  ? 28  ILE A CA  1 
ATOM   213  C  C   . ILE A 1 28  ? 25.656  8.607   38.650 1.00 20.38  ? 28  ILE A C   1 
ATOM   214  O  O   . ILE A 1 28  ? 26.519  8.602   39.541 1.00 18.51  ? 28  ILE A O   1 
ATOM   215  C  CB  . ILE A 1 28  ? 25.252  10.663  37.245 1.00 21.27  ? 28  ILE A CB  1 
ATOM   216  C  CG1 . ILE A 1 28  ? 25.757  11.433  36.028 1.00 21.70  ? 28  ILE A CG1 1 
ATOM   217  C  CG2 . ILE A 1 28  ? 25.541  11.475  38.527 1.00 21.83  ? 28  ILE A CG2 1 
ATOM   218  C  CD1 . ILE A 1 28  ? 25.005  12.717  35.770 1.00 20.56  ? 28  ILE A CD1 1 
ATOM   219  N  N   . LEU A 1 29  ? 24.464  8.037   38.795 1.00 18.39  ? 29  LEU A N   1 
ATOM   220  C  CA  . LEU A 1 29  ? 24.091  7.345   40.022 1.00 17.25  ? 29  LEU A CA  1 
ATOM   221  C  C   . LEU A 1 29  ? 25.075  6.222   40.328 1.00 16.80  ? 29  LEU A C   1 
ATOM   222  O  O   . LEU A 1 29  ? 25.448  6.007   41.482 1.00 17.32  ? 29  LEU A O   1 
ATOM   223  C  CB  . LEU A 1 29  ? 22.671  6.786   39.912 1.00 20.17  ? 29  LEU A CB  1 
ATOM   224  C  CG  . LEU A 1 29  ? 21.668  7.269   40.961 1.00 27.69  ? 29  LEU A CG  1 
ATOM   225  C  CD1 . LEU A 1 29  ? 21.823  8.763   41.205 1.00 21.59  ? 29  LEU A CD1 1 
ATOM   226  C  CD2 . LEU A 1 29  ? 20.245  6.936   40.538 1.00 23.44  ? 29  LEU A CD2 1 
ATOM   227  N  N   . LYS A 1 30  ? 25.492  5.508   39.287 1.00 13.75  ? 30  LYS A N   1 
ATOM   228  C  CA  . LYS A 1 30  ? 26.446  4.417   39.440 1.00 17.45  ? 30  LYS A CA  1 
ATOM   229  C  C   . LYS A 1 30  ? 27.815  4.947   39.850 1.00 19.60  ? 30  LYS A C   1 
ATOM   230  O  O   . LYS A 1 30  ? 28.440  4.431   40.777 1.00 18.10  ? 30  LYS A O   1 
ATOM   231  C  CB  . LYS A 1 30  ? 26.558  3.618   38.140 1.00 18.84  ? 30  LYS A CB  1 
ATOM   232  C  CG  . LYS A 1 30  ? 27.587  2.499   38.186 1.00 20.26  ? 30  LYS A CG  1 
ATOM   233  C  CD  . LYS A 1 30  ? 27.022  1.256   38.853 1.00 21.59  ? 30  LYS A CD  1 
ATOM   234  C  CE  . LYS A 1 30  ? 27.664  -0.007  38.303 1.00 25.06  ? 30  LYS A CE  1 
ATOM   235  N  NZ  . LYS A 1 30  ? 27.189  -1.226  39.013 1.00 28.58  ? 30  LYS A NZ  1 
ATOM   236  N  N   . GLU A 1 31  ? 28.275  5.982   39.154 1.00 20.89  ? 31  GLU A N   1 
ATOM   237  C  CA  . GLU A 1 31  ? 29.551  6.590   39.453 1.00 24.57  ? 31  GLU A CA  1 
ATOM   238  C  C   . GLU A 1 31  ? 29.653  7.109   40.873 1.00 25.16  ? 31  GLU A C   1 
ATOM   239  O  O   . GLU A 1 31  ? 30.674  6.998   41.481 1.00 24.72  ? 31  GLU A O   1 
ATOM   240  C  CB  . GLU A 1 31  ? 29.764  7.752   38.523 1.00 29.22  ? 31  GLU A CB  1 
ATOM   241  C  CG  . GLU A 1 31  ? 31.196  8.152   38.394 1.00 38.01  ? 31  GLU A CG  1 
ATOM   242  C  CD  . GLU A 1 31  ? 31.687  8.983   39.546 1.00 47.77  ? 31  GLU A CD  1 
ATOM   243  O  OE1 . GLU A 1 31  ? 30.874  9.604   40.274 1.00 53.15  ? 31  GLU A OE1 1 
ATOM   244  O  OE2 . GLU A 1 31  ? 32.907  9.021   39.720 1.00 53.41  ? 31  GLU A OE2 1 
ATOM   245  N  N   . LYS A 1 32  ? 28.567  7.698   41.343 1.00 20.96  ? 32  LYS A N   1 
ATOM   246  C  CA  . LYS A 1 32  ? 28.475  8.286   42.659 1.00 24.52  ? 32  LYS A CA  1 
ATOM   247  C  C   . LYS A 1 32  ? 28.512  7.203   43.766 1.00 23.95  ? 32  LYS A C   1 
ATOM   248  O  O   . LYS A 1 32  ? 28.888  7.494   44.886 1.00 21.39  ? 32  LYS A O   1 
ATOM   249  C  CB  . LYS A 1 32  ? 27.221  9.142   42.802 1.00 22.91  ? 32  LYS A CB  1 
ATOM   250  C  CG  . LYS A 1 32  ? 27.207  10.444  42.072 1.00 29.96  ? 32  LYS A CG  1 
ATOM   251  C  CD  . LYS A 1 32  ? 26.089  11.323  42.585 1.00 30.90  ? 32  LYS A CD  1 
ATOM   252  C  CE  . LYS A 1 32  ? 26.161  12.724  42.047 1.00 40.52  ? 32  LYS A CE  1 
ATOM   253  N  NZ  . LYS A 1 32  ? 27.330  13.487  42.458 1.00 45.67  ? 32  LYS A NZ  1 
ATOM   254  N  N   . GLY A 1 33  ? 28.105  5.977   43.428 1.00 15.79  ? 33  GLY A N   1 
ATOM   255  C  CA  . GLY A 1 33  ? 28.052  4.877   44.389 1.00 19.03  ? 33  GLY A CA  1 
ATOM   256  C  C   . GLY A 1 33  ? 26.642  4.575   44.887 1.00 17.35  ? 33  GLY A C   1 
ATOM   257  O  O   . GLY A 1 33  ? 26.431  3.647   45.665 1.00 15.71  ? 33  GLY A O   1 
ATOM   258  N  N   . ILE A 1 34  ? 25.677  5.359   44.420 1.00 13.29  ? 34  ILE A N   1 
ATOM   259  C  CA  . ILE A 1 34  ? 24.277  5.224   44.834 1.00 14.79  ? 34  ILE A CA  1 
ATOM   260  C  C   . ILE A 1 34  ? 23.557  4.025   44.213 1.00 14.46  ? 34  ILE A C   1 
ATOM   261  O  O   . ILE A 1 34  ? 22.766  3.362   44.886 1.00 11.27  ? 34  ILE A O   1 
ATOM   262  C  CB  . ILE A 1 34  ? 23.492  6.516   44.507 1.00 14.27  ? 34  ILE A CB  1 
ATOM   263  C  CG1 . ILE A 1 34  ? 24.051  7.665   45.356 1.00 16.05  ? 34  ILE A CG1 1 
ATOM   264  C  CG2 . ILE A 1 34  ? 21.991  6.330   44.741 1.00 13.30  ? 34  ILE A CG2 1 
ATOM   265  C  CD1 . ILE A 1 34  ? 23.494  9.022   45.006 1.00 19.87  ? 34  ILE A CD1 1 
ATOM   266  N  N   . TYR A 1 35  ? 23.827  3.757   42.937 1.00 12.67  ? 35  TYR A N   1 
ATOM   267  C  CA  . TYR A 1 35  ? 23.183  2.638   42.231 1.00 12.44  ? 35  TYR A CA  1 
ATOM   268  C  C   . TYR A 1 35  ? 23.429  1.316   42.977 1.00 14.02  ? 35  TYR A C   1 
ATOM   269  O  O   . TYR A 1 35  ? 22.533  0.494   43.111 1.00 12.17  ? 35  TYR A O   1 
ATOM   270  C  CB  . TYR A 1 35  ? 23.730  2.532   40.804 1.00 10.88  ? 35  TYR A CB  1 
ATOM   271  C  CG  . TYR A 1 35  ? 22.940  1.601   39.897 1.00 12.87  ? 35  TYR A CG  1 
ATOM   272  C  CD1 . TYR A 1 35  ? 21.959  2.092   39.045 1.00 12.93  ? 35  TYR A CD1 1 
ATOM   273  C  CD2 . TYR A 1 35  ? 23.189  0.238   39.890 1.00 12.11  ? 35  TYR A CD2 1 
ATOM   274  C  CE1 . TYR A 1 35  ? 21.247  1.234   38.204 1.00 15.04  ? 35  TYR A CE1 1 
ATOM   275  C  CE2 . TYR A 1 35  ? 22.481  -0.623  39.070 1.00 13.95  ? 35  TYR A CE2 1 
ATOM   276  C  CZ  . TYR A 1 35  ? 21.517  -0.124  38.233 1.00 14.51  ? 35  TYR A CZ  1 
ATOM   277  O  OH  . TYR A 1 35  ? 20.833  -1.002  37.430 1.00 15.44  ? 35  TYR A OH  1 
ATOM   278  N  N   . ASP A 1 36  ? 24.618  1.154   43.480 1.00 12.92  ? 36  ASP A N   1 
ATOM   279  C  CA  . ASP A 1 36  ? 24.967  -0.039  44.191 1.00 18.40  ? 36  ASP A CA  1 
ATOM   280  C  C   . ASP A 1 36  ? 24.102  -0.311  45.438 1.00 15.49  ? 36  ASP A C   1 
ATOM   281  O  O   . ASP A 1 36  ? 23.869  -1.411  45.773 1.00 15.39  ? 36  ASP A O   1 
ATOM   282  C  CB  . ASP A 1 36  ? 26.466  -0.127  44.433 1.00 22.83  ? 36  ASP A CB  1 
ATOM   283  C  CG  . ASP A 1 36  ? 27.243  -0.477  43.163 1.00 33.82  ? 36  ASP A CG  1 
ATOM   284  O  OD1 . ASP A 1 36  ? 26.695  -0.674  42.096 1.00 42.54  ? 36  ASP A OD1 1 
ATOM   285  O  OD2 . ASP A 1 36  ? 28.429  -0.531  43.198 1.00 37.66  ? 36  ASP A OD2 1 
ATOM   286  N  N   . ARG A 1 37  ? 23.601  0.731   46.042 1.00 13.46  ? 37  ARG A N   1 
ATOM   287  C  CA  . ARG A 1 37  ? 22.675  0.604   47.178 1.00 12.73  ? 37  ARG A CA  1 
ATOM   288  C  C   . ARG A 1 37  ? 21.413  -0.139  46.768 1.00 13.16  ? 37  ARG A C   1 
ATOM   289  O  O   . ARG A 1 37  ? 20.882  -0.931  47.535 1.00 11.84  ? 37  ARG A O   1 
ATOM   290  C  CB  . ARG A 1 37  ? 22.304  1.973   47.766 1.00 14.77  ? 37  ARG A CB  1 
ATOM   291  C  CG  . ARG A 1 37  ? 23.464  2.686   48.431 1.00 14.89  ? 37  ARG A CG  1 
ATOM   292  C  CD  . ARG A 1 37  ? 23.188  4.170   48.685 1.00 18.28  ? 37  ARG A CD  1 
ATOM   293  N  NE  . ARG A 1 37  ? 21.914  4.424   49.360 1.00 17.54  ? 37  ARG A NE  1 
ATOM   294  C  CZ  . ARG A 1 37  ? 21.721  4.396   50.678 1.00 20.28  ? 37  ARG A CZ  1 
ATOM   295  N  NH1 . ARG A 1 37  ? 22.718  4.119   51.510 1.00 16.57  ? 37  ARG A NH1 1 
ATOM   296  N  NH2 . ARG A 1 37  ? 20.514  4.662   51.168 1.00 24.68  ? 37  ARG A NH2 1 
ATOM   297  N  N   . TYR A 1 38  ? 20.938  0.119   45.549 1.00 11.20  ? 38  TYR A N   1 
ATOM   298  C  CA  . TYR A 1 38  ? 19.763  -0.593  45.030 1.00 11.26  ? 38  TYR A CA  1 
ATOM   299  C  C   . TYR A 1 38  ? 20.014  -2.074  44.782 1.00 13.29  ? 38  TYR A C   1 
ATOM   300  O  O   . TYR A 1 38  ? 19.173  -2.931  45.103 1.00 14.19  ? 38  TYR A O   1 
ATOM   301  C  CB  . TYR A 1 38  ? 19.199  0.133   43.786 1.00 9.29   ? 38  TYR A CB  1 
ATOM   302  C  CG  . TYR A 1 38  ? 18.606  1.430   44.233 1.00 11.31  ? 38  TYR A CG  1 
ATOM   303  C  CD1 . TYR A 1 38  ? 17.283  1.494   44.650 1.00 12.30  ? 38  TYR A CD1 1 
ATOM   304  C  CD2 . TYR A 1 38  ? 19.397  2.573   44.372 1.00 11.16  ? 38  TYR A CD2 1 
ATOM   305  C  CE1 . TYR A 1 38  ? 16.753  2.664   45.130 1.00 11.89  ? 38  TYR A CE1 1 
ATOM   306  C  CE2 . TYR A 1 38  ? 18.870  3.751   44.846 1.00 14.00  ? 38  TYR A CE2 1 
ATOM   307  C  CZ  . TYR A 1 38  ? 17.548  3.788   45.228 1.00 16.12  ? 38  TYR A CZ  1 
ATOM   308  O  OH  . TYR A 1 38  ? 17.013  4.951   45.712 1.00 15.16  ? 38  TYR A OH  1 
ATOM   309  N  N   . ILE A 1 39  ? 21.165  -2.395  44.208 1.00 10.75  ? 39  ILE A N   1 
ATOM   310  C  CA  . ILE A 1 39  ? 21.512  -3.801  44.033 1.00 12.80  ? 39  ILE A CA  1 
ATOM   311  C  C   . ILE A 1 39  ? 21.572  -4.491  45.386 1.00 13.77  ? 39  ILE A C   1 
ATOM   312  O  O   . ILE A 1 39  ? 21.039  -5.590  45.563 1.00 14.31  ? 39  ILE A O   1 
ATOM   313  C  CB  . ILE A 1 39  ? 22.860  -3.961  43.308 1.00 12.31  ? 39  ILE A CB  1 
ATOM   314  C  CG1 . ILE A 1 39  ? 22.816  -3.214  41.966 1.00 15.72  ? 39  ILE A CG1 1 
ATOM   315  C  CG2 . ILE A 1 39  ? 23.192  -5.450  43.107 1.00 15.95  ? 39  ILE A CG2 1 
ATOM   316  C  CD1 . ILE A 1 39  ? 24.152  -3.197  41.249 1.00 20.31  ? 39  ILE A CD1 1 
ATOM   317  N  N   . ALA A 1 40  ? 22.214  -3.840  46.350 1.00 9.75   ? 40  ALA A N   1 
ATOM   318  C  CA  . ALA A 1 40  ? 22.398  -4.441  47.672 1.00 11.80  ? 40  ALA A CA  1 
ATOM   319  C  C   . ALA A 1 40  ? 21.072  -4.652  48.413 1.00 9.75   ? 40  ALA A C   1 
ATOM   320  O  O   . ALA A 1 40  ? 20.858  -5.696  49.004 1.00 11.38  ? 40  ALA A O   1 
ATOM   321  C  CB  . ALA A 1 40  ? 23.348  -3.580  48.512 1.00 13.27  ? 40  ALA A CB  1 
ATOM   322  N  N   . TRP A 1 41  ? 20.199  -3.651  48.362 1.00 15.82  ? 41  TRP A N   1 
ATOM   323  C  CA  . TRP A 1 41  ? 18.901  -3.740  49.001 1.00 16.63  ? 41  TRP A CA  1 
ATOM   324  C  C   . TRP A 1 41  ? 18.153  -4.945  48.517 1.00 18.38  ? 41  TRP A C   1 
ATOM   325  O  O   . TRP A 1 41  ? 17.661  -5.761  49.325 1.00 17.93  ? 41  TRP A O   1 
ATOM   326  C  CB  . TRP A 1 41  ? 18.089  -2.478  48.737 1.00 15.06  ? 41  TRP A CB  1 
ATOM   327  C  CG  . TRP A 1 41  ? 18.286  -1.402  49.778 1.00 17.00  ? 41  TRP A CG  1 
ATOM   328  C  CD1 . TRP A 1 41  ? 18.772  -1.552  51.074 1.00 17.84  ? 41  TRP A CD1 1 
ATOM   329  C  CD2 . TRP A 1 41  ? 18.006  0.036   49.642 1.00 19.25  ? 41  TRP A CD2 1 
ATOM   330  N  NE1 . TRP A 1 41  ? 18.810  -0.346  51.726 1.00 18.75  ? 41  TRP A NE1 1 
ATOM   331  C  CE2 . TRP A 1 41  ? 18.365  0.646   50.925 1.00 19.80  ? 41  TRP A CE2 1 
ATOM   332  C  CE3 . TRP A 1 41  ? 17.515  0.843   48.628 1.00 20.28  ? 41  TRP A CE3 1 
ATOM   333  C  CZ2 . TRP A 1 41  ? 18.228  2.004   51.154 1.00 23.39  ? 41  TRP A CZ2 1 
ATOM   334  C  CZ3 . TRP A 1 41  ? 17.382  2.212   48.873 1.00 21.69  ? 41  TRP A CZ3 1 
ATOM   335  C  CH2 . TRP A 1 41  ? 17.730  2.775   50.106 1.00 22.57  ? 41  TRP A CH2 1 
ATOM   336  N  N   . HIS A 1 42  ? 18.053  -5.083  47.198 1.00 12.67  ? 42  HIS A N   1 
ATOM   337  C  CA  . HIS A 1 42  ? 17.373  -6.214  46.600 1.00 14.27  ? 42  HIS A CA  1 
ATOM   338  C  C   . HIS A 1 42  ? 17.891  -7.502  47.166 1.00 16.23  ? 42  HIS A C   1 
ATOM   339  O  O   . HIS A 1 42  ? 17.120  -8.316  47.719 1.00 14.77  ? 42  HIS A O   1 
ATOM   340  C  CB  . HIS A 1 42  ? 17.542  -6.200  45.086 1.00 15.00  ? 42  HIS A CB  1 
ATOM   341  C  CG  . HIS A 1 42  ? 16.448  -6.931  44.344 1.00 16.92  ? 42  HIS A CG  1 
ATOM   342  N  ND1 . HIS A 1 42  ? 16.696  -7.980  43.540 1.00 20.89  ? 42  HIS A ND1 1 
ATOM   343  C  CD2 . HIS A 1 42  ? 15.070  -6.726  44.310 1.00 17.12  ? 42  HIS A CD2 1 
ATOM   344  C  CE1 . HIS A 1 42  ? 15.538  -8.426  43.016 1.00 19.68  ? 42  HIS A CE1 1 
ATOM   345  N  NE2 . HIS A 1 42  ? 14.544  -7.657  43.489 1.00 21.58  ? 42  HIS A NE2 1 
ATOM   346  N  N   . GLY A 1 43  ? 19.198  -7.712  47.043 1.00 14.21  ? 43  GLY A N   1 
ATOM   347  C  CA  . GLY A 1 43  ? 19.830  -8.904  47.572 1.00 15.68  ? 43  GLY A CA  1 
ATOM   348  C  C   . GLY A 1 43  ? 19.520  -9.149  49.042 1.00 15.13  ? 43  GLY A C   1 
ATOM   349  O  O   . GLY A 1 43  ? 19.235  -10.281 49.436 1.00 17.52  ? 43  GLY A O   1 
ATOM   350  N  N   . ALA A 1 44  ? 19.579  -8.096  49.849 1.00 13.26  ? 44  ALA A N   1 
ATOM   351  C  CA  . ALA A 1 44  ? 19.338  -8.207  51.286 1.00 14.64  ? 44  ALA A CA  1 
ATOM   352  C  C   . ALA A 1 44  ? 17.922  -8.686  51.580 1.00 14.21  ? 44  ALA A C   1 
ATOM   353  O  O   . ALA A 1 44  ? 17.720  -9.538  52.450 1.00 14.71  ? 44  ALA A O   1 
ATOM   354  C  CB  . ALA A 1 44  ? 19.604  -6.880  51.976 1.00 15.91  ? 44  ALA A CB  1 
ATOM   355  N  N   . ALA A 1 45  ? 16.947  -8.167  50.840 1.00 11.65  ? 45  ALA A N   1 
ATOM   356  C  CA  . ALA A 1 45  ? 15.546  -8.555  51.065 1.00 13.06  ? 45  ALA A CA  1 
ATOM   357  C  C   . ALA A 1 45  ? 15.328  -10.025 50.720 1.00 15.23  ? 45  ALA A C   1 
ATOM   358  O  O   . ALA A 1 45  ? 14.491  -10.704 51.326 1.00 16.95  ? 45  ALA A O   1 
ATOM   359  C  CB  . ALA A 1 45  ? 14.594  -7.662  50.257 1.00 13.75  ? 45  ALA A CB  1 
ATOM   360  N  N   . GLY A 1 46  ? 16.092  -10.522 49.752 1.00 15.62  ? 46  GLY A N   1 
ATOM   361  C  CA  . GLY A 1 46  ? 16.017  -11.917 49.348 1.00 20.07  ? 46  GLY A CA  1 
ATOM   362  C  C   . GLY A 1 46  ? 16.459  -12.895 50.421 1.00 23.38  ? 46  GLY A C   1 
ATOM   363  O  O   . GLY A 1 46  ? 16.003  -14.040 50.459 1.00 26.49  ? 46  GLY A O   1 
ATOM   364  N  N   . LYS A 1 47  ? 17.343  -12.464 51.300 1.00 24.72  ? 47  LYS A N   1 
ATOM   365  C  CA  . LYS A 1 47  ? 17.821  -13.283 52.399 1.00 28.49  ? 47  LYS A CA  1 
ATOM   366  C  C   . LYS A 1 47  ? 17.005  -13.070 53.657 1.00 27.77  ? 47  LYS A C   1 
ATOM   367  O  O   . LYS A 1 47  ? 17.357  -13.593 54.702 1.00 29.64  ? 47  LYS A O   1 
ATOM   368  C  CB  . LYS A 1 47  ? 19.283  -12.989 52.703 1.00 27.80  ? 47  LYS A CB  1 
ATOM   369  C  CG  . LYS A 1 47  ? 20.199  -13.295 51.568 1.00 35.82  ? 47  LYS A CG  1 
ATOM   370  C  CD  . LYS A 1 47  ? 21.648  -13.110 51.919 1.00 45.71  ? 47  LYS A CD  1 
ATOM   371  C  CE  . LYS A 1 47  ? 22.444  -14.384 51.696 1.00 50.06  ? 47  LYS A CE  1 
ATOM   372  N  NZ  . LYS A 1 47  ? 21.921  -15.209 50.576 1.00 49.24  ? 47  LYS A NZ  1 
ATOM   373  N  N   . PHE A 1 48  ? 15.950  -12.265 53.571 1.00 19.38  ? 48  PHE A N   1 
ATOM   374  C  CA  . PHE A 1 48  ? 15.117  -12.019 54.741 1.00 14.72  ? 48  PHE A CA  1 
ATOM   375  C  C   . PHE A 1 48  ? 13.834  -12.831 54.592 1.00 17.48  ? 48  PHE A C   1 
ATOM   376  O  O   . PHE A 1 48  ? 12.920  -12.412 53.909 1.00 14.46  ? 48  PHE A O   1 
ATOM   377  C  CB  . PHE A 1 48  ? 14.813  -10.524 54.903 1.00 16.58  ? 48  PHE A CB  1 
ATOM   378  C  CG  . PHE A 1 48  ? 14.208  -10.179 56.230 1.00 13.83  ? 48  PHE A CG  1 
ATOM   379  C  CD1 . PHE A 1 48  ? 15.009  -10.044 57.361 1.00 19.32  ? 48  PHE A CD1 1 
ATOM   380  C  CD2 . PHE A 1 48  ? 12.839  -10.009 56.357 1.00 15.56  ? 48  PHE A CD2 1 
ATOM   381  C  CE1 . PHE A 1 48  ? 14.446  -9.742  58.598 1.00 17.98  ? 48  PHE A CE1 1 
ATOM   382  C  CE2 . PHE A 1 48  ? 12.263  -9.713  57.587 1.00 19.75  ? 48  PHE A CE2 1 
ATOM   383  C  CZ  . PHE A 1 48  ? 13.068  -9.569  58.712 1.00 18.15  ? 48  PHE A CZ  1 
ATOM   384  N  N   . HIS A 1 49  ? 13.778  -14.003 55.222 1.00 14.44  ? 49  HIS A N   1 
ATOM   385  C  CA  . HIS A 1 49  ? 12.620  -14.885 55.055 1.00 14.87  ? 49  HIS A CA  1 
ATOM   386  C  C   . HIS A 1 49  ? 11.519  -14.634 56.090 1.00 12.61  ? 49  HIS A C   1 
ATOM   387  O  O   . HIS A 1 49  ? 11.794  -14.345 57.251 1.00 15.68  ? 49  HIS A O   1 
ATOM   388  C  CB  . HIS A 1 49  ? 13.064  -16.345 55.046 1.00 14.44  ? 49  HIS A CB  1 
ATOM   389  C  CG  . HIS A 1 49  ? 14.002  -16.668 53.926 1.00 17.55  ? 49  HIS A CG  1 
ATOM   390  N  ND1 . HIS A 1 49  ? 13.570  -16.905 52.637 1.00 20.63  ? 49  HIS A ND1 1 
ATOM   391  C  CD2 . HIS A 1 49  ? 15.351  -16.769 53.895 1.00 21.39  ? 49  HIS A CD2 1 
ATOM   392  C  CE1 . HIS A 1 49  ? 14.614  -17.155 51.866 1.00 23.35  ? 49  HIS A CE1 1 
ATOM   393  N  NE2 . HIS A 1 49  ? 15.707  -17.069 52.602 1.00 23.88  ? 49  HIS A NE2 1 
ATOM   394  N  N   . THR A 1 50  ? 10.266  -14.744 55.648 1.00 14.76  ? 50  THR A N   1 
ATOM   395  C  CA  . THR A 1 50  ? 9.118   -14.355 56.461 1.00 14.98  ? 50  THR A CA  1 
ATOM   396  C  C   . THR A 1 50  ? 8.133   -15.507 56.573 1.00 17.28  ? 50  THR A C   1 
ATOM   397  O  O   . THR A 1 50  ? 7.262   -15.654 55.719 1.00 16.56  ? 50  THR A O   1 
ATOM   398  C  CB  . THR A 1 50  ? 8.380   -13.110 55.870 1.00 15.08  ? 50  THR A CB  1 
ATOM   399  O  OG1 . THR A 1 50  ? 7.903   -13.398 54.548 1.00 16.78  ? 50  THR A OG1 1 
ATOM   400  C  CG2 . THR A 1 50  ? 9.307   -11.910 55.810 1.00 16.17  ? 50  THR A CG2 1 
ATOM   401  N  N   . PRO A 1 51  ? 8.269   -16.341 57.616 1.00 15.25  ? 51  PRO A N   1 
ATOM   402  C  CA  . PRO A 1 51  ? 9.274   -16.337 58.688 1.00 16.65  ? 51  PRO A CA  1 
ATOM   403  C  C   . PRO A 1 51  ? 10.533  -17.092 58.257 1.00 15.90  ? 51  PRO A C   1 
ATOM   404  O  O   . PRO A 1 51  ? 10.513  -17.721 57.196 1.00 15.32  ? 51  PRO A O   1 
ATOM   405  C  CB  . PRO A 1 51  ? 8.572   -17.134 59.790 1.00 20.22  ? 51  PRO A CB  1 
ATOM   406  C  CG  . PRO A 1 51  ? 7.798   -18.164 59.023 1.00 19.26  ? 51  PRO A CG  1 
ATOM   407  C  CD  . PRO A 1 51  ? 7.263   -17.403 57.822 1.00 17.38  ? 51  PRO A CD  1 
ATOM   408  N  N   . PRO A 1 52  ? 11.604  -17.047 59.062 1.00 17.50  ? 52  PRO A N   1 
ATOM   409  C  CA  . PRO A 1 52  ? 12.821  -17.801 58.725 1.00 19.80  ? 52  PRO A CA  1 
ATOM   410  C  C   . PRO A 1 52  ? 12.538  -19.286 58.463 1.00 22.04  ? 52  PRO A C   1 
ATOM   411  O  O   . PRO A 1 52  ? 11.711  -19.884 59.149 1.00 20.63  ? 52  PRO A O   1 
ATOM   412  C  CB  . PRO A 1 52  ? 13.688  -17.630 59.969 1.00 18.74  ? 52  PRO A CB  1 
ATOM   413  C  CG  . PRO A 1 52  ? 13.274  -16.309 60.519 1.00 21.31  ? 52  PRO A CG  1 
ATOM   414  C  CD  . PRO A 1 52  ? 11.793  -16.216 60.274 1.00 17.55  ? 52  PRO A CD  1 
ATOM   415  N  N   . GLY A 1 53  ? 13.194  -19.854 57.456 1.00 21.99  ? 53  GLY A N   1 
ATOM   416  C  CA  . GLY A 1 53  ? 12.937  -21.230 57.064 1.00 25.87  ? 53  GLY A CA  1 
ATOM   417  C  C   . GLY A 1 53  ? 11.871  -21.425 55.990 1.00 27.38  ? 53  GLY A C   1 
ATOM   418  O  O   . GLY A 1 53  ? 11.789  -22.499 55.388 1.00 28.17  ? 53  GLY A O   1 
ATOM   419  N  N   . SER A 1 54  ? 11.032  -20.418 55.752 1.00 22.09  ? 54  SER A N   1 
ATOM   420  C  CA  . SER A 1 54  ? 10.019  -20.549 54.708 1.00 22.10  ? 54  SER A CA  1 
ATOM   421  C  C   . SER A 1 54  ? 10.519  -19.974 53.382 1.00 23.52  ? 54  SER A C   1 
ATOM   422  O  O   . SER A 1 54  ? 11.508  -19.239 53.348 1.00 23.17  ? 54  SER A O   1 
ATOM   423  C  CB  . SER A 1 54  ? 8.713   -19.873 55.114 1.00 24.92  ? 54  SER A CB  1 
ATOM   424  O  OG  . SER A 1 54  ? 8.777   -18.485 54.877 1.00 27.19  ? 54  SER A OG  1 
ATOM   425  N  N   . ASP A 1 55  ? 9.844   -20.304 52.285 1.00 18.26  ? 55  ASP A N   1 
ATOM   426  C  CA  . ASP A 1 55  ? 10.298  -19.819 50.984 1.00 21.43  ? 55  ASP A CA  1 
ATOM   427  C  C   . ASP A 1 55  ? 9.742   -18.441 50.610 1.00 20.78  ? 55  ASP A C   1 
ATOM   428  O  O   . ASP A 1 55  ? 9.917   -17.991 49.474 1.00 23.56  ? 55  ASP A O   1 
ATOM   429  C  CB  . ASP A 1 55  ? 10.037  -20.846 49.872 1.00 23.14  ? 55  ASP A CB  1 
ATOM   430  C  CG  . ASP A 1 55  ? 8.577   -21.241 49.758 1.00 31.21  ? 55  ASP A CG  1 
ATOM   431  O  OD1 . ASP A 1 55  ? 7.698   -20.460 50.180 1.00 32.09  ? 55  ASP A OD1 1 
ATOM   432  O  OD2 . ASP A 1 55  ? 8.305   -22.349 49.240 1.00 40.82  ? 55  ASP A OD2 1 
ATOM   433  N  N   . ARG A 1 56  ? 9.057   -17.784 51.547 1.00 13.67  ? 56  ARG A N   1 
ATOM   434  C  CA  . ARG A 1 56  ? 8.660   -16.389 51.345 1.00 13.99  ? 56  ARG A CA  1 
ATOM   435  C  C   . ARG A 1 56  ? 9.836   -15.522 51.763 1.00 14.36  ? 56  ARG A C   1 
ATOM   436  O  O   . ARG A 1 56  ? 10.560  -15.860 52.700 1.00 14.74  ? 56  ARG A O   1 
ATOM   437  C  CB  . ARG A 1 56  ? 7.476   -15.990 52.234 1.00 14.84  ? 56  ARG A CB  1 
ATOM   438  C  CG  . ARG A 1 56  ? 6.215   -16.845 52.140 1.00 16.44  ? 56  ARG A CG  1 
ATOM   439  C  CD  . ARG A 1 56  ? 5.110   -16.183 52.995 1.00 16.14  ? 56  ARG A CD  1 
ATOM   440  N  NE  . ARG A 1 56  ? 3.994   -17.092 53.268 1.00 19.43  ? 56  ARG A NE  1 
ATOM   441  C  CZ  . ARG A 1 56  ? 4.007   -18.014 54.222 1.00 22.96  ? 56  ARG A CZ  1 
ATOM   442  N  NH1 . ARG A 1 56  ? 5.079   -18.154 54.990 1.00 19.71  ? 56  ARG A NH1 1 
ATOM   443  N  NH2 . ARG A 1 56  ? 2.952   -18.802 54.407 1.00 26.70  ? 56  ARG A NH2 1 
ATOM   444  N  N   . ASN A 1 57  ? 10.026  -14.396 51.094 1.00 13.45  ? 57  ASN A N   1 
ATOM   445  C  CA  . ASN A 1 57  ? 10.974  -13.410 51.603 1.00 13.36  ? 57  ASN A CA  1 
ATOM   446  C  C   . ASN A 1 57  ? 10.385  -12.015 51.517 1.00 13.54  ? 57  ASN A C   1 
ATOM   447  O  O   . ASN A 1 57  ? 9.261   -11.851 51.044 1.00 11.84  ? 57  ASN A O   1 
ATOM   448  C  CB  . ASN A 1 57  ? 12.369  -13.536 50.961 1.00 14.50  ? 57  ASN A CB  1 
ATOM   449  C  CG  . ASN A 1 57  ? 12.366  -13.253 49.476 1.00 18.79  ? 57  ASN A CG  1 
ATOM   450  O  OD1 . ASN A 1 57  ? 12.163  -12.111 49.052 1.00 15.31  ? 57  ASN A OD1 1 
ATOM   451  N  ND2 . ASN A 1 57  ? 12.619  -14.289 48.672 1.00 19.05  ? 57  ASN A ND2 1 
ATOM   452  N  N   . ALA A 1 58  ? 11.115  -11.025 52.024 1.00 12.92  ? 58  ALA A N   1 
ATOM   453  C  CA  . ALA A 1 58  ? 10.576  -9.678  52.158 1.00 11.89  ? 58  ALA A CA  1 
ATOM   454  C  C   . ALA A 1 58  ? 10.099  -9.114  50.824 1.00 12.13  ? 58  ALA A C   1 
ATOM   455  O  O   . ALA A 1 58  ? 9.146   -8.327  50.791 1.00 12.23  ? 58  ALA A O   1 
ATOM   456  C  CB  . ALA A 1 58  ? 11.612  -8.752  52.776 1.00 10.32  ? 58  ALA A CB  1 
ATOM   457  N  N   . ALA A 1 59  ? 10.774  -9.490  49.738 1.00 9.86   ? 59  ALA A N   1 
ATOM   458  C  CA  . ALA A 1 59  ? 10.544  -8.854  48.433 1.00 12.75  ? 59  ALA A CA  1 
ATOM   459  C  C   . ALA A 1 59  ? 9.910   -9.775  47.391 1.00 12.12  ? 59  ALA A C   1 
ATOM   460  O  O   . ALA A 1 59  ? 9.466   -9.302  46.350 1.00 12.33  ? 59  ALA A O   1 
ATOM   461  C  CB  . ALA A 1 59  ? 11.861  -8.286  47.876 1.00 11.98  ? 59  ALA A CB  1 
ATOM   462  N  N   . HIS A 1 60  ? 9.897   -11.085 47.636 1.00 13.07  ? 60  HIS A N   1 
ATOM   463  C  CA  . HIS A 1 60  ? 9.423   -12.065 46.640 1.00 12.34  ? 60  HIS A CA  1 
ATOM   464  C  C   . HIS A 1 60  ? 8.619   -13.219 47.187 1.00 14.31  ? 60  HIS A C   1 
ATOM   465  O  O   . HIS A 1 60  ? 8.700   -13.536 48.351 1.00 14.22  ? 60  HIS A O   1 
ATOM   466  C  CB  . HIS A 1 60  ? 10.548  -12.682 45.849 1.00 13.78  ? 60  HIS A CB  1 
ATOM   467  C  CG  . HIS A 1 60  ? 11.463  -11.702 45.208 1.00 18.51  ? 60  HIS A CG  1 
ATOM   468  N  ND1 . HIS A 1 60  ? 12.578  -11.222 45.840 1.00 23.06  ? 60  HIS A ND1 1 
ATOM   469  C  CD2 . HIS A 1 60  ? 11.433  -11.110 43.997 1.00 16.55  ? 60  HIS A CD2 1 
ATOM   470  C  CE1 . HIS A 1 60  ? 13.218  -10.405 45.037 1.00 16.02  ? 60  HIS A CE1 1 
ATOM   471  N  NE2 . HIS A 1 60  ? 12.521  -10.288 43.927 1.00 22.37  ? 60  HIS A NE2 1 
ATOM   472  N  N   . MET A 1 61  ? 7.870   -13.847 46.285 1.00 12.02  ? 61  MET A N   1 
ATOM   473  C  CA  . MET A 1 61  ? 7.194   -15.109 46.572 1.00 15.01  ? 61  MET A CA  1 
ATOM   474  C  C   . MET A 1 61  ? 6.222   -14.958 47.722 1.00 15.74  ? 61  MET A C   1 
ATOM   475  O  O   . MET A 1 61  ? 6.032   -15.876 48.522 1.00 15.97  ? 61  MET A O   1 
ATOM   476  C  CB  . MET A 1 61  ? 8.224   -16.205 46.847 1.00 19.24  ? 61  MET A CB  1 
ATOM   477  C  CG  . MET A 1 61  ? 9.004   -16.570 45.589 1.00 25.40  ? 61  MET A CG  1 
ATOM   478  S  SD  . MET A 1 61  ? 10.451  -17.579 45.923 1.00 38.95  ? 61  MET A SD  1 
ATOM   479  C  CE  . MET A 1 61  ? 11.196  -17.606 44.290 1.00 33.14  ? 61  MET A CE  1 
ATOM   480  N  N   . SER A 1 62  ? 5.654   -13.770 47.868 1.00 15.05  ? 62  SER A N   1 
ATOM   481  C  CA  . SER A 1 62  ? 4.704   -13.461 48.916 1.00 14.57  ? 62  SER A CA  1 
ATOM   482  C  C   . SER A 1 62  ? 4.007   -12.157 48.623 1.00 12.51  ? 62  SER A C   1 
ATOM   483  O  O   . SER A 1 62  ? 4.354   -11.491 47.737 1.00 11.96  ? 62  SER A O   1 
ATOM   484  C  CB  . SER A 1 62  ? 5.396   -13.339 50.249 1.00 18.13  ? 62  SER A CB  1 
ATOM   485  O  OG  . SER A 1 62  ? 4.540   -13.602 51.338 1.00 26.19  ? 62  SER A OG  1 
ATOM   486  N  N   . SER A 1 63  ? 3.033   -11.813 49.432 1.00 11.04  ? 63  SER A N   1 
ATOM   487  C  CA  . SER A 1 63  ? 2.190   -10.638 49.218 1.00 12.33  ? 63  SER A CA  1 
ATOM   488  C  C   . SER A 1 63  ? 2.912   -9.303  49.046 1.00 12.28  ? 63  SER A C   1 
ATOM   489  O  O   . SER A 1 63  ? 2.443   -8.434  48.307 1.00 11.93  ? 63  SER A O   1 
ATOM   490  C  CB  . SER A 1 63  ? 1.186   -10.531 50.360 1.00 15.29  ? 63  SER A CB  1 
ATOM   491  O  OG  . SER A 1 63  ? 0.546   -11.788 50.533 1.00 18.88  ? 63  SER A OG  1 
ATOM   492  N  N   . ALA A 1 64  ? 4.025   -9.130  49.755 1.00 14.19  ? 64  ALA A N   1 
ATOM   493  C  CA  . ALA A 1 64  ? 4.760   -7.872  49.727 1.00 11.68  ? 64  ALA A CA  1 
ATOM   494  C  C   . ALA A 1 64  ? 5.519   -7.638  48.425 1.00 12.95  ? 64  ALA A C   1 
ATOM   495  O  O   . ALA A 1 64  ? 6.074   -6.559  48.232 1.00 14.68  ? 64  ALA A O   1 
ATOM   496  C  CB  . ALA A 1 64  ? 5.713   -7.735  50.946 1.00 13.79  ? 64  ALA A CB  1 
ATOM   497  N  N   . PHE A 1 65  ? 5.518   -8.627  47.531 1.00 10.63  ? 65  PHE A N   1 
ATOM   498  C  CA  . PHE A 1 65  ? 6.221   -8.501  46.257 1.00 11.93  ? 65  PHE A CA  1 
ATOM   499  C  C   . PHE A 1 65  ? 5.912   -7.171  45.546 1.00 12.09  ? 65  PHE A C   1 
ATOM   500  O  O   . PHE A 1 65  ? 6.817   -6.430  45.166 1.00 9.10   ? 65  PHE A O   1 
ATOM   501  C  CB  . PHE A 1 65  ? 5.879   -9.680  45.342 1.00 13.28  ? 65  PHE A CB  1 
ATOM   502  C  CG  . PHE A 1 65  ? 6.340   -9.485  43.919 1.00 13.91  ? 65  PHE A CG  1 
ATOM   503  C  CD1 . PHE A 1 65  ? 7.693   -9.491  43.615 1.00 13.38  ? 65  PHE A CD1 1 
ATOM   504  C  CD2 . PHE A 1 65  ? 5.426   -9.283  42.900 1.00 13.18  ? 65  PHE A CD2 1 
ATOM   505  C  CE1 . PHE A 1 65  ? 8.133   -9.298  42.317 1.00 14.39  ? 65  PHE A CE1 1 
ATOM   506  C  CE2 . PHE A 1 65  ? 5.861   -9.097  41.584 1.00 17.34  ? 65  PHE A CE2 1 
ATOM   507  C  CZ  . PHE A 1 65  ? 7.222   -9.104  41.301 1.00 12.91  ? 65  PHE A CZ  1 
ATOM   508  N  N   . LEU A 1 66  ? 4.630   -6.859  45.398 1.00 13.11  ? 66  LEU A N   1 
ATOM   509  C  CA  . LEU A 1 66  ? 4.221   -5.627  44.706 1.00 10.84  ? 66  LEU A CA  1 
ATOM   510  C  C   . LEU A 1 66  ? 4.529   -4.314  45.450 1.00 10.65  ? 66  LEU A C   1 
ATOM   511  O  O   . LEU A 1 66  ? 5.200   -3.445  44.897 1.00 10.66  ? 66  LEU A O   1 
ATOM   512  C  CB  . LEU A 1 66  ? 2.755   -5.710  44.253 1.00 10.42  ? 66  LEU A CB  1 
ATOM   513  C  CG  . LEU A 1 66  ? 2.488   -6.770  43.179 1.00 13.21  ? 66  LEU A CG  1 
ATOM   514  C  CD1 . LEU A 1 66  ? 0.982   -7.015  42.985 1.00 11.81  ? 66  LEU A CD1 1 
ATOM   515  C  CD2 . LEU A 1 66  ? 3.139   -6.347  41.853 1.00 12.02  ? 66  LEU A CD2 1 
ATOM   516  N  N   . PRO A 1 67  ? 4.047   -4.149  46.697 1.00 10.64  ? 67  PRO A N   1 
ATOM   517  C  CA  . PRO A 1 67  ? 4.429   -2.921  47.409 1.00 10.09  ? 67  PRO A CA  1 
ATOM   518  C  C   . PRO A 1 67  ? 5.943   -2.749  47.640 1.00 9.20   ? 67  PRO A C   1 
ATOM   519  O  O   . PRO A 1 67  ? 6.421   -1.607  47.642 1.00 8.76   ? 67  PRO A O   1 
ATOM   520  C  CB  . PRO A 1 67  ? 3.703   -3.064  48.760 1.00 10.72  ? 67  PRO A CB  1 
ATOM   521  C  CG  . PRO A 1 67  ? 3.420   -4.509  48.895 1.00 10.66  ? 67  PRO A CG  1 
ATOM   522  C  CD  . PRO A 1 67  ? 3.109   -4.956  47.497 1.00 11.17  ? 67  PRO A CD  1 
ATOM   523  N  N   . TRP A 1 68  ? 6.679   -3.838  47.849 1.00 9.36   ? 68  TRP A N   1 
ATOM   524  C  CA  . TRP A 1 68  ? 8.125   -3.728  48.086 1.00 10.50  ? 68  TRP A CA  1 
ATOM   525  C  C   . TRP A 1 68  ? 8.765   -3.099  46.846 1.00 10.85  ? 68  TRP A C   1 
ATOM   526  O  O   . TRP A 1 68  ? 9.532   -2.140  46.940 1.00 10.80  ? 68  TRP A O   1 
ATOM   527  C  CB  . TRP A 1 68  ? 8.753   -5.103  48.399 1.00 10.84  ? 68  TRP A CB  1 
ATOM   528  C  CG  . TRP A 1 68  ? 10.167  -5.072  48.913 1.00 10.13  ? 68  TRP A CG  1 
ATOM   529  C  CD1 . TRP A 1 68  ? 10.581  -5.265  50.212 1.00 12.63  ? 68  TRP A CD1 1 
ATOM   530  C  CD2 . TRP A 1 68  ? 11.360  -4.847  48.147 1.00 10.54  ? 68  TRP A CD2 1 
ATOM   531  N  NE1 . TRP A 1 68  ? 11.952  -5.166  50.295 1.00 11.85  ? 68  TRP A NE1 1 
ATOM   532  C  CE2 . TRP A 1 68  ? 12.454  -4.912  49.046 1.00 10.70  ? 68  TRP A CE2 1 
ATOM   533  C  CE3 . TRP A 1 68  ? 11.612  -4.617  46.790 1.00 10.18  ? 68  TRP A CE3 1 
ATOM   534  C  CZ2 . TRP A 1 68  ? 13.779  -4.736  48.632 1.00 11.45  ? 68  TRP A CZ2 1 
ATOM   535  C  CZ3 . TRP A 1 68  ? 12.930  -4.430  46.382 1.00 11.40  ? 68  TRP A CZ3 1 
ATOM   536  C  CH2 . TRP A 1 68  ? 13.996  -4.497  47.303 1.00 14.57  ? 68  TRP A CH2 1 
ATOM   537  N  N   . HIS A 1 69  ? 8.432   -3.610  45.668 1.00 7.20   ? 69  HIS A N   1 
ATOM   538  C  CA  . HIS A 1 69  ? 8.980   -3.083  44.450 1.00 8.72   ? 69  HIS A CA  1 
ATOM   539  C  C   . HIS A 1 69  ? 8.483   -1.701  44.120 1.00 11.15  ? 69  HIS A C   1 
ATOM   540  O  O   . HIS A 1 69  ? 9.218   -0.917  43.619 1.00 10.22  ? 69  HIS A O   1 
ATOM   541  C  CB  . HIS A 1 69  ? 8.836   -4.079  43.306 1.00 10.06  ? 69  HIS A CB  1 
ATOM   542  C  CG  . HIS A 1 69  ? 9.653   -5.329  43.523 1.00 9.75   ? 69  HIS A CG  1 
ATOM   543  N  ND1 . HIS A 1 69  ? 9.243   -6.338  44.241 1.00 9.87   ? 69  HIS A ND1 1 
ATOM   544  C  CD2 . HIS A 1 69  ? 10.933  -5.631  43.130 1.00 10.79  ? 69  HIS A CD2 1 
ATOM   545  C  CE1 . HIS A 1 69  ? 10.197  -7.253  44.293 1.00 14.05  ? 69  HIS A CE1 1 
ATOM   546  N  NE2 . HIS A 1 69  ? 11.234  -6.805  43.622 1.00 11.39  ? 69  HIS A NE2 1 
ATOM   547  N  N   . ARG A 1 70  ? 7.269   -1.372  44.489 1.00 9.10   ? 70  ARG A N   1 
ATOM   548  C  CA  . ARG A 1 70  ? 6.799   0.007   44.278 1.00 9.74   ? 70  ARG A CA  1 
ATOM   549  C  C   . ARG A 1 70  ? 7.611   1.010   45.117 1.00 9.47   ? 70  ARG A C   1 
ATOM   550  O  O   . ARG A 1 70  ? 7.975   2.094   44.636 1.00 10.53  ? 70  ARG A O   1 
ATOM   551  C  CB  . ARG A 1 70  ? 5.308   0.140   44.607 1.00 11.82  ? 70  ARG A CB  1 
ATOM   552  C  CG  . ARG A 1 70  ? 4.768   1.553   44.429 1.00 11.77  ? 70  ARG A CG  1 
ATOM   553  C  CD  . ARG A 1 70  ? 3.259   1.595   44.593 1.00 12.65  ? 70  ARG A CD  1 
ATOM   554  N  NE  . ARG A 1 70  ? 2.582   1.083   43.406 1.00 11.84  ? 70  ARG A NE  1 
ATOM   555  C  CZ  . ARG A 1 70  ? 1.260   0.938   43.299 1.00 14.90  ? 70  ARG A CZ  1 
ATOM   556  N  NH1 . ARG A 1 70  ? 0.465   1.250   44.317 1.00 14.47  ? 70  ARG A NH1 1 
ATOM   557  N  NH2 . ARG A 1 70  ? 0.736   0.466   42.179 1.00 13.32  ? 70  ARG A NH2 1 
ATOM   558  N  N   . GLU A 1 71  ? 7.904   0.644   46.358 1.00 10.12  ? 71  GLU A N   1 
ATOM   559  C  CA  . GLU A 1 71  ? 8.741   1.484   47.214 1.00 10.96  ? 71  GLU A CA  1 
ATOM   560  C  C   . GLU A 1 71  ? 10.157  1.614   46.647 1.00 10.51  ? 71  GLU A C   1 
ATOM   561  O  O   . GLU A 1 71  ? 10.736  2.697   46.635 1.00 13.29  ? 71  GLU A O   1 
ATOM   562  C  CB  . GLU A 1 71  ? 8.777   0.931   48.648 1.00 12.50  ? 71  GLU A CB  1 
ATOM   563  C  CG  . GLU A 1 71  ? 9.726   1.672   49.605 1.00 15.23  ? 71  GLU A CG  1 
ATOM   564  C  CD  . GLU A 1 71  ? 9.320   3.111   49.934 1.00 21.37  ? 71  GLU A CD  1 
ATOM   565  O  OE1 . GLU A 1 71  ? 8.194   3.544   49.586 1.00 19.70  ? 71  GLU A OE1 1 
ATOM   566  O  OE2 . GLU A 1 71  ? 10.144  3.809   50.568 1.00 22.87  ? 71  GLU A OE2 1 
ATOM   567  N  N   . TYR A 1 72  ? 10.709  0.494   46.207 1.00 10.98  ? 72  TYR A N   1 
ATOM   568  C  CA  . TYR A 1 72  ? 12.050  0.440   45.633 1.00 11.62  ? 72  TYR A CA  1 
ATOM   569  C  C   . TYR A 1 72  ? 12.168  1.402   44.461 1.00 12.39  ? 72  TYR A C   1 
ATOM   570  O  O   . TYR A 1 72  ? 13.113  2.193   44.376 1.00 11.86  ? 72  TYR A O   1 
ATOM   571  C  CB  . TYR A 1 72  ? 12.272  -0.982  45.163 1.00 11.47  ? 72  TYR A CB  1 
ATOM   572  C  CG  . TYR A 1 72  ? 13.637  -1.374  44.637 1.00 11.16  ? 72  TYR A CG  1 
ATOM   573  C  CD1 . TYR A 1 72  ? 14.687  -1.648  45.499 1.00 12.26  ? 72  TYR A CD1 1 
ATOM   574  C  CD2 . TYR A 1 72  ? 13.835  -1.584  43.282 1.00 12.91  ? 72  TYR A CD2 1 
ATOM   575  C  CE1 . TYR A 1 72  ? 15.926  -2.078  45.014 1.00 13.60  ? 72  TYR A CE1 1 
ATOM   576  C  CE2 . TYR A 1 72  ? 15.064  -2.005  42.790 1.00 14.48  ? 72  TYR A CE2 1 
ATOM   577  C  CZ  . TYR A 1 72  ? 16.098  -2.254  43.652 1.00 12.89  ? 72  TYR A CZ  1 
ATOM   578  O  OH  . TYR A 1 72  ? 17.313  -2.679  43.161 1.00 16.37  ? 72  TYR A OH  1 
ATOM   579  N  N   . LEU A 1 73  ? 11.203  1.318   43.551 1.00 10.10  ? 73  LEU A N   1 
ATOM   580  C  CA  . LEU A 1 73  ? 11.200  2.174   42.360 1.00 12.16  ? 73  LEU A CA  1 
ATOM   581  C  C   . LEU A 1 73  ? 11.022  3.633   42.726 1.00 11.54  ? 73  LEU A C   1 
ATOM   582  O  O   . LEU A 1 73  ? 11.604  4.505   42.099 1.00 12.69  ? 73  LEU A O   1 
ATOM   583  C  CB  . LEU A 1 73  ? 10.099  1.758   41.393 1.00 11.71  ? 73  LEU A CB  1 
ATOM   584  C  CG  . LEU A 1 73  ? 10.234  0.390   40.727 1.00 14.51  ? 73  LEU A CG  1 
ATOM   585  C  CD1 . LEU A 1 73  ? 9.103   0.178   39.728 1.00 13.00  ? 73  LEU A CD1 1 
ATOM   586  C  CD2 . LEU A 1 73  ? 11.594  0.215   40.051 1.00 15.55  ? 73  LEU A CD2 1 
ATOM   587  N  N   . LEU A 1 74  ? 10.197  3.894   43.733 1.00 11.36  ? 74  LEU A N   1 
ATOM   588  C  CA  . LEU A 1 74  ? 9.949   5.256   44.171 1.00 14.70  ? 74  LEU A CA  1 
ATOM   589  C  C   . LEU A 1 74  ? 11.232  5.907   44.710 1.00 14.00  ? 74  LEU A C   1 
ATOM   590  O  O   . LEU A 1 74  ? 11.548  7.065   44.385 1.00 12.21  ? 74  LEU A O   1 
ATOM   591  C  CB  . LEU A 1 74  ? 8.830   5.282   45.219 1.00 13.79  ? 74  LEU A CB  1 
ATOM   592  C  CG  . LEU A 1 74  ? 8.473   6.660   45.792 1.00 17.62  ? 74  LEU A CG  1 
ATOM   593  C  CD1 . LEU A 1 74  ? 7.865   7.545   44.700 1.00 19.09  ? 74  LEU A CD1 1 
ATOM   594  C  CD2 . LEU A 1 74  ? 7.506   6.507   46.962 1.00 21.09  ? 74  LEU A CD2 1 
ATOM   595  N  N   . ARG A 1 75  ? 11.981  5.155   45.513 1.00 12.43  ? 75  ARG A N   1 
ATOM   596  C  CA  . ARG A 1 75  ? 13.248  5.636   46.039 1.00 13.01  ? 75  ARG A CA  1 
ATOM   597  C  C   . ARG A 1 75  ? 14.223  5.870   44.896 1.00 13.49  ? 75  ARG A C   1 
ATOM   598  O  O   . ARG A 1 75  ? 14.928  6.885   44.861 1.00 16.17  ? 75  ARG A O   1 
ATOM   599  C  CB  . ARG A 1 75  ? 13.840  4.647   47.067 1.00 12.75  ? 75  ARG A CB  1 
ATOM   600  C  CG  . ARG A 1 75  ? 13.157  4.697   48.433 1.00 15.80  ? 75  ARG A CG  1 
ATOM   601  C  CD  . ARG A 1 75  ? 13.582  3.543   49.359 1.00 17.17  ? 75  ARG A CD  1 
ATOM   602  N  NE  . ARG A 1 75  ? 12.797  3.554   50.594 1.00 18.68  ? 75  ARG A NE  1 
ATOM   603  C  CZ  . ARG A 1 75  ? 13.250  3.963   51.774 1.00 20.37  ? 75  ARG A CZ  1 
ATOM   604  N  NH1 . ARG A 1 75  ? 12.448  3.942   52.830 1.00 21.47  ? 75  ARG A NH1 1 
ATOM   605  N  NH2 . ARG A 1 75  ? 14.503  4.388   51.903 1.00 23.55  ? 75  ARG A NH2 1 
ATOM   606  N  N   . PHE A 1 76  ? 14.258  4.923   43.967 1.00 9.98   ? 76  PHE A N   1 
ATOM   607  C  CA  . PHE A 1 76  ? 15.142  5.003   42.807 1.00 10.92  ? 76  PHE A CA  1 
ATOM   608  C  C   . PHE A 1 76  ? 14.838  6.254   41.969 1.00 14.35  ? 76  PHE A C   1 
ATOM   609  O  O   . PHE A 1 76  ? 15.748  7.014   41.615 1.00 14.12  ? 76  PHE A O   1 
ATOM   610  C  CB  . PHE A 1 76  ? 15.014  3.735   41.936 1.00 12.12  ? 76  PHE A CB  1 
ATOM   611  C  CG  . PHE A 1 76  ? 16.026  3.675   40.803 1.00 11.49  ? 76  PHE A CG  1 
ATOM   612  C  CD1 . PHE A 1 76  ? 17.363  3.419   41.064 1.00 12.48  ? 76  PHE A CD1 1 
ATOM   613  C  CD2 . PHE A 1 76  ? 15.635  3.914   39.494 1.00 13.23  ? 76  PHE A CD2 1 
ATOM   614  C  CE1 . PHE A 1 76  ? 18.298  3.369   40.028 1.00 12.18  ? 76  PHE A CE1 1 
ATOM   615  C  CE2 . PHE A 1 76  ? 16.560  3.873   38.455 1.00 15.63  ? 76  PHE A CE2 1 
ATOM   616  C  CZ  . PHE A 1 76  ? 17.892  3.608   38.723 1.00 13.27  ? 76  PHE A CZ  1 
ATOM   617  N  N   . GLU A 1 77  ? 13.560  6.480   41.675 1.00 13.13  ? 77  GLU A N   1 
ATOM   618  C  CA  . GLU A 1 77  ? 13.153  7.642   40.876 1.00 16.02  ? 77  GLU A CA  1 
ATOM   619  C  C   . GLU A 1 77  ? 13.481  8.966   41.596 1.00 18.09  ? 77  GLU A C   1 
ATOM   620  O  O   . GLU A 1 77  ? 13.886  9.944   40.968 1.00 18.03  ? 77  GLU A O   1 
ATOM   621  C  CB  . GLU A 1 77  ? 11.664  7.541   40.530 1.00 16.68  ? 77  GLU A CB  1 
ATOM   622  C  CG  . GLU A 1 77  ? 11.112  8.660   39.657 1.00 21.62  ? 77  GLU A CG  1 
ATOM   623  C  CD  . GLU A 1 77  ? 9.655   8.418   39.284 1.00 20.81  ? 77  GLU A CD  1 
ATOM   624  O  OE1 . GLU A 1 77  ? 8.783   8.457   40.180 1.00 21.37  ? 77  GLU A OE1 1 
ATOM   625  O  OE2 . GLU A 1 77  ? 9.385   8.169   38.099 1.00 18.40  ? 77  GLU A OE2 1 
ATOM   626  N  N   . ARG A 1 78  ? 13.340  8.981   42.918 1.00 18.37  ? 78  ARG A N   1 
ATOM   627  C  CA  . ARG A 1 78  ? 13.746  10.144  43.710 1.00 17.67  ? 78  ARG A CA  1 
ATOM   628  C  C   . ARG A 1 78  ? 15.245  10.407  43.605 1.00 20.24  ? 78  ARG A C   1 
ATOM   629  O  O   . ARG A 1 78  ? 15.685  11.560  43.557 1.00 18.53  ? 78  ARG A O   1 
ATOM   630  C  CB  . ARG A 1 78  ? 13.329  9.994   45.170 1.00 17.86  ? 78  ARG A CB  1 
ATOM   631  C  CG  . ARG A 1 78  ? 11.848  10.249  45.419 1.00 24.58  ? 78  ARG A CG  1 
ATOM   632  C  CD  . ARG A 1 78  ? 11.542  10.077  46.894 1.00 30.15  ? 78  ARG A CD  1 
ATOM   633  N  NE  . ARG A 1 78  ? 10.119  10.178  47.203 1.00 36.06  ? 78  ARG A NE  1 
ATOM   634  C  CZ  . ARG A 1 78  ? 9.539   9.526   48.205 1.00 30.89  ? 78  ARG A CZ  1 
ATOM   635  N  NH1 . ARG A 1 78  ? 10.259  8.713   48.971 1.00 37.98  ? 78  ARG A NH1 1 
ATOM   636  N  NH2 . ARG A 1 78  ? 8.243   9.676   48.434 1.00 35.48  ? 78  ARG A NH2 1 
ATOM   637  N  N   . ASP A 1 79  ? 16.033  9.342   43.571 1.00 17.70  ? 79  ASP A N   1 
ATOM   638  C  CA  . ASP A 1 79  ? 17.471  9.483   43.326 1.00 18.52  ? 79  ASP A CA  1 
ATOM   639  C  C   . ASP A 1 79  ? 17.780  10.013  41.913 1.00 18.80  ? 79  ASP A C   1 
ATOM   640  O  O   . ASP A 1 79  ? 18.659  10.853  41.757 1.00 21.62  ? 79  ASP A O   1 
ATOM   641  C  CB  . ASP A 1 79  ? 18.230  8.178   43.638 1.00 19.93  ? 79  ASP A CB  1 
ATOM   642  C  CG  . ASP A 1 79  ? 18.597  8.058   45.122 1.00 25.39  ? 79  ASP A CG  1 
ATOM   643  O  OD1 . ASP A 1 79  ? 18.636  6.928   45.664 1.00 21.69  ? 79  ASP A OD1 1 
ATOM   644  O  OD2 . ASP A 1 79  ? 18.852  9.108   45.752 1.00 26.98  ? 79  ASP A OD2 1 
ATOM   645  N  N   . LEU A 1 80  ? 17.061  9.542   40.894 1.00 17.13  ? 80  LEU A N   1 
ATOM   646  C  CA  . LEU A 1 80  ? 17.216  10.091  39.540 1.00 17.44  ? 80  LEU A CA  1 
ATOM   647  C  C   . LEU A 1 80  ? 16.916  11.588  39.531 1.00 20.09  ? 80  LEU A C   1 
ATOM   648  O  O   . LEU A 1 80  ? 17.692  12.381  39.004 1.00 19.97  ? 80  LEU A O   1 
ATOM   649  C  CB  . LEU A 1 80  ? 16.288  9.396   38.532 1.00 17.39  ? 80  LEU A CB  1 
ATOM   650  C  CG  . LEU A 1 80  ? 16.519  7.902   38.272 1.00 19.26  ? 80  LEU A CG  1 
ATOM   651  C  CD1 . LEU A 1 80  ? 15.392  7.354   37.433 1.00 18.99  ? 80  LEU A CD1 1 
ATOM   652  C  CD2 . LEU A 1 80  ? 17.859  7.667   37.591 1.00 19.99  ? 80  LEU A CD2 1 
ATOM   653  N  N   . GLN A 1 81  ? 15.813  11.943  40.127 1.00 19.77  ? 81  GLN A N   1 
ATOM   654  C  CA  . GLN A 1 81  ? 15.410  13.292  40.219 1.00 22.20  ? 81  GLN A CA  1 
ATOM   655  C  C   . GLN A 1 81  ? 16.370  14.237  40.919 1.00 26.23  ? 81  GLN A C   1 
ATOM   656  O  O   . GLN A 1 81  ? 16.387  15.389  40.627 1.00 24.16  ? 81  GLN A O   1 
ATOM   657  C  CB  . GLN A 1 81  ? 14.138  13.355  40.967 1.00 25.70  ? 81  GLN A CB  1 
ATOM   658  C  CG  . GLN A 1 81  ? 13.163  14.184  40.253 1.00 41.17  ? 81  GLN A CG  1 
ATOM   659  C  CD  . GLN A 1 81  ? 12.169  13.352  39.541 1.00 40.80  ? 81  GLN A CD  1 
ATOM   660  O  OE1 . GLN A 1 81  ? 11.976  12.227  39.900 1.00 41.00  ? 81  GLN A OE1 1 
ATOM   661  N  NE2 . GLN A 1 81  ? 11.523  13.907  38.540 1.00 36.95  ? 81  GLN A NE2 1 
ATOM   662  N  N   . SER A 1 82  ? 17.104  13.755  41.883 1.00 21.64  ? 82  SER A N   1 
ATOM   663  C  CA  . SER A 1 82  ? 18.013  14.593  42.587 1.00 25.08  ? 82  SER A CA  1 
ATOM   664  C  C   . SER A 1 82  ? 19.237  14.914  41.751 1.00 29.50  ? 82  SER A C   1 
ATOM   665  O  O   . SER A 1 82  ? 19.946  15.838  42.036 1.00 27.81  ? 82  SER A O   1 
ATOM   666  C  CB  . SER A 1 82  ? 18.383  13.979  43.904 1.00 27.59  ? 82  SER A CB  1 
ATOM   667  O  OG  . SER A 1 82  ? 19.106  12.831  43.711 1.00 36.65  ? 82  SER A OG  1 
ATOM   668  N  N   . ILE A 1 83  ? 19.444  14.126  40.721 1.00 19.27  ? 83  ILE A N   1 
ATOM   669  C  CA  . ILE A 1 83  ? 20.485  14.424  39.743 1.00 23.05  ? 83  ILE A CA  1 
ATOM   670  C  C   . ILE A 1 83  ? 19.929  15.324  38.630 1.00 25.43  ? 83  ILE A C   1 
ATOM   671  O  O   . ILE A 1 83  ? 20.517  16.356  38.310 1.00 25.94  ? 83  ILE A O   1 
ATOM   672  C  CB  . ILE A 1 83  ? 21.078  13.142  39.116 1.00 22.46  ? 83  ILE A CB  1 
ATOM   673  C  CG1 . ILE A 1 83  ? 21.686  12.233  40.184 1.00 23.41  ? 83  ILE A CG1 1 
ATOM   674  C  CG2 . ILE A 1 83  ? 22.122  13.484  38.058 1.00 23.54  ? 83  ILE A CG2 1 
ATOM   675  C  CD1 . ILE A 1 83  ? 22.714  12.910  41.061 1.00 24.70  ? 83  ILE A CD1 1 
ATOM   676  N  N   . ASN A 1 84  ? 18.796  14.927  38.054 1.00 22.13  ? 84  ASN A N   1 
ATOM   677  C  CA  . ASN A 1 84  ? 18.130  15.684  36.992 1.00 21.99  ? 84  ASN A CA  1 
ATOM   678  C  C   . ASN A 1 84  ? 16.613  15.680  37.197 1.00 24.50  ? 84  ASN A C   1 
ATOM   679  O  O   . ASN A 1 84  ? 15.961  14.666  36.951 1.00 23.04  ? 84  ASN A O   1 
ATOM   680  C  CB  . ASN A 1 84  ? 18.460  15.068  35.626 1.00 24.73  ? 84  ASN A CB  1 
ATOM   681  C  CG  . ASN A 1 84  ? 17.914  15.887  34.453 1.00 24.00  ? 84  ASN A CG  1 
ATOM   682  O  OD1 . ASN A 1 84  ? 16.946  16.635  34.587 1.00 26.20  ? 84  ASN A OD1 1 
ATOM   683  N  ND2 . ASN A 1 84  ? 18.539  15.735  33.294 1.00 27.02  ? 84  ASN A ND2 1 
ATOM   684  N  N   . PRO A 1 85  ? 16.042  16.827  37.612 1.00 31.55  ? 85  PRO A N   1 
ATOM   685  C  CA  . PRO A 1 85  ? 14.620  16.936  37.970 1.00 32.59  ? 85  PRO A CA  1 
ATOM   686  C  C   . PRO A 1 85  ? 13.646  16.642  36.825 1.00 32.04  ? 85  PRO A C   1 
ATOM   687  O  O   . PRO A 1 85  ? 12.448  16.510  37.066 1.00 35.38  ? 85  PRO A O   1 
ATOM   688  C  CB  . PRO A 1 85  ? 14.481  18.400  38.402 1.00 37.47  ? 85  PRO A CB  1 
ATOM   689  C  CG  . PRO A 1 85  ? 15.608  19.105  37.716 1.00 36.84  ? 85  PRO A CG  1 
ATOM   690  C  CD  . PRO A 1 85  ? 16.736  18.123  37.726 1.00 33.92  ? 85  PRO A CD  1 
ATOM   691  N  N   . GLU A 1 86  ? 14.124  16.550  35.617 1.00 32.39  ? 86  GLU A N   1 
ATOM   692  C  CA  . GLU A 1 86  ? 13.245  16.248  34.525 1.00 35.76  ? 86  GLU A CA  1 
ATOM   693  C  C   . GLU A 1 86  ? 13.127  14.744  34.249 1.00 35.65  ? 86  GLU A C   1 
ATOM   694  O  O   . GLU A 1 86  ? 12.250  14.325  33.544 1.00 37.53  ? 86  GLU A O   1 
ATOM   695  C  CB  . GLU A 1 86  ? 13.659  16.958  33.250 1.00 40.35  ? 86  GLU A CB  1 
ATOM   696  C  CG  . GLU A 1 86  ? 13.573  18.452  33.280 1.00 45.34  ? 86  GLU A CG  1 
ATOM   697  C  CD  . GLU A 1 86  ? 12.145  18.909  33.603 1.00 54.01  ? 86  GLU A CD  1 
ATOM   698  O  OE1 . GLU A 1 86  ? 11.164  18.312  33.108 1.00 59.29  ? 86  GLU A OE1 1 
ATOM   699  O  OE2 . GLU A 1 86  ? 12.029  19.852  34.379 1.00 51.60  ? 86  GLU A OE2 1 
ATOM   700  N  N   . VAL A 1 87  ? 14.019  13.948  34.809 1.00 25.21  ? 87  VAL A N   1 
ATOM   701  C  CA  . VAL A 1 87  ? 14.039  12.514  34.537 1.00 20.15  ? 87  VAL A CA  1 
ATOM   702  C  C   . VAL A 1 87  ? 13.047  11.778  35.426 1.00 23.65  ? 87  VAL A C   1 
ATOM   703  O  O   . VAL A 1 87  ? 13.027  11.980  36.641 1.00 23.46  ? 87  VAL A O   1 
ATOM   704  C  CB  . VAL A 1 87  ? 15.453  11.928  34.740 1.00 20.90  ? 87  VAL A CB  1 
ATOM   705  C  CG1 . VAL A 1 87  ? 15.444  10.407  34.657 1.00 19.26  ? 87  VAL A CG1 1 
ATOM   706  C  CG2 . VAL A 1 87  ? 16.401  12.502  33.709 1.00 18.77  ? 87  VAL A CG2 1 
ATOM   707  N  N   . THR A 1 88  ? 12.209  10.947  34.811 1.00 20.58  ? 88  THR A N   1 
ATOM   708  C  CA  . THR A 1 88  ? 11.370  10.015  35.552 1.00 18.95  ? 88  THR A CA  1 
ATOM   709  C  C   . THR A 1 88  ? 11.677  8.588   35.092 1.00 20.81  ? 88  THR A C   1 
ATOM   710  O  O   . THR A 1 88  ? 12.367  8.386   34.102 1.00 18.84  ? 88  THR A O   1 
ATOM   711  C  CB  . THR A 1 88  ? 9.867   10.273  35.329 1.00 19.18  ? 88  THR A CB  1 
ATOM   712  O  OG1 . THR A 1 88  ? 9.542   10.025  33.957 1.00 22.00  ? 88  THR A OG1 1 
ATOM   713  C  CG2 . THR A 1 88  ? 9.497   11.704  35.707 1.00 24.84  ? 88  THR A CG2 1 
ATOM   714  N  N   . LEU A 1 89  ? 11.153  7.603   35.812 1.00 16.53  ? 89  LEU A N   1 
ATOM   715  C  CA  . LEU A 1 89  ? 11.343  6.198   35.451 1.00 17.39  ? 89  LEU A CA  1 
ATOM   716  C  C   . LEU A 1 89  ? 10.356  5.762   34.366 1.00 16.39  ? 89  LEU A C   1 
ATOM   717  O  O   . LEU A 1 89  ? 9.158   5.718   34.629 1.00 17.01  ? 89  LEU A O   1 
ATOM   718  C  CB  . LEU A 1 89  ? 11.086  5.343   36.687 1.00 17.73  ? 89  LEU A CB  1 
ATOM   719  C  CG  . LEU A 1 89  ? 11.950  4.130   37.029 1.00 23.70  ? 89  LEU A CG  1 
ATOM   720  C  CD1 . LEU A 1 89  ? 11.104  3.101   37.758 1.00 19.48  ? 89  LEU A CD1 1 
ATOM   721  C  CD2 . LEU A 1 89  ? 12.645  3.528   35.832 1.00 19.96  ? 89  LEU A CD2 1 
ATOM   722  N  N   . PRO A 1 90  ? 10.850  5.400   33.159 1.00 15.15  ? 90  PRO A N   1 
ATOM   723  C  CA  . PRO A 1 90  ? 9.999   4.864   32.091 1.00 15.73  ? 90  PRO A CA  1 
ATOM   724  C  C   . PRO A 1 90  ? 9.638   3.397   32.319 1.00 18.61  ? 90  PRO A C   1 
ATOM   725  O  O   . PRO A 1 90  ? 10.263  2.722   33.150 1.00 17.12  ? 90  PRO A O   1 
ATOM   726  C  CB  . PRO A 1 90  ? 10.895  4.948   30.838 1.00 15.49  ? 90  PRO A CB  1 
ATOM   727  C  CG  . PRO A 1 90  ? 12.129  5.686   31.253 1.00 21.58  ? 90  PRO A CG  1 
ATOM   728  C  CD  . PRO A 1 90  ? 12.254  5.491   32.727 1.00 16.81  ? 90  PRO A CD  1 
ATOM   729  N  N   . TYR A 1 91  ? 8.656   2.891   31.579 1.00 15.78  ? 91  TYR A N   1 
ATOM   730  C  CA  . TYR A 1 91  ? 8.325   1.466   31.682 1.00 13.87  ? 91  TYR A CA  1 
ATOM   731  C  C   . TYR A 1 91  ? 8.455   0.718   30.361 1.00 15.88  ? 91  TYR A C   1 
ATOM   732  O  O   . TYR A 1 91  ? 8.160   1.260   29.298 1.00 15.85  ? 91  TYR A O   1 
ATOM   733  C  CB  . TYR A 1 91  ? 6.925   1.259   32.274 1.00 14.22  ? 91  TYR A CB  1 
ATOM   734  C  CG  . TYR A 1 91  ? 5.775   1.804   31.452 1.00 14.46  ? 91  TYR A CG  1 
ATOM   735  C  CD1 . TYR A 1 91  ? 5.170   1.029   30.463 1.00 17.93  ? 91  TYR A CD1 1 
ATOM   736  C  CD2 . TYR A 1 91  ? 5.272   3.077   31.684 1.00 16.67  ? 91  TYR A CD2 1 
ATOM   737  C  CE1 . TYR A 1 91  ? 4.103   1.520   29.710 1.00 17.37  ? 91  TYR A CE1 1 
ATOM   738  C  CE2 . TYR A 1 91  ? 4.205   3.574   30.943 1.00 19.31  ? 91  TYR A CE2 1 
ATOM   739  C  CZ  . TYR A 1 91  ? 3.626   2.786   29.958 1.00 20.88  ? 91  TYR A CZ  1 
ATOM   740  O  OH  . TYR A 1 91  ? 2.566   3.277   29.224 1.00 22.21  ? 91  TYR A OH  1 
ATOM   741  N  N   . TRP A 1 92  ? 8.914   -0.524  30.449 1.00 12.97  ? 92  TRP A N   1 
ATOM   742  C  CA  . TRP A 1 92  ? 9.061   -1.394  29.301 1.00 15.42  ? 92  TRP A CA  1 
ATOM   743  C  C   . TRP A 1 92  ? 7.793   -2.226  29.185 1.00 14.82  ? 92  TRP A C   1 
ATOM   744  O  O   . TRP A 1 92  ? 7.572   -3.152  29.957 1.00 14.10  ? 92  TRP A O   1 
ATOM   745  C  CB  . TRP A 1 92  ? 10.294  -2.288  29.472 1.00 12.89  ? 92  TRP A CB  1 
ATOM   746  C  CG  . TRP A 1 92  ? 10.460  -3.366  28.409 1.00 17.51  ? 92  TRP A CG  1 
ATOM   747  C  CD1 . TRP A 1 92  ? 10.043  -3.315  27.101 1.00 16.80  ? 92  TRP A CD1 1 
ATOM   748  C  CD2 . TRP A 1 92  ? 11.080  -4.645  28.576 1.00 17.68  ? 92  TRP A CD2 1 
ATOM   749  N  NE1 . TRP A 1 92  ? 10.372  -4.475  26.459 1.00 17.53  ? 92  TRP A NE1 1 
ATOM   750  C  CE2 . TRP A 1 92  ? 11.008  -5.309  27.335 1.00 18.12  ? 92  TRP A CE2 1 
ATOM   751  C  CE3 . TRP A 1 92  ? 11.685  -5.294  29.654 1.00 16.15  ? 92  TRP A CE3 1 
ATOM   752  C  CZ2 . TRP A 1 92  ? 11.512  -6.588  27.146 1.00 17.08  ? 92  TRP A CZ2 1 
ATOM   753  C  CZ3 . TRP A 1 92  ? 12.200  -6.563  29.457 1.00 18.93  ? 92  TRP A CZ3 1 
ATOM   754  C  CH2 . TRP A 1 92  ? 12.105  -7.198  28.217 1.00 18.00  ? 92  TRP A CH2 1 
ATOM   755  N  N   . GLU A 1 93  ? 6.947   -1.880  28.221 1.00 16.71  ? 93  GLU A N   1 
ATOM   756  C  CA  . GLU A 1 93  ? 5.721   -2.629  28.013 1.00 20.37  ? 93  GLU A CA  1 
ATOM   757  C  C   . GLU A 1 93  ? 6.019   -3.903  27.225 1.00 22.08  ? 93  GLU A C   1 
ATOM   758  O  O   . GLU A 1 93  ? 5.819   -3.950  26.000 1.00 22.06  ? 93  GLU A O   1 
ATOM   759  C  CB  . GLU A 1 93  ? 4.683   -1.760  27.293 1.00 21.75  ? 93  GLU A CB  1 
ATOM   760  C  CG  . GLU A 1 93  ? 3.285   -2.357  27.299 1.00 25.08  ? 93  GLU A CG  1 
ATOM   761  C  CD  . GLU A 1 93  ? 2.247   -1.452  26.669 1.00 31.56  ? 93  GLU A CD  1 
ATOM   762  O  OE1 . GLU A 1 93  ? 2.161   -1.418  25.421 1.00 39.77  ? 93  GLU A OE1 1 
ATOM   763  O  OE2 . GLU A 1 93  ? 1.508   -0.780  27.418 1.00 35.98  ? 93  GLU A OE2 1 
ATOM   764  N  N   . TRP A 1 94  ? 6.488   -4.934  27.923 1.00 17.65  ? 94  TRP A N   1 
ATOM   765  C  CA  . TRP A 1 94  ? 6.917   -6.174  27.286 1.00 20.21  ? 94  TRP A CA  1 
ATOM   766  C  C   . TRP A 1 94  ? 5.820   -6.871  26.497 1.00 23.50  ? 94  TRP A C   1 
ATOM   767  O  O   . TRP A 1 94  ? 6.086   -7.510  25.521 1.00 23.37  ? 94  TRP A O   1 
ATOM   768  C  CB  . TRP A 1 94  ? 7.595   -7.177  28.257 1.00 19.26  ? 94  TRP A CB  1 
ATOM   769  C  CG  . TRP A 1 94  ? 7.320   -7.056  29.694 1.00 19.07  ? 94  TRP A CG  1 
ATOM   770  C  CD1 . TRP A 1 94  ? 8.111   -6.468  30.611 1.00 18.61  ? 94  TRP A CD1 1 
ATOM   771  C  CD2 . TRP A 1 94  ? 6.207   -7.569  30.416 1.00 18.62  ? 94  TRP A CD2 1 
ATOM   772  N  NE1 . TRP A 1 94  ? 7.573   -6.552  31.837 1.00 17.07  ? 94  TRP A NE1 1 
ATOM   773  C  CE2 . TRP A 1 94  ? 6.393   -7.221  31.752 1.00 17.98  ? 94  TRP A CE2 1 
ATOM   774  C  CE3 . TRP A 1 94  ? 5.062   -8.268  30.063 1.00 20.22  ? 94  TRP A CE3 1 
ATOM   775  C  CZ2 . TRP A 1 94  ? 5.505   -7.567  32.729 1.00 21.21  ? 94  TRP A CZ2 1 
ATOM   776  C  CZ3 . TRP A 1 94  ? 4.194   -8.612  31.029 1.00 19.87  ? 94  TRP A CZ3 1 
ATOM   777  C  CH2 . TRP A 1 94  ? 4.410   -8.262  32.350 1.00 18.93  ? 94  TRP A CH2 1 
ATOM   778  N  N   . GLU A 1 95  ? 4.593   -6.739  26.950 1.00 25.27  ? 95  GLU A N   1 
ATOM   779  C  CA  . GLU A 1 95  ? 3.494   -7.461  26.321 1.00 25.33  ? 95  GLU A CA  1 
ATOM   780  C  C   . GLU A 1 95  ? 3.273   -7.004  24.872 1.00 29.98  ? 95  GLU A C   1 
ATOM   781  O  O   . GLU A 1 95  ? 2.797   -7.775  24.036 1.00 31.13  ? 95  GLU A O   1 
ATOM   782  C  CB  . GLU A 1 95  ? 2.211   -7.385  27.167 1.00 27.09  ? 95  GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 95  ? 1.620   -5.999  27.336 1.00 28.37  ? 95  GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 95  ? 2.079   -5.304  28.620 1.00 30.10  ? 95  GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 95  ? 3.300   -5.288  28.894 1.00 24.59  ? 95  GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 95  ? 1.213   -4.777  29.351 1.00 31.65  ? 95  GLU A OE2 1 
ATOM   787  N  N   . THR A 1 96  ? 3.660   -5.767  24.569 1.00 27.05  ? 96  THR A N   1 
ATOM   788  C  CA  . THR A 1 96  ? 3.627   -5.253  23.196 1.00 31.60  ? 96  THR A CA  1 
ATOM   789  C  C   . THR A 1 96  ? 4.818   -5.748  22.358 1.00 30.37  ? 96  THR A C   1 
ATOM   790  O  O   . THR A 1 96  ? 4.678   -6.033  21.170 1.00 28.52  ? 96  THR A O   1 
ATOM   791  C  CB  . THR A 1 96  ? 3.558   -3.707  23.174 1.00 32.45  ? 96  THR A CB  1 
ATOM   792  O  OG1 . THR A 1 96  ? 2.300   -3.281  23.713 1.00 35.15  ? 96  THR A OG1 1 
ATOM   793  C  CG2 . THR A 1 96  ? 3.680   -3.174  21.751 1.00 33.87  ? 96  THR A CG2 1 
ATOM   794  N  N   . ASP A 1 97  ? 5.987   -5.859  22.981 1.00 27.50  ? 97  ASP A N   1 
ATOM   795  C  CA  . ASP A 1 97  ? 7.173   -6.389  22.307 1.00 25.54  ? 97  ASP A CA  1 
ATOM   796  C  C   . ASP A 1 97  ? 7.014   -7.868  21.982 1.00 28.83  ? 97  ASP A C   1 
ATOM   797  O  O   . ASP A 1 97  ? 7.649   -8.385  21.057 1.00 31.45  ? 97  ASP A O   1 
ATOM   798  C  CB  . ASP A 1 97  ? 8.407   -6.214  23.191 1.00 26.59  ? 97  ASP A CB  1 
ATOM   799  C  CG  . ASP A 1 97  ? 8.974   -4.820  23.135 1.00 28.66  ? 97  ASP A CG  1 
ATOM   800  O  OD1 . ASP A 1 97  ? 10.106  -4.639  23.635 1.00 28.19  ? 97  ASP A OD1 1 
ATOM   801  O  OD2 . ASP A 1 97  ? 8.304   -3.909  22.588 1.00 28.59  ? 97  ASP A OD2 1 
ATOM   802  N  N   . ALA A 1 98  ? 6.204   -8.543  22.767 1.00 22.60  ? 98  ALA A N   1 
ATOM   803  C  CA  . ALA A 1 98  ? 5.877   -9.937  22.577 1.00 26.27  ? 98  ALA A CA  1 
ATOM   804  C  C   . ALA A 1 98  ? 5.157   -10.190 21.245 1.00 30.63  ? 98  ALA A C   1 
ATOM   805  O  O   . ALA A 1 98  ? 5.171   -11.283 20.783 1.00 28.21  ? 98  ALA A O   1 
ATOM   806  C  CB  . ALA A 1 98  ? 5.009   -10.413 23.724 1.00 23.63  ? 98  ALA A CB  1 
ATOM   807  N  N   . GLN A 1 99  ? 4.521   -9.158  20.703 1.00 33.35  ? 99  GLN A N   1 
ATOM   808  C  CA  . GLN A 1 99  ? 3.860   -9.221  19.397 1.00 38.94  ? 99  GLN A CA  1 
ATOM   809  C  C   . GLN A 1 99  ? 4.820   -9.133  18.192 1.00 41.38  ? 99  GLN A C   1 
ATOM   810  O  O   . GLN A 1 99  ? 4.454   -9.410  17.082 1.00 44.24  ? 99  GLN A O   1 
ATOM   811  C  CB  . GLN A 1 99  ? 2.753   -8.178  19.268 1.00 41.21  ? 99  GLN A CB  1 
ATOM   812  C  CG  . GLN A 1 99  ? 3.230   -6.785  18.905 1.00 47.19  ? 99  GLN A CG  1 
ATOM   813  C  CD  . GLN A 1 99  ? 2.503   -6.157  17.701 1.00 54.52  ? 99  GLN A CD  1 
ATOM   814  O  OE1 . GLN A 1 99  ? 1.350   -6.483  17.406 1.00 56.02  ? 99  GLN A OE1 1 
ATOM   815  N  NE2 . GLN A 1 99  ? 3.181   -5.232  17.018 1.00 56.60  ? 99  GLN A NE2 1 
ATOM   816  N  N   . MET A 1 100 ? 6.040   -8.714  18.412 1.00 34.90  ? 100 MET A N   1 
ATOM   817  C  CA  . MET A 1 100 ? 7.032   -8.699  17.337 1.00 37.90  ? 100 MET A CA  1 
ATOM   818  C  C   . MET A 1 100 ? 7.453   -10.075 16.867 1.00 41.96  ? 100 MET A C   1 
ATOM   819  O  O   . MET A 1 100 ? 7.373   -11.009 17.595 1.00 39.33  ? 100 MET A O   1 
ATOM   820  C  CB  . MET A 1 100 ? 8.279   -7.924  17.750 1.00 37.86  ? 100 MET A CB  1 
ATOM   821  C  CG  . MET A 1 100 ? 8.007   -6.479  18.066 1.00 38.15  ? 100 MET A CG  1 
ATOM   822  S  SD  . MET A 1 100 ? 9.471   -5.597  18.583 1.00 41.45  ? 100 MET A SD  1 
ATOM   823  C  CE  . MET A 1 100 ? 10.417  -5.532  17.091 1.00 37.40  ? 100 MET A CE  1 
ATOM   824  N  N   . GLN A 1 101 ? 7.919   -10.148 15.627 1.00 47.43  ? 101 GLN A N   1 
ATOM   825  C  CA  . GLN A 1 101 ? 8.518   -11.341 15.052 1.00 48.71  ? 101 GLN A CA  1 
ATOM   826  C  C   . GLN A 1 101 ? 9.820   -11.651 15.783 1.00 49.06  ? 101 GLN A C   1 
ATOM   827  O  O   . GLN A 1 101 ? 10.106  -12.807 16.108 1.00 52.48  ? 101 GLN A O   1 
ATOM   828  C  CB  . GLN A 1 101 ? 8.791   -11.105 13.566 1.00 54.76  ? 101 GLN A CB  1 
ATOM   829  C  CG  . GLN A 1 101 ? 9.357   -12.291 12.802 1.00 60.02  ? 101 GLN A CG  1 
ATOM   830  C  CD  . GLN A 1 101 ? 9.508   -11.980 11.319 1.00 64.63  ? 101 GLN A CD  1 
ATOM   831  O  OE1 . GLN A 1 101 ? 9.030   -10.948 10.840 1.00 61.94  ? 101 GLN A OE1 1 
ATOM   832  N  NE2 . GLN A 1 101 ? 10.175  -12.868 10.587 1.00 65.35  ? 101 GLN A NE2 1 
ATOM   833  N  N   . ASP A 1 102 ? 10.608  -10.609 16.033 1.00 39.40  ? 102 ASP A N   1 
ATOM   834  C  CA  . ASP A 1 102 ? 11.820  -10.736 16.836 1.00 40.52  ? 102 ASP A CA  1 
ATOM   835  C  C   . ASP A 1 102 ? 11.872  -9.600  17.855 1.00 36.22  ? 102 ASP A C   1 
ATOM   836  O  O   . ASP A 1 102 ? 12.251  -8.478  17.518 1.00 33.69  ? 102 ASP A O   1 
ATOM   837  C  CB  . ASP A 1 102 ? 13.074  -10.734 15.953 1.00 41.26  ? 102 ASP A CB  1 
ATOM   838  C  CG  . ASP A 1 102 ? 14.359  -10.953 16.749 1.00 46.03  ? 102 ASP A CG  1 
ATOM   839  O  OD1 . ASP A 1 102 ? 14.278  -11.329 17.942 1.00 45.19  ? 102 ASP A OD1 1 
ATOM   840  O  OD2 . ASP A 1 102 ? 15.458  -10.765 16.178 1.00 48.50  ? 102 ASP A OD2 1 
ATOM   841  N  N   . PRO A 1 103 ? 11.470  -9.889  19.104 1.00 34.96  ? 103 PRO A N   1 
ATOM   842  C  CA  . PRO A 1 103 ? 11.443  -8.888  20.180 1.00 34.19  ? 103 PRO A CA  1 
ATOM   843  C  C   . PRO A 1 103 ? 12.809  -8.260  20.436 1.00 31.56  ? 103 PRO A C   1 
ATOM   844  O  O   . PRO A 1 103 ? 12.867  -7.147  20.954 1.00 31.44  ? 103 PRO A O   1 
ATOM   845  C  CB  . PRO A 1 103 ? 10.996  -9.699  21.399 1.00 32.87  ? 103 PRO A CB  1 
ATOM   846  C  CG  . PRO A 1 103 ? 10.188  -10.808 20.818 1.00 35.95  ? 103 PRO A CG  1 
ATOM   847  C  CD  . PRO A 1 103 ? 10.896  -11.174 19.539 1.00 35.78  ? 103 PRO A CD  1 
ATOM   848  N  N   . SER A 1 104 ? 13.883  -8.949  20.063 1.00 28.81  ? 104 SER A N   1 
ATOM   849  C  CA  . SER A 1 104 ? 15.225  -8.427  20.274 1.00 34.12  ? 104 SER A CA  1 
ATOM   850  C  C   . SER A 1 104 ? 15.481  -7.157  19.469 1.00 34.64  ? 104 SER A C   1 
ATOM   851  O  O   . SER A 1 104 ? 16.442  -6.434  19.732 1.00 35.70  ? 104 SER A O   1 
ATOM   852  C  CB  . SER A 1 104 ? 16.277  -9.489  19.941 1.00 36.01  ? 104 SER A CB  1 
ATOM   853  O  OG  . SER A 1 104 ? 16.347  -9.723  18.546 1.00 42.03  ? 104 SER A OG  1 
ATOM   854  N  N   . GLN A 1 105 ? 14.612  -6.884  18.501 1.00 33.12  ? 105 GLN A N   1 
ATOM   855  C  CA  . GLN A 1 105 ? 14.741  -5.714  17.642 1.00 32.67  ? 105 GLN A CA  1 
ATOM   856  C  C   . GLN A 1 105 ? 13.948  -4.525  18.171 1.00 32.74  ? 105 GLN A C   1 
ATOM   857  O  O   . GLN A 1 105 ? 13.900  -3.475  17.533 1.00 30.77  ? 105 GLN A O   1 
ATOM   858  C  CB  . GLN A 1 105 ? 14.287  -6.045  16.211 1.00 39.06  ? 105 GLN A CB  1 
ATOM   859  C  CG  . GLN A 1 105 ? 15.027  -7.221  15.586 1.00 39.10  ? 105 GLN A CG  1 
ATOM   860  C  CD  . GLN A 1 105 ? 16.531  -7.019  15.588 1.00 47.25  ? 105 GLN A CD  1 
ATOM   861  O  OE1 . GLN A 1 105 ? 17.030  -5.991  15.124 1.00 53.90  ? 105 GLN A OE1 1 
ATOM   862  N  NE2 . GLN A 1 105 ? 17.263  -7.992  16.129 1.00 50.23  ? 105 GLN A NE2 1 
ATOM   863  N  N   . SER A 1 106 ? 13.312  -4.698  19.327 1.00 29.52  ? 106 SER A N   1 
ATOM   864  C  CA  . SER A 1 106 ? 12.633  -3.595  19.995 1.00 28.62  ? 106 SER A CA  1 
ATOM   865  C  C   . SER A 1 106 ? 13.587  -2.414  20.179 1.00 26.94  ? 106 SER A C   1 
ATOM   866  O  O   . SER A 1 106 ? 14.790  -2.610  20.384 1.00 24.48  ? 106 SER A O   1 
ATOM   867  C  CB  . SER A 1 106 ? 12.103  -4.044  21.361 1.00 26.63  ? 106 SER A CB  1 
ATOM   868  O  OG  . SER A 1 106 ? 11.339  -3.014  21.973 1.00 26.60  ? 106 SER A OG  1 
ATOM   869  N  N   . GLN A 1 107 ? 13.095  -1.245  20.076 1.00 27.63  ? 107 GLN A N   1 
ATOM   870  C  CA  . GLN A 1 107 ? 13.912  -0.043  20.210 1.00 34.16  ? 107 GLN A CA  1 
ATOM   871  C  C   . GLN A 1 107 ? 14.494  0.096   21.613 1.00 31.33  ? 107 GLN A C   1 
ATOM   872  O  O   . GLN A 1 107 ? 15.402  0.889   21.832 1.00 31.13  ? 107 GLN A O   1 
ATOM   873  C  CB  . GLN A 1 107 ? 13.128  1.225   19.840 1.00 36.10  ? 107 GLN A CB  1 
ATOM   874  C  CG  . GLN A 1 107 ? 13.056  1.515   18.341 1.00 44.62  ? 107 GLN A CG  1 
ATOM   875  C  CD  . GLN A 1 107 ? 12.301  2.803   18.026 1.00 51.31  ? 107 GLN A CD  1 
ATOM   876  O  OE1 . GLN A 1 107 ? 11.067  2.852   18.102 1.00 54.93  ? 107 GLN A OE1 1 
ATOM   877  N  NE2 . GLN A 1 107 ? 13.041  3.855   17.677 1.00 45.99  ? 107 GLN A NE2 1 
ATOM   878  N  N   . ILE A 1 108 ? 13.968  -0.683  22.552 1.00 26.65  ? 108 ILE A N   1 
ATOM   879  C  CA  . ILE A 1 108 ? 14.448  -0.654  23.928 1.00 24.41  ? 108 ILE A CA  1 
ATOM   880  C  C   . ILE A 1 108 ? 15.899  -1.115  24.012 1.00 22.18  ? 108 ILE A C   1 
ATOM   881  O  O   . ILE A 1 108 ? 16.647  -0.688  24.891 1.00 23.20  ? 108 ILE A O   1 
ATOM   882  C  CB  . ILE A 1 108 ? 13.584  -1.539  24.847 1.00 21.07  ? 108 ILE A CB  1 
ATOM   883  C  CG1 . ILE A 1 108 ? 14.036  -1.398  26.302 1.00 17.23  ? 108 ILE A CG1 1 
ATOM   884  C  CG2 . ILE A 1 108 ? 13.650  -2.992  24.402 1.00 18.72  ? 108 ILE A CG2 1 
ATOM   885  C  CD1 . ILE A 1 108 ? 12.985  -1.808  27.310 1.00 17.22  ? 108 ILE A CD1 1 
ATOM   886  N  N   . TRP A 1 109 ? 16.291  -1.989  23.090 1.00 21.50  ? 109 TRP A N   1 
ATOM   887  C  CA  . TRP A 1 109 ? 17.646  -2.504  23.053 1.00 21.25  ? 109 TRP A CA  1 
ATOM   888  C  C   . TRP A 1 109 ? 18.493  -1.726  22.090 1.00 27.62  ? 109 TRP A C   1 
ATOM   889  O  O   . TRP A 1 109 ? 19.398  -2.286  21.435 1.00 26.27  ? 109 TRP A O   1 
ATOM   890  C  CB  . TRP A 1 109 ? 17.647  -3.981  22.677 1.00 22.54  ? 109 TRP A CB  1 
ATOM   891  C  CG  . TRP A 1 109 ? 16.664  -4.807  23.471 1.00 24.28  ? 109 TRP A CG  1 
ATOM   892  C  CD1 . TRP A 1 109 ? 15.512  -5.436  23.007 1.00 23.95  ? 109 TRP A CD1 1 
ATOM   893  C  CD2 . TRP A 1 109 ? 16.717  -5.124  24.906 1.00 22.19  ? 109 TRP A CD2 1 
ATOM   894  N  NE1 . TRP A 1 109 ? 14.872  -6.097  24.024 1.00 21.74  ? 109 TRP A NE1 1 
ATOM   895  C  CE2 . TRP A 1 109 ? 15.541  -5.950  25.187 1.00 22.14  ? 109 TRP A CE2 1 
ATOM   896  C  CE3 . TRP A 1 109 ? 17.586  -4.818  25.942 1.00 20.23  ? 109 TRP A CE3 1 
ATOM   897  C  CZ2 . TRP A 1 109 ? 15.271  -6.434  26.455 1.00 19.90  ? 109 TRP A CZ2 1 
ATOM   898  C  CZ3 . TRP A 1 109 ? 17.302  -5.313  27.217 1.00 18.94  ? 109 TRP A CZ3 1 
ATOM   899  C  CH2 . TRP A 1 109 ? 16.172  -6.101  27.465 1.00 21.17  ? 109 TRP A CH2 1 
ATOM   900  N  N   . SER A 1 110 ? 18.218  -0.430  21.984 1.00 28.46  ? 110 SER A N   1 
ATOM   901  C  CA  . SER A 1 110 ? 18.960  0.443   21.082 1.00 31.81  ? 110 SER A CA  1 
ATOM   902  C  C   . SER A 1 110 ? 20.336  0.777   21.647 1.00 35.33  ? 110 SER A C   1 
ATOM   903  O  O   . SER A 1 110 ? 20.536  0.776   22.862 1.00 29.37  ? 110 SER A O   1 
ATOM   904  C  CB  . SER A 1 110 ? 18.174  1.729   20.815 1.00 37.52  ? 110 SER A CB  1 
ATOM   905  O  OG  . SER A 1 110 ? 17.917  2.428   22.020 1.00 39.87  ? 110 SER A OG  1 
ATOM   906  N  N   . ALA A 1 111 ? 21.282  1.063   20.758 1.00 29.58  ? 111 ALA A N   1 
ATOM   907  C  CA  . ALA A 1 111 ? 22.640  1.400   21.167 1.00 28.04  ? 111 ALA A CA  1 
ATOM   908  C  C   . ALA A 1 111 ? 22.679  2.729   21.912 1.00 34.64  ? 111 ALA A C   1 
ATOM   909  O  O   . ALA A 1 111 ? 23.708  3.109   22.470 1.00 32.65  ? 111 ALA A O   1 
ATOM   910  C  CB  . ALA A 1 111 ? 23.563  1.440   19.958 1.00 33.39  ? 111 ALA A CB  1 
ATOM   911  N  N   . ASP A 1 112 ? 21.548  3.427   21.924 1.00 37.73  ? 112 ASP A N   1 
ATOM   912  C  CA  . ASP A 1 112 ? 21.439  4.699   22.626 1.00 40.28  ? 112 ASP A CA  1 
ATOM   913  C  C   . ASP A 1 112 ? 20.485  4.583   23.810 1.00 37.74  ? 112 ASP A C   1 
ATOM   914  O  O   . ASP A 1 112 ? 19.998  5.588   24.328 1.00 35.83  ? 112 ASP A O   1 
ATOM   915  C  CB  . ASP A 1 112 ? 20.964  5.798   21.673 1.00 41.83  ? 112 ASP A CB  1 
ATOM   916  C  CG  . ASP A 1 112 ? 19.454  5.846   21.545 1.00 45.84  ? 112 ASP A CG  1 
ATOM   917  O  OD1 . ASP A 1 112 ? 18.810  4.786   21.691 1.00 52.23  ? 112 ASP A OD1 1 
ATOM   918  O  OD2 . ASP A 1 112 ? 18.912  6.943   21.298 1.00 43.71  ? 112 ASP A OD2 1 
ATOM   919  N  N   . PHE A 1 113 ? 20.170  3.349   24.215 1.00 27.99  ? 113 PHE A N   1 
ATOM   920  C  CA  . PHE A 1 113 ? 19.315  3.120   25.383 1.00 25.42  ? 113 PHE A CA  1 
ATOM   921  C  C   . PHE A 1 113 ? 19.858  1.990   26.248 1.00 21.76  ? 113 PHE A C   1 
ATOM   922  O  O   . PHE A 1 113 ? 20.761  2.189   26.947 1.00 25.86  ? 113 PHE A O   1 
ATOM   923  C  CB  . PHE A 1 113 ? 17.840  2.996   25.040 1.00 26.50  ? 113 PHE A CB  1 
ATOM   924  C  CG  . PHE A 1 113 ? 16.909  3.270   26.180 1.00 23.67  ? 113 PHE A CG  1 
ATOM   925  C  CD1 . PHE A 1 113 ? 15.903  2.395   26.475 1.00 22.49  ? 113 PHE A CD1 1 
ATOM   926  C  CD2 . PHE A 1 113 ? 17.023  4.401   26.935 1.00 25.34  ? 113 PHE A CD2 1 
ATOM   927  C  CE1 . PHE A 1 113 ? 15.057  2.633   27.501 1.00 20.75  ? 113 PHE A CE1 1 
ATOM   928  C  CE2 . PHE A 1 113 ? 16.187  4.644   27.973 1.00 23.37  ? 113 PHE A CE2 1 
ATOM   929  C  CZ  . PHE A 1 113 ? 15.208  3.755   28.258 1.00 21.53  ? 113 PHE A CZ  1 
ATOM   930  N  N   . MET A 1 114 ? 19.330  0.808   26.149 1.00 20.04  ? 114 MET A N   1 
ATOM   931  C  CA  . MET A 1 114 ? 19.746  -0.307  26.990 1.00 19.59  ? 114 MET A CA  1 
ATOM   932  C  C   . MET A 1 114 ? 20.818  -1.186  26.353 1.00 19.96  ? 114 MET A C   1 
ATOM   933  O  O   . MET A 1 114 ? 21.444  -1.995  27.037 1.00 19.08  ? 114 MET A O   1 
ATOM   934  C  CB  . MET A 1 114 ? 18.536  -1.161  27.377 1.00 19.24  ? 114 MET A CB  1 
ATOM   935  C  CG  . MET A 1 114 ? 17.505  -0.431  28.223 1.00 20.07  ? 114 MET A CG  1 
ATOM   936  S  SD  . MET A 1 114 ? 18.062  -0.156  29.915 1.00 20.90  ? 114 MET A SD  1 
ATOM   937  C  CE  . MET A 1 114 ? 18.422  1.598   29.873 1.00 18.58  ? 114 MET A CE  1 
ATOM   938  N  N   . GLY A 1 115 ? 21.032  -1.036  25.049 1.00 23.30  ? 115 GLY A N   1 
ATOM   939  C  CA  . GLY A 1 115 ? 22.010  -1.868  24.370 1.00 21.87  ? 115 GLY A CA  1 
ATOM   940  C  C   . GLY A 1 115 ? 21.367  -3.211  24.103 1.00 24.98  ? 115 GLY A C   1 
ATOM   941  O  O   . GLY A 1 115 ? 20.236  -3.452  24.518 1.00 23.12  ? 115 GLY A O   1 
ATOM   942  N  N   . GLY A 1 116 ? 22.072  -4.099  23.418 1.00 21.16  ? 116 GLY A N   1 
ATOM   943  C  CA  . GLY A 1 116 ? 21.421  -5.279  22.899 1.00 23.40  ? 116 GLY A CA  1 
ATOM   944  C  C   . GLY A 1 116 ? 21.621  -6.550  23.683 1.00 26.28  ? 116 GLY A C   1 
ATOM   945  O  O   . GLY A 1 116 ? 22.045  -6.546  24.849 1.00 20.18  ? 116 GLY A O   1 
ATOM   946  N  N   . ASN A 1 117 ? 21.300  -7.649  23.010 1.00 27.41  ? 117 ASN A N   1 
ATOM   947  C  CA  . ASN A 1 117 ? 21.508  -8.989  23.523 1.00 27.90  ? 117 ASN A CA  1 
ATOM   948  C  C   . ASN A 1 117 ? 22.993  -9.243  23.731 1.00 26.59  ? 117 ASN A C   1 
ATOM   949  O  O   . ASN A 1 117 ? 23.828  -8.536  23.171 1.00 29.19  ? 117 ASN A O   1 
ATOM   950  C  CB  . ASN A 1 117 ? 20.925  -9.999  22.529 1.00 28.41  ? 117 ASN A CB  1 
ATOM   951  C  CG  . ASN A 1 117 ? 20.655  -11.343 23.160 1.00 30.00  ? 117 ASN A CG  1 
ATOM   952  O  OD1 . ASN A 1 117 ? 20.794  -11.507 24.369 1.00 25.58  ? 117 ASN A OD1 1 
ATOM   953  N  ND2 . ASN A 1 117 ? 20.254  -12.313 22.345 1.00 32.24  ? 117 ASN A ND2 1 
ATOM   954  N  N   . GLY A 1 118 ? 23.328  -10.223 24.562 1.00 22.59  ? 118 GLY A N   1 
ATOM   955  C  CA  . GLY A 1 118 ? 24.720  -10.578 24.785 1.00 26.34  ? 118 GLY A CA  1 
ATOM   956  C  C   . GLY A 1 118 ? 25.362  -11.160 23.536 1.00 32.26  ? 118 GLY A C   1 
ATOM   957  O  O   . GLY A 1 118 ? 24.670  -11.652 22.641 1.00 28.98  ? 118 GLY A O   1 
ATOM   958  N  N   . ASN A 1 119 ? 26.681  -11.129 23.483 1.00 34.19  ? 119 ASN A N   1 
ATOM   959  C  CA  . ASN A 1 119 ? 27.440  -11.660 22.352 1.00 37.41  ? 119 ASN A CA  1 
ATOM   960  C  C   . ASN A 1 119 ? 27.833  -13.110 22.592 1.00 37.79  ? 119 ASN A C   1 
ATOM   961  O  O   . ASN A 1 119 ? 28.623  -13.376 23.481 1.00 40.50  ? 119 ASN A O   1 
ATOM   962  C  CB  . ASN A 1 119 ? 28.702  -10.815 22.155 1.00 38.69  ? 119 ASN A CB  1 
ATOM   963  C  CG  . ASN A 1 119 ? 29.421  -11.098 20.838 1.00 44.70  ? 119 ASN A CG  1 
ATOM   964  O  OD1 . ASN A 1 119 ? 29.239  -12.130 20.229 1.00 45.06  ? 119 ASN A OD1 1 
ATOM   965  N  ND2 . ASN A 1 119 ? 30.250  -10.171 20.418 1.00 42.56  ? 119 ASN A ND2 1 
ATOM   966  N  N   . PRO A 1 120 ? 27.296  -14.051 21.787 1.00 35.55  ? 120 PRO A N   1 
ATOM   967  C  CA  . PRO A 1 120 ? 27.515  -15.496 21.958 1.00 36.76  ? 120 PRO A CA  1 
ATOM   968  C  C   . PRO A 1 120 ? 28.991  -15.894 22.072 1.00 42.26  ? 120 PRO A C   1 
ATOM   969  O  O   . PRO A 1 120 ? 29.313  -16.778 22.865 1.00 42.73  ? 120 PRO A O   1 
ATOM   970  C  CB  . PRO A 1 120 ? 26.908  -16.095 20.687 1.00 40.60  ? 120 PRO A CB  1 
ATOM   971  C  CG  . PRO A 1 120 ? 25.899  -15.116 20.257 1.00 37.56  ? 120 PRO A CG  1 
ATOM   972  C  CD  . PRO A 1 120 ? 26.442  -13.765 20.621 1.00 32.96  ? 120 PRO A CD  1 
ATOM   973  N  N   . ILE A 1 121 ? 29.846  -15.286 21.266 1.00 61.15  ? 121 ILE A N   1 
ATOM   974  C  CA  . ILE A 1 121 ? 31.242  -15.679 21.218 1.00 61.80  ? 121 ILE A CA  1 
ATOM   975  C  C   . ILE A 1 121 ? 32.056  -15.063 22.350 1.00 64.31  ? 121 ILE A C   1 
ATOM   976  O  O   . ILE A 1 121 ? 33.192  -15.439 22.565 1.00 65.96  ? 121 ILE A O   1 
ATOM   977  C  CB  . ILE A 1 121 ? 31.854  -15.410 19.838 1.00 64.71  ? 121 ILE A CB  1 
ATOM   978  C  CG1 . ILE A 1 121 ? 31.468  -14.059 19.328 1.00 63.25  ? 121 ILE A CG1 1 
ATOM   979  C  CG2 . ILE A 1 121 ? 31.338  -16.399 18.815 1.00 70.08  ? 121 ILE A CG2 1 
ATOM   980  C  CD1 . ILE A 1 121 ? 32.550  -13.450 18.480 1.00 63.22  ? 121 ILE A CD1 1 
ATOM   981  N  N   . LYS A 1 122 ? 31.450  -14.115 23.083 1.00 52.69  ? 122 LYS A N   1 
ATOM   982  C  CA  . LYS A 1 122 ? 32.030  -13.598 24.326 1.00 50.50  ? 122 LYS A CA  1 
ATOM   983  C  C   . LYS A 1 122 ? 31.250  -14.064 25.552 1.00 50.72  ? 122 LYS A C   1 
ATOM   984  O  O   . LYS A 1 122 ? 31.130  -13.359 26.497 1.00 48.00  ? 122 LYS A O   1 
ATOM   985  C  CB  . LYS A 1 122 ? 32.126  -12.077 24.361 1.00 48.33  ? 122 LYS A CB  1 
ATOM   986  C  CG  . LYS A 1 122 ? 32.722  -11.385 23.150 1.00 52.19  ? 122 LYS A CG  1 
ATOM   987  C  CD  . LYS A 1 122 ? 32.669  -9.873  23.314 1.00 57.71  ? 122 LYS A CD  1 
ATOM   988  C  CE  . LYS A 1 122 ? 32.811  -9.118  22.001 1.00 59.82  ? 122 LYS A CE  1 
ATOM   989  N  NZ  . LYS A 1 122 ? 33.421  -7.773  22.126 1.00 58.39  ? 122 LYS A NZ  1 
ATOM   990  N  N   . ASP A 1 123 ? 30.741  -15.271 25.508 1.00 47.03  ? 123 ASP A N   1 
ATOM   991  C  CA  . ASP A 1 123 ? 29.942  -15.814 26.579 1.00 49.57  ? 123 ASP A CA  1 
ATOM   992  C  C   . ASP A 1 123 ? 28.778  -14.893 27.035 1.00 41.40  ? 123 ASP A C   1 
ATOM   993  O  O   . ASP A 1 123 ? 28.528  -14.748 28.176 1.00 45.02  ? 123 ASP A O   1 
ATOM   994  C  CB  . ASP A 1 123 ? 30.791  -16.236 27.751 1.00 50.76  ? 123 ASP A CB  1 
ATOM   995  C  CG  . ASP A 1 123 ? 30.076  -17.204 28.621 1.00 55.45  ? 123 ASP A CG  1 
ATOM   996  O  OD1 . ASP A 1 123 ? 29.306  -18.017 28.084 1.00 62.32  ? 123 ASP A OD1 1 
ATOM   997  O  OD2 . ASP A 1 123 ? 30.246  -17.150 29.828 1.00 63.55  ? 123 ASP A OD2 1 
ATOM   998  N  N   . PHE A 1 124 ? 28.145  -14.292 26.072 1.00 35.25  ? 124 PHE A N   1 
ATOM   999  C  CA  . PHE A 1 124 ? 26.925  -13.484 26.218 1.00 34.86  ? 124 PHE A CA  1 
ATOM   1000 C  C   . PHE A 1 124 ? 27.099  -12.187 27.009 1.00 33.82  ? 124 PHE A C   1 
ATOM   1001 O  O   . PHE A 1 124 ? 26.136  -11.626 27.538 1.00 29.08  ? 124 PHE A O   1 
ATOM   1002 C  CB  . PHE A 1 124 ? 25.760  -14.325 26.754 1.00 36.58  ? 124 PHE A CB  1 
ATOM   1003 C  CG  . PHE A 1 124 ? 25.367  -15.449 25.837 1.00 33.61  ? 124 PHE A CG  1 
ATOM   1004 C  CD1 . PHE A 1 124 ? 24.640  -15.198 24.689 1.00 33.67  ? 124 PHE A CD1 1 
ATOM   1005 C  CD2 . PHE A 1 124 ? 25.736  -16.752 26.122 1.00 38.24  ? 124 PHE A CD2 1 
ATOM   1006 C  CE1 . PHE A 1 124 ? 24.284  -16.229 23.838 1.00 37.98  ? 124 PHE A CE1 1 
ATOM   1007 C  CE2 . PHE A 1 124 ? 25.384  -17.786 25.275 1.00 39.64  ? 124 PHE A CE2 1 
ATOM   1008 C  CZ  . PHE A 1 124 ? 24.658  -17.522 24.132 1.00 36.17  ? 124 PHE A CZ  1 
ATOM   1009 N  N   . ILE A 1 125 ? 28.337  -11.716 27.067 1.00 34.78  ? 125 ILE A N   1 
ATOM   1010 C  CA  . ILE A 1 125 ? 28.641  -10.375 27.539 1.00 34.03  ? 125 ILE A CA  1 
ATOM   1011 C  C   . ILE A 1 125 ? 28.002  -9.336  26.610 1.00 30.99  ? 125 ILE A C   1 
ATOM   1012 O  O   . ILE A 1 125 ? 28.050  -9.468  25.381 1.00 30.98  ? 125 ILE A O   1 
ATOM   1013 C  CB  . ILE A 1 125 ? 30.177  -10.162 27.618 1.00 34.65  ? 125 ILE A CB  1 
ATOM   1014 C  CG1 . ILE A 1 125 ? 30.760  -10.892 28.829 1.00 38.40  ? 125 ILE A CG1 1 
ATOM   1015 C  CG2 . ILE A 1 125 ? 30.524  -8.692  27.695 1.00 36.69  ? 125 ILE A CG2 1 
ATOM   1016 C  CD1 . ILE A 1 125 ? 30.519  -10.195 30.152 1.00 35.99  ? 125 ILE A CD1 1 
ATOM   1017 N  N   . VAL A 1 126 ? 27.381  -8.318  27.201 1.00 23.53  ? 126 VAL A N   1 
ATOM   1018 C  CA  . VAL A 1 126 ? 26.809  -7.220  26.444 1.00 26.42  ? 126 VAL A CA  1 
ATOM   1019 C  C   . VAL A 1 126 ? 27.948  -6.304  25.980 1.00 26.86  ? 126 VAL A C   1 
ATOM   1020 O  O   . VAL A 1 126 ? 28.720  -5.807  26.799 1.00 26.87  ? 126 VAL A O   1 
ATOM   1021 C  CB  . VAL A 1 126 ? 25.777  -6.427  27.299 1.00 25.32  ? 126 VAL A CB  1 
ATOM   1022 C  CG1 . VAL A 1 126 ? 25.294  -5.190  26.565 1.00 23.50  ? 126 VAL A CG1 1 
ATOM   1023 C  CG2 . VAL A 1 126 ? 24.587  -7.321  27.672 1.00 18.99  ? 126 VAL A CG2 1 
ATOM   1024 N  N   . ASP A 1 127 ? 28.061  -6.103  24.668 1.00 31.52  ? 127 ASP A N   1 
ATOM   1025 C  CA  . ASP A 1 127 ? 29.139  -5.289  24.105 1.00 36.26  ? 127 ASP A CA  1 
ATOM   1026 C  C   . ASP A 1 127 ? 28.614  -4.123  23.269 1.00 36.48  ? 127 ASP A C   1 
ATOM   1027 O  O   . ASP A 1 127 ? 29.359  -3.486  22.527 1.00 32.97  ? 127 ASP A O   1 
ATOM   1028 C  CB  . ASP A 1 127 ? 30.105  -6.154  23.287 1.00 41.21  ? 127 ASP A CB  1 
ATOM   1029 C  CG  . ASP A 1 127 ? 29.436  -6.820  22.086 1.00 44.24  ? 127 ASP A CG  1 
ATOM   1030 O  OD1 . ASP A 1 127 ? 28.192  -6.732  21.944 1.00 44.32  ? 127 ASP A OD1 1 
ATOM   1031 O  OD2 . ASP A 1 127 ? 30.162  -7.446  21.280 1.00 49.32  ? 127 ASP A OD2 1 
ATOM   1032 N  N   . THR A 1 128 ? 27.322  -3.854  23.397 1.00 31.06  ? 128 THR A N   1 
ATOM   1033 C  CA  . THR A 1 128 ? 26.702  -2.722  22.726 1.00 31.28  ? 128 THR A CA  1 
ATOM   1034 C  C   . THR A 1 128 ? 25.970  -1.851  23.748 1.00 31.59  ? 128 THR A C   1 
ATOM   1035 O  O   . THR A 1 128 ? 25.482  -2.354  24.757 1.00 26.84  ? 128 THR A O   1 
ATOM   1036 C  CB  . THR A 1 128 ? 25.733  -3.191  21.616 1.00 33.24  ? 128 THR A CB  1 
ATOM   1037 O  OG1 . THR A 1 128 ? 24.819  -4.166  22.139 1.00 31.27  ? 128 THR A OG1 1 
ATOM   1038 C  CG2 . THR A 1 128 ? 26.510  -3.820  20.462 1.00 34.32  ? 128 THR A CG2 1 
ATOM   1039 N  N   . GLY A 1 129 ? 25.909  -0.546  23.495 1.00 28.49  ? 129 GLY A N   1 
ATOM   1040 C  CA  . GLY A 1 129 ? 25.176  0.364   24.362 1.00 26.42  ? 129 GLY A CA  1 
ATOM   1041 C  C   . GLY A 1 129 ? 25.964  0.930   25.534 1.00 26.14  ? 129 GLY A C   1 
ATOM   1042 O  O   . GLY A 1 129 ? 27.141  0.619   25.724 1.00 25.14  ? 129 GLY A O   1 
ATOM   1043 N  N   . PRO A 1 130 ? 25.304  1.763   26.348 1.00 26.27  ? 130 PRO A N   1 
ATOM   1044 C  CA  . PRO A 1 130 ? 25.941  2.496   27.449 1.00 26.05  ? 130 PRO A CA  1 
ATOM   1045 C  C   . PRO A 1 130 ? 26.360  1.607   28.612 1.00 25.30  ? 130 PRO A C   1 
ATOM   1046 O  O   . PRO A 1 130 ? 27.161  2.043   29.445 1.00 25.83  ? 130 PRO A O   1 
ATOM   1047 C  CB  . PRO A 1 130 ? 24.851  3.479   27.898 1.00 26.01  ? 130 PRO A CB  1 
ATOM   1048 C  CG  . PRO A 1 130 ? 23.817  3.459   26.833 1.00 27.24  ? 130 PRO A CG  1 
ATOM   1049 C  CD  . PRO A 1 130 ? 23.879  2.090   26.227 1.00 24.94  ? 130 PRO A CD  1 
ATOM   1050 N  N   . PHE A 1 131 ? 25.840  0.378   28.667 1.00 20.19  ? 131 PHE A N   1 
ATOM   1051 C  CA  . PHE A 1 131 ? 26.136  -0.524  29.780 1.00 20.57  ? 131 PHE A CA  1 
ATOM   1052 C  C   . PHE A 1 131 ? 26.974  -1.720  29.351 1.00 21.19  ? 131 PHE A C   1 
ATOM   1053 O  O   . PHE A 1 131 ? 27.044  -2.731  30.048 1.00 18.44  ? 131 PHE A O   1 
ATOM   1054 C  CB  . PHE A 1 131 ? 24.836  -0.977  30.456 1.00 20.86  ? 131 PHE A CB  1 
ATOM   1055 C  CG  . PHE A 1 131 ? 23.921  0.156   30.770 1.00 19.47  ? 131 PHE A CG  1 
ATOM   1056 C  CD1 . PHE A 1 131 ? 22.775  0.363   30.031 1.00 18.85  ? 131 PHE A CD1 1 
ATOM   1057 C  CD2 . PHE A 1 131 ? 24.242  1.057   31.763 1.00 16.58  ? 131 PHE A CD2 1 
ATOM   1058 C  CE1 . PHE A 1 131 ? 21.943  1.428   30.307 1.00 18.26  ? 131 PHE A CE1 1 
ATOM   1059 C  CE2 . PHE A 1 131 ? 23.419  2.128   32.031 1.00 19.65  ? 131 PHE A CE2 1 
ATOM   1060 C  CZ  . PHE A 1 131 ? 22.270  2.316   31.302 1.00 17.75  ? 131 PHE A CZ  1 
ATOM   1061 N  N   . ALA A 1 132 ? 27.617  -1.588  28.201 1.00 25.29  ? 132 ALA A N   1 
ATOM   1062 C  CA  . ALA A 1 132 ? 28.476  -2.645  27.684 1.00 26.02  ? 132 ALA A CA  1 
ATOM   1063 C  C   . ALA A 1 132 ? 29.677  -2.842  28.597 1.00 29.28  ? 132 ALA A C   1 
ATOM   1064 O  O   . ALA A 1 132 ? 30.023  -1.953  29.379 1.00 27.87  ? 132 ALA A O   1 
ATOM   1065 C  CB  . ALA A 1 132 ? 28.931  -2.311  26.267 1.00 28.38  ? 132 ALA A CB  1 
ATOM   1066 N  N   . ALA A 1 133 ? 30.300  -4.013  28.502 1.00 36.94  ? 133 ALA A N   1 
ATOM   1067 C  CA  . ALA A 1 133 ? 31.488  -4.316  29.295 1.00 40.26  ? 133 ALA A CA  1 
ATOM   1068 C  C   . ALA A 1 133 ? 32.522  -3.226  29.045 1.00 41.08  ? 133 ALA A C   1 
ATOM   1069 O  O   . ALA A 1 133 ? 32.645  -2.733  27.918 1.00 42.73  ? 133 ALA A O   1 
ATOM   1070 C  CB  . ALA A 1 133 ? 32.050  -5.679  28.914 1.00 35.61  ? 133 ALA A CB  1 
ATOM   1071 N  N   . GLY A 1 134 ? 33.239  -2.836  30.093 1.00 38.76  ? 134 GLY A N   1 
ATOM   1072 C  CA  . GLY A 1 134 ? 34.219  -1.770  29.983 1.00 35.31  ? 134 GLY A CA  1 
ATOM   1073 C  C   . GLY A 1 134 ? 33.646  -0.398  30.285 1.00 37.69  ? 134 GLY A C   1 
ATOM   1074 O  O   . GLY A 1 134 ? 34.394  0.550   30.523 1.00 39.16  ? 134 GLY A O   1 
ATOM   1075 N  N   . ARG A 1 135 ? 32.321  -0.294  30.275 1.00 33.31  ? 135 ARG A N   1 
ATOM   1076 C  CA  . ARG A 1 135 ? 31.649  0.969   30.552 1.00 31.42  ? 135 ARG A CA  1 
ATOM   1077 C  C   . ARG A 1 135 ? 30.611  0.810   31.657 1.00 31.45  ? 135 ARG A C   1 
ATOM   1078 O  O   . ARG A 1 135 ? 29.899  1.756   31.995 1.00 27.67  ? 135 ARG A O   1 
ATOM   1079 C  CB  . ARG A 1 135 ? 30.988  1.514   29.284 1.00 35.94  ? 135 ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1 135 ? 31.969  1.896   28.188 1.00 39.59  ? 135 ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1 135 ? 31.291  2.715   27.102 1.00 42.12  ? 135 ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1 135 ? 30.316  1.929   26.352 1.00 46.59  ? 135 ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1 135 ? 30.552  1.379   25.166 1.00 52.40  ? 135 ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1 135 ? 31.737  1.528   24.588 1.00 53.26  ? 135 ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1 135 ? 29.605  0.680   24.556 1.00 41.47  ? 135 ARG A NH2 1 
ATOM   1086 N  N   . TRP A 1 136 ? 30.530  -0.392  32.218 1.00 25.05  ? 136 TRP A N   1 
ATOM   1087 C  CA  . TRP A 1 136 ? 29.584  -0.676  33.279 1.00 21.61  ? 136 TRP A CA  1 
ATOM   1088 C  C   . TRP A 1 136 ? 29.942  -1.941  34.001 1.00 23.35  ? 136 TRP A C   1 
ATOM   1089 O  O   . TRP A 1 136 ? 29.793  -3.055  33.453 1.00 24.72  ? 136 TRP A O   1 
ATOM   1090 C  CB  . TRP A 1 136 ? 28.169  -0.774  32.721 1.00 22.46  ? 136 TRP A CB  1 
ATOM   1091 C  CG  . TRP A 1 136 ? 27.130  -1.114  33.763 1.00 22.04  ? 136 TRP A CG  1 
ATOM   1092 C  CD1 . TRP A 1 136 ? 26.775  -2.376  34.229 1.00 22.17  ? 136 TRP A CD1 1 
ATOM   1093 C  CD2 . TRP A 1 136 ? 26.272  -0.179  34.507 1.00 17.70  ? 136 TRP A CD2 1 
ATOM   1094 N  NE1 . TRP A 1 136 ? 25.789  -2.288  35.179 1.00 20.22  ? 136 TRP A NE1 1 
ATOM   1095 C  CE2 . TRP A 1 136 ? 25.443  -1.001  35.392 1.00 16.59  ? 136 TRP A CE2 1 
ATOM   1096 C  CE3 . TRP A 1 136 ? 26.116  1.198   34.527 1.00 19.19  ? 136 TRP A CE3 1 
ATOM   1097 C  CZ2 . TRP A 1 136 ? 24.508  -0.444  36.247 1.00 16.73  ? 136 TRP A CZ2 1 
ATOM   1098 C  CZ3 . TRP A 1 136 ? 25.169  1.747   35.395 1.00 18.60  ? 136 TRP A CZ3 1 
ATOM   1099 C  CH2 . TRP A 1 136 ? 24.386  0.944   36.232 1.00 16.21  ? 136 TRP A CH2 1 
ATOM   1100 N  N   . THR A 1 137 ? 30.416  -1.799  35.235 1.00 25.28  ? 137 THR A N   1 
ATOM   1101 C  CA  . THR A 1 137 ? 30.800  -2.948  36.045 1.00 31.25  ? 137 THR A CA  1 
ATOM   1102 C  C   . THR A 1 137 ? 29.615  -3.478  36.846 1.00 30.05  ? 137 THR A C   1 
ATOM   1103 O  O   . THR A 1 137 ? 28.706  -2.726  37.197 1.00 28.54  ? 137 THR A O   1 
ATOM   1104 C  CB  . THR A 1 137 ? 31.946  -2.599  37.013 1.00 34.69  ? 137 THR A CB  1 
ATOM   1105 O  OG1 . THR A 1 137 ? 31.437  -1.810  38.096 1.00 38.80  ? 137 THR A OG1 1 
ATOM   1106 C  CG2 . THR A 1 137 ? 33.034  -1.820  36.291 1.00 41.35  ? 137 THR A CG2 1 
ATOM   1107 N  N   . THR A 1 138 ? 29.631  -4.776  37.130 1.00 26.94  ? 138 THR A N   1 
ATOM   1108 C  CA  . THR A 1 138 ? 28.559  -5.406  37.886 1.00 23.72  ? 138 THR A CA  1 
ATOM   1109 C  C   . THR A 1 138 ? 29.132  -5.950  39.183 1.00 25.17  ? 138 THR A C   1 
ATOM   1110 O  O   . THR A 1 138 ? 30.347  -6.079  39.317 1.00 26.87  ? 138 THR A O   1 
ATOM   1111 C  CB  . THR A 1 138 ? 27.893  -6.537  37.076 1.00 25.59  ? 138 THR A CB  1 
ATOM   1112 O  OG1 . THR A 1 138 ? 28.882  -7.509  36.714 1.00 26.17  ? 138 THR A OG1 1 
ATOM   1113 C  CG2 . THR A 1 138 ? 27.240  -5.973  35.818 1.00 21.79  ? 138 THR A CG2 1 
ATOM   1114 N  N   . ILE A 1 139 ? 28.278  -6.232  40.149 1.00 24.38  ? 139 ILE A N   1 
ATOM   1115 C  CA  . ILE A 1 139 ? 28.715  -6.845  41.381 1.00 22.34  ? 139 ILE A CA  1 
ATOM   1116 C  C   . ILE A 1 139 ? 27.952  -8.141  41.648 1.00 24.02  ? 139 ILE A C   1 
ATOM   1117 O  O   . ILE A 1 139 ? 26.875  -8.284  41.192 1.00 23.31  ? 139 ILE A O   1 
ATOM   1118 C  CB  . ILE A 1 139 ? 28.646  -5.863  42.542 1.00 27.32  ? 139 ILE A CB  1 
ATOM   1119 C  CG1 . ILE A 1 139 ? 27.201  -5.612  42.927 1.00 25.99  ? 139 ILE A CG1 1 
ATOM   1120 C  CG2 . ILE A 1 139 ? 29.315  -4.556  42.147 1.00 27.45  ? 139 ILE A CG2 1 
ATOM   1121 C  CD1 . ILE A 1 139 ? 26.979  -4.741  44.132 1.00 28.34  ? 139 ILE A CD1 1 
ATOM   1122 N  N   . ASP A 1 140 ? 28.529  -9.064  42.397 1.00 23.47  ? 140 ASP A N   1 
ATOM   1123 C  CA  . ASP A 1 140 ? 27.914  -10.344 42.662 1.00 25.70  ? 140 ASP A CA  1 
ATOM   1124 C  C   . ASP A 1 140 ? 27.107  -10.310 43.944 1.00 27.69  ? 140 ASP A C   1 
ATOM   1125 O  O   . ASP A 1 140 ? 26.967  -9.279  44.506 1.00 26.35  ? 140 ASP A O   1 
ATOM   1126 C  CB  . ASP A 1 140 ? 28.962  -11.445 42.736 1.00 29.97  ? 140 ASP A CB  1 
ATOM   1127 C  CG  . ASP A 1 140 ? 30.000  -11.211 43.820 1.00 35.25  ? 140 ASP A CG  1 
ATOM   1128 O  OD1 . ASP A 1 140 ? 29.783  -10.466 44.781 1.00 34.85  ? 140 ASP A OD1 1 
ATOM   1129 O  OD2 . ASP A 1 140 ? 31.063  -11.809 43.706 1.00 40.63  ? 140 ASP A OD2 1 
ATOM   1130 N  N   . GLU A 1 141 ? 26.665  -11.453 44.412 1.00 32.01  ? 141 GLU A N   1 
ATOM   1131 C  CA  . GLU A 1 141 ? 25.789  -11.504 45.559 1.00 40.92  ? 141 GLU A CA  1 
ATOM   1132 C  C   . GLU A 1 141 ? 26.551  -11.144 46.814 1.00 44.43  ? 141 GLU A C   1 
ATOM   1133 O  O   . GLU A 1 141 ? 25.990  -10.735 47.781 1.00 41.17  ? 141 GLU A O   1 
ATOM   1134 C  CB  . GLU A 1 141 ? 25.147  -12.877 45.706 1.00 44.48  ? 141 GLU A CB  1 
ATOM   1135 C  CG  . GLU A 1 141 ? 23.980  -13.149 44.755 1.00 50.24  ? 141 GLU A CG  1 
ATOM   1136 C  CD  . GLU A 1 141 ? 23.332  -14.525 44.972 1.00 62.71  ? 141 GLU A CD  1 
ATOM   1137 O  OE1 . GLU A 1 141 ? 23.315  -14.951 46.142 1.00 62.03  ? 141 GLU A OE1 1 
ATOM   1138 O  OE2 . GLU A 1 141 ? 22.898  -15.201 43.978 1.00 58.05  ? 141 GLU A OE2 1 
ATOM   1139 N  N   . GLN A 1 142 ? 27.857  -11.315 46.768 1.00 51.25  ? 142 GLN A N   1 
ATOM   1140 C  CA  . GLN A 1 142 ? 28.707  -10.996 47.929 1.00 52.70  ? 142 GLN A CA  1 
ATOM   1141 C  C   . GLN A 1 142 ? 29.155  -9.571  47.960 1.00 50.34  ? 142 GLN A C   1 
ATOM   1142 O  O   . GLN A 1 142 ? 29.751  -9.098  48.912 1.00 52.21  ? 142 GLN A O   1 
ATOM   1143 C  CB  . GLN A 1 142 ? 29.934  -11.886 47.987 1.00 57.02  ? 142 GLN A CB  1 
ATOM   1144 C  CG  . GLN A 1 142 ? 29.631  -13.252 48.495 1.00 62.73  ? 142 GLN A CG  1 
ATOM   1145 C  CD  . GLN A 1 142 ? 28.878  -13.251 49.806 1.00 66.84  ? 142 GLN A CD  1 
ATOM   1146 O  OE1 . GLN A 1 142 ? 29.268  -12.591 50.765 1.00 69.82  ? 142 GLN A OE1 1 
ATOM   1147 N  NE2 . GLN A 1 142 ? 27.788  -13.999 49.855 1.00 67.71  ? 142 GLN A NE2 1 
ATOM   1148 N  N   . GLY A 1 143 ? 28.880  -8.879  46.880 1.00 34.72  ? 143 GLY A N   1 
ATOM   1149 C  CA  . GLY A 1 143 ? 29.136  -7.446  46.854 1.00 27.89  ? 143 GLY A CA  1 
ATOM   1150 C  C   . GLY A 1 143 ? 30.481  -7.057  46.230 1.00 30.20  ? 143 GLY A C   1 
ATOM   1151 O  O   . GLY A 1 143 ? 30.965  -5.937  46.412 1.00 27.71  ? 143 GLY A O   1 
ATOM   1152 N  N   . ASN A 1 144 ? 31.069  -7.989  45.486 1.00 34.63  ? 144 ASN A N   1 
ATOM   1153 C  CA  . ASN A 1 144 ? 32.328  -7.742  44.796 1.00 32.91  ? 144 ASN A CA  1 
ATOM   1154 C  C   . ASN A 1 144 ? 32.128  -7.633  43.288 1.00 30.87  ? 144 ASN A C   1 
ATOM   1155 O  O   . ASN A 1 144 ? 31.085  -8.021  42.762 1.00 32.07  ? 144 ASN A O   1 
ATOM   1156 C  CB  . ASN A 1 144 ? 33.340  -8.844  45.115 1.00 36.67  ? 144 ASN A CB  1 
ATOM   1157 C  CG  . ASN A 1 144 ? 33.723  -8.876  46.582 1.00 36.13  ? 144 ASN A CG  1 
ATOM   1158 O  OD1 . ASN A 1 144 ? 34.137  -7.865  47.150 1.00 36.23  ? 144 ASN A OD1 1 
ATOM   1159 N  ND2 . ASN A 1 144 ? 33.586  -10.041 47.204 1.00 33.99  ? 144 ASN A ND2 1 
ATOM   1160 N  N   . PRO A 1 145 ? 33.132  -7.103  42.597 1.00 32.60  ? 145 PRO A N   1 
ATOM   1161 C  CA  . PRO A 1 145 ? 33.059  -6.932  41.142 1.00 34.09  ? 145 PRO A CA  1 
ATOM   1162 C  C   . PRO A 1 145 ? 32.928  -8.266  40.414 1.00 29.68  ? 145 PRO A C   1 
ATOM   1163 O  O   . PRO A 1 145 ? 33.715  -9.180  40.657 1.00 31.43  ? 145 PRO A O   1 
ATOM   1164 C  CB  . PRO A 1 145 ? 34.400  -6.278  40.804 1.00 32.30  ? 145 PRO A CB  1 
ATOM   1165 C  CG  . PRO A 1 145 ? 34.775  -5.541  42.043 1.00 34.60  ? 145 PRO A CG  1 
ATOM   1166 C  CD  . PRO A 1 145 ? 34.271  -6.377  43.185 1.00 26.80  ? 145 PRO A CD  1 
ATOM   1167 N  N   . SER A 1 146 ? 31.998  -8.380  39.498 1.00 26.68  ? 146 SER A N   1 
ATOM   1168 C  CA  . SER A 1 146 ? 31.761  -9.619  38.777 1.00 27.54  ? 146 SER A CA  1 
ATOM   1169 C  C   . SER A 1 146 ? 31.870  -9.566  37.262 1.00 32.84  ? 146 SER A C   1 
ATOM   1170 O  O   . SER A 1 146 ? 31.357  -10.422 36.606 1.00 36.49  ? 146 SER A O   1 
ATOM   1171 C  CB  . SER A 1 146 ? 30.374  -10.126 39.072 1.00 27.19  ? 146 SER A CB  1 
ATOM   1172 O  OG  . SER A 1 146 ? 29.476  -9.119  38.845 1.00 27.52  ? 146 SER A OG  1 
ATOM   1173 N  N   . GLY A 1 147 ? 32.494  -8.547  36.720 1.00 36.19  ? 147 GLY A N   1 
ATOM   1174 C  CA  . GLY A 1 147 ? 32.928  -8.576  35.349 1.00 39.89  ? 147 GLY A CA  1 
ATOM   1175 C  C   . GLY A 1 147 ? 32.143  -8.225  34.095 1.00 45.06  ? 147 GLY A C   1 
ATOM   1176 O  O   . GLY A 1 147 ? 32.620  -8.462  33.000 1.00 45.22  ? 147 GLY A O   1 
ATOM   1177 N  N   . GLY A 1 148 ? 30.974  -7.661  34.208 1.00 31.57  ? 148 GLY A N   1 
ATOM   1178 C  CA  . GLY A 1 148 ? 30.306  -7.329  32.991 1.00 30.27  ? 148 GLY A CA  1 
ATOM   1179 C  C   . GLY A 1 148 ? 28.889  -7.861  32.841 1.00 29.49  ? 148 GLY A C   1 
ATOM   1180 O  O   . GLY A 1 148 ? 28.593  -8.957  33.171 1.00 26.37  ? 148 GLY A O   1 
ATOM   1181 N  N   . LEU A 1 149 ? 28.055  -7.024  32.279 1.00 26.47  ? 149 LEU A N   1 
ATOM   1182 C  CA  . LEU A 1 149 ? 26.672  -7.344  32.061 1.00 22.29  ? 149 LEU A CA  1 
ATOM   1183 C  C   . LEU A 1 149 ? 26.540  -8.436  31.024 1.00 25.16  ? 149 LEU A C   1 
ATOM   1184 O  O   . LEU A 1 149 ? 27.178  -8.395  30.033 1.00 21.80  ? 149 LEU A O   1 
ATOM   1185 C  CB  . LEU A 1 149 ? 25.946  -6.096  31.623 1.00 21.86  ? 149 LEU A CB  1 
ATOM   1186 C  CG  . LEU A 1 149 ? 24.455  -6.164  31.578 1.00 22.73  ? 149 LEU A CG  1 
ATOM   1187 C  CD1 . LEU A 1 149 ? 23.889  -6.743  32.831 1.00 23.12  ? 149 LEU A CD1 1 
ATOM   1188 C  CD2 . LEU A 1 149 ? 23.752  -4.934  31.105 1.00 22.71  ? 149 LEU A CD2 1 
ATOM   1189 N  N   . LYS A 1 150 ? 25.681  -9.413  31.297 1.00 20.94  ? 150 LYS A N   1 
ATOM   1190 C  CA  . LYS A 1 150 ? 25.447  -10.513 30.369 1.00 22.29  ? 150 LYS A CA  1 
ATOM   1191 C  C   . LYS A 1 150 ? 23.955  -10.681 30.104 1.00 22.66  ? 150 LYS A C   1 
ATOM   1192 O  O   . LYS A 1 150 ? 23.131  -10.472 30.994 1.00 18.34  ? 150 LYS A O   1 
ATOM   1193 C  CB  . LYS A 1 150 ? 26.035  -11.814 30.919 1.00 24.33  ? 150 LYS A CB  1 
ATOM   1194 C  CG  . LYS A 1 150 ? 27.554  -11.841 30.958 1.00 27.38  ? 150 LYS A CG  1 
ATOM   1195 C  CD  . LYS A 1 150 ? 28.064  -13.019 31.772 1.00 34.06  ? 150 LYS A CD  1 
ATOM   1196 C  CE  . LYS A 1 150 ? 29.438  -13.465 31.297 1.00 40.10  ? 150 LYS A CE  1 
ATOM   1197 N  NZ  . LYS A 1 150 ? 29.892  -14.700 31.993 1.00 43.79  ? 150 LYS A NZ  1 
ATOM   1198 N  N   . ARG A 1 151 ? 23.534  -10.945 28.880 1.00 19.19  ? 151 ARG A N   1 
ATOM   1199 C  CA  . ARG A 1 151 ? 22.118  -11.123 28.544 1.00 20.08  ? 151 ARG A CA  1 
ATOM   1200 C  C   . ARG A 1 151 ? 22.064  -12.258 27.485 1.00 23.48  ? 151 ARG A C   1 
ATOM   1201 O  O   . ARG A 1 151 ? 22.954  -12.331 26.704 1.00 21.70  ? 151 ARG A O   1 
ATOM   1202 C  CB  . ARG A 1 151 ? 21.501  -9.848  27.951 1.00 21.26  ? 151 ARG A CB  1 
ATOM   1203 C  CG  . ARG A 1 151 ? 21.250  -8.655  28.873 1.00 21.26  ? 151 ARG A CG  1 
ATOM   1204 C  CD  . ARG A 1 151 ? 20.787  -7.432  28.127 1.00 20.34  ? 151 ARG A CD  1 
ATOM   1205 N  NE  . ARG A 1 151 ? 20.632  -6.248  28.943 1.00 21.06  ? 151 ARG A NE  1 
ATOM   1206 C  CZ  . ARG A 1 151 ? 20.809  -5.024  28.513 1.00 19.88  ? 151 ARG A CZ  1 
ATOM   1207 N  NH1 . ARG A 1 151 ? 21.173  -4.841  27.272 1.00 19.47  ? 151 ARG A NH1 1 
ATOM   1208 N  NH2 . ARG A 1 151 ? 20.628  -4.002  29.305 1.00 18.90  ? 151 ARG A NH2 1 
ATOM   1209 N  N   . ASN A 1 152 ? 21.094  -13.154 27.546 1.00 15.83  ? 152 ASN A N   1 
ATOM   1210 C  CA  . ASN A 1 152 ? 20.778  -14.151 26.530 1.00 19.71  ? 152 ASN A CA  1 
ATOM   1211 C  C   . ASN A 1 152 ? 19.270  -14.271 26.344 1.00 20.09  ? 152 ASN A C   1 
ATOM   1212 O  O   . ASN A 1 152 ? 18.609  -15.043 27.038 1.00 19.38  ? 152 ASN A O   1 
ATOM   1213 C  CB  . ASN A 1 152 ? 21.374  -15.509 26.905 1.00 20.43  ? 152 ASN A CB  1 
ATOM   1214 C  CG  . ASN A 1 152 ? 21.579  -16.407 25.701 1.00 25.04  ? 152 ASN A CG  1 
ATOM   1215 O  OD1 . ASN A 1 152 ? 21.191  -16.066 24.584 1.00 26.46  ? 152 ASN A OD1 1 
ATOM   1216 N  ND2 . ASN A 1 152 ? 22.193  -17.564 25.923 1.00 27.69  ? 152 ASN A ND2 1 
ATOM   1217 N  N   . PHE A 1 153 ? 18.731  -13.498 25.407 1.00 22.72  ? 153 PHE A N   1 
ATOM   1218 C  CA  . PHE A 1 153 ? 17.282  -13.450 25.189 1.00 23.66  ? 153 PHE A CA  1 
ATOM   1219 C  C   . PHE A 1 153 ? 16.682  -14.794 24.792 1.00 26.49  ? 153 PHE A C   1 
ATOM   1220 O  O   . PHE A 1 153 ? 17.132  -15.420 23.822 1.00 24.67  ? 153 PHE A O   1 
ATOM   1221 C  CB  . PHE A 1 153 ? 16.910  -12.415 24.110 1.00 22.43  ? 153 PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1 153 ? 17.304  -11.003 24.443 1.00 22.13  ? 153 PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1 153 ? 17.562  -10.625 25.746 1.00 22.12  ? 153 PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1 153 ? 17.403  -10.046 23.442 1.00 25.64  ? 153 PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1 153 ? 17.929  -9.333  26.051 1.00 21.21  ? 153 PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1 153 ? 17.765  -8.740  23.740 1.00 22.50  ? 153 PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1 153 ? 18.032  -8.390  25.048 1.00 24.08  ? 153 PHE A CZ  1 
ATOM   1228 N  N   . GLY A 1 154 ? 15.659  -15.220 25.534 1.00 23.40  ? 154 GLY A N   1 
ATOM   1229 C  CA  . GLY A 1 154 ? 14.867  -16.391 25.172 1.00 23.22  ? 154 GLY A CA  1 
ATOM   1230 C  C   . GLY A 1 154 ? 15.615  -17.708 25.093 1.00 28.24  ? 154 GLY A C   1 
ATOM   1231 O  O   . GLY A 1 154 ? 15.185  -18.630 24.392 1.00 30.30  ? 154 GLY A O   1 
ATOM   1232 N  N   . ALA A 1 155 ? 16.712  -17.818 25.831 1.00 25.96  ? 155 ALA A N   1 
ATOM   1233 C  CA  . ALA A 1 155 ? 17.612  -18.970 25.729 1.00 28.17  ? 155 ALA A CA  1 
ATOM   1234 C  C   . ALA A 1 155 ? 17.155  -20.227 26.462 1.00 33.17  ? 155 ALA A C   1 
ATOM   1235 O  O   . ALA A 1 155 ? 17.707  -21.304 26.233 1.00 34.42  ? 155 ALA A O   1 
ATOM   1236 C  CB  . ALA A 1 155 ? 18.998  -18.591 26.201 1.00 29.24  ? 155 ALA A CB  1 
ATOM   1237 N  N   . THR A 1 156 ? 16.190  -20.113 27.370 1.00 27.13  ? 156 THR A N   1 
ATOM   1238 C  CA  . THR A 1 156 ? 15.744  -21.238 28.170 1.00 28.66  ? 156 THR A CA  1 
ATOM   1239 C  C   . THR A 1 156 ? 14.464  -21.901 27.647 1.00 27.62  ? 156 THR A C   1 
ATOM   1240 O  O   . THR A 1 156 ? 13.678  -21.289 27.035 1.00 27.16  ? 156 THR A O   1 
ATOM   1241 C  CB  . THR A 1 156 ? 15.592  -20.917 29.690 1.00 28.63  ? 156 THR A CB  1 
ATOM   1242 O  OG1 . THR A 1 156 ? 14.403  -20.197 29.932 1.00 30.63  ? 156 THR A OG1 1 
ATOM   1243 C  CG2 . THR A 1 156 ? 16.745  -20.153 30.204 1.00 31.38  ? 156 THR A CG2 1 
ATOM   1244 N  N   . LYS A 1 157 ? 14.285  -23.168 27.953 1.00 33.12  ? 157 LYS A N   1 
ATOM   1245 C  CA  . LYS A 1 157 ? 13.152  -23.907 27.460 1.00 36.63  ? 157 LYS A CA  1 
ATOM   1246 C  C   . LYS A 1 157 ? 11.905  -23.456 28.127 1.00 37.26  ? 157 LYS A C   1 
ATOM   1247 O  O   . LYS A 1 157 ? 10.916  -23.446 27.520 1.00 38.33  ? 157 LYS A O   1 
ATOM   1248 C  CB  . LYS A 1 157 ? 13.288  -25.384 27.748 1.00 41.04  ? 157 LYS A CB  1 
ATOM   1249 C  CG  . LYS A 1 157 ? 14.209  -26.148 26.851 1.00 47.40  ? 157 LYS A CG  1 
ATOM   1250 C  CD  . LYS A 1 157 ? 13.962  -25.850 25.389 1.00 47.72  ? 157 LYS A CD  1 
ATOM   1251 C  CE  . LYS A 1 157 ? 14.963  -26.577 24.529 1.00 38.61  ? 157 LYS A CE  1 
ATOM   1252 N  NZ  . LYS A 1 157 ? 16.017  -27.274 25.312 1.00 31.13  ? 157 LYS A NZ  1 
ATOM   1253 N  N   . GLU A 1 158 ? 11.947  -23.106 29.393 1.00 35.29  ? 158 GLU A N   1 
ATOM   1254 C  CA  . GLU A 1 158 ? 10.715  -22.695 30.066 1.00 39.37  ? 158 GLU A CA  1 
ATOM   1255 C  C   . GLU A 1 158 ? 10.216  -21.312 29.745 1.00 34.79  ? 158 GLU A C   1 
ATOM   1256 O  O   . GLU A 1 158 ? 9.089   -21.066 29.908 1.00 38.92  ? 158 GLU A O   1 
ATOM   1257 C  CB  . GLU A 1 158 ? 10.795  -22.845 31.566 1.00 44.15  ? 158 GLU A CB  1 
ATOM   1258 C  CG  . GLU A 1 158 ? 12.185  -22.739 32.110 1.00 49.34  ? 158 GLU A CG  1 
ATOM   1259 C  CD  . GLU A 1 158 ? 13.089  -23.809 31.555 1.00 51.12  ? 158 GLU A CD  1 
ATOM   1260 O  OE1 . GLU A 1 158 ? 14.035  -24.240 32.246 1.00 45.37  ? 158 GLU A OE1 1 
ATOM   1261 O  OE2 . GLU A 1 158 ? 12.847  -24.237 30.447 1.00 50.90  ? 158 GLU A OE2 1 
ATOM   1262 N  N   . ALA A 1 159 ? 11.078  -20.428 29.276 1.00 26.68  ? 159 ALA A N   1 
ATOM   1263 C  CA  . ALA A 1 159 ? 10.683  -19.063 28.935 1.00 20.50  ? 159 ALA A CA  1 
ATOM   1264 C  C   . ALA A 1 159 ? 11.260  -18.630 27.610 1.00 22.35  ? 159 ALA A C   1 
ATOM   1265 O  O   . ALA A 1 159 ? 12.017  -17.735 27.564 1.00 21.38  ? 159 ALA A O   1 
ATOM   1266 C  CB  . ALA A 1 159 ? 11.056  -18.068 30.019 1.00 20.85  ? 159 ALA A CB  1 
ATOM   1267 N  N   . PRO A 1 160 ? 10.859  -19.284 26.521 1.00 26.63  ? 160 PRO A N   1 
ATOM   1268 C  CA  . PRO A 1 160 ? 11.383  -18.937 25.193 1.00 27.48  ? 160 PRO A CA  1 
ATOM   1269 C  C   . PRO A 1 160 ? 10.806  -17.626 24.637 1.00 27.16  ? 160 PRO A C   1 
ATOM   1270 O  O   . PRO A 1 160 ? 11.343  -17.063 23.681 1.00 27.74  ? 160 PRO A O   1 
ATOM   1271 C  CB  . PRO A 1 160 ? 10.938  -20.127 24.333 1.00 28.38  ? 160 PRO A CB  1 
ATOM   1272 C  CG  . PRO A 1 160 ? 9.665   -20.563 24.967 1.00 29.24  ? 160 PRO A CG  1 
ATOM   1273 C  CD  . PRO A 1 160 ? 9.858   -20.363 26.453 1.00 26.29  ? 160 PRO A CD  1 
ATOM   1274 N  N   . THR A 1 161 ? 9.741   -17.136 25.224 1.00 24.20  ? 161 THR A N   1 
ATOM   1275 C  CA  . THR A 1 161 ? 9.048   -15.960 24.727 1.00 23.35  ? 161 THR A CA  1 
ATOM   1276 C  C   . THR A 1 161 ? 8.631   -14.992 25.864 1.00 22.46  ? 161 THR A C   1 
ATOM   1277 O  O   . THR A 1 161 ? 8.530   -15.386 26.990 1.00 22.65  ? 161 THR A O   1 
ATOM   1278 C  CB  . THR A 1 161 ? 7.753   -16.363 23.961 1.00 29.23  ? 161 THR A CB  1 
ATOM   1279 O  OG1 . THR A 1 161 ? 6.845   -17.013 24.856 1.00 26.31  ? 161 THR A OG1 1 
ATOM   1280 C  CG2 . THR A 1 161 ? 8.057   -17.274 22.764 1.00 27.11  ? 161 THR A CG2 1 
ATOM   1281 N  N   . LEU A 1 162 ? 8.332   -13.763 25.502 1.00 18.13  ? 162 LEU A N   1 
ATOM   1282 C  CA  . LEU A 1 162 ? 7.821   -12.793 26.461 1.00 19.12  ? 162 LEU A CA  1 
ATOM   1283 C  C   . LEU A 1 162 ? 6.329   -13.008 26.703 1.00 22.03  ? 162 LEU A C   1 
ATOM   1284 O  O   . LEU A 1 162 ? 5.638   -13.528 25.834 1.00 20.09  ? 162 LEU A O   1 
ATOM   1285 C  CB  . LEU A 1 162 ? 8.066   -11.372 25.950 1.00 19.42  ? 162 LEU A CB  1 
ATOM   1286 C  CG  . LEU A 1 162 ? 9.520   -10.912 25.999 1.00 18.58  ? 162 LEU A CG  1 
ATOM   1287 C  CD1 . LEU A 1 162 ? 9.691   -9.669  25.147 1.00 20.94  ? 162 LEU A CD1 1 
ATOM   1288 C  CD2 . LEU A 1 162 ? 9.934   -10.646 27.447 1.00 16.48  ? 162 LEU A CD2 1 
ATOM   1289 N  N   . PRO A 1 163 ? 5.826   -12.602 27.886 1.00 24.10  ? 163 PRO A N   1 
ATOM   1290 C  CA  . PRO A 1 163 ? 4.385   -12.703 28.152 1.00 22.13  ? 163 PRO A CA  1 
ATOM   1291 C  C   . PRO A 1 163 ? 3.565   -11.832 27.198 1.00 25.91  ? 163 PRO A C   1 
ATOM   1292 O  O   . PRO A 1 163 ? 4.055   -10.806 26.718 1.00 25.44  ? 163 PRO A O   1 
ATOM   1293 C  CB  . PRO A 1 163 ? 4.239   -12.205 29.599 1.00 26.42  ? 163 PRO A CB  1 
ATOM   1294 C  CG  . PRO A 1 163 ? 5.536   -11.599 29.966 1.00 25.06  ? 163 PRO A CG  1 
ATOM   1295 C  CD  . PRO A 1 163 ? 6.588   -12.099 29.045 1.00 23.35  ? 163 PRO A CD  1 
ATOM   1296 N  N   . THR A 1 164 ? 2.326   -12.235 26.935 1.00 20.92  ? 164 THR A N   1 
ATOM   1297 C  CA  . THR A 1 164 ? 1.512   -11.590 25.908 1.00 22.04  ? 164 THR A CA  1 
ATOM   1298 C  C   . THR A 1 164 ? 0.468   -10.661 26.504 1.00 25.36  ? 164 THR A C   1 
ATOM   1299 O  O   . THR A 1 164 ? 0.222   -10.688 27.711 1.00 21.91  ? 164 THR A O   1 
ATOM   1300 C  CB  . THR A 1 164 ? 0.749   -12.637 25.095 1.00 25.20  ? 164 THR A CB  1 
ATOM   1301 O  OG1 . THR A 1 164 ? -0.172  -13.314 25.961 1.00 24.52  ? 164 THR A OG1 1 
ATOM   1302 C  CG2 . THR A 1 164 ? 1.715   -13.649 24.476 1.00 23.09  ? 164 THR A CG2 1 
ATOM   1303 N  N   . ARG A 1 165 ? -0.167  -9.874  25.642 0.80 16.83  ? 165 ARG A N   1 
ATOM   1304 C  CA  . ARG A 1 165 ? -1.246  -8.990  26.055 0.80 19.22  ? 165 ARG A CA  1 
ATOM   1305 C  C   . ARG A 1 165 ? -2.363  -9.771  26.741 0.80 20.32  ? 165 ARG A C   1 
ATOM   1306 O  O   . ARG A 1 165 ? -2.945  -9.298  27.717 0.80 18.31  ? 165 ARG A O   1 
ATOM   1307 C  CB  . ARG A 1 165 ? -1.801  -8.224  24.853 0.80 24.09  ? 165 ARG A CB  1 
ATOM   1308 C  CG  . ARG A 1 165 ? -0.812  -7.256  24.222 0.80 32.02  ? 165 ARG A CG  1 
ATOM   1309 C  CD  . ARG A 1 165 ? -1.454  -6.469  23.092 0.80 37.08  ? 165 ARG A CD  1 
ATOM   1310 N  NE  . ARG A 1 165 ? -1.269  -5.030  23.254 0.80 41.68  ? 165 ARG A NE  1 
ATOM   1311 C  CZ  . ARG A 1 165 ? -1.227  -4.164  22.246 0.80 46.14  ? 165 ARG A CZ  1 
ATOM   1312 N  NH1 . ARG A 1 165 ? -1.357  -4.590  20.997 0.80 44.38  ? 165 ARG A NH1 1 
ATOM   1313 N  NH2 . ARG A 1 165 ? -1.055  -2.872  22.487 0.80 44.69  ? 165 ARG A NH2 1 
ATOM   1314 N  N   . ASP A 1 166 ? -2.663  -10.964 26.233 1.00 33.35  ? 166 ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 166 ? -3.706  -11.770 26.828 1.00 33.38  ? 166 ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 166 ? -3.322  -12.337 28.195 1.00 33.87  ? 166 ASP A C   1 
ATOM   1317 O  O   . ASP A 1 166 ? -4.164  -12.492 29.042 1.00 33.73  ? 166 ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 166 ? -4.106  -12.885 25.881 1.00 37.53  ? 166 ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 166 ? -4.852  -12.376 24.705 1.00 49.91  ? 166 ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 166 ? -5.310  -11.224 24.742 1.00 57.47  ? 166 ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 166 ? -5.012  -13.142 23.738 1.00 50.65  ? 166 ASP A OD2 1 
ATOM   1322 N  N   . ASP A 1 167 ? -2.047  -12.650 28.373 1.00 28.05  ? 167 ASP A N   1 
ATOM   1323 C  CA  . ASP A 1 167 ? -1.512  -13.019 29.683 1.00 26.43  ? 167 ASP A CA  1 
ATOM   1324 C  C   . ASP A 1 167 ? -1.814  -11.916 30.706 1.00 25.48  ? 167 ASP A C   1 
ATOM   1325 O  O   . ASP A 1 167 ? -2.263  -12.196 31.819 1.00 27.29  ? 167 ASP A O   1 
ATOM   1326 C  CB  . ASP A 1 167 ? 0.007   -13.255 29.616 1.00 25.32  ? 167 ASP A CB  1 
ATOM   1327 C  CG  . ASP A 1 167 ? 0.383   -14.540 28.903 1.00 28.71  ? 167 ASP A CG  1 
ATOM   1328 O  OD1 . ASP A 1 167 ? -0.477  -15.442 28.799 1.00 36.28  ? 167 ASP A OD1 1 
ATOM   1329 O  OD2 . ASP A 1 167 ? 1.548   -14.657 28.444 1.00 26.41  ? 167 ASP A OD2 1 
ATOM   1330 N  N   . VAL A 1 168 ? -1.569  -10.663 30.326 1.00 22.15  ? 168 VAL A N   1 
ATOM   1331 C  CA  . VAL A 1 168 ? -1.823  -9.530  31.220 1.00 19.38  ? 168 VAL A CA  1 
ATOM   1332 C  C   . VAL A 1 168 ? -3.320  -9.342  31.473 1.00 23.31  ? 168 VAL A C   1 
ATOM   1333 O  O   . VAL A 1 168 ? -3.757  -9.189  32.615 1.00 19.66  ? 168 VAL A O   1 
ATOM   1334 C  CB  . VAL A 1 168 ? -1.227  -8.221  30.667 1.00 19.91  ? 168 VAL A CB  1 
ATOM   1335 C  CG1 . VAL A 1 168 ? -1.624  -7.032  31.544 1.00 19.02  ? 168 VAL A CG1 1 
ATOM   1336 C  CG2 . VAL A 1 168 ? 0.293   -8.334  30.548 1.00 18.21  ? 168 VAL A CG2 1 
ATOM   1337 N  N   . LEU A 1 169 ? -4.123  -9.341  30.409 1.00 25.25  ? 169 LEU A N   1 
ATOM   1338 C  CA  . LEU A 1 169 ? -5.588  -9.247  30.514 1.00 28.03  ? 169 LEU A CA  1 
ATOM   1339 C  C   . LEU A 1 169 ? -6.198  -10.291 31.443 1.00 25.51  ? 169 LEU A C   1 
ATOM   1340 O  O   . LEU A 1 169 ? -7.079  -10.001 32.222 1.00 26.32  ? 169 LEU A O   1 
ATOM   1341 C  CB  . LEU A 1 169 ? -6.235  -9.387  29.140 1.00 29.20  ? 169 LEU A CB  1 
ATOM   1342 C  CG  . LEU A 1 169 ? -6.591  -8.133  28.380 1.00 32.60  ? 169 LEU A CG  1 
ATOM   1343 C  CD1 . LEU A 1 169 ? -5.894  -6.957  28.899 1.00 34.26  ? 169 LEU A CD1 1 
ATOM   1344 C  CD2 . LEU A 1 169 ? -6.310  -8.325  26.940 1.00 34.40  ? 169 LEU A CD2 1 
ATOM   1345 N  N   . ASN A 1 170 ? -5.697  -11.508 31.339 1.00 25.06  ? 170 ASN A N   1 
ATOM   1346 C  CA  . ASN A 1 170 ? -6.212  -12.568 32.189 1.00 25.14  ? 170 ASN A CA  1 
ATOM   1347 C  C   . ASN A 1 170 ? -5.863  -12.361 33.666 1.00 30.28  ? 170 ASN A C   1 
ATOM   1348 O  O   . ASN A 1 170 ? -6.683  -12.646 34.540 1.00 26.80  ? 170 ASN A O   1 
ATOM   1349 C  CB  . ASN A 1 170 ? -5.780  -13.951 31.678 1.00 32.73  ? 170 ASN A CB  1 
ATOM   1350 C  CG  . ASN A 1 170 ? -6.480  -14.335 30.370 1.00 36.77  ? 170 ASN A CG  1 
ATOM   1351 O  OD1 . ASN A 1 170 ? -7.648  -14.001 30.158 1.00 38.88  ? 170 ASN A OD1 1 
ATOM   1352 N  ND2 . ASN A 1 170 ? -5.763  -15.025 29.487 1.00 36.29  ? 170 ASN A ND2 1 
ATOM   1353 N  N   . ALA A 1 171 ? -4.667  -11.834 33.943 1.00 24.13  ? 171 ALA A N   1 
ATOM   1354 C  CA  . ALA A 1 171 ? -4.287  -11.496 35.320 1.00 21.23  ? 171 ALA A CA  1 
ATOM   1355 C  C   . ALA A 1 171 ? -5.194  -10.397 35.870 1.00 20.12  ? 171 ALA A C   1 
ATOM   1356 O  O   . ALA A 1 171 ? -5.649  -10.468 37.012 1.00 20.80  ? 171 ALA A O   1 
ATOM   1357 C  CB  . ALA A 1 171 ? -2.810  -11.076 35.394 1.00 21.43  ? 171 ALA A CB  1 
ATOM   1358 N  N   . LEU A 1 172 ? -5.482  -9.401  35.037 1.00 22.71  ? 172 LEU A N   1 
ATOM   1359 C  CA  . LEU A 1 172 ? -6.312  -8.269  35.432 1.00 22.49  ? 172 LEU A CA  1 
ATOM   1360 C  C   . LEU A 1 172 ? -7.742  -8.665  35.832 1.00 25.32  ? 172 LEU A C   1 
ATOM   1361 O  O   . LEU A 1 172 ? -8.413  -7.934  36.559 1.00 24.95  ? 172 LEU A O   1 
ATOM   1362 C  CB  . LEU A 1 172 ? -6.327  -7.197  34.335 1.00 23.22  ? 172 LEU A CB  1 
ATOM   1363 C  CG  . LEU A 1 172 ? -5.024  -6.408  34.149 1.00 24.33  ? 172 LEU A CG  1 
ATOM   1364 C  CD1 . LEU A 1 172 ? -5.180  -5.335  33.087 1.00 23.47  ? 172 LEU A CD1 1 
ATOM   1365 C  CD2 . LEU A 1 172 ? -4.573  -5.795  35.481 1.00 20.71  ? 172 LEU A CD2 1 
ATOM   1366 N  N   . LYS A 1 173 ? -8.210  -9.830  35.410 1.00 23.59  ? 173 LYS A N   1 
ATOM   1367 C  CA  . LYS A 1 173 ? -9.548  -10.297 35.767 1.00 30.13  ? 173 LYS A CA  1 
ATOM   1368 C  C   . LYS A 1 173 ? -9.677  -10.889 37.165 1.00 27.65  ? 173 LYS A C   1 
ATOM   1369 O  O   . LYS A 1 173 ? -10.759 -11.011 37.673 1.00 28.18  ? 173 LYS A O   1 
ATOM   1370 C  CB  . LYS A 1 173 ? -10.035 -11.327 34.767 1.00 27.71  ? 173 LYS A CB  1 
ATOM   1371 C  CG  . LYS A 1 173 ? -10.178 -10.822 33.367 1.00 32.28  ? 173 LYS A CG  1 
ATOM   1372 C  CD  . LYS A 1 173 ? -10.582 -11.970 32.447 1.00 33.66  ? 173 LYS A CD  1 
ATOM   1373 C  CE  . LYS A 1 173 ? -10.993 -11.517 31.071 1.00 39.87  ? 173 LYS A CE  1 
ATOM   1374 N  NZ  . LYS A 1 173 ? -11.271 -12.699 30.222 1.00 43.21  ? 173 LYS A NZ  1 
ATOM   1375 N  N   . ILE A 1 174 ? -8.548  -11.266 37.761 1.00 23.41  ? 174 ILE A N   1 
ATOM   1376 C  CA  . ILE A 1 174 ? -8.566  -11.872 39.098 1.00 22.09  ? 174 ILE A CA  1 
ATOM   1377 C  C   . ILE A 1 174 ? -9.142  -10.917 40.143 1.00 21.84  ? 174 ILE A C   1 
ATOM   1378 O  O   . ILE A 1 174 ? -8.762  -9.751  40.198 1.00 20.66  ? 174 ILE A O   1 
ATOM   1379 C  CB  . ILE A 1 174 ? -7.161  -12.330 39.528 1.00 21.85  ? 174 ILE A CB  1 
ATOM   1380 C  CG1 . ILE A 1 174 ? -6.550  -13.246 38.470 1.00 20.32  ? 174 ILE A CG1 1 
ATOM   1381 C  CG2 . ILE A 1 174 ? -7.206  -13.044 40.880 1.00 19.11  ? 174 ILE A CG2 1 
ATOM   1382 C  CD1 . ILE A 1 174 ? -7.248  -14.577 38.344 1.00 30.03  ? 174 ILE A CD1 1 
ATOM   1383 N  N   . THR A 1 175 ? -10.056 -11.414 40.972 1.00 22.00  ? 175 THR A N   1 
ATOM   1384 C  CA  . THR A 1 175 ? -10.772 -10.556 41.920 1.00 26.26  ? 175 THR A CA  1 
ATOM   1385 C  C   . THR A 1 175 ? -10.041 -10.274 43.247 1.00 27.13  ? 175 THR A C   1 
ATOM   1386 O  O   . THR A 1 175 ? -10.250 -9.227  43.858 1.00 32.21  ? 175 THR A O   1 
ATOM   1387 C  CB  . THR A 1 175 ? -12.198 -11.101 42.224 1.00 30.73  ? 175 THR A CB  1 
ATOM   1388 O  OG1 . THR A 1 175 ? -12.112 -12.456 42.674 1.00 37.80  ? 175 THR A OG1 1 
ATOM   1389 C  CG2 . THR A 1 175 ? -13.047 -11.067 40.972 1.00 34.92  ? 175 THR A CG2 1 
ATOM   1390 N  N   . GLN A 1 176 ? -9.180  -11.191 43.682 1.00 26.37  ? 176 GLN A N   1 
ATOM   1391 C  CA  . GLN A 1 176 ? -8.494  -11.046 44.969 1.00 27.28  ? 176 GLN A CA  1 
ATOM   1392 C  C   . GLN A 1 176 ? -7.041  -10.613 44.808 1.00 22.34  ? 176 GLN A C   1 
ATOM   1393 O  O   . GLN A 1 176 ? -6.317  -11.177 43.988 1.00 22.53  ? 176 GLN A O   1 
ATOM   1394 C  CB  . GLN A 1 176 ? -8.517  -12.379 45.716 1.00 29.37  ? 176 GLN A CB  1 
ATOM   1395 C  CG  . GLN A 1 176 ? -9.912  -12.861 46.060 1.00 34.78  ? 176 GLN A CG  1 
ATOM   1396 C  CD  . GLN A 1 176 ? -10.562 -11.982 47.098 1.00 39.00  ? 176 GLN A CD  1 
ATOM   1397 O  OE1 . GLN A 1 176 ? -10.252 -12.077 48.286 1.00 46.27  ? 176 GLN A OE1 1 
ATOM   1398 N  NE2 . GLN A 1 176 ? -11.459 -11.109 46.659 1.00 43.69  ? 176 GLN A NE2 1 
ATOM   1399 N  N   . TYR A 1 177 ? -6.605  -9.642  45.606 1.00 16.78  ? 177 TYR A N   1 
ATOM   1400 C  CA  . TYR A 1 177 ? -5.194  -9.256  45.580 1.00 17.09  ? 177 TYR A CA  1 
ATOM   1401 C  C   . TYR A 1 177 ? -4.298  -10.469 45.837 1.00 16.31  ? 177 TYR A C   1 
ATOM   1402 O  O   . TYR A 1 177 ? -3.364  -10.732 45.080 1.00 15.51  ? 177 TYR A O   1 
ATOM   1403 C  CB  . TYR A 1 177 ? -4.871  -8.133  46.578 1.00 17.07  ? 177 TYR A CB  1 
ATOM   1404 C  CG  . TYR A 1 177 ? -3.375  -7.854  46.632 1.00 16.59  ? 177 TYR A CG  1 
ATOM   1405 C  CD1 . TYR A 1 177 ? -2.768  -7.023  45.700 1.00 15.80  ? 177 TYR A CD1 1 
ATOM   1406 C  CD2 . TYR A 1 177 ? -2.570  -8.468  47.585 1.00 16.22  ? 177 TYR A CD2 1 
ATOM   1407 C  CE1 . TYR A 1 177 ? -1.404  -6.790  45.730 1.00 13.18  ? 177 TYR A CE1 1 
ATOM   1408 C  CE2 . TYR A 1 177 ? -1.189  -8.250  47.622 1.00 15.74  ? 177 TYR A CE2 1 
ATOM   1409 C  CZ  . TYR A 1 177 ? -0.618  -7.410  46.692 1.00 13.55  ? 177 TYR A CZ  1 
ATOM   1410 O  OH  . TYR A 1 177 ? 0.737   -7.186  46.718 1.00 13.97  ? 177 TYR A OH  1 
ATOM   1411 N  N   . ASP A 1 178 ? -4.598  -11.215 46.899 1.00 16.05  ? 178 ASP A N   1 
ATOM   1412 C  CA  . ASP A 1 178 ? -3.826  -12.397 47.248 1.00 15.09  ? 178 ASP A CA  1 
ATOM   1413 C  C   . ASP A 1 178 ? -4.701  -13.301 48.111 1.00 21.33  ? 178 ASP A C   1 
ATOM   1414 O  O   . ASP A 1 178 ? -5.792  -12.906 48.534 1.00 20.43  ? 178 ASP A O   1 
ATOM   1415 C  CB  . ASP A 1 178 ? -2.550  -11.995 47.995 1.00 15.94  ? 178 ASP A CB  1 
ATOM   1416 C  CG  . ASP A 1 178 ? -1.409  -12.993 47.815 1.00 18.21  ? 178 ASP A CG  1 
ATOM   1417 O  OD1 . ASP A 1 178 ? -1.632  -14.099 47.269 1.00 18.22  ? 178 ASP A OD1 1 
ATOM   1418 O  OD2 . ASP A 1 178 ? -0.279  -12.667 48.251 1.00 17.38  ? 178 ASP A OD2 1 
ATOM   1419 N  N   . THR A 1 179 ? -4.228  -14.494 48.393 1.00 17.91  ? 179 THR A N   1 
ATOM   1420 C  CA  . THR A 1 179 ? -4.929  -15.512 49.139 1.00 19.22  ? 179 THR A CA  1 
ATOM   1421 C  C   . THR A 1 179 ? -3.976  -16.336 50.018 1.00 20.49  ? 179 THR A C   1 
ATOM   1422 O  O   . THR A 1 179 ? -2.851  -16.501 49.694 1.00 18.69  ? 179 THR A O   1 
ATOM   1423 C  CB  . THR A 1 179 ? -5.617  -16.524 48.193 1.00 21.06  ? 179 THR A CB  1 
ATOM   1424 O  OG1 . THR A 1 179 ? -4.653  -17.147 47.345 1.00 20.43  ? 179 THR A OG1 1 
ATOM   1425 C  CG2 . THR A 1 179 ? -6.660  -15.864 47.396 1.00 19.44  ? 179 THR A CG2 1 
ATOM   1426 N  N   . PRO A 1 180 ? -4.473  -16.873 51.120 1.00 24.78  ? 180 PRO A N   1 
ATOM   1427 C  CA  . PRO A 1 180 ? -3.630  -17.754 51.922 1.00 24.93  ? 180 PRO A CA  1 
ATOM   1428 C  C   . PRO A 1 180 ? -3.176  -18.906 51.068 1.00 24.60  ? 180 PRO A C   1 
ATOM   1429 O  O   . PRO A 1 180 ? -3.947  -19.298 50.246 1.00 25.41  ? 180 PRO A O   1 
ATOM   1430 C  CB  . PRO A 1 180 ? -4.597  -18.277 52.976 1.00 27.76  ? 180 PRO A CB  1 
ATOM   1431 C  CG  . PRO A 1 180 ? -5.642  -17.259 53.065 1.00 27.22  ? 180 PRO A CG  1 
ATOM   1432 C  CD  . PRO A 1 180 ? -5.835  -16.822 51.666 1.00 26.59  ? 180 PRO A CD  1 
ATOM   1433 N  N   . PRO A 1 181 ? -1.973  -19.431 51.290 1.00 21.69  ? 181 PRO A N   1 
ATOM   1434 C  CA  . PRO A 1 181 ? -1.145  -19.038 52.439 1.00 19.92  ? 181 PRO A CA  1 
ATOM   1435 C  C   . PRO A 1 181 ? -0.177  -17.885 52.169 1.00 21.22  ? 181 PRO A C   1 
ATOM   1436 O  O   . PRO A 1 181 ? 0.802   -17.728 52.899 1.00 20.98  ? 181 PRO A O   1 
ATOM   1437 C  CB  . PRO A 1 181 ? -0.360  -20.315 52.750 1.00 20.03  ? 181 PRO A CB  1 
ATOM   1438 C  CG  . PRO A 1 181 ? -0.276  -21.026 51.443 1.00 23.07  ? 181 PRO A CG  1 
ATOM   1439 C  CD  . PRO A 1 181 ? -1.568  -20.734 50.733 1.00 21.64  ? 181 PRO A CD  1 
ATOM   1440 N  N   . TRP A 1 182 ? -0.451  -17.092 51.141 1.00 17.98  ? 182 TRP A N   1 
ATOM   1441 C  CA  . TRP A 1 182 ? 0.362   -15.911 50.829 1.00 19.55  ? 182 TRP A CA  1 
ATOM   1442 C  C   . TRP A 1 182 ? 1.752   -16.295 50.331 1.00 18.65  ? 182 TRP A C   1 
ATOM   1443 O  O   . TRP A 1 182 ? 2.752   -15.743 50.770 1.00 17.59  ? 182 TRP A O   1 
ATOM   1444 C  CB  . TRP A 1 182 ? 0.475   -14.983 52.048 1.00 17.25  ? 182 TRP A CB  1 
ATOM   1445 C  CG  . TRP A 1 182 ? -0.743  -14.997 52.922 1.00 18.39  ? 182 TRP A CG  1 
ATOM   1446 C  CD1 . TRP A 1 182 ? -0.884  -15.626 54.131 1.00 21.32  ? 182 TRP A CD1 1 
ATOM   1447 C  CD2 . TRP A 1 182 ? -2.001  -14.374 52.645 1.00 18.42  ? 182 TRP A CD2 1 
ATOM   1448 N  NE1 . TRP A 1 182 ? -2.149  -15.413 54.631 1.00 24.04  ? 182 TRP A NE1 1 
ATOM   1449 C  CE2 . TRP A 1 182 ? -2.855  -14.650 53.734 1.00 21.63  ? 182 TRP A CE2 1 
ATOM   1450 C  CE3 . TRP A 1 182 ? -2.486  -13.602 51.586 1.00 19.02  ? 182 TRP A CE3 1 
ATOM   1451 C  CZ2 . TRP A 1 182 ? -4.166  -14.181 53.791 1.00 23.90  ? 182 TRP A CZ2 1 
ATOM   1452 C  CZ3 . TRP A 1 182 ? -3.794  -13.141 51.639 1.00 20.37  ? 182 TRP A CZ3 1 
ATOM   1453 C  CH2 . TRP A 1 182 ? -4.618  -13.430 52.739 1.00 23.02  ? 182 TRP A CH2 1 
ATOM   1454 N  N   . ASP A 1 183 ? 1.803   -17.201 49.391 1.00 15.76  ? 183 ASP A N   1 
ATOM   1455 C  CA  . ASP A 1 183 ? 3.053   -17.701 48.870 1.00 16.58  ? 183 ASP A CA  1 
ATOM   1456 C  C   . ASP A 1 183 ? 2.925   -18.217 47.442 1.00 16.30  ? 183 ASP A C   1 
ATOM   1457 O  O   . ASP A 1 183 ? 1.937   -17.988 46.829 1.00 20.20  ? 183 ASP A O   1 
ATOM   1458 C  CB  . ASP A 1 183 ? 3.652   -18.739 49.810 1.00 20.57  ? 183 ASP A CB  1 
ATOM   1459 C  CG  . ASP A 1 183 ? 2.941   -20.065 49.774 1.00 23.44  ? 183 ASP A CG  1 
ATOM   1460 O  OD1 . ASP A 1 183 ? 2.025   -20.237 48.997 1.00 22.48  ? 183 ASP A OD1 1 
ATOM   1461 O  OD2 . ASP A 1 183 ? 3.301   -20.951 50.543 1.00 29.42  ? 183 ASP A OD2 1 
ATOM   1462 N  N   . MET A 1 184 ? 3.955   -18.872 46.955 1.00 21.53  ? 184 MET A N   1 
ATOM   1463 C  CA  . MET A 1 184 ? 3.994   -19.351 45.607 1.00 24.73  ? 184 MET A CA  1 
ATOM   1464 C  C   . MET A 1 184 ? 2.832   -20.232 45.232 1.00 23.19  ? 184 MET A C   1 
ATOM   1465 O  O   . MET A 1 184 ? 2.531   -20.404 44.109 1.00 24.34  ? 184 MET A O   1 
ATOM   1466 C  CB  . MET A 1 184 ? 5.225   -20.211 45.443 1.00 24.48  ? 184 MET A CB  1 
ATOM   1467 C  CG  . MET A 1 184 ? 6.336   -19.495 44.855 1.00 31.33  ? 184 MET A CG  1 
ATOM   1468 S  SD  . MET A 1 184 ? 7.785   -20.557 44.901 1.00 57.25  ? 184 MET A SD  1 
ATOM   1469 C  CE  . MET A 1 184 ? 8.844   -19.305 45.578 1.00 34.91  ? 184 MET A CE  1 
ATOM   1470 N  N   . THR A 1 185 ? 2.242   -20.838 46.227 1.00 19.79  ? 185 THR A N   1 
ATOM   1471 C  CA  . THR A 1 185 ? 1.149   -21.756 46.015 1.00 20.05  ? 185 THR A CA  1 
ATOM   1472 C  C   . THR A 1 185 ? -0.243  -21.136 46.033 1.00 23.96  ? 185 THR A C   1 
ATOM   1473 O  O   . THR A 1 185 ? -1.196  -21.818 45.786 1.00 22.32  ? 185 THR A O   1 
ATOM   1474 C  CB  . THR A 1 185 ? 1.151   -22.950 46.962 1.00 20.49  ? 185 THR A CB  1 
ATOM   1475 O  OG1 . THR A 1 185 ? 0.695   -22.540 48.233 1.00 19.88  ? 185 THR A OG1 1 
ATOM   1476 C  CG2 . THR A 1 185 ? 2.525   -23.575 47.039 1.00 23.39  ? 185 THR A CG2 1 
ATOM   1477 N  N   . SER A 1 186 ? -0.323  -19.843 46.330 1.00 19.87  ? 186 SER A N   1 
ATOM   1478 C  CA  . SER A 1 186 ? -1.603  -19.146 46.380 1.00 18.78  ? 186 SER A CA  1 
ATOM   1479 C  C   . SER A 1 186 ? -2.356  -19.276 45.060 1.00 24.46  ? 186 SER A C   1 
ATOM   1480 O  O   . SER A 1 186 ? -1.766  -19.168 43.985 1.00 20.34  ? 186 SER A O   1 
ATOM   1481 C  CB  . SER A 1 186 ? -1.395  -17.669 46.723 1.00 17.24  ? 186 SER A CB  1 
ATOM   1482 O  OG  . SER A 1 186 ? -0.946  -17.515 48.058 1.00 16.50  ? 186 SER A OG  1 
ATOM   1483 N  N   . GLN A 1 187 ? -3.661  -19.509 45.150 1.00 24.40  ? 187 GLN A N   1 
ATOM   1484 C  CA  . GLN A 1 187 ? -4.497  -19.652 43.964 1.00 26.20  ? 187 GLN A CA  1 
ATOM   1485 C  C   . GLN A 1 187 ? -5.475  -18.488 43.837 1.00 26.95  ? 187 GLN A C   1 
ATOM   1486 O  O   . GLN A 1 187 ? -5.808  -17.834 44.825 1.00 23.02  ? 187 GLN A O   1 
ATOM   1487 C  CB  . GLN A 1 187 ? -5.260  -20.977 44.003 1.00 27.87  ? 187 GLN A CB  1 
ATOM   1488 C  CG  . GLN A 1 187 ? -4.367  -22.208 44.006 1.00 31.93  ? 187 GLN A CG  1 
ATOM   1489 C  CD  . GLN A 1 187 ? -3.381  -22.214 42.855 1.00 37.17  ? 187 GLN A CD  1 
ATOM   1490 O  OE1 . GLN A 1 187 ? -3.772  -22.262 41.688 1.00 42.14  ? 187 GLN A OE1 1 
ATOM   1491 N  NE2 . GLN A 1 187 ? -2.094  -22.166 43.177 1.00 38.30  ? 187 GLN A NE2 1 
ATOM   1492 N  N   . ASN A 1 188 ? -5.930  -18.235 42.614 1.00 24.59  ? 188 ASN A N   1 
ATOM   1493 C  CA  . ASN A 1 188 ? -6.868  -17.150 42.356 1.00 26.44  ? 188 ASN A CA  1 
ATOM   1494 C  C   . ASN A 1 188 ? -6.405  -15.831 42.964 1.00 25.58  ? 188 ASN A C   1 
ATOM   1495 O  O   . ASN A 1 188 ? -7.218  -15.021 43.408 1.00 21.55  ? 188 ASN A O   1 
ATOM   1496 C  CB  . ASN A 1 188 ? -8.261  -17.509 42.878 1.00 29.91  ? 188 ASN A CB  1 
ATOM   1497 C  CG  . ASN A 1 188 ? -8.785  -18.806 42.294 1.00 40.89  ? 188 ASN A CG  1 
ATOM   1498 O  OD1 . ASN A 1 188 ? -9.208  -19.703 43.024 1.00 50.81  ? 188 ASN A OD1 1 
ATOM   1499 N  ND2 . ASN A 1 188 ? -8.761  -18.912 40.971 1.00 43.60  ? 188 ASN A ND2 1 
ATOM   1500 N  N   . SER A 1 189 ? -5.092  -15.622 42.982 1.00 19.61  ? 189 SER A N   1 
ATOM   1501 C  CA  . SER A 1 189 ? -4.518  -14.402 43.537 1.00 18.92  ? 189 SER A CA  1 
ATOM   1502 C  C   . SER A 1 189 ? -3.835  -13.572 42.455 1.00 17.34  ? 189 SER A C   1 
ATOM   1503 O  O   . SER A 1 189 ? -3.003  -14.080 41.702 1.00 19.63  ? 189 SER A O   1 
ATOM   1504 C  CB  . SER A 1 189 ? -3.523  -14.737 44.650 1.00 21.28  ? 189 SER A CB  1 
ATOM   1505 O  OG  . SER A 1 189 ? -2.354  -13.942 44.545 1.00 20.65  ? 189 SER A OG  1 
ATOM   1506 N  N   . PHE A 1 190 ? -4.191  -12.294 42.384 1.00 15.87  ? 190 PHE A N   1 
ATOM   1507 C  CA  . PHE A 1 190 ? -3.610  -11.386 41.390 1.00 17.24  ? 190 PHE A CA  1 
ATOM   1508 C  C   . PHE A 1 190 ? -2.099  -11.289 41.587 1.00 15.50  ? 190 PHE A C   1 
ATOM   1509 O  O   . PHE A 1 190 ? -1.334  -11.294 40.624 1.00 14.41  ? 190 PHE A O   1 
ATOM   1510 C  CB  . PHE A 1 190 ? -4.237  -9.991  41.467 1.00 16.43  ? 190 PHE A CB  1 
ATOM   1511 C  CG  . PHE A 1 190 ? -3.514  -8.968  40.633 1.00 16.84  ? 190 PHE A CG  1 
ATOM   1512 C  CD1 . PHE A 1 190 ? -3.562  -9.030  39.245 1.00 17.46  ? 190 PHE A CD1 1 
ATOM   1513 C  CD2 . PHE A 1 190 ? -2.762  -7.969  41.234 1.00 18.10  ? 190 PHE A CD2 1 
ATOM   1514 C  CE1 . PHE A 1 190 ? -2.879  -8.103  38.468 1.00 15.88  ? 190 PHE A CE1 1 
ATOM   1515 C  CE2 . PHE A 1 190 ? -2.077  -7.035  40.471 1.00 14.94  ? 190 PHE A CE2 1 
ATOM   1516 C  CZ  . PHE A 1 190 ? -2.135  -7.102  39.084 1.00 16.86  ? 190 PHE A CZ  1 
ATOM   1517 N  N   . ARG A 1 191 ? -1.679  -11.222 42.846 1.00 14.42  ? 191 ARG A N   1 
ATOM   1518 C  CA  . ARG A 1 191 ? -0.262  -11.068 43.164 1.00 15.38  ? 191 ARG A CA  1 
ATOM   1519 C  C   . ARG A 1 191 ? 0.529   -12.276 42.647 1.00 15.66  ? 191 ARG A C   1 
ATOM   1520 O  O   . ARG A 1 191 ? 1.552   -12.112 41.967 1.00 13.99  ? 191 ARG A O   1 
ATOM   1521 C  CB  . ARG A 1 191 ? -0.075  -10.847 44.681 1.00 15.43  ? 191 ARG A CB  1 
ATOM   1522 C  CG  . ARG A 1 191 ? 1.367   -10.515 45.160 1.00 12.26  ? 191 ARG A CG  1 
ATOM   1523 C  CD  . ARG A 1 191 ? 2.233   -11.768 45.282 1.00 13.18  ? 191 ARG A CD  1 
ATOM   1524 N  NE  . ARG A 1 191 ? 1.588   -12.847 46.035 1.00 13.51  ? 191 ARG A NE  1 
ATOM   1525 C  CZ  . ARG A 1 191 ? 1.984   -14.116 45.990 1.00 15.82  ? 191 ARG A CZ  1 
ATOM   1526 N  NH1 . ARG A 1 191 ? 3.024   -14.466 45.242 1.00 14.11  ? 191 ARG A NH1 1 
ATOM   1527 N  NH2 . ARG A 1 191 ? 1.339   -15.043 46.686 1.00 16.57  ? 191 ARG A NH2 1 
ATOM   1528 N  N   . ASN A 1 192 ? 0.051   -13.485 42.945 1.00 13.24  ? 192 ASN A N   1 
ATOM   1529 C  CA  . ASN A 1 192 ? 0.780   -14.681 42.541 1.00 15.37  ? 192 ASN A CA  1 
ATOM   1530 C  C   . ASN A 1 192 ? 0.736   -14.873 41.031 1.00 16.57  ? 192 ASN A C   1 
ATOM   1531 O  O   . ASN A 1 192 ? 1.684   -15.380 40.433 1.00 15.84  ? 192 ASN A O   1 
ATOM   1532 C  CB  . ASN A 1 192 ? 0.246   -15.932 43.234 1.00 16.86  ? 192 ASN A CB  1 
ATOM   1533 C  CG  . ASN A 1 192 ? 1.299   -17.028 43.336 1.00 18.83  ? 192 ASN A CG  1 
ATOM   1534 O  OD1 . ASN A 1 192 ? 2.477   -16.750 43.567 1.00 16.39  ? 192 ASN A OD1 1 
ATOM   1535 N  ND2 . ASN A 1 192 ? 0.883   -18.270 43.155 1.00 19.20  ? 192 ASN A ND2 1 
ATOM   1536 N  N   . GLN A 1 193 ? -0.377  -14.480 40.427 1.00 15.43  ? 193 GLN A N   1 
ATOM   1537 C  CA  . GLN A 1 193 ? -0.510  -14.561 38.970 1.00 16.64  ? 193 GLN A CA  1 
ATOM   1538 C  C   . GLN A 1 193 ? 0.475   -13.627 38.263 1.00 17.13  ? 193 GLN A C   1 
ATOM   1539 O  O   . GLN A 1 193 ? 1.202   -14.029 37.349 1.00 18.13  ? 193 GLN A O   1 
ATOM   1540 C  CB  . GLN A 1 193 ? -1.930  -14.205 38.548 1.00 19.95  ? 193 GLN A CB  1 
ATOM   1541 C  CG  . GLN A 1 193 ? -2.165  -14.390 37.065 1.00 22.98  ? 193 GLN A CG  1 
ATOM   1542 C  CD  . GLN A 1 193 ? -2.419  -15.832 36.720 1.00 30.96  ? 193 GLN A CD  1 
ATOM   1543 O  OE1 . GLN A 1 193 ? -3.162  -16.518 37.420 1.00 35.89  ? 193 GLN A OE1 1 
ATOM   1544 N  NE2 . GLN A 1 193 ? -1.792  -16.313 35.648 1.00 37.93  ? 193 GLN A NE2 1 
ATOM   1545 N  N   . LEU A 1 194 ? 0.484   -12.372 38.682 1.00 13.91  ? 194 LEU A N   1 
ATOM   1546 C  CA  . LEU A 1 194 ? 1.403   -11.391 38.114 1.00 15.58  ? 194 LEU A CA  1 
ATOM   1547 C  C   . LEU A 1 194 ? 2.870   -11.724 38.397 1.00 15.63  ? 194 LEU A C   1 
ATOM   1548 O  O   . LEU A 1 194 ? 3.718   -11.581 37.518 1.00 15.95  ? 194 LEU A O   1 
ATOM   1549 C  CB  . LEU A 1 194 ? 1.052   -9.987  38.600 1.00 14.62  ? 194 LEU A CB  1 
ATOM   1550 C  CG  . LEU A 1 194 ? 1.899   -8.816  38.090 1.00 16.91  ? 194 LEU A CG  1 
ATOM   1551 C  CD1 . LEU A 1 194 ? 1.999   -8.830  36.564 1.00 18.22  ? 194 LEU A CD1 1 
ATOM   1552 C  CD2 . LEU A 1 194 ? 1.298   -7.523  38.579 1.00 14.30  ? 194 LEU A CD2 1 
ATOM   1553 N  N   . GLU A 1 195 ? 3.168   -12.179 39.613 1.00 15.87  ? 195 GLU A N   1 
ATOM   1554 C  CA  . GLU A 1 195 ? 4.547   -12.513 39.955 1.00 16.76  ? 195 GLU A CA  1 
ATOM   1555 C  C   . GLU A 1 195 ? 5.036   -13.653 39.065 1.00 19.11  ? 195 GLU A C   1 
ATOM   1556 O  O   . GLU A 1 195 ? 6.216   -13.730 38.712 1.00 18.68  ? 195 GLU A O   1 
ATOM   1557 C  CB  . GLU A 1 195 ? 4.701   -12.860 41.443 1.00 17.25  ? 195 GLU A CB  1 
ATOM   1558 C  CG  . GLU A 1 195 ? 6.174   -12.990 41.862 1.00 20.35  ? 195 GLU A CG  1 
ATOM   1559 C  CD  . GLU A 1 195 ? 6.401   -13.028 43.368 1.00 22.90  ? 195 GLU A CD  1 
ATOM   1560 O  OE1 . GLU A 1 195 ? 7.593   -13.017 43.766 1.00 17.29  ? 195 GLU A OE1 1 
ATOM   1561 O  OE2 . GLU A 1 195 ? 5.409   -13.088 44.140 1.00 20.38  ? 195 GLU A OE2 1 
ATOM   1562 N  N   . GLY A 1 196 ? 4.114   -14.533 38.694 1.00 19.44  ? 196 GLY A N   1 
ATOM   1563 C  CA  . GLY A 1 196 ? 4.367   -15.502 37.647 1.00 18.04  ? 196 GLY A CA  1 
ATOM   1564 C  C   . GLY A 1 196 ? 4.430   -16.949 38.081 1.00 23.38  ? 196 GLY A C   1 
ATOM   1565 O  O   . GLY A 1 196 ? 5.009   -17.783 37.380 1.00 20.16  ? 196 GLY A O   1 
ATOM   1566 N  N   . PHE A 1 197 ? 3.814   -17.255 39.217 1.00 22.69  ? 197 PHE A N   1 
ATOM   1567 C  CA  . PHE A 1 197 ? 3.915   -18.590 39.799 1.00 24.01  ? 197 PHE A CA  1 
ATOM   1568 C  C   . PHE A 1 197 ? 2.667   -19.467 39.648 1.00 28.71  ? 197 PHE A C   1 
ATOM   1569 O  O   . PHE A 1 197 ? 2.642   -20.592 40.146 1.00 31.06  ? 197 PHE A O   1 
ATOM   1570 C  CB  . PHE A 1 197 ? 4.311   -18.500 41.269 1.00 22.86  ? 197 PHE A CB  1 
ATOM   1571 C  CG  . PHE A 1 197 ? 5.705   -18.015 41.479 1.00 23.84  ? 197 PHE A CG  1 
ATOM   1572 C  CD1 . PHE A 1 197 ? 6.782   -18.782 41.070 1.00 27.84  ? 197 PHE A CD1 1 
ATOM   1573 C  CD2 . PHE A 1 197 ? 5.944   -16.787 42.076 1.00 26.05  ? 197 PHE A CD2 1 
ATOM   1574 C  CE1 . PHE A 1 197 ? 8.078   -18.343 41.251 1.00 31.19  ? 197 PHE A CE1 1 
ATOM   1575 C  CE2 . PHE A 1 197 ? 7.241   -16.337 42.268 1.00 27.75  ? 197 PHE A CE2 1 
ATOM   1576 C  CZ  . PHE A 1 197 ? 8.312   -17.114 41.849 1.00 33.49  ? 197 PHE A CZ  1 
ATOM   1577 N  N   . ILE A 1 198 ? 1.634   -18.961 38.986 1.00 25.18  ? 198 ILE A N   1 
ATOM   1578 C  CA  . ILE A 1 198 ? 0.494   -19.809 38.641 1.00 31.04  ? 198 ILE A CA  1 
ATOM   1579 C  C   . ILE A 1 198 ? 0.791   -20.452 37.297 1.00 32.63  ? 198 ILE A C   1 
ATOM   1580 O  O   . ILE A 1 198 ? 0.791   -19.761 36.274 1.00 31.17  ? 198 ILE A O   1 
ATOM   1581 C  CB  . ILE A 1 198 ? -0.812  -19.013 38.510 1.00 29.76  ? 198 ILE A CB  1 
ATOM   1582 C  CG1 . ILE A 1 198 ? -1.108  -18.259 39.800 1.00 29.24  ? 198 ILE A CG1 1 
ATOM   1583 C  CG2 . ILE A 1 198 ? -1.971  -19.949 38.172 1.00 34.38  ? 198 ILE A CG2 1 
ATOM   1584 C  CD1 . ILE A 1 198 ? -1.374  -19.161 40.935 1.00 30.34  ? 198 ILE A CD1 1 
ATOM   1585 N  N   . ASN A 1 199 ? 1.059   -21.757 37.306 1.00 39.29  ? 199 ASN A N   1 
ATOM   1586 C  CA  . ASN A 1 199 ? 1.456   -22.471 36.094 1.00 41.41  ? 199 ASN A CA  1 
ATOM   1587 C  C   . ASN A 1 199 ? 2.702   -21.857 35.461 1.00 41.05  ? 199 ASN A C   1 
ATOM   1588 O  O   . ASN A 1 199 ? 2.745   -21.653 34.250 1.00 39.70  ? 199 ASN A O   1 
ATOM   1589 C  CB  . ASN A 1 199 ? 0.315   -22.468 35.069 1.00 45.81  ? 199 ASN A CB  1 
ATOM   1590 C  CG  . ASN A 1 199 ? -0.724  -23.533 35.341 1.00 54.15  ? 199 ASN A CG  1 
ATOM   1591 O  OD1 . ASN A 1 199 ? -1.644  -23.335 36.139 1.00 52.82  ? 199 ASN A OD1 1 
ATOM   1592 N  ND2 . ASN A 1 199 ? -0.593  -24.668 34.661 1.00 57.03  ? 199 ASN A ND2 1 
ATOM   1593 N  N   . GLY A 1 200 ? 3.710   -21.570 36.285 1.00 35.01  ? 200 GLY A N   1 
ATOM   1594 C  CA  . GLY A 1 200 ? 4.865   -20.789 35.868 1.00 35.74  ? 200 GLY A CA  1 
ATOM   1595 C  C   . GLY A 1 200 ? 5.852   -21.464 34.931 1.00 37.25  ? 200 GLY A C   1 
ATOM   1596 O  O   . GLY A 1 200 ? 5.733   -22.649 34.652 1.00 37.74  ? 200 GLY A O   1 
ATOM   1597 N  N   . PRO A 1 201 ? 6.826   -20.699 34.449 1.00 35.04  ? 201 PRO A N   1 
ATOM   1598 C  CA  . PRO A 1 201 ? 6.946   -19.283 34.814 1.00 30.63  ? 201 PRO A CA  1 
ATOM   1599 C  C   . PRO A 1 201 ? 6.250   -18.371 33.809 1.00 28.90  ? 201 PRO A C   1 
ATOM   1600 O  O   . PRO A 1 201 ? 6.517   -18.455 32.610 1.00 28.99  ? 201 PRO A O   1 
ATOM   1601 C  CB  . PRO A 1 201 ? 8.456   -19.045 34.781 1.00 31.14  ? 201 PRO A CB  1 
ATOM   1602 C  CG  . PRO A 1 201 ? 8.965   -20.037 33.792 1.00 32.67  ? 201 PRO A CG  1 
ATOM   1603 C  CD  . PRO A 1 201 ? 8.095   -21.252 33.946 1.00 35.62  ? 201 PRO A CD  1 
ATOM   1604 N  N   . GLN A 1 202 ? 5.361   -17.512 34.296 1.00 17.05  ? 202 GLN A N   1 
ATOM   1605 C  CA  . GLN A 1 202 ? 4.616   -16.612 33.423 1.00 19.17  ? 202 GLN A CA  1 
ATOM   1606 C  C   . GLN A 1 202 ? 4.659   -15.172 33.922 1.00 17.14  ? 202 GLN A C   1 
ATOM   1607 O  O   . GLN A 1 202 ? 4.771   -14.922 35.122 1.00 13.79  ? 202 GLN A O   1 
ATOM   1608 C  CB  . GLN A 1 202 ? 3.164   -17.077 33.291 1.00 22.09  ? 202 GLN A CB  1 
ATOM   1609 C  CG  . GLN A 1 202 ? 3.009   -18.572 33.058 1.00 23.75  ? 202 GLN A CG  1 
ATOM   1610 C  CD  . GLN A 1 202 ? 2.891   -18.923 31.588 1.00 28.79  ? 202 GLN A CD  1 
ATOM   1611 O  OE1 . GLN A 1 202 ? 2.782   -18.043 30.734 1.00 26.71  ? 202 GLN A OE1 1 
ATOM   1612 N  NE2 . GLN A 1 202 ? 2.910   -20.216 31.286 1.00 29.89  ? 202 GLN A NE2 1 
ATOM   1613 N  N   . LEU A 1 203 ? 4.569   -14.229 32.990 1.00 17.29  ? 203 LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 203 ? 4.577   -12.811 33.327 1.00 19.46  ? 203 LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 203 ? 5.915   -12.378 33.916 1.00 17.59  ? 203 LEU A C   1 
ATOM   1616 O  O   . LEU A 1 203 ? 6.967   -12.575 33.307 1.00 16.30  ? 203 LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 203 ? 3.444   -12.487 34.303 1.00 16.73  ? 203 LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 203 ? 2.039   -12.396 33.704 1.00 19.46  ? 203 LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 203 ? 0.983   -12.474 34.796 1.00 20.60  ? 203 LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 203 ? 1.882   -11.121 32.891 1.00 21.19  ? 203 LEU A CD2 1 
ATOM   1621 N  N   . HIS A 1 204 ? 5.866   -11.786 35.104 1.00 15.50  ? 204 HIS A N   1 
ATOM   1622 C  CA  . HIS A 1 204 ? 7.059   -11.300 35.770 1.00 14.38  ? 204 HIS A CA  1 
ATOM   1623 C  C   . HIS A 1 204 ? 8.183   -12.293 35.705 1.00 13.81  ? 204 HIS A C   1 
ATOM   1624 O  O   . HIS A 1 204 ? 9.201   -12.060 35.019 1.00 13.88  ? 204 HIS A O   1 
ATOM   1625 C  CB  . HIS A 1 204 ? 6.754   -10.952 37.222 1.00 15.58  ? 204 HIS A CB  1 
ATOM   1626 C  CG  . HIS A 1 204 ? 7.985   -10.803 38.084 1.00 15.25  ? 204 HIS A CG  1 
ATOM   1627 N  ND1 . HIS A 1 204 ? 8.814   -9.749  37.985 1.00 15.35  ? 204 HIS A ND1 1 
ATOM   1628 C  CD2 . HIS A 1 204 ? 8.509   -11.623 39.082 1.00 14.23  ? 204 HIS A CD2 1 
ATOM   1629 C  CE1 . HIS A 1 204 ? 9.819   -9.883  38.871 1.00 16.53  ? 204 HIS A CE1 1 
ATOM   1630 N  NE2 . HIS A 1 204 ? 9.630   -11.031 39.542 1.00 16.89  ? 204 HIS A NE2 1 
ATOM   1631 N  N   . ASP A 1 205 ? 8.026   -13.407 36.412 1.00 13.47  ? 205 ASP A N   1 
ATOM   1632 C  CA  . ASP A 1 205 ? 9.067   -14.430 36.470 1.00 16.47  ? 205 ASP A CA  1 
ATOM   1633 C  C   . ASP A 1 205 ? 9.556   -14.800 35.066 1.00 16.34  ? 205 ASP A C   1 
ATOM   1634 O  O   . ASP A 1 205 ? 10.738  -15.048 34.862 1.00 14.94  ? 205 ASP A O   1 
ATOM   1635 C  CB  . ASP A 1 205 ? 8.566   -15.681 37.206 1.00 17.31  ? 205 ASP A CB  1 
ATOM   1636 C  CG  . ASP A 1 205 ? 9.700   -16.638 37.586 1.00 28.97  ? 205 ASP A CG  1 
ATOM   1637 O  OD1 . ASP A 1 205 ? 10.651  -16.206 38.273 1.00 35.09  ? 205 ASP A OD1 1 
ATOM   1638 O  OD2 . ASP A 1 205 ? 9.646   -17.822 37.191 1.00 29.17  ? 205 ASP A OD2 1 
ATOM   1639 N  N   . ARG A 1 206 ? 8.633   -14.816 34.109 1.00 16.60  ? 206 ARG A N   1 
ATOM   1640 C  CA  . ARG A 1 206 ? 8.956   -15.161 32.723 1.00 16.68  ? 206 ARG A CA  1 
ATOM   1641 C  C   . ARG A 1 206 ? 9.889   -14.136 32.071 1.00 16.99  ? 206 ARG A C   1 
ATOM   1642 O  O   . ARG A 1 206 ? 10.774  -14.495 31.275 1.00 15.12  ? 206 ARG A O   1 
ATOM   1643 C  CB  . ARG A 1 206 ? 7.677   -15.297 31.906 1.00 19.91  ? 206 ARG A CB  1 
ATOM   1644 C  CG  . ARG A 1 206 ? 7.856   -16.066 30.603 1.00 20.45  ? 206 ARG A CG  1 
ATOM   1645 C  CD  . ARG A 1 206 ? 6.523   -16.292 29.906 1.00 23.43  ? 206 ARG A CD  1 
ATOM   1646 N  NE  . ARG A 1 206 ? 6.710   -16.985 28.638 1.00 25.09  ? 206 ARG A NE  1 
ATOM   1647 C  CZ  . ARG A 1 206 ? 6.575   -18.296 28.468 1.00 28.58  ? 206 ARG A CZ  1 
ATOM   1648 N  NH1 . ARG A 1 206 ? 6.230   -19.077 29.487 1.00 26.96  ? 206 ARG A NH1 1 
ATOM   1649 N  NH2 . ARG A 1 206 ? 6.776   -18.825 27.265 1.00 28.68  ? 206 ARG A NH2 1 
ATOM   1650 N  N   . VAL A 1 207 ? 9.697   -12.868 32.417 1.00 13.22  ? 207 VAL A N   1 
ATOM   1651 C  CA  . VAL A 1 207 ? 10.506  -11.797 31.845 1.00 15.83  ? 207 VAL A CA  1 
ATOM   1652 C  C   . VAL A 1 207 ? 11.941  -11.936 32.330 1.00 16.47  ? 207 VAL A C   1 
ATOM   1653 O  O   . VAL A 1 207 ? 12.865  -11.888 31.519 1.00 16.09  ? 207 VAL A O   1 
ATOM   1654 C  CB  . VAL A 1 207 ? 9.934   -10.377 32.131 1.00 16.34  ? 207 VAL A CB  1 
ATOM   1655 C  CG1 . VAL A 1 207 ? 10.887  -9.290  31.638 1.00 17.03  ? 207 VAL A CG1 1 
ATOM   1656 C  CG2 . VAL A 1 207 ? 8.563   -10.202 31.473 1.00 14.65  ? 207 VAL A CG2 1 
ATOM   1657 N  N   . HIS A 1 208 ? 12.135  -12.148 33.640 1.00 16.51  ? 208 HIS A N   1 
ATOM   1658 C  CA  . HIS A 1 208 ? 13.480  -12.351 34.161 1.00 16.75  ? 208 HIS A CA  1 
ATOM   1659 C  C   . HIS A 1 208 ? 14.173  -13.478 33.419 1.00 19.27  ? 208 HIS A C   1 
ATOM   1660 O  O   . HIS A 1 208 ? 15.333  -13.350 33.009 1.00 16.74  ? 208 HIS A O   1 
ATOM   1661 C  CB  . HIS A 1 208 ? 13.471  -12.675 35.662 1.00 20.15  ? 208 HIS A CB  1 
ATOM   1662 C  CG  . HIS A 1 208 ? 13.366  -11.466 36.537 1.00 22.86  ? 208 HIS A CG  1 
ATOM   1663 N  ND1 . HIS A 1 208 ? 14.467  -10.736 36.930 1.00 22.30  ? 208 HIS A ND1 1 
ATOM   1664 C  CD2 . HIS A 1 208 ? 12.289  -10.848 37.077 1.00 24.92  ? 208 HIS A CD2 1 
ATOM   1665 C  CE1 . HIS A 1 208 ? 14.072  -9.718  37.676 1.00 24.73  ? 208 HIS A CE1 1 
ATOM   1666 N  NE2 . HIS A 1 208 ? 12.757  -9.765  37.784 1.00 25.66  ? 208 HIS A NE2 1 
ATOM   1667 N  N   . ARG A 1 209 ? 13.455  -14.584 33.256 1.00 12.91  ? 209 ARG A N   1 
ATOM   1668 C  CA  . ARG A 1 209 ? 14.029  -15.771 32.645 1.00 14.00  ? 209 ARG A CA  1 
ATOM   1669 C  C   . ARG A 1 209 ? 14.332  -15.539 31.168 1.00 16.60  ? 209 ARG A C   1 
ATOM   1670 O  O   . ARG A 1 209 ? 15.329  -16.039 30.653 1.00 16.06  ? 209 ARG A O   1 
ATOM   1671 C  CB  . ARG A 1 209 ? 13.079  -16.964 32.799 1.00 15.01  ? 209 ARG A CB  1 
ATOM   1672 C  CG  . ARG A 1 209 ? 13.081  -17.566 34.202 1.00 19.93  ? 209 ARG A CG  1 
ATOM   1673 C  CD  . ARG A 1 209 ? 11.930  -18.541 34.359 1.00 22.66  ? 209 ARG A CD  1 
ATOM   1674 N  NE  . ARG A 1 209 ? 11.811  -19.001 35.734 1.00 24.41  ? 209 ARG A NE  1 
ATOM   1675 C  CZ  . ARG A 1 209 ? 12.368  -20.115 36.186 1.00 30.03  ? 209 ARG A CZ  1 
ATOM   1676 N  NH1 . ARG A 1 209 ? 12.220  -20.460 37.457 1.00 29.01  ? 209 ARG A NH1 1 
ATOM   1677 N  NH2 . ARG A 1 209 ? 13.072  -20.882 35.364 1.00 29.19  ? 209 ARG A NH2 1 
ATOM   1678 N  N   . TRP A 1 210 ? 13.459  -14.791 30.495 1.00 14.74  ? 210 TRP A N   1 
ATOM   1679 C  CA  . TRP A 1 210 ? 13.648  -14.470 29.080 1.00 14.56  ? 210 TRP A CA  1 
ATOM   1680 C  C   . TRP A 1 210 ? 14.911  -13.634 28.845 1.00 18.99  ? 210 TRP A C   1 
ATOM   1681 O  O   . TRP A 1 210 ? 15.697  -13.932 27.952 1.00 16.79  ? 210 TRP A O   1 
ATOM   1682 C  CB  . TRP A 1 210 ? 12.428  -13.748 28.512 1.00 15.24  ? 210 TRP A CB  1 
ATOM   1683 C  CG  . TRP A 1 210 ? 12.510  -13.489 27.012 1.00 17.93  ? 210 TRP A CG  1 
ATOM   1684 C  CD1 . TRP A 1 210 ? 12.120  -14.334 26.006 1.00 21.04  ? 210 TRP A CD1 1 
ATOM   1685 C  CD2 . TRP A 1 210 ? 13.020  -12.313 26.371 1.00 15.14  ? 210 TRP A CD2 1 
ATOM   1686 N  NE1 . TRP A 1 210 ? 12.351  -13.750 24.784 1.00 18.80  ? 210 TRP A NE1 1 
ATOM   1687 C  CE2 . TRP A 1 210 ? 12.906  -12.509 24.982 1.00 20.27  ? 210 TRP A CE2 1 
ATOM   1688 C  CE3 . TRP A 1 210 ? 13.557  -11.108 26.840 1.00 16.50  ? 210 TRP A CE3 1 
ATOM   1689 C  CZ2 . TRP A 1 210 ? 13.310  -11.543 24.056 1.00 17.54  ? 210 TRP A CZ2 1 
ATOM   1690 C  CZ3 . TRP A 1 210 ? 13.958  -10.155 25.926 1.00 18.23  ? 210 TRP A CZ3 1 
ATOM   1691 C  CH2 . TRP A 1 210 ? 13.827  -10.378 24.546 1.00 18.60  ? 210 TRP A CH2 1 
ATOM   1692 N  N   . VAL A 1 211 ? 15.118  -12.594 29.653 1.00 18.73  ? 211 VAL A N   1 
ATOM   1693 C  CA  . VAL A 1 211 ? 16.283  -11.735 29.450 1.00 17.14  ? 211 VAL A CA  1 
ATOM   1694 C  C   . VAL A 1 211 ? 17.590  -12.504 29.669 1.00 16.59  ? 211 VAL A C   1 
ATOM   1695 O  O   . VAL A 1 211 ? 18.530  -12.375 28.885 1.00 19.98  ? 211 VAL A O   1 
ATOM   1696 C  CB  . VAL A 1 211 ? 16.237  -10.465 30.343 1.00 16.54  ? 211 VAL A CB  1 
ATOM   1697 C  CG1 . VAL A 1 211 ? 17.530  -9.677  30.194 1.00 18.38  ? 211 VAL A CG1 1 
ATOM   1698 C  CG2 . VAL A 1 211 ? 15.039  -9.590  29.966 1.00 17.42  ? 211 VAL A CG2 1 
ATOM   1699 N  N   . GLY A 1 212 ? 17.645  -13.324 30.715 1.00 17.38  ? 212 GLY A N   1 
ATOM   1700 C  CA  . GLY A 1 212 ? 18.828  -14.128 30.986 1.00 19.05  ? 212 GLY A CA  1 
ATOM   1701 C  C   . GLY A 1 212 ? 19.935  -13.268 31.572 1.00 21.22  ? 212 GLY A C   1 
ATOM   1702 O  O   . GLY A 1 212 ? 19.687  -12.129 31.946 1.00 18.91  ? 212 GLY A O   1 
ATOM   1703 N  N   . GLY A 1 213 ? 21.157  -13.790 31.627 1.00 16.62  ? 213 GLY A N   1 
ATOM   1704 C  CA  . GLY A 1 213 ? 22.260  -13.056 32.233 1.00 18.88  ? 213 GLY A CA  1 
ATOM   1705 C  C   . GLY A 1 213 ? 21.969  -12.736 33.690 1.00 19.62  ? 213 GLY A C   1 
ATOM   1706 O  O   . GLY A 1 213 ? 21.324  -13.525 34.377 1.00 19.02  ? 213 GLY A O   1 
ATOM   1707 N  N   . GLN A 1 214 ? 22.392  -11.574 34.143 1.00 21.40  ? 214 GLN A N   1 
ATOM   1708 C  CA  . GLN A 1 214 ? 22.165  -11.181 35.523 1.00 19.68  ? 214 GLN A CA  1 
ATOM   1709 C  C   . GLN A 1 214 ? 20.650  -11.114 35.790 1.00 18.90  ? 214 GLN A C   1 
ATOM   1710 O  O   . GLN A 1 214 ? 20.233  -11.463 36.824 1.00 17.72  ? 214 GLN A O   1 
ATOM   1711 C  CB  . GLN A 1 214 ? 22.852  -9.864  35.919 1.00 20.74  ? 214 GLN A CB  1 
ATOM   1712 C  CG  . GLN A 1 214 ? 24.332  -9.965  36.224 1.00 24.37  ? 214 GLN A CG  1 
ATOM   1713 C  CD  . GLN A 1 214 ? 25.198  -9.872  34.998 1.00 27.18  ? 214 GLN A CD  1 
ATOM   1714 O  OE1 . GLN A 1 214 ? 24.724  -9.838  33.930 1.00 23.81  ? 214 GLN A OE1 1 
ATOM   1715 N  NE2 . GLN A 1 214 ? 26.467  -9.817  35.189 1.00 24.56  ? 214 GLN A NE2 1 
ATOM   1716 N  N   . MET A 1 215 ? 19.870  -10.695 34.822 1.00 17.41  ? 215 MET A N   1 
ATOM   1717 C  CA  . MET A 1 215 ? 18.427  -10.598 35.008 1.00 19.34  ? 215 MET A CA  1 
ATOM   1718 C  C   . MET A 1 215 ? 17.749  -11.917 35.368 1.00 22.52  ? 215 MET A C   1 
ATOM   1719 O  O   . MET A 1 215 ? 16.687  -11.926 35.924 1.00 22.03  ? 215 MET A O   1 
ATOM   1720 C  CB  . MET A 1 215 ? 17.779  -10.078 33.771 1.00 21.05  ? 215 MET A CB  1 
ATOM   1721 C  CG  . MET A 1 215 ? 17.562  -8.596  33.738 1.00 21.17  ? 215 MET A CG  1 
ATOM   1722 S  SD  . MET A 1 215 ? 16.334  -7.922  34.857 1.00 21.58  ? 215 MET A SD  1 
ATOM   1723 C  CE  . MET A 1 215 ? 14.747  -8.120  34.145 1.00 23.73  ? 215 MET A CE  1 
ATOM   1724 N  N   . GLY A 1 216 ? 18.363  -13.012 35.001 1.00 20.96  ? 216 GLY A N   1 
ATOM   1725 C  CA  . GLY A 1 216 ? 17.749  -14.294 35.199 1.00 22.13  ? 216 GLY A CA  1 
ATOM   1726 C  C   . GLY A 1 216 ? 17.962  -14.834 36.574 1.00 24.81  ? 216 GLY A C   1 
ATOM   1727 O  O   . GLY A 1 216 ? 17.476  -15.850 36.890 1.00 28.98  ? 216 GLY A O   1 
ATOM   1728 N  N   . VAL A 1 217 ? 18.722  -14.100 37.381 1.00 24.86  ? 217 VAL A N   1 
ATOM   1729 C  CA  . VAL A 1 217 ? 19.002  -14.491 38.757 1.00 25.78  ? 217 VAL A CA  1 
ATOM   1730 C  C   . VAL A 1 217 ? 18.538  -13.407 39.725 1.00 25.67  ? 217 VAL A C   1 
ATOM   1731 O  O   . VAL A 1 217 ? 19.238  -12.421 39.953 1.00 24.75  ? 217 VAL A O   1 
ATOM   1732 C  CB  . VAL A 1 217 ? 20.503  -14.756 38.976 1.00 27.80  ? 217 VAL A CB  1 
ATOM   1733 C  CG1 . VAL A 1 217 ? 20.777  -15.074 40.437 1.00 32.17  ? 217 VAL A CG1 1 
ATOM   1734 C  CG2 . VAL A 1 217 ? 20.977  -15.888 38.078 1.00 27.74  ? 217 VAL A CG2 1 
ATOM   1735 N  N   . VAL A 1 218 ? 17.411  -13.635 40.311 1.00 26.79  ? 218 VAL A N   1 
ATOM   1736 C  CA  . VAL A 1 218 ? 16.698  -12.613 41.006 1.00 28.04  ? 218 VAL A CA  1 
ATOM   1737 C  C   . VAL A 1 218 ? 17.552  -11.729 41.913 1.00 27.68  ? 218 VAL A C   1 
ATOM   1738 O  O   . VAL A 1 218 ? 17.484  -10.576 41.809 1.00 27.45  ? 218 VAL A O   1 
ATOM   1739 C  CB  . VAL A 1 218 ? 15.452  -13.154 41.685 1.00 32.24  ? 218 VAL A CB  1 
ATOM   1740 C  CG1 . VAL A 1 218 ? 14.483  -12.052 41.983 1.00 38.44  ? 218 VAL A CG1 1 
ATOM   1741 C  CG2 . VAL A 1 218 ? 14.781  -14.097 40.744 1.00 32.42  ? 218 VAL A CG2 1 
ATOM   1742 N  N   . PRO A 1 219 ? 18.345  -12.279 42.776 1.00 34.44  ? 219 PRO A N   1 
ATOM   1743 C  CA  . PRO A 1 219 ? 19.089  -11.410 43.668 1.00 38.90  ? 219 PRO A CA  1 
ATOM   1744 C  C   . PRO A 1 219 ? 19.923  -10.389 42.924 1.00 39.65  ? 219 PRO A C   1 
ATOM   1745 O  O   . PRO A 1 219 ? 19.781  -9.249  43.295 1.00 42.29  ? 219 PRO A O   1 
ATOM   1746 C  CB  . PRO A 1 219 ? 20.007  -12.356 44.406 1.00 37.38  ? 219 PRO A CB  1 
ATOM   1747 C  CG  . PRO A 1 219 ? 19.835  -13.656 43.771 1.00 40.96  ? 219 PRO A CG  1 
ATOM   1748 C  CD  . PRO A 1 219 ? 18.473  -13.657 43.209 1.00 37.52  ? 219 PRO A CD  1 
ATOM   1749 N  N   . THR A 1 220 ? 20.714  -10.811 41.936 1.00 31.93  ? 220 THR A N   1 
ATOM   1750 C  CA  . THR A 1 220 ? 21.625  -9.980  41.148 1.00 28.49  ? 220 THR A CA  1 
ATOM   1751 C  C   . THR A 1 220 ? 21.005  -9.195  39.978 1.00 22.33  ? 220 THR A C   1 
ATOM   1752 O  O   . THR A 1 220 ? 21.661  -8.434  39.353 1.00 19.96  ? 220 THR A O   1 
ATOM   1753 C  CB  . THR A 1 220 ? 22.788  -10.805 40.572 1.00 28.50  ? 220 THR A CB  1 
ATOM   1754 O  OG1 . THR A 1 220 ? 22.381  -11.583 39.427 1.00 29.45  ? 220 THR A OG1 1 
ATOM   1755 C  CG2 . THR A 1 220 ? 23.389  -11.628 41.573 1.00 34.07  ? 220 THR A CG2 1 
ATOM   1756 N  N   . ALA A 1 221 ? 19.740  -9.409  39.726 1.00 17.28  ? 221 ALA A N   1 
ATOM   1757 C  CA  . ALA A 1 221 ? 19.042  -8.782  38.638 1.00 18.50  ? 221 ALA A CA  1 
ATOM   1758 C  C   . ALA A 1 221 ? 19.241  -7.265  38.497 1.00 15.91  ? 221 ALA A C   1 
ATOM   1759 O  O   . ALA A 1 221 ? 19.458  -6.807  37.419 1.00 17.00  ? 221 ALA A O   1 
ATOM   1760 C  CB  . ALA A 1 221 ? 17.566  -9.118  38.686 1.00 16.42  ? 221 ALA A CB  1 
ATOM   1761 N  N   . PRO A 1 222 ? 19.141  -6.511  39.591 1.00 14.34  ? 222 PRO A N   1 
ATOM   1762 C  CA  . PRO A 1 222 ? 19.349  -5.060  39.527 1.00 12.37  ? 222 PRO A CA  1 
ATOM   1763 C  C   . PRO A 1 222 ? 20.565  -4.643  38.689 1.00 14.03  ? 222 PRO A C   1 
ATOM   1764 O  O   . PRO A 1 222 ? 20.566  -3.539  38.145 1.00 14.87  ? 222 PRO A O   1 
ATOM   1765 C  CB  . PRO A 1 222 ? 19.569  -4.679  40.993 1.00 14.82  ? 222 PRO A CB  1 
ATOM   1766 C  CG  . PRO A 1 222 ? 18.819  -5.713  41.761 1.00 16.73  ? 222 PRO A CG  1 
ATOM   1767 C  CD  . PRO A 1 222 ? 18.956  -6.986  40.973 1.00 16.82  ? 222 PRO A CD  1 
ATOM   1768 N  N   . ASN A 1 223 ? 21.578  -5.501  38.591 1.00 13.39  ? 223 ASN A N   1 
ATOM   1769 C  CA  . ASN A 1 223 ? 22.804  -5.159  37.863 1.00 15.94  ? 223 ASN A CA  1 
ATOM   1770 C  C   . ASN A 1 223 ? 22.515  -4.659  36.451 1.00 18.84  ? 223 ASN A C   1 
ATOM   1771 O  O   . ASN A 1 223 ? 23.275  -3.872  35.891 1.00 16.68  ? 223 ASN A O   1 
ATOM   1772 C  CB  . ASN A 1 223 ? 23.749  -6.345  37.783 1.00 15.96  ? 223 ASN A CB  1 
ATOM   1773 C  CG  . ASN A 1 223 ? 24.621  -6.466  39.001 1.00 18.94  ? 223 ASN A CG  1 
ATOM   1774 O  OD1 . ASN A 1 223 ? 25.515  -5.644  39.220 1.00 19.11  ? 223 ASN A OD1 1 
ATOM   1775 N  ND2 . ASN A 1 223 ? 24.374  -7.494  39.804 1.00 19.23  ? 223 ASN A ND2 1 
ATOM   1776 N  N   . ASP A 1 224 ? 21.408  -5.129  35.886 1.00 16.95  ? 224 ASP A N   1 
ATOM   1777 C  CA  . ASP A 1 224 ? 20.971  -4.703  34.563 1.00 14.75  ? 224 ASP A CA  1 
ATOM   1778 C  C   . ASP A 1 224 ? 19.931  -3.613  34.729 1.00 16.46  ? 224 ASP A C   1 
ATOM   1779 O  O   . ASP A 1 224 ? 18.900  -3.846  35.342 1.00 15.76  ? 224 ASP A O   1 
ATOM   1780 C  CB  . ASP A 1 224 ? 20.363  -5.916  33.834 1.00 16.26  ? 224 ASP A CB  1 
ATOM   1781 C  CG  . ASP A 1 224 ? 20.087  -5.649  32.365 1.00 19.89  ? 224 ASP A CG  1 
ATOM   1782 O  OD1 . ASP A 1 224 ? 19.913  -4.462  31.988 1.00 19.33  ? 224 ASP A OD1 1 
ATOM   1783 O  OD2 . ASP A 1 224 ? 20.033  -6.645  31.594 1.00 19.39  ? 224 ASP A OD2 1 
ATOM   1784 N  N   . PRO A 1 225 ? 20.194  -2.410  34.183 1.00 15.47  ? 225 PRO A N   1 
ATOM   1785 C  CA  . PRO A 1 225 ? 19.255  -1.290  34.319 1.00 13.47  ? 225 PRO A CA  1 
ATOM   1786 C  C   . PRO A 1 225 ? 17.836  -1.599  33.815 1.00 14.70  ? 225 PRO A C   1 
ATOM   1787 O  O   . PRO A 1 225 ? 16.879  -0.990  34.292 1.00 14.11  ? 225 PRO A O   1 
ATOM   1788 C  CB  . PRO A 1 225 ? 19.907  -0.189  33.475 1.00 17.71  ? 225 PRO A CB  1 
ATOM   1789 C  CG  . PRO A 1 225 ? 21.388  -0.492  33.577 1.00 19.62  ? 225 PRO A CG  1 
ATOM   1790 C  CD  . PRO A 1 225 ? 21.468  -1.996  33.561 1.00 15.41  ? 225 PRO A CD  1 
ATOM   1791 N  N   . VAL A 1 226 ? 17.699  -2.534  32.879 1.00 14.15  ? 226 VAL A N   1 
ATOM   1792 C  CA  . VAL A 1 226 ? 16.373  -2.880  32.364 1.00 13.92  ? 226 VAL A CA  1 
ATOM   1793 C  C   . VAL A 1 226 ? 15.454  -3.460  33.467 1.00 12.08  ? 226 VAL A C   1 
ATOM   1794 O  O   . VAL A 1 226 ? 14.233  -3.438  33.339 1.00 11.96  ? 226 VAL A O   1 
ATOM   1795 C  CB  . VAL A 1 226 ? 16.453  -3.808  31.123 1.00 15.47  ? 226 VAL A CB  1 
ATOM   1796 C  CG1 . VAL A 1 226 ? 16.669  -5.260  31.524 1.00 16.17  ? 226 VAL A CG1 1 
ATOM   1797 C  CG2 . VAL A 1 226 ? 15.190  -3.668  30.280 1.00 16.87  ? 226 VAL A CG2 1 
ATOM   1798 N  N   . PHE A 1 227 ? 16.059  -3.964  34.541 1.00 13.69  ? 227 PHE A N   1 
ATOM   1799 C  CA  . PHE A 1 227 ? 15.341  -4.341  35.767 1.00 12.52  ? 227 PHE A CA  1 
ATOM   1800 C  C   . PHE A 1 227 ? 14.313  -3.310  36.173 1.00 11.22  ? 227 PHE A C   1 
ATOM   1801 O  O   . PHE A 1 227 ? 13.179  -3.638  36.516 1.00 11.42  ? 227 PHE A O   1 
ATOM   1802 C  CB  . PHE A 1 227 ? 16.329  -4.466  36.934 1.00 11.91  ? 227 PHE A CB  1 
ATOM   1803 C  CG  . PHE A 1 227 ? 15.693  -4.907  38.232 1.00 13.31  ? 227 PHE A CG  1 
ATOM   1804 C  CD1 . PHE A 1 227 ? 15.235  -3.982  39.154 1.00 16.69  ? 227 PHE A CD1 1 
ATOM   1805 C  CD2 . PHE A 1 227 ? 15.568  -6.251  38.536 1.00 13.96  ? 227 PHE A CD2 1 
ATOM   1806 C  CE1 . PHE A 1 227 ? 14.647  -4.399  40.355 1.00 14.43  ? 227 PHE A CE1 1 
ATOM   1807 C  CE2 . PHE A 1 227 ? 14.999  -6.667  39.742 1.00 14.37  ? 227 PHE A CE2 1 
ATOM   1808 C  CZ  . PHE A 1 227 ? 14.536  -5.739  40.638 1.00 13.71  ? 227 PHE A CZ  1 
ATOM   1809 N  N   . PHE A 1 228 ? 14.740  -2.055  36.202 1.00 11.99  ? 228 PHE A N   1 
ATOM   1810 C  CA  . PHE A 1 228 ? 13.888  -0.988  36.699 1.00 14.21  ? 228 PHE A CA  1 
ATOM   1811 C  C   . PHE A 1 228 ? 12.758  -0.681  35.704 1.00 13.34  ? 228 PHE A C   1 
ATOM   1812 O  O   . PHE A 1 228 ? 11.631  -0.359  36.102 1.00 12.40  ? 228 PHE A O   1 
ATOM   1813 C  CB  . PHE A 1 228 ? 14.732  0.254   37.002 1.00 14.15  ? 228 PHE A CB  1 
ATOM   1814 C  CG  . PHE A 1 228 ? 15.714  0.048   38.114 1.00 14.58  ? 228 PHE A CG  1 
ATOM   1815 C  CD1 . PHE A 1 228 ? 15.350  0.297   39.430 1.00 15.21  ? 228 PHE A CD1 1 
ATOM   1816 C  CD2 . PHE A 1 228 ? 16.992  -0.432  37.854 1.00 13.24  ? 228 PHE A CD2 1 
ATOM   1817 C  CE1 . PHE A 1 228 ? 16.253  0.096   40.460 1.00 13.31  ? 228 PHE A CE1 1 
ATOM   1818 C  CE2 . PHE A 1 228 ? 17.899  -0.645  38.886 1.00 16.28  ? 228 PHE A CE2 1 
ATOM   1819 C  CZ  . PHE A 1 228 ? 17.530  -0.378  40.186 1.00 14.13  ? 228 PHE A CZ  1 
ATOM   1820 N  N   . LEU A 1 229 ? 13.057  -0.786  34.415 1.00 10.24  ? 229 LEU A N   1 
ATOM   1821 C  CA  . LEU A 1 229 ? 12.038  -0.573  33.393 1.00 13.61  ? 229 LEU A CA  1 
ATOM   1822 C  C   . LEU A 1 229 ? 11.008  -1.724  33.376 1.00 11.44  ? 229 LEU A C   1 
ATOM   1823 O  O   . LEU A 1 229 ? 9.815   -1.494  33.170 1.00 11.89  ? 229 LEU A O   1 
ATOM   1824 C  CB  . LEU A 1 229 ? 12.684  -0.446  32.010 1.00 15.23  ? 229 LEU A CB  1 
ATOM   1825 C  CG  . LEU A 1 229 ? 13.858  0.527   31.915 1.00 15.90  ? 229 LEU A CG  1 
ATOM   1826 C  CD1 . LEU A 1 229 ? 14.418  0.549   30.506 1.00 16.41  ? 229 LEU A CD1 1 
ATOM   1827 C  CD2 . LEU A 1 229 ? 13.432  1.899   32.357 1.00 16.26  ? 229 LEU A CD2 1 
ATOM   1828 N  N   . HIS A 1 230 ? 11.486  -2.948  33.584 1.00 12.44  ? 230 HIS A N   1 
ATOM   1829 C  CA  . HIS A 1 230 ? 10.612  -4.101  33.782 1.00 12.01  ? 230 HIS A CA  1 
ATOM   1830 C  C   . HIS A 1 230 ? 9.707   -3.917  34.999 1.00 13.46  ? 230 HIS A C   1 
ATOM   1831 O  O   . HIS A 1 230 ? 8.488   -4.045  34.893 1.00 11.84  ? 230 HIS A O   1 
ATOM   1832 C  CB  . HIS A 1 230 ? 11.428  -5.391  33.929 1.00 14.96  ? 230 HIS A CB  1 
ATOM   1833 C  CG  . HIS A 1 230 ? 10.654  -6.532  34.502 1.00 15.44  ? 230 HIS A CG  1 
ATOM   1834 N  ND1 . HIS A 1 230 ? 9.490   -7.008  33.931 1.00 15.67  ? 230 HIS A ND1 1 
ATOM   1835 C  CD2 . HIS A 1 230 ? 10.861  -7.289  35.607 1.00 14.80  ? 230 HIS A CD2 1 
ATOM   1836 C  CE1 . HIS A 1 230 ? 9.024   -8.010  34.649 1.00 16.02  ? 230 HIS A CE1 1 
ATOM   1837 N  NE2 . HIS A 1 230 ? 9.835   -8.203  35.676 1.00 18.23  ? 230 HIS A NE2 1 
ATOM   1838 N  N   . HIS A 1 231 ? 10.288  -3.596  36.154 1.00 11.84  ? 231 HIS A N   1 
ATOM   1839 C  CA  . HIS A 1 231 ? 9.458   -3.386  37.345 1.00 11.89  ? 231 HIS A CA  1 
ATOM   1840 C  C   . HIS A 1 231 ? 8.493   -2.211  37.276 1.00 11.86  ? 231 HIS A C   1 
ATOM   1841 O  O   . HIS A 1 231 ? 7.444   -2.239  37.923 1.00 11.72  ? 231 HIS A O   1 
ATOM   1842 C  CB  . HIS A 1 231 ? 10.287  -3.384  38.624 1.00 12.18  ? 231 HIS A CB  1 
ATOM   1843 C  CG  . HIS A 1 231 ? 10.500  -4.758  39.171 1.00 10.67  ? 231 HIS A CG  1 
ATOM   1844 N  ND1 . HIS A 1 231 ? 9.533   -5.422  39.897 1.00 14.03  ? 231 HIS A ND1 1 
ATOM   1845 C  CD2 . HIS A 1 231 ? 11.534  -5.625  39.041 1.00 13.19  ? 231 HIS A CD2 1 
ATOM   1846 C  CE1 . HIS A 1 231 ? 9.974   -6.627  40.215 1.00 14.80  ? 231 HIS A CE1 1 
ATOM   1847 N  NE2 . HIS A 1 231 ? 11.189  -6.771  39.711 1.00 15.74  ? 231 HIS A NE2 1 
ATOM   1848 N  N   . ALA A 1 232 ? 8.835   -1.183  36.500 1.00 11.03  ? 232 ALA A N   1 
ATOM   1849 C  CA  . ALA A 1 232 ? 7.882   -0.095  36.247 1.00 11.85  ? 232 ALA A CA  1 
ATOM   1850 C  C   . ALA A 1 232 ? 6.647   -0.602  35.484 1.00 10.47  ? 232 ALA A C   1 
ATOM   1851 O  O   . ALA A 1 232 ? 5.518   -0.186  35.752 1.00 12.22  ? 232 ALA A O   1 
ATOM   1852 C  CB  . ALA A 1 232 ? 8.553   1.063   35.499 1.00 11.72  ? 232 ALA A CB  1 
ATOM   1853 N  N   . ASN A 1 233 ? 6.857   -1.493  34.529 1.00 10.53  ? 233 ASN A N   1 
ATOM   1854 C  CA  . ASN A 1 233 ? 5.715   -2.143  33.873 1.00 12.57  ? 233 ASN A CA  1 
ATOM   1855 C  C   . ASN A 1 233 ? 4.878   -3.005  34.830 1.00 12.86  ? 233 ASN A C   1 
ATOM   1856 O  O   . ASN A 1 233 ? 3.648   -2.961  34.804 1.00 12.84  ? 233 ASN A O   1 
ATOM   1857 C  CB  . ASN A 1 233 ? 6.162   -2.972  32.673 1.00 11.97  ? 233 ASN A CB  1 
ATOM   1858 C  CG  . ASN A 1 233 ? 5.036   -3.188  31.674 1.00 15.87  ? 233 ASN A CG  1 
ATOM   1859 O  OD1 . ASN A 1 233 ? 4.320   -2.249  31.331 1.00 14.95  ? 233 ASN A OD1 1 
ATOM   1860 N  ND2 . ASN A 1 233 ? 4.856   -4.423  31.232 1.00 15.19  ? 233 ASN A ND2 1 
ATOM   1861 N  N   . VAL A 1 234 ? 5.541   -3.787  35.684 1.00 13.77  ? 234 VAL A N   1 
ATOM   1862 C  CA  . VAL A 1 234 ? 4.820   -4.564  36.702 1.00 13.05  ? 234 VAL A CA  1 
ATOM   1863 C  C   . VAL A 1 234 ? 4.009   -3.642  37.632 1.00 13.42  ? 234 VAL A C   1 
ATOM   1864 O  O   . VAL A 1 234 ? 2.856   -3.918  37.957 1.00 12.96  ? 234 VAL A O   1 
ATOM   1865 C  CB  . VAL A 1 234 ? 5.804   -5.428  37.530 1.00 12.98  ? 234 VAL A CB  1 
ATOM   1866 C  CG1 . VAL A 1 234 ? 5.093   -6.118  38.709 1.00 14.75  ? 234 VAL A CG1 1 
ATOM   1867 C  CG2 . VAL A 1 234 ? 6.470   -6.439  36.628 1.00 12.98  ? 234 VAL A CG2 1 
ATOM   1868 N  N   . ASP A 1 235 ? 4.620   -2.536  38.054 1.00 11.61  ? 235 ASP A N   1 
ATOM   1869 C  CA  . ASP A 1 235 ? 3.954   -1.579  38.922 1.00 11.98  ? 235 ASP A CA  1 
ATOM   1870 C  C   . ASP A 1 235 ? 2.767   -0.949  38.189 1.00 13.33  ? 235 ASP A C   1 
ATOM   1871 O  O   . ASP A 1 235 ? 1.704   -0.713  38.774 1.00 14.26  ? 235 ASP A O   1 
ATOM   1872 C  CB  . ASP A 1 235 ? 4.940   -0.486  39.358 1.00 10.94  ? 235 ASP A CB  1 
ATOM   1873 C  CG  . ASP A 1 235 ? 4.353   0.451   40.381 1.00 14.64  ? 235 ASP A CG  1 
ATOM   1874 O  OD1 . ASP A 1 235 ? 4.238   1.675   40.098 1.00 16.30  ? 235 ASP A OD1 1 
ATOM   1875 O  OD2 . ASP A 1 235 ? 3.997   -0.033  41.477 1.00 13.03  ? 235 ASP A OD2 1 
ATOM   1876 N  N   . ARG A 1 236 ? 2.959   -0.667  36.908 1.00 11.67  ? 236 ARG A N   1 
ATOM   1877 C  CA  . ARG A 1 236 ? 1.886   -0.069  36.112 1.00 13.59  ? 236 ARG A CA  1 
ATOM   1878 C  C   . ARG A 1 236 ? 0.690   -1.033  36.037 1.00 15.21  ? 236 ARG A C   1 
ATOM   1879 O  O   . ARG A 1 236 ? -0.467  -0.620  36.174 1.00 16.45  ? 236 ARG A O   1 
ATOM   1880 C  CB  . ARG A 1 236 ? 2.386   0.270   34.708 1.00 13.87  ? 236 ARG A CB  1 
ATOM   1881 C  CG  . ARG A 1 236 ? 1.301   0.853   33.811 1.00 16.96  ? 236 ARG A CG  1 
ATOM   1882 C  CD  . ARG A 1 236 ? 1.767   0.977   32.378 1.00 17.86  ? 236 ARG A CD  1 
ATOM   1883 N  NE  . ARG A 1 236 ? 2.024   -0.316  31.748 1.00 17.93  ? 236 ARG A NE  1 
ATOM   1884 C  CZ  . ARG A 1 236 ? 1.074   -1.101  31.238 1.00 19.45  ? 236 ARG A CZ  1 
ATOM   1885 N  NH1 . ARG A 1 236 ? -0.196  -0.748  31.319 1.00 19.82  ? 236 ARG A NH1 1 
ATOM   1886 N  NH2 . ARG A 1 236 ? 1.391   -2.252  30.673 1.00 20.23  ? 236 ARG A NH2 1 
ATOM   1887 N  N   . ILE A 1 237 ? 0.976   -2.318  35.840 1.00 12.01  ? 237 ILE A N   1 
ATOM   1888 C  CA  . ILE A 1 237 ? -0.071  -3.338  35.706 1.00 13.97  ? 237 ILE A CA  1 
ATOM   1889 C  C   . ILE A 1 237 ? -0.851  -3.503  37.019 1.00 14.59  ? 237 ILE A C   1 
ATOM   1890 O  O   . ILE A 1 237 ? -2.082  -3.630  37.015 1.00 15.45  ? 237 ILE A O   1 
ATOM   1891 C  CB  . ILE A 1 237 ? 0.524   -4.685  35.219 1.00 17.74  ? 237 ILE A CB  1 
ATOM   1892 C  CG1 . ILE A 1 237 ? 0.983   -4.568  33.760 1.00 16.83  ? 237 ILE A CG1 1 
ATOM   1893 C  CG2 . ILE A 1 237 ? -0.477  -5.838  35.350 1.00 16.76  ? 237 ILE A CG2 1 
ATOM   1894 C  CD1 . ILE A 1 237 ? 1.812   -5.756  33.295 1.00 18.04  ? 237 ILE A CD1 1 
ATOM   1895 N  N   . TRP A 1 238 ? -0.137  -3.469  38.140 1.00 13.56  ? 238 TRP A N   1 
ATOM   1896 C  CA  . TRP A 1 238 ? -0.783  -3.426  39.449 1.00 14.90  ? 238 TRP A CA  1 
ATOM   1897 C  C   . TRP A 1 238 ? -1.679  -2.191  39.600 1.00 16.69  ? 238 TRP A C   1 
ATOM   1898 O  O   . TRP A 1 238 ? -2.815  -2.290  40.070 1.00 16.47  ? 238 TRP A O   1 
ATOM   1899 C  CB  . TRP A 1 238 ? 0.274   -3.465  40.568 1.00 13.33  ? 238 TRP A CB  1 
ATOM   1900 C  CG  . TRP A 1 238 ? -0.282  -3.451  41.960 1.00 13.39  ? 238 TRP A CG  1 
ATOM   1901 C  CD1 . TRP A 1 238 ? -1.516  -3.903  42.375 1.00 14.25  ? 238 TRP A CD1 1 
ATOM   1902 C  CD2 . TRP A 1 238 ? 0.371   -2.942  43.131 1.00 15.08  ? 238 TRP A CD2 1 
ATOM   1903 N  NE1 . TRP A 1 238 ? -1.649  -3.722  43.735 1.00 13.99  ? 238 TRP A NE1 1 
ATOM   1904 C  CE2 . TRP A 1 238 ? -0.510  -3.128  44.219 1.00 15.35  ? 238 TRP A CE2 1 
ATOM   1905 C  CE3 . TRP A 1 238 ? 1.621   -2.351  43.367 1.00 13.60  ? 238 TRP A CE3 1 
ATOM   1906 C  CZ2 . TRP A 1 238 ? -0.182  -2.732  45.519 1.00 16.18  ? 238 TRP A CZ2 1 
ATOM   1907 C  CZ3 . TRP A 1 238 ? 1.940   -1.967  44.651 1.00 13.68  ? 238 TRP A CZ3 1 
ATOM   1908 C  CH2 . TRP A 1 238 ? 1.042   -2.150  45.713 1.00 15.21  ? 238 TRP A CH2 1 
ATOM   1909 N  N   . ALA A 1 239 ? -1.170  -1.027  39.212 1.00 14.83  ? 239 ALA A N   1 
ATOM   1910 C  CA  . ALA A 1 239 ? -1.960  0.204   39.285 1.00 15.52  ? 239 ALA A CA  1 
ATOM   1911 C  C   . ALA A 1 239 ? -3.252  0.119   38.458 1.00 17.68  ? 239 ALA A C   1 
ATOM   1912 O  O   . ALA A 1 239 ? -4.286  0.651   38.859 1.00 20.84  ? 239 ALA A O   1 
ATOM   1913 C  CB  . ALA A 1 239 ? -1.126  1.405   38.863 1.00 17.01  ? 239 ALA A CB  1 
ATOM   1914 N  N   . VAL A 1 240 ? -3.183  -0.540  37.310 1.00 16.32  ? 240 VAL A N   1 
ATOM   1915 C  CA  . VAL A 1 240 ? -4.365  -0.777  36.476 1.00 17.32  ? 240 VAL A CA  1 
ATOM   1916 C  C   . VAL A 1 240 ? -5.363  -1.662  37.222 1.00 20.53  ? 240 VAL A C   1 
ATOM   1917 O  O   . VAL A 1 240 ? -6.555  -1.359  37.293 1.00 19.76  ? 240 VAL A O   1 
ATOM   1918 C  CB  . VAL A 1 240 ? -3.958  -1.429  35.150 1.00 20.62  ? 240 VAL A CB  1 
ATOM   1919 C  CG1 . VAL A 1 240 ? -5.181  -1.909  34.370 1.00 22.60  ? 240 VAL A CG1 1 
ATOM   1920 C  CG2 . VAL A 1 240 ? -3.132  -0.443  34.325 1.00 20.14  ? 240 VAL A CG2 1 
ATOM   1921 N  N   . TRP A 1 241 ? -4.854  -2.744  37.807 1.00 17.00  ? 241 TRP A N   1 
ATOM   1922 C  CA  . TRP A 1 241 ? -5.675  -3.668  38.578 1.00 18.08  ? 241 TRP A CA  1 
ATOM   1923 C  C   . TRP A 1 241 ? -6.374  -2.941  39.725 1.00 20.14  ? 241 TRP A C   1 
ATOM   1924 O  O   . TRP A 1 241 ? -7.563  -3.165  39.979 1.00 20.17  ? 241 TRP A O   1 
ATOM   1925 C  CB  . TRP A 1 241 ? -4.825  -4.834  39.099 1.00 16.33  ? 241 TRP A CB  1 
ATOM   1926 C  CG  . TRP A 1 241 ? -5.599  -5.864  39.886 1.00 20.33  ? 241 TRP A CG  1 
ATOM   1927 C  CD1 . TRP A 1 241 ? -6.157  -7.015  39.405 1.00 18.77  ? 241 TRP A CD1 1 
ATOM   1928 C  CD2 . TRP A 1 241 ? -5.896  -5.831  41.288 1.00 16.81  ? 241 TRP A CD2 1 
ATOM   1929 N  NE1 . TRP A 1 241 ? -6.784  -7.696  40.418 1.00 19.71  ? 241 TRP A NE1 1 
ATOM   1930 C  CE2 . TRP A 1 241 ? -6.639  -6.993  41.583 1.00 19.33  ? 241 TRP A CE2 1 
ATOM   1931 C  CE3 . TRP A 1 241 ? -5.603  -4.935  42.319 1.00 16.03  ? 241 TRP A CE3 1 
ATOM   1932 C  CZ2 . TRP A 1 241 ? -7.095  -7.280  42.867 1.00 20.03  ? 241 TRP A CZ2 1 
ATOM   1933 C  CZ3 . TRP A 1 241 ? -6.063  -5.218  43.590 1.00 17.95  ? 241 TRP A CZ3 1 
ATOM   1934 C  CH2 . TRP A 1 241 ? -6.803  -6.378  43.850 1.00 19.87  ? 241 TRP A CH2 1 
ATOM   1935 N  N   . GLN A 1 242 ? -5.638  -2.077  40.418 1.00 16.41  ? 242 GLN A N   1 
ATOM   1936 C  CA  . GLN A 1 242 ? -6.197  -1.311  41.530 1.00 17.93  ? 242 GLN A CA  1 
ATOM   1937 C  C   . GLN A 1 242 ? -7.364  -0.417  41.112 1.00 22.13  ? 242 GLN A C   1 
ATOM   1938 O  O   . GLN A 1 242 ? -8.260  -0.155  41.923 1.00 23.71  ? 242 GLN A O   1 
ATOM   1939 C  CB  . GLN A 1 242 ? -5.115  -0.454  42.208 1.00 16.67  ? 242 GLN A CB  1 
ATOM   1940 C  CG  . GLN A 1 242 ? -4.075  -1.269  43.010 1.00 14.44  ? 242 GLN A CG  1 
ATOM   1941 C  CD  . GLN A 1 242 ? -3.094  -0.373  43.733 1.00 18.42  ? 242 GLN A CD  1 
ATOM   1942 O  OE1 . GLN A 1 242 ? -2.228  0.245   43.109 1.00 15.83  ? 242 GLN A OE1 1 
ATOM   1943 N  NE2 . GLN A 1 242 ? -3.239  -0.272  45.054 1.00 18.29  ? 242 GLN A NE2 1 
ATOM   1944 N  N   . ILE A 1 243 ? -7.357  0.077   39.898 1.00 26.11  ? 243 ILE A N   1 
ATOM   1945 C  CA  . ILE A 1 243 ? -8.507  0.865   39.451 1.00 30.73  ? 243 ILE A CA  1 
ATOM   1946 C  C   . ILE A 1 243 ? -9.690  0.051   38.981 1.00 31.68  ? 243 ILE A C   1 
ATOM   1947 O  O   . ILE A 1 243 ? -10.793 0.459   39.237 1.00 32.60  ? 243 ILE A O   1 
ATOM   1948 C  CB  . ILE A 1 243 ? -8.194  1.857   38.372 1.00 33.73  ? 243 ILE A CB  1 
ATOM   1949 C  CG1 . ILE A 1 243 ? -7.377  2.970   38.929 1.00 36.41  ? 243 ILE A CG1 1 
ATOM   1950 C  CG2 . ILE A 1 243 ? -9.459  2.479   37.832 1.00 38.77  ? 243 ILE A CG2 1 
ATOM   1951 C  CD1 . ILE A 1 243 ? -6.239  3.242   38.008 1.00 39.75  ? 243 ILE A CD1 1 
ATOM   1952 N  N   . ILE A 1 244 ? -9.448  -1.081  38.327 1.00 25.16  ? 244 ILE A N   1 
ATOM   1953 C  CA  . ILE A 1 244 ? -10.529 -1.963  37.907 1.00 26.43  ? 244 ILE A CA  1 
ATOM   1954 C  C   . ILE A 1 244 ? -11.275 -2.489  39.129 1.00 29.44  ? 244 ILE A C   1 
ATOM   1955 O  O   . ILE A 1 244 ? -12.504 -2.448  39.185 1.00 27.99  ? 244 ILE A O   1 
ATOM   1956 C  CB  . ILE A 1 244 ? -10.002 -3.152  37.084 1.00 27.08  ? 244 ILE A CB  1 
ATOM   1957 C  CG1 . ILE A 1 244 ? -9.381  -2.661  35.774 1.00 27.66  ? 244 ILE A CG1 1 
ATOM   1958 C  CG2 . ILE A 1 244 ? -11.120 -4.147  36.809 1.00 28.18  ? 244 ILE A CG2 1 
ATOM   1959 C  CD1 . ILE A 1 244 ? -8.557  -3.708  35.059 1.00 25.08  ? 244 ILE A CD1 1 
ATOM   1960 N  N   . HIS A 1 245 ? -10.519 -2.980  40.106 1.00 27.12  ? 245 HIS A N   1 
ATOM   1961 C  CA  . HIS A 1 245 ? -11.089 -3.462  41.349 1.00 28.83  ? 245 HIS A CA  1 
ATOM   1962 C  C   . HIS A 1 245 ? -10.827 -2.475  42.448 1.00 30.31  ? 245 HIS A C   1 
ATOM   1963 O  O   . HIS A 1 245 ? -9.990  -2.718  43.344 1.00 29.30  ? 245 HIS A O   1 
ATOM   1964 C  CB  . HIS A 1 245 ? -10.506 -4.821  41.714 1.00 28.65  ? 245 HIS A CB  1 
ATOM   1965 C  CG  . HIS A 1 245 ? -10.419 -5.779  40.549 1.00 26.86  ? 245 HIS A CG  1 
ATOM   1966 N  ND1 . HIS A 1 245 ? -11.327 -6.749  40.341 1.00 28.22  ? 245 HIS A ND1 1 
ATOM   1967 C  CD2 . HIS A 1 245 ? -9.486  -5.886  39.519 1.00 24.22  ? 245 HIS A CD2 1 
ATOM   1968 C  CE1 . HIS A 1 245 ? -10.996 -7.443  39.236 1.00 26.09  ? 245 HIS A CE1 1 
ATOM   1969 N  NE2 . HIS A 1 245 ? -9.869  -6.913  38.734 1.00 26.77  ? 245 HIS A NE2 1 
ATOM   1970 N  N   . ARG A 1 246 ? -11.530 -1.349  42.397 1.00 32.13  ? 246 ARG A N   1 
ATOM   1971 C  CA  . ARG A 1 246 ? -11.334 -0.288  43.333 1.00 36.41  ? 246 ARG A CA  1 
ATOM   1972 C  C   . ARG A 1 246 ? -11.921 -0.552  44.721 1.00 34.28  ? 246 ARG A C   1 
ATOM   1973 O  O   . ARG A 1 246 ? -11.625 0.094   45.650 1.00 36.09  ? 246 ARG A O   1 
ATOM   1974 C  CB  . ARG A 1 246 ? -11.824 1.001   42.750 1.00 40.51  ? 246 ARG A CB  1 
ATOM   1975 C  CG  . ARG A 1 246 ? -13.222 1.321   43.129 1.00 46.22  ? 246 ARG A CG  1 
ATOM   1976 C  CD  . ARG A 1 246 ? -13.302 2.725   43.652 1.00 52.58  ? 246 ARG A CD  1 
ATOM   1977 N  NE  . ARG A 1 246 ? -13.044 3.699   42.599 1.00 58.44  ? 246 ARG A NE  1 
ATOM   1978 C  CZ  . ARG A 1 246 ? -13.812 4.747   42.356 1.00 61.64  ? 246 ARG A CZ  1 
ATOM   1979 N  NH1 . ARG A 1 246 ? -14.898 4.943   43.093 1.00 57.31  ? 246 ARG A NH1 1 
ATOM   1980 N  NH2 . ARG A 1 246 ? -13.504 5.593   41.386 1.00 65.53  ? 246 ARG A NH2 1 
ATOM   1981 N  N   . ASN A 1 247 ? -12.745 -1.550  44.821 1.00 25.24  ? 247 ASN A N   1 
ATOM   1982 C  CA  . ASN A 1 247 ? -13.264 -1.970  46.106 1.00 30.73  ? 247 ASN A CA  1 
ATOM   1983 C  C   . ASN A 1 247 ? -12.443 -3.094  46.783 1.00 30.95  ? 247 ASN A C   1 
ATOM   1984 O  O   . ASN A 1 247 ? -12.806 -3.588  47.828 1.00 30.78  ? 247 ASN A O   1 
ATOM   1985 C  CB  . ASN A 1 247 ? -14.764 -2.306  46.012 1.00 29.70  ? 247 ASN A CB  1 
ATOM   1986 C  CG  . ASN A 1 247 ? -15.593 -1.113  45.562 1.00 30.30  ? 247 ASN A CG  1 
ATOM   1987 O  OD1 . ASN A 1 247 ? -15.487 -0.056  46.111 1.00 32.53  ? 247 ASN A OD1 1 
ATOM   1988 N  ND2 . ASN A 1 247 ? -16.364 -1.294  44.529 1.00 31.30  ? 247 ASN A ND2 1 
ATOM   1989 N  N   . GLN A 1 248 ? -11.360 -3.475  46.144 1.00 25.75  ? 248 GLN A N   1 
ATOM   1990 C  CA  . GLN A 1 248 ? -10.464 -4.487  46.693 1.00 27.91  ? 248 GLN A CA  1 
ATOM   1991 C  C   . GLN A 1 248 ? -9.252  -3.813  47.305 1.00 28.67  ? 248 GLN A C   1 
ATOM   1992 O  O   . GLN A 1 248 ? -8.767  -2.811  46.784 1.00 28.58  ? 248 GLN A O   1 
ATOM   1993 C  CB  . GLN A 1 248 ? -10.014 -5.463  45.606 1.00 27.43  ? 248 GLN A CB  1 
ATOM   1994 C  CG  . GLN A 1 248 ? -11.117 -6.380  45.125 1.00 31.12  ? 248 GLN A CG  1 
ATOM   1995 C  CD  . GLN A 1 248 ? -11.655 -7.243  46.241 1.00 35.81  ? 248 GLN A CD  1 
ATOM   1996 O  OE1 . GLN A 1 248 ? -10.889 -7.848  47.000 1.00 36.29  ? 248 GLN A OE1 1 
ATOM   1997 N  NE2 . GLN A 1 248 ? -12.978 -7.303  46.356 1.00 31.11  ? 248 GLN A NE2 1 
ATOM   1998 N  N   . ASN A 1 249 ? -8.770  -4.351  48.419 1.00 27.58  ? 249 ASN A N   1 
ATOM   1999 C  CA  . ASN A 1 249 ? -7.613  -3.763  49.082 1.00 25.57  ? 249 ASN A CA  1 
ATOM   2000 C  C   . ASN A 1 249 ? -6.512  -4.810  49.214 1.00 24.79  ? 249 ASN A C   1 
ATOM   2001 O  O   . ASN A 1 249 ? -6.723  -5.983  48.909 1.00 20.24  ? 249 ASN A O   1 
ATOM   2002 C  CB  . ASN A 1 249 ? -8.016  -3.219  50.455 1.00 27.98  ? 249 ASN A CB  1 
ATOM   2003 C  CG  . ASN A 1 249 ? -7.091  -2.108  50.950 1.00 32.86  ? 249 ASN A CG  1 
ATOM   2004 O  OD1 . ASN A 1 249 ? -5.988  -1.908  50.434 1.00 29.31  ? 249 ASN A OD1 1 
ATOM   2005 N  ND2 . ASN A 1 249 ? -7.542  -1.387  51.972 1.00 34.22  ? 249 ASN A ND2 1 
ATOM   2006 N  N   . TYR A 1 250 ? -5.342  -4.382  49.674 1.00 20.64  ? 250 TYR A N   1 
ATOM   2007 C  CA  . TYR A 1 250 ? -4.234  -5.292  49.937 1.00 18.21  ? 250 TYR A CA  1 
ATOM   2008 C  C   . TYR A 1 250 ? -4.629  -6.428  50.887 1.00 20.19  ? 250 TYR A C   1 
ATOM   2009 O  O   . TYR A 1 250 ? -5.463  -6.251  51.766 1.00 19.73  ? 250 TYR A O   1 
ATOM   2010 C  CB  . TYR A 1 250 ? -3.073  -4.494  50.542 1.00 18.11  ? 250 TYR A CB  1 
ATOM   2011 C  CG  . TYR A 1 250 ? -1.827  -5.307  50.814 1.00 16.03  ? 250 TYR A CG  1 
ATOM   2012 C  CD1 . TYR A 1 250 ? -0.868  -5.482  49.826 1.00 14.60  ? 250 TYR A CD1 1 
ATOM   2013 C  CD2 . TYR A 1 250 ? -1.595  -5.870  52.065 1.00 16.29  ? 250 TYR A CD2 1 
ATOM   2014 C  CE1 . TYR A 1 250 ? 0.278   -6.214  50.063 1.00 13.65  ? 250 TYR A CE1 1 
ATOM   2015 C  CE2 . TYR A 1 250 ? -0.449  -6.613  52.314 1.00 16.05  ? 250 TYR A CE2 1 
ATOM   2016 C  CZ  . TYR A 1 250 ? 0.491   -6.769  51.310 1.00 14.93  ? 250 TYR A CZ  1 
ATOM   2017 O  OH  . TYR A 1 250 ? 1.639   -7.495  51.533 1.00 13.82  ? 250 TYR A OH  1 
ATOM   2018 N  N   . GLN A 1 251 ? -4.032  -7.599  50.685 1.00 18.02  ? 251 GLN A N   1 
ATOM   2019 C  CA  . GLN A 1 251 ? -4.158  -8.730  51.595 1.00 18.02  ? 251 GLN A CA  1 
ATOM   2020 C  C   . GLN A 1 251 ? -2.784  -9.381  51.676 1.00 20.22  ? 251 GLN A C   1 
ATOM   2021 O  O   . GLN A 1 251 ? -2.074  -9.427  50.669 1.00 18.56  ? 251 GLN A O   1 
ATOM   2022 C  CB  . GLN A 1 251 ? -5.172  -9.745  51.067 1.00 21.42  ? 251 GLN A CB  1 
ATOM   2023 C  CG  . GLN A 1 251 ? -6.617  -9.288  51.138 1.00 23.64  ? 251 GLN A CG  1 
ATOM   2024 C  CD  . GLN A 1 251 ? -7.574  -10.348 50.634 1.00 29.86  ? 251 GLN A CD  1 
ATOM   2025 O  OE1 . GLN A 1 251 ? -7.768  -11.380 51.277 1.00 37.58  ? 251 GLN A OE1 1 
ATOM   2026 N  NE2 . GLN A 1 251 ? -8.168  -10.107 49.473 1.00 27.19  ? 251 GLN A NE2 1 
ATOM   2027 N  N   . PRO A 1 252 ? -2.407  -9.896  52.862 1.00 19.64  ? 252 PRO A N   1 
ATOM   2028 C  CA  . PRO A 1 252 ? -3.248  -9.993  54.065 1.00 19.92  ? 252 PRO A CA  1 
ATOM   2029 C  C   . PRO A 1 252 ? -3.295  -8.721  54.902 1.00 21.95  ? 252 PRO A C   1 
ATOM   2030 O  O   . PRO A 1 252 ? -2.339  -7.938  54.923 1.00 19.10  ? 252 PRO A O   1 
ATOM   2031 C  CB  . PRO A 1 252 ? -2.574  -11.117 54.864 1.00 20.29  ? 252 PRO A CB  1 
ATOM   2032 C  CG  . PRO A 1 252 ? -1.128  -10.997 54.515 1.00 18.65  ? 252 PRO A CG  1 
ATOM   2033 C  CD  . PRO A 1 252 ? -1.092  -10.537 53.059 1.00 19.29  ? 252 PRO A CD  1 
ATOM   2034 N  N   . MET A 1 253 ? -4.394  -8.526  55.612 1.00 26.77  ? 253 MET A N   1 
ATOM   2035 C  CA  . MET A 1 253 ? -4.549  -7.405  56.507 1.00 26.61  ? 253 MET A CA  1 
ATOM   2036 C  C   . MET A 1 253 ? -3.952  -7.682  57.890 1.00 29.36  ? 253 MET A C   1 
ATOM   2037 O  O   . MET A 1 253 ? -3.422  -6.825  58.514 1.00 30.33  ? 253 MET A O   1 
ATOM   2038 C  CB  . MET A 1 253 ? -6.006  -6.999  56.604 1.00 30.56  ? 253 MET A CB  1 
ATOM   2039 C  CG  . MET A 1 253 ? -6.466  -6.184  55.418 1.00 33.52  ? 253 MET A CG  1 
ATOM   2040 S  SD  . MET A 1 253 ? -5.807  -4.537  55.437 1.00 38.81  ? 253 MET A SD  1 
ATOM   2041 C  CE  . MET A 1 253 ? -6.235  -4.009  57.033 1.00 36.23  ? 253 MET A CE  1 
ATOM   2042 N  N   . LYS A 1 254 ? -3.984  -8.914  58.376 1.00 59.92  ? 254 LYS A N   1 
ATOM   2043 C  CA  . LYS A 1 254 ? -3.435  -9.106  59.723 1.00 62.73  ? 254 LYS A CA  1 
ATOM   2044 C  C   . LYS A 1 254 ? -2.568  -10.340 59.964 1.00 62.47  ? 254 LYS A C   1 
ATOM   2045 O  O   . LYS A 1 254 ? -1.369  -10.246 60.224 1.00 64.88  ? 254 LYS A O   1 
ATOM   2046 C  CB  . LYS A 1 254 ? -4.565  -9.068  60.758 1.00 69.40  ? 254 LYS A CB  1 
ATOM   2047 C  CG  . LYS A 1 254 ? -5.632  -10.131 60.552 1.00 71.53  ? 254 LYS A CG  1 
ATOM   2048 C  CD  . LYS A 1 254 ? -6.899  -9.535  59.961 1.00 78.95  ? 254 LYS A CD  1 
ATOM   2049 C  CE  . LYS A 1 254 ? -7.721  -8.822  61.022 1.00 82.55  ? 254 LYS A CE  1 
ATOM   2050 N  NZ  . LYS A 1 254 ? -8.396  -9.781  61.940 1.00 84.36  ? 254 LYS A NZ  1 
ATOM   2051 N  N   . ASN A 1 255 ? -3.215  -11.490 59.884 1.00 43.34  ? 255 ASN A N   1 
ATOM   2052 C  CA  . ASN A 1 255 ? -2.728  -12.764 60.388 1.00 49.09  ? 255 ASN A CA  1 
ATOM   2053 C  C   . ASN A 1 255 ? -1.818  -13.492 59.409 1.00 47.48  ? 255 ASN A C   1 
ATOM   2054 O  O   . ASN A 1 255 ? -1.862  -14.718 59.318 1.00 50.18  ? 255 ASN A O   1 
ATOM   2055 C  CB  . ASN A 1 255 ? -3.901  -13.666 60.780 1.00 54.88  ? 255 ASN A CB  1 
ATOM   2056 C  CG  . ASN A 1 255 ? -4.780  -13.047 61.849 1.00 55.24  ? 255 ASN A CG  1 
ATOM   2057 O  OD1 . ASN A 1 255 ? -4.424  -12.035 62.452 1.00 55.57  ? 255 ASN A OD1 1 
ATOM   2058 N  ND2 . ASN A 1 255 ? -5.936  -13.654 62.089 1.00 58.77  ? 255 ASN A ND2 1 
ATOM   2059 N  N   . GLY A 1 256 ? -0.989  -12.751 58.678 1.00 61.92  ? 256 GLY A N   1 
ATOM   2060 C  CA  . GLY A 1 256 ? -0.063  -13.417 57.766 1.00 55.36  ? 256 GLY A CA  1 
ATOM   2061 C  C   . GLY A 1 256 ? 1.302   -13.333 58.385 1.00 52.67  ? 256 GLY A C   1 
ATOM   2062 O  O   . GLY A 1 256 ? 1.403   -12.860 59.455 1.00 54.61  ? 256 GLY A O   1 
ATOM   2063 N  N   . PRO A 1 257 ? 2.361   -13.742 57.683 1.00 17.61  ? 257 PRO A N   1 
ATOM   2064 C  CA  . PRO A 1 257 ? 3.667   -13.657 58.349 1.00 20.61  ? 257 PRO A CA  1 
ATOM   2065 C  C   . PRO A 1 257 ? 4.073   -12.197 58.572 1.00 19.51  ? 257 PRO A C   1 
ATOM   2066 O  O   . PRO A 1 257 ? 3.700   -11.328 57.779 1.00 17.84  ? 257 PRO A O   1 
ATOM   2067 C  CB  . PRO A 1 257 ? 4.621   -14.305 57.334 1.00 21.53  ? 257 PRO A CB  1 
ATOM   2068 C  CG  . PRO A 1 257 ? 3.758   -15.133 56.457 1.00 20.00  ? 257 PRO A CG  1 
ATOM   2069 C  CD  . PRO A 1 257 ? 2.422   -14.465 56.404 1.00 20.02  ? 257 PRO A CD  1 
ATOM   2070 N  N   . PHE A 1 258 ? 4.818   -11.923 59.636 1.00 16.58  ? 258 PHE A N   1 
ATOM   2071 C  CA  . PHE A 1 258 ? 5.294   -10.571 59.885 1.00 18.33  ? 258 PHE A CA  1 
ATOM   2072 C  C   . PHE A 1 258 ? 6.151   -10.113 58.711 1.00 17.81  ? 258 PHE A C   1 
ATOM   2073 O  O   . PHE A 1 258 ? 7.052   -10.828 58.289 1.00 16.92  ? 258 PHE A O   1 
ATOM   2074 C  CB  . PHE A 1 258 ? 6.114   -10.514 61.178 1.00 19.57  ? 258 PHE A CB  1 
ATOM   2075 C  CG  . PHE A 1 258 ? 6.653   -9.140  61.496 1.00 22.03  ? 258 PHE A CG  1 
ATOM   2076 C  CD1 . PHE A 1 258 ? 5.808   -8.130  61.918 1.00 23.93  ? 258 PHE A CD1 1 
ATOM   2077 C  CD2 . PHE A 1 258 ? 8.008   -8.869  61.393 1.00 23.35  ? 258 PHE A CD2 1 
ATOM   2078 C  CE1 . PHE A 1 258 ? 6.302   -6.867  62.218 1.00 25.05  ? 258 PHE A CE1 1 
ATOM   2079 C  CE2 . PHE A 1 258 ? 8.506   -7.613  61.702 1.00 22.39  ? 258 PHE A CE2 1 
ATOM   2080 C  CZ  . PHE A 1 258 ? 7.654   -6.614  62.112 1.00 23.76  ? 258 PHE A CZ  1 
ATOM   2081 N  N   . GLY A 1 259 ? 5.860   -8.923  58.197 1.00 17.49  ? 259 GLY A N   1 
ATOM   2082 C  CA  . GLY A 1 259 ? 6.520   -8.400  57.015 1.00 20.70  ? 259 GLY A CA  1 
ATOM   2083 C  C   . GLY A 1 259 ? 5.629   -8.481  55.780 1.00 17.78  ? 259 GLY A C   1 
ATOM   2084 O  O   . GLY A 1 259 ? 5.925   -7.873  54.747 1.00 17.74  ? 259 GLY A O   1 
ATOM   2085 N  N   . GLN A 1 260 ? 4.521   -9.211  55.891 1.00 14.85  ? 260 GLN A N   1 
ATOM   2086 C  CA  . GLN A 1 260 ? 3.602   -9.375  54.769 1.00 13.58  ? 260 GLN A CA  1 
ATOM   2087 C  C   . GLN A 1 260 ? 2.260   -8.656  54.963 1.00 17.30  ? 260 GLN A C   1 
ATOM   2088 O  O   . GLN A 1 260 ? 1.516   -8.463  54.004 1.00 17.23  ? 260 GLN A O   1 
ATOM   2089 C  CB  . GLN A 1 260 ? 3.351   -10.859 54.508 1.00 14.26  ? 260 GLN A CB  1 
ATOM   2090 C  CG  . GLN A 1 260 ? 4.614   -11.660 54.164 1.00 15.92  ? 260 GLN A CG  1 
ATOM   2091 C  CD  . GLN A 1 260 ? 5.255   -11.195 52.869 1.00 15.73  ? 260 GLN A CD  1 
ATOM   2092 O  OE1 . GLN A 1 260 ? 4.571   -10.686 51.982 1.00 16.35  ? 260 GLN A OE1 1 
ATOM   2093 N  NE2 . GLN A 1 260 ? 6.574   -11.382 52.746 1.00 14.75  ? 260 GLN A NE2 1 
ATOM   2094 N  N   . ASN A 1 261 ? 1.943   -8.276  56.196 1.00 14.54  ? 261 ASN A N   1 
ATOM   2095 C  CA  . ASN A 1 261 ? 0.652   -7.645  56.474 1.00 15.94  ? 261 ASN A CA  1 
ATOM   2096 C  C   . ASN A 1 261 ? 0.615   -6.175  56.083 1.00 15.98  ? 261 ASN A C   1 
ATOM   2097 O  O   . ASN A 1 261 ? 1.655   -5.540  55.935 1.00 14.36  ? 261 ASN A O   1 
ATOM   2098 C  CB  . ASN A 1 261 ? 0.251   -7.812  57.939 1.00 19.11  ? 261 ASN A CB  1 
ATOM   2099 C  CG  . ASN A 1 261 ? 0.128   -9.265  58.338 1.00 20.34  ? 261 ASN A CG  1 
ATOM   2100 O  OD1 . ASN A 1 261 ? -0.792  -9.955  57.901 1.00 19.40  ? 261 ASN A OD1 1 
ATOM   2101 N  ND2 . ASN A 1 261 ? 1.063   -9.746  59.159 1.00 18.74  ? 261 ASN A ND2 1 
ATOM   2102 N  N   . PHE A 1 262 ? -0.600  -5.654  55.940 1.00 16.23  ? 262 PHE A N   1 
ATOM   2103 C  CA  . PHE A 1 262 ? -0.876  -4.295  55.450 1.00 15.88  ? 262 PHE A CA  1 
ATOM   2104 C  C   . PHE A 1 262 ? -0.051  -3.210  56.146 1.00 18.19  ? 262 PHE A C   1 
ATOM   2105 O  O   . PHE A 1 262 ? 0.383   -2.234  55.522 1.00 15.44  ? 262 PHE A O   1 
ATOM   2106 C  CB  . PHE A 1 262 ? -2.368  -4.008  55.663 1.00 18.73  ? 262 PHE A CB  1 
ATOM   2107 C  CG  . PHE A 1 262 ? -2.876  -2.767  54.967 1.00 20.19  ? 262 PHE A CG  1 
ATOM   2108 C  CD1 . PHE A 1 262 ? -2.686  -2.583  53.604 1.00 19.71  ? 262 PHE A CD1 1 
ATOM   2109 C  CD2 . PHE A 1 262 ? -3.602  -1.815  55.671 1.00 21.10  ? 262 PHE A CD2 1 
ATOM   2110 C  CE1 . PHE A 1 262 ? -3.188  -1.447  52.959 1.00 20.57  ? 262 PHE A CE1 1 
ATOM   2111 C  CE2 . PHE A 1 262 ? -4.102  -0.684  55.035 1.00 21.34  ? 262 PHE A CE2 1 
ATOM   2112 C  CZ  . PHE A 1 262 ? -3.892  -0.501  53.681 1.00 22.17  ? 262 PHE A CZ  1 
ATOM   2113 N  N   . ARG A 1 263 ? 0.126   -3.352  57.444 1.00 14.01  ? 263 ARG A N   1 
ATOM   2114 C  CA  . ARG A 1 263 ? 0.809   -2.337  58.240 1.00 16.68  ? 263 ARG A CA  1 
ATOM   2115 C  C   . ARG A 1 263 ? 2.140   -2.795  58.827 1.00 18.05  ? 263 ARG A C   1 
ATOM   2116 O  O   . ARG A 1 263 ? 2.619   -2.184  59.751 1.00 17.60  ? 263 ARG A O   1 
ATOM   2117 C  CB  . ARG A 1 263 ? -0.112  -1.771  59.323 1.00 21.66  ? 263 ARG A CB  1 
ATOM   2118 C  CG  . ARG A 1 263 ? -1.246  -1.018  58.772 1.00 23.77  ? 263 ARG A CG  1 
ATOM   2119 C  CD  . ARG A 1 263 ? -2.101  -0.358  59.787 1.00 29.78  ? 263 ARG A CD  1 
ATOM   2120 N  NE  . ARG A 1 263 ? -3.025  0.505   59.093 1.00 31.91  ? 263 ARG A NE  1 
ATOM   2121 C  CZ  . ARG A 1 263 ? -4.331  0.496   59.255 1.00 32.98  ? 263 ARG A CZ  1 
ATOM   2122 N  NH1 . ARG A 1 263 ? -4.869  -0.302  60.127 1.00 37.78  ? 263 ARG A NH1 1 
ATOM   2123 N  NH2 . ARG A 1 263 ? -5.088  1.311   58.552 1.00 31.68  ? 263 ARG A NH2 1 
ATOM   2124 N  N   . ASP A 1 264 ? 2.720   -3.851  58.266 1.00 17.01  ? 264 ASP A N   1 
ATOM   2125 C  CA  . ASP A 1 264 ? 4.033   -4.336  58.692 1.00 17.68  ? 264 ASP A CA  1 
ATOM   2126 C  C   . ASP A 1 264 ? 5.101   -3.587  57.904 1.00 16.08  ? 264 ASP A C   1 
ATOM   2127 O  O   . ASP A 1 264 ? 4.906   -3.297  56.729 1.00 15.35  ? 264 ASP A O   1 
ATOM   2128 C  CB  . ASP A 1 264 ? 4.191   -5.831  58.370 1.00 17.85  ? 264 ASP A CB  1 
ATOM   2129 C  CG  . ASP A 1 264 ? 3.367   -6.739  59.268 1.00 21.78  ? 264 ASP A CG  1 
ATOM   2130 O  OD1 . ASP A 1 264 ? 2.829   -6.266  60.300 1.00 19.67  ? 264 ASP A OD1 1 
ATOM   2131 O  OD2 . ASP A 1 264 ? 3.292   -7.954  58.937 1.00 17.81  ? 264 ASP A OD2 1 
ATOM   2132 N  N   . PRO A 1 265 ? 6.253   -3.308  58.530 1.00 17.31  ? 265 PRO A N   1 
ATOM   2133 C  CA  . PRO A 1 265 ? 7.363   -2.702  57.784 1.00 15.31  ? 265 PRO A CA  1 
ATOM   2134 C  C   . PRO A 1 265 ? 7.945   -3.702  56.785 1.00 16.98  ? 265 PRO A C   1 
ATOM   2135 O  O   . PRO A 1 265 ? 8.044   -4.887  57.103 1.00 15.38  ? 265 PRO A O   1 
ATOM   2136 C  CB  . PRO A 1 265 ? 8.414   -2.415  58.870 1.00 22.34  ? 265 PRO A CB  1 
ATOM   2137 C  CG  . PRO A 1 265 ? 7.775   -2.752  60.185 1.00 26.26  ? 265 PRO A CG  1 
ATOM   2138 C  CD  . PRO A 1 265 ? 6.596   -3.599  59.935 1.00 19.71  ? 265 PRO A CD  1 
ATOM   2139 N  N   . MET A 1 266 ? 8.331   -3.228  55.605 1.00 13.86  ? 266 MET A N   1 
ATOM   2140 C  CA  . MET A 1 266 ? 8.947   -4.074  54.590 1.00 13.75  ? 266 MET A CA  1 
ATOM   2141 C  C   . MET A 1 266 ? 10.463  -3.947  54.647 1.00 14.34  ? 266 MET A C   1 
ATOM   2142 O  O   . MET A 1 266 ? 11.032  -2.976  54.135 1.00 12.26  ? 266 MET A O   1 
ATOM   2143 C  CB  . MET A 1 266 ? 8.455   -3.667  53.190 1.00 14.35  ? 266 MET A CB  1 
ATOM   2144 C  CG  . MET A 1 266 ? 6.963   -3.871  52.986 1.00 13.66  ? 266 MET A CG  1 
ATOM   2145 S  SD  . MET A 1 266 ? 6.411   -3.429  51.318 1.00 13.27  ? 266 MET A SD  1 
ATOM   2146 C  CE  . MET A 1 266 ? 6.743   -1.676  51.287 1.00 10.50  ? 266 MET A CE  1 
ATOM   2147 N  N   . TYR A 1 267 ? 11.106  -4.921  55.286 1.00 13.25  ? 267 TYR A N   1 
ATOM   2148 C  CA  . TYR A 1 267 ? 12.557  -5.010  55.294 1.00 13.19  ? 267 TYR A CA  1 
ATOM   2149 C  C   . TYR A 1 267 ? 13.093  -4.818  53.864 1.00 10.97  ? 267 TYR A C   1 
ATOM   2150 O  O   . TYR A 1 267 ? 12.596  -5.449  52.930 1.00 12.45  ? 267 TYR A O   1 
ATOM   2151 C  CB  . TYR A 1 267 ? 13.000  -6.374  55.843 1.00 11.67  ? 267 TYR A CB  1 
ATOM   2152 C  CG  . TYR A 1 267 ? 14.499  -6.470  55.919 1.00 13.36  ? 267 TYR A CG  1 
ATOM   2153 C  CD1 . TYR A 1 267 ? 15.180  -6.037  57.046 1.00 12.42  ? 267 TYR A CD1 1 
ATOM   2154 C  CD2 . TYR A 1 267 ? 15.237  -6.956  54.849 1.00 11.73  ? 267 TYR A CD2 1 
ATOM   2155 C  CE1 . TYR A 1 267 ? 16.561  -6.088  57.113 1.00 12.02  ? 267 TYR A CE1 1 
ATOM   2156 C  CE2 . TYR A 1 267 ? 16.622  -7.015  54.904 1.00 12.90  ? 267 TYR A CE2 1 
ATOM   2157 C  CZ  . TYR A 1 267 ? 17.277  -6.575  56.041 1.00 14.52  ? 267 TYR A CZ  1 
ATOM   2158 O  OH  . TYR A 1 267 ? 18.656  -6.629  56.105 1.00 14.45  ? 267 TYR A OH  1 
ATOM   2159 N  N   . PRO A 1 268 ? 14.140  -4.002  53.687 1.00 11.09  ? 268 PRO A N   1 
ATOM   2160 C  CA  . PRO A 1 268 ? 15.025  -3.369  54.674 1.00 10.97  ? 268 PRO A CA  1 
ATOM   2161 C  C   . PRO A 1 268 ? 14.593  -1.995  55.175 1.00 12.12  ? 268 PRO A C   1 
ATOM   2162 O  O   . PRO A 1 268 ? 15.421  -1.313  55.787 1.00 12.33  ? 268 PRO A O   1 
ATOM   2163 C  CB  . PRO A 1 268 ? 16.318  -3.197  53.883 1.00 12.58  ? 268 PRO A CB  1 
ATOM   2164 C  CG  . PRO A 1 268 ? 15.806  -2.826  52.488 1.00 12.22  ? 268 PRO A CG  1 
ATOM   2165 C  CD  . PRO A 1 268 ? 14.648  -3.818  52.308 1.00 12.35  ? 268 PRO A CD  1 
ATOM   2166 N  N   . TRP A 1 269 ? 13.343  -1.598  54.929 1.00 12.66  ? 269 TRP A N   1 
ATOM   2167 C  CA  . TRP A 1 269 ? 12.871  -0.259  55.255 1.00 11.17  ? 269 TRP A CA  1 
ATOM   2168 C  C   . TRP A 1 269 ? 11.827  -0.328  56.361 1.00 14.61  ? 269 TRP A C   1 
ATOM   2169 O  O   . TRP A 1 269 ? 11.469  -1.411  56.803 1.00 14.93  ? 269 TRP A O   1 
ATOM   2170 C  CB  . TRP A 1 269 ? 12.234  0.415   54.029 1.00 13.99  ? 269 TRP A CB  1 
ATOM   2171 C  CG  . TRP A 1 269 ? 13.052  0.343   52.797 1.00 12.75  ? 269 TRP A CG  1 
ATOM   2172 C  CD1 . TRP A 1 269 ? 14.273  0.914   52.593 1.00 15.20  ? 269 TRP A CD1 1 
ATOM   2173 C  CD2 . TRP A 1 269 ? 12.711  -0.322  51.575 1.00 12.60  ? 269 TRP A CD2 1 
ATOM   2174 N  NE1 . TRP A 1 269 ? 14.726  0.634   51.325 1.00 13.18  ? 269 TRP A NE1 1 
ATOM   2175 C  CE2 . TRP A 1 269 ? 13.781  -0.124  50.677 1.00 12.41  ? 269 TRP A CE2 1 
ATOM   2176 C  CE3 . TRP A 1 269 ? 11.612  -1.086  51.159 1.00 12.90  ? 269 TRP A CE3 1 
ATOM   2177 C  CZ2 . TRP A 1 269 ? 13.781  -0.640  49.381 1.00 12.08  ? 269 TRP A CZ2 1 
ATOM   2178 C  CZ3 . TRP A 1 269 ? 11.615  -1.610  49.869 1.00 11.33  ? 269 TRP A CZ3 1 
ATOM   2179 C  CH2 . TRP A 1 269 ? 12.694  -1.385  48.999 1.00 11.33  ? 269 TRP A CH2 1 
ATOM   2180 N  N   . ASN A 1 270 ? 11.339  0.830   56.793 1.00 15.15  ? 270 ASN A N   1 
ATOM   2181 C  CA  . ASN A 1 270 ? 10.192  0.906   57.703 1.00 16.81  ? 270 ASN A CA  1 
ATOM   2182 C  C   . ASN A 1 270 ? 8.861   1.106   56.954 1.00 19.17  ? 270 ASN A C   1 
ATOM   2183 O  O   . ASN A 1 270 ? 7.789   1.004   57.530 1.00 17.54  ? 270 ASN A O   1 
ATOM   2184 C  CB  . ASN A 1 270 ? 10.401  2.018   58.735 1.00 19.44  ? 270 ASN A CB  1 
ATOM   2185 C  CG  . ASN A 1 270 ? 11.577  1.735   59.655 1.00 25.94  ? 270 ASN A CG  1 
ATOM   2186 O  OD1 . ASN A 1 270 ? 12.330  2.643   60.023 1.00 33.39  ? 270 ASN A OD1 1 
ATOM   2187 N  ND2 . ASN A 1 270 ? 11.746  0.474   60.023 1.00 24.07  ? 270 ASN A ND2 1 
ATOM   2188 N  N   . THR A 1 271 ? 8.956   1.348   55.656 1.00 14.84  ? 271 THR A N   1 
ATOM   2189 C  CA  . THR A 1 271 ? 7.790   1.561   54.792 1.00 16.44  ? 271 THR A CA  1 
ATOM   2190 C  C   . THR A 1 271 ? 6.831   0.373   54.837 1.00 15.99  ? 271 THR A C   1 
ATOM   2191 O  O   . THR A 1 271 ? 7.271   -0.766  54.794 1.00 12.64  ? 271 THR A O   1 
ATOM   2192 C  CB  . THR A 1 271 ? 8.249   1.742   53.332 1.00 16.04  ? 271 THR A CB  1 
ATOM   2193 O  OG1 . THR A 1 271 ? 9.285   2.734   53.278 1.00 18.07  ? 271 THR A OG1 1 
ATOM   2194 C  CG2 . THR A 1 271 ? 7.069   2.156   52.425 1.00 14.83  ? 271 THR A CG2 1 
ATOM   2195 N  N   . THR A 1 272 ? 5.524   0.637   54.915 1.00 12.57  ? 272 THR A N   1 
ATOM   2196 C  CA  . THR A 1 272 ? 4.521   -0.434  54.917 1.00 12.96  ? 272 THR A CA  1 
ATOM   2197 C  C   . THR A 1 272 ? 3.785   -0.535  53.570 1.00 12.41  ? 272 THR A C   1 
ATOM   2198 O  O   . THR A 1 272 ? 3.773   0.428   52.787 1.00 13.96  ? 272 THR A O   1 
ATOM   2199 C  CB  . THR A 1 272 ? 3.467   -0.192  56.016 1.00 15.49  ? 272 THR A CB  1 
ATOM   2200 O  OG1 . THR A 1 272 ? 2.675   0.938   55.650 1.00 15.10  ? 272 THR A OG1 1 
ATOM   2201 C  CG2 . THR A 1 272 ? 4.127   0.058   57.370 1.00 16.18  ? 272 THR A CG2 1 
ATOM   2202 N  N   . PRO A 1 273 ? 3.132   -1.679  53.303 1.00 12.57  ? 273 PRO A N   1 
ATOM   2203 C  CA  . PRO A 1 273 ? 2.323   -1.725  52.080 1.00 12.84  ? 273 PRO A CA  1 
ATOM   2204 C  C   . PRO A 1 273 ? 1.264   -0.616  52.061 1.00 14.42  ? 273 PRO A C   1 
ATOM   2205 O  O   . PRO A 1 273 ? 1.058   -0.012  51.019 1.00 14.96  ? 273 PRO A O   1 
ATOM   2206 C  CB  . PRO A 1 273 ? 1.662   -3.104  52.150 1.00 14.25  ? 273 PRO A CB  1 
ATOM   2207 C  CG  . PRO A 1 273 ? 2.659   -3.941  52.888 1.00 13.31  ? 273 PRO A CG  1 
ATOM   2208 C  CD  . PRO A 1 273 ? 3.207   -3.001  53.958 1.00 14.10  ? 273 PRO A CD  1 
ATOM   2209 N  N   . GLU A 1 274 ? 0.688   -0.308  53.233 1.00 27.62  ? 274 GLU A N   1 
ATOM   2210 C  CA  . GLU A 1 274 ? -0.304  0.790   53.395 1.00 27.49  ? 274 GLU A CA  1 
ATOM   2211 C  C   . GLU A 1 274 ? 0.255   2.106   52.840 1.00 29.72  ? 274 GLU A C   1 
ATOM   2212 O  O   . GLU A 1 274 ? -0.393  2.796   52.064 1.00 29.58  ? 274 GLU A O   1 
ATOM   2213 C  CB  . GLU A 1 274 ? -0.890  0.838   54.808 1.00 29.56  ? 274 GLU A CB  1 
ATOM   2214 C  CG  . GLU A 1 274 ? -1.266  2.268   55.176 1.00 32.39  ? 274 GLU A CG  1 
ATOM   2215 C  CD  . GLU A 1 274 ? -2.014  2.371   56.496 1.00 41.67  ? 274 GLU A CD  1 
ATOM   2216 O  OE1 . GLU A 1 274 ? -1.324  2.558   57.514 1.00 37.04  ? 274 GLU A OE1 1 
ATOM   2217 O  OE2 . GLU A 1 274 ? -3.319  2.207   56.475 1.00 44.54  ? 274 GLU A OE2 1 
ATOM   2218 N  N   . ASP A 1 275 ? 1.454   2.460   53.282 1.00 18.14  ? 275 ASP A N   1 
ATOM   2219 C  CA  . ASP A 1 275 ? 2.230   3.588   52.768 1.00 20.63  ? 275 ASP A CA  1 
ATOM   2220 C  C   . ASP A 1 275 ? 2.277   3.803   51.249 1.00 21.68  ? 275 ASP A C   1 
ATOM   2221 O  O   . ASP A 1 275 ? 2.273   4.946   50.776 1.00 21.79  ? 275 ASP A O   1 
ATOM   2222 C  CB  . ASP A 1 275 ? 3.666   3.585   53.315 1.00 20.46  ? 275 ASP A CB  1 
ATOM   2223 C  CG  . ASP A 1 275 ? 3.727   3.772   54.820 1.00 26.79  ? 275 ASP A CG  1 
ATOM   2224 O  OD1 . ASP A 1 275 ? 2.768   4.338   55.401 1.00 27.94  ? 275 ASP A OD1 1 
ATOM   2225 O  OD2 . ASP A 1 275 ? 4.746   3.364   55.425 1.00 24.39  ? 275 ASP A OD2 1 
ATOM   2226 N  N   . VAL A 1 276 ? 2.330   2.717   50.484 1.00 15.46  ? 276 VAL A N   1 
ATOM   2227 C  CA  . VAL A 1 276 ? 2.477   2.840   49.034 1.00 16.50  ? 276 VAL A CA  1 
ATOM   2228 C  C   . VAL A 1 276 ? 1.263   2.299   48.260 1.00 16.02  ? 276 VAL A C   1 
ATOM   2229 O  O   . VAL A 1 276 ? 1.340   2.047   47.070 1.00 16.28  ? 276 VAL A O   1 
ATOM   2230 C  CB  . VAL A 1 276 ? 3.767   2.152   48.533 1.00 14.81  ? 276 VAL A CB  1 
ATOM   2231 C  CG1 . VAL A 1 276 ? 5.000   2.772   49.201 1.00 14.76  ? 276 VAL A CG1 1 
ATOM   2232 C  CG2 . VAL A 1 276 ? 3.718   0.646   48.793 1.00 14.15  ? 276 VAL A CG2 1 
ATOM   2233 N  N   . MET A 1 277 ? 0.146   2.134   48.962 1.00 17.26  ? 277 MET A N   1 
ATOM   2234 C  CA  . MET A 1 277 ? -1.082  1.655   48.340 1.00 20.30  ? 277 MET A CA  1 
ATOM   2235 C  C   . MET A 1 277 ? -1.427  2.495   47.115 1.00 21.60  ? 277 MET A C   1 
ATOM   2236 O  O   . MET A 1 277 ? -1.362  2.015   45.984 1.00 22.85  ? 277 MET A O   1 
ATOM   2237 C  CB  . MET A 1 277 ? -2.238  1.684   49.342 1.00 23.25  ? 277 MET A CB  1 
ATOM   2238 C  CG  . MET A 1 277 ? -2.974  0.362   49.480 1.00 34.20  ? 277 MET A CG  1 
ATOM   2239 S  SD  . MET A 1 277 ? -2.300  -0.924  48.411 1.00 33.76  ? 277 MET A SD  1 
ATOM   2240 C  CE  . MET A 1 277 ? -1.016  -1.599  49.461 1.00 23.57  ? 277 MET A CE  1 
ATOM   2241 N  N   . ASN A 1 278 ? -1.792  3.751   47.350 1.00 18.77  ? 278 ASN A N   1 
ATOM   2242 C  CA  . ASN A 1 278 ? -2.114  4.670   46.266 1.00 24.25  ? 278 ASN A CA  1 
ATOM   2243 C  C   . ASN A 1 278 ? -0.858  5.302   45.678 1.00 20.40  ? 278 ASN A C   1 
ATOM   2244 O  O   . ASN A 1 278 ? -0.141  6.033   46.363 1.00 21.59  ? 278 ASN A O   1 
ATOM   2245 C  CB  . ASN A 1 278 ? -3.074  5.758   46.751 1.00 25.27  ? 278 ASN A CB  1 
ATOM   2246 C  CG  . ASN A 1 278 ? -3.398  6.773   45.673 1.00 31.91  ? 278 ASN A CG  1 
ATOM   2247 O  OD1 . ASN A 1 278 ? -2.860  6.715   44.568 1.00 35.89  ? 278 ASN A OD1 1 
ATOM   2248 N  ND2 . ASN A 1 278 ? -4.282  7.712   45.991 1.00 39.37  ? 278 ASN A ND2 1 
ATOM   2249 N  N   . HIS A 1 279 ? -0.593  5.015   44.408 1.00 19.80  ? 279 HIS A N   1 
ATOM   2250 C  CA  . HIS A 1 279 ? 0.609   5.527   43.739 1.00 18.57  ? 279 HIS A CA  1 
ATOM   2251 C  C   . HIS A 1 279 ? 0.515   7.014   43.407 1.00 22.92  ? 279 HIS A C   1 
ATOM   2252 O  O   . HIS A 1 279 ? 1.517   7.721   43.412 1.00 19.46  ? 279 HIS A O   1 
ATOM   2253 C  CB  . HIS A 1 279 ? 0.944   4.721   42.486 1.00 18.35  ? 279 HIS A CB  1 
ATOM   2254 C  CG  . HIS A 1 279 ? 0.055   5.014   41.314 1.00 19.28  ? 279 HIS A CG  1 
ATOM   2255 N  ND1 . HIS A 1 279 ? -1.228  4.521   41.203 1.00 23.82  ? 279 HIS A ND1 1 
ATOM   2256 C  CD2 . HIS A 1 279 ? 0.280   5.728   40.187 1.00 22.47  ? 279 HIS A CD2 1 
ATOM   2257 C  CE1 . HIS A 1 279 ? -1.760  4.929   40.065 1.00 24.31  ? 279 HIS A CE1 1 
ATOM   2258 N  NE2 . HIS A 1 279 ? -0.863  5.655   39.424 1.00 24.19  ? 279 HIS A NE2 1 
ATOM   2259 N  N   . ARG A 1 280 ? -0.674  7.547   43.144 1.00 27.29  ? 280 ARG A N   1 
ATOM   2260 C  CA  . ARG A 1 280 ? -0.708  8.965   42.816 1.00 29.45  ? 280 ARG A CA  1 
ATOM   2261 C  C   . ARG A 1 280 ? -0.517  9.834   44.093 1.00 30.61  ? 280 ARG A C   1 
ATOM   2262 O  O   . ARG A 1 280 ? -0.136  11.006  44.027 1.00 27.55  ? 280 ARG A O   1 
ATOM   2263 C  CB  . ARG A 1 280 ? -1.938  9.294   41.945 1.00 35.33  ? 280 ARG A CB  1 
ATOM   2264 C  CG  . ARG A 1 280 ? -2.079  8.341   40.748 1.00 48.00  ? 280 ARG A CG  1 
ATOM   2265 C  CD  . ARG A 1 280 ? -3.269  8.603   39.827 1.00 56.12  ? 280 ARG A CD  1 
ATOM   2266 N  NE  . ARG A 1 280 ? -3.355  10.030  39.511 1.00 62.64  ? 280 ARG A NE  1 
ATOM   2267 C  CZ  . ARG A 1 280 ? -3.940  10.578  38.457 1.00 71.34  ? 280 ARG A CZ  1 
ATOM   2268 N  NH1 . ARG A 1 280 ? -4.529  9.837   37.545 1.00 67.58  ? 280 ARG A NH1 1 
ATOM   2269 N  NH2 . ARG A 1 280 ? -3.945  11.884  38.353 1.00 68.72  ? 280 ARG A NH2 1 
ATOM   2270 N  N   . LYS A 1 281 ? -0.651  9.251   45.300 1.00 27.50  ? 281 LYS A N   1 
ATOM   2271 C  CA  . LYS A 1 281 ? -0.215  9.957   46.528 1.00 26.77  ? 281 LYS A CA  1 
ATOM   2272 C  C   . LYS A 1 281 ? 1.271   9.944   46.664 1.00 28.94  ? 281 LYS A C   1 
ATOM   2273 O  O   . LYS A 1 281 ? 1.825   10.670  47.463 1.00 26.50  ? 281 LYS A O   1 
ATOM   2274 C  CB  . LYS A 1 281 ? -0.742  9.345   47.823 1.00 35.28  ? 281 LYS A CB  1 
ATOM   2275 C  CG  . LYS A 1 281 ? -1.183  10.359  48.837 1.00 43.46  ? 281 LYS A CG  1 
ATOM   2276 C  CD  . LYS A 1 281 ? -2.485  11.013  48.445 1.00 46.84  ? 281 LYS A CD  1 
ATOM   2277 C  CE  . LYS A 1 281 ? -2.531  12.534  48.610 1.00 62.10  ? 281 LYS A CE  1 
ATOM   2278 N  NZ  . LYS A 1 281 ? -2.317  13.321  47.352 1.00 65.91  ? 281 LYS A NZ  1 
ATOM   2279 N  N   . LEU A 1 282 ? 1.924   9.082   45.907 1.00 19.32  ? 282 LEU A N   1 
ATOM   2280 C  CA  . LEU A 1 282 ? 3.377   9.029   45.943 1.00 19.84  ? 282 LEU A CA  1 
ATOM   2281 C  C   . LEU A 1 282 ? 4.018   10.022  44.984 1.00 22.49  ? 282 LEU A C   1 
ATOM   2282 O  O   . LEU A 1 282 ? 5.240   10.160  44.962 1.00 18.76  ? 282 LEU A O   1 
ATOM   2283 C  CB  . LEU A 1 282 ? 3.861   7.617   45.617 1.00 19.79  ? 282 LEU A CB  1 
ATOM   2284 C  CG  . LEU A 1 282 ? 3.375   6.539   46.580 1.00 16.85  ? 282 LEU A CG  1 
ATOM   2285 C  CD1 . LEU A 1 282 ? 3.854   5.167   46.119 1.00 15.40  ? 282 LEU A CD1 1 
ATOM   2286 C  CD2 . LEU A 1 282 ? 3.851   6.845   47.980 1.00 17.29  ? 282 LEU A CD2 1 
ATOM   2287 N  N   . GLY A 1 283 ? 3.192   10.688  44.179 1.00 18.82  ? 283 GLY A N   1 
ATOM   2288 C  CA  . GLY A 1 283 ? 3.662   11.738  43.300 1.00 22.73  ? 283 GLY A CA  1 
ATOM   2289 C  C   . GLY A 1 283 ? 3.893   11.375  41.844 1.00 23.27  ? 283 GLY A C   1 
ATOM   2290 O  O   . GLY A 1 283 ? 4.510   12.140  41.114 1.00 25.99  ? 283 GLY A O   1 
ATOM   2291 N  N   . TYR A 1 284 ? 3.397   10.227  41.401 1.00 21.05  ? 284 TYR A N   1 
ATOM   2292 C  CA  . TYR A 1 284 ? 3.585   9.854   40.007 1.00 19.60  ? 284 TYR A CA  1 
ATOM   2293 C  C   . TYR A 1 284 ? 2.352   9.222   39.396 1.00 20.46  ? 284 TYR A C   1 
ATOM   2294 O  O   . TYR A 1 284 ? 1.463   8.755   40.109 1.00 20.34  ? 284 TYR A O   1 
ATOM   2295 C  CB  . TYR A 1 284 ? 4.804   8.934   39.829 1.00 18.96  ? 284 TYR A CB  1 
ATOM   2296 C  CG  . TYR A 1 284 ? 4.641   7.521   40.367 1.00 16.10  ? 284 TYR A CG  1 
ATOM   2297 C  CD1 . TYR A 1 284 ? 4.190   6.484   39.550 1.00 14.25  ? 284 TYR A CD1 1 
ATOM   2298 C  CD2 . TYR A 1 284 ? 4.976   7.221   41.687 1.00 16.92  ? 284 TYR A CD2 1 
ATOM   2299 C  CE1 . TYR A 1 284 ? 4.052   5.175   40.045 1.00 14.99  ? 284 TYR A CE1 1 
ATOM   2300 C  CE2 . TYR A 1 284 ? 4.839   5.926   42.182 1.00 14.49  ? 284 TYR A CE2 1 
ATOM   2301 C  CZ  . TYR A 1 284 ? 4.387   4.911   41.357 1.00 14.82  ? 284 TYR A CZ  1 
ATOM   2302 O  OH  . TYR A 1 284 ? 4.271   3.632   41.869 1.00 13.82  ? 284 TYR A OH  1 
ATOM   2303 N  N   . VAL A 1 285 ? 2.305   9.229   38.065 1.00 17.28  ? 285 VAL A N   1 
ATOM   2304 C  CA  . VAL A 1 285 ? 1.271   8.532   37.291 1.00 18.87  ? 285 VAL A CA  1 
ATOM   2305 C  C   . VAL A 1 285 ? 1.910   7.918   36.072 1.00 16.28  ? 285 VAL A C   1 
ATOM   2306 O  O   . VAL A 1 285 ? 3.015   8.307   35.697 1.00 17.64  ? 285 VAL A O   1 
ATOM   2307 C  CB  . VAL A 1 285 ? 0.171   9.490   36.795 1.00 23.52  ? 285 VAL A CB  1 
ATOM   2308 C  CG1 . VAL A 1 285 ? -0.672  9.960   37.955 1.00 31.10  ? 285 VAL A CG1 1 
ATOM   2309 C  CG2 . VAL A 1 285 ? 0.794   10.667  36.071 1.00 23.10  ? 285 VAL A CG2 1 
ATOM   2310 N  N   . TYR A 1 286 ? 1.227   6.945   35.468 1.00 19.86  ? 286 TYR A N   1 
ATOM   2311 C  CA  . TYR A 1 286 ? 1.657   6.368   34.203 1.00 18.72  ? 286 TYR A CA  1 
ATOM   2312 C  C   . TYR A 1 286 ? 0.955   7.120   33.077 1.00 24.79  ? 286 TYR A C   1 
ATOM   2313 O  O   . TYR A 1 286 ? -0.201  7.518   33.229 1.00 24.54  ? 286 TYR A O   1 
ATOM   2314 C  CB  . TYR A 1 286 ? 1.387   4.851   34.160 1.00 19.39  ? 286 TYR A CB  1 
ATOM   2315 C  CG  . TYR A 1 286 ? 2.324   4.143   35.107 1.00 18.58  ? 286 TYR A CG  1 
ATOM   2316 C  CD1 . TYR A 1 286 ? 1.932   3.820   36.398 1.00 19.44  ? 286 TYR A CD1 1 
ATOM   2317 C  CD2 . TYR A 1 286 ? 3.636   3.889   34.734 1.00 15.44  ? 286 TYR A CD2 1 
ATOM   2318 C  CE1 . TYR A 1 286 ? 2.819   3.218   37.284 1.00 16.46  ? 286 TYR A CE1 1 
ATOM   2319 C  CE2 . TYR A 1 286 ? 4.527   3.294   35.605 1.00 16.60  ? 286 TYR A CE2 1 
ATOM   2320 C  CZ  . TYR A 1 286 ? 4.120   2.967   36.874 1.00 15.96  ? 286 TYR A CZ  1 
ATOM   2321 O  OH  . TYR A 1 286 ? 5.035   2.390   37.729 1.00 15.60  ? 286 TYR A OH  1 
ATOM   2322 N  N   . ASP A 1 287 ? 1.669   7.376   31.989 1.00 22.14  ? 287 ASP A N   1 
ATOM   2323 C  CA  . ASP A 1 287 ? 1.161   8.162   30.861 1.00 25.67  ? 287 ASP A CA  1 
ATOM   2324 C  C   . ASP A 1 287 ? -0.278  7.813   30.446 1.00 30.76  ? 287 ASP A C   1 
ATOM   2325 O  O   . ASP A 1 287 ? -1.101  8.700   30.266 1.00 34.91  ? 287 ASP A O   1 
ATOM   2326 C  CB  . ASP A 1 287 ? 2.117   8.105   29.663 1.00 23.33  ? 287 ASP A CB  1 
ATOM   2327 C  CG  . ASP A 1 287 ? 2.505   6.686   29.250 1.00 29.21  ? 287 ASP A CG  1 
ATOM   2328 O  OD1 . ASP A 1 287 ? 1.948   5.689   29.730 1.00 30.08  ? 287 ASP A OD1 1 
ATOM   2329 O  OD2 . ASP A 1 287 ? 3.383   6.583   28.406 1.00 30.29  ? 287 ASP A OD2 1 
ATOM   2330 N  N   . ILE A 1 288 ? -0.557  6.522   30.301 1.00 56.41  ? 288 ILE A N   1 
ATOM   2331 C  CA  . ILE A 1 288 ? -1.885  6.064   29.911 1.00 57.20  ? 288 ILE A CA  1 
ATOM   2332 C  C   . ILE A 1 288 ? -2.965  6.704   30.776 1.00 60.07  ? 288 ILE A C   1 
ATOM   2333 O  O   . ILE A 1 288 ? -3.794  7.470   30.284 1.00 58.16  ? 288 ILE A O   1 
ATOM   2334 C  CB  . ILE A 1 288 ? -2.005  4.531   30.009 1.00 58.47  ? 288 ILE A CB  1 
ATOM   2335 C  CG1 . ILE A 1 288 ? -1.090  3.859   28.983 1.00 58.07  ? 288 ILE A CG1 1 
ATOM   2336 C  CG2 . ILE A 1 288 ? -3.448  4.096   29.809 1.00 60.84  ? 288 ILE A CG2 1 
ATOM   2337 C  CD1 . ILE A 1 288 ? -0.944  2.366   29.181 1.00 59.94  ? 288 ILE A CD1 1 
ATOM   2338 N  N   . GLU A 1 289 ? -2.949  6.387   32.066 1.00 52.73  ? 289 GLU A N   1 
ATOM   2339 C  CA  . GLU A 1 289 ? -3.927  6.930   33.001 1.00 52.73  ? 289 GLU A CA  1 
ATOM   2340 C  C   . GLU A 1 289 ? -4.466  8.272   32.517 1.00 52.73  ? 289 GLU A C   1 
ATOM   2341 O  O   . GLU A 1 289 ? -5.094  9.010   33.277 1.00 52.73  ? 289 GLU A O   1 
ATOM   2342 C  CB  . GLU A 1 289 ? -3.309  7.083   34.393 1.00 42.73  ? 289 GLU A CB  1 
ATOM   2343 C  CG  . GLU A 1 289 ? -2.683  5.809   34.937 1.00 42.73  ? 289 GLU A CG  1 
ATOM   2344 C  CD  . GLU A 1 289 ? -2.186  5.967   36.361 1.00 42.73  ? 289 GLU A CD  1 
ATOM   2345 O  OE1 . GLU A 1 289 ? -0.978  6.223   36.545 1.00 42.73  ? 289 GLU A OE1 1 
ATOM   2346 O  OE2 . GLU A 1 289 ? -3.004  5.834   37.295 1.00 42.73  ? 289 GLU A OE2 1 
ATOM   2347 N  N   . LYS B 1 4   ? 19.324  14.460  76.137 1.00 62.03  ? 4   LYS B N   1 
ATOM   2348 C  CA  . LYS B 1 4   ? 19.964  13.886  77.315 1.00 59.94  ? 4   LYS B CA  1 
ATOM   2349 C  C   . LYS B 1 4   ? 18.937  13.551  78.392 1.00 64.21  ? 4   LYS B C   1 
ATOM   2350 O  O   . LYS B 1 4   ? 18.845  14.237  79.410 1.00 73.63  ? 4   LYS B O   1 
ATOM   2351 C  CB  . LYS B 1 4   ? 21.017  14.845  77.873 1.00 65.03  ? 4   LYS B CB  1 
ATOM   2352 C  CG  . LYS B 1 4   ? 21.370  15.991  76.940 1.00 64.51  ? 4   LYS B CG  1 
ATOM   2353 C  CD  . LYS B 1 4   ? 20.122  16.631  76.354 1.00 65.14  ? 4   LYS B CD  1 
ATOM   2354 C  CE  . LYS B 1 4   ? 20.473  17.801  75.450 1.00 66.42  ? 4   LYS B CE  1 
ATOM   2355 N  NZ  . LYS B 1 4   ? 20.861  17.352  74.084 1.00 60.05  ? 4   LYS B NZ  1 
ATOM   2356 N  N   . TYR B 1 5   ? 18.168  12.493  78.160 1.00 67.96  ? 5   TYR B N   1 
ATOM   2357 C  CA  . TYR B 1 5   ? 17.147  12.065  79.109 1.00 70.03  ? 5   TYR B CA  1 
ATOM   2358 C  C   . TYR B 1 5   ? 17.232  10.566  79.374 1.00 59.57  ? 5   TYR B C   1 
ATOM   2359 O  O   . TYR B 1 5   ? 17.450  10.138  80.508 1.00 63.64  ? 5   TYR B O   1 
ATOM   2360 C  CB  . TYR B 1 5   ? 15.752  12.430  78.597 1.00 74.55  ? 5   TYR B CB  1 
ATOM   2361 C  CG  . TYR B 1 5   ? 14.772  12.788  79.691 1.00 83.77  ? 5   TYR B CG  1 
ATOM   2362 C  CD1 . TYR B 1 5   ? 13.945  11.824  80.252 1.00 89.46  ? 5   TYR B CD1 1 
ATOM   2363 C  CD2 . TYR B 1 5   ? 14.673  14.090  80.163 1.00 86.01  ? 5   TYR B CD2 1 
ATOM   2364 C  CE1 . TYR B 1 5   ? 13.048  12.147  81.253 1.00 96.00  ? 5   TYR B CE1 1 
ATOM   2365 C  CE2 . TYR B 1 5   ? 13.779  14.422  81.163 1.00 95.67  ? 5   TYR B CE2 1 
ATOM   2366 C  CZ  . TYR B 1 5   ? 12.969  13.447  81.704 1.00 100.43 ? 5   TYR B CZ  1 
ATOM   2367 O  OH  . TYR B 1 5   ? 12.077  13.773  82.700 1.00 99.42  ? 5   TYR B OH  1 
ATOM   2368 N  N   . ARG B 1 6   ? 17.058  9.773   78.322 1.00 48.87  ? 6   ARG B N   1 
ATOM   2369 C  CA  . ARG B 1 6   ? 17.113  8.323   78.440 1.00 43.61  ? 6   ARG B CA  1 
ATOM   2370 C  C   . ARG B 1 6   ? 18.536  8.052   78.973 1.00 38.74  ? 6   ARG B C   1 
ATOM   2371 O  O   . ARG B 1 6   ? 19.524  8.604   78.479 1.00 39.42  ? 6   ARG B O   1 
ATOM   2372 C  CB  . ARG B 1 6   ? 16.903  7.636   77.089 1.00 45.56  ? 6   ARG B CB  1 
ATOM   2373 C  CG  . ARG B 1 6   ? 15.475  7.414   76.697 1.00 51.26  ? 6   ARG B CG  1 
ATOM   2374 C  CD  . ARG B 1 6   ? 15.358  6.531   75.487 1.00 50.30  ? 6   ARG B CD  1 
ATOM   2375 N  NE  . ARG B 1 6   ? 16.024  7.061   74.293 1.00 56.65  ? 6   ARG B NE  1 
ATOM   2376 C  CZ  . ARG B 1 6   ? 15.946  8.314   73.829 1.00 46.40  ? 6   ARG B CZ  1 
ATOM   2377 N  NH1 . ARG B 1 6   ? 15.242  9.231   74.449 1.00 49.31  ? 6   ARG B NH1 1 
ATOM   2378 N  NH2 . ARG B 1 6   ? 16.611  8.629   72.747 1.00 48.48  ? 6   ARG B NH2 1 
ATOM   2379 N  N   . VAL B 1 7   ? 18.642  7.256   80.023 1.00 25.15  ? 7   VAL B N   1 
ATOM   2380 C  CA  . VAL B 1 7   ? 19.970  6.877   80.451 1.00 22.71  ? 7   VAL B CA  1 
ATOM   2381 C  C   . VAL B 1 7   ? 20.398  5.596   79.705 1.00 23.88  ? 7   VAL B C   1 
ATOM   2382 O  O   . VAL B 1 7   ? 19.639  4.945   78.986 1.00 21.98  ? 7   VAL B O   1 
ATOM   2383 C  CB  . VAL B 1 7   ? 20.122  6.534   81.964 1.00 26.56  ? 7   VAL B CB  1 
ATOM   2384 C  CG1 . VAL B 1 7   ? 21.428  7.095   82.563 1.00 21.26  ? 7   VAL B CG1 1 
ATOM   2385 C  CG2 . VAL B 1 7   ? 18.849  6.684   82.764 1.00 29.51  ? 7   VAL B CG2 1 
ATOM   2386 N  N   . ARG B 1 8   ? 21.631  5.252   79.962 1.00 21.05  ? 8   ARG B N   1 
ATOM   2387 C  CA  . ARG B 1 8   ? 22.157  3.918   79.685 1.00 18.80  ? 8   ARG B CA  1 
ATOM   2388 C  C   . ARG B 1 8   ? 23.129  3.549   80.789 1.00 18.29  ? 8   ARG B C   1 
ATOM   2389 O  O   . ARG B 1 8   ? 24.138  4.233   80.988 1.00 16.74  ? 8   ARG B O   1 
ATOM   2390 C  CB  . ARG B 1 8   ? 22.853  3.880   78.321 1.00 17.99  ? 8   ARG B CB  1 
ATOM   2391 C  CG  . ARG B 1 8   ? 21.907  4.029   77.128 1.00 16.81  ? 8   ARG B CG  1 
ATOM   2392 C  CD  . ARG B 1 8   ? 22.650  3.822   75.804 1.00 17.88  ? 8   ARG B CD  1 
ATOM   2393 N  NE  . ARG B 1 8   ? 21.749  3.945   74.661 1.00 16.60  ? 8   ARG B NE  1 
ATOM   2394 C  CZ  . ARG B 1 8   ? 22.129  3.897   73.389 1.00 16.04  ? 8   ARG B CZ  1 
ATOM   2395 N  NH1 . ARG B 1 8   ? 23.404  3.719   73.068 1.00 12.71  ? 8   ARG B NH1 1 
ATOM   2396 N  NH2 . ARG B 1 8   ? 21.220  4.026   72.435 1.00 15.99  ? 8   ARG B NH2 1 
ATOM   2397 N  N   . LYS B 1 9   ? 22.815  2.513   81.541 1.00 19.86  ? 9   LYS B N   1 
ATOM   2398 C  CA  . LYS B 1 9   ? 23.557  2.141   82.745 1.00 18.28  ? 9   LYS B CA  1 
ATOM   2399 C  C   . LYS B 1 9   ? 24.482  0.924   82.580 1.00 22.04  ? 9   LYS B C   1 
ATOM   2400 O  O   . LYS B 1 9   ? 24.228  0.051   81.763 1.00 18.04  ? 9   LYS B O   1 
ATOM   2401 C  CB  . LYS B 1 9   ? 22.587  1.867   83.864 1.00 23.60  ? 9   LYS B CB  1 
ATOM   2402 C  CG  . LYS B 1 9   ? 21.647  2.984   84.166 1.00 26.65  ? 9   LYS B CG  1 
ATOM   2403 C  CD  . LYS B 1 9   ? 20.568  2.540   85.103 1.00 33.27  ? 9   LYS B CD  1 
ATOM   2404 C  CE  . LYS B 1 9   ? 19.554  3.627   85.378 1.00 37.67  ? 9   LYS B CE  1 
ATOM   2405 N  NZ  . LYS B 1 9   ? 18.577  3.242   86.435 1.00 48.37  ? 9   LYS B NZ  1 
ATOM   2406 N  N   . ASN B 1 10  ? 25.541  0.900   83.381 1.00 17.31  ? 10  ASN B N   1 
ATOM   2407 C  CA  . ASN B 1 10  ? 26.441  -0.240  83.511 1.00 18.56  ? 10  ASN B CA  1 
ATOM   2408 C  C   . ASN B 1 10  ? 25.610  -1.451  83.906 1.00 19.96  ? 10  ASN B C   1 
ATOM   2409 O  O   . ASN B 1 10  ? 24.806  -1.370  84.841 1.00 19.34  ? 10  ASN B O   1 
ATOM   2410 C  CB  . ASN B 1 10  ? 27.487  0.074   84.599 1.00 19.05  ? 10  ASN B CB  1 
ATOM   2411 C  CG  . ASN B 1 10  ? 28.645  -0.918  84.631 1.00 21.91  ? 10  ASN B CG  1 
ATOM   2412 O  OD1 . ASN B 1 10  ? 28.452  -2.119  84.489 1.00 22.25  ? 10  ASN B OD1 1 
ATOM   2413 N  ND2 . ASN B 1 10  ? 29.858  -0.409  84.824 1.00 20.24  ? 10  ASN B ND2 1 
ATOM   2414 N  N   . VAL B 1 11  ? 25.779  -2.558  83.177 1.00 16.21  ? 11  VAL B N   1 
ATOM   2415 C  CA  . VAL B 1 11  ? 25.103  -3.814  83.504 1.00 17.53  ? 11  VAL B CA  1 
ATOM   2416 C  C   . VAL B 1 11  ? 25.222  -4.155  84.994 1.00 22.41  ? 11  VAL B C   1 
ATOM   2417 O  O   . VAL B 1 11  ? 24.254  -4.560  85.628 1.00 22.21  ? 11  VAL B O   1 
ATOM   2418 C  CB  . VAL B 1 11  ? 25.653  -4.985  82.657 1.00 18.00  ? 11  VAL B CB  1 
ATOM   2419 C  CG1 . VAL B 1 11  ? 25.324  -6.341  83.311 1.00 20.87  ? 11  VAL B CG1 1 
ATOM   2420 C  CG2 . VAL B 1 11  ? 25.086  -4.915  81.252 1.00 17.96  ? 11  VAL B CG2 1 
ATOM   2421 N  N   . LEU B 1 12  ? 26.395  -3.959  85.561 1.00 29.68  ? 12  LEU B N   1 
ATOM   2422 C  CA  . LEU B 1 12  ? 26.627  -4.264  86.969 1.00 30.35  ? 12  LEU B CA  1 
ATOM   2423 C  C   . LEU B 1 12  ? 25.860  -3.389  87.950 1.00 31.42  ? 12  LEU B C   1 
ATOM   2424 O  O   . LEU B 1 12  ? 25.747  -3.734  89.097 1.00 37.59  ? 12  LEU B O   1 
ATOM   2425 C  CB  . LEU B 1 12  ? 28.101  -4.289  87.284 1.00 30.92  ? 12  LEU B CB  1 
ATOM   2426 C  CG  . LEU B 1 12  ? 28.884  -5.397  86.588 1.00 37.30  ? 12  LEU B CG  1 
ATOM   2427 C  CD1 . LEU B 1 12  ? 30.319  -5.456  87.056 1.00 36.47  ? 12  LEU B CD1 1 
ATOM   2428 C  CD2 . LEU B 1 12  ? 28.209  -6.780  86.623 1.00 39.33  ? 12  LEU B CD2 1 
ATOM   2429 N  N   . HIS B 1 13  ? 25.343  -2.261  87.472 1.00 29.07  ? 13  HIS B N   1 
ATOM   2430 C  CA  . HIS B 1 13  ? 24.621  -1.334  88.324 1.00 30.83  ? 13  HIS B CA  1 
ATOM   2431 C  C   . HIS B 1 13  ? 23.139  -1.384  88.085 1.00 31.98  ? 13  HIS B C   1 
ATOM   2432 O  O   . HIS B 1 13  ? 22.389  -0.496  88.546 1.00 32.09  ? 13  HIS B O   1 
ATOM   2433 C  CB  . HIS B 1 13  ? 25.134  0.087   88.120 1.00 31.87  ? 13  HIS B CB  1 
ATOM   2434 C  CG  . HIS B 1 13  ? 26.616  0.241   88.370 1.00 32.30  ? 13  HIS B CG  1 
ATOM   2435 N  ND1 . HIS B 1 13  ? 27.290  1.360   88.052 1.00 36.90  ? 13  HIS B ND1 1 
ATOM   2436 C  CD2 . HIS B 1 13  ? 27.546  -0.635  88.927 1.00 34.87  ? 13  HIS B CD2 1 
ATOM   2437 C  CE1 . HIS B 1 13  ? 28.586  1.213   88.387 1.00 39.12  ? 13  HIS B CE1 1 
ATOM   2438 N  NE2 . HIS B 1 13  ? 28.741  -0.008  88.922 1.00 34.77  ? 13  HIS B NE2 1 
ATOM   2439 N  N   . LEU B 1 14  ? 22.690  -2.410  87.370 1.00 27.82  ? 14  LEU B N   1 
ATOM   2440 C  CA  . LEU B 1 14  ? 21.270  -2.574  87.080 1.00 25.74  ? 14  LEU B CA  1 
ATOM   2441 C  C   . LEU B 1 14  ? 20.577  -3.375  88.178 1.00 29.99  ? 14  LEU B C   1 
ATOM   2442 O  O   . LEU B 1 14  ? 21.099  -4.390  88.639 1.00 32.22  ? 14  LEU B O   1 
ATOM   2443 C  CB  . LEU B 1 14  ? 21.074  -3.259  85.726 1.00 29.03  ? 14  LEU B CB  1 
ATOM   2444 C  CG  . LEU B 1 14  ? 21.438  -2.433  84.490 1.00 30.65  ? 14  LEU B CG  1 
ATOM   2445 C  CD1 . LEU B 1 14  ? 21.710  -3.340  83.299 1.00 25.61  ? 14  LEU B CD1 1 
ATOM   2446 C  CD2 . LEU B 1 14  ? 20.337  -1.434  84.168 1.00 26.40  ? 14  LEU B CD2 1 
ATOM   2447 N  N   . THR B 1 15  ? 19.401  -2.915  88.594 1.00 30.83  ? 15  THR B N   1 
ATOM   2448 C  CA  . THR B 1 15  ? 18.653  -3.590  89.642 1.00 34.14  ? 15  THR B CA  1 
ATOM   2449 C  C   . THR B 1 15  ? 18.278  -4.928  89.026 1.00 35.34  ? 15  THR B C   1 
ATOM   2450 O  O   . THR B 1 15  ? 18.497  -5.149  87.835 1.00 28.81  ? 15  THR B O   1 
ATOM   2451 C  CB  . THR B 1 15  ? 17.372  -2.804  89.975 1.00 34.87  ? 15  THR B CB  1 
ATOM   2452 O  OG1 . THR B 1 15  ? 16.497  -2.808  88.839 1.00 35.87  ? 15  THR B OG1 1 
ATOM   2453 C  CG2 . THR B 1 15  ? 17.709  -1.367  90.343 1.00 37.12  ? 15  THR B CG2 1 
ATOM   2454 N  N   . ASP B 1 16  ? 17.718  -5.825  89.829 1.00 47.73  ? 16  ASP B N   1 
ATOM   2455 C  CA  . ASP B 1 16  ? 17.373  -7.150  89.326 1.00 48.50  ? 16  ASP B CA  1 
ATOM   2456 C  C   . ASP B 1 16  ? 16.186  -6.871  88.410 1.00 47.50  ? 16  ASP B C   1 
ATOM   2457 O  O   . ASP B 1 16  ? 16.184  -7.263  87.243 1.00 43.40  ? 16  ASP B O   1 
ATOM   2458 C  CB  . ASP B 1 16  ? 16.897  -7.825  90.613 1.00 55.79  ? 16  ASP B CB  1 
ATOM   2459 C  CG  . ASP B 1 16  ? 17.877  -8.863  91.123 1.00 62.42  ? 16  ASP B CG  1 
ATOM   2460 O  OD1 . ASP B 1 16  ? 18.953  -9.020  90.509 1.00 62.74  ? 16  ASP B OD1 1 
ATOM   2461 O  OD2 . ASP B 1 16  ? 17.572  -9.523  92.139 1.00 65.78  ? 16  ASP B OD2 1 
ATOM   2462 N  N   . THR B 1 17  ? 15.177  -6.192  88.947 1.00 31.67  ? 17  THR B N   1 
ATOM   2463 C  CA  . THR B 1 17  ? 13.981  -5.864  88.181 1.00 32.47  ? 17  THR B CA  1 
ATOM   2464 C  C   . THR B 1 17  ? 14.317  -5.306  86.798 1.00 31.36  ? 17  THR B C   1 
ATOM   2465 O  O   . THR B 1 17  ? 13.661  -5.648  85.814 1.00 30.34  ? 17  THR B O   1 
ATOM   2466 C  CB  . THR B 1 17  ? 13.081  -4.865  88.932 1.00 38.57  ? 17  THR B CB  1 
ATOM   2467 O  OG1 . THR B 1 17  ? 12.657  -5.445  90.169 1.00 46.45  ? 17  THR B OG1 1 
ATOM   2468 C  CG2 . THR B 1 17  ? 11.854  -4.511  88.101 1.00 37.90  ? 17  THR B CG2 1 
ATOM   2469 N  N   . GLU B 1 18  ? 15.348  -4.480  86.719 1.00 36.74  ? 18  GLU B N   1 
ATOM   2470 C  CA  . GLU B 1 18  ? 15.761  -3.873  85.454 1.00 35.63  ? 18  GLU B CA  1 
ATOM   2471 C  C   . GLU B 1 18  ? 16.242  -4.918  84.436 1.00 32.45  ? 18  GLU B C   1 
ATOM   2472 O  O   . GLU B 1 18  ? 15.994  -4.852  83.288 1.00 27.13  ? 18  GLU B O   1 
ATOM   2473 C  CB  . GLU B 1 18  ? 16.806  -2.810  85.694 1.00 35.27  ? 18  GLU B CB  1 
ATOM   2474 C  CG  . GLU B 1 18  ? 16.234  -1.461  86.115 1.00 36.40  ? 18  GLU B CG  1 
ATOM   2475 C  CD  . GLU B 1 18  ? 17.294  -0.400  86.329 1.00 41.30  ? 18  GLU B CD  1 
ATOM   2476 O  OE1 . GLU B 1 18  ? 18.249  -0.645  87.057 1.00 39.48  ? 18  GLU B OE1 1 
ATOM   2477 O  OE2 . GLU B 1 18  ? 17.177  0.681   85.753 1.00 43.26  ? 18  GLU B OE2 1 
ATOM   2478 N  N   . LYS B 1 19  ? 16.911  -5.921  84.922 1.00 29.37  ? 19  LYS B N   1 
ATOM   2479 C  CA  . LYS B 1 19  ? 17.348  -7.015  84.063 1.00 30.15  ? 19  LYS B CA  1 
ATOM   2480 C  C   . LYS B 1 19  ? 16.284  -8.004  83.598 1.00 32.37  ? 19  LYS B C   1 
ATOM   2481 O  O   . LYS B 1 19  ? 16.345  -8.516  82.481 1.00 29.32  ? 19  LYS B O   1 
ATOM   2482 C  CB  . LYS B 1 19  ? 18.324  -7.926  84.810 1.00 33.85  ? 19  LYS B CB  1 
ATOM   2483 C  CG  . LYS B 1 19  ? 19.630  -7.252  85.197 1.00 32.43  ? 19  LYS B CG  1 
ATOM   2484 C  CD  . LYS B 1 19  ? 20.278  -7.945  86.385 1.00 35.40  ? 19  LYS B CD  1 
ATOM   2485 C  CE  . LYS B 1 19  ? 21.686  -7.425  86.626 1.00 36.87  ? 19  LYS B CE  1 
ATOM   2486 N  NZ  . LYS B 1 19  ? 22.509  -8.393  87.403 1.00 41.55  ? 19  LYS B NZ  1 
ATOM   2487 N  N   . ARG B 1 20  ? 15.309  -8.265  84.462 1.00 30.21  ? 20  ARG B N   1 
ATOM   2488 C  CA  . ARG B 1 20  ? 14.226  -9.186  84.139 1.00 34.27  ? 20  ARG B CA  1 
ATOM   2489 C  C   . ARG B 1 20  ? 13.368  -8.467  83.103 1.00 30.63  ? 20  ARG B C   1 
ATOM   2490 O  O   . ARG B 1 20  ? 12.735  -9.101  82.258 1.00 29.17  ? 20  ARG B O   1 
ATOM   2491 C  CB  . ARG B 1 20  ? 13.396  -9.494  85.386 1.00 36.48  ? 20  ARG B CB  1 
ATOM   2492 C  CG  . ARG B 1 20  ? 12.096  -10.229 85.101 1.00 53.08  ? 20  ARG B CG  1 
ATOM   2493 C  CD  . ARG B 1 20  ? 11.043  -9.290  84.535 1.00 66.37  ? 20  ARG B CD  1 
ATOM   2494 N  NE  . ARG B 1 20  ? 9.699   -9.850  84.638 1.00 73.90  ? 20  ARG B NE  1 
ATOM   2495 C  CZ  . ARG B 1 20  ? 9.324   -10.999 84.087 1.00 76.82  ? 20  ARG B CZ  1 
ATOM   2496 N  NH1 . ARG B 1 20  ? 10.194  -11.717 83.389 1.00 76.59  ? 20  ARG B NH1 1 
ATOM   2497 N  NH2 . ARG B 1 20  ? 8.079   -11.432 84.232 1.00 79.42  ? 20  ARG B NH2 1 
ATOM   2498 N  N   . ASP B 1 21  ? 13.353  -7.140  83.174 1.00 29.47  ? 21  ASP B N   1 
ATOM   2499 C  CA  . ASP B 1 21  ? 12.576  -6.327  82.235 1.00 28.61  ? 21  ASP B CA  1 
ATOM   2500 C  C   . ASP B 1 21  ? 13.280  -6.130  80.886 1.00 26.50  ? 21  ASP B C   1 
ATOM   2501 O  O   . ASP B 1 21  ? 12.663  -6.150  79.869 1.00 24.38  ? 21  ASP B O   1 
ATOM   2502 C  CB  . ASP B 1 21  ? 12.286  -4.973  82.843 1.00 33.15  ? 21  ASP B CB  1 
ATOM   2503 C  CG  . ASP B 1 21  ? 11.133  -4.998  83.867 1.00 40.84  ? 21  ASP B CG  1 
ATOM   2504 O  OD1 . ASP B 1 21  ? 10.374  -5.957  83.946 1.00 43.25  ? 21  ASP B OD1 1 
ATOM   2505 O  OD2 . ASP B 1 21  ? 10.985  -4.020  84.582 1.00 43.18  ? 21  ASP B OD2 1 
ATOM   2506 N  N   . PHE B 1 22  ? 14.595  -5.941  80.931 1.00 23.90  ? 22  PHE B N   1 
ATOM   2507 C  CA  . PHE B 1 22  ? 15.360  -5.872  79.690 1.00 23.04  ? 22  PHE B CA  1 
ATOM   2508 C  C   . PHE B 1 22  ? 15.260  -7.184  78.921 1.00 22.85  ? 22  PHE B C   1 
ATOM   2509 O  O   . PHE B 1 22  ? 14.945  -7.187  77.735 1.00 19.65  ? 22  PHE B O   1 
ATOM   2510 C  CB  . PHE B 1 22  ? 16.826  -5.521  79.950 1.00 22.08  ? 22  PHE B CB  1 
ATOM   2511 C  CG  . PHE B 1 22  ? 17.680  -5.545  78.708 1.00 19.18  ? 22  PHE B CG  1 
ATOM   2512 C  CD1 . PHE B 1 22  ? 17.687  -4.468  77.837 1.00 21.18  ? 22  PHE B CD1 1 
ATOM   2513 C  CD2 . PHE B 1 22  ? 18.467  -6.647  78.410 1.00 19.56  ? 22  PHE B CD2 1 
ATOM   2514 C  CE1 . PHE B 1 22  ? 18.466  -4.484  76.698 1.00 18.77  ? 22  PHE B CE1 1 
ATOM   2515 C  CE2 . PHE B 1 22  ? 19.242  -6.675  77.266 1.00 19.18  ? 22  PHE B CE2 1 
ATOM   2516 C  CZ  . PHE B 1 22  ? 19.246  -5.585  76.408 1.00 18.72  ? 22  PHE B CZ  1 
ATOM   2517 N  N   . VAL B 1 23  ? 15.531  -8.292  79.603 1.00 20.48  ? 23  VAL B N   1 
ATOM   2518 C  CA  . VAL B 1 23  ? 15.478  -9.609  78.979 1.00 21.91  ? 23  VAL B CA  1 
ATOM   2519 C  C   . VAL B 1 23  ? 14.090  -9.904  78.422 1.00 22.19  ? 23  VAL B C   1 
ATOM   2520 O  O   . VAL B 1 23  ? 13.953  -10.437 77.321 1.00 20.20  ? 23  VAL B O   1 
ATOM   2521 C  CB  . VAL B 1 23  ? 15.869  -10.719 79.972 1.00 24.68  ? 23  VAL B CB  1 
ATOM   2522 C  CG1 . VAL B 1 23  ? 15.419  -12.076 79.453 1.00 24.41  ? 23  VAL B CG1 1 
ATOM   2523 C  CG2 . VAL B 1 23  ? 17.370  -10.706 80.219 1.00 21.34  ? 23  VAL B CG2 1 
ATOM   2524 N  N   . ARG B 1 24  ? 13.063  -9.554  79.189 1.00 32.39  ? 24  ARG B N   1 
ATOM   2525 C  CA  . ARG B 1 24  ? 11.684  -9.788  78.778 1.00 34.47  ? 24  ARG B CA  1 
ATOM   2526 C  C   . ARG B 1 24  ? 11.334  -8.988  77.527 1.00 34.20  ? 24  ARG B C   1 
ATOM   2527 O  O   . ARG B 1 24  ? 10.608  -9.467  76.655 1.00 31.49  ? 24  ARG B O   1 
ATOM   2528 C  CB  . ARG B 1 24  ? 10.719  -9.437  79.913 1.00 39.13  ? 24  ARG B CB  1 
ATOM   2529 C  CG  . ARG B 1 24  ? 9.257   -9.690  79.585 1.00 44.01  ? 24  ARG B CG  1 
ATOM   2530 C  CD  . ARG B 1 24  ? 8.340   -8.969  80.559 1.00 52.44  ? 24  ARG B CD  1 
ATOM   2531 N  NE  . ARG B 1 24  ? 8.691   -7.558  80.698 1.00 59.03  ? 24  ARG B NE  1 
ATOM   2532 C  CZ  . ARG B 1 24  ? 8.642   -6.885  81.842 1.00 57.09  ? 24  ARG B CZ  1 
ATOM   2533 N  NH1 . ARG B 1 24  ? 8.256   -7.493  82.956 1.00 55.86  ? 24  ARG B NH1 1 
ATOM   2534 N  NH2 . ARG B 1 24  ? 8.979   -5.603  81.875 1.00 55.54  ? 24  ARG B NH2 1 
ATOM   2535 N  N   . THR B 1 25  ? 11.853  -7.767  77.446 1.00 17.15  ? 25  THR B N   1 
ATOM   2536 C  CA  . THR B 1 25  ? 11.592  -6.899  76.309 1.00 19.57  ? 25  THR B CA  1 
ATOM   2537 C  C   . THR B 1 25  ? 12.314  -7.406  75.072 1.00 18.16  ? 25  THR B C   1 
ATOM   2538 O  O   . THR B 1 25  ? 11.769  -7.361  73.978 1.00 17.80  ? 25  THR B O   1 
ATOM   2539 C  CB  . THR B 1 25  ? 12.000  -5.453  76.593 1.00 21.40  ? 25  THR B CB  1 
ATOM   2540 O  OG1 . THR B 1 25  ? 11.374  -5.015  77.807 1.00 23.28  ? 25  THR B OG1 1 
ATOM   2541 C  CG2 . THR B 1 25  ? 11.554  -4.555  75.464 1.00 21.23  ? 25  THR B CG2 1 
ATOM   2542 N  N   . VAL B 1 26  ? 13.542  -7.888  75.244 1.00 17.25  ? 26  VAL B N   1 
ATOM   2543 C  CA  . VAL B 1 26  ? 14.259  -8.500  74.130 1.00 17.39  ? 26  VAL B CA  1 
ATOM   2544 C  C   . VAL B 1 26  ? 13.522  -9.736  73.602 1.00 17.33  ? 26  VAL B C   1 
ATOM   2545 O  O   . VAL B 1 26  ? 13.448  -9.962  72.397 1.00 16.04  ? 26  VAL B O   1 
ATOM   2546 C  CB  . VAL B 1 26  ? 15.716  -8.843  74.513 1.00 16.08  ? 26  VAL B CB  1 
ATOM   2547 C  CG1 . VAL B 1 26  ? 16.384  -9.674  73.424 1.00 16.51  ? 26  VAL B CG1 1 
ATOM   2548 C  CG2 . VAL B 1 26  ? 16.506  -7.567  74.786 1.00 14.15  ? 26  VAL B CG2 1 
ATOM   2549 N  N   . LEU B 1 27  ? 12.959  -10.538 74.501 1.00 18.26  ? 27  LEU B N   1 
ATOM   2550 C  CA  . LEU B 1 27  ? 12.219  -11.729 74.066 1.00 17.47  ? 27  LEU B CA  1 
ATOM   2551 C  C   . LEU B 1 27  ? 10.951  -11.377 73.291 1.00 16.88  ? 27  LEU B C   1 
ATOM   2552 O  O   . LEU B 1 27  ? 10.537  -12.116 72.403 1.00 18.78  ? 27  LEU B O   1 
ATOM   2553 C  CB  . LEU B 1 27  ? 11.886  -12.641 75.250 1.00 17.90  ? 27  LEU B CB  1 
ATOM   2554 C  CG  . LEU B 1 27  ? 13.092  -13.345 75.877 1.00 20.00  ? 27  LEU B CG  1 
ATOM   2555 C  CD1 . LEU B 1 27  ? 12.730  -13.890 77.251 1.00 24.60  ? 27  LEU B CD1 1 
ATOM   2556 C  CD2 . LEU B 1 27  ? 13.603  -14.459 74.978 1.00 19.27  ? 27  LEU B CD2 1 
ATOM   2557 N  N   . ILE B 1 28  ? 10.346  -10.245 73.636 1.00 16.90  ? 28  ILE B N   1 
ATOM   2558 C  CA  . ILE B 1 28  ? 9.143   -9.781  72.956 1.00 20.80  ? 28  ILE B CA  1 
ATOM   2559 C  C   . ILE B 1 28  ? 9.473   -9.327  71.539 1.00 17.24  ? 28  ILE B C   1 
ATOM   2560 O  O   . ILE B 1 28  ? 8.734   -9.612  70.597 1.00 21.32  ? 28  ILE B O   1 
ATOM   2561 C  CB  . ILE B 1 28  ? 8.476   -8.621  73.717 1.00 22.60  ? 28  ILE B CB  1 
ATOM   2562 C  CG1 . ILE B 1 28  ? 7.721   -9.149  74.939 1.00 23.74  ? 28  ILE B CG1 1 
ATOM   2563 C  CG2 . ILE B 1 28  ? 7.540   -7.850  72.799 1.00 24.75  ? 28  ILE B CG2 1 
ATOM   2564 C  CD1 . ILE B 1 28  ? 7.199   -8.060  75.852 1.00 27.24  ? 28  ILE B CD1 1 
ATOM   2565 N  N   . LEU B 1 29  ? 10.590  -8.621  71.397 1.00 21.23  ? 29  LEU B N   1 
ATOM   2566 C  CA  . LEU B 1 29  ? 11.037  -8.152  70.092 1.00 21.33  ? 29  LEU B CA  1 
ATOM   2567 C  C   . LEU B 1 29  ? 11.344  -9.332  69.177 1.00 20.42  ? 29  LEU B C   1 
ATOM   2568 O  O   . LEU B 1 29  ? 11.082  -9.284  67.975 1.00 19.02  ? 29  LEU B O   1 
ATOM   2569 C  CB  . LEU B 1 29  ? 12.273  -7.261  70.235 1.00 21.26  ? 29  LEU B CB  1 
ATOM   2570 C  CG  . LEU B 1 29  ? 12.103  -5.795  69.833 1.00 29.00  ? 29  LEU B CG  1 
ATOM   2571 C  CD1 . LEU B 1 29  ? 11.034  -5.125  70.684 1.00 26.70  ? 29  LEU B CD1 1 
ATOM   2572 C  CD2 . LEU B 1 29  ? 13.425  -5.051  69.941 1.00 30.79  ? 29  LEU B CD2 1 
ATOM   2573 N  N   . LYS B 1 30  ? 11.898  -10.391 69.757 1.00 17.01  ? 30  LYS B N   1 
ATOM   2574 C  CA  . LYS B 1 30  ? 12.218  -11.597 69.003 1.00 18.48  ? 30  LYS B CA  1 
ATOM   2575 C  C   . LYS B 1 30  ? 10.943  -12.309 68.566 1.00 23.05  ? 30  LYS B C   1 
ATOM   2576 O  O   . LYS B 1 30  ? 10.826  -12.747 67.422 1.00 21.43  ? 30  LYS B O   1 
ATOM   2577 C  CB  . LYS B 1 30  ? 13.087  -12.538 69.839 1.00 17.99  ? 30  LYS B CB  1 
ATOM   2578 C  CG  . LYS B 1 30  ? 13.481  -13.820 69.123 1.00 22.70  ? 30  LYS B CG  1 
ATOM   2579 C  CD  . LYS B 1 30  ? 14.688  -13.601 68.225 1.00 21.29  ? 30  LYS B CD  1 
ATOM   2580 C  CE  . LYS B 1 30  ? 15.268  -14.923 67.748 1.00 24.68  ? 30  LYS B CE  1 
ATOM   2581 N  NZ  . LYS B 1 30  ? 16.401  -14.724 66.803 1.00 30.37  ? 30  LYS B NZ  1 
ATOM   2582 N  N   . GLU B 1 31  ? 9.989   -12.418 69.485 1.00 20.50  ? 31  GLU B N   1 
ATOM   2583 C  CA  . GLU B 1 31  ? 8.708   -13.054 69.188 1.00 21.83  ? 31  GLU B CA  1 
ATOM   2584 C  C   . GLU B 1 31  ? 7.934   -12.321 68.096 1.00 25.92  ? 31  GLU B C   1 
ATOM   2585 O  O   . GLU B 1 31  ? 7.305   -12.956 67.250 1.00 26.49  ? 31  GLU B O   1 
ATOM   2586 C  CB  . GLU B 1 31  ? 7.851   -13.166 70.455 1.00 26.85  ? 31  GLU B CB  1 
ATOM   2587 C  CG  . GLU B 1 31  ? 6.680   -14.135 70.333 1.00 33.73  ? 31  GLU B CG  1 
ATOM   2588 C  CD  . GLU B 1 31  ? 5.495   -13.536 69.598 1.00 43.22  ? 31  GLU B CD  1 
ATOM   2589 O  OE1 . GLU B 1 31  ? 5.246   -12.322 69.770 1.00 45.01  ? 31  GLU B OE1 1 
ATOM   2590 O  OE2 . GLU B 1 31  ? 4.825   -14.275 68.837 1.00 47.61  ? 31  GLU B OE2 1 
ATOM   2591 N  N   . LYS B 1 32  ? 7.979   -10.991 68.108 1.00 26.19  ? 32  LYS B N   1 
ATOM   2592 C  CA  . LYS B 1 32  ? 7.273   -10.198 67.125 1.00 28.08  ? 32  LYS B CA  1 
ATOM   2593 C  C   . LYS B 1 32  ? 7.903   -10.143 65.733 1.00 29.09  ? 32  LYS B C   1 
ATOM   2594 O  O   . LYS B 1 32  ? 7.290   -9.661  64.816 1.00 32.47  ? 32  LYS B O   1 
ATOM   2595 C  CB  . LYS B 1 32  ? 7.060   -8.800  67.643 1.00 29.03  ? 32  LYS B CB  1 
ATOM   2596 C  CG  . LYS B 1 32  ? 6.132   -8.714  68.797 1.00 34.57  ? 32  LYS B CG  1 
ATOM   2597 C  CD  . LYS B 1 32  ? 6.182   -7.341  69.415 1.00 39.72  ? 32  LYS B CD  1 
ATOM   2598 C  CE  . LYS B 1 32  ? 5.108   -7.161  70.428 1.00 46.93  ? 32  LYS B CE  1 
ATOM   2599 N  NZ  . LYS B 1 32  ? 3.769   -7.105  69.872 1.00 51.78  ? 32  LYS B NZ  1 
ATOM   2600 N  N   . GLY B 1 33  ? 9.113   -10.625 65.583 1.00 21.99  ? 33  GLY B N   1 
ATOM   2601 C  CA  . GLY B 1 33  ? 9.777   -10.627 64.287 1.00 23.17  ? 33  GLY B CA  1 
ATOM   2602 C  C   . GLY B 1 33  ? 10.699  -9.443  64.058 1.00 22.35  ? 33  GLY B C   1 
ATOM   2603 O  O   . GLY B 1 33  ? 11.358  -9.333  63.020 1.00 20.66  ? 33  GLY B O   1 
ATOM   2604 N  N   . ILE B 1 34  ? 10.750  -8.554  65.038 1.00 16.23  ? 34  ILE B N   1 
ATOM   2605 C  CA  . ILE B 1 34  ? 11.553  -7.345  64.956 1.00 17.30  ? 34  ILE B CA  1 
ATOM   2606 C  C   . ILE B 1 34  ? 13.053  -7.570  65.184 1.00 17.82  ? 34  ILE B C   1 
ATOM   2607 O  O   . ILE B 1 34  ? 13.887  -6.999  64.479 1.00 15.11  ? 34  ILE B O   1 
ATOM   2608 C  CB  . ILE B 1 34  ? 11.034  -6.308  65.952 1.00 19.33  ? 34  ILE B CB  1 
ATOM   2609 C  CG1 . ILE B 1 34  ? 9.603   -5.913  65.576 1.00 19.18  ? 34  ILE B CG1 1 
ATOM   2610 C  CG2 . ILE B 1 34  ? 11.953  -5.099  66.014 1.00 17.83  ? 34  ILE B CG2 1 
ATOM   2611 C  CD1 . ILE B 1 34  ? 8.989   -4.964  66.552 1.00 26.20  ? 34  ILE B CD1 1 
ATOM   2612 N  N   . TYR B 1 35  ? 13.402  -8.392  66.167 1.00 13.03  ? 35  TYR B N   1 
ATOM   2613 C  CA  . TYR B 1 35  ? 14.816  -8.651  66.450 1.00 13.08  ? 35  TYR B CA  1 
ATOM   2614 C  C   . TYR B 1 35  ? 15.544  -9.162  65.195 1.00 12.84  ? 35  TYR B C   1 
ATOM   2615 O  O   . TYR B 1 35  ? 16.676  -8.783  64.935 1.00 11.63  ? 35  TYR B O   1 
ATOM   2616 C  CB  . TYR B 1 35  ? 14.947  -9.648  67.606 1.00 14.64  ? 35  TYR B CB  1 
ATOM   2617 C  CG  . TYR B 1 35  ? 16.340  -9.781  68.178 1.00 14.34  ? 35  TYR B CG  1 
ATOM   2618 C  CD1 . TYR B 1 35  ? 16.720  -9.061  69.309 1.00 16.28  ? 35  TYR B CD1 1 
ATOM   2619 C  CD2 . TYR B 1 35  ? 17.273  -10.642 67.596 1.00 13.92  ? 35  TYR B CD2 1 
ATOM   2620 C  CE1 . TYR B 1 35  ? 18.006  -9.190  69.841 1.00 15.40  ? 35  TYR B CE1 1 
ATOM   2621 C  CE2 . TYR B 1 35  ? 18.554  -10.766 68.112 1.00 15.29  ? 35  TYR B CE2 1 
ATOM   2622 C  CZ  . TYR B 1 35  ? 18.911  -10.041 69.233 1.00 14.31  ? 35  TYR B CZ  1 
ATOM   2623 O  OH  . TYR B 1 35  ? 20.180  -10.175 69.746 1.00 13.68  ? 35  TYR B OH  1 
ATOM   2624 N  N   . ASP B 1 36  ? 14.904  -10.032 64.407 1.00 17.08  ? 36  ASP B N   1 
ATOM   2625 C  CA  . ASP B 1 36  ? 15.542  -10.541 63.194 1.00 21.49  ? 36  ASP B CA  1 
ATOM   2626 C  C   . ASP B 1 36  ? 15.976  -9.391  62.275 1.00 18.57  ? 36  ASP B C   1 
ATOM   2627 O  O   . ASP B 1 36  ? 17.072  -9.417  61.690 1.00 17.97  ? 36  ASP B O   1 
ATOM   2628 C  CB  . ASP B 1 36  ? 14.643  -11.526 62.401 1.00 24.73  ? 36  ASP B CB  1 
ATOM   2629 C  CG  . ASP B 1 36  ? 14.677  -12.988 62.962 1.00 32.53  ? 36  ASP B CG  1 
ATOM   2630 O  OD1 . ASP B 1 36  ? 13.598  -13.419 63.544 1.00 36.39  ? 36  ASP B OD1 1 
ATOM   2631 O  OD2 . ASP B 1 36  ? 15.754  -13.695 62.796 1.00 38.34  ? 36  ASP B OD2 1 
ATOM   2632 N  N   . ARG B 1 37  ? 15.131  -8.381  62.122 1.00 13.66  ? 37  ARG B N   1 
ATOM   2633 C  CA  . ARG B 1 37  ? 15.476  -7.267  61.237 1.00 14.20  ? 37  ARG B CA  1 
ATOM   2634 C  C   . ARG B 1 37  ? 16.871  -6.730  61.574 1.00 15.26  ? 37  ARG B C   1 
ATOM   2635 O  O   . ARG B 1 37  ? 17.637  -6.359  60.678 1.00 12.71  ? 37  ARG B O   1 
ATOM   2636 C  CB  . ARG B 1 37  ? 14.427  -6.148  61.335 1.00 14.77  ? 37  ARG B CB  1 
ATOM   2637 C  CG  . ARG B 1 37  ? 13.061  -6.570  60.811 1.00 19.42  ? 37  ARG B CG  1 
ATOM   2638 C  CD  . ARG B 1 37  ? 11.955  -5.578  61.175 1.00 19.80  ? 37  ARG B CD  1 
ATOM   2639 N  NE  . ARG B 1 37  ? 12.344  -4.197  60.927 1.00 19.42  ? 37  ARG B NE  1 
ATOM   2640 C  CZ  . ARG B 1 37  ? 12.147  -3.553  59.776 1.00 21.47  ? 37  ARG B CZ  1 
ATOM   2641 N  NH1 . ARG B 1 37  ? 11.563  -4.170  58.757 1.00 18.38  ? 37  ARG B NH1 1 
ATOM   2642 N  NH2 . ARG B 1 37  ? 12.532  -2.289  59.647 1.00 20.61  ? 37  ARG B NH2 1 
ATOM   2643 N  N   . TYR B 1 38  ? 17.201  -6.692  62.865 1.00 13.32  ? 38  TYR B N   1 
ATOM   2644 C  CA  . TYR B 1 38  ? 18.524  -6.206  63.286 1.00 12.73  ? 38  TYR B CA  1 
ATOM   2645 C  C   . TYR B 1 38  ? 19.661  -7.130  62.886 1.00 13.52  ? 38  TYR B C   1 
ATOM   2646 O  O   . TYR B 1 38  ? 20.730  -6.668  62.467 1.00 13.28  ? 38  TYR B O   1 
ATOM   2647 C  CB  . TYR B 1 38  ? 18.550  -5.923  64.796 1.00 13.48  ? 38  TYR B CB  1 
ATOM   2648 C  CG  . TYR B 1 38  ? 17.757  -4.687  65.079 1.00 12.72  ? 38  TYR B CG  1 
ATOM   2649 C  CD1 . TYR B 1 38  ? 18.354  -3.437  65.038 1.00 15.36  ? 38  TYR B CD1 1 
ATOM   2650 C  CD2 . TYR B 1 38  ? 16.397  -4.763  65.328 1.00 16.25  ? 38  TYR B CD2 1 
ATOM   2651 C  CE1 . TYR B 1 38  ? 17.615  -2.283  65.261 1.00 18.16  ? 38  TYR B CE1 1 
ATOM   2652 C  CE2 . TYR B 1 38  ? 15.649  -3.622  65.542 1.00 15.51  ? 38  TYR B CE2 1 
ATOM   2653 C  CZ  . TYR B 1 38  ? 16.262  -2.394  65.517 1.00 19.60  ? 38  TYR B CZ  1 
ATOM   2654 O  OH  . TYR B 1 38  ? 15.515  -1.269  65.732 1.00 17.61  ? 38  TYR B OH  1 
ATOM   2655 N  N   . ILE B 1 39  ? 19.442  -8.436  63.034 1.00 12.73  ? 39  ILE B N   1 
ATOM   2656 C  CA  . ILE B 1 39  ? 20.423  -9.413  62.581 1.00 13.07  ? 39  ILE B CA  1 
ATOM   2657 C  C   . ILE B 1 39  ? 20.664  -9.236  61.083 1.00 14.11  ? 39  ILE B C   1 
ATOM   2658 O  O   . ILE B 1 39  ? 21.814  -9.180  60.618 1.00 12.98  ? 39  ILE B O   1 
ATOM   2659 C  CB  . ILE B 1 39  ? 19.964  -10.864 62.876 1.00 12.94  ? 39  ILE B CB  1 
ATOM   2660 C  CG1 . ILE B 1 39  ? 19.723  -11.050 64.382 1.00 12.75  ? 39  ILE B CG1 1 
ATOM   2661 C  CG2 . ILE B 1 39  ? 20.993  -11.878 62.362 1.00 15.35  ? 39  ILE B CG2 1 
ATOM   2662 C  CD1 . ILE B 1 39  ? 19.038  -12.380 64.726 1.00 15.09  ? 39  ILE B CD1 1 
ATOM   2663 N  N   . ALA B 1 40  ? 19.574  -9.138  60.330 1.00 11.68  ? 40  ALA B N   1 
ATOM   2664 C  CA  . ALA B 1 40  ? 19.675  -9.009  58.878 1.00 11.85  ? 40  ALA B CA  1 
ATOM   2665 C  C   . ALA B 1 40  ? 20.370  -7.712  58.442 1.00 11.80  ? 40  ALA B C   1 
ATOM   2666 O  O   . ALA B 1 40  ? 21.240  -7.729  57.557 1.00 11.56  ? 40  ALA B O   1 
ATOM   2667 C  CB  . ALA B 1 40  ? 18.299  -9.135  58.236 1.00 13.77  ? 40  ALA B CB  1 
ATOM   2668 N  N   . TRP B 1 41  ? 19.990  -6.601  59.064 1.00 9.37   ? 41  TRP B N   1 
ATOM   2669 C  CA  . TRP B 1 41  ? 20.579  -5.314  58.753 1.00 9.99   ? 41  TRP B CA  1 
ATOM   2670 C  C   . TRP B 1 41  ? 22.075  -5.372  58.848 1.00 12.36  ? 41  TRP B C   1 
ATOM   2671 O  O   . TRP B 1 41  ? 22.792  -4.902  57.939 1.00 12.80  ? 41  TRP B O   1 
ATOM   2672 C  CB  . TRP B 1 41  ? 20.038  -4.239  59.688 1.00 9.65   ? 41  TRP B CB  1 
ATOM   2673 C  CG  . TRP B 1 41  ? 18.843  -3.501  59.133 1.00 9.63   ? 41  TRP B CG  1 
ATOM   2674 C  CD1 . TRP B 1 41  ? 18.411  -3.454  57.811 1.00 11.31  ? 41  TRP B CD1 1 
ATOM   2675 C  CD2 . TRP B 1 41  ? 17.881  -2.670  59.874 1.00 13.01  ? 41  TRP B CD2 1 
ATOM   2676 N  NE1 . TRP B 1 41  ? 17.286  -2.680  57.689 1.00 12.40  ? 41  TRP B NE1 1 
ATOM   2677 C  CE2 . TRP B 1 41  ? 16.917  -2.180  58.887 1.00 12.56  ? 41  TRP B CE2 1 
ATOM   2678 C  CE3 . TRP B 1 41  ? 17.731  -2.301  61.202 1.00 14.87  ? 41  TRP B CE3 1 
ATOM   2679 C  CZ2 . TRP B 1 41  ? 15.859  -1.360  59.240 1.00 17.43  ? 41  TRP B CZ2 1 
ATOM   2680 C  CZ3 . TRP B 1 41  ? 16.660  -1.473  61.545 1.00 14.80  ? 41  TRP B CZ3 1 
ATOM   2681 C  CH2 . TRP B 1 41  ? 15.749  -1.016  60.586 1.00 14.04  ? 41  TRP B CH2 1 
ATOM   2682 N  N   . HIS B 1 42  ? 22.568  -5.996  59.917 1.00 12.55  ? 42  HIS B N   1 
ATOM   2683 C  CA  . HIS B 1 42  ? 24.008  -6.103  60.178 1.00 12.17  ? 42  HIS B CA  1 
ATOM   2684 C  C   . HIS B 1 42  ? 24.705  -6.906  59.136 1.00 10.72  ? 42  HIS B C   1 
ATOM   2685 O  O   . HIS B 1 42  ? 25.736  -6.525  58.681 1.00 14.16  ? 42  HIS B O   1 
ATOM   2686 C  CB  . HIS B 1 42  ? 24.267  -6.692  61.552 1.00 13.50  ? 42  HIS B CB  1 
ATOM   2687 C  CG  . HIS B 1 42  ? 25.703  -6.595  62.038 1.00 13.55  ? 42  HIS B CG  1 
ATOM   2688 N  ND1 . HIS B 1 42  ? 26.500  -7.635  62.085 1.00 14.83  ? 42  HIS B ND1 1 
ATOM   2689 C  CD2 . HIS B 1 42  ? 26.476  -5.511  62.383 1.00 15.59  ? 42  HIS B CD2 1 
ATOM   2690 C  CE1 . HIS B 1 42  ? 27.707  -7.261  62.491 1.00 16.54  ? 42  HIS B CE1 1 
ATOM   2691 N  NE2 . HIS B 1 42  ? 27.673  -5.968  62.701 1.00 17.17  ? 42  HIS B NE2 1 
ATOM   2692 N  N   . GLY B 1 43  ? 24.147  -8.053  58.790 1.00 11.57  ? 43  GLY B N   1 
ATOM   2693 C  CA  . GLY B 1 43  ? 24.670  -8.893  57.729 1.00 14.64  ? 43  GLY B CA  1 
ATOM   2694 C  C   . GLY B 1 43  ? 24.654  -8.191  56.385 1.00 14.38  ? 43  GLY B C   1 
ATOM   2695 O  O   . GLY B 1 43  ? 25.588  -8.322  55.594 1.00 15.82  ? 43  GLY B O   1 
ATOM   2696 N  N   . ALA B 1 44  ? 23.586  -7.444  56.127 1.00 11.38  ? 44  ALA B N   1 
ATOM   2697 C  CA  . ALA B 1 44  ? 23.449  -6.705  54.871 1.00 14.01  ? 44  ALA B CA  1 
ATOM   2698 C  C   . ALA B 1 44  ? 24.557  -5.672  54.717 1.00 13.86  ? 44  ALA B C   1 
ATOM   2699 O  O   . ALA B 1 44  ? 25.151  -5.546  53.647 1.00 14.59  ? 44  ALA B O   1 
ATOM   2700 C  CB  . ALA B 1 44  ? 22.089  -6.028  54.803 1.00 12.93  ? 44  ALA B CB  1 
ATOM   2701 N  N   . ALA B 1 45  ? 24.841  -4.942  55.792 1.00 12.89  ? 45  ALA B N   1 
ATOM   2702 C  CA  . ALA B 1 45  ? 25.869  -3.907  55.750 1.00 12.00  ? 45  ALA B CA  1 
ATOM   2703 C  C   . ALA B 1 45  ? 27.232  -4.494  55.422 1.00 14.94  ? 45  ALA B C   1 
ATOM   2704 O  O   . ALA B 1 45  ? 28.043  -3.851  54.755 1.00 15.86  ? 45  ALA B O   1 
ATOM   2705 C  CB  . ALA B 1 45  ? 25.921  -3.149  57.063 1.00 10.07  ? 45  ALA B CB  1 
ATOM   2706 N  N   . GLY B 1 46  ? 27.478  -5.715  55.893 1.00 14.77  ? 46  GLY B N   1 
ATOM   2707 C  CA  . GLY B 1 46  ? 28.748  -6.388  55.674 1.00 19.70  ? 46  GLY B CA  1 
ATOM   2708 C  C   . GLY B 1 46  ? 29.033  -6.723  54.222 1.00 24.74  ? 46  GLY B C   1 
ATOM   2709 O  O   . GLY B 1 46  ? 30.196  -6.903  53.846 1.00 27.27  ? 46  GLY B O   1 
ATOM   2710 N  N   . LYS B 1 47  ? 27.991  -6.743  53.401 1.00 23.35  ? 47  LYS B N   1 
ATOM   2711 C  CA  . LYS B 1 47  ? 28.101  -7.056  51.984 1.00 29.81  ? 47  LYS B CA  1 
ATOM   2712 C  C   . LYS B 1 47  ? 28.113  -5.836  51.108 1.00 27.37  ? 47  LYS B C   1 
ATOM   2713 O  O   . LYS B 1 47  ? 28.098  -5.923  49.908 1.00 28.90  ? 47  LYS B O   1 
ATOM   2714 C  CB  . LYS B 1 47  ? 26.966  -7.986  51.551 1.00 33.06  ? 47  LYS B CB  1 
ATOM   2715 C  CG  . LYS B 1 47  ? 27.203  -9.413  51.945 1.00 34.09  ? 47  LYS B CG  1 
ATOM   2716 C  CD  . LYS B 1 47  ? 25.985  -10.118 52.483 1.00 39.57  ? 47  LYS B CD  1 
ATOM   2717 C  CE  . LYS B 1 47  ? 24.749  -9.798  51.726 1.00 44.70  ? 47  LYS B CE  1 
ATOM   2718 N  NZ  . LYS B 1 47  ? 23.546  -10.483 52.275 1.00 51.57  ? 47  LYS B NZ  1 
ATOM   2719 N  N   . PHE B 1 48  ? 28.085  -4.683  51.736 1.00 19.26  ? 48  PHE B N   1 
ATOM   2720 C  CA  . PHE B 1 48  ? 28.099  -3.442  50.995 1.00 16.88  ? 48  PHE B CA  1 
ATOM   2721 C  C   . PHE B 1 48  ? 29.509  -2.878  51.127 1.00 17.60  ? 48  PHE B C   1 
ATOM   2722 O  O   . PHE B 1 48  ? 29.817  -2.214  52.100 1.00 15.35  ? 48  PHE B O   1 
ATOM   2723 C  CB  . PHE B 1 48  ? 27.056  -2.467  51.551 1.00 18.41  ? 48  PHE B CB  1 
ATOM   2724 C  CG  . PHE B 1 48  ? 26.860  -1.240  50.709 1.00 18.58  ? 48  PHE B CG  1 
ATOM   2725 C  CD1 . PHE B 1 48  ? 26.002  -1.260  49.613 1.00 21.88  ? 48  PHE B CD1 1 
ATOM   2726 C  CD2 . PHE B 1 48  ? 27.527  -0.075  51.004 1.00 17.72  ? 48  PHE B CD2 1 
ATOM   2727 C  CE1 . PHE B 1 48  ? 25.827  -0.141  48.841 1.00 17.74  ? 48  PHE B CE1 1 
ATOM   2728 C  CE2 . PHE B 1 48  ? 27.360  1.054   50.231 1.00 23.98  ? 48  PHE B CE2 1 
ATOM   2729 C  CZ  . PHE B 1 48  ? 26.508  1.019   49.141 1.00 22.44  ? 48  PHE B CZ  1 
ATOM   2730 N  N   . HIS B 1 49  ? 30.369  -3.171  50.159 1.00 15.31  ? 49  HIS B N   1 
ATOM   2731 C  CA  . HIS B 1 49  ? 31.760  -2.717  50.237 1.00 14.73  ? 49  HIS B CA  1 
ATOM   2732 C  C   . HIS B 1 49  ? 31.943  -1.316  49.656 1.00 15.82  ? 49  HIS B C   1 
ATOM   2733 O  O   . HIS B 1 49  ? 31.330  -0.971  48.662 1.00 14.29  ? 49  HIS B O   1 
ATOM   2734 C  CB  . HIS B 1 49  ? 32.675  -3.734  49.566 1.00 14.29  ? 49  HIS B CB  1 
ATOM   2735 C  CG  . HIS B 1 49  ? 32.661  -5.067  50.245 1.00 17.37  ? 49  HIS B CG  1 
ATOM   2736 N  ND1 . HIS B 1 49  ? 33.408  -5.332  51.369 1.00 21.10  ? 49  HIS B ND1 1 
ATOM   2737 C  CD2 . HIS B 1 49  ? 31.952  -6.193  49.987 1.00 22.02  ? 49  HIS B CD2 1 
ATOM   2738 C  CE1 . HIS B 1 49  ? 33.179  -6.574  51.767 1.00 22.55  ? 49  HIS B CE1 1 
ATOM   2739 N  NE2 . HIS B 1 49  ? 32.293  -7.113  50.952 1.00 23.38  ? 49  HIS B NE2 1 
ATOM   2740 N  N   . THR B 1 50  ? 32.786  -0.515  50.299 1.00 14.38  ? 50  THR B N   1 
ATOM   2741 C  CA  . THR B 1 50  ? 32.959  0.879   49.938 1.00 16.34  ? 50  THR B CA  1 
ATOM   2742 C  C   . THR B 1 50  ? 34.433  1.164   49.642 1.00 17.04  ? 50  THR B C   1 
ATOM   2743 O  O   . THR B 1 50  ? 35.224  1.394   50.561 1.00 16.68  ? 50  THR B O   1 
ATOM   2744 C  CB  . THR B 1 50  ? 32.478  1.798   51.083 1.00 16.98  ? 50  THR B CB  1 
ATOM   2745 O  OG1 . THR B 1 50  ? 33.270  1.557   52.253 1.00 16.28  ? 50  THR B OG1 1 
ATOM   2746 C  CG2 . THR B 1 50  ? 31.022  1.519   51.423 1.00 13.08  ? 50  THR B CG2 1 
ATOM   2747 N  N   . PRO B 1 51  ? 34.816  1.121   48.363 1.00 14.96  ? 51  PRO B N   1 
ATOM   2748 C  CA  . PRO B 1 51  ? 33.974  0.763   47.206 1.00 17.22  ? 51  PRO B CA  1 
ATOM   2749 C  C   . PRO B 1 51  ? 33.928  -0.755  46.996 1.00 15.98  ? 51  PRO B C   1 
ATOM   2750 O  O   . PRO B 1 51  ? 34.612  -1.476  47.721 1.00 16.28  ? 51  PRO B O   1 
ATOM   2751 C  CB  . PRO B 1 51  ? 34.692  1.460   46.043 1.00 21.53  ? 51  PRO B CB  1 
ATOM   2752 C  CG  . PRO B 1 51  ? 36.144  1.428   46.445 1.00 22.70  ? 51  PRO B CG  1 
ATOM   2753 C  CD  . PRO B 1 51  ? 36.157  1.581   47.956 1.00 16.61  ? 51  PRO B CD  1 
ATOM   2754 N  N   . PRO B 1 52  ? 33.121  -1.252  46.034 1.00 19.51  ? 52  PRO B N   1 
ATOM   2755 C  CA  . PRO B 1 52  ? 33.111  -2.701  45.787 1.00 18.27  ? 52  PRO B CA  1 
ATOM   2756 C  C   . PRO B 1 52  ? 34.520  -3.247  45.528 1.00 22.41  ? 52  PRO B C   1 
ATOM   2757 O  O   . PRO B 1 52  ? 35.295  -2.636  44.787 1.00 20.93  ? 52  PRO B O   1 
ATOM   2758 C  CB  . PRO B 1 52  ? 32.269  -2.827  44.512 1.00 22.02  ? 52  PRO B CB  1 
ATOM   2759 C  CG  . PRO B 1 52  ? 31.344  -1.670  44.564 1.00 23.38  ? 52  PRO B CG  1 
ATOM   2760 C  CD  . PRO B 1 52  ? 32.107  -0.546  45.225 1.00 23.01  ? 52  PRO B CD  1 
ATOM   2761 N  N   . GLY B 1 53  ? 34.847  -4.374  46.147 1.00 21.12  ? 53  GLY B N   1 
ATOM   2762 C  CA  . GLY B 1 53  ? 36.167  -4.956  46.008 1.00 24.29  ? 53  GLY B CA  1 
ATOM   2763 C  C   . GLY B 1 53  ? 37.105  -4.601  47.152 1.00 24.31  ? 53  GLY B C   1 
ATOM   2764 O  O   . GLY B 1 53  ? 38.111  -5.271  47.347 1.00 25.45  ? 53  GLY B O   1 
ATOM   2765 N  N   . SER B 1 54  ? 36.780  -3.546  47.898 1.00 19.67  ? 54  SER B N   1 
ATOM   2766 C  CA  . SER B 1 54  ? 37.589  -3.106  49.035 1.00 18.98  ? 54  SER B CA  1 
ATOM   2767 C  C   . SER B 1 54  ? 37.304  -3.952  50.274 1.00 19.87  ? 54  SER B C   1 
ATOM   2768 O  O   . SER B 1 54  ? 36.278  -4.608  50.348 1.00 20.92  ? 54  SER B O   1 
ATOM   2769 C  CB  . SER B 1 54  ? 37.274  -1.642  49.350 1.00 17.29  ? 54  SER B CB  1 
ATOM   2770 O  OG  . SER B 1 54  ? 37.874  -1.236  50.565 1.00 23.69  ? 54  SER B OG  1 
ATOM   2771 N  N   . ASP B 1 55  ? 38.194  -3.928  51.262 1.00 24.30  ? 55  ASP B N   1 
ATOM   2772 C  CA  . ASP B 1 55  ? 37.878  -4.600  52.521 1.00 26.29  ? 55  ASP B CA  1 
ATOM   2773 C  C   . ASP B 1 55  ? 36.972  -3.749  53.415 1.00 24.98  ? 55  ASP B C   1 
ATOM   2774 O  O   . ASP B 1 55  ? 36.369  -4.260  54.352 1.00 24.01  ? 55  ASP B O   1 
ATOM   2775 C  CB  . ASP B 1 55  ? 39.127  -5.100  53.274 1.00 28.56  ? 55  ASP B CB  1 
ATOM   2776 C  CG  . ASP B 1 55  ? 40.169  -4.015  53.515 1.00 34.54  ? 55  ASP B CG  1 
ATOM   2777 O  OD1 . ASP B 1 55  ? 39.904  -2.817  53.262 1.00 30.58  ? 55  ASP B OD1 1 
ATOM   2778 O  OD2 . ASP B 1 55  ? 41.275  -4.377  53.981 1.00 43.65  ? 55  ASP B OD2 1 
ATOM   2779 N  N   . ARG B 1 56  ? 36.851  -2.462  53.107 1.00 17.47  ? 56  ARG B N   1 
ATOM   2780 C  CA  . ARG B 1 56  ? 35.943  -1.598  53.862 1.00 18.05  ? 56  ARG B CA  1 
ATOM   2781 C  C   . ARG B 1 56  ? 34.505  -1.981  53.552 1.00 17.53  ? 56  ARG B C   1 
ATOM   2782 O  O   . ARG B 1 56  ? 34.178  -2.301  52.410 1.00 16.93  ? 56  ARG B O   1 
ATOM   2783 C  CB  . ARG B 1 56  ? 36.086  -0.129  53.460 1.00 15.80  ? 56  ARG B CB  1 
ATOM   2784 C  CG  . ARG B 1 56  ? 37.471  0.487   53.532 1.00 18.20  ? 56  ARG B CG  1 
ATOM   2785 C  CD  . ARG B 1 56  ? 37.352  1.979   53.193 1.00 17.76  ? 56  ARG B CD  1 
ATOM   2786 N  NE  . ARG B 1 56  ? 38.632  2.585   52.849 1.00 16.94  ? 56  ARG B NE  1 
ATOM   2787 C  CZ  . ARG B 1 56  ? 39.147  2.560   51.628 1.00 19.77  ? 56  ARG B CZ  1 
ATOM   2788 N  NH1 . ARG B 1 56  ? 38.485  1.958   50.649 1.00 19.59  ? 56  ARG B NH1 1 
ATOM   2789 N  NH2 . ARG B 1 56  ? 40.321  3.137   51.382 1.00 25.07  ? 56  ARG B NH2 1 
ATOM   2790 N  N   . ASN B 1 57  ? 33.636  -1.919  54.552 1.00 16.65  ? 57  ASN B N   1 
ATOM   2791 C  CA  . ASN B 1 57  ? 32.202  -2.035  54.284 1.00 17.22  ? 57  ASN B CA  1 
ATOM   2792 C  C   . ASN B 1 57  ? 31.423  -0.983  55.062 1.00 14.98  ? 57  ASN B C   1 
ATOM   2793 O  O   . ASN B 1 57  ? 32.012  -0.203  55.835 1.00 11.70  ? 57  ASN B O   1 
ATOM   2794 C  CB  . ASN B 1 57  ? 31.660  -3.463  54.499 1.00 14.79  ? 57  ASN B CB  1 
ATOM   2795 C  CG  . ASN B 1 57  ? 31.747  -3.932  55.945 1.00 16.62  ? 57  ASN B CG  1 
ATOM   2796 O  OD1 . ASN B 1 57  ? 31.077  -3.403  56.824 1.00 15.34  ? 57  ASN B OD1 1 
ATOM   2797 N  ND2 . ASN B 1 57  ? 32.541  -4.977  56.182 1.00 20.03  ? 57  ASN B ND2 1 
ATOM   2798 N  N   . ALA B 1 58  ? 30.108  -0.952  54.843 1.00 12.34  ? 58  ALA B N   1 
ATOM   2799 C  CA  . ALA B 1 58  ? 29.276  0.124   55.380 1.00 13.24  ? 58  ALA B CA  1 
ATOM   2800 C  C   . ALA B 1 58  ? 29.376  0.240   56.889 1.00 11.78  ? 58  ALA B C   1 
ATOM   2801 O  O   . ALA B 1 58  ? 29.213  1.336   57.448 1.00 13.21  ? 58  ALA B O   1 
ATOM   2802 C  CB  . ALA B 1 58  ? 27.813  -0.071  54.968 1.00 13.50  ? 58  ALA B CB  1 
ATOM   2803 N  N   . ALA B 1 59  ? 29.623  -0.887  57.554 1.00 10.38  ? 59  ALA B N   1 
ATOM   2804 C  CA  . ALA B 1 59  ? 29.587  -0.907  59.012 1.00 12.00  ? 59  ALA B CA  1 
ATOM   2805 C  C   . ALA B 1 59  ? 30.902  -1.278  59.715 1.00 12.86  ? 59  ALA B C   1 
ATOM   2806 O  O   . ALA B 1 59  ? 30.971  -1.206  60.929 1.00 11.65  ? 59  ALA B O   1 
ATOM   2807 C  CB  . ALA B 1 59  ? 28.469  -1.824  59.481 1.00 13.71  ? 59  ALA B CB  1 
ATOM   2808 N  N   . HIS B 1 60  ? 31.921  -1.710  58.970 1.00 13.42  ? 60  HIS B N   1 
ATOM   2809 C  CA  . HIS B 1 60  ? 33.160  -2.169  59.568 1.00 14.28  ? 60  HIS B CA  1 
ATOM   2810 C  C   . HIS B 1 60  ? 34.404  -1.829  58.794 1.00 16.43  ? 60  HIS B C   1 
ATOM   2811 O  O   . HIS B 1 60  ? 34.327  -1.627  57.626 1.00 13.52  ? 60  HIS B O   1 
ATOM   2812 C  CB  . HIS B 1 60  ? 33.195  -3.671  59.816 1.00 15.48  ? 60  HIS B CB  1 
ATOM   2813 C  CG  . HIS B 1 60  ? 32.009  -4.223  60.545 1.00 16.29  ? 60  HIS B CG  1 
ATOM   2814 N  ND1 . HIS B 1 60  ? 30.911  -4.564  59.932 1.00 17.45  ? 60  HIS B ND1 1 
ATOM   2815 C  CD2 . HIS B 1 60  ? 31.793  -4.468  61.856 1.00 14.37  ? 60  HIS B CD2 1 
ATOM   2816 C  CE1 . HIS B 1 60  ? 30.027  -5.000  60.796 1.00 13.79  ? 60  HIS B CE1 1 
ATOM   2817 N  NE2 . HIS B 1 60  ? 30.557  -4.935  61.972 1.00 18.20  ? 60  HIS B NE2 1 
ATOM   2818 N  N   . MET B 1 61  ? 35.535  -1.785  59.483 1.00 13.37  ? 61  MET B N   1 
ATOM   2819 C  CA  . MET B 1 61  ? 36.843  -1.682  58.844 1.00 14.27  ? 61  MET B CA  1 
ATOM   2820 C  C   . MET B 1 61  ? 37.004  -0.365  58.114 1.00 15.66  ? 61  MET B C   1 
ATOM   2821 O  O   . MET B 1 61  ? 37.760  -0.257  57.146 1.00 15.99  ? 61  MET B O   1 
ATOM   2822 C  CB  . MET B 1 61  ? 37.061  -2.878  57.907 1.00 16.17  ? 61  MET B CB  1 
ATOM   2823 C  CG  . MET B 1 61  ? 37.109  -4.198  58.691 1.00 22.51  ? 61  MET B CG  1 
ATOM   2824 S  SD  . MET B 1 61  ? 37.233  -5.681  57.673 1.00 29.58  ? 61  MET B SD  1 
ATOM   2825 C  CE  . MET B 1 61  ? 37.408  -6.919  58.959 1.00 27.69  ? 61  MET B CE  1 
ATOM   2826 N  N   . SER B 1 62  ? 36.348  0.639   58.661 1.00 25.09  ? 62  SER B N   1 
ATOM   2827 C  CA  . SER B 1 62  ? 36.435  1.943   58.086 1.00 25.74  ? 62  SER B CA  1 
ATOM   2828 C  C   . SER B 1 62  ? 35.614  2.977   58.904 1.00 23.96  ? 62  SER B C   1 
ATOM   2829 O  O   . SER B 1 62  ? 34.854  2.605   59.767 1.00 22.88  ? 62  SER B O   1 
ATOM   2830 C  CB  . SER B 1 62  ? 36.059  1.832   56.605 1.00 27.78  ? 62  SER B CB  1 
ATOM   2831 O  OG  . SER B 1 62  ? 36.071  3.105   55.940 1.00 32.50  ? 62  SER B OG  1 
ATOM   2832 N  N   . SER B 1 63  ? 35.851  4.258   58.640 1.00 11.96  ? 63  SER B N   1 
ATOM   2833 C  CA  . SER B 1 63  ? 35.331  5.349   59.463 1.00 12.43  ? 63  SER B CA  1 
ATOM   2834 C  C   . SER B 1 63  ? 33.930  5.129   60.034 1.00 12.39  ? 63  SER B C   1 
ATOM   2835 O  O   . SER B 1 63  ? 33.691  5.350   61.221 1.00 11.40  ? 63  SER B O   1 
ATOM   2836 C  CB  . SER B 1 63  ? 35.367  6.665   58.679 1.00 16.25  ? 63  SER B CB  1 
ATOM   2837 O  OG  . SER B 1 63  ? 36.652  6.894   58.127 1.00 19.38  ? 63  SER B OG  1 
ATOM   2838 N  N   . ALA B 1 64  ? 33.007  4.706   59.179 1.00 12.66  ? 64  ALA B N   1 
ATOM   2839 C  CA  . ALA B 1 64  ? 31.582  4.630   59.531 1.00 11.11  ? 64  ALA B CA  1 
ATOM   2840 C  C   . ALA B 1 64  ? 31.278  3.605   60.630 1.00 10.95  ? 64  ALA B C   1 
ATOM   2841 O  O   . ALA B 1 64  ? 30.166  3.584   61.169 1.00 10.01  ? 64  ALA B O   1 
ATOM   2842 C  CB  . ALA B 1 64  ? 30.725  4.360   58.269 1.00 11.19  ? 64  ALA B CB  1 
ATOM   2843 N  N   . PHE B 1 65  ? 32.259  2.770   60.975 1.00 10.26  ? 65  PHE B N   1 
ATOM   2844 C  CA  . PHE B 1 65  ? 32.072  1.773   62.033 1.00 11.06  ? 65  PHE B CA  1 
ATOM   2845 C  C   . PHE B 1 65  ? 31.353  2.325   63.259 1.00 9.31   ? 65  PHE B C   1 
ATOM   2846 O  O   . PHE B 1 65  ? 30.350  1.777   63.717 1.00 8.72   ? 65  PHE B O   1 
ATOM   2847 C  CB  . PHE B 1 65  ? 33.433  1.197   62.453 1.00 9.68   ? 65  PHE B CB  1 
ATOM   2848 C  CG  . PHE B 1 65  ? 33.371  0.347   63.691 1.00 12.03  ? 65  PHE B CG  1 
ATOM   2849 C  CD1 . PHE B 1 65  ? 32.694  -0.863  63.684 1.00 11.94  ? 65  PHE B CD1 1 
ATOM   2850 C  CD2 . PHE B 1 65  ? 33.991  0.764   64.861 1.00 11.33  ? 65  PHE B CD2 1 
ATOM   2851 C  CE1 . PHE B 1 65  ? 32.637  -1.645  64.828 1.00 12.50  ? 65  PHE B CE1 1 
ATOM   2852 C  CE2 . PHE B 1 65  ? 33.941  -0.017  66.015 1.00 12.48  ? 65  PHE B CE2 1 
ATOM   2853 C  CZ  . PHE B 1 65  ? 33.263  -1.217  65.996 1.00 13.13  ? 65  PHE B CZ  1 
ATOM   2854 N  N   . LEU B 1 66  ? 31.844  3.445   63.780 1.00 9.38   ? 66  LEU B N   1 
ATOM   2855 C  CA  . LEU B 1 66  ? 31.251  4.035   64.971 1.00 7.06   ? 66  LEU B CA  1 
ATOM   2856 C  C   . LEU B 1 66  ? 29.859  4.646   64.775 1.00 7.60   ? 66  LEU B C   1 
ATOM   2857 O  O   . LEU B 1 66  ? 28.922  4.282   65.495 1.00 9.20   ? 66  LEU B O   1 
ATOM   2858 C  CB  . LEU B 1 66  ? 32.229  5.020   65.626 1.00 7.81   ? 66  LEU B CB  1 
ATOM   2859 C  CG  . LEU B 1 66  ? 33.456  4.310   66.222 1.00 9.04   ? 66  LEU B CG  1 
ATOM   2860 C  CD1 . LEU B 1 66  ? 34.539  5.294   66.688 1.00 8.20   ? 66  LEU B CD1 1 
ATOM   2861 C  CD2 . LEU B 1 66  ? 33.000  3.467   67.399 1.00 8.53   ? 66  LEU B CD2 1 
ATOM   2862 N  N   . PRO B 1 67  ? 29.704  5.592   63.829 1.00 8.52   ? 67  PRO B N   1 
ATOM   2863 C  CA  . PRO B 1 67  ? 28.338  6.115   63.674 1.00 8.87   ? 67  PRO B CA  1 
ATOM   2864 C  C   . PRO B 1 67  ? 27.330  5.060   63.197 1.00 8.20   ? 67  PRO B C   1 
ATOM   2865 O  O   . PRO B 1 67  ? 26.151  5.137   63.580 1.00 8.36   ? 67  PRO B O   1 
ATOM   2866 C  CB  . PRO B 1 67  ? 28.496  7.221   62.621 1.00 10.28  ? 67  PRO B CB  1 
ATOM   2867 C  CG  . PRO B 1 67  ? 29.727  6.837   61.866 1.00 11.33  ? 67  PRO B CG  1 
ATOM   2868 C  CD  . PRO B 1 67  ? 30.643  6.233   62.899 1.00 9.47   ? 67  PRO B CD  1 
ATOM   2869 N  N   . TRP B 1 68  ? 27.773  4.086   62.405 1.00 6.56   ? 68  TRP B N   1 
ATOM   2870 C  CA  . TRP B 1 68  ? 26.845  3.041   61.931 1.00 7.20   ? 68  TRP B CA  1 
ATOM   2871 C  C   . TRP B 1 68  ? 26.262  2.298   63.135 1.00 8.88   ? 68  TRP B C   1 
ATOM   2872 O  O   . TRP B 1 68  ? 25.042  2.063   63.212 1.00 8.86   ? 68  TRP B O   1 
ATOM   2873 C  CB  . TRP B 1 68  ? 27.544  2.057   60.983 1.00 8.00   ? 68  TRP B CB  1 
ATOM   2874 C  CG  . TRP B 1 68  ? 26.584  1.097   60.242 1.00 7.53   ? 68  TRP B CG  1 
ATOM   2875 C  CD1 . TRP B 1 68  ? 26.187  1.193   58.948 1.00 9.09   ? 68  TRP B CD1 1 
ATOM   2876 C  CD2 . TRP B 1 68  ? 25.932  -0.071  60.777 1.00 9.28   ? 68  TRP B CD2 1 
ATOM   2877 N  NE1 . TRP B 1 68  ? 25.330  0.155   58.629 1.00 10.33  ? 68  TRP B NE1 1 
ATOM   2878 C  CE2 . TRP B 1 68  ? 25.159  -0.633  59.739 1.00 9.47   ? 68  TRP B CE2 1 
ATOM   2879 C  CE3 . TRP B 1 68  ? 25.960  -0.721  62.018 1.00 9.00   ? 68  TRP B CE3 1 
ATOM   2880 C  CZ2 . TRP B 1 68  ? 24.384  -1.785  59.914 1.00 12.74  ? 68  TRP B CZ2 1 
ATOM   2881 C  CZ3 . TRP B 1 68  ? 25.183  -1.859  62.200 1.00 9.83   ? 68  TRP B CZ3 1 
ATOM   2882 C  CH2 . TRP B 1 68  ? 24.415  -2.389  61.145 1.00 11.02  ? 68  TRP B CH2 1 
ATOM   2883 N  N   . HIS B 1 69  ? 27.113  1.922   64.107 1.00 7.25   ? 69  HIS B N   1 
ATOM   2884 C  CA  . HIS B 1 69  ? 26.665  1.210   65.278 1.00 8.18   ? 69  HIS B CA  1 
ATOM   2885 C  C   . HIS B 1 69  ? 25.873  2.072   66.237 1.00 9.70   ? 69  HIS B C   1 
ATOM   2886 O  O   . HIS B 1 69  ? 24.971  1.617   66.828 1.00 10.14  ? 69  HIS B O   1 
ATOM   2887 C  CB  . HIS B 1 69  ? 27.756  0.401   65.939 1.00 9.01   ? 69  HIS B CB  1 
ATOM   2888 C  CG  . HIS B 1 69  ? 28.218  -0.757  65.103 1.00 8.89   ? 69  HIS B CG  1 
ATOM   2889 N  ND1 . HIS B 1 69  ? 29.141  -0.643  64.167 1.00 10.08  ? 69  HIS B ND1 1 
ATOM   2890 C  CD2 . HIS B 1 69  ? 27.756  -2.063  65.112 1.00 10.80  ? 69  HIS B CD2 1 
ATOM   2891 C  CE1 . HIS B 1 69  ? 29.295  -1.789  63.567 1.00 12.41  ? 69  HIS B CE1 1 
ATOM   2892 N  NE2 . HIS B 1 69  ? 28.454  -2.647  64.106 1.00 11.63  ? 69  HIS B NE2 1 
ATOM   2893 N  N   . ARG B 1 70  ? 26.224  3.340   66.324 1.00 9.47   ? 70  ARG B N   1 
ATOM   2894 C  CA  . ARG B 1 70  ? 25.430  4.286   67.099 1.00 10.45  ? 70  ARG B CA  1 
ATOM   2895 C  C   . ARG B 1 70  ? 23.987  4.307   66.607 1.00 9.39   ? 70  ARG B C   1 
ATOM   2896 O  O   . ARG B 1 70  ? 23.050  4.200   67.398 1.00 11.54  ? 70  ARG B O   1 
ATOM   2897 C  CB  . ARG B 1 70  ? 26.035  5.688   67.016 1.00 11.47  ? 70  ARG B CB  1 
ATOM   2898 C  CG  . ARG B 1 70  ? 25.324  6.723   67.873 1.00 13.43  ? 70  ARG B CG  1 
ATOM   2899 C  CD  . ARG B 1 70  ? 26.175  7.969   68.055 1.00 11.12  ? 70  ARG B CD  1 
ATOM   2900 N  NE  . ARG B 1 70  ? 27.138  7.820   69.142 1.00 12.30  ? 70  ARG B NE  1 
ATOM   2901 C  CZ  . ARG B 1 70  ? 27.970  8.777   69.539 1.00 14.01  ? 70  ARG B CZ  1 
ATOM   2902 N  NH1 . ARG B 1 70  ? 27.959  9.959   68.938 1.00 11.97  ? 70  ARG B NH1 1 
ATOM   2903 N  NH2 . ARG B 1 70  ? 28.813  8.553   70.537 1.00 12.98  ? 70  ARG B NH2 1 
ATOM   2904 N  N   . GLU B 1 71  ? 23.818  4.442   65.296 1.00 10.60  ? 71  GLU B N   1 
ATOM   2905 C  CA  . GLU B 1 71  ? 22.477  4.452   64.685 1.00 10.92  ? 71  GLU B CA  1 
ATOM   2906 C  C   . GLU B 1 71  ? 21.745  3.135   64.916 1.00 12.37  ? 71  GLU B C   1 
ATOM   2907 O  O   . GLU B 1 71  ? 20.550  3.109   65.212 1.00 11.23  ? 71  GLU B O   1 
ATOM   2908 C  CB  . GLU B 1 71  ? 22.569  4.737   63.189 1.00 10.43  ? 71  GLU B CB  1 
ATOM   2909 C  CG  . GLU B 1 71  ? 21.235  4.666   62.434 1.00 15.84  ? 71  GLU B CG  1 
ATOM   2910 C  CD  . GLU B 1 71  ? 20.230  5.763   62.824 1.00 20.83  ? 71  GLU B CD  1 
ATOM   2911 O  OE1 . GLU B 1 71  ? 20.571  6.686   63.606 1.00 19.34  ? 71  GLU B OE1 1 
ATOM   2912 O  OE2 . GLU B 1 71  ? 19.092  5.707   62.315 1.00 19.25  ? 71  GLU B OE2 1 
ATOM   2913 N  N   . TYR B 1 72  ? 22.479  2.038   64.772 1.00 11.21  ? 72  TYR B N   1 
ATOM   2914 C  CA  . TYR B 1 72  ? 21.931  0.698   64.969 1.00 10.65  ? 72  TYR B CA  1 
ATOM   2915 C  C   . TYR B 1 72  ? 21.355  0.556   66.381 1.00 11.01  ? 72  TYR B C   1 
ATOM   2916 O  O   . TYR B 1 72  ? 20.200  0.126   66.544 1.00 11.21  ? 72  TYR B O   1 
ATOM   2917 C  CB  . TYR B 1 72  ? 23.049  -0.300  64.722 1.00 10.29  ? 72  TYR B CB  1 
ATOM   2918 C  CG  . TYR B 1 72  ? 22.709  -1.777  64.698 1.00 11.69  ? 72  TYR B CG  1 
ATOM   2919 C  CD1 . TYR B 1 72  ? 22.072  -2.359  63.601 1.00 11.16  ? 72  TYR B CD1 1 
ATOM   2920 C  CD2 . TYR B 1 72  ? 23.131  -2.612  65.735 1.00 12.95  ? 72  TYR B CD2 1 
ATOM   2921 C  CE1 . TYR B 1 72  ? 21.824  -3.742  63.560 1.00 10.34  ? 72  TYR B CE1 1 
ATOM   2922 C  CE2 . TYR B 1 72  ? 22.872  -3.980  65.705 1.00 12.30  ? 72  TYR B CE2 1 
ATOM   2923 C  CZ  . TYR B 1 72  ? 22.225  -4.536  64.622 1.00 11.70  ? 72  TYR B CZ  1 
ATOM   2924 O  OH  . TYR B 1 72  ? 22.008  -5.905  64.604 1.00 12.90  ? 72  TYR B OH  1 
ATOM   2925 N  N   . LEU B 1 73  ? 22.145  0.939   67.391 1.00 10.22  ? 73  LEU B N   1 
ATOM   2926 C  CA  . LEU B 1 73  ? 21.701  0.869   68.786 1.00 11.68  ? 73  LEU B CA  1 
ATOM   2927 C  C   . LEU B 1 73  ? 20.558  1.821   69.065 1.00 12.02  ? 73  LEU B C   1 
ATOM   2928 O  O   . LEU B 1 73  ? 19.673  1.517   69.854 1.00 13.88  ? 73  LEU B O   1 
ATOM   2929 C  CB  . LEU B 1 73  ? 22.834  1.194   69.757 1.00 12.52  ? 73  LEU B CB  1 
ATOM   2930 C  CG  . LEU B 1 73  ? 24.057  0.287   69.705 1.00 15.47  ? 73  LEU B CG  1 
ATOM   2931 C  CD1 . LEU B 1 73  ? 25.044  0.729   70.775 1.00 14.46  ? 73  LEU B CD1 1 
ATOM   2932 C  CD2 . LEU B 1 73  ? 23.682  -1.174  69.862 1.00 14.68  ? 73  LEU B CD2 1 
ATOM   2933 N  N   . LEU B 1 74  ? 20.595  2.989   68.439 1.00 14.61  ? 74  LEU B N   1 
ATOM   2934 C  CA  . LEU B 1 74  ? 19.540  3.983   68.636 1.00 12.30  ? 74  LEU B CA  1 
ATOM   2935 C  C   . LEU B 1 74  ? 18.206  3.407   68.162 1.00 14.60  ? 74  LEU B C   1 
ATOM   2936 O  O   . LEU B 1 74  ? 17.212  3.448   68.888 1.00 16.42  ? 74  LEU B O   1 
ATOM   2937 C  CB  . LEU B 1 74  ? 19.876  5.281   67.893 1.00 15.01  ? 74  LEU B CB  1 
ATOM   2938 C  CG  . LEU B 1 74  ? 18.800  6.374   67.987 1.00 20.32  ? 74  LEU B CG  1 
ATOM   2939 C  CD1 . LEU B 1 74  ? 18.533  6.722   69.441 1.00 21.46  ? 74  LEU B CD1 1 
ATOM   2940 C  CD2 . LEU B 1 74  ? 19.220  7.608   67.211 1.00 20.81  ? 74  LEU B CD2 1 
ATOM   2941 N  N   . ARG B 1 75  ? 18.187  2.841   66.956 1.00 13.79  ? 75  ARG B N   1 
ATOM   2942 C  CA  . ARG B 1 75  ? 16.968  2.217   66.453 1.00 15.81  ? 75  ARG B CA  1 
ATOM   2943 C  C   . ARG B 1 75  ? 16.501  1.081   67.362 1.00 19.41  ? 75  ARG B C   1 
ATOM   2944 O  O   . ARG B 1 75  ? 15.312  0.969   67.667 1.00 18.52  ? 75  ARG B O   1 
ATOM   2945 C  CB  . ARG B 1 75  ? 17.149  1.718   65.018 1.00 14.12  ? 75  ARG B CB  1 
ATOM   2946 C  CG  . ARG B 1 75  ? 17.321  2.857   64.008 1.00 15.27  ? 75  ARG B CG  1 
ATOM   2947 C  CD  . ARG B 1 75  ? 17.677  2.325   62.622 1.00 16.35  ? 75  ARG B CD  1 
ATOM   2948 N  NE  . ARG B 1 75  ? 17.826  3.419   61.658 1.00 20.44  ? 75  ARG B NE  1 
ATOM   2949 C  CZ  . ARG B 1 75  ? 16.982  3.655   60.662 1.00 21.59  ? 75  ARG B CZ  1 
ATOM   2950 N  NH1 . ARG B 1 75  ? 17.196  4.676   59.838 1.00 23.23  ? 75  ARG B NH1 1 
ATOM   2951 N  NH2 . ARG B 1 75  ? 15.935  2.862   60.477 1.00 22.57  ? 75  ARG B NH2 1 
ATOM   2952 N  N   . PHE B 1 76  ? 17.447  0.253   67.798 1.00 11.56  ? 76  PHE B N   1 
ATOM   2953 C  CA  . PHE B 1 76  ? 17.132  -0.863  68.680 1.00 12.82  ? 76  PHE B CA  1 
ATOM   2954 C  C   . PHE B 1 76  ? 16.494  -0.369  69.992 1.00 16.03  ? 76  PHE B C   1 
ATOM   2955 O  O   . PHE B 1 76  ? 15.463  -0.883  70.424 1.00 16.29  ? 76  PHE B O   1 
ATOM   2956 C  CB  . PHE B 1 76  ? 18.398  -1.686  68.962 1.00 14.53  ? 76  PHE B CB  1 
ATOM   2957 C  CG  . PHE B 1 76  ? 18.131  -2.988  69.697 1.00 13.02  ? 76  PHE B CG  1 
ATOM   2958 C  CD1 . PHE B 1 76  ? 17.515  -4.037  69.059 1.00 15.49  ? 76  PHE B CD1 1 
ATOM   2959 C  CD2 . PHE B 1 76  ? 18.508  -3.145  71.023 1.00 19.10  ? 76  PHE B CD2 1 
ATOM   2960 C  CE1 . PHE B 1 76  ? 17.266  -5.237  69.720 1.00 17.43  ? 76  PHE B CE1 1 
ATOM   2961 C  CE2 . PHE B 1 76  ? 18.278  -4.335  71.689 1.00 17.23  ? 76  PHE B CE2 1 
ATOM   2962 C  CZ  . PHE B 1 76  ? 17.651  -5.386  71.035 1.00 16.66  ? 76  PHE B CZ  1 
ATOM   2963 N  N   . GLU B 1 77  ? 17.093  0.647   70.596 1.00 14.65  ? 77  GLU B N   1 
ATOM   2964 C  CA  . GLU B 1 77  ? 16.614  1.192   71.867 1.00 17.77  ? 77  GLU B CA  1 
ATOM   2965 C  C   . GLU B 1 77  ? 15.206  1.798   71.718 1.00 21.89  ? 77  GLU B C   1 
ATOM   2966 O  O   . GLU B 1 77  ? 14.369  1.713   72.628 1.00 19.56  ? 77  GLU B O   1 
ATOM   2967 C  CB  . GLU B 1 77  ? 17.608  2.225   72.398 1.00 18.13  ? 77  GLU B CB  1 
ATOM   2968 C  CG  . GLU B 1 77  ? 17.267  2.754   73.786 1.00 20.78  ? 77  GLU B CG  1 
ATOM   2969 C  CD  . GLU B 1 77  ? 18.349  3.638   74.356 1.00 24.33  ? 77  GLU B CD  1 
ATOM   2970 O  OE1 . GLU B 1 77  ? 18.602  4.714   73.768 1.00 24.39  ? 77  GLU B OE1 1 
ATOM   2971 O  OE2 . GLU B 1 77  ? 18.941  3.252   75.393 1.00 20.30  ? 77  GLU B OE2 1 
ATOM   2972 N  N   . ARG B 1 78  ? 14.945  2.403   70.569 1.00 21.25  ? 78  ARG B N   1 
ATOM   2973 C  CA  . ARG B 1 78  ? 13.617  2.872   70.253 1.00 22.80  ? 78  ARG B CA  1 
ATOM   2974 C  C   . ARG B 1 78  ? 12.607  1.745   70.190 1.00 24.70  ? 78  ARG B C   1 
ATOM   2975 O  O   . ARG B 1 78  ? 11.523  1.878   70.680 1.00 25.01  ? 78  ARG B O   1 
ATOM   2976 C  CB  . ARG B 1 78  ? 13.598  3.681   68.965 1.00 26.85  ? 78  ARG B CB  1 
ATOM   2977 C  CG  . ARG B 1 78  ? 14.351  4.955   69.055 1.00 29.91  ? 78  ARG B CG  1 
ATOM   2978 C  CD  . ARG B 1 78  ? 14.129  5.757   67.828 1.00 35.18  ? 78  ARG B CD  1 
ATOM   2979 N  NE  . ARG B 1 78  ? 14.658  7.080   67.995 1.00 42.08  ? 78  ARG B NE  1 
ATOM   2980 C  CZ  . ARG B 1 78  ? 15.368  7.703   67.082 1.00 39.61  ? 78  ARG B CZ  1 
ATOM   2981 N  NH1 . ARG B 1 78  ? 15.641  7.105   65.951 1.00 39.84  ? 78  ARG B NH1 1 
ATOM   2982 N  NH2 . ARG B 1 78  ? 15.816  8.907   67.334 1.00 41.38  ? 78  ARG B NH2 1 
ATOM   2983 N  N   . ASP B 1 79  ? 13.003  0.628   69.598 1.00 24.51  ? 79  ASP B N   1 
ATOM   2984 C  CA  . ASP B 1 79  ? 12.136  -0.553  69.562 1.00 28.30  ? 79  ASP B CA  1 
ATOM   2985 C  C   . ASP B 1 79  ? 11.922  -1.162  70.958 1.00 25.87  ? 79  ASP B C   1 
ATOM   2986 O  O   . ASP B 1 79  ? 10.823  -1.615  71.267 1.00 25.36  ? 79  ASP B O   1 
ATOM   2987 C  CB  . ASP B 1 79  ? 12.652  -1.603  68.578 1.00 25.98  ? 79  ASP B CB  1 
ATOM   2988 C  CG  . ASP B 1 79  ? 12.175  -1.352  67.153 1.00 30.33  ? 79  ASP B CG  1 
ATOM   2989 O  OD1 . ASP B 1 79  ? 12.963  -1.570  66.202 1.00 27.65  ? 79  ASP B OD1 1 
ATOM   2990 O  OD2 . ASP B 1 79  ? 11.004  -0.949  66.977 1.00 31.36  ? 79  ASP B OD2 1 
ATOM   2991 N  N   . LEU B 1 80  ? 12.960  -1.168  71.793 1.00 18.20  ? 80  LEU B N   1 
ATOM   2992 C  CA  . LEU B 1 80  ? 12.803  -1.568  73.190 1.00 22.99  ? 80  LEU B CA  1 
ATOM   2993 C  C   . LEU B 1 80  ? 11.755  -0.701  73.891 1.00 24.91  ? 80  LEU B C   1 
ATOM   2994 O  O   . LEU B 1 80  ? 10.864  -1.215  74.567 1.00 28.01  ? 80  LEU B O   1 
ATOM   2995 C  CB  . LEU B 1 80  ? 14.126  -1.468  73.953 1.00 20.80  ? 80  LEU B CB  1 
ATOM   2996 C  CG  . LEU B 1 80  ? 15.272  -2.414  73.582 1.00 17.56  ? 80  LEU B CG  1 
ATOM   2997 C  CD1 . LEU B 1 80  ? 16.510  -2.041  74.394 1.00 19.81  ? 80  LEU B CD1 1 
ATOM   2998 C  CD2 . LEU B 1 80  ? 14.865  -3.866  73.826 1.00 23.19  ? 80  LEU B CD2 1 
ATOM   2999 N  N   . GLN B 1 81  ? 11.899  0.617   73.751 1.00 34.31  ? 81  GLN B N   1 
ATOM   3000 C  CA  . GLN B 1 81  ? 11.008  1.583   74.400 1.00 37.42  ? 81  GLN B CA  1 
ATOM   3001 C  C   . GLN B 1 81  ? 9.553   1.586   73.885 1.00 38.59  ? 81  GLN B C   1 
ATOM   3002 O  O   . GLN B 1 81  ? 8.655   1.954   74.632 1.00 43.34  ? 81  GLN B O   1 
ATOM   3003 C  CB  . GLN B 1 81  ? 11.592  2.996   74.393 1.00 38.51  ? 81  GLN B CB  1 
ATOM   3004 C  CG  . GLN B 1 81  ? 12.794  3.136   75.294 1.00 41.86  ? 81  GLN B CG  1 
ATOM   3005 C  CD  . GLN B 1 81  ? 12.716  4.213   76.403 1.00 48.13  ? 81  GLN B CD  1 
ATOM   3006 O  OE1 . GLN B 1 81  ? 12.251  5.320   76.206 1.00 51.28  ? 81  GLN B OE1 1 
ATOM   3007 N  NE2 . GLN B 1 81  ? 13.251  3.885   77.528 1.00 49.78  ? 81  GLN B NE2 1 
ATOM   3008 N  N   . SER B 1 82  ? 9.321   1.159   72.640 1.00 29.79  ? 82  SER B N   1 
ATOM   3009 C  CA  . SER B 1 82  ? 7.969   1.013   72.143 1.00 36.84  ? 82  SER B CA  1 
ATOM   3010 C  C   . SER B 1 82  ? 7.251   -0.155  72.816 1.00 40.02  ? 82  SER B C   1 
ATOM   3011 O  O   . SER B 1 82  ? 6.049   -0.251  72.780 1.00 41.05  ? 82  SER B O   1 
ATOM   3012 C  CB  . SER B 1 82  ? 7.938   0.863   70.630 1.00 36.74  ? 82  SER B CB  1 
ATOM   3013 O  OG  . SER B 1 82  ? 8.600   -0.305  70.223 1.00 48.37  ? 82  SER B OG  1 
ATOM   3014 N  N   . ILE B 1 83  ? 8.030   -1.051  73.409 1.00 32.22  ? 83  ILE B N   1 
ATOM   3015 C  CA  . ILE B 1 83  ? 7.462   -2.148  74.185 1.00 33.96  ? 83  ILE B CA  1 
ATOM   3016 C  C   . ILE B 1 83  ? 7.312   -1.757  75.652 1.00 32.30  ? 83  ILE B C   1 
ATOM   3017 O  O   . ILE B 1 83  ? 6.281   -2.012  76.264 1.00 34.03  ? 83  ILE B O   1 
ATOM   3018 C  CB  . ILE B 1 83  ? 8.327   -3.422  74.105 1.00 32.49  ? 83  ILE B CB  1 
ATOM   3019 C  CG1 . ILE B 1 83  ? 8.552   -3.830  72.652 1.00 31.07  ? 83  ILE B CG1 1 
ATOM   3020 C  CG2 . ILE B 1 83  ? 7.675   -4.560  74.883 1.00 29.69  ? 83  ILE B CG2 1 
ATOM   3021 C  CD1 . ILE B 1 83  ? 7.298   -4.263  71.937 1.00 33.98  ? 83  ILE B CD1 1 
ATOM   3022 N  N   . ASN B 1 84  ? 8.348   -1.133  76.202 1.00 31.38  ? 84  ASN B N   1 
ATOM   3023 C  CA  . ASN B 1 84  ? 8.395   -0.767  77.616 1.00 32.94  ? 84  ASN B CA  1 
ATOM   3024 C  C   . ASN B 1 84  ? 9.241   0.496   77.791 1.00 34.17  ? 84  ASN B C   1 
ATOM   3025 O  O   . ASN B 1 84  ? 10.473  0.426   77.784 1.00 30.98  ? 84  ASN B O   1 
ATOM   3026 C  CB  . ASN B 1 84  ? 8.986   -1.932  78.434 1.00 32.61  ? 84  ASN B CB  1 
ATOM   3027 C  CG  . ASN B 1 84  ? 8.979   -1.674  79.944 1.00 34.40  ? 84  ASN B CG  1 
ATOM   3028 O  OD1 . ASN B 1 84  ? 8.968   -0.530  80.402 1.00 34.80  ? 84  ASN B OD1 1 
ATOM   3029 N  ND2 . ASN B 1 84  ? 9.009   -2.754  80.722 1.00 34.68  ? 84  ASN B ND2 1 
ATOM   3030 N  N   . PRO B 1 85  ? 8.581   1.658   77.973 1.00 35.47  ? 85  PRO B N   1 
ATOM   3031 C  CA  . PRO B 1 85  ? 9.246   2.970   78.002 1.00 35.82  ? 85  PRO B CA  1 
ATOM   3032 C  C   . PRO B 1 85  ? 10.285  3.136   79.111 1.00 38.84  ? 85  PRO B C   1 
ATOM   3033 O  O   . PRO B 1 85  ? 11.063  4.091   79.085 1.00 39.71  ? 85  PRO B O   1 
ATOM   3034 C  CB  . PRO B 1 85  ? 8.082   3.952   78.212 1.00 40.31  ? 85  PRO B CB  1 
ATOM   3035 C  CG  . PRO B 1 85  ? 6.982   3.134   78.791 1.00 39.22  ? 85  PRO B CG  1 
ATOM   3036 C  CD  . PRO B 1 85  ? 7.126   1.776   78.168 1.00 37.85  ? 85  PRO B CD  1 
ATOM   3037 N  N   . GLU B 1 86  ? 10.264  2.254   80.074 1.00 37.07  ? 86  GLU B N   1 
ATOM   3038 C  CA  . GLU B 1 86  ? 11.268  2.296   81.108 1.00 42.04  ? 86  GLU B CA  1 
ATOM   3039 C  C   . GLU B 1 86  ? 12.557  1.536   80.768 1.00 37.06  ? 86  GLU B C   1 
ATOM   3040 O  O   . GLU B 1 86  ? 13.488  1.585   81.514 1.00 37.29  ? 86  GLU B O   1 
ATOM   3041 C  CB  . GLU B 1 86  ? 10.677  1.799   82.426 1.00 42.59  ? 86  GLU B CB  1 
ATOM   3042 C  CG  . GLU B 1 86  ? 9.396   2.513   82.816 1.00 48.15  ? 86  GLU B CG  1 
ATOM   3043 C  CD  . GLU B 1 86  ? 9.578   4.010   82.989 1.00 56.97  ? 86  GLU B CD  1 
ATOM   3044 O  OE1 . GLU B 1 86  ? 10.416  4.415   83.814 1.00 61.52  ? 86  GLU B OE1 1 
ATOM   3045 O  OE2 . GLU B 1 86  ? 8.882   4.785   82.293 1.00 61.45  ? 86  GLU B OE2 1 
ATOM   3046 N  N   . VAL B 1 87  ? 12.583  0.838   79.641 1.00 32.69  ? 87  VAL B N   1 
ATOM   3047 C  CA  . VAL B 1 87  ? 13.728  0.012   79.271 1.00 28.95  ? 87  VAL B CA  1 
ATOM   3048 C  C   . VAL B 1 87  ? 14.701  0.760   78.357 1.00 28.35  ? 87  VAL B C   1 
ATOM   3049 O  O   . VAL B 1 87  ? 14.330  1.184   77.270 1.00 29.82  ? 87  VAL B O   1 
ATOM   3050 C  CB  . VAL B 1 87  ? 13.279  -1.313  78.607 1.00 29.72  ? 87  VAL B CB  1 
ATOM   3051 C  CG1 . VAL B 1 87  ? 14.487  -2.096  78.089 1.00 25.47  ? 87  VAL B CG1 1 
ATOM   3052 C  CG2 . VAL B 1 87  ? 12.483  -2.154  79.591 1.00 26.24  ? 87  VAL B CG2 1 
ATOM   3053 N  N   . THR B 1 88  ? 15.939  0.926   78.821 1.00 27.50  ? 88  THR B N   1 
ATOM   3054 C  CA  . THR B 1 88  ? 17.016  1.490   78.005 1.00 24.21  ? 88  THR B CA  1 
ATOM   3055 C  C   . THR B 1 88  ? 18.097  0.434   77.749 1.00 26.14  ? 88  THR B C   1 
ATOM   3056 O  O   . THR B 1 88  ? 18.142  -0.594  78.416 1.00 21.72  ? 88  THR B O   1 
ATOM   3057 C  CB  . THR B 1 88  ? 17.682  2.720   78.677 1.00 25.25  ? 88  THR B CB  1 
ATOM   3058 O  OG1 . THR B 1 88  ? 18.340  2.315   79.884 1.00 25.47  ? 88  THR B OG1 1 
ATOM   3059 C  CG2 . THR B 1 88  ? 16.648  3.806   78.994 1.00 28.70  ? 88  THR B CG2 1 
ATOM   3060 N  N   . LEU B 1 89  ? 18.980  0.694   76.795 1.00 21.57  ? 89  LEU B N   1 
ATOM   3061 C  CA  . LEU B 1 89  ? 20.062  -0.248  76.505 1.00 20.49  ? 89  LEU B CA  1 
ATOM   3062 C  C   . LEU B 1 89  ? 21.227  -0.110  77.492 1.00 19.23  ? 89  LEU B C   1 
ATOM   3063 O  O   . LEU B 1 89  ? 21.873  0.939   77.555 1.00 18.31  ? 89  LEU B O   1 
ATOM   3064 C  CB  . LEU B 1 89  ? 20.540  -0.028  75.065 1.00 20.28  ? 89  LEU B CB  1 
ATOM   3065 C  CG  . LEU B 1 89  ? 21.737  -0.832  74.588 1.00 22.67  ? 89  LEU B CG  1 
ATOM   3066 C  CD1 . LEU B 1 89  ? 21.426  -2.315  74.647 1.00 20.57  ? 89  LEU B CD1 1 
ATOM   3067 C  CD2 . LEU B 1 89  ? 22.059  -0.401  73.168 1.00 20.38  ? 89  LEU B CD2 1 
ATOM   3068 N  N   . PRO B 1 90  ? 21.504  -1.163  78.283 1.00 16.35  ? 90  PRO B N   1 
ATOM   3069 C  CA  . PRO B 1 90  ? 22.671  -1.084  79.168 1.00 15.26  ? 90  PRO B CA  1 
ATOM   3070 C  C   . PRO B 1 90  ? 23.985  -1.380  78.441 1.00 15.33  ? 90  PRO B C   1 
ATOM   3071 O  O   . PRO B 1 90  ? 23.964  -1.824  77.287 1.00 15.14  ? 90  PRO B O   1 
ATOM   3072 C  CB  . PRO B 1 90  ? 22.388  -2.153  80.236 1.00 17.47  ? 90  PRO B CB  1 
ATOM   3073 C  CG  . PRO B 1 90  ? 21.251  -2.977  79.734 1.00 19.13  ? 90  PRO B CG  1 
ATOM   3074 C  CD  . PRO B 1 90  ? 20.796  -2.451  78.402 1.00 15.06  ? 90  PRO B CD  1 
ATOM   3075 N  N   . TYR B 1 91  ? 25.112  -1.124  79.099 1.00 14.95  ? 91  TYR B N   1 
ATOM   3076 C  CA  . TYR B 1 91  ? 26.411  -1.458  78.518 1.00 13.66  ? 91  TYR B CA  1 
ATOM   3077 C  C   . TYR B 1 91  ? 27.216  -2.445  79.363 1.00 16.60  ? 91  TYR B C   1 
ATOM   3078 O  O   . TYR B 1 91  ? 27.191  -2.408  80.600 1.00 16.38  ? 91  TYR B O   1 
ATOM   3079 C  CB  . TYR B 1 91  ? 27.238  -0.199  78.227 1.00 12.90  ? 91  TYR B CB  1 
ATOM   3080 C  CG  . TYR B 1 91  ? 27.616  0.641   79.444 1.00 16.28  ? 91  TYR B CG  1 
ATOM   3081 C  CD1 . TYR B 1 91  ? 28.785  0.381   80.160 1.00 17.37  ? 91  TYR B CD1 1 
ATOM   3082 C  CD2 . TYR B 1 91  ? 26.826  1.722   79.847 1.00 16.07  ? 91  TYR B CD2 1 
ATOM   3083 C  CE1 . TYR B 1 91  ? 29.146  1.150   81.258 1.00 17.57  ? 91  TYR B CE1 1 
ATOM   3084 C  CE2 . TYR B 1 91  ? 27.186  2.507   80.956 1.00 15.27  ? 91  TYR B CE2 1 
ATOM   3085 C  CZ  . TYR B 1 91  ? 28.340  2.210   81.653 1.00 19.25  ? 91  TYR B CZ  1 
ATOM   3086 O  OH  . TYR B 1 91  ? 28.704  2.973   82.748 1.00 18.77  ? 91  TYR B OH  1 
ATOM   3087 N  N   . TRP B 1 92  ? 27.938  -3.323  78.677 1.00 14.22  ? 92  TRP B N   1 
ATOM   3088 C  CA  . TRP B 1 92  ? 28.841  -4.264  79.321 1.00 14.70  ? 92  TRP B CA  1 
ATOM   3089 C  C   . TRP B 1 92  ? 30.223  -3.650  79.377 1.00 15.05  ? 92  TRP B C   1 
ATOM   3090 O  O   . TRP B 1 92  ? 30.909  -3.549  78.356 1.00 12.76  ? 92  TRP B O   1 
ATOM   3091 C  CB  . TRP B 1 92  ? 28.872  -5.576  78.515 1.00 13.74  ? 92  TRP B CB  1 
ATOM   3092 C  CG  . TRP B 1 92  ? 29.896  -6.595  78.980 1.00 15.16  ? 92  TRP B CG  1 
ATOM   3093 C  CD1 . TRP B 1 92  ? 30.401  -6.758  80.251 1.00 14.90  ? 92  TRP B CD1 1 
ATOM   3094 C  CD2 . TRP B 1 92  ? 30.526  -7.592  78.166 1.00 14.53  ? 92  TRP B CD2 1 
ATOM   3095 N  NE1 . TRP B 1 92  ? 31.310  -7.797  80.266 1.00 15.71  ? 92  TRP B NE1 1 
ATOM   3096 C  CE2 . TRP B 1 92  ? 31.401  -8.328  79.001 1.00 14.48  ? 92  TRP B CE2 1 
ATOM   3097 C  CE3 . TRP B 1 92  ? 30.432  -7.936  76.807 1.00 13.04  ? 92  TRP B CE3 1 
ATOM   3098 C  CZ2 . TRP B 1 92  ? 32.188  -9.376  78.522 1.00 13.65  ? 92  TRP B CZ2 1 
ATOM   3099 C  CZ3 . TRP B 1 92  ? 31.214  -8.989  76.328 1.00 16.11  ? 92  TRP B CZ3 1 
ATOM   3100 C  CH2 . TRP B 1 92  ? 32.082  -9.693  77.185 1.00 15.82  ? 92  TRP B CH2 1 
ATOM   3101 N  N   . GLU B 1 93  ? 30.633  -3.230  80.572 1.00 16.25  ? 93  GLU B N   1 
ATOM   3102 C  CA  . GLU B 1 93  ? 31.974  -2.683  80.785 1.00 17.96  ? 93  GLU B CA  1 
ATOM   3103 C  C   . GLU B 1 93  ? 33.040  -3.785  80.888 1.00 20.26  ? 93  GLU B C   1 
ATOM   3104 O  O   . GLU B 1 93  ? 33.534  -4.102  81.983 1.00 17.75  ? 93  GLU B O   1 
ATOM   3105 C  CB  . GLU B 1 93  ? 31.991  -1.798  82.035 1.00 22.30  ? 93  GLU B CB  1 
ATOM   3106 C  CG  . GLU B 1 93  ? 33.246  -0.979  82.189 1.00 22.28  ? 93  GLU B CG  1 
ATOM   3107 C  CD  . GLU B 1 93  ? 33.122  0.037   83.313 1.00 30.60  ? 93  GLU B CD  1 
ATOM   3108 O  OE1 . GLU B 1 93  ? 33.167  -0.368  84.491 1.00 31.14  ? 93  GLU B OE1 1 
ATOM   3109 O  OE2 . GLU B 1 93  ? 32.943  1.235   83.020 1.00 31.33  ? 93  GLU B OE2 1 
ATOM   3110 N  N   . TRP B 1 94  ? 33.397  -4.356  79.742 1.00 18.74  ? 94  TRP B N   1 
ATOM   3111 C  CA  . TRP B 1 94  ? 34.308  -5.487  79.692 1.00 14.96  ? 94  TRP B CA  1 
ATOM   3112 C  C   . TRP B 1 94  ? 35.696  -5.234  80.283 1.00 20.36  ? 94  TRP B C   1 
ATOM   3113 O  O   . TRP B 1 94  ? 36.331  -6.141  80.788 1.00 20.18  ? 94  TRP B O   1 
ATOM   3114 C  CB  . TRP B 1 94  ? 34.419  -6.097  78.290 1.00 16.79  ? 94  TRP B CB  1 
ATOM   3115 C  CG  . TRP B 1 94  ? 34.119  -5.223  77.102 1.00 13.61  ? 94  TRP B CG  1 
ATOM   3116 C  CD1 . TRP B 1 94  ? 32.999  -5.223  76.358 1.00 13.71  ? 94  TRP B CD1 1 
ATOM   3117 C  CD2 . TRP B 1 94  ? 34.985  -4.262  76.512 1.00 16.13  ? 94  TRP B CD2 1 
ATOM   3118 N  NE1 . TRP B 1 94  ? 33.092  -4.334  75.347 1.00 14.76  ? 94  TRP B NE1 1 
ATOM   3119 C  CE2 . TRP B 1 94  ? 34.303  -3.715  75.410 1.00 14.31  ? 94  TRP B CE2 1 
ATOM   3120 C  CE3 . TRP B 1 94  ? 36.257  -3.790  76.809 1.00 16.07  ? 94  TRP B CE3 1 
ATOM   3121 C  CZ2 . TRP B 1 94  ? 34.863  -2.748  74.602 1.00 13.60  ? 94  TRP B CZ2 1 
ATOM   3122 C  CZ3 . TRP B 1 94  ? 36.805  -2.845  76.015 1.00 16.91  ? 94  TRP B CZ3 1 
ATOM   3123 C  CH2 . TRP B 1 94  ? 36.101  -2.316  74.918 1.00 14.57  ? 94  TRP B CH2 1 
ATOM   3124 N  N   . GLU B 1 95  ? 36.153  -3.994  80.208 1.00 20.69  ? 95  GLU B N   1 
ATOM   3125 C  CA  . GLU B 1 95  ? 37.485  -3.646  80.709 1.00 21.21  ? 95  GLU B CA  1 
ATOM   3126 C  C   . GLU B 1 95  ? 37.624  -3.923  82.212 1.00 25.29  ? 95  GLU B C   1 
ATOM   3127 O  O   . GLU B 1 95  ? 38.709  -4.245  82.698 1.00 27.40  ? 95  GLU B O   1 
ATOM   3128 C  CB  . GLU B 1 95  ? 37.836  -2.183  80.381 1.00 22.07  ? 95  GLU B CB  1 
ATOM   3129 C  CG  . GLU B 1 95  ? 36.864  -1.154  80.954 1.00 25.14  ? 95  GLU B CG  1 
ATOM   3130 C  CD  . GLU B 1 95  ? 35.886  -0.587  79.924 1.00 27.56  ? 95  GLU B CD  1 
ATOM   3131 O  OE1 . GLU B 1 95  ? 35.132  -1.366  79.303 1.00 24.19  ? 95  GLU B OE1 1 
ATOM   3132 O  OE2 . GLU B 1 95  ? 35.861  0.650   79.747 1.00 26.48  ? 95  GLU B OE2 1 
ATOM   3133 N  N   . THR B 1 96  ? 36.536  -3.787  82.941 1.00 23.96  ? 96  THR B N   1 
ATOM   3134 C  CA  . THR B 1 96  ? 36.582  -4.133  84.337 1.00 26.46  ? 96  THR B CA  1 
ATOM   3135 C  C   . THR B 1 96  ? 36.412  -5.613  84.630 1.00 28.65  ? 96  THR B C   1 
ATOM   3136 O  O   . THR B 1 96  ? 37.021  -6.138  85.539 1.00 25.67  ? 96  THR B O   1 
ATOM   3137 C  CB  . THR B 1 96  ? 35.720  -3.245  85.281 1.00 31.72  ? 96  THR B CB  1 
ATOM   3138 O  OG1 . THR B 1 96  ? 34.713  -4.001  85.926 1.00 39.31  ? 96  THR B OG1 1 
ATOM   3139 C  CG2 . THR B 1 96  ? 35.162  -2.106  84.657 1.00 27.17  ? 96  THR B CG2 1 
ATOM   3140 N  N   . ASP B 1 97  ? 35.587  -6.280  83.843 1.00 22.57  ? 97  ASP B N   1 
ATOM   3141 C  CA  . ASP B 1 97  ? 35.501  -7.734  83.927 1.00 20.61  ? 97  ASP B CA  1 
ATOM   3142 C  C   . ASP B 1 97  ? 36.872  -8.355  83.682 1.00 21.26  ? 97  ASP B C   1 
ATOM   3143 O  O   . ASP B 1 97  ? 37.200  -9.382  84.266 1.00 24.54  ? 97  ASP B O   1 
ATOM   3144 C  CB  . ASP B 1 97  ? 34.479  -8.282  82.918 1.00 20.93  ? 97  ASP B CB  1 
ATOM   3145 C  CG  . ASP B 1 97  ? 33.041  -8.129  83.399 1.00 24.99  ? 97  ASP B CG  1 
ATOM   3146 O  OD1 . ASP B 1 97  ? 32.127  -8.710  82.771 1.00 22.51  ? 97  ASP B OD1 1 
ATOM   3147 O  OD2 . ASP B 1 97  ? 32.819  -7.441  84.417 1.00 25.09  ? 97  ASP B OD2 1 
ATOM   3148 N  N   . ALA B 1 98  ? 37.674  -7.724  82.822 1.00 19.84  ? 98  ALA B N   1 
ATOM   3149 C  CA  . ALA B 1 98  ? 39.014  -8.218  82.496 1.00 23.36  ? 98  ALA B CA  1 
ATOM   3150 C  C   . ALA B 1 98  ? 39.931  -8.318  83.717 1.00 29.44  ? 98  ALA B C   1 
ATOM   3151 O  O   . ALA B 1 98  ? 40.954  -9.004  83.676 1.00 26.93  ? 98  ALA B O   1 
ATOM   3152 C  CB  . ALA B 1 98  ? 39.662  -7.348  81.440 1.00 21.58  ? 98  ALA B CB  1 
ATOM   3153 N  N   . GLN B 1 99  ? 39.572  -7.613  84.753 1.00 36.85  ? 99  GLN B N   1 
ATOM   3154 C  CA  . GLN B 1 99  ? 40.368  -7.546  85.950 1.00 41.36  ? 99  GLN B CA  1 
ATOM   3155 C  C   . GLN B 1 99  ? 40.187  -8.841  86.794 1.00 46.33  ? 99  GLN B C   1 
ATOM   3156 O  O   . GLN B 1 99  ? 41.042  -9.153  87.561 1.00 48.01  ? 99  GLN B O   1 
ATOM   3157 C  CB  . GLN B 1 99  ? 40.011  -6.242  86.690 1.00 39.69  ? 99  GLN B CB  1 
ATOM   3158 C  CG  . GLN B 1 99  ? 40.368  -4.867  86.071 1.00 45.52  ? 99  GLN B CG  1 
ATOM   3159 C  CD  . GLN B 1 99  ? 39.949  -3.559  86.780 1.00 55.51  ? 99  GLN B CD  1 
ATOM   3160 O  OE1 . GLN B 1 99  ? 38.982  -3.492  87.560 1.00 58.32  ? 99  GLN B OE1 1 
ATOM   3161 N  NE2 . GLN B 1 99  ? 40.618  -2.502  86.419 1.00 55.09  ? 99  GLN B NE2 1 
ATOM   3162 N  N   . MET B 1 100 ? 39.095  -9.598  86.599 1.00 35.35  ? 100 MET B N   1 
ATOM   3163 C  CA  . MET B 1 100 ? 38.788  -10.823 87.335 1.00 36.74  ? 100 MET B CA  1 
ATOM   3164 C  C   . MET B 1 100 ? 39.732  -11.968 86.967 1.00 43.78  ? 100 MET B C   1 
ATOM   3165 O  O   . MET B 1 100 ? 40.348  -11.965 85.898 1.00 43.74  ? 100 MET B O   1 
ATOM   3166 C  CB  . MET B 1 100 ? 37.336  -11.249 87.080 1.00 35.54  ? 100 MET B CB  1 
ATOM   3167 C  CG  . MET B 1 100 ? 36.300  -10.169 87.362 1.00 37.01  ? 100 MET B CG  1 
ATOM   3168 S  SD  . MET B 1 100 ? 34.606  -10.716 87.001 1.00 34.33  ? 100 MET B SD  1 
ATOM   3169 C  CE  . MET B 1 100 ? 34.417  -12.001 88.240 1.00 35.06  ? 100 MET B CE  1 
ATOM   3170 N  N   . GLN B 1 101 ? 39.821  -13.016 87.776 1.00 56.39  ? 101 GLN B N   1 
ATOM   3171 C  CA  . GLN B 1 101 ? 40.654  -14.175 87.436 1.00 57.23  ? 101 GLN B CA  1 
ATOM   3172 C  C   . GLN B 1 101 ? 39.913  -14.981 86.431 1.00 57.72  ? 101 GLN B C   1 
ATOM   3173 O  O   . GLN B 1 101 ? 40.434  -15.471 85.463 1.00 57.09  ? 101 GLN B O   1 
ATOM   3174 C  CB  . GLN B 1 101 ? 40.908  -15.069 88.665 1.00 63.23  ? 101 GLN B CB  1 
ATOM   3175 C  CG  . GLN B 1 101 ? 41.814  -16.275 88.408 1.00 68.57  ? 101 GLN B CG  1 
ATOM   3176 C  CD  . GLN B 1 101 ? 41.068  -17.604 88.299 1.00 78.28  ? 101 GLN B CD  1 
ATOM   3177 O  OE1 . GLN B 1 101 ? 40.503  -18.086 89.278 1.00 74.67  ? 101 GLN B OE1 1 
ATOM   3178 N  NE2 . GLN B 1 101 ? 41.071  -18.194 87.115 1.00 76.70  ? 101 GLN B NE2 1 
ATOM   3179 N  N   . ASP B 1 102 ? 38.640  -15.101 86.680 1.00 64.59  ? 102 ASP B N   1 
ATOM   3180 C  CA  . ASP B 1 102 ? 37.834  -15.746 85.669 1.00 64.31  ? 102 ASP B CA  1 
ATOM   3181 C  C   . ASP B 1 102 ? 36.664  -14.829 85.337 1.00 59.40  ? 102 ASP B C   1 
ATOM   3182 O  O   . ASP B 1 102 ? 35.653  -14.837 86.034 1.00 55.36  ? 102 ASP B O   1 
ATOM   3183 C  CB  . ASP B 1 102 ? 37.326  -17.094 86.179 1.00 64.82  ? 102 ASP B CB  1 
ATOM   3184 C  CG  . ASP B 1 102 ? 36.554  -17.860 85.126 1.00 68.01  ? 102 ASP B CG  1 
ATOM   3185 O  OD1 . ASP B 1 102 ? 36.434  -17.343 83.990 1.00 68.68  ? 102 ASP B OD1 1 
ATOM   3186 O  OD2 . ASP B 1 102 ? 36.047  -18.968 85.435 1.00 66.40  ? 102 ASP B OD2 1 
ATOM   3187 N  N   . PRO B 1 103 ? 36.804  -14.038 84.259 1.00 35.80  ? 103 PRO B N   1 
ATOM   3188 C  CA  . PRO B 1 103 ? 35.784  -13.085 83.802 1.00 26.55  ? 103 PRO B CA  1 
ATOM   3189 C  C   . PRO B 1 103 ? 34.452  -13.762 83.524 1.00 25.16  ? 103 PRO B C   1 
ATOM   3190 O  O   . PRO B 1 103 ? 33.426  -13.091 83.469 1.00 20.30  ? 103 PRO B O   1 
ATOM   3191 C  CB  . PRO B 1 103 ? 36.381  -12.544 82.505 1.00 26.43  ? 103 PRO B CB  1 
ATOM   3192 C  CG  . PRO B 1 103 ? 37.850  -12.678 82.695 1.00 32.50  ? 103 PRO B CG  1 
ATOM   3193 C  CD  . PRO B 1 103 ? 38.028  -13.961 83.444 1.00 31.67  ? 103 PRO B CD  1 
ATOM   3194 N  N   . SER B 1 104 ? 34.531  -15.002 83.334 1.00 27.29  ? 104 SER B N   1 
ATOM   3195 C  CA  . SER B 1 104 ? 33.375  -15.844 83.180 1.00 23.63  ? 104 SER B CA  1 
ATOM   3196 C  C   . SER B 1 104 ? 32.460  -15.837 84.392 1.00 25.60  ? 104 SER B C   1 
ATOM   3197 O  O   . SER B 1 104 ? 31.332  -16.257 84.310 1.00 26.24  ? 104 SER B O   1 
ATOM   3198 C  CB  . SER B 1 104 ? 33.820  -17.283 82.845 1.00 32.74  ? 104 SER B CB  1 
ATOM   3199 O  OG  . SER B 1 104 ? 32.693  -18.152 82.732 1.00 35.56  ? 104 SER B OG  1 
ATOM   3200 N  N   . GLN B 1 105 ? 32.929  -15.388 85.505 1.00 25.66  ? 105 GLN B N   1 
ATOM   3201 C  CA  . GLN B 1 105 ? 32.173  -15.285 86.753 1.00 27.34  ? 105 GLN B CA  1 
ATOM   3202 C  C   . GLN B 1 105 ? 31.425  -13.951 86.906 1.00 25.80  ? 105 GLN B C   1 
ATOM   3203 O  O   . GLN B 1 105 ? 30.667  -13.770 87.858 1.00 25.94  ? 105 GLN B O   1 
ATOM   3204 C  CB  . GLN B 1 105 ? 33.084  -15.525 87.968 1.00 29.61  ? 105 GLN B CB  1 
ATOM   3205 C  CG  . GLN B 1 105 ? 33.592  -16.952 88.084 1.00 30.26  ? 105 GLN B CG  1 
ATOM   3206 C  CD  . GLN B 1 105 ? 34.654  -17.098 89.162 1.00 43.39  ? 105 GLN B CD  1 
ATOM   3207 O  OE1 . GLN B 1 105 ? 35.435  -16.179 89.407 1.00 44.58  ? 105 GLN B OE1 1 
ATOM   3208 N  NE2 . GLN B 1 105 ? 34.683  -18.253 89.815 1.00 38.58  ? 105 GLN B NE2 1 
ATOM   3209 N  N   . SER B 1 106 ? 31.617  -13.024 85.981 1.00 22.90  ? 106 SER B N   1 
ATOM   3210 C  CA  . SER B 1 106 ? 30.899  -11.782 86.027 1.00 20.84  ? 106 SER B CA  1 
ATOM   3211 C  C   . SER B 1 106 ? 29.385  -11.992 86.071 1.00 21.17  ? 106 SER B C   1 
ATOM   3212 O  O   . SER B 1 106 ? 28.879  -12.882 85.479 1.00 21.83  ? 106 SER B O   1 
ATOM   3213 C  CB  . SER B 1 106 ? 31.317  -10.877 84.877 1.00 23.77  ? 106 SER B CB  1 
ATOM   3214 O  OG  . SER B 1 106 ? 30.436  -9.824  84.663 1.00 22.14  ? 106 SER B OG  1 
ATOM   3215 N  N   . GLN B 1 107 ? 28.674  -11.134 86.764 1.00 23.15  ? 107 GLN B N   1 
ATOM   3216 C  CA  . GLN B 1 107 ? 27.228  -11.246 86.841 1.00 25.30  ? 107 GLN B CA  1 
ATOM   3217 C  C   . GLN B 1 107 ? 26.459  -11.014 85.524 1.00 21.29  ? 107 GLN B C   1 
ATOM   3218 O  O   . GLN B 1 107 ? 25.284  -11.220 85.444 1.00 20.53  ? 107 GLN B O   1 
ATOM   3219 C  CB  . GLN B 1 107 ? 26.678  -10.371 87.939 1.00 24.65  ? 107 GLN B CB  1 
ATOM   3220 C  CG  . GLN B 1 107 ? 27.184  -10.772 89.291 1.00 31.92  ? 107 GLN B CG  1 
ATOM   3221 C  CD  . GLN B 1 107 ? 26.756  -12.177 89.622 1.00 37.58  ? 107 GLN B CD  1 
ATOM   3222 O  OE1 . GLN B 1 107 ? 25.583  -12.515 89.532 1.00 37.07  ? 107 GLN B OE1 1 
ATOM   3223 N  NE2 . GLN B 1 107 ? 27.705  -12.999 89.986 1.00 40.94  ? 107 GLN B NE2 1 
ATOM   3224 N  N   . ILE B 1 108 ? 27.184  -10.583 84.498 1.00 17.94  ? 108 ILE B N   1 
ATOM   3225 C  CA  . ILE B 1 108 ? 26.588  -10.334 83.190 1.00 17.37  ? 108 ILE B CA  1 
ATOM   3226 C  C   . ILE B 1 108 ? 26.276  -11.641 82.466 1.00 18.93  ? 108 ILE B C   1 
ATOM   3227 O  O   . ILE B 1 108 ? 25.710  -11.635 81.373 1.00 19.37  ? 108 ILE B O   1 
ATOM   3228 C  CB  . ILE B 1 108 ? 27.510  -9.476  82.304 1.00 19.65  ? 108 ILE B CB  1 
ATOM   3229 C  CG1 . ILE B 1 108 ? 26.835  -9.177  80.964 1.00 18.75  ? 108 ILE B CG1 1 
ATOM   3230 C  CG2 . ILE B 1 108 ? 28.845  -10.174 82.090 1.00 17.11  ? 108 ILE B CG2 1 
ATOM   3231 C  CD1 . ILE B 1 108 ? 27.657  -8.296  80.049 1.00 17.40  ? 108 ILE B CD1 1 
ATOM   3232 N  N   . TRP B 1 109 ? 26.647  -12.758 83.083 1.00 16.52  ? 109 TRP B N   1 
ATOM   3233 C  CA  . TRP B 1 109 ? 26.409  -14.065 82.501 1.00 18.70  ? 109 TRP B CA  1 
ATOM   3234 C  C   . TRP B 1 109 ? 25.479  -14.877 83.354 1.00 20.78  ? 109 TRP B C   1 
ATOM   3235 O  O   . TRP B 1 109 ? 25.192  -16.055 83.049 1.00 20.85  ? 109 TRP B O   1 
ATOM   3236 C  CB  . TRP B 1 109 ? 27.724  -14.810 82.304 1.00 18.68  ? 109 TRP B CB  1 
ATOM   3237 C  CG  . TRP B 1 109 ? 28.725  -14.057 81.461 1.00 17.91  ? 109 TRP B CG  1 
ATOM   3238 C  CD1 . TRP B 1 109 ? 29.954  -13.540 81.861 1.00 21.08  ? 109 TRP B CD1 1 
ATOM   3239 C  CD2 . TRP B 1 109 ? 28.612  -13.709 80.037 1.00 16.52  ? 109 TRP B CD2 1 
ATOM   3240 N  NE1 . TRP B 1 109 ? 30.587  -12.918 80.815 1.00 19.37  ? 109 TRP B NE1 1 
ATOM   3241 C  CE2 . TRP B 1 109 ? 29.838  -12.983 79.694 1.00 16.60  ? 109 TRP B CE2 1 
ATOM   3242 C  CE3 . TRP B 1 109 ? 27.658  -13.918 79.053 1.00 14.29  ? 109 TRP B CE3 1 
ATOM   3243 C  CZ2 . TRP B 1 109 ? 30.071  -12.500 78.419 1.00 17.75  ? 109 TRP B CZ2 1 
ATOM   3244 C  CZ3 . TRP B 1 109 ? 27.906  -13.425 77.770 1.00 16.56  ? 109 TRP B CZ3 1 
ATOM   3245 C  CH2 . TRP B 1 109 ? 29.084  -12.734 77.463 1.00 17.20  ? 109 TRP B CH2 1 
ATOM   3246 N  N   . SER B 1 110 ? 24.995  -14.270 84.433 1.00 24.63  ? 110 SER B N   1 
ATOM   3247 C  CA  . SER B 1 110 ? 24.077  -14.944 85.355 1.00 28.25  ? 110 SER B CA  1 
ATOM   3248 C  C   . SER B 1 110 ? 22.861  -15.514 84.623 1.00 31.94  ? 110 SER B C   1 
ATOM   3249 O  O   . SER B 1 110 ? 22.478  -15.034 83.544 1.00 25.12  ? 110 SER B O   1 
ATOM   3250 C  CB  . SER B 1 110 ? 23.612  -13.998 86.470 1.00 32.73  ? 110 SER B CB  1 
ATOM   3251 O  OG  . SER B 1 110 ? 22.884  -12.893 85.944 1.00 38.22  ? 110 SER B OG  1 
ATOM   3252 N  N   . ALA B 1 111 ? 22.246  -16.521 85.209 1.00 25.07  ? 111 ALA B N   1 
ATOM   3253 C  CA  . ALA B 1 111 ? 21.136  -17.161 84.577 1.00 28.17  ? 111 ALA B CA  1 
ATOM   3254 C  C   . ALA B 1 111 ? 19.924  -16.261 84.480 1.00 29.40  ? 111 ALA B C   1 
ATOM   3255 O  O   . ALA B 1 111 ? 19.058  -16.530 83.720 1.00 28.54  ? 111 ALA B O   1 
ATOM   3256 C  CB  . ALA B 1 111 ? 20.801  -18.461 85.243 1.00 31.08  ? 111 ALA B CB  1 
ATOM   3257 N  N   . ASP B 1 112 ? 19.884  -15.178 85.211 1.00 32.78  ? 112 ASP B N   1 
ATOM   3258 C  CA  . ASP B 1 112 ? 18.784  -14.245 85.065 1.00 36.83  ? 112 ASP B CA  1 
ATOM   3259 C  C   . ASP B 1 112 ? 18.964  -13.175 83.981 1.00 37.23  ? 112 ASP B C   1 
ATOM   3260 O  O   . ASP B 1 112 ? 18.097  -12.394 83.728 1.00 36.02  ? 112 ASP B O   1 
ATOM   3261 C  CB  . ASP B 1 112 ? 18.492  -13.577 86.381 1.00 42.08  ? 112 ASP B CB  1 
ATOM   3262 C  CG  . ASP B 1 112 ? 19.513  -12.540 86.741 1.00 53.13  ? 112 ASP B CG  1 
ATOM   3263 O  OD1 . ASP B 1 112 ? 20.671  -12.671 86.357 1.00 49.72  ? 112 ASP B OD1 1 
ATOM   3264 O  OD2 . ASP B 1 112 ? 19.125  -11.578 87.420 1.00 57.10  ? 112 ASP B OD2 1 
ATOM   3265 N  N   . PHE B 1 113 ? 20.125  -13.153 83.373 1.00 24.42  ? 113 PHE B N   1 
ATOM   3266 C  CA  . PHE B 1 113 ? 20.447  -12.125 82.430 1.00 22.82  ? 113 PHE B CA  1 
ATOM   3267 C  C   . PHE B 1 113 ? 20.800  -12.757 81.078 1.00 21.58  ? 113 PHE B C   1 
ATOM   3268 O  O   . PHE B 1 113 ? 19.976  -13.033 80.336 1.00 20.07  ? 113 PHE B O   1 
ATOM   3269 C  CB  . PHE B 1 113 ? 21.531  -11.168 82.943 1.00 22.79  ? 113 PHE B CB  1 
ATOM   3270 C  CG  . PHE B 1 113 ? 21.534  -9.834  82.279 1.00 19.62  ? 113 PHE B CG  1 
ATOM   3271 C  CD1 . PHE B 1 113 ? 22.702  -9.267  81.838 1.00 18.62  ? 113 PHE B CD1 1 
ATOM   3272 C  CD2 . PHE B 1 113 ? 20.390  -9.144  82.135 1.00 20.01  ? 113 PHE B CD2 1 
ATOM   3273 C  CE1 . PHE B 1 113 ? 22.687  -8.041  81.225 1.00 20.64  ? 113 PHE B CE1 1 
ATOM   3274 C  CE2 . PHE B 1 113 ? 20.363  -7.920  81.519 1.00 25.77  ? 113 PHE B CE2 1 
ATOM   3275 C  CZ  . PHE B 1 113 ? 21.518  -7.361  81.054 1.00 20.61  ? 113 PHE B CZ  1 
ATOM   3276 N  N   . MET B 1 114 ? 22.043  -13.025 80.820 1.00 20.42  ? 114 MET B N   1 
ATOM   3277 C  CA  . MET B 1 114 ? 22.473  -13.327 79.460 1.00 17.71  ? 114 MET B CA  1 
ATOM   3278 C  C   . MET B 1 114 ? 22.793  -14.817 79.392 1.00 18.43  ? 114 MET B C   1 
ATOM   3279 O  O   . MET B 1 114 ? 22.980  -15.367 78.307 1.00 17.95  ? 114 MET B O   1 
ATOM   3280 C  CB  . MET B 1 114 ? 23.667  -12.512 78.957 1.00 18.13  ? 114 MET B CB  1 
ATOM   3281 C  CG  . MET B 1 114 ? 23.427  -11.011 78.929 1.00 16.71  ? 114 MET B CG  1 
ATOM   3282 S  SD  . MET B 1 114 ? 22.675  -10.455 77.387 1.00 20.35  ? 114 MET B SD  1 
ATOM   3283 C  CE  . MET B 1 114 ? 20.976  -10.224 77.903 1.00 19.35  ? 114 MET B CE  1 
ATOM   3284 N  N   . GLY B 1 115 ? 22.857  -15.468 80.549 1.00 17.47  ? 115 GLY B N   1 
ATOM   3285 C  CA  . GLY B 1 115 ? 23.165  -16.887 80.590 1.00 17.27  ? 115 GLY B CA  1 
ATOM   3286 C  C   . GLY B 1 115 ? 24.660  -17.068 80.432 1.00 18.20  ? 115 GLY B C   1 
ATOM   3287 O  O   . GLY B 1 115 ? 25.386  -16.085 80.290 1.00 15.88  ? 115 GLY B O   1 
ATOM   3288 N  N   . GLY B 1 116 ? 25.138  -18.310 80.451 1.00 17.13  ? 116 GLY B N   1 
ATOM   3289 C  CA  . GLY B 1 116 ? 26.565  -18.540 80.594 1.00 16.14  ? 116 GLY B CA  1 
ATOM   3290 C  C   . GLY B 1 116 ? 27.347  -18.908 79.353 1.00 15.53  ? 116 GLY B C   1 
ATOM   3291 O  O   . GLY B 1 116 ? 26.940  -18.628 78.217 1.00 12.89  ? 116 GLY B O   1 
ATOM   3292 N  N   . ASN B 1 117 ? 28.494  -19.532 79.607 1.00 15.12  ? 117 ASN B N   1 
ATOM   3293 C  CA  . ASN B 1 117 ? 29.421  -20.005 78.592 1.00 14.73  ? 117 ASN B CA  1 
ATOM   3294 C  C   . ASN B 1 117 ? 28.789  -21.228 77.928 1.00 14.31  ? 117 ASN B C   1 
ATOM   3295 O  O   . ASN B 1 117 ? 27.837  -21.811 78.455 1.00 16.34  ? 117 ASN B O   1 
ATOM   3296 C  CB  . ASN B 1 117 ? 30.757  -20.370 79.280 1.00 16.20  ? 117 ASN B CB  1 
ATOM   3297 C  CG  . ASN B 1 117 ? 31.942  -20.460 78.310 1.00 16.41  ? 117 ASN B CG  1 
ATOM   3298 O  OD1 . ASN B 1 117 ? 31.801  -20.262 77.103 1.00 15.11  ? 117 ASN B OD1 1 
ATOM   3299 N  ND2 . ASN B 1 117 ? 33.130  -20.731 78.855 1.00 14.59  ? 117 ASN B ND2 1 
ATOM   3300 N  N   . GLY B 1 118 ? 29.303  -21.619 76.770 1.00 15.06  ? 118 GLY B N   1 
ATOM   3301 C  CA  . GLY B 1 118 ? 28.727  -22.742 76.051 1.00 14.81  ? 118 GLY B CA  1 
ATOM   3302 C  C   . GLY B 1 118 ? 29.093  -24.068 76.701 1.00 18.72  ? 118 GLY B C   1 
ATOM   3303 O  O   . GLY B 1 118 ? 30.089  -24.154 77.416 1.00 17.70  ? 118 GLY B O   1 
ATOM   3304 N  N   . ASN B 1 119 ? 28.283  -25.091 76.450 1.00 16.02  ? 119 ASN B N   1 
ATOM   3305 C  CA  . ASN B 1 119 ? 28.501  -26.437 76.994 1.00 19.23  ? 119 ASN B CA  1 
ATOM   3306 C  C   . ASN B 1 119 ? 29.347  -27.238 76.018 1.00 17.81  ? 119 ASN B C   1 
ATOM   3307 O  O   . ASN B 1 119 ? 28.865  -27.627 74.948 1.00 18.94  ? 119 ASN B O   1 
ATOM   3308 C  CB  . ASN B 1 119 ? 27.141  -27.117 77.220 1.00 19.74  ? 119 ASN B CB  1 
ATOM   3309 C  CG  . ASN B 1 119 ? 27.251  -28.526 77.817 1.00 20.75  ? 119 ASN B CG  1 
ATOM   3310 O  OD1 . ASN B 1 119 ? 28.272  -29.197 77.702 1.00 19.33  ? 119 ASN B OD1 1 
ATOM   3311 N  ND2 . ASN B 1 119 ? 26.172  -28.978 78.434 1.00 20.37  ? 119 ASN B ND2 1 
ATOM   3312 N  N   . PRO B 1 120 ? 30.612  -27.492 76.378 1.00 20.73  ? 120 PRO B N   1 
ATOM   3313 C  CA  . PRO B 1 120 ? 31.555  -28.160 75.476 1.00 22.67  ? 120 PRO B CA  1 
ATOM   3314 C  C   . PRO B 1 120 ? 31.102  -29.564 75.042 1.00 27.72  ? 120 PRO B C   1 
ATOM   3315 O  O   . PRO B 1 120 ? 31.548  -30.042 73.999 1.00 27.41  ? 120 PRO B O   1 
ATOM   3316 C  CB  . PRO B 1 120 ? 32.855  -28.218 76.290 1.00 26.36  ? 120 PRO B CB  1 
ATOM   3317 C  CG  . PRO B 1 120 ? 32.507  -27.817 77.663 1.00 25.82  ? 120 PRO B CG  1 
ATOM   3318 C  CD  . PRO B 1 120 ? 31.244  -27.054 77.634 1.00 23.25  ? 120 PRO B CD  1 
ATOM   3319 N  N   . ILE B 1 121 ? 30.220  -30.194 75.810 1.00 25.35  ? 121 ILE B N   1 
ATOM   3320 C  CA  . ILE B 1 121 ? 29.675  -31.513 75.433 1.00 29.20  ? 121 ILE B CA  1 
ATOM   3321 C  C   . ILE B 1 121 ? 28.619  -31.380 74.317 1.00 31.74  ? 121 ILE B C   1 
ATOM   3322 O  O   . ILE B 1 121 ? 28.354  -32.322 73.572 1.00 30.67  ? 121 ILE B O   1 
ATOM   3323 C  CB  . ILE B 1 121 ? 29.111  -32.255 76.679 1.00 26.62  ? 121 ILE B CB  1 
ATOM   3324 C  CG1 . ILE B 1 121 ? 30.262  -32.755 77.548 1.00 29.32  ? 121 ILE B CG1 1 
ATOM   3325 C  CG2 . ILE B 1 121 ? 28.222  -33.444 76.294 1.00 37.29  ? 121 ILE B CG2 1 
ATOM   3326 C  CD1 . ILE B 1 121 ? 29.818  -33.623 78.712 1.00 32.57  ? 121 ILE B CD1 1 
ATOM   3327 N  N   . LYS B 1 122 ? 28.055  -30.198 74.190 1.00 29.71  ? 122 LYS B N   1 
ATOM   3328 C  CA  . LYS B 1 122 ? 27.080  -29.888 73.161 1.00 28.41  ? 122 LYS B CA  1 
ATOM   3329 C  C   . LYS B 1 122 ? 27.630  -28.954 72.121 1.00 26.50  ? 122 LYS B C   1 
ATOM   3330 O  O   . LYS B 1 122 ? 26.934  -28.187 71.557 1.00 29.17  ? 122 LYS B O   1 
ATOM   3331 C  CB  . LYS B 1 122 ? 25.905  -29.194 73.763 1.00 26.89  ? 122 LYS B CB  1 
ATOM   3332 C  CG  . LYS B 1 122 ? 24.929  -30.082 74.424 1.00 31.33  ? 122 LYS B CG  1 
ATOM   3333 C  CD  . LYS B 1 122 ? 24.246  -29.332 75.501 1.00 35.01  ? 122 LYS B CD  1 
ATOM   3334 C  CE  . LYS B 1 122 ? 22.746  -29.390 75.419 1.00 39.11  ? 122 LYS B CE  1 
ATOM   3335 N  NZ  . LYS B 1 122 ? 22.212  -29.250 76.775 1.00 38.18  ? 122 LYS B NZ  1 
ATOM   3336 N  N   . ASP B 1 123 ? 28.886  -29.079 71.772 1.00 22.31  ? 123 ASP B N   1 
ATOM   3337 C  CA  . ASP B 1 123 ? 29.221  -28.350 70.608 1.00 27.05  ? 123 ASP B CA  1 
ATOM   3338 C  C   . ASP B 1 123 ? 29.037  -26.857 70.891 1.00 23.07  ? 123 ASP B C   1 
ATOM   3339 O  O   . ASP B 1 123 ? 28.584  -26.100 70.050 1.00 21.18  ? 123 ASP B O   1 
ATOM   3340 C  CB  . ASP B 1 123 ? 28.235  -28.785 69.530 1.00 31.04  ? 123 ASP B CB  1 
ATOM   3341 C  CG  . ASP B 1 123 ? 28.659  -30.052 68.853 1.00 43.49  ? 123 ASP B CG  1 
ATOM   3342 O  OD1 . ASP B 1 123 ? 29.775  -30.504 69.076 1.00 49.99  ? 123 ASP B OD1 1 
ATOM   3343 O  OD2 . ASP B 1 123 ? 27.881  -30.572 68.099 1.00 45.30  ? 123 ASP B OD2 1 
ATOM   3344 N  N   . PHE B 1 124 ? 29.375  -26.485 72.116 1.00 20.36  ? 124 PHE B N   1 
ATOM   3345 C  CA  . PHE B 1 124 ? 29.310  -25.175 72.723 1.00 20.41  ? 124 PHE B CA  1 
ATOM   3346 C  C   . PHE B 1 124 ? 28.003  -24.422 72.741 1.00 19.17  ? 124 PHE B C   1 
ATOM   3347 O  O   . PHE B 1 124 ? 27.987  -23.239 72.774 1.00 16.63  ? 124 PHE B O   1 
ATOM   3348 C  CB  . PHE B 1 124 ? 30.463  -24.323 72.278 1.00 20.87  ? 124 PHE B CB  1 
ATOM   3349 C  CG  . PHE B 1 124 ? 31.773  -24.936 72.561 1.00 21.96  ? 124 PHE B CG  1 
ATOM   3350 C  CD1 . PHE B 1 124 ? 32.416  -25.708 71.611 1.00 26.44  ? 124 PHE B CD1 1 
ATOM   3351 C  CD2 . PHE B 1 124 ? 32.369  -24.748 73.777 1.00 20.03  ? 124 PHE B CD2 1 
ATOM   3352 C  CE1 . PHE B 1 124 ? 33.641  -26.277 71.890 1.00 28.15  ? 124 PHE B CE1 1 
ATOM   3353 C  CE2 . PHE B 1 124 ? 33.591  -25.295 74.034 1.00 24.29  ? 124 PHE B CE2 1 
ATOM   3354 C  CZ  . PHE B 1 124 ? 34.204  -26.076 73.108 1.00 24.80  ? 124 PHE B CZ  1 
ATOM   3355 N  N   . ILE B 1 125 ? 26.922  -25.168 72.816 1.00 21.92  ? 125 ILE B N   1 
ATOM   3356 C  CA  . ILE B 1 125 ? 25.596  -24.564 72.851 1.00 20.66  ? 125 ILE B CA  1 
ATOM   3357 C  C   . ILE B 1 125 ? 25.267  -24.042 74.246 1.00 21.30  ? 125 ILE B C   1 
ATOM   3358 O  O   . ILE B 1 125 ? 25.436  -24.749 75.239 1.00 20.38  ? 125 ILE B O   1 
ATOM   3359 C  CB  . ILE B 1 125 ? 24.508  -25.564 72.418 1.00 22.67  ? 125 ILE B CB  1 
ATOM   3360 C  CG1 . ILE B 1 125 ? 24.508  -25.725 70.896 1.00 23.02  ? 125 ILE B CG1 1 
ATOM   3361 C  CG2 . ILE B 1 125 ? 23.142  -25.112 72.911 1.00 22.28  ? 125 ILE B CG2 1 
ATOM   3362 C  CD1 . ILE B 1 125 ? 23.650  -24.709 70.175 1.00 24.76  ? 125 ILE B CD1 1 
ATOM   3363 N  N   . VAL B 1 126 ? 24.798  -22.800 74.312 1.00 17.99  ? 126 VAL B N   1 
ATOM   3364 C  CA  . VAL B 1 126 ? 24.452  -22.184 75.578 1.00 21.00  ? 126 VAL B CA  1 
ATOM   3365 C  C   . VAL B 1 126 ? 23.184  -22.843 76.085 1.00 21.64  ? 126 VAL B C   1 
ATOM   3366 O  O   . VAL B 1 126 ? 22.164  -22.799 75.417 1.00 20.57  ? 126 VAL B O   1 
ATOM   3367 C  CB  . VAL B 1 126 ? 24.203  -20.671 75.411 1.00 16.08  ? 126 VAL B CB  1 
ATOM   3368 C  CG1 . VAL B 1 126 ? 23.703  -20.060 76.704 1.00 18.52  ? 126 VAL B CG1 1 
ATOM   3369 C  CG2 . VAL B 1 126 ? 25.474  -19.990 74.935 1.00 16.47  ? 126 VAL B CG2 1 
ATOM   3370 N  N   . ASP B 1 127 ? 23.246  -23.454 77.267 1.00 29.07  ? 127 ASP B N   1 
ATOM   3371 C  CA  . ASP B 1 127 ? 22.074  -24.132 77.809 1.00 29.60  ? 127 ASP B CA  1 
ATOM   3372 C  C   . ASP B 1 127 ? 21.636  -23.591 79.173 1.00 30.35  ? 127 ASP B C   1 
ATOM   3373 O  O   . ASP B 1 127 ? 20.880  -24.241 79.895 1.00 30.24  ? 127 ASP B O   1 
ATOM   3374 C  CB  . ASP B 1 127 ? 22.269  -25.663 77.834 1.00 33.80  ? 127 ASP B CB  1 
ATOM   3375 C  CG  . ASP B 1 127 ? 23.449  -26.095 78.685 1.00 36.28  ? 127 ASP B CG  1 
ATOM   3376 O  OD1 . ASP B 1 127 ? 24.185  -25.214 79.183 1.00 36.08  ? 127 ASP B OD1 1 
ATOM   3377 O  OD2 . ASP B 1 127 ? 23.647  -27.324 78.844 1.00 40.51  ? 127 ASP B OD2 1 
ATOM   3378 N  N   . THR B 1 128 ? 22.110  -22.397 79.515 1.00 22.75  ? 128 THR B N   1 
ATOM   3379 C  CA  . THR B 1 128 ? 21.629  -21.698 80.699 1.00 22.71  ? 128 THR B CA  1 
ATOM   3380 C  C   . THR B 1 128 ? 21.125  -20.307 80.298 1.00 24.99  ? 128 THR B C   1 
ATOM   3381 O  O   . THR B 1 128 ? 21.558  -19.749 79.281 1.00 20.35  ? 128 THR B O   1 
ATOM   3382 C  CB  . THR B 1 128 ? 22.739  -21.549 81.757 1.00 27.04  ? 128 THR B CB  1 
ATOM   3383 O  OG1 . THR B 1 128 ? 23.834  -20.801 81.209 1.00 27.02  ? 128 THR B OG1 1 
ATOM   3384 C  CG2 . THR B 1 128 ? 23.246  -22.922 82.204 1.00 28.96  ? 128 THR B CG2 1 
ATOM   3385 N  N   . GLY B 1 129 ? 20.215  -19.756 81.093 1.00 21.20  ? 129 GLY B N   1 
ATOM   3386 C  CA  . GLY B 1 129 ? 19.745  -18.396 80.878 1.00 22.32  ? 129 GLY B CA  1 
ATOM   3387 C  C   . GLY B 1 129 ? 18.577  -18.317 79.916 1.00 22.28  ? 129 GLY B C   1 
ATOM   3388 O  O   . GLY B 1 129 ? 18.139  -19.331 79.383 1.00 21.01  ? 129 GLY B O   1 
ATOM   3389 N  N   . PRO B 1 130 ? 18.071  -17.099 79.683 1.00 21.25  ? 130 PRO B N   1 
ATOM   3390 C  CA  . PRO B 1 130 ? 16.867  -16.846 78.881 1.00 22.03  ? 130 PRO B CA  1 
ATOM   3391 C  C   . PRO B 1 130 ? 17.072  -17.068 77.388 1.00 20.70  ? 130 PRO B C   1 
ATOM   3392 O  O   . PRO B 1 130 ? 16.094  -17.177 76.645 1.00 21.33  ? 130 PRO B O   1 
ATOM   3393 C  CB  . PRO B 1 130 ? 16.579  -15.358 79.132 1.00 21.59  ? 130 PRO B CB  1 
ATOM   3394 C  CG  . PRO B 1 130 ? 17.438  -14.955 80.265 1.00 22.75  ? 130 PRO B CG  1 
ATOM   3395 C  CD  . PRO B 1 130 ? 18.622  -15.866 80.257 1.00 19.69  ? 130 PRO B CD  1 
ATOM   3396 N  N   . PHE B 1 131 ? 18.328  -17.126 76.954 1.00 19.15  ? 131 PHE B N   1 
ATOM   3397 C  CA  . PHE B 1 131 ? 18.643  -17.296 75.543 1.00 17.54  ? 131 PHE B CA  1 
ATOM   3398 C  C   . PHE B 1 131 ? 19.230  -18.679 75.242 1.00 20.67  ? 131 PHE B C   1 
ATOM   3399 O  O   . PHE B 1 131 ? 19.863  -18.896 74.204 1.00 16.42  ? 131 PHE B O   1 
ATOM   3400 C  CB  . PHE B 1 131 ? 19.577  -16.172 75.098 1.00 18.54  ? 131 PHE B CB  1 
ATOM   3401 C  CG  . PHE B 1 131 ? 19.089  -14.809 75.505 1.00 18.94  ? 131 PHE B CG  1 
ATOM   3402 C  CD1 . PHE B 1 131 ? 19.796  -14.044 76.414 1.00 18.43  ? 131 PHE B CD1 1 
ATOM   3403 C  CD2 . PHE B 1 131 ? 17.888  -14.318 75.012 1.00 18.25  ? 131 PHE B CD2 1 
ATOM   3404 C  CE1 . PHE B 1 131 ? 19.331  -12.799 76.811 1.00 18.81  ? 131 PHE B CE1 1 
ATOM   3405 C  CE2 . PHE B 1 131 ? 17.418  -13.072 75.399 1.00 19.46  ? 131 PHE B CE2 1 
ATOM   3406 C  CZ  . PHE B 1 131 ? 18.136  -12.312 76.303 1.00 19.15  ? 131 PHE B CZ  1 
ATOM   3407 N  N   . ALA B 1 132 ? 19.013  -19.612 76.161 1.00 20.29  ? 132 ALA B N   1 
ATOM   3408 C  CA  . ALA B 1 132 ? 19.466  -20.985 75.981 1.00 21.80  ? 132 ALA B CA  1 
ATOM   3409 C  C   . ALA B 1 132 ? 18.742  -21.649 74.811 1.00 22.89  ? 132 ALA B C   1 
ATOM   3410 O  O   . ALA B 1 132 ? 17.614  -21.280 74.488 1.00 21.74  ? 132 ALA B O   1 
ATOM   3411 C  CB  . ALA B 1 132 ? 19.241  -21.781 77.264 1.00 22.92  ? 132 ALA B CB  1 
ATOM   3412 N  N   . ALA B 1 133 ? 19.397  -22.620 74.181 1.00 24.54  ? 133 ALA B N   1 
ATOM   3413 C  CA  . ALA B 1 133 ? 18.793  -23.382 73.082 1.00 28.32  ? 133 ALA B CA  1 
ATOM   3414 C  C   . ALA B 1 133 ? 17.435  -23.932 73.503 1.00 27.00  ? 133 ALA B C   1 
ATOM   3415 O  O   . ALA B 1 133 ? 17.281  -24.411 74.617 1.00 26.93  ? 133 ALA B O   1 
ATOM   3416 C  CB  . ALA B 1 133 ? 19.708  -24.515 72.649 1.00 29.35  ? 133 ALA B CB  1 
ATOM   3417 N  N   . GLY B 1 134 ? 16.444  -23.828 72.627 1.00 31.54  ? 134 GLY B N   1 
ATOM   3418 C  CA  . GLY B 1 134 ? 15.095  -24.234 72.986 1.00 28.81  ? 134 GLY B CA  1 
ATOM   3419 C  C   . GLY B 1 134 ? 14.236  -23.063 73.413 1.00 32.14  ? 134 GLY B C   1 
ATOM   3420 O  O   . GLY B 1 134 ? 13.012  -23.128 73.326 1.00 36.11  ? 134 GLY B O   1 
ATOM   3421 N  N   . ARG B 1 135 ? 14.873  -21.987 73.875 1.00 23.39  ? 135 ARG B N   1 
ATOM   3422 C  CA  . ARG B 1 135 ? 14.147  -20.789 74.283 1.00 23.78  ? 135 ARG B CA  1 
ATOM   3423 C  C   . ARG B 1 135 ? 14.412  -19.624 73.328 1.00 22.93  ? 135 ARG B C   1 
ATOM   3424 O  O   . ARG B 1 135 ? 13.754  -18.583 73.409 1.00 23.36  ? 135 ARG B O   1 
ATOM   3425 C  CB  . ARG B 1 135 ? 14.549  -20.377 75.704 1.00 28.18  ? 135 ARG B CB  1 
ATOM   3426 C  CG  . ARG B 1 135 ? 14.237  -21.425 76.757 1.00 34.83  ? 135 ARG B CG  1 
ATOM   3427 C  CD  . ARG B 1 135 ? 14.108  -20.806 78.135 1.00 37.06  ? 135 ARG B CD  1 
ATOM   3428 N  NE  . ARG B 1 135 ? 15.372  -20.790 78.864 1.00 40.94  ? 135 ARG B NE  1 
ATOM   3429 C  CZ  . ARG B 1 135 ? 15.869  -21.842 79.513 1.00 44.62  ? 135 ARG B CZ  1 
ATOM   3430 N  NH1 . ARG B 1 135 ? 15.213  -22.998 79.492 1.00 43.98  ? 135 ARG B NH1 1 
ATOM   3431 N  NH2 . ARG B 1 135 ? 17.024  -21.744 80.171 1.00 35.29  ? 135 ARG B NH2 1 
ATOM   3432 N  N   . TRP B 1 136 ? 15.367  -19.815 72.423 1.00 18.69  ? 136 TRP B N   1 
ATOM   3433 C  CA  . TRP B 1 136 ? 15.880  -18.742 71.571 1.00 19.19  ? 136 TRP B CA  1 
ATOM   3434 C  C   . TRP B 1 136 ? 16.480  -19.345 70.305 1.00 20.77  ? 136 TRP B C   1 
ATOM   3435 O  O   . TRP B 1 136 ? 17.446  -20.110 70.357 1.00 21.43  ? 136 TRP B O   1 
ATOM   3436 C  CB  . TRP B 1 136 ? 16.948  -17.964 72.343 1.00 15.94  ? 136 TRP B CB  1 
ATOM   3437 C  CG  . TRP B 1 136 ? 17.644  -16.813 71.632 1.00 16.93  ? 136 TRP B CG  1 
ATOM   3438 C  CD1 . TRP B 1 136 ? 18.861  -16.843 71.015 1.00 14.87  ? 136 TRP B CD1 1 
ATOM   3439 C  CD2 . TRP B 1 136 ? 17.193  -15.456 71.562 1.00 14.43  ? 136 TRP B CD2 1 
ATOM   3440 N  NE1 . TRP B 1 136 ? 19.183  -15.592 70.532 1.00 15.33  ? 136 TRP B NE1 1 
ATOM   3441 C  CE2 . TRP B 1 136 ? 18.175  -14.722 70.860 1.00 14.54  ? 136 TRP B CE2 1 
ATOM   3442 C  CE3 . TRP B 1 136 ? 16.050  -14.794 72.013 1.00 13.60  ? 136 TRP B CE3 1 
ATOM   3443 C  CZ2 . TRP B 1 136 ? 18.050  -13.360 70.609 1.00 13.11  ? 136 TRP B CZ2 1 
ATOM   3444 C  CZ3 . TRP B 1 136 ? 15.926  -13.441 71.762 1.00 13.24  ? 136 TRP B CZ3 1 
ATOM   3445 C  CH2 . TRP B 1 136 ? 16.921  -12.736 71.064 1.00 14.56  ? 136 TRP B CH2 1 
ATOM   3446 N  N   . THR B 1 137 ? 15.889  -19.050 69.172 1.00 20.12  ? 137 THR B N   1 
ATOM   3447 C  CA  . THR B 1 137 ? 16.395  -19.593 67.940 1.00 28.30  ? 137 THR B CA  1 
ATOM   3448 C  C   . THR B 1 137 ? 17.254  -18.617 67.186 1.00 25.12  ? 137 THR B C   1 
ATOM   3449 O  O   . THR B 1 137 ? 16.895  -17.487 67.054 1.00 27.78  ? 137 THR B O   1 
ATOM   3450 C  CB  . THR B 1 137 ? 15.254  -19.998 66.999 1.00 31.81  ? 137 THR B CB  1 
ATOM   3451 O  OG1 . THR B 1 137 ? 14.448  -18.844 66.742 1.00 34.71  ? 137 THR B OG1 1 
ATOM   3452 C  CG2 . THR B 1 137 ? 14.413  -21.066 67.632 1.00 32.54  ? 137 THR B CG2 1 
ATOM   3453 N  N   . THR B 1 138 ? 18.362  -19.074 66.655 1.00 21.10  ? 138 THR B N   1 
ATOM   3454 C  CA  . THR B 1 138 ? 19.244  -18.186 65.907 1.00 17.15  ? 138 THR B CA  1 
ATOM   3455 C  C   . THR B 1 138 ? 18.993  -18.360 64.413 1.00 22.79  ? 138 THR B C   1 
ATOM   3456 O  O   . THR B 1 138 ? 18.346  -19.329 63.995 1.00 23.99  ? 138 THR B O   1 
ATOM   3457 C  CB  . THR B 1 138 ? 20.729  -18.468 66.230 1.00 23.03  ? 138 THR B CB  1 
ATOM   3458 O  OG1 . THR B 1 138 ? 21.012  -19.852 65.990 1.00 23.42  ? 138 THR B OG1 1 
ATOM   3459 C  CG2 . THR B 1 138 ? 21.037  -18.137 67.695 1.00 18.87  ? 138 THR B CG2 1 
ATOM   3460 N  N   . ILE B 1 139 ? 19.480  -17.417 63.611 1.00 18.05  ? 139 ILE B N   1 
ATOM   3461 C  CA  . ILE B 1 139 ? 19.453  -17.569 62.161 1.00 18.55  ? 139 ILE B CA  1 
ATOM   3462 C  C   . ILE B 1 139 ? 20.867  -17.472 61.607 1.00 21.71  ? 139 ILE B C   1 
ATOM   3463 O  O   . ILE B 1 139 ? 21.737  -16.847 62.211 1.00 19.62  ? 139 ILE B O   1 
ATOM   3464 C  CB  . ILE B 1 139 ? 18.539  -16.531 61.459 1.00 21.84  ? 139 ILE B CB  1 
ATOM   3465 C  CG1 . ILE B 1 139 ? 19.025  -15.112 61.737 1.00 22.42  ? 139 ILE B CG1 1 
ATOM   3466 C  CG2 . ILE B 1 139 ? 17.097  -16.692 61.913 1.00 22.85  ? 139 ILE B CG2 1 
ATOM   3467 C  CD1 . ILE B 1 139 ? 18.192  -14.029 61.052 1.00 24.79  ? 139 ILE B CD1 1 
ATOM   3468 N  N   . ASP B 1 140 ? 21.124  -18.089 60.475 1.00 20.40  ? 140 ASP B N   1 
ATOM   3469 C  CA  . ASP B 1 140 ? 22.443  -18.029 59.823 1.00 22.66  ? 140 ASP B CA  1 
ATOM   3470 C  C   . ASP B 1 140 ? 22.450  -16.914 58.773 1.00 23.94  ? 140 ASP B C   1 
ATOM   3471 O  O   . ASP B 1 140 ? 21.498  -16.244 58.698 1.00 22.16  ? 140 ASP B O   1 
ATOM   3472 C  CB  . ASP B 1 140 ? 22.757  -19.365 59.176 1.00 26.99  ? 140 ASP B CB  1 
ATOM   3473 C  CG  . ASP B 1 140 ? 21.673  -19.819 58.196 1.00 29.66  ? 140 ASP B CG  1 
ATOM   3474 O  OD1 . ASP B 1 140 ? 21.544  -21.013 58.023 1.00 28.12  ? 140 ASP B OD1 1 
ATOM   3475 O  OD2 . ASP B 1 140 ? 20.964  -19.004 57.619 1.00 28.21  ? 140 ASP B OD2 1 
ATOM   3476 N  N   . GLU B 1 141 ? 23.503  -16.721 57.988 1.00 37.54  ? 141 GLU B N   1 
ATOM   3477 C  CA  . GLU B 1 141 ? 23.431  -15.731 56.870 1.00 41.89  ? 141 GLU B CA  1 
ATOM   3478 C  C   . GLU B 1 141 ? 22.539  -16.020 55.604 1.00 46.76  ? 141 GLU B C   1 
ATOM   3479 O  O   . GLU B 1 141 ? 22.505  -15.237 54.674 1.00 47.72  ? 141 GLU B O   1 
ATOM   3480 C  CB  . GLU B 1 141 ? 24.812  -15.305 56.370 1.00 50.14  ? 141 GLU B CB  1 
ATOM   3481 C  CG  . GLU B 1 141 ? 26.034  -15.666 57.187 1.00 57.74  ? 141 GLU B CG  1 
ATOM   3482 C  CD  . GLU B 1 141 ? 27.279  -14.913 56.679 1.00 65.36  ? 141 GLU B CD  1 
ATOM   3483 O  OE1 . GLU B 1 141 ? 28.064  -14.471 57.509 1.00 65.43  ? 141 GLU B OE1 1 
ATOM   3484 O  OE2 . GLU B 1 141 ? 27.482  -14.743 55.453 1.00 68.18  ? 141 GLU B OE2 1 
ATOM   3485 N  N   . GLN B 1 142 ? 21.838  -17.109 55.609 1.00 33.19  ? 142 GLN B N   1 
ATOM   3486 C  CA  . GLN B 1 142 ? 20.906  -17.278 54.556 1.00 35.85  ? 142 GLN B CA  1 
ATOM   3487 C  C   . GLN B 1 142 ? 19.623  -16.814 55.118 1.00 34.18  ? 142 GLN B C   1 
ATOM   3488 O  O   . GLN B 1 142 ? 18.684  -16.665 54.404 1.00 28.82  ? 142 GLN B O   1 
ATOM   3489 C  CB  . GLN B 1 142 ? 20.831  -18.730 54.140 1.00 37.42  ? 142 GLN B CB  1 
ATOM   3490 C  CG  . GLN B 1 142 ? 21.788  -19.053 53.041 1.00 45.83  ? 142 GLN B CG  1 
ATOM   3491 C  CD  . GLN B 1 142 ? 23.092  -18.355 53.212 1.00 51.93  ? 142 GLN B CD  1 
ATOM   3492 O  OE1 . GLN B 1 142 ? 23.687  -17.878 52.261 1.00 53.47  ? 142 GLN B OE1 1 
ATOM   3493 N  NE2 . GLN B 1 142 ? 23.562  -18.317 54.419 1.00 53.20  ? 142 GLN B NE2 1 
ATOM   3494 N  N   . GLY B 1 143 ? 19.600  -16.555 56.419 1.00 22.66  ? 143 GLY B N   1 
ATOM   3495 C  CA  . GLY B 1 143 ? 18.325  -16.155 56.984 1.00 20.39  ? 143 GLY B CA  1 
ATOM   3496 C  C   . GLY B 1 143 ? 17.435  -17.285 57.463 1.00 18.76  ? 143 GLY B C   1 
ATOM   3497 O  O   . GLY B 1 143 ? 16.239  -17.086 57.682 1.00 19.64  ? 143 GLY B O   1 
ATOM   3498 N  N   . ASN B 1 144 ? 18.014  -18.469 57.634 1.00 20.47  ? 144 ASN B N   1 
ATOM   3499 C  CA  . ASN B 1 144 ? 17.254  -19.642 58.066 1.00 23.03  ? 144 ASN B CA  1 
ATOM   3500 C  C   . ASN B 1 144 ? 17.656  -20.074 59.472 1.00 23.99  ? 144 ASN B C   1 
ATOM   3501 O  O   . ASN B 1 144 ? 18.779  -19.810 59.887 1.00 23.51  ? 144 ASN B O   1 
ATOM   3502 C  CB  . ASN B 1 144 ? 17.467  -20.785 57.069 1.00 23.29  ? 144 ASN B CB  1 
ATOM   3503 C  CG  . ASN B 1 144 ? 17.017  -20.412 55.677 1.00 25.41  ? 144 ASN B CG  1 
ATOM   3504 O  OD1 . ASN B 1 144 ? 15.891  -19.944 55.492 1.00 24.83  ? 144 ASN B OD1 1 
ATOM   3505 N  ND2 . ASN B 1 144 ? 17.903  -20.568 54.701 1.00 21.63  ? 144 ASN B ND2 1 
ATOM   3506 N  N   . PRO B 1 145 ? 16.739  -20.738 60.202 1.00 23.63  ? 145 PRO B N   1 
ATOM   3507 C  CA  . PRO B 1 145 ? 17.012  -21.130 61.587 1.00 25.02  ? 145 PRO B CA  1 
ATOM   3508 C  C   . PRO B 1 145 ? 18.298  -21.943 61.680 1.00 27.62  ? 145 PRO B C   1 
ATOM   3509 O  O   . PRO B 1 145 ? 18.586  -22.725 60.778 1.00 27.05  ? 145 PRO B O   1 
ATOM   3510 C  CB  . PRO B 1 145 ? 15.800  -21.988 61.950 1.00 25.54  ? 145 PRO B CB  1 
ATOM   3511 C  CG  . PRO B 1 145 ? 14.713  -21.504 61.040 1.00 28.64  ? 145 PRO B CG  1 
ATOM   3512 C  CD  . PRO B 1 145 ? 15.409  -21.199 59.758 1.00 22.38  ? 145 PRO B CD  1 
ATOM   3513 N  N   . SER B 1 146 ? 19.071  -21.749 62.743 1.00 23.81  ? 146 SER B N   1 
ATOM   3514 C  CA  . SER B 1 146 ? 20.390  -22.361 62.793 1.00 23.96  ? 146 SER B CA  1 
ATOM   3515 C  C   . SER B 1 146 ? 20.738  -23.010 64.131 1.00 28.07  ? 146 SER B C   1 
ATOM   3516 O  O   . SER B 1 146 ? 21.908  -23.235 64.420 1.00 29.51  ? 146 SER B O   1 
ATOM   3517 C  CB  . SER B 1 146 ? 21.470  -21.360 62.386 1.00 26.84  ? 146 SER B CB  1 
ATOM   3518 O  OG  . SER B 1 146 ? 21.497  -20.261 63.285 1.00 27.29  ? 146 SER B OG  1 
ATOM   3519 N  N   . GLY B 1 147 ? 19.725  -23.299 64.942 1.00 23.28  ? 147 GLY B N   1 
ATOM   3520 C  CA  . GLY B 1 147 ? 19.886  -24.273 66.012 1.00 26.92  ? 147 GLY B CA  1 
ATOM   3521 C  C   . GLY B 1 147 ? 20.281  -23.877 67.426 1.00 32.35  ? 147 GLY B C   1 
ATOM   3522 O  O   . GLY B 1 147 ? 20.397  -24.744 68.287 1.00 37.00  ? 147 GLY B O   1 
ATOM   3523 N  N   . GLY B 1 148 ? 20.495  -22.603 67.707 1.00 27.80  ? 148 GLY B N   1 
ATOM   3524 C  CA  . GLY B 1 148 ? 20.801  -22.268 69.091 1.00 27.82  ? 148 GLY B CA  1 
ATOM   3525 C  C   . GLY B 1 148 ? 22.099  -21.520 69.294 1.00 20.20  ? 148 GLY B C   1 
ATOM   3526 O  O   . GLY B 1 148 ? 23.071  -21.694 68.555 1.00 22.44  ? 148 GLY B O   1 
ATOM   3527 N  N   . LEU B 1 149 ? 22.099  -20.668 70.307 1.00 17.02  ? 149 LEU B N   1 
ATOM   3528 C  CA  . LEU B 1 149 ? 23.233  -19.805 70.594 1.00 17.91  ? 149 LEU B CA  1 
ATOM   3529 C  C   . LEU B 1 149 ? 24.451  -20.594 71.071 1.00 15.15  ? 149 LEU B C   1 
ATOM   3530 O  O   . LEU B 1 149 ? 24.313  -21.509 71.858 1.00 15.22  ? 149 LEU B O   1 
ATOM   3531 C  CB  . LEU B 1 149 ? 22.810  -18.804 71.658 1.00 17.46  ? 149 LEU B CB  1 
ATOM   3532 C  CG  . LEU B 1 149 ? 23.778  -17.685 72.022 1.00 16.74  ? 149 LEU B CG  1 
ATOM   3533 C  CD1 . LEU B 1 149 ? 24.046  -16.829 70.813 1.00 15.60  ? 149 LEU B CD1 1 
ATOM   3534 C  CD2 . LEU B 1 149 ? 23.161  -16.873 73.139 1.00 16.88  ? 149 LEU B CD2 1 
ATOM   3535 N  N   . LYS B 1 150 ? 25.630  -20.234 70.575 1.00 17.23  ? 150 LYS B N   1 
ATOM   3536 C  CA  . LYS B 1 150 ? 26.888  -20.804 71.042 1.00 14.51  ? 150 LYS B CA  1 
ATOM   3537 C  C   . LYS B 1 150 ? 27.806  -19.718 71.598 1.00 15.44  ? 150 LYS B C   1 
ATOM   3538 O  O   . LYS B 1 150 ? 27.800  -18.582 71.128 1.00 10.84  ? 150 LYS B O   1 
ATOM   3539 C  CB  . LYS B 1 150 ? 27.606  -21.537 69.914 1.00 14.86  ? 150 LYS B CB  1 
ATOM   3540 C  CG  . LYS B 1 150 ? 26.794  -22.672 69.300 1.00 19.88  ? 150 LYS B CG  1 
ATOM   3541 C  CD  . LYS B 1 150 ? 27.594  -23.389 68.229 1.00 20.72  ? 150 LYS B CD  1 
ATOM   3542 C  CE  . LYS B 1 150 ? 26.908  -24.685 67.800 1.00 27.18  ? 150 LYS B CE  1 
ATOM   3543 N  NZ  . LYS B 1 150 ? 27.839  -25.530 66.988 1.00 32.33  ? 150 LYS B NZ  1 
ATOM   3544 N  N   . ARG B 1 151 ? 28.565  -20.067 72.630 1.00 12.99  ? 151 ARG B N   1 
ATOM   3545 C  CA  . ARG B 1 151 ? 29.592  -19.192 73.180 1.00 13.86  ? 151 ARG B CA  1 
ATOM   3546 C  C   . ARG B 1 151 ? 30.762  -20.078 73.611 1.00 14.99  ? 151 ARG B C   1 
ATOM   3547 O  O   . ARG B 1 151 ? 30.550  -21.208 74.048 1.00 15.43  ? 151 ARG B O   1 
ATOM   3548 C  CB  . ARG B 1 151 ? 29.067  -18.420 74.395 1.00 13.96  ? 151 ARG B CB  1 
ATOM   3549 C  CG  . ARG B 1 151 ? 27.992  -17.359 74.108 1.00 14.88  ? 151 ARG B CG  1 
ATOM   3550 C  CD  . ARG B 1 151 ? 27.485  -16.750 75.430 1.00 13.72  ? 151 ARG B CD  1 
ATOM   3551 N  NE  . ARG B 1 151 ? 26.399  -15.799 75.224 1.00 13.72  ? 151 ARG B NE  1 
ATOM   3552 C  CZ  . ARG B 1 151 ? 25.394  -15.634 76.075 1.00 15.23  ? 151 ARG B CZ  1 
ATOM   3553 N  NH1 . ARG B 1 151 ? 25.333  -16.360 77.193 1.00 15.11  ? 151 ARG B NH1 1 
ATOM   3554 N  NH2 . ARG B 1 151 ? 24.446  -14.757 75.809 1.00 13.83  ? 151 ARG B NH2 1 
ATOM   3555 N  N   . ASN B 1 152 ? 31.984  -19.578 73.473 1.00 14.86  ? 152 ASN B N   1 
ATOM   3556 C  CA  . ASN B 1 152 ? 33.163  -20.322 73.901 1.00 17.38  ? 152 ASN B CA  1 
ATOM   3557 C  C   . ASN B 1 152 ? 34.246  -19.361 74.400 1.00 15.73  ? 152 ASN B C   1 
ATOM   3558 O  O   . ASN B 1 152 ? 35.181  -19.049 73.674 1.00 15.91  ? 152 ASN B O   1 
ATOM   3559 C  CB  . ASN B 1 152 ? 33.682  -21.185 72.743 1.00 18.52  ? 152 ASN B CB  1 
ATOM   3560 C  CG  . ASN B 1 152 ? 34.787  -22.141 73.173 1.00 25.20  ? 152 ASN B CG  1 
ATOM   3561 O  OD1 . ASN B 1 152 ? 35.095  -22.260 74.359 1.00 20.96  ? 152 ASN B OD1 1 
ATOM   3562 N  ND2 . ASN B 1 152 ? 35.388  -22.817 72.209 1.00 23.48  ? 152 ASN B ND2 1 
ATOM   3563 N  N   . PHE B 1 153 ? 34.132  -18.925 75.652 1.00 16.54  ? 153 PHE B N   1 
ATOM   3564 C  CA  . PHE B 1 153 ? 34.940  -17.805 76.177 1.00 16.67  ? 153 PHE B CA  1 
ATOM   3565 C  C   . PHE B 1 153 ? 36.445  -18.040 76.121 1.00 21.26  ? 153 PHE B C   1 
ATOM   3566 O  O   . PHE B 1 153 ? 36.948  -19.066 76.607 1.00 18.61  ? 153 PHE B O   1 
ATOM   3567 C  CB  . PHE B 1 153 ? 34.563  -17.474 77.620 1.00 14.00  ? 153 PHE B CB  1 
ATOM   3568 C  CG  . PHE B 1 153 ? 33.145  -17.033 77.801 1.00 15.79  ? 153 PHE B CG  1 
ATOM   3569 C  CD1 . PHE B 1 153 ? 32.420  -16.505 76.736 1.00 16.85  ? 153 PHE B CD1 1 
ATOM   3570 C  CD2 . PHE B 1 153 ? 32.530  -17.147 79.037 1.00 15.68  ? 153 PHE B CD2 1 
ATOM   3571 C  CE1 . PHE B 1 153 ? 31.108  -16.100 76.904 1.00 16.52  ? 153 PHE B CE1 1 
ATOM   3572 C  CE2 . PHE B 1 153 ? 31.225  -16.748 79.221 1.00 16.73  ? 153 PHE B CE2 1 
ATOM   3573 C  CZ  . PHE B 1 153 ? 30.506  -16.223 78.147 1.00 15.18  ? 153 PHE B CZ  1 
ATOM   3574 N  N   . GLY B 1 154 ? 37.147  -17.081 75.527 1.00 15.79  ? 154 GLY B N   1 
ATOM   3575 C  CA  . GLY B 1 154 ? 38.598  -17.051 75.495 1.00 18.89  ? 154 GLY B CA  1 
ATOM   3576 C  C   . GLY B 1 154 ? 39.276  -18.278 74.924 1.00 22.93  ? 154 GLY B C   1 
ATOM   3577 O  O   . GLY B 1 154 ? 40.367  -18.655 75.362 1.00 26.19  ? 154 GLY B O   1 
ATOM   3578 N  N   . ALA B 1 155 ? 38.659  -18.885 73.922 1.00 24.62  ? 155 ALA B N   1 
ATOM   3579 C  CA  . ALA B 1 155 ? 39.139  -20.158 73.393 1.00 27.90  ? 155 ALA B CA  1 
ATOM   3580 C  C   . ALA B 1 155 ? 40.171  -20.012 72.269 1.00 31.89  ? 155 ALA B C   1 
ATOM   3581 O  O   . ALA B 1 155 ? 40.769  -20.999 71.847 1.00 31.86  ? 155 ALA B O   1 
ATOM   3582 C  CB  . ALA B 1 155 ? 37.968  -21.009 72.928 1.00 25.38  ? 155 ALA B CB  1 
ATOM   3583 N  N   . THR B 1 156 ? 40.384  -18.795 71.773 1.00 27.38  ? 156 THR B N   1 
ATOM   3584 C  CA  . THR B 1 156 ? 41.372  -18.627 70.716 1.00 27.82  ? 156 THR B CA  1 
ATOM   3585 C  C   . THR B 1 156 ? 42.706  -18.115 71.242 1.00 31.05  ? 156 THR B C   1 
ATOM   3586 O  O   . THR B 1 156 ? 42.770  -17.436 72.267 1.00 31.42  ? 156 THR B O   1 
ATOM   3587 C  CB  . THR B 1 156 ? 40.880  -17.721 69.554 1.00 33.68  ? 156 THR B CB  1 
ATOM   3588 O  OG1 . THR B 1 156 ? 41.012  -16.342 69.918 1.00 32.08  ? 156 THR B OG1 1 
ATOM   3589 C  CG2 . THR B 1 156 ? 39.431  -18.025 69.201 1.00 33.14  ? 156 THR B CG2 1 
ATOM   3590 N  N   . LYS B 1 157 ? 43.783  -18.429 70.533 1.00 31.91  ? 157 LYS B N   1 
ATOM   3591 C  CA  . LYS B 1 157 ? 45.095  -17.999 70.968 1.00 33.12  ? 157 LYS B CA  1 
ATOM   3592 C  C   . LYS B 1 157 ? 45.324  -16.506 70.761 1.00 31.83  ? 157 LYS B C   1 
ATOM   3593 O  O   . LYS B 1 157 ? 46.113  -15.915 71.469 1.00 30.68  ? 157 LYS B O   1 
ATOM   3594 C  CB  . LYS B 1 157 ? 46.208  -18.793 70.283 1.00 39.14  ? 157 LYS B CB  1 
ATOM   3595 C  CG  . LYS B 1 157 ? 46.399  -18.487 68.844 1.00 41.27  ? 157 LYS B CG  1 
ATOM   3596 C  CD  . LYS B 1 157 ? 47.338  -19.449 68.144 1.00 52.92  ? 157 LYS B CD  1 
ATOM   3597 C  CE  . LYS B 1 157 ? 48.749  -19.150 68.490 1.00 54.15  ? 157 LYS B CE  1 
ATOM   3598 N  NZ  . LYS B 1 157 ? 49.662  -19.634 67.432 1.00 61.76  ? 157 LYS B NZ  1 
ATOM   3599 N  N   . GLU B 1 158 ? 44.633  -15.911 69.784 1.00 45.59  ? 158 GLU B N   1 
ATOM   3600 C  CA  . GLU B 1 158 ? 44.834  -14.489 69.534 1.00 46.32  ? 158 GLU B CA  1 
ATOM   3601 C  C   . GLU B 1 158 ? 44.083  -13.590 70.526 1.00 43.60  ? 158 GLU B C   1 
ATOM   3602 O  O   . GLU B 1 158 ? 44.471  -12.442 70.746 1.00 43.57  ? 158 GLU B O   1 
ATOM   3603 C  CB  . GLU B 1 158 ? 44.475  -14.150 68.085 1.00 48.54  ? 158 GLU B CB  1 
ATOM   3604 C  CG  . GLU B 1 158 ? 45.398  -14.757 67.049 1.00 52.59  ? 158 GLU B CG  1 
ATOM   3605 C  CD  . GLU B 1 158 ? 44.979  -14.466 65.608 1.00 61.03  ? 158 GLU B CD  1 
ATOM   3606 O  OE1 . GLU B 1 158 ? 43.857  -13.944 65.378 1.00 56.44  ? 158 GLU B OE1 1 
ATOM   3607 O  OE2 . GLU B 1 158 ? 45.791  -14.771 64.701 1.00 60.12  ? 158 GLU B OE2 1 
ATOM   3608 N  N   . ALA B 1 159 ? 43.017  -14.113 71.125 1.00 26.05  ? 159 ALA B N   1 
ATOM   3609 C  CA  . ALA B 1 159 ? 42.238  -13.356 72.102 1.00 22.65  ? 159 ALA B CA  1 
ATOM   3610 C  C   . ALA B 1 159 ? 41.898  -14.134 73.368 1.00 21.39  ? 159 ALA B C   1 
ATOM   3611 O  O   . ALA B 1 159 ? 40.721  -14.363 73.655 1.00 22.02  ? 159 ALA B O   1 
ATOM   3612 C  CB  . ALA B 1 159 ? 40.951  -12.830 71.453 1.00 23.15  ? 159 ALA B CB  1 
ATOM   3613 N  N   . PRO B 1 160 ? 42.922  -14.523 74.149 1.00 23.17  ? 160 PRO B N   1 
ATOM   3614 C  CA  . PRO B 1 160 ? 42.669  -15.284 75.381 1.00 23.83  ? 160 PRO B CA  1 
ATOM   3615 C  C   . PRO B 1 160 ? 41.989  -14.466 76.482 1.00 24.04  ? 160 PRO B C   1 
ATOM   3616 O  O   . PRO B 1 160 ? 41.354  -15.038 77.374 1.00 20.45  ? 160 PRO B O   1 
ATOM   3617 C  CB  . PRO B 1 160 ? 44.081  -15.684 75.837 1.00 24.61  ? 160 PRO B CB  1 
ATOM   3618 C  CG  . PRO B 1 160 ? 44.978  -14.662 75.244 1.00 24.36  ? 160 PRO B CG  1 
ATOM   3619 C  CD  . PRO B 1 160 ? 44.362  -14.313 73.917 1.00 23.44  ? 160 PRO B CD  1 
ATOM   3620 N  N   . THR B 1 161 ? 42.126  -13.145 76.419 1.00 21.64  ? 161 THR B N   1 
ATOM   3621 C  CA  . THR B 1 161 ? 41.639  -12.268 77.474 1.00 20.92  ? 161 THR B CA  1 
ATOM   3622 C  C   . THR B 1 161 ? 40.854  -11.081 76.900 1.00 18.14  ? 161 THR B C   1 
ATOM   3623 O  O   . THR B 1 161 ? 41.043  -10.712 75.741 1.00 17.46  ? 161 THR B O   1 
ATOM   3624 C  CB  . THR B 1 161 ? 42.816  -11.689 78.283 1.00 24.69  ? 161 THR B CB  1 
ATOM   3625 O  OG1 . THR B 1 161 ? 43.752  -11.093 77.373 1.00 24.68  ? 161 THR B OG1 1 
ATOM   3626 C  CG2 . THR B 1 161 ? 43.528  -12.791 79.094 1.00 25.23  ? 161 THR B CG2 1 
ATOM   3627 N  N   . LEU B 1 162 ? 39.984  -10.498 77.722 1.00 16.18  ? 162 LEU B N   1 
ATOM   3628 C  CA  . LEU B 1 162 ? 39.262  -9.272  77.367 1.00 18.59  ? 162 LEU B CA  1 
ATOM   3629 C  C   . LEU B 1 162 ? 40.205  -8.059  77.409 1.00 19.53  ? 162 LEU B C   1 
ATOM   3630 O  O   . LEU B 1 162 ? 41.253  -8.113  78.060 1.00 16.06  ? 162 LEU B O   1 
ATOM   3631 C  CB  . LEU B 1 162 ? 38.083  -9.058  78.322 1.00 15.94  ? 162 LEU B CB  1 
ATOM   3632 C  CG  . LEU B 1 162 ? 36.932  -10.062 78.218 1.00 16.10  ? 162 LEU B CG  1 
ATOM   3633 C  CD1 . LEU B 1 162 ? 35.967  -9.932  79.396 1.00 13.88  ? 162 LEU B CD1 1 
ATOM   3634 C  CD2 . LEU B 1 162 ? 36.198  -9.879  76.894 1.00 15.21  ? 162 LEU B CD2 1 
ATOM   3635 N  N   . PRO B 1 163 ? 39.845  -6.965  76.702 1.00 19.72  ? 163 PRO B N   1 
ATOM   3636 C  CA  . PRO B 1 163 ? 40.650  -5.740  76.739 1.00 15.21  ? 163 PRO B CA  1 
ATOM   3637 C  C   . PRO B 1 163 ? 40.687  -5.149  78.141 1.00 17.95  ? 163 PRO B C   1 
ATOM   3638 O  O   . PRO B 1 163 ? 39.734  -5.294  78.901 1.00 18.97  ? 163 PRO B O   1 
ATOM   3639 C  CB  . PRO B 1 163 ? 39.912  -4.771  75.797 1.00 16.81  ? 163 PRO B CB  1 
ATOM   3640 C  CG  . PRO B 1 163 ? 38.820  -5.544  75.153 1.00 15.28  ? 163 PRO B CG  1 
ATOM   3641 C  CD  . PRO B 1 163 ? 38.855  -6.962  75.609 1.00 18.45  ? 163 PRO B CD  1 
ATOM   3642 N  N   . THR B 1 164 ? 41.787  -4.486  78.473 1.00 19.80  ? 164 THR B N   1 
ATOM   3643 C  CA  . THR B 1 164 ? 41.975  -3.946  79.816 1.00 20.21  ? 164 THR B CA  1 
ATOM   3644 C  C   . THR B 1 164 ? 41.643  -2.465  79.918 1.00 22.48  ? 164 THR B C   1 
ATOM   3645 O  O   . THR B 1 164 ? 41.464  -1.785  78.909 1.00 19.26  ? 164 THR B O   1 
ATOM   3646 C  CB  . THR B 1 164 ? 43.429  -4.094  80.235 1.00 26.30  ? 164 THR B CB  1 
ATOM   3647 O  OG1 . THR B 1 164 ? 44.231  -3.219  79.429 1.00 23.24  ? 164 THR B OG1 1 
ATOM   3648 C  CG2 . THR B 1 164 ? 43.888  -5.544  80.041 1.00 23.75  ? 164 THR B CG2 1 
ATOM   3649 N  N   . ARG B 1 165 ? 41.581  -1.953  81.142 0.85 18.55  ? 165 ARG B N   1 
ATOM   3650 C  CA  . ARG B 1 165 ? 41.328  -0.528  81.336 0.85 20.90  ? 165 ARG B CA  1 
ATOM   3651 C  C   . ARG B 1 165 ? 42.398  0.328   80.677 0.85 19.99  ? 165 ARG B C   1 
ATOM   3652 O  O   . ARG B 1 165 ? 42.098  1.378   80.111 0.85 18.13  ? 165 ARG B O   1 
ATOM   3653 C  CB  . ARG B 1 165 ? 41.235  -0.197  82.819 0.85 23.46  ? 165 ARG B CB  1 
ATOM   3654 C  CG  . ARG B 1 165 ? 39.926  -0.605  83.445 0.85 28.27  ? 165 ARG B CG  1 
ATOM   3655 C  CD  . ARG B 1 165 ? 40.017  -0.513  84.955 0.85 32.68  ? 165 ARG B CD  1 
ATOM   3656 N  NE  . ARG B 1 165 ? 38.763  -0.885  85.598 0.85 36.35  ? 165 ARG B NE  1 
ATOM   3657 C  CZ  . ARG B 1 165 ? 38.623  -1.035  86.909 0.85 41.05  ? 165 ARG B CZ  1 
ATOM   3658 N  NH1 . ARG B 1 165 ? 39.669  -0.867  87.709 0.85 46.13  ? 165 ARG B NH1 1 
ATOM   3659 N  NH2 . ARG B 1 165 ? 37.453  -1.389  87.424 0.85 40.55  ? 165 ARG B NH2 1 
ATOM   3660 N  N   . ASP B 1 166 ? 43.643  -0.127  80.743 1.00 25.11  ? 166 ASP B N   1 
ATOM   3661 C  CA  . ASP B 1 166 ? 44.747  0.585   80.110 1.00 26.18  ? 166 ASP B CA  1 
ATOM   3662 C  C   . ASP B 1 166 ? 44.587  0.640   78.591 1.00 25.66  ? 166 ASP B C   1 
ATOM   3663 O  O   . ASP B 1 166 ? 44.944  1.635   77.969 1.00 28.07  ? 166 ASP B O   1 
ATOM   3664 C  CB  . ASP B 1 166 ? 46.087  -0.045  80.491 1.00 30.09  ? 166 ASP B CB  1 
ATOM   3665 C  CG  . ASP B 1 166 ? 46.595  0.431   81.852 1.00 42.97  ? 166 ASP B CG  1 
ATOM   3666 O  OD1 . ASP B 1 166 ? 47.678  -0.033  82.277 1.00 49.04  ? 166 ASP B OD1 1 
ATOM   3667 O  OD2 . ASP B 1 166 ? 45.928  1.283   82.489 1.00 43.34  ? 166 ASP B OD2 1 
ATOM   3668 N  N   . ASP B 1 167 ? 44.046  -0.424  77.993 1.00 19.30  ? 167 ASP B N   1 
ATOM   3669 C  CA  . ASP B 1 167 ? 43.789  -0.439  76.552 1.00 17.19  ? 167 ASP B CA  1 
ATOM   3670 C  C   . ASP B 1 167 ? 42.810  0.682   76.195 1.00 15.65  ? 167 ASP B C   1 
ATOM   3671 O  O   . ASP B 1 167 ? 42.994  1.386   75.214 1.00 17.36  ? 167 ASP B O   1 
ATOM   3672 C  CB  . ASP B 1 167 ? 43.197  -1.794  76.099 1.00 17.18  ? 167 ASP B CB  1 
ATOM   3673 C  CG  . ASP B 1 167 ? 44.203  -2.955  76.184 1.00 23.62  ? 167 ASP B CG  1 
ATOM   3674 O  OD1 . ASP B 1 167 ? 45.428  -2.706  76.167 1.00 23.62  ? 167 ASP B OD1 1 
ATOM   3675 O  OD2 . ASP B 1 167 ? 43.763  -4.128  76.248 1.00 23.23  ? 167 ASP B OD2 1 
ATOM   3676 N  N   . VAL B 1 168 ? 41.765  0.833   76.996 1.00 14.70  ? 168 VAL B N   1 
ATOM   3677 C  CA  . VAL B 1 168 ? 40.764  1.864   76.743 1.00 14.81  ? 168 VAL B CA  1 
ATOM   3678 C  C   . VAL B 1 168 ? 41.367  3.267   76.919 1.00 19.27  ? 168 VAL B C   1 
ATOM   3679 O  O   . VAL B 1 168 ? 41.230  4.131   76.051 1.00 17.66  ? 168 VAL B O   1 
ATOM   3680 C  CB  . VAL B 1 168 ? 39.538  1.651   77.647 1.00 17.56  ? 168 VAL B CB  1 
ATOM   3681 C  CG1 . VAL B 1 168 ? 38.600  2.845   77.606 1.00 16.28  ? 168 VAL B CG1 1 
ATOM   3682 C  CG2 . VAL B 1 168 ? 38.795  0.347   77.224 1.00 13.61  ? 168 VAL B CG2 1 
ATOM   3683 N  N   . LEU B 1 169 ? 42.027  3.501   78.036 1.00 18.69  ? 169 LEU B N   1 
ATOM   3684 C  CA  . LEU B 1 169 ? 42.707  4.763   78.297 1.00 20.72  ? 169 LEU B CA  1 
ATOM   3685 C  C   . LEU B 1 169 ? 43.676  5.167   77.202 1.00 22.57  ? 169 LEU B C   1 
ATOM   3686 O  O   . LEU B 1 169 ? 43.703  6.300   76.801 1.00 23.47  ? 169 LEU B O   1 
ATOM   3687 C  CB  . LEU B 1 169 ? 43.408  4.698   79.632 1.00 23.19  ? 169 LEU B CB  1 
ATOM   3688 C  CG  . LEU B 1 169 ? 42.657  5.249   80.835 1.00 29.06  ? 169 LEU B CG  1 
ATOM   3689 C  CD1 . LEU B 1 169 ? 41.159  5.399   80.670 1.00 28.33  ? 169 LEU B CD1 1 
ATOM   3690 C  CD2 . LEU B 1 169 ? 43.017  4.525   82.132 1.00 28.23  ? 169 LEU B CD2 1 
ATOM   3691 N  N   . ASN B 1 170 ? 44.423  4.224   76.675 1.00 21.78  ? 170 ASN B N   1 
ATOM   3692 C  CA  . ASN B 1 170 ? 45.360  4.505   75.593 1.00 23.74  ? 170 ASN B CA  1 
ATOM   3693 C  C   . ASN B 1 170 ? 44.664  4.912   74.299 1.00 27.56  ? 170 ASN B C   1 
ATOM   3694 O  O   . ASN B 1 170 ? 45.158  5.775   73.578 1.00 23.75  ? 170 ASN B O   1 
ATOM   3695 C  CB  . ASN B 1 170 ? 46.274  3.308   75.327 1.00 26.67  ? 170 ASN B CB  1 
ATOM   3696 C  CG  . ASN B 1 170 ? 47.328  3.118   76.409 1.00 30.25  ? 170 ASN B CG  1 
ATOM   3697 O  OD1 . ASN B 1 170 ? 47.822  4.082   76.992 1.00 30.07  ? 170 ASN B OD1 1 
ATOM   3698 N  ND2 . ASN B 1 170 ? 47.672  1.861   76.684 1.00 31.87  ? 170 ASN B ND2 1 
ATOM   3699 N  N   . ALA B 1 171 ? 43.524  4.290   74.001 1.00 21.90  ? 171 ALA B N   1 
ATOM   3700 C  CA  . ALA B 1 171 ? 42.759  4.670   72.820 1.00 19.32  ? 171 ALA B CA  1 
ATOM   3701 C  C   . ALA B 1 171 ? 42.266  6.100   72.973 1.00 17.89  ? 171 ALA B C   1 
ATOM   3702 O  O   . ALA B 1 171 ? 42.273  6.863   72.008 1.00 15.53  ? 171 ALA B O   1 
ATOM   3703 C  CB  . ALA B 1 171 ? 41.571  3.720   72.595 1.00 19.77  ? 171 ALA B CB  1 
ATOM   3704 N  N   . LEU B 1 172 ? 41.844  6.456   74.186 1.00 16.63  ? 172 LEU B N   1 
ATOM   3705 C  CA  . LEU B 1 172 ? 41.237  7.763   74.426 1.00 19.73  ? 172 LEU B CA  1 
ATOM   3706 C  C   . LEU B 1 172 ? 42.225  8.919   74.281 1.00 22.18  ? 172 LEU B C   1 
ATOM   3707 O  O   . LEU B 1 172 ? 41.815  10.070  74.151 1.00 17.51  ? 172 LEU B O   1 
ATOM   3708 C  CB  . LEU B 1 172 ? 40.562  7.822   75.798 1.00 19.35  ? 172 LEU B CB  1 
ATOM   3709 C  CG  . LEU B 1 172 ? 39.238  7.064   75.919 1.00 19.56  ? 172 LEU B CG  1 
ATOM   3710 C  CD1 . LEU B 1 172 ? 38.796  7.007   77.369 1.00 16.37  ? 172 LEU B CD1 1 
ATOM   3711 C  CD2 . LEU B 1 172 ? 38.154  7.698   75.028 1.00 14.55  ? 172 LEU B CD2 1 
ATOM   3712 N  N   . LYS B 1 173 ? 43.516  8.603   74.286 1.00 21.94  ? 173 LYS B N   1 
ATOM   3713 C  CA  . LYS B 1 173 ? 44.570  9.612   74.118 1.00 25.51  ? 173 LYS B CA  1 
ATOM   3714 C  C   . LYS B 1 173 ? 44.778  10.037  72.672 1.00 23.84  ? 173 LYS B C   1 
ATOM   3715 O  O   . LYS B 1 173 ? 45.420  11.049  72.404 1.00 20.61  ? 173 LYS B O   1 
ATOM   3716 C  CB  . LYS B 1 173 ? 45.903  9.076   74.634 1.00 24.02  ? 173 LYS B CB  1 
ATOM   3717 C  CG  . LYS B 1 173 ? 45.956  8.815   76.113 1.00 30.04  ? 173 LYS B CG  1 
ATOM   3718 C  CD  . LYS B 1 173 ? 47.262  8.121   76.454 1.00 31.25  ? 173 LYS B CD  1 
ATOM   3719 C  CE  . LYS B 1 173 ? 47.326  7.765   77.926 1.00 38.74  ? 173 LYS B CE  1 
ATOM   3720 N  NZ  . LYS B 1 173 ? 48.452  6.832   78.190 1.00 41.40  ? 173 LYS B NZ  1 
ATOM   3721 N  N   . ILE B 1 174 ? 44.268  9.243   71.739 1.00 17.78  ? 174 ILE B N   1 
ATOM   3722 C  CA  . ILE B 1 174 ? 44.470  9.491   70.315 1.00 19.79  ? 174 ILE B CA  1 
ATOM   3723 C  C   . ILE B 1 174 ? 43.724  10.755  69.888 1.00 21.03  ? 174 ILE B C   1 
ATOM   3724 O  O   . ILE B 1 174 ? 42.562  10.955  70.252 1.00 18.99  ? 174 ILE B O   1 
ATOM   3725 C  CB  . ILE B 1 174 ? 43.996  8.285   69.474 1.00 16.29  ? 174 ILE B CB  1 
ATOM   3726 C  CG1 . ILE B 1 174 ? 44.743  7.033   69.915 1.00 22.47  ? 174 ILE B CG1 1 
ATOM   3727 C  CG2 . ILE B 1 174 ? 44.231  8.529   67.996 1.00 18.79  ? 174 ILE B CG2 1 
ATOM   3728 C  CD1 . ILE B 1 174 ? 46.176  7.013   69.453 1.00 28.90  ? 174 ILE B CD1 1 
ATOM   3729 N  N   . THR B 1 175 ? 44.379  11.604  69.124 1.00 22.65  ? 175 THR B N   1 
ATOM   3730 C  CA  . THR B 1 175 ? 43.832  12.899  68.807 1.00 23.65  ? 175 THR B CA  1 
ATOM   3731 C  C   . THR B 1 175 ? 42.957  12.934  67.557 1.00 23.99  ? 175 THR B C   1 
ATOM   3732 O  O   . THR B 1 175 ? 42.070  13.692  67.501 1.00 28.28  ? 175 THR B O   1 
ATOM   3733 C  CB  . THR B 1 175 ? 44.912  14.018  68.771 1.00 28.15  ? 175 THR B CB  1 
ATOM   3734 O  OG1 . THR B 1 175 ? 45.766  13.838  67.689 1.00 32.36  ? 175 THR B OG1 1 
ATOM   3735 C  CG2 . THR B 1 175 ? 45.757  13.966  69.961 1.00 32.60  ? 175 THR B CG2 1 
ATOM   3736 N  N   . GLN B 1 176 ? 43.234  12.100  66.581 1.00 20.44  ? 176 GLN B N   1 
ATOM   3737 C  CA  . GLN B 1 176 ? 42.521  12.065  65.325 1.00 24.38  ? 176 GLN B CA  1 
ATOM   3738 C  C   . GLN B 1 176 ? 41.369  11.018  65.326 1.00 20.42  ? 176 GLN B C   1 
ATOM   3739 O  O   . GLN B 1 176 ? 41.571  9.895   65.688 1.00 16.92  ? 176 GLN B O   1 
ATOM   3740 C  CB  . GLN B 1 176 ? 43.484  11.706  64.209 1.00 22.86  ? 176 GLN B CB  1 
ATOM   3741 C  CG  . GLN B 1 176 ? 44.569  12.704  63.925 1.00 29.05  ? 176 GLN B CG  1 
ATOM   3742 C  CD  . GLN B 1 176 ? 44.019  14.004  63.512 1.00 31.54  ? 176 GLN B CD  1 
ATOM   3743 O  OE1 . GLN B 1 176 ? 43.854  14.859  64.314 1.00 43.20  ? 176 GLN B OE1 1 
ATOM   3744 N  NE2 . GLN B 1 176 ? 43.694  14.140  62.276 1.00 38.79  ? 176 GLN B NE2 1 
ATOM   3745 N  N   . TYR B 1 177 ? 40.191  11.423  64.885 1.00 16.61  ? 177 TYR B N   1 
ATOM   3746 C  CA  . TYR B 1 177 ? 39.102  10.441  64.778 1.00 14.82  ? 177 TYR B CA  1 
ATOM   3747 C  C   . TYR B 1 177 ? 39.521  9.283   63.867 1.00 14.34  ? 177 TYR B C   1 
ATOM   3748 O  O   . TYR B 1 177 ? 39.403  8.114   64.220 1.00 14.69  ? 177 TYR B O   1 
ATOM   3749 C  CB  . TYR B 1 177 ? 37.810  11.068  64.241 1.00 14.75  ? 177 TYR B CB  1 
ATOM   3750 C  CG  . TYR B 1 177 ? 36.760  10.013  64.012 1.00 12.72  ? 177 TYR B CG  1 
ATOM   3751 C  CD1 . TYR B 1 177 ? 35.949  9.576   65.056 1.00 14.27  ? 177 TYR B CD1 1 
ATOM   3752 C  CD2 . TYR B 1 177 ? 36.596  9.432   62.757 1.00 15.00  ? 177 TYR B CD2 1 
ATOM   3753 C  CE1 . TYR B 1 177 ? 34.991  8.568   64.843 1.00 12.32  ? 177 TYR B CE1 1 
ATOM   3754 C  CE2 . TYR B 1 177 ? 35.645  8.437   62.533 1.00 10.69  ? 177 TYR B CE2 1 
ATOM   3755 C  CZ  . TYR B 1 177 ? 34.857  8.007   63.589 1.00 11.84  ? 177 TYR B CZ  1 
ATOM   3756 O  OH  . TYR B 1 177 ? 33.920  7.020   63.369 1.00 13.90  ? 177 TYR B OH  1 
ATOM   3757 N  N   . ASP B 1 178 ? 39.988  9.620   62.677 1.00 15.08  ? 178 ASP B N   1 
ATOM   3758 C  CA  . ASP B 1 178 ? 40.465  8.610   61.748 1.00 16.26  ? 178 ASP B CA  1 
ATOM   3759 C  C   . ASP B 1 178 ? 41.480  9.283   60.843 1.00 19.46  ? 178 ASP B C   1 
ATOM   3760 O  O   . ASP B 1 178 ? 41.615  10.510  60.853 1.00 19.19  ? 178 ASP B O   1 
ATOM   3761 C  CB  . ASP B 1 178 ? 39.304  8.044   60.925 1.00 13.09  ? 178 ASP B CB  1 
ATOM   3762 C  CG  . ASP B 1 178 ? 39.562  6.622   60.443 1.00 15.35  ? 178 ASP B CG  1 
ATOM   3763 O  OD1 . ASP B 1 178 ? 40.704  6.136   60.576 1.00 16.75  ? 178 ASP B OD1 1 
ATOM   3764 O  OD2 . ASP B 1 178 ? 38.617  5.987   59.927 1.00 15.75  ? 178 ASP B OD2 1 
ATOM   3765 N  N   . THR B 1 179 ? 42.209  8.484   60.077 1.00 18.74  ? 179 THR B N   1 
ATOM   3766 C  CA  . THR B 1 179 ? 43.245  9.007   59.200 1.00 18.54  ? 179 THR B CA  1 
ATOM   3767 C  C   . THR B 1 179 ? 43.156  8.247   57.895 1.00 20.99  ? 179 THR B C   1 
ATOM   3768 O  O   . THR B 1 179 ? 42.649  7.131   57.871 1.00 18.02  ? 179 THR B O   1 
ATOM   3769 C  CB  . THR B 1 179 ? 44.642  8.778   59.801 1.00 20.98  ? 179 THR B CB  1 
ATOM   3770 O  OG1 . THR B 1 179 ? 44.845  7.370   60.000 1.00 22.18  ? 179 THR B OG1 1 
ATOM   3771 C  CG2 . THR B 1 179 ? 44.786  9.505   61.129 1.00 22.52  ? 179 THR B CG2 1 
ATOM   3772 N  N   . PRO B 1 180 ? 43.627  8.850   56.795 1.00 22.89  ? 180 PRO B N   1 
ATOM   3773 C  CA  . PRO B 1 180 ? 43.625  8.095   55.536 1.00 23.86  ? 180 PRO B CA  1 
ATOM   3774 C  C   . PRO B 1 180 ? 44.553  6.880   55.647 1.00 23.50  ? 180 PRO B C   1 
ATOM   3775 O  O   . PRO B 1 180 ? 45.497  6.915   56.439 1.00 22.43  ? 180 PRO B O   1 
ATOM   3776 C  CB  . PRO B 1 180 ? 44.146  9.116   54.510 1.00 24.09  ? 180 PRO B CB  1 
ATOM   3777 C  CG  . PRO B 1 180 ? 44.795  10.197  55.318 1.00 27.92  ? 180 PRO B CG  1 
ATOM   3778 C  CD  . PRO B 1 180 ? 44.065  10.248  56.617 1.00 25.32  ? 180 PRO B CD  1 
ATOM   3779 N  N   . PRO B 1 181 ? 44.285  5.806   54.891 1.00 21.84  ? 181 PRO B N   1 
ATOM   3780 C  CA  . PRO B 1 181 ? 43.246  5.595   53.875 1.00 20.79  ? 181 PRO B CA  1 
ATOM   3781 C  C   . PRO B 1 181 ? 41.911  5.070   54.424 1.00 20.76  ? 181 PRO B C   1 
ATOM   3782 O  O   . PRO B 1 181 ? 41.187  4.379   53.700 1.00 20.59  ? 181 PRO B O   1 
ATOM   3783 C  CB  . PRO B 1 181 ? 43.883  4.552   52.960 1.00 23.77  ? 181 PRO B CB  1 
ATOM   3784 C  CG  . PRO B 1 181 ? 44.714  3.716   53.899 1.00 25.46  ? 181 PRO B CG  1 
ATOM   3785 C  CD  . PRO B 1 181 ? 45.183  4.640   55.008 1.00 24.79  ? 181 PRO B CD  1 
ATOM   3786 N  N   . TRP B 1 182 ? 41.594  5.398   55.672 1.00 17.61  ? 182 TRP B N   1 
ATOM   3787 C  CA  . TRP B 1 182 ? 40.269  5.122   56.246 1.00 17.71  ? 182 TRP B CA  1 
ATOM   3788 C  C   . TRP B 1 182 ? 39.952  3.632   56.258 1.00 16.36  ? 182 TRP B C   1 
ATOM   3789 O  O   . TRP B 1 182 ? 38.878  3.216   55.846 1.00 16.92  ? 182 TRP B O   1 
ATOM   3790 C  CB  . TRP B 1 182 ? 39.175  5.889   55.478 1.00 17.33  ? 182 TRP B CB  1 
ATOM   3791 C  CG  . TRP B 1 182 ? 39.618  7.250   54.999 1.00 18.16  ? 182 TRP B CG  1 
ATOM   3792 C  CD1 . TRP B 1 182 ? 39.859  7.625   53.712 1.00 19.95  ? 182 TRP B CD1 1 
ATOM   3793 C  CD2 . TRP B 1 182 ? 39.894  8.398   55.811 1.00 17.42  ? 182 TRP B CD2 1 
ATOM   3794 N  NE1 . TRP B 1 182 ? 40.258  8.942   53.669 1.00 22.23  ? 182 TRP B NE1 1 
ATOM   3795 C  CE2 . TRP B 1 182 ? 40.286  9.439   54.946 1.00 20.37  ? 182 TRP B CE2 1 
ATOM   3796 C  CE3 . TRP B 1 182 ? 39.837  8.648   57.184 1.00 17.18  ? 182 TRP B CE3 1 
ATOM   3797 C  CZ2 . TRP B 1 182 ? 40.625  10.713  55.410 1.00 20.08  ? 182 TRP B CZ2 1 
ATOM   3798 C  CZ3 . TRP B 1 182 ? 40.176  9.921   57.648 1.00 19.15  ? 182 TRP B CZ3 1 
ATOM   3799 C  CH2 . TRP B 1 182 ? 40.557  10.936  56.761 1.00 20.32  ? 182 TRP B CH2 1 
ATOM   3800 N  N   . ASP B 1 183 ? 40.893  2.821   56.729 1.00 15.50  ? 183 ASP B N   1 
ATOM   3801 C  CA  . ASP B 1 183 ? 40.693  1.376   56.712 1.00 15.12  ? 183 ASP B CA  1 
ATOM   3802 C  C   . ASP B 1 183 ? 41.506  0.716   57.811 1.00 16.11  ? 183 ASP B C   1 
ATOM   3803 O  O   . ASP B 1 183 ? 41.979  1.393   58.710 1.00 14.49  ? 183 ASP B O   1 
ATOM   3804 C  CB  . ASP B 1 183 ? 41.010  0.790   55.331 1.00 18.42  ? 183 ASP B CB  1 
ATOM   3805 C  CG  . ASP B 1 183 ? 42.482  0.908   54.948 1.00 20.97  ? 183 ASP B CG  1 
ATOM   3806 O  OD1 . ASP B 1 183 ? 42.797  0.626   53.774 1.00 24.81  ? 183 ASP B OD1 1 
ATOM   3807 O  OD2 . ASP B 1 183 ? 43.330  1.275   55.795 1.00 20.16  ? 183 ASP B OD2 1 
ATOM   3808 N  N   . MET B 1 184 ? 41.653  -0.615  57.727 1.00 19.90  ? 184 MET B N   1 
ATOM   3809 C  CA  . MET B 1 184 ? 42.399  -1.277  58.781 1.00 20.41  ? 184 MET B CA  1 
ATOM   3810 C  C   . MET B 1 184 ? 43.871  -0.880  58.875 1.00 19.79  ? 184 MET B C   1 
ATOM   3811 O  O   . MET B 1 184 ? 44.495  -1.164  59.845 1.00 21.61  ? 184 MET B O   1 
ATOM   3812 C  CB  . MET B 1 184 ? 42.351  -2.777  58.608 1.00 24.74  ? 184 MET B CB  1 
ATOM   3813 C  CG  . MET B 1 184 ? 41.019  -3.412  58.796 1.00 26.32  ? 184 MET B CG  1 
ATOM   3814 S  SD  . MET B 1 184 ? 40.991  -5.203  58.671 1.00 38.32  ? 184 MET B SD  1 
ATOM   3815 C  CE  . MET B 1 184 ? 42.706  -5.498  58.448 1.00 35.15  ? 184 MET B CE  1 
ATOM   3816 N  N   . THR B 1 185 ? 44.415  -0.264  57.926 1.00 18.43  ? 185 THR B N   1 
ATOM   3817 C  CA  . THR B 1 185 ? 45.818  0.157   57.974 1.00 21.01  ? 185 THR B CA  1 
ATOM   3818 C  C   . THR B 1 185 ? 46.020  1.551   58.579 1.00 22.94  ? 185 THR B C   1 
ATOM   3819 O  O   . THR B 1 185 ? 47.161  1.981   58.769 1.00 23.75  ? 185 THR B O   1 
ATOM   3820 C  CB  . THR B 1 185 ? 46.484  0.112   56.580 1.00 22.82  ? 185 THR B CB  1 
ATOM   3821 O  OG1 . THR B 1 185 ? 45.966  1.169   55.756 1.00 21.30  ? 185 THR B OG1 1 
ATOM   3822 C  CG2 . THR B 1 185 ? 46.230  -1.230  55.913 1.00 24.42  ? 185 THR B CG2 1 
ATOM   3823 N  N   . SER B 1 186 ? 44.924  2.254   58.876 1.00 19.03  ? 186 SER B N   1 
ATOM   3824 C  CA  . SER B 1 186 ? 45.002  3.610   59.420 1.00 19.07  ? 186 SER B CA  1 
ATOM   3825 C  C   . SER B 1 186 ? 45.799  3.627   60.717 1.00 20.65  ? 186 SER B C   1 
ATOM   3826 O  O   . SER B 1 186 ? 45.589  2.780   61.583 1.00 18.81  ? 186 SER B O   1 
ATOM   3827 C  CB  . SER B 1 186 ? 43.599  4.180   59.661 1.00 17.91  ? 186 SER B CB  1 
ATOM   3828 O  OG  . SER B 1 186 ? 42.887  4.327   58.437 1.00 17.93  ? 186 SER B OG  1 
ATOM   3829 N  N   . GLN B 1 187 ? 46.694  4.587   60.869 1.00 28.69  ? 187 GLN B N   1 
ATOM   3830 C  CA  . GLN B 1 187 ? 47.440  4.628   62.098 1.00 28.97  ? 187 GLN B CA  1 
ATOM   3831 C  C   . GLN B 1 187 ? 47.134  5.969   62.799 1.00 29.99  ? 187 GLN B C   1 
ATOM   3832 O  O   . GLN B 1 187 ? 46.566  6.856   62.191 1.00 28.24  ? 187 GLN B O   1 
ATOM   3833 C  CB  . GLN B 1 187 ? 48.914  4.322   61.791 1.00 34.45  ? 187 GLN B CB  1 
ATOM   3834 C  CG  . GLN B 1 187 ? 49.043  3.222   60.725 1.00 32.98  ? 187 GLN B CG  1 
ATOM   3835 C  CD  . GLN B 1 187 ? 49.317  1.868   61.314 1.00 43.58  ? 187 GLN B CD  1 
ATOM   3836 O  OE1 . GLN B 1 187 ? 50.450  1.542   61.557 1.00 45.58  ? 187 GLN B OE1 1 
ATOM   3837 N  NE2 . GLN B 1 187 ? 48.272  1.079   61.559 1.00 39.60  ? 187 GLN B NE2 1 
ATOM   3838 N  N   . ASN B 1 188 ? 47.429  6.069   64.093 1.00 23.61  ? 188 ASN B N   1 
ATOM   3839 C  CA  . ASN B 1 188 ? 47.110  7.215   64.878 1.00 26.50  ? 188 ASN B CA  1 
ATOM   3840 C  C   . ASN B 1 188 ? 45.612  7.589   64.716 1.00 24.66  ? 188 ASN B C   1 
ATOM   3841 O  O   . ASN B 1 188 ? 45.290  8.713   64.649 1.00 21.55  ? 188 ASN B O   1 
ATOM   3842 C  CB  . ASN B 1 188 ? 48.012  8.392   64.509 1.00 25.80  ? 188 ASN B CB  1 
ATOM   3843 C  CG  . ASN B 1 188 ? 49.481  8.061   64.684 1.00 36.97  ? 188 ASN B CG  1 
ATOM   3844 O  OD1 . ASN B 1 188 ? 50.224  8.017   63.734 1.00 40.40  ? 188 ASN B OD1 1 
ATOM   3845 N  ND2 . ASN B 1 188 ? 49.867  7.793   65.892 1.00 37.86  ? 188 ASN B ND2 1 
ATOM   3846 N  N   . SER B 1 189 ? 44.767  6.576   64.643 1.00 20.04  ? 189 SER B N   1 
ATOM   3847 C  CA  . SER B 1 189 ? 43.335  6.723   64.423 1.00 17.96  ? 189 SER B CA  1 
ATOM   3848 C  C   . SER B 1 189 ? 42.548  6.200   65.618 1.00 15.49  ? 189 SER B C   1 
ATOM   3849 O  O   . SER B 1 189 ? 42.679  5.024   65.985 1.00 15.68  ? 189 SER B O   1 
ATOM   3850 C  CB  . SER B 1 189 ? 42.941  5.952   63.146 1.00 18.35  ? 189 SER B CB  1 
ATOM   3851 O  OG  . SER B 1 189 ? 41.553  5.650   63.096 1.00 16.54  ? 189 SER B OG  1 
ATOM   3852 N  N   . PHE B 1 190 ? 41.727  7.055   66.227 1.00 13.01  ? 190 PHE B N   1 
ATOM   3853 C  CA  . PHE B 1 190 ? 40.886  6.594   67.326 1.00 13.81  ? 190 PHE B CA  1 
ATOM   3854 C  C   . PHE B 1 190 ? 39.974  5.469   66.856 1.00 11.36  ? 190 PHE B C   1 
ATOM   3855 O  O   . PHE B 1 190 ? 39.804  4.475   67.547 1.00 12.48  ? 190 PHE B O   1 
ATOM   3856 C  CB  . PHE B 1 190 ? 40.012  7.707   67.879 1.00 12.53  ? 190 PHE B CB  1 
ATOM   3857 C  CG  . PHE B 1 190 ? 39.053  7.244   68.927 1.00 13.76  ? 190 PHE B CG  1 
ATOM   3858 C  CD1 . PHE B 1 190 ? 39.522  6.816   70.171 1.00 12.37  ? 190 PHE B CD1 1 
ATOM   3859 C  CD2 . PHE B 1 190 ? 37.687  7.206   68.674 1.00 11.91  ? 190 PHE B CD2 1 
ATOM   3860 C  CE1 . PHE B 1 190 ? 38.645  6.368   71.147 1.00 13.97  ? 190 PHE B CE1 1 
ATOM   3861 C  CE2 . PHE B 1 190 ? 36.797  6.764   69.650 1.00 13.35  ? 190 PHE B CE2 1 
ATOM   3862 C  CZ  . PHE B 1 190 ? 37.280  6.343   70.894 1.00 14.45  ? 190 PHE B CZ  1 
ATOM   3863 N  N   . ARG B 1 191 ? 39.383  5.656   65.682 1.00 10.92  ? 191 ARG B N   1 
ATOM   3864 C  CA  . ARG B 1 191 ? 38.424  4.695   65.135 1.00 11.13  ? 191 ARG B CA  1 
ATOM   3865 C  C   . ARG B 1 191 ? 39.075  3.325   64.961 1.00 12.69  ? 191 ARG B C   1 
ATOM   3866 O  O   . ARG B 1 191 ? 38.534  2.305   65.393 1.00 11.17  ? 191 ARG B O   1 
ATOM   3867 C  CB  . ARG B 1 191 ? 37.866  5.209   63.795 1.00 11.48  ? 191 ARG B CB  1 
ATOM   3868 C  CG  . ARG B 1 191 ? 36.674  4.382   63.210 1.00 11.70  ? 191 ARG B CG  1 
ATOM   3869 C  CD  . ARG B 1 191 ? 37.124  3.155   62.431 1.00 13.70  ? 191 ARG B CD  1 
ATOM   3870 N  NE  . ARG B 1 191 ? 38.140  3.508   61.450 1.00 12.86  ? 191 ARG B NE  1 
ATOM   3871 C  CZ  . ARG B 1 191 ? 38.991  2.647   60.918 1.00 13.38  ? 191 ARG B CZ  1 
ATOM   3872 N  NH1 . ARG B 1 191 ? 38.922  1.364   61.240 1.00 12.40  ? 191 ARG B NH1 1 
ATOM   3873 N  NH2 . ARG B 1 191 ? 39.901  3.075   60.052 1.00 15.19  ? 191 ARG B NH2 1 
ATOM   3874 N  N   . ASN B 1 192 ? 40.226  3.300   64.303 1.00 10.59  ? 192 ASN B N   1 
ATOM   3875 C  CA  . ASN B 1 192 ? 40.875  2.029   64.018 1.00 11.48  ? 192 ASN B CA  1 
ATOM   3876 C  C   . ASN B 1 192 ? 41.409  1.349   65.281 1.00 11.97  ? 192 ASN B C   1 
ATOM   3877 O  O   . ASN B 1 192 ? 41.379  0.125   65.402 1.00 12.88  ? 192 ASN B O   1 
ATOM   3878 C  CB  . ASN B 1 192 ? 41.971  2.198   62.965 1.00 12.96  ? 192 ASN B CB  1 
ATOM   3879 C  CG  . ASN B 1 192 ? 42.291  0.895   62.248 1.00 15.81  ? 192 ASN B CG  1 
ATOM   3880 O  OD1 . ASN B 1 192 ? 41.393  0.104   61.945 1.00 14.52  ? 192 ASN B OD1 1 
ATOM   3881 N  ND2 . ASN B 1 192 ? 43.572  0.674   61.961 1.00 15.60  ? 192 ASN B ND2 1 
ATOM   3882 N  N   . GLN B 1 193 ? 41.898  2.124   66.216 1.00 15.24  ? 193 GLN B N   1 
ATOM   3883 C  CA  . GLN B 1 193 ? 42.306  1.644   67.502 1.00 15.26  ? 193 GLN B CA  1 
ATOM   3884 C  C   . GLN B 1 193 ? 41.160  0.994   68.294 1.00 15.81  ? 193 GLN B C   1 
ATOM   3885 O  O   . GLN B 1 193 ? 41.285  -0.087  68.753 1.00 16.08  ? 193 GLN B O   1 
ATOM   3886 C  CB  . GLN B 1 193 ? 42.849  2.804   68.294 1.00 17.47  ? 193 GLN B CB  1 
ATOM   3887 C  CG  . GLN B 1 193 ? 43.442  2.418   69.603 1.00 24.22  ? 193 GLN B CG  1 
ATOM   3888 C  CD  . GLN B 1 193 ? 44.701  1.718   69.371 1.00 27.43  ? 193 GLN B CD  1 
ATOM   3889 O  OE1 . GLN B 1 193 ? 44.789  0.556   69.581 1.00 36.71  ? 193 GLN B OE1 1 
ATOM   3890 N  NE2 . GLN B 1 193 ? 45.658  2.409   68.880 1.00 31.98  ? 193 GLN B NE2 1 
ATOM   3891 N  N   . LEU B 1 194 ? 40.067  1.710   68.444 1.00 12.65  ? 194 LEU B N   1 
ATOM   3892 C  CA  . LEU B 1 194 ? 38.908  1.174   69.150 1.00 13.82  ? 194 LEU B CA  1 
ATOM   3893 C  C   . LEU B 1 194 ? 38.292  -0.032  68.426 1.00 11.78  ? 194 LEU B C   1 
ATOM   3894 O  O   . LEU B 1 194 ? 37.839  -0.973  69.070 1.00 11.22  ? 194 LEU B O   1 
ATOM   3895 C  CB  . LEU B 1 194 ? 37.857  2.275   69.381 1.00 12.73  ? 194 LEU B CB  1 
ATOM   3896 C  CG  . LEU B 1 194 ? 36.579  1.873   70.111 1.00 12.89  ? 194 LEU B CG  1 
ATOM   3897 C  CD1 . LEU B 1 194 ? 36.867  1.237   71.483 1.00 16.02  ? 194 LEU B CD1 1 
ATOM   3898 C  CD2 . LEU B 1 194 ? 35.634  3.051   70.241 1.00 13.32  ? 194 LEU B CD2 1 
ATOM   3899 N  N   . GLU B 1 195 ? 38.303  -0.018  67.098 1.00 11.75  ? 195 GLU B N   1 
ATOM   3900 C  CA  . GLU B 1 195 ? 37.712  -1.125  66.347 1.00 12.47  ? 195 GLU B CA  1 
ATOM   3901 C  C   . GLU B 1 195 ? 38.593  -2.361  66.551 1.00 17.84  ? 195 GLU B C   1 
ATOM   3902 O  O   . GLU B 1 195 ? 38.103  -3.492  66.575 1.00 16.40  ? 195 GLU B O   1 
ATOM   3903 C  CB  . GLU B 1 195 ? 37.525  -0.788  64.863 1.00 14.55  ? 195 GLU B CB  1 
ATOM   3904 C  CG  . GLU B 1 195 ? 36.709  -1.878  64.110 1.00 15.25  ? 195 GLU B CG  1 
ATOM   3905 C  CD  . GLU B 1 195 ? 36.286  -1.494  62.693 1.00 18.56  ? 195 GLU B CD  1 
ATOM   3906 O  OE1 . GLU B 1 195 ? 35.501  -2.267  62.083 1.00 16.81  ? 195 GLU B OE1 1 
ATOM   3907 O  OE2 . GLU B 1 195 ? 36.724  -0.435  62.184 1.00 17.11  ? 195 GLU B OE2 1 
ATOM   3908 N  N   . GLY B 1 196 ? 39.893  -2.126  66.730 1.00 17.49  ? 196 GLY B N   1 
ATOM   3909 C  CA  . GLY B 1 196 ? 40.798  -3.160  67.205 1.00 16.95  ? 196 GLY B CA  1 
ATOM   3910 C  C   . GLY B 1 196 ? 41.822  -3.660  66.208 1.00 22.50  ? 196 GLY B C   1 
ATOM   3911 O  O   . GLY B 1 196 ? 42.334  -4.778  66.343 1.00 20.74  ? 196 GLY B O   1 
ATOM   3912 N  N   . PHE B 1 197 ? 42.141  -2.837  65.217 1.00 15.12  ? 197 PHE B N   1 
ATOM   3913 C  CA  . PHE B 1 197 ? 43.021  -3.270  64.141 1.00 19.36  ? 197 PHE B CA  1 
ATOM   3914 C  C   . PHE B 1 197 ? 44.442  -2.723  64.203 1.00 23.79  ? 197 PHE B C   1 
ATOM   3915 O  O   . PHE B 1 197 ? 45.234  -2.964  63.293 1.00 25.32  ? 197 PHE B O   1 
ATOM   3916 C  CB  . PHE B 1 197 ? 42.401  -2.955  62.775 1.00 20.19  ? 197 PHE B CB  1 
ATOM   3917 C  CG  . PHE B 1 197 ? 41.153  -3.734  62.486 1.00 20.12  ? 197 PHE B CG  1 
ATOM   3918 C  CD1 . PHE B 1 197 ? 41.212  -5.103  62.285 1.00 22.17  ? 197 PHE B CD1 1 
ATOM   3919 C  CD2 . PHE B 1 197 ? 39.923  -3.098  62.404 1.00 20.50  ? 197 PHE B CD2 1 
ATOM   3920 C  CE1 . PHE B 1 197 ? 40.069  -5.833  62.019 1.00 25.68  ? 197 PHE B CE1 1 
ATOM   3921 C  CE2 . PHE B 1 197 ? 38.770  -3.826  62.127 1.00 19.42  ? 197 PHE B CE2 1 
ATOM   3922 C  CZ  . PHE B 1 197 ? 38.847  -5.197  61.939 1.00 26.28  ? 197 PHE B CZ  1 
ATOM   3923 N  N   . ILE B 1 198 ? 44.767  -1.971  65.249 1.00 22.84  ? 198 ILE B N   1 
ATOM   3924 C  CA  . ILE B 1 198 ? 46.145  -1.535  65.432 1.00 26.90  ? 198 ILE B CA  1 
ATOM   3925 C  C   . ILE B 1 198 ? 46.835  -2.544  66.347 1.00 29.64  ? 198 ILE B C   1 
ATOM   3926 O  O   . ILE B 1 198 ? 46.495  -2.643  67.524 1.00 25.55  ? 198 ILE B O   1 
ATOM   3927 C  CB  . ILE B 1 198 ? 46.232  -0.108  65.999 1.00 29.09  ? 198 ILE B CB  1 
ATOM   3928 C  CG1 . ILE B 1 198 ? 45.618  0.892   65.007 1.00 24.67  ? 198 ILE B CG1 1 
ATOM   3929 C  CG2 . ILE B 1 198 ? 47.694  0.263   66.290 1.00 30.75  ? 198 ILE B CG2 1 
ATOM   3930 C  CD1 . ILE B 1 198 ? 45.659  2.333   65.481 1.00 25.52  ? 198 ILE B CD1 1 
ATOM   3931 N  N   . ASN B 1 199 ? 47.733  -3.308  65.751 1.00 40.75  ? 199 ASN B N   1 
ATOM   3932 C  CA  . ASN B 1 199 ? 48.350  -4.404  66.445 1.00 45.33  ? 199 ASN B CA  1 
ATOM   3933 C  C   . ASN B 1 199 ? 47.331  -5.401  67.004 1.00 41.88  ? 199 ASN B C   1 
ATOM   3934 O  O   . ASN B 1 199 ? 47.446  -5.818  68.113 1.00 42.68  ? 199 ASN B O   1 
ATOM   3935 C  CB  . ASN B 1 199 ? 49.127  -3.820  67.580 1.00 48.32  ? 199 ASN B CB  1 
ATOM   3936 C  CG  . ASN B 1 199 ? 50.536  -3.609  67.224 1.00 56.60  ? 199 ASN B CG  1 
ATOM   3937 O  OD1 . ASN B 1 199 ? 50.976  -2.483  66.989 1.00 55.51  ? 199 ASN B OD1 1 
ATOM   3938 N  ND2 . ASN B 1 199 ? 51.254  -4.695  67.133 1.00 60.94  ? 199 ASN B ND2 1 
ATOM   3939 N  N   . GLY B 1 200 ? 46.334  -5.732  66.214 1.00 32.49  ? 200 GLY B N   1 
ATOM   3940 C  CA  . GLY B 1 200 ? 45.164  -6.459  66.687 1.00 31.07  ? 200 GLY B CA  1 
ATOM   3941 C  C   . GLY B 1 200 ? 45.321  -7.961  66.880 1.00 33.17  ? 200 GLY B C   1 
ATOM   3942 O  O   . GLY B 1 200 ? 46.350  -8.537  66.525 1.00 34.90  ? 200 GLY B O   1 
ATOM   3943 N  N   . PRO B 1 201 ? 44.296  -8.591  67.443 1.00 30.05  ? 201 PRO B N   1 
ATOM   3944 C  CA  . PRO B 1 201 ? 43.057  -7.889  67.797 1.00 26.65  ? 201 PRO B CA  1 
ATOM   3945 C  C   . PRO B 1 201 ? 43.139  -7.173  69.143 1.00 26.36  ? 201 PRO B C   1 
ATOM   3946 O  O   . PRO B 1 201 ? 43.686  -7.713  70.105 1.00 26.12  ? 201 PRO B O   1 
ATOM   3947 C  CB  . PRO B 1 201 ? 42.028  -9.018  67.866 1.00 28.12  ? 201 PRO B CB  1 
ATOM   3948 C  CG  . PRO B 1 201 ? 42.825  -10.223 68.232 1.00 28.35  ? 201 PRO B CG  1 
ATOM   3949 C  CD  . PRO B 1 201 ? 44.156  -10.054 67.556 1.00 30.58  ? 201 PRO B CD  1 
ATOM   3950 N  N   . GLN B 1 202 ? 42.587  -5.965  69.198 1.00 24.93  ? 202 GLN B N   1 
ATOM   3951 C  CA  . GLN B 1 202 ? 42.531  -5.186  70.429 1.00 25.23  ? 202 GLN B CA  1 
ATOM   3952 C  C   . GLN B 1 202 ? 41.162  -4.529  70.546 1.00 24.28  ? 202 GLN B C   1 
ATOM   3953 O  O   . GLN B 1 202 ? 40.514  -4.255  69.535 1.00 20.83  ? 202 GLN B O   1 
ATOM   3954 C  CB  . GLN B 1 202 ? 43.632  -4.125  70.446 1.00 28.41  ? 202 GLN B CB  1 
ATOM   3955 C  CG  . GLN B 1 202 ? 45.021  -4.666  70.149 1.00 29.94  ? 202 GLN B CG  1 
ATOM   3956 C  CD  . GLN B 1 202 ? 45.501  -5.646  71.201 1.00 37.32  ? 202 GLN B CD  1 
ATOM   3957 O  OE1 . GLN B 1 202 ? 44.911  -5.760  72.276 1.00 29.52  ? 202 GLN B OE1 1 
ATOM   3958 N  NE2 . GLN B 1 202 ? 46.578  -6.361  70.897 1.00 36.75  ? 202 GLN B NE2 1 
ATOM   3959 N  N   . LEU B 1 203 ? 40.653  -4.392  71.760 1.00 17.92  ? 203 LEU B N   1 
ATOM   3960 C  CA  . LEU B 1 203 ? 39.403  -3.721  72.024 1.00 19.84  ? 203 LEU B CA  1 
ATOM   3961 C  C   . LEU B 1 203 ? 38.194  -4.423  71.377 1.00 17.83  ? 203 LEU B C   1 
ATOM   3962 O  O   . LEU B 1 203 ? 38.015  -5.561  71.587 1.00 17.54  ? 203 LEU B O   1 
ATOM   3963 C  CB  . LEU B 1 203 ? 39.514  -2.235  71.653 1.00 19.04  ? 203 LEU B CB  1 
ATOM   3964 C  CG  . LEU B 1 203 ? 40.403  -1.488  72.703 1.00 21.21  ? 203 LEU B CG  1 
ATOM   3965 C  CD1 . LEU B 1 203 ? 41.034  -0.227  72.189 1.00 21.60  ? 203 LEU B CD1 1 
ATOM   3966 C  CD2 . LEU B 1 203 ? 39.748  -1.279  74.038 1.00 18.80  ? 203 LEU B CD2 1 
ATOM   3967 N  N   . HIS B 1 204 ? 37.389  -3.715  70.607 1.00 16.38  ? 204 HIS B N   1 
ATOM   3968 C  CA  . HIS B 1 204 ? 36.255  -4.312  69.936 1.00 15.59  ? 204 HIS B CA  1 
ATOM   3969 C  C   . HIS B 1 204 ? 36.490  -5.687  69.309 1.00 16.17  ? 204 HIS B C   1 
ATOM   3970 O  O   . HIS B 1 204 ? 35.785  -6.633  69.593 1.00 16.12  ? 204 HIS B O   1 
ATOM   3971 C  CB  . HIS B 1 204 ? 35.698  -3.349  68.891 1.00 14.34  ? 204 HIS B CB  1 
ATOM   3972 C  CG  . HIS B 1 204 ? 34.724  -3.970  67.913 1.00 15.94  ? 204 HIS B CG  1 
ATOM   3973 N  ND1 . HIS B 1 204 ? 35.050  -4.283  66.697 1.00 15.66  ? 204 HIS B ND1 1 
ATOM   3974 C  CD2 . HIS B 1 204 ? 33.440  -4.373  68.069 1.00 15.71  ? 204 HIS B CD2 1 
ATOM   3975 C  CE1 . HIS B 1 204 ? 34.038  -4.844  66.091 1.00 17.51  ? 204 HIS B CE1 1 
ATOM   3976 N  NE2 . HIS B 1 204 ? 33.057  -4.906  66.921 1.00 17.29  ? 204 HIS B NE2 1 
ATOM   3977 N  N   . ASP B 1 205 ? 37.484  -5.784  68.463 1.00 10.17  ? 205 ASP B N   1 
ATOM   3978 C  CA  . ASP B 1 205 ? 37.634  -6.994  67.665 1.00 15.85  ? 205 ASP B CA  1 
ATOM   3979 C  C   . ASP B 1 205 ? 37.962  -8.129  68.646 1.00 17.93  ? 205 ASP B C   1 
ATOM   3980 O  O   . ASP B 1 205 ? 37.534  -9.273  68.465 1.00 16.34  ? 205 ASP B O   1 
ATOM   3981 C  CB  . ASP B 1 205 ? 38.767  -6.817  66.650 1.00 17.94  ? 205 ASP B CB  1 
ATOM   3982 C  CG  . ASP B 1 205 ? 38.830  -7.952  65.641 1.00 31.30  ? 205 ASP B CG  1 
ATOM   3983 O  OD1 . ASP B 1 205 ? 39.947  -8.438  65.357 1.00 34.03  ? 205 ASP B OD1 1 
ATOM   3984 O  OD2 . ASP B 1 205 ? 37.760  -8.353  65.129 1.00 30.42  ? 205 ASP B OD2 1 
ATOM   3985 N  N   . ARG B 1 206 ? 38.695  -7.789  69.697 1.00 16.05  ? 206 ARG B N   1 
ATOM   3986 C  CA  . ARG B 1 206 ? 39.111  -8.767  70.700 1.00 15.35  ? 206 ARG B CA  1 
ATOM   3987 C  C   . ARG B 1 206 ? 37.918  -9.286  71.508 1.00 14.44  ? 206 ARG B C   1 
ATOM   3988 O  O   . ARG B 1 206 ? 37.854  -10.465 71.871 1.00 14.77  ? 206 ARG B O   1 
ATOM   3989 C  CB  . ARG B 1 206 ? 40.170  -8.134  71.604 1.00 17.79  ? 206 ARG B CB  1 
ATOM   3990 C  CG  . ARG B 1 206 ? 40.872  -9.113  72.533 1.00 22.05  ? 206 ARG B CG  1 
ATOM   3991 C  CD  . ARG B 1 206 ? 41.887  -8.409  73.428 1.00 22.27  ? 206 ARG B CD  1 
ATOM   3992 N  NE  . ARG B 1 206 ? 42.656  -9.382  74.193 1.00 26.69  ? 206 ARG B NE  1 
ATOM   3993 C  CZ  . ARG B 1 206 ? 43.829  -9.873  73.807 1.00 26.97  ? 206 ARG B CZ  1 
ATOM   3994 N  NH1 . ARG B 1 206 ? 44.380  -9.461  72.672 1.00 24.30  ? 206 ARG B NH1 1 
ATOM   3995 N  NH2 . ARG B 1 206 ? 44.456  -10.768 74.566 1.00 25.17  ? 206 ARG B NH2 1 
ATOM   3996 N  N   . VAL B 1 207 ? 36.947  -8.420  71.771 1.00 12.05  ? 207 VAL B N   1 
ATOM   3997 C  CA  . VAL B 1 207 ? 35.773  -8.847  72.537 1.00 11.58  ? 207 VAL B CA  1 
ATOM   3998 C  C   . VAL B 1 207 ? 34.959  -9.862  71.746 1.00 13.18  ? 207 VAL B C   1 
ATOM   3999 O  O   . VAL B 1 207 ? 34.551  -10.887 72.289 1.00 12.89  ? 207 VAL B O   1 
ATOM   4000 C  CB  . VAL B 1 207 ? 34.885  -7.660  72.954 1.00 12.02  ? 207 VAL B CB  1 
ATOM   4001 C  CG1 . VAL B 1 207 ? 33.609  -8.146  73.598 1.00 12.49  ? 207 VAL B CG1 1 
ATOM   4002 C  CG2 . VAL B 1 207 ? 35.640  -6.739  73.912 1.00 12.57  ? 207 VAL B CG2 1 
ATOM   4003 N  N   . HIS B 1 208 ? 34.728  -9.581  70.462 1.00 13.55  ? 208 HIS B N   1 
ATOM   4004 C  CA  . HIS B 1 208 ? 34.073  -10.555 69.586 1.00 14.33  ? 208 HIS B CA  1 
ATOM   4005 C  C   . HIS B 1 208 ? 34.789  -11.900 69.631 1.00 15.77  ? 208 HIS B C   1 
ATOM   4006 O  O   . HIS B 1 208 ? 34.165  -12.942 69.854 1.00 15.19  ? 208 HIS B O   1 
ATOM   4007 C  CB  . HIS B 1 208 ? 34.025  -10.050 68.147 1.00 15.05  ? 208 HIS B CB  1 
ATOM   4008 C  CG  . HIS B 1 208 ? 32.865  -9.146  67.869 1.00 18.45  ? 208 HIS B CG  1 
ATOM   4009 N  ND1 . HIS B 1 208 ? 31.587  -9.622  67.675 1.00 17.57  ? 208 HIS B ND1 1 
ATOM   4010 C  CD2 . HIS B 1 208 ? 32.789  -7.800  67.758 1.00 21.81  ? 208 HIS B CD2 1 
ATOM   4011 C  CE1 . HIS B 1 208 ? 30.770  -8.604  67.457 1.00 19.30  ? 208 HIS B CE1 1 
ATOM   4012 N  NE2 . HIS B 1 208 ? 31.475  -7.491  67.495 1.00 22.04  ? 208 HIS B NE2 1 
ATOM   4013 N  N   . ARG B 1 209 ? 36.097  -11.872 69.475 1.00 11.63  ? 209 ARG B N   1 
ATOM   4014 C  CA  . ARG B 1 209 ? 36.875  -13.081 69.446 1.00 16.32  ? 209 ARG B CA  1 
ATOM   4015 C  C   . ARG B 1 209 ? 36.876  -13.817 70.773 1.00 16.09  ? 209 ARG B C   1 
ATOM   4016 O  O   . ARG B 1 209 ? 36.813  -14.993 70.809 1.00 14.39  ? 209 ARG B O   1 
ATOM   4017 C  CB  . ARG B 1 209 ? 38.281  -12.810 68.967 1.00 18.10  ? 209 ARG B CB  1 
ATOM   4018 C  CG  . ARG B 1 209 ? 38.322  -12.381 67.530 1.00 25.69  ? 209 ARG B CG  1 
ATOM   4019 C  CD  . ARG B 1 209 ? 39.725  -12.138 67.089 1.00 32.43  ? 209 ARG B CD  1 
ATOM   4020 N  NE  . ARG B 1 209 ? 39.726  -11.570 65.772 1.00 35.98  ? 209 ARG B NE  1 
ATOM   4021 C  CZ  . ARG B 1 209 ? 40.691  -11.747 64.914 1.00 43.85  ? 209 ARG B CZ  1 
ATOM   4022 N  NH1 . ARG B 1 209 ? 41.727  -12.468 65.263 1.00 45.96  ? 209 ARG B NH1 1 
ATOM   4023 N  NH2 . ARG B 1 209 ? 40.632  -11.187 63.724 1.00 45.23  ? 209 ARG B NH2 1 
ATOM   4024 N  N   . TRP B 1 210 ? 36.887  -13.064 71.846 1.00 13.92  ? 210 TRP B N   1 
ATOM   4025 C  CA  . TRP B 1 210 ? 36.859  -13.660 73.176 1.00 13.16  ? 210 TRP B CA  1 
ATOM   4026 C  C   . TRP B 1 210 ? 35.555  -14.397 73.443 1.00 15.57  ? 210 TRP B C   1 
ATOM   4027 O  O   . TRP B 1 210 ? 35.563  -15.499 73.991 1.00 15.02  ? 210 TRP B O   1 
ATOM   4028 C  CB  . TRP B 1 210 ? 37.107  -12.608 74.264 1.00 13.62  ? 210 TRP B CB  1 
ATOM   4029 C  CG  . TRP B 1 210 ? 37.242  -13.171 75.650 1.00 14.45  ? 210 TRP B CG  1 
ATOM   4030 C  CD1 . TRP B 1 210 ? 38.387  -13.607 76.248 1.00 15.28  ? 210 TRP B CD1 1 
ATOM   4031 C  CD2 . TRP B 1 210 ? 36.190  -13.358 76.610 1.00 13.21  ? 210 TRP B CD2 1 
ATOM   4032 N  NE1 . TRP B 1 210 ? 38.116  -14.052 77.524 1.00 15.71  ? 210 TRP B NE1 1 
ATOM   4033 C  CE2 . TRP B 1 210 ? 36.776  -13.907 77.769 1.00 17.38  ? 210 TRP B CE2 1 
ATOM   4034 C  CE3 . TRP B 1 210 ? 34.810  -13.119 76.597 1.00 14.22  ? 210 TRP B CE3 1 
ATOM   4035 C  CZ2 . TRP B 1 210 ? 36.030  -14.221 78.904 1.00 16.68  ? 210 TRP B CZ2 1 
ATOM   4036 C  CZ3 . TRP B 1 210 ? 34.070  -13.429 77.719 1.00 14.38  ? 210 TRP B CZ3 1 
ATOM   4037 C  CH2 . TRP B 1 210 ? 34.678  -13.982 78.858 1.00 15.39  ? 210 TRP B CH2 1 
ATOM   4038 N  N   . VAL B 1 211 ? 34.430  -13.796 73.077 1.00 12.15  ? 211 VAL B N   1 
ATOM   4039 C  CA  . VAL B 1 211 ? 33.148  -14.416 73.385 1.00 12.63  ? 211 VAL B CA  1 
ATOM   4040 C  C   . VAL B 1 211 ? 32.966  -15.729 72.616 1.00 13.67  ? 211 VAL B C   1 
ATOM   4041 O  O   . VAL B 1 211 ? 32.446  -16.703 73.152 1.00 13.83  ? 211 VAL B O   1 
ATOM   4042 C  CB  . VAL B 1 211 ? 31.964  -13.450 73.151 1.00 12.75  ? 211 VAL B CB  1 
ATOM   4043 C  CG1 . VAL B 1 211 ? 30.643  -14.181 73.336 1.00 12.65  ? 211 VAL B CG1 1 
ATOM   4044 C  CG2 . VAL B 1 211 ? 32.058  -12.259 74.130 1.00 11.03  ? 211 VAL B CG2 1 
ATOM   4045 N  N   . GLY B 1 212 ? 33.430  -15.764 71.374 1.00 15.68  ? 212 GLY B N   1 
ATOM   4046 C  CA  . GLY B 1 212 ? 33.305  -16.962 70.556 1.00 16.18  ? 212 GLY B CA  1 
ATOM   4047 C  C   . GLY B 1 212 ? 31.872  -17.226 70.119 1.00 18.41  ? 212 GLY B C   1 
ATOM   4048 O  O   . GLY B 1 212 ? 31.012  -16.350 70.237 1.00 14.81  ? 212 GLY B O   1 
ATOM   4049 N  N   . GLY B 1 213 ? 31.603  -18.435 69.620 1.00 15.47  ? 213 GLY B N   1 
ATOM   4050 C  CA  . GLY B 1 213 ? 30.300  -18.746 69.038 1.00 16.72  ? 213 GLY B CA  1 
ATOM   4051 C  C   . GLY B 1 213 ? 29.861  -17.739 67.972 1.00 14.12  ? 213 GLY B C   1 
ATOM   4052 O  O   . GLY B 1 213 ? 30.680  -17.284 67.179 1.00 14.82  ? 213 GLY B O   1 
ATOM   4053 N  N   . GLN B 1 214 ? 28.575  -17.380 67.966 1.00 14.36  ? 214 GLN B N   1 
ATOM   4054 C  CA  . GLN B 1 214 ? 28.044  -16.432 66.972 1.00 14.65  ? 214 GLN B CA  1 
ATOM   4055 C  C   . GLN B 1 214 ? 28.751  -15.077 67.046 1.00 13.65  ? 214 GLN B C   1 
ATOM   4056 O  O   . GLN B 1 214 ? 28.993  -14.439 66.019 1.00 14.15  ? 214 GLN B O   1 
ATOM   4057 C  CB  . GLN B 1 214 ? 26.525  -16.226 67.121 1.00 17.31  ? 214 GLN B CB  1 
ATOM   4058 C  CG  . GLN B 1 214 ? 25.641  -17.252 66.387 1.00 19.45  ? 214 GLN B CG  1 
ATOM   4059 C  CD  . GLN B 1 214 ? 25.392  -18.477 67.239 1.00 22.52  ? 214 GLN B CD  1 
ATOM   4060 O  OE1 . GLN B 1 214 ? 25.916  -18.582 68.343 1.00 22.25  ? 214 GLN B OE1 1 
ATOM   4061 N  NE2 . GLN B 1 214 ? 24.581  -19.404 66.738 1.00 24.79  ? 214 GLN B NE2 1 
ATOM   4062 N  N   . MET B 1 215 ? 29.089  -14.639 68.259 1.00 13.04  ? 215 MET B N   1 
ATOM   4063 C  CA  . MET B 1 215 ? 29.815  -13.380 68.430 1.00 15.01  ? 215 MET B CA  1 
ATOM   4064 C  C   . MET B 1 215 ? 31.180  -13.382 67.743 1.00 17.35  ? 215 MET B C   1 
ATOM   4065 O  O   . MET B 1 215 ? 31.706  -12.328 67.401 1.00 18.52  ? 215 MET B O   1 
ATOM   4066 C  CB  . MET B 1 215 ? 29.986  -13.047 69.914 1.00 14.63  ? 215 MET B CB  1 
ATOM   4067 C  CG  . MET B 1 215 ? 28.785  -12.381 70.521 1.00 15.93  ? 215 MET B CG  1 
ATOM   4068 S  SD  . MET B 1 215 ? 28.645  -10.611 70.044 1.00 16.18  ? 215 MET B SD  1 
ATOM   4069 C  CE  . MET B 1 215 ? 29.930  -9.861  71.044 1.00 15.25  ? 215 MET B CE  1 
ATOM   4070 N  N   . GLY B 1 216 ? 31.764  -14.565 67.563 1.00 15.28  ? 216 GLY B N   1 
ATOM   4071 C  CA  . GLY B 1 216 ? 33.055  -14.663 66.903 1.00 17.06  ? 216 GLY B CA  1 
ATOM   4072 C  C   . GLY B 1 216 ? 32.994  -14.443 65.400 1.00 21.36  ? 216 GLY B C   1 
ATOM   4073 O  O   . GLY B 1 216 ? 34.020  -14.282 64.745 1.00 24.08  ? 216 GLY B O   1 
ATOM   4074 N  N   . VAL B 1 217 ? 31.789  -14.437 64.842 1.00 20.95  ? 217 VAL B N   1 
ATOM   4075 C  CA  . VAL B 1 217 ? 31.604  -14.233 63.403 1.00 21.06  ? 217 VAL B CA  1 
ATOM   4076 C  C   . VAL B 1 217 ? 30.779  -12.965 63.206 1.00 23.19  ? 217 VAL B C   1 
ATOM   4077 O  O   . VAL B 1 217 ? 29.565  -12.962 63.450 1.00 19.95  ? 217 VAL B O   1 
ATOM   4078 C  CB  . VAL B 1 217 ? 30.857  -15.419 62.780 1.00 21.95  ? 217 VAL B CB  1 
ATOM   4079 C  CG1 . VAL B 1 217 ? 30.642  -15.190 61.291 1.00 25.19  ? 217 VAL B CG1 1 
ATOM   4080 C  CG2 . VAL B 1 217 ? 31.633  -16.718 63.027 1.00 27.03  ? 217 VAL B CG2 1 
ATOM   4081 N  N   . VAL B 1 218 ? 31.416  -11.956 62.694 1.00 26.06  ? 218 VAL B N   1 
ATOM   4082 C  CA  . VAL B 1 218 ? 30.860  -10.624 62.767 1.00 29.60  ? 218 VAL B CA  1 
ATOM   4083 C  C   . VAL B 1 218 ? 29.465  -10.497 62.168 1.00 26.88  ? 218 VAL B C   1 
ATOM   4084 O  O   . VAL B 1 218 ? 28.613  -9.951  62.766 1.00 26.62  ? 218 VAL B O   1 
ATOM   4085 C  CB  . VAL B 1 218 ? 31.864  -9.568  62.289 1.00 35.85  ? 218 VAL B CB  1 
ATOM   4086 C  CG1 . VAL B 1 218 ? 31.240  -8.213  62.297 1.00 28.61  ? 218 VAL B CG1 1 
ATOM   4087 C  CG2 . VAL B 1 218 ? 33.066  -9.603  63.222 1.00 33.78  ? 218 VAL B CG2 1 
ATOM   4088 N  N   . PRO B 1 219 ? 29.283  -11.083 61.016 1.00 32.75  ? 219 PRO B N   1 
ATOM   4089 C  CA  . PRO B 1 219 ? 28.007  -11.017 60.325 1.00 41.23  ? 219 PRO B CA  1 
ATOM   4090 C  C   . PRO B 1 219 ? 26.869  -11.524 61.188 1.00 39.46  ? 219 PRO B C   1 
ATOM   4091 O  O   . PRO B 1 219 ? 25.956  -10.762 61.308 1.00 40.71  ? 219 PRO B O   1 
ATOM   4092 C  CB  . PRO B 1 219 ? 28.183  -11.960 59.159 1.00 39.47  ? 219 PRO B CB  1 
ATOM   4093 C  CG  . PRO B 1 219 ? 29.623  -12.190 59.026 1.00 38.49  ? 219 PRO B CG  1 
ATOM   4094 C  CD  . PRO B 1 219 ? 30.351  -11.510 60.120 1.00 37.53  ? 219 PRO B CD  1 
ATOM   4095 N  N   . THR B 1 220 ? 27.001  -12.725 61.763 1.00 25.49  ? 220 THR B N   1 
ATOM   4096 C  CA  . THR B 1 220 ? 26.036  -13.431 62.618 1.00 24.35  ? 220 THR B CA  1 
ATOM   4097 C  C   . THR B 1 220 ? 26.013  -13.004 64.102 1.00 18.75  ? 220 THR B C   1 
ATOM   4098 O  O   . THR B 1 220 ? 25.187  -13.441 64.835 1.00 16.03  ? 220 THR B O   1 
ATOM   4099 C  CB  . THR B 1 220 ? 26.316  -14.956 62.586 1.00 25.80  ? 220 THR B CB  1 
ATOM   4100 O  OG1 . THR B 1 220 ? 27.429  -15.327 63.434 1.00 27.15  ? 220 THR B OG1 1 
ATOM   4101 C  CG2 . THR B 1 220 ? 26.541  -15.387 61.250 1.00 29.83  ? 220 THR B CG2 1 
ATOM   4102 N  N   . ALA B 1 221 ? 26.953  -12.168 64.484 1.00 12.87  ? 221 ALA B N   1 
ATOM   4103 C  CA  . ALA B 1 221 ? 27.112  -11.770 65.891 1.00 12.67  ? 221 ALA B CA  1 
ATOM   4104 C  C   . ALA B 1 221 ? 25.843  -11.304 66.639 1.00 11.23  ? 221 ALA B C   1 
ATOM   4105 O  O   . ALA B 1 221 ? 25.658  -11.673 67.794 1.00 9.81   ? 221 ALA B O   1 
ATOM   4106 C  CB  . ALA B 1 221 ? 28.237  -10.760 66.032 1.00 12.87  ? 221 ALA B CB  1 
ATOM   4107 N  N   . PRO B 1 222 ? 24.965  -10.497 65.992 1.00 10.50  ? 222 PRO B N   1 
ATOM   4108 C  CA  . PRO B 1 222 ? 23.782  -10.048 66.739 1.00 9.87   ? 222 PRO B CA  1 
ATOM   4109 C  C   . PRO B 1 222 ? 22.790  -11.138 67.130 1.00 11.42  ? 222 PRO B C   1 
ATOM   4110 O  O   . PRO B 1 222 ? 21.830  -10.802 67.823 1.00 12.29  ? 222 PRO B O   1 
ATOM   4111 C  CB  . PRO B 1 222 ? 23.107  -9.029  65.781 1.00 12.25  ? 222 PRO B CB  1 
ATOM   4112 C  CG  . PRO B 1 222 ? 24.211  -8.588  64.860 1.00 12.22  ? 222 PRO B CG  1 
ATOM   4113 C  CD  . PRO B 1 222 ? 25.090  -9.804  64.695 1.00 13.04  ? 222 PRO B CD  1 
ATOM   4114 N  N   . ASN B 1 223 ? 22.986  -12.385 66.702 1.00 11.25  ? 223 ASN B N   1 
ATOM   4115 C  CA  . ASN B 1 223 ? 22.210  -13.495 67.244 1.00 12.14  ? 223 ASN B CA  1 
ATOM   4116 C  C   . ASN B 1 223 ? 22.369  -13.601 68.773 1.00 13.65  ? 223 ASN B C   1 
ATOM   4117 O  O   . ASN B 1 223 ? 21.488  -14.112 69.461 1.00 15.46  ? 223 ASN B O   1 
ATOM   4118 C  CB  . ASN B 1 223 ? 22.625  -14.818 66.605 1.00 13.39  ? 223 ASN B CB  1 
ATOM   4119 C  CG  . ASN B 1 223 ? 21.920  -15.080 65.292 1.00 14.67  ? 223 ASN B CG  1 
ATOM   4120 O  OD1 . ASN B 1 223 ? 20.734  -15.408 65.267 1.00 14.24  ? 223 ASN B OD1 1 
ATOM   4121 N  ND2 . ASN B 1 223 ? 22.656  -14.966 64.198 1.00 14.60  ? 223 ASN B ND2 1 
ATOM   4122 N  N   . ASP B 1 224 ? 23.497  -13.119 69.292 1.00 14.41  ? 224 ASP B N   1 
ATOM   4123 C  CA  . ASP B 1 224 ? 23.726  -13.061 70.739 1.00 15.40  ? 224 ASP B CA  1 
ATOM   4124 C  C   . ASP B 1 224 ? 23.342  -11.665 71.260 1.00 13.25  ? 224 ASP B C   1 
ATOM   4125 O  O   . ASP B 1 224 ? 23.953  -10.687 70.877 1.00 11.14  ? 224 ASP B O   1 
ATOM   4126 C  CB  . ASP B 1 224 ? 25.207  -13.363 71.029 1.00 14.27  ? 224 ASP B CB  1 
ATOM   4127 C  CG  . ASP B 1 224 ? 25.478  -13.667 72.501 1.00 16.28  ? 224 ASP B CG  1 
ATOM   4128 O  OD1 . ASP B 1 224 ? 24.703  -13.220 73.375 1.00 15.16  ? 224 ASP B OD1 1 
ATOM   4129 O  OD2 . ASP B 1 224 ? 26.465  -14.385 72.776 1.00 15.93  ? 224 ASP B OD2 1 
ATOM   4130 N  N   . PRO B 1 225 ? 22.324  -11.577 72.138 1.00 14.55  ? 225 PRO B N   1 
ATOM   4131 C  CA  . PRO B 1 225 ? 21.927  -10.291 72.728 1.00 12.70  ? 225 PRO B CA  1 
ATOM   4132 C  C   . PRO B 1 225 ? 23.080  -9.526  73.381 1.00 13.03  ? 225 PRO B C   1 
ATOM   4133 O  O   . PRO B 1 225 ? 23.025  -8.298  73.428 1.00 14.00  ? 225 PRO B O   1 
ATOM   4134 C  CB  . PRO B 1 225 ? 20.889  -10.692 73.778 1.00 16.44  ? 225 PRO B CB  1 
ATOM   4135 C  CG  . PRO B 1 225 ? 20.292  -11.945 73.237 1.00 19.09  ? 225 PRO B CG  1 
ATOM   4136 C  CD  . PRO B 1 225 ? 21.431  -12.673 72.557 1.00 18.01  ? 225 PRO B CD  1 
ATOM   4137 N  N   . VAL B 1 226 ? 24.102  -10.206 73.886 1.00 10.94  ? 226 VAL B N   1 
ATOM   4138 C  CA  . VAL B 1 226 ? 25.269  -9.511  74.404 1.00 12.55  ? 226 VAL B CA  1 
ATOM   4139 C  C   . VAL B 1 226 ? 25.950  -8.567  73.383 1.00 11.78  ? 226 VAL B C   1 
ATOM   4140 O  O   . VAL B 1 226 ? 26.652  -7.669  73.753 1.00 10.42  ? 226 VAL B O   1 
ATOM   4141 C  CB  . VAL B 1 226 ? 26.278  -10.453 75.071 1.00 15.70  ? 226 VAL B CB  1 
ATOM   4142 C  CG1 . VAL B 1 226 ? 27.295  -10.931 74.116 1.00 12.96  ? 226 VAL B CG1 1 
ATOM   4143 C  CG2 . VAL B 1 226 ? 26.958  -9.733  76.201 1.00 17.04  ? 226 VAL B CG2 1 
ATOM   4144 N  N   . PHE B 1 227 ? 25.692  -8.808  72.099 1.00 11.65  ? 227 PHE B N   1 
ATOM   4145 C  CA  . PHE B 1 227 ? 26.195  -7.963  71.014 1.00 10.58  ? 227 PHE B CA  1 
ATOM   4146 C  C   . PHE B 1 227 ? 25.860  -6.498  71.268 1.00 10.81  ? 227 PHE B C   1 
ATOM   4147 O  O   . PHE B 1 227 ? 26.699  -5.611  71.075 1.00 8.72   ? 227 PHE B O   1 
ATOM   4148 C  CB  . PHE B 1 227 ? 25.555  -8.384  69.682 1.00 9.51   ? 227 PHE B CB  1 
ATOM   4149 C  CG  . PHE B 1 227 ? 25.941  -7.512  68.503 1.00 9.27   ? 227 PHE B CG  1 
ATOM   4150 C  CD1 . PHE B 1 227 ? 25.160  -6.424  68.123 1.00 9.83   ? 227 PHE B CD1 1 
ATOM   4151 C  CD2 . PHE B 1 227 ? 27.074  -7.796  67.773 1.00 11.16  ? 227 PHE B CD2 1 
ATOM   4152 C  CE1 . PHE B 1 227 ? 25.533  -5.633  67.047 1.00 12.49  ? 227 PHE B CE1 1 
ATOM   4153 C  CE2 . PHE B 1 227 ? 27.446  -7.037  66.701 1.00 11.42  ? 227 PHE B CE2 1 
ATOM   4154 C  CZ  . PHE B 1 227 ? 26.674  -5.940  66.324 1.00 11.14  ? 227 PHE B CZ  1 
ATOM   4155 N  N   . PHE B 1 228 ? 24.622  -6.258  71.693 1.00 9.46   ? 228 PHE B N   1 
ATOM   4156 C  CA  . PHE B 1 228 ? 24.125  -4.900  71.881 1.00 11.77  ? 228 PHE B CA  1 
ATOM   4157 C  C   . PHE B 1 228 ? 24.730  -4.284  73.138 1.00 10.95  ? 228 PHE B C   1 
ATOM   4158 O  O   . PHE B 1 228 ? 25.024  -3.092  73.175 1.00 11.30  ? 228 PHE B O   1 
ATOM   4159 C  CB  . PHE B 1 228 ? 22.590  -4.899  71.934 1.00 12.31  ? 228 PHE B CB  1 
ATOM   4160 C  CG  . PHE B 1 228 ? 21.950  -5.342  70.645 1.00 12.01  ? 228 PHE B CG  1 
ATOM   4161 C  CD1 . PHE B 1 228 ? 21.614  -4.412  69.673 1.00 15.10  ? 228 PHE B CD1 1 
ATOM   4162 C  CD2 . PHE B 1 228 ? 21.730  -6.685  70.387 1.00 11.21  ? 228 PHE B CD2 1 
ATOM   4163 C  CE1 . PHE B 1 228 ? 21.056  -4.823  68.473 1.00 14.24  ? 228 PHE B CE1 1 
ATOM   4164 C  CE2 . PHE B 1 228 ? 21.177  -7.100  69.190 1.00 13.19  ? 228 PHE B CE2 1 
ATOM   4165 C  CZ  . PHE B 1 228 ? 20.835  -6.165  68.233 1.00 13.23  ? 228 PHE B CZ  1 
ATOM   4166 N  N   . LEU B 1 229 ? 24.938  -5.109  74.159 1.00 10.34  ? 229 LEU B N   1 
ATOM   4167 C  CA  . LEU B 1 229 ? 25.594  -4.656  75.380 1.00 10.92  ? 229 LEU B CA  1 
ATOM   4168 C  C   . LEU B 1 229 ? 27.040  -4.272  75.079 1.00 12.26  ? 229 LEU B C   1 
ATOM   4169 O  O   . LEU B 1 229 ? 27.529  -3.239  75.536 1.00 11.83  ? 229 LEU B O   1 
ATOM   4170 C  CB  . LEU B 1 229 ? 25.549  -5.747  76.451 1.00 12.83  ? 229 LEU B CB  1 
ATOM   4171 C  CG  . LEU B 1 229 ? 24.162  -6.277  76.820 1.00 20.73  ? 229 LEU B CG  1 
ATOM   4172 C  CD1 . LEU B 1 229 ? 24.219  -7.080  78.110 1.00 20.16  ? 229 LEU B CD1 1 
ATOM   4173 C  CD2 . LEU B 1 229 ? 23.164  -5.135  76.939 1.00 17.12  ? 229 LEU B CD2 1 
ATOM   4174 N  N   . HIS B 1 230 ? 27.714  -5.114  74.302 1.00 10.37  ? 230 HIS B N   1 
ATOM   4175 C  CA  . HIS B 1 230 ? 29.081  -4.858  73.880 1.00 9.99   ? 230 HIS B CA  1 
ATOM   4176 C  C   . HIS B 1 230 ? 29.151  -3.543  73.116 1.00 10.75  ? 230 HIS B C   1 
ATOM   4177 O  O   . HIS B 1 230 ? 29.953  -2.654  73.446 1.00 11.71  ? 230 HIS B O   1 
ATOM   4178 C  CB  . HIS B 1 230 ? 29.591  -5.999  73.001 1.00 10.70  ? 230 HIS B CB  1 
ATOM   4179 C  CG  . HIS B 1 230 ? 30.808  -5.643  72.210 1.00 11.36  ? 230 HIS B CG  1 
ATOM   4180 N  ND1 . HIS B 1 230 ? 31.954  -5.151  72.793 1.00 11.91  ? 230 HIS B ND1 1 
ATOM   4181 C  CD2 . HIS B 1 230 ? 31.039  -5.659  70.874 1.00 12.01  ? 230 HIS B CD2 1 
ATOM   4182 C  CE1 . HIS B 1 230 ? 32.856  -4.909  71.858 1.00 12.50  ? 230 HIS B CE1 1 
ATOM   4183 N  NE2 . HIS B 1 230 ? 32.321  -5.194  70.682 1.00 13.71  ? 230 HIS B NE2 1 
ATOM   4184 N  N   . HIS B 1 231 ? 28.304  -3.400  72.097 1.00 11.04  ? 231 HIS B N   1 
ATOM   4185 C  CA  . HIS B 1 231 ? 28.335  -2.170  71.313 1.00 10.54  ? 231 HIS B CA  1 
ATOM   4186 C  C   . HIS B 1 231 ? 27.943  -0.908  72.074 1.00 12.60  ? 231 HIS B C   1 
ATOM   4187 O  O   . HIS B 1 231 ? 28.399  0.179   71.726 1.00 11.90  ? 231 HIS B O   1 
ATOM   4188 C  CB  . HIS B 1 231 ? 27.573  -2.315  69.998 1.00 11.03  ? 231 HIS B CB  1 
ATOM   4189 C  CG  . HIS B 1 231 ? 28.413  -2.885  68.907 1.00 12.62  ? 231 HIS B CG  1 
ATOM   4190 N  ND1 . HIS B 1 231 ? 29.335  -2.124  68.206 1.00 13.84  ? 231 HIS B ND1 1 
ATOM   4191 C  CD2 . HIS B 1 231 ? 28.534  -4.143  68.428 1.00 14.91  ? 231 HIS B CD2 1 
ATOM   4192 C  CE1 . HIS B 1 231 ? 29.957  -2.884  67.334 1.00 13.49  ? 231 HIS B CE1 1 
ATOM   4193 N  NE2 . HIS B 1 231 ? 29.489  -4.121  67.443 1.00 15.22  ? 231 HIS B NE2 1 
ATOM   4194 N  N   . ALA B 1 232 ? 27.092  -1.035  73.087 1.00 10.98  ? 232 ALA B N   1 
ATOM   4195 C  CA  . ALA B 1 232 ? 26.787  0.133   73.921 1.00 10.58  ? 232 ALA B CA  1 
ATOM   4196 C  C   . ALA B 1 232 ? 28.042  0.611   74.648 1.00 10.76  ? 232 ALA B C   1 
ATOM   4197 O  O   . ALA B 1 232 ? 28.249  1.819   74.823 1.00 10.46  ? 232 ALA B O   1 
ATOM   4198 C  CB  . ALA B 1 232 ? 25.649  -0.156  74.890 1.00 13.05  ? 232 ALA B CB  1 
ATOM   4199 N  N   . ASN B 1 233 ? 28.897  -0.325  75.046 1.00 10.70  ? 233 ASN B N   1 
ATOM   4200 C  CA  . ASN B 1 233 ? 30.164  0.041   75.677 1.00 11.82  ? 233 ASN B CA  1 
ATOM   4201 C  C   . ASN B 1 233 ? 31.101  0.723   74.681 1.00 12.60  ? 233 ASN B C   1 
ATOM   4202 O  O   . ASN B 1 233 ? 31.777  1.688   75.019 1.00 12.39  ? 233 ASN B O   1 
ATOM   4203 C  CB  . ASN B 1 233 ? 30.874  -1.185  76.277 1.00 10.70  ? 233 ASN B CB  1 
ATOM   4204 C  CG  . ASN B 1 233 ? 31.908  -0.793  77.327 1.00 16.58  ? 233 ASN B CG  1 
ATOM   4205 O  OD1 . ASN B 1 233 ? 31.623  0.020   78.203 1.00 17.73  ? 233 ASN B OD1 1 
ATOM   4206 N  ND2 . ASN B 1 233 ? 33.121  -1.335  77.216 1.00 14.81  ? 233 ASN B ND2 1 
ATOM   4207 N  N   . VAL B 1 234 ? 31.168  0.203   73.457 1.00 9.66   ? 234 VAL B N   1 
ATOM   4208 C  CA  . VAL B 1 234 ? 31.966  0.843   72.404 1.00 9.49   ? 234 VAL B CA  1 
ATOM   4209 C  C   . VAL B 1 234 ? 31.470  2.274   72.152 1.00 12.06  ? 234 VAL B C   1 
ATOM   4210 O  O   . VAL B 1 234 ? 32.259  3.219   72.034 1.00 10.12  ? 234 VAL B O   1 
ATOM   4211 C  CB  . VAL B 1 234 ? 31.902  0.001   71.082 1.00 10.59  ? 234 VAL B CB  1 
ATOM   4212 C  CG1 . VAL B 1 234 ? 32.482  0.753   69.908 1.00 10.73  ? 234 VAL B CG1 1 
ATOM   4213 C  CG2 . VAL B 1 234 ? 32.648  -1.322  71.271 1.00 9.41   ? 234 VAL B CG2 1 
ATOM   4214 N  N   . ASP B 1 235 ? 30.150  2.423   72.086 1.00 9.91   ? 235 ASP B N   1 
ATOM   4215 C  CA  . ASP B 1 235 ? 29.527  3.730   71.856 1.00 12.12  ? 235 ASP B CA  1 
ATOM   4216 C  C   . ASP B 1 235 ? 29.838  4.675   73.015 1.00 11.07  ? 235 ASP B C   1 
ATOM   4217 O  O   . ASP B 1 235 ? 30.118  5.857   72.806 1.00 11.58  ? 235 ASP B O   1 
ATOM   4218 C  CB  . ASP B 1 235 ? 28.013  3.568   71.712 1.00 12.42  ? 235 ASP B CB  1 
ATOM   4219 C  CG  . ASP B 1 235 ? 27.330  4.845   71.249 1.00 14.29  ? 235 ASP B CG  1 
ATOM   4220 O  OD1 . ASP B 1 235 ? 26.442  5.347   71.982 1.00 15.63  ? 235 ASP B OD1 1 
ATOM   4221 O  OD2 . ASP B 1 235 ? 27.679  5.332   70.151 1.00 13.54  ? 235 ASP B OD2 1 
ATOM   4222 N  N   . ARG B 1 236 ? 29.800  4.142   74.234 1.00 13.23  ? 236 ARG B N   1 
ATOM   4223 C  CA  . ARG B 1 236 ? 30.147  4.928   75.421 1.00 13.44  ? 236 ARG B CA  1 
ATOM   4224 C  C   . ARG B 1 236 ? 31.587  5.433   75.344 1.00 15.12  ? 236 ARG B C   1 
ATOM   4225 O  O   . ARG B 1 236 ? 31.857  6.612   75.592 1.00 14.58  ? 236 ARG B O   1 
ATOM   4226 C  CB  . ARG B 1 236 ? 29.967  4.088   76.683 1.00 15.29  ? 236 ARG B CB  1 
ATOM   4227 C  CG  . ARG B 1 236 ? 30.352  4.817   77.968 1.00 17.38  ? 236 ARG B CG  1 
ATOM   4228 C  CD  . ARG B 1 236 ? 30.165  3.915   79.165 1.00 17.10  ? 236 ARG B CD  1 
ATOM   4229 N  NE  . ARG B 1 236 ? 31.139  2.828   79.158 1.00 17.61  ? 236 ARG B NE  1 
ATOM   4230 C  CZ  . ARG B 1 236 ? 32.333  2.885   79.744 1.00 23.09  ? 236 ARG B CZ  1 
ATOM   4231 N  NH1 . ARG B 1 236 ? 32.707  3.980   80.390 1.00 27.03  ? 236 ARG B NH1 1 
ATOM   4232 N  NH2 . ARG B 1 236 ? 33.156  1.848   79.675 1.00 24.31  ? 236 ARG B NH2 1 
ATOM   4233 N  N   . ILE B 1 237 ? 32.517  4.542   75.013 1.00 12.79  ? 237 ILE B N   1 
ATOM   4234 C  CA  . ILE B 1 237 ? 33.911  4.956   74.862 1.00 12.91  ? 237 ILE B CA  1 
ATOM   4235 C  C   . ILE B 1 237 ? 34.071  6.062   73.807 1.00 14.54  ? 237 ILE B C   1 
ATOM   4236 O  O   . ILE B 1 237 ? 34.823  7.030   74.004 1.00 14.16  ? 237 ILE B O   1 
ATOM   4237 C  CB  . ILE B 1 237 ? 34.840  3.752   74.574 1.00 13.01  ? 237 ILE B CB  1 
ATOM   4238 C  CG1 . ILE B 1 237 ? 34.831  2.806   75.778 1.00 15.99  ? 237 ILE B CG1 1 
ATOM   4239 C  CG2 . ILE B 1 237 ? 36.279  4.233   74.266 1.00 14.47  ? 237 ILE B CG2 1 
ATOM   4240 C  CD1 . ILE B 1 237 ? 35.475  1.444   75.517 1.00 16.41  ? 237 ILE B CD1 1 
ATOM   4241 N  N   . TRP B 1 238 ? 33.370  5.930   72.690 1.00 11.70  ? 238 TRP B N   1 
ATOM   4242 C  CA  . TRP B 1 238 ? 33.402  6.974   71.666 1.00 11.57  ? 238 TRP B CA  1 
ATOM   4243 C  C   . TRP B 1 238 ? 32.848  8.311   72.196 1.00 12.29  ? 238 TRP B C   1 
ATOM   4244 O  O   . TRP B 1 238 ? 33.462  9.361   71.996 1.00 13.41  ? 238 TRP B O   1 
ATOM   4245 C  CB  . TRP B 1 238 ? 32.655  6.508   70.411 1.00 10.37  ? 238 TRP B CB  1 
ATOM   4246 C  CG  . TRP B 1 238 ? 32.605  7.529   69.306 1.00 11.18  ? 238 TRP B CG  1 
ATOM   4247 C  CD1 . TRP B 1 238 ? 33.519  8.509   69.038 1.00 10.07  ? 238 TRP B CD1 1 
ATOM   4248 C  CD2 . TRP B 1 238 ? 31.586  7.646   68.308 1.00 11.22  ? 238 TRP B CD2 1 
ATOM   4249 N  NE1 . TRP B 1 238 ? 33.121  9.240   67.938 1.00 13.56  ? 238 TRP B NE1 1 
ATOM   4250 C  CE2 . TRP B 1 238 ? 31.935  8.732   67.478 1.00 12.54  ? 238 TRP B CE2 1 
ATOM   4251 C  CE3 . TRP B 1 238 ? 30.402  6.942   68.046 1.00 9.46   ? 238 TRP B CE3 1 
ATOM   4252 C  CZ2 . TRP B 1 238 ? 31.149  9.124   66.405 1.00 11.95  ? 238 TRP B CZ2 1 
ATOM   4253 C  CZ3 . TRP B 1 238 ? 29.621  7.340   66.987 1.00 11.64  ? 238 TRP B CZ3 1 
ATOM   4254 C  CH2 . TRP B 1 238 ? 29.998  8.420   66.176 1.00 11.87  ? 238 TRP B CH2 1 
ATOM   4255 N  N   . ALA B 1 239 ? 31.704  8.263   72.878 1.00 11.21  ? 239 ALA B N   1 
ATOM   4256 C  CA  . ALA B 1 239 ? 31.096  9.443   73.499 1.00 13.53  ? 239 ALA B CA  1 
ATOM   4257 C  C   . ALA B 1 239 ? 32.070  10.139  74.447 1.00 15.89  ? 239 ALA B C   1 
ATOM   4258 O  O   . ALA B 1 239 ? 32.161  11.368  74.480 1.00 13.93  ? 239 ALA B O   1 
ATOM   4259 C  CB  . ALA B 1 239 ? 29.827  9.041   74.256 1.00 12.53  ? 239 ALA B CB  1 
ATOM   4260 N  N   . VAL B 1 240 ? 32.802  9.344   75.224 1.00 13.77  ? 240 VAL B N   1 
ATOM   4261 C  CA  . VAL B 1 240 ? 33.841  9.886   76.097 1.00 13.49  ? 240 VAL B CA  1 
ATOM   4262 C  C   . VAL B 1 240 ? 34.947  10.577  75.292 1.00 15.48  ? 240 VAL B C   1 
ATOM   4263 O  O   . VAL B 1 240 ? 35.369  11.699  75.619 1.00 16.47  ? 240 VAL B O   1 
ATOM   4264 C  CB  . VAL B 1 240 ? 34.422  8.774   77.018 1.00 14.35  ? 240 VAL B CB  1 
ATOM   4265 C  CG1 . VAL B 1 240 ? 35.703  9.226   77.674 1.00 17.25  ? 240 VAL B CG1 1 
ATOM   4266 C  CG2 . VAL B 1 240 ? 33.402  8.385   78.052 1.00 16.71  ? 240 VAL B CG2 1 
ATOM   4267 N  N   . TRP B 1 241 ? 35.400  9.928   74.223 1.00 11.89  ? 241 TRP B N   1 
ATOM   4268 C  CA  . TRP B 1 241 ? 36.419  10.510  73.346 1.00 11.89  ? 241 TRP B CA  1 
ATOM   4269 C  C   . TRP B 1 241 ? 35.943  11.852  72.781 1.00 14.78  ? 241 TRP B C   1 
ATOM   4270 O  O   . TRP B 1 241 ? 36.703  12.824  72.715 1.00 15.50  ? 241 TRP B O   1 
ATOM   4271 C  CB  . TRP B 1 241 ? 36.741  9.558   72.192 1.00 14.54  ? 241 TRP B CB  1 
ATOM   4272 C  CG  . TRP B 1 241 ? 37.802  10.075  71.257 1.00 14.07  ? 241 TRP B CG  1 
ATOM   4273 C  CD1 . TRP B 1 241 ? 39.150  9.869   71.359 1.00 15.21  ? 241 TRP B CD1 1 
ATOM   4274 C  CD2 . TRP B 1 241 ? 37.606  10.867  70.074 1.00 12.93  ? 241 TRP B CD2 1 
ATOM   4275 N  NE1 . TRP B 1 241 ? 39.803  10.484  70.323 1.00 15.50  ? 241 TRP B NE1 1 
ATOM   4276 C  CE2 . TRP B 1 241 ? 38.882  11.108  69.519 1.00 14.65  ? 241 TRP B CE2 1 
ATOM   4277 C  CE3 . TRP B 1 241 ? 36.479  11.400  69.434 1.00 12.05  ? 241 TRP B CE3 1 
ATOM   4278 C  CZ2 . TRP B 1 241 ? 39.066  11.861  68.366 1.00 12.11  ? 241 TRP B CZ2 1 
ATOM   4279 C  CZ3 . TRP B 1 241 ? 36.663  12.151  68.283 1.00 17.81  ? 241 TRP B CZ3 1 
ATOM   4280 C  CH2 . TRP B 1 241 ? 37.950  12.377  67.764 1.00 16.92  ? 241 TRP B CH2 1 
ATOM   4281 N  N   . GLN B 1 242 ? 34.679  11.901  72.380 1.00 12.25  ? 242 GLN B N   1 
ATOM   4282 C  CA  . GLN B 1 242 ? 34.107  13.142  71.861 1.00 14.72  ? 242 GLN B CA  1 
ATOM   4283 C  C   . GLN B 1 242 ? 34.078  14.262  72.915 1.00 19.04  ? 242 GLN B C   1 
ATOM   4284 O  O   . GLN B 1 242 ? 34.293  15.429  72.588 1.00 22.01  ? 242 GLN B O   1 
ATOM   4285 C  CB  . GLN B 1 242 ? 32.692  12.898  71.350 1.00 15.80  ? 242 GLN B CB  1 
ATOM   4286 C  CG  . GLN B 1 242 ? 32.610  12.011  70.114 1.00 14.57  ? 242 GLN B CG  1 
ATOM   4287 C  CD  . GLN B 1 242 ? 31.189  11.905  69.618 1.00 15.23  ? 242 GLN B CD  1 
ATOM   4288 O  OE1 . GLN B 1 242 ? 30.358  11.246  70.241 1.00 14.82  ? 242 GLN B OE1 1 
ATOM   4289 N  NE2 . GLN B 1 242 ? 30.889  12.591  68.523 1.00 13.31  ? 242 GLN B NE2 1 
ATOM   4290 N  N   . ILE B 1 243 ? 33.770  13.902  74.158 1.00 15.99  ? 243 ILE B N   1 
ATOM   4291 C  CA  . ILE B 1 243 ? 33.750  14.853  75.273 1.00 19.76  ? 243 ILE B CA  1 
ATOM   4292 C  C   . ILE B 1 243 ? 35.131  15.459  75.544 1.00 21.88  ? 243 ILE B C   1 
ATOM   4293 O  O   . ILE B 1 243 ? 35.269  16.668  75.782 1.00 20.12  ? 243 ILE B O   1 
ATOM   4294 C  CB  . ILE B 1 243 ? 33.199  14.201  76.553 1.00 20.06  ? 243 ILE B CB  1 
ATOM   4295 C  CG1 . ILE B 1 243 ? 31.703  13.925  76.410 1.00 20.47  ? 243 ILE B CG1 1 
ATOM   4296 C  CG2 . ILE B 1 243 ? 33.464  15.078  77.787 1.00 23.44  ? 243 ILE B CG2 1 
ATOM   4297 C  CD1 . ILE B 1 243 ? 31.152  13.059  77.526 1.00 23.86  ? 243 ILE B CD1 1 
ATOM   4298 N  N   . ILE B 1 244 ? 36.167  14.638  75.502 1.00 21.99  ? 244 ILE B N   1 
ATOM   4299 C  CA  . ILE B 1 244 ? 37.487  15.159  75.827 1.00 26.55  ? 244 ILE B CA  1 
ATOM   4300 C  C   . ILE B 1 244 ? 38.223  15.752  74.629 1.00 25.13  ? 244 ILE B C   1 
ATOM   4301 O  O   . ILE B 1 244 ? 39.116  16.563  74.801 1.00 25.76  ? 244 ILE B O   1 
ATOM   4302 C  CB  . ILE B 1 244 ? 38.362  14.132  76.598 1.00 29.93  ? 244 ILE B CB  1 
ATOM   4303 C  CG1 . ILE B 1 244 ? 38.769  12.969  75.715 1.00 27.03  ? 244 ILE B CG1 1 
ATOM   4304 C  CG2 . ILE B 1 244 ? 37.614  13.598  77.817 1.00 30.36  ? 244 ILE B CG2 1 
ATOM   4305 C  CD1 . ILE B 1 244 ? 39.315  11.782  76.520 1.00 26.94  ? 244 ILE B CD1 1 
ATOM   4306 N  N   . HIS B 1 245 ? 37.826  15.359  73.425 1.00 17.59  ? 245 HIS B N   1 
ATOM   4307 C  CA  . HIS B 1 245 ? 38.366  15.954  72.220 1.00 18.30  ? 245 HIS B CA  1 
ATOM   4308 C  C   . HIS B 1 245 ? 37.277  16.726  71.542 1.00 25.24  ? 245 HIS B C   1 
ATOM   4309 O  O   . HIS B 1 245 ? 36.749  16.298  70.493 1.00 20.46  ? 245 HIS B O   1 
ATOM   4310 C  CB  . HIS B 1 245 ? 38.911  14.880  71.288 1.00 19.26  ? 245 HIS B CB  1 
ATOM   4311 C  CG  . HIS B 1 245 ? 40.016  14.049  71.896 1.00 19.88  ? 245 HIS B CG  1 
ATOM   4312 N  ND1 . HIS B 1 245 ? 41.264  14.521  72.069 1.00 24.44  ? 245 HIS B ND1 1 
ATOM   4313 C  CD2 . HIS B 1 245 ? 40.020  12.740  72.374 1.00 18.27  ? 245 HIS B CD2 1 
ATOM   4314 C  CE1 . HIS B 1 245 ? 42.030  13.565  72.629 1.00 22.43  ? 245 HIS B CE1 1 
ATOM   4315 N  NE2 . HIS B 1 245 ? 41.268  12.476  72.815 1.00 21.72  ? 245 HIS B NE2 1 
ATOM   4316 N  N   . ARG B 1 246 ? 36.907  17.863  72.125 1.00 31.96  ? 246 ARG B N   1 
ATOM   4317 C  CA  . ARG B 1 246 ? 35.748  18.608  71.644 1.00 35.43  ? 246 ARG B CA  1 
ATOM   4318 C  C   . ARG B 1 246 ? 35.961  19.307  70.303 1.00 37.84  ? 246 ARG B C   1 
ATOM   4319 O  O   . ARG B 1 246 ? 35.013  19.515  69.554 1.00 42.99  ? 246 ARG B O   1 
ATOM   4320 C  CB  . ARG B 1 246 ? 35.309  19.609  72.706 1.00 34.76  ? 246 ARG B CB  1 
ATOM   4321 C  CG  . ARG B 1 246 ? 33.820  19.787  72.798 1.00 39.43  ? 246 ARG B CG  1 
ATOM   4322 C  CD  . ARG B 1 246 ? 33.076  18.495  72.531 1.00 41.38  ? 246 ARG B CD  1 
ATOM   4323 N  NE  . ARG B 1 246 ? 31.755  18.796  71.996 1.00 48.63  ? 246 ARG B NE  1 
ATOM   4324 C  CZ  . ARG B 1 246 ? 31.190  18.158  70.976 1.00 47.46  ? 246 ARG B CZ  1 
ATOM   4325 N  NH1 . ARG B 1 246 ? 31.822  17.154  70.375 1.00 48.67  ? 246 ARG B NH1 1 
ATOM   4326 N  NH2 . ARG B 1 246 ? 29.983  18.521  70.564 1.00 56.11  ? 246 ARG B NH2 1 
ATOM   4327 N  N   . ASN B 1 247 ? 37.203  19.664  70.002 1.00 39.55  ? 247 ASN B N   1 
ATOM   4328 C  CA  . ASN B 1 247 ? 37.520  20.347  68.748 1.00 44.70  ? 247 ASN B CA  1 
ATOM   4329 C  C   . ASN B 1 247 ? 37.813  19.398  67.586 1.00 46.05  ? 247 ASN B C   1 
ATOM   4330 O  O   . ASN B 1 247 ? 37.969  19.818  66.437 1.00 44.70  ? 247 ASN B O   1 
ATOM   4331 C  CB  . ASN B 1 247 ? 38.667  21.336  68.953 1.00 50.75  ? 247 ASN B CB  1 
ATOM   4332 C  CG  . ASN B 1 247 ? 38.199  22.630  69.604 1.00 52.73  ? 247 ASN B CG  1 
ATOM   4333 O  OD1 . ASN B 1 247 ? 37.156  23.181  69.229 1.00 54.76  ? 247 ASN B OD1 1 
ATOM   4334 N  ND2 . ASN B 1 247 ? 38.952  23.109  70.593 1.00 52.22  ? 247 ASN B ND2 1 
ATOM   4335 N  N   . GLN B 1 248 ? 37.883  18.110  67.880 1.00 28.16  ? 248 GLN B N   1 
ATOM   4336 C  CA  . GLN B 1 248 ? 38.014  17.142  66.811 1.00 27.09  ? 248 GLN B CA  1 
ATOM   4337 C  C   . GLN B 1 248 ? 36.633  16.804  66.289 1.00 27.53  ? 248 GLN B C   1 
ATOM   4338 O  O   . GLN B 1 248 ? 35.651  16.853  67.031 1.00 31.24  ? 248 GLN B O   1 
ATOM   4339 C  CB  . GLN B 1 248 ? 38.732  15.895  67.307 1.00 24.35  ? 248 GLN B CB  1 
ATOM   4340 C  CG  . GLN B 1 248 ? 40.153  16.189  67.705 1.00 25.39  ? 248 GLN B CG  1 
ATOM   4341 C  CD  . GLN B 1 248 ? 41.006  16.585  66.522 1.00 28.85  ? 248 GLN B CD  1 
ATOM   4342 O  OE1 . GLN B 1 248 ? 40.718  16.224  65.380 1.00 26.68  ? 248 GLN B OE1 1 
ATOM   4343 N  NE2 . GLN B 1 248 ? 42.070  17.329  66.788 1.00 32.52  ? 248 GLN B NE2 1 
ATOM   4344 N  N   . ASN B 1 249 ? 36.570  16.499  64.988 1.00 30.24  ? 249 ASN B N   1 
ATOM   4345 C  CA  . ASN B 1 249 ? 35.325  16.082  64.290 1.00 32.62  ? 249 ASN B CA  1 
ATOM   4346 C  C   . ASN B 1 249 ? 35.536  14.847  63.448 1.00 27.37  ? 249 ASN B C   1 
ATOM   4347 O  O   . ASN B 1 249 ? 36.661  14.463  63.077 1.00 25.81  ? 249 ASN B O   1 
ATOM   4348 C  CB  . ASN B 1 249 ? 34.733  17.152  63.320 1.00 31.35  ? 249 ASN B CB  1 
ATOM   4349 C  CG  . ASN B 1 249 ? 33.198  17.086  63.202 1.00 40.38  ? 249 ASN B CG  1 
ATOM   4350 O  OD1 . ASN B 1 249 ? 32.543  16.077  63.503 1.00 33.91  ? 249 ASN B OD1 1 
ATOM   4351 N  ND2 . ASN B 1 249 ? 32.617  18.219  62.769 1.00 40.65  ? 249 ASN B ND2 1 
ATOM   4352 N  N   . TYR B 1 250 ? 34.410  14.254  63.107 1.00 21.75  ? 250 TYR B N   1 
ATOM   4353 C  CA  . TYR B 1 250 ? 34.458  13.071  62.270 1.00 18.27  ? 250 TYR B CA  1 
ATOM   4354 C  C   . TYR B 1 250 ? 35.354  13.311  61.049 1.00 20.94  ? 250 TYR B C   1 
ATOM   4355 O  O   . TYR B 1 250 ? 35.436  14.431  60.534 1.00 21.40  ? 250 TYR B O   1 
ATOM   4356 C  CB  . TYR B 1 250 ? 33.038  12.722  61.839 1.00 20.17  ? 250 TYR B CB  1 
ATOM   4357 C  CG  . TYR B 1 250 ? 32.907  11.472  61.001 1.00 18.00  ? 250 TYR B CG  1 
ATOM   4358 C  CD1 . TYR B 1 250 ? 32.776  10.222  61.599 1.00 17.91  ? 250 TYR B CD1 1 
ATOM   4359 C  CD2 . TYR B 1 250 ? 32.896  11.539  59.620 1.00 15.82  ? 250 TYR B CD2 1 
ATOM   4360 C  CE1 . TYR B 1 250 ? 32.645  9.087   60.837 1.00 14.86  ? 250 TYR B CE1 1 
ATOM   4361 C  CE2 . TYR B 1 250 ? 32.754  10.407  58.850 1.00 15.15  ? 250 TYR B CE2 1 
ATOM   4362 C  CZ  . TYR B 1 250 ? 32.636  9.182   59.463 1.00 15.35  ? 250 TYR B CZ  1 
ATOM   4363 O  OH  . TYR B 1 250 ? 32.502  8.055   58.693 1.00 13.75  ? 250 TYR B OH  1 
ATOM   4364 N  N   . GLN B 1 251 ? 36.063  12.266  60.632 1.00 15.92  ? 251 GLN B N   1 
ATOM   4365 C  CA  . GLN B 1 251 ? 36.786  12.238  59.365 1.00 18.05  ? 251 GLN B CA  1 
ATOM   4366 C  C   . GLN B 1 251 ? 36.522  10.877  58.715 1.00 15.83  ? 251 GLN B C   1 
ATOM   4367 O  O   . GLN B 1 251 ? 36.418  9.874   59.415 1.00 16.36  ? 251 GLN B O   1 
ATOM   4368 C  CB  . GLN B 1 251 ? 38.286  12.383  59.605 1.00 19.18  ? 251 GLN B CB  1 
ATOM   4369 C  CG  . GLN B 1 251 ? 38.698  13.612  60.400 1.00 22.19  ? 251 GLN B CG  1 
ATOM   4370 C  CD  . GLN B 1 251 ? 40.206  13.788  60.431 1.00 25.92  ? 251 GLN B CD  1 
ATOM   4371 O  OE1 . GLN B 1 251 ? 40.866  13.773  59.390 1.00 30.56  ? 251 GLN B OE1 1 
ATOM   4372 N  NE2 . GLN B 1 251 ? 40.759  13.941  61.623 1.00 28.63  ? 251 GLN B NE2 1 
ATOM   4373 N  N   . PRO B 1 252 ? 36.453  10.821  57.379 1.00 15.54  ? 252 PRO B N   1 
ATOM   4374 C  CA  . PRO B 1 252 ? 36.695  11.905  56.423 1.00 16.95  ? 252 PRO B CA  1 
ATOM   4375 C  C   . PRO B 1 252 ? 35.490  12.806  56.260 1.00 19.45  ? 252 PRO B C   1 
ATOM   4376 O  O   . PRO B 1 252 ? 34.342  12.339  56.265 1.00 15.21  ? 252 PRO B O   1 
ATOM   4377 C  CB  . PRO B 1 252 ? 36.945  11.162  55.116 1.00 18.08  ? 252 PRO B CB  1 
ATOM   4378 C  CG  . PRO B 1 252 ? 36.159  9.900   55.252 1.00 18.69  ? 252 PRO B CG  1 
ATOM   4379 C  CD  . PRO B 1 252 ? 36.219  9.533   56.707 1.00 14.98  ? 252 PRO B CD  1 
ATOM   4380 N  N   . MET B 1 253 ? 35.759  14.096  56.113 1.00 20.07  ? 253 MET B N   1 
ATOM   4381 C  CA  . MET B 1 253 ? 34.710  15.069  55.863 1.00 24.25  ? 253 MET B CA  1 
ATOM   4382 C  C   . MET B 1 253 ? 34.181  14.936  54.449 1.00 23.87  ? 253 MET B C   1 
ATOM   4383 O  O   . MET B 1 253 ? 32.974  14.996  54.218 1.00 26.16  ? 253 MET B O   1 
ATOM   4384 C  CB  . MET B 1 253 ? 35.236  16.483  56.096 1.00 24.45  ? 253 MET B CB  1 
ATOM   4385 C  CG  . MET B 1 253 ? 35.160  16.907  57.529 1.00 26.14  ? 253 MET B CG  1 
ATOM   4386 S  SD  . MET B 1 253 ? 33.439  16.855  58.079 1.00 35.07  ? 253 MET B SD  1 
ATOM   4387 C  CE  . MET B 1 253 ? 32.725  18.186  57.122 1.00 29.17  ? 253 MET B CE  1 
ATOM   4388 N  N   . LYS B 1 254 ? 35.094  14.761  53.500 1.00 23.82  ? 254 LYS B N   1 
ATOM   4389 C  CA  . LYS B 1 254 ? 34.730  14.582  52.104 1.00 28.42  ? 254 LYS B CA  1 
ATOM   4390 C  C   . LYS B 1 254 ? 35.851  13.810  51.429 1.00 30.87  ? 254 LYS B C   1 
ATOM   4391 O  O   . LYS B 1 254 ? 36.942  13.687  51.987 1.00 34.76  ? 254 LYS B O   1 
ATOM   4392 C  CB  . LYS B 1 254 ? 34.554  15.941  51.424 1.00 36.02  ? 254 LYS B CB  1 
ATOM   4393 C  CG  . LYS B 1 254 ? 35.854  16.712  51.289 1.00 37.36  ? 254 LYS B CG  1 
ATOM   4394 C  CD  . LYS B 1 254 ? 35.646  18.048  50.589 1.00 47.04  ? 254 LYS B CD  1 
ATOM   4395 C  CE  . LYS B 1 254 ? 36.964  18.794  50.429 1.00 53.01  ? 254 LYS B CE  1 
ATOM   4396 N  NZ  . LYS B 1 254 ? 36.755  20.214  50.018 1.00 51.86  ? 254 LYS B NZ  1 
ATOM   4397 N  N   . ASN B 1 255 ? 35.585  13.279  50.244 1.00 42.14  ? 255 ASN B N   1 
ATOM   4398 C  CA  . ASN B 1 255 ? 36.614  12.584  49.470 1.00 47.07  ? 255 ASN B CA  1 
ATOM   4399 C  C   . ASN B 1 255 ? 37.186  11.292  50.096 1.00 47.39  ? 255 ASN B C   1 
ATOM   4400 O  O   . ASN B 1 255 ? 38.260  10.829  49.702 1.00 49.29  ? 255 ASN B O   1 
ATOM   4401 C  CB  . ASN B 1 255 ? 37.734  13.560  49.068 1.00 53.13  ? 255 ASN B CB  1 
ATOM   4402 C  CG  . ASN B 1 255 ? 37.207  14.775  48.304 1.00 55.49  ? 255 ASN B CG  1 
ATOM   4403 O  OD1 . ASN B 1 255 ? 37.404  15.921  48.719 1.00 57.78  ? 255 ASN B OD1 1 
ATOM   4404 N  ND2 . ASN B 1 255 ? 36.527  14.526  47.184 1.00 50.93  ? 255 ASN B ND2 1 
ATOM   4405 N  N   . GLY B 1 256 ? 36.478  10.726  51.073 1.00 26.73  ? 256 GLY B N   1 
ATOM   4406 C  CA  . GLY B 1 256 ? 36.648  9.319   51.419 1.00 26.65  ? 256 GLY B CA  1 
ATOM   4407 C  C   . GLY B 1 256 ? 35.745  8.519   50.489 1.00 21.07  ? 256 GLY B C   1 
ATOM   4408 O  O   . GLY B 1 256 ? 35.011  9.112   49.702 1.00 24.18  ? 256 GLY B O   1 
ATOM   4409 N  N   . PRO B 1 257 ? 35.783  7.177   50.568 1.00 19.28  ? 257 PRO B N   1 
ATOM   4410 C  CA  . PRO B 1 257 ? 34.892  6.375   49.715 1.00 20.61  ? 257 PRO B CA  1 
ATOM   4411 C  C   . PRO B 1 257 ? 33.432  6.720   50.007 1.00 18.84  ? 257 PRO B C   1 
ATOM   4412 O  O   . PRO B 1 257 ? 33.143  7.160   51.117 1.00 17.33  ? 257 PRO B O   1 
ATOM   4413 C  CB  . PRO B 1 257 ? 35.170  4.932   50.161 1.00 20.85  ? 257 PRO B CB  1 
ATOM   4414 C  CG  . PRO B 1 257 ? 36.506  4.983   50.858 1.00 20.43  ? 257 PRO B CG  1 
ATOM   4415 C  CD  . PRO B 1 257 ? 36.584  6.344   51.483 1.00 19.05  ? 257 PRO B CD  1 
ATOM   4416 N  N   . PHE B 1 258 ? 32.539  6.527   49.041 1.00 19.60  ? 258 PHE B N   1 
ATOM   4417 C  CA  . PHE B 1 258 ? 31.126  6.847   49.249 1.00 21.68  ? 258 PHE B CA  1 
ATOM   4418 C  C   . PHE B 1 258 ? 30.563  5.917   50.316 1.00 18.36  ? 258 PHE B C   1 
ATOM   4419 O  O   . PHE B 1 258 ? 30.760  4.713   50.252 1.00 16.63  ? 258 PHE B O   1 
ATOM   4420 C  CB  . PHE B 1 258 ? 30.333  6.716   47.948 1.00 21.18  ? 258 PHE B CB  1 
ATOM   4421 C  CG  . PHE B 1 258 ? 28.857  6.959   48.115 1.00 19.87  ? 258 PHE B CG  1 
ATOM   4422 C  CD1 . PHE B 1 258 ? 28.372  8.240   48.292 1.00 21.46  ? 258 PHE B CD1 1 
ATOM   4423 C  CD2 . PHE B 1 258 ? 27.959  5.903   48.122 1.00 20.94  ? 258 PHE B CD2 1 
ATOM   4424 C  CE1 . PHE B 1 258 ? 27.016  8.472   48.464 1.00 24.00  ? 258 PHE B CE1 1 
ATOM   4425 C  CE2 . PHE B 1 258 ? 26.599  6.131   48.280 1.00 22.15  ? 258 PHE B CE2 1 
ATOM   4426 C  CZ  . PHE B 1 258 ? 26.131  7.416   48.447 1.00 20.54  ? 258 PHE B CZ  1 
ATOM   4427 N  N   . GLY B 1 259 ? 29.870  6.477   51.302 1.00 19.28  ? 259 GLY B N   1 
ATOM   4428 C  CA  . GLY B 1 259 ? 29.402  5.692   52.430 1.00 17.96  ? 259 GLY B CA  1 
ATOM   4429 C  C   . GLY B 1 259 ? 30.218  5.963   53.695 1.00 18.41  ? 259 GLY B C   1 
ATOM   4430 O  O   . GLY B 1 259 ? 29.787  5.632   54.803 1.00 15.33  ? 259 GLY B O   1 
ATOM   4431 N  N   . GLN B 1 260 ? 31.388  6.584   53.530 1.00 13.04  ? 260 GLN B N   1 
ATOM   4432 C  CA  . GLN B 1 260 ? 32.269  6.866   54.660 1.00 12.32  ? 260 GLN B CA  1 
ATOM   4433 C  C   . GLN B 1 260 ? 32.356  8.350   55.039 1.00 14.11  ? 260 GLN B C   1 
ATOM   4434 O  O   . GLN B 1 260 ? 32.850  8.690   56.108 1.00 13.44  ? 260 GLN B O   1 
ATOM   4435 C  CB  . GLN B 1 260 ? 33.669  6.314   54.368 1.00 13.63  ? 260 GLN B CB  1 
ATOM   4436 C  CG  . GLN B 1 260 ? 33.665  4.815   54.020 1.00 14.21  ? 260 GLN B CG  1 
ATOM   4437 C  CD  . GLN B 1 260 ? 33.244  3.947   55.202 1.00 16.52  ? 260 GLN B CD  1 
ATOM   4438 O  OE1 . GLN B 1 260 ? 33.327  4.380   56.353 1.00 16.35  ? 260 GLN B OE1 1 
ATOM   4439 N  NE2 . GLN B 1 260 ? 32.792  2.720   54.922 1.00 12.02  ? 260 GLN B NE2 1 
ATOM   4440 N  N   . ASN B 1 261 ? 31.899  9.237   54.158 1.00 12.54  ? 261 ASN B N   1 
ATOM   4441 C  CA  . ASN B 1 261 ? 32.012  10.663  54.440 1.00 12.52  ? 261 ASN B CA  1 
ATOM   4442 C  C   . ASN B 1 261 ? 30.950  11.178  55.415 1.00 14.74  ? 261 ASN B C   1 
ATOM   4443 O  O   . ASN B 1 261 ? 29.905  10.567  55.583 1.00 12.32  ? 261 ASN B O   1 
ATOM   4444 C  CB  . ASN B 1 261 ? 32.020  11.467  53.134 1.00 15.63  ? 261 ASN B CB  1 
ATOM   4445 C  CG  . ASN B 1 261 ? 33.189  11.100  52.242 1.00 18.57  ? 261 ASN B CG  1 
ATOM   4446 O  OD1 . ASN B 1 261 ? 34.334  11.408  52.558 1.00 17.00  ? 261 ASN B OD1 1 
ATOM   4447 N  ND2 . ASN B 1 261 ? 32.909  10.423  51.126 1.00 19.69  ? 261 ASN B ND2 1 
ATOM   4448 N  N   . PHE B 1 262 ? 31.253  12.312  56.048 1.00 13.12  ? 262 PHE B N   1 
ATOM   4449 C  CA  . PHE B 1 262 ? 30.428  12.939  57.076 1.00 13.97  ? 262 PHE B CA  1 
ATOM   4450 C  C   . PHE B 1 262 ? 28.942  13.023  56.725 1.00 14.21  ? 262 PHE B C   1 
ATOM   4451 O  O   . PHE B 1 262 ? 28.088  12.772  57.570 1.00 13.45  ? 262 PHE B O   1 
ATOM   4452 C  CB  . PHE B 1 262 ? 31.002  14.339  57.351 1.00 19.20  ? 262 PHE B CB  1 
ATOM   4453 C  CG  . PHE B 1 262 ? 30.457  15.016  58.578 1.00 18.14  ? 262 PHE B CG  1 
ATOM   4454 C  CD1 . PHE B 1 262 ? 30.480  14.386  59.820 1.00 20.13  ? 262 PHE B CD1 1 
ATOM   4455 C  CD2 . PHE B 1 262 ? 29.979  16.317  58.504 1.00 19.68  ? 262 PHE B CD2 1 
ATOM   4456 C  CE1 . PHE B 1 262 ? 29.999  15.032  60.953 1.00 21.00  ? 262 PHE B CE1 1 
ATOM   4457 C  CE2 . PHE B 1 262 ? 29.504  16.972  59.643 1.00 20.52  ? 262 PHE B CE2 1 
ATOM   4458 C  CZ  . PHE B 1 262 ? 29.516  16.331  60.864 1.00 20.65  ? 262 PHE B CZ  1 
ATOM   4459 N  N   . ARG B 1 263 ? 28.633  13.353  55.473 1.00 15.93  ? 263 ARG B N   1 
ATOM   4460 C  CA  . ARG B 1 263 ? 27.239  13.529  55.069 1.00 17.69  ? 263 ARG B CA  1 
ATOM   4461 C  C   . ARG B 1 263 ? 26.758  12.480  54.044 1.00 19.28  ? 263 ARG B C   1 
ATOM   4462 O  O   . ARG B 1 263 ? 25.774  12.692  53.342 1.00 18.55  ? 263 ARG B O   1 
ATOM   4463 C  CB  . ARG B 1 263 ? 26.999  14.975  54.589 1.00 22.12  ? 263 ARG B CB  1 
ATOM   4464 C  CG  . ARG B 1 263 ? 27.324  16.031  55.658 1.00 19.51  ? 263 ARG B CG  1 
ATOM   4465 C  CD  . ARG B 1 263 ? 26.748  17.427  55.313 1.00 29.58  ? 263 ARG B CD  1 
ATOM   4466 N  NE  . ARG B 1 263 ? 26.899  18.374  56.422 1.00 29.20  ? 263 ARG B NE  1 
ATOM   4467 C  CZ  . ARG B 1 263 ? 27.953  19.169  56.591 1.00 27.79  ? 263 ARG B CZ  1 
ATOM   4468 N  NH1 . ARG B 1 263 ? 28.949  19.146  55.715 1.00 31.55  ? 263 ARG B NH1 1 
ATOM   4469 N  NH2 . ARG B 1 263 ? 28.015  19.989  57.634 1.00 27.84  ? 263 ARG B NH2 1 
ATOM   4470 N  N   . ASP B 1 264 ? 27.458  11.348  53.970 1.00 14.38  ? 264 ASP B N   1 
ATOM   4471 C  CA  . ASP B 1 264 ? 27.017  10.210  53.150 1.00 16.09  ? 264 ASP B CA  1 
ATOM   4472 C  C   . ASP B 1 264 ? 25.981  9.372   53.898 1.00 13.90  ? 264 ASP B C   1 
ATOM   4473 O  O   . ASP B 1 264 ? 26.053  9.221   55.111 1.00 13.76  ? 264 ASP B O   1 
ATOM   4474 C  CB  . ASP B 1 264 ? 28.189  9.284   52.819 1.00 16.01  ? 264 ASP B CB  1 
ATOM   4475 C  CG  . ASP B 1 264 ? 29.162  9.881   51.815 1.00 19.75  ? 264 ASP B CG  1 
ATOM   4476 O  OD1 . ASP B 1 264 ? 28.851  10.920  51.186 1.00 20.44  ? 264 ASP B OD1 1 
ATOM   4477 O  OD2 . ASP B 1 264 ? 30.244  9.290   51.644 1.00 17.21  ? 264 ASP B OD2 1 
ATOM   4478 N  N   . PRO B 1 265 ? 25.029  8.783   53.170 1.00 17.16  ? 265 PRO B N   1 
ATOM   4479 C  CA  . PRO B 1 265 ? 24.097  7.875   53.859 1.00 16.06  ? 265 PRO B CA  1 
ATOM   4480 C  C   . PRO B 1 265 ? 24.813  6.579   54.238 1.00 14.61  ? 265 PRO B C   1 
ATOM   4481 O  O   . PRO B 1 265 ? 25.645  6.123   53.468 1.00 15.07  ? 265 PRO B O   1 
ATOM   4482 C  CB  . PRO B 1 265 ? 23.031  7.592   52.795 1.00 16.77  ? 265 PRO B CB  1 
ATOM   4483 C  CG  . PRO B 1 265 ? 23.762  7.766   51.477 1.00 18.21  ? 265 PRO B CG  1 
ATOM   4484 C  CD  . PRO B 1 265 ? 24.737  8.910   51.731 1.00 19.35  ? 265 PRO B CD  1 
ATOM   4485 N  N   . MET B 1 266 ? 24.508  6.028   55.409 1.00 13.14  ? 266 MET B N   1 
ATOM   4486 C  CA  . MET B 1 266 ? 25.081  4.767   55.855 1.00 11.64  ? 266 MET B CA  1 
ATOM   4487 C  C   . MET B 1 266 ? 24.116  3.642   55.518 1.00 11.85  ? 266 MET B C   1 
ATOM   4488 O  O   . MET B 1 266 ? 23.084  3.464   56.180 1.00 11.89  ? 266 MET B O   1 
ATOM   4489 C  CB  . MET B 1 266 ? 25.360  4.796   57.368 1.00 13.03  ? 266 MET B CB  1 
ATOM   4490 C  CG  . MET B 1 266 ? 26.369  5.864   57.799 1.00 12.05  ? 266 MET B CG  1 
ATOM   4491 S  SD  . MET B 1 266 ? 26.712  5.855   59.557 1.00 15.12  ? 266 MET B SD  1 
ATOM   4492 C  CE  . MET B 1 266 ? 25.102  6.299   60.233 1.00 11.19  ? 266 MET B CE  1 
ATOM   4493 N  N   . TYR B 1 267 ? 24.454  2.901   54.466 1.00 10.41  ? 267 TYR B N   1 
ATOM   4494 C  CA  . TYR B 1 267 ? 23.695  1.716   54.079 1.00 12.21  ? 267 TYR B CA  1 
ATOM   4495 C  C   . TYR B 1 267 ? 23.599  0.801   55.297 1.00 10.78  ? 267 TYR B C   1 
ATOM   4496 O  O   . TYR B 1 267 ? 24.608  0.576   55.966 1.00 12.19  ? 267 TYR B O   1 
ATOM   4497 C  CB  . TYR B 1 267 ? 24.421  0.992   52.951 1.00 10.04  ? 267 TYR B CB  1 
ATOM   4498 C  CG  . TYR B 1 267 ? 23.686  -0.247  52.498 1.00 11.90  ? 267 TYR B CG  1 
ATOM   4499 C  CD1 . TYR B 1 267 ? 22.685  -0.169  51.535 1.00 10.61  ? 267 TYR B CD1 1 
ATOM   4500 C  CD2 . TYR B 1 267 ? 23.978  -1.491  53.044 1.00 12.19  ? 267 TYR B CD2 1 
ATOM   4501 C  CE1 . TYR B 1 267 ? 22.003  -1.295  51.128 1.00 9.83   ? 267 TYR B CE1 1 
ATOM   4502 C  CE2 . TYR B 1 267 ? 23.293  -2.627  52.644 1.00 13.11  ? 267 TYR B CE2 1 
ATOM   4503 C  CZ  . TYR B 1 267 ? 22.314  -2.521  51.688 1.00 12.39  ? 267 TYR B CZ  1 
ATOM   4504 O  OH  . TYR B 1 267 ? 21.637  -3.650  51.301 1.00 13.97  ? 267 TYR B OH  1 
ATOM   4505 N  N   . PRO B 1 268 ? 22.412  0.224   55.564 1.00 10.10  ? 268 PRO B N   1 
ATOM   4506 C  CA  . PRO B 1 268 ? 21.223  0.131   54.706 1.00 11.65  ? 268 PRO B CA  1 
ATOM   4507 C  C   . PRO B 1 268 ? 20.226  1.279   54.875 1.00 14.39  ? 268 PRO B C   1 
ATOM   4508 O  O   . PRO B 1 268 ? 19.095  1.154   54.408 1.00 12.73  ? 268 PRO B O   1 
ATOM   4509 C  CB  . PRO B 1 268 ? 20.583  -1.180  55.178 1.00 13.38  ? 268 PRO B CB  1 
ATOM   4510 C  CG  . PRO B 1 268 ? 20.884  -1.189  56.654 1.00 12.99  ? 268 PRO B CG  1 
ATOM   4511 C  CD  . PRO B 1 268 ? 22.277  -0.604  56.780 1.00 12.21  ? 268 PRO B CD  1 
ATOM   4512 N  N   . TRP B 1 269 ? 20.641  2.368   55.522 1.00 12.40  ? 269 TRP B N   1 
ATOM   4513 C  CA  . TRP B 1 269 ? 19.749  3.476   55.834 1.00 13.65  ? 269 TRP B CA  1 
ATOM   4514 C  C   . TRP B 1 269 ? 20.111  4.739   55.060 1.00 15.71  ? 269 TRP B C   1 
ATOM   4515 O  O   . TRP B 1 269 ? 21.066  4.760   54.286 1.00 15.70  ? 269 TRP B O   1 
ATOM   4516 C  CB  . TRP B 1 269 ? 19.826  3.799   57.331 1.00 12.95  ? 269 TRP B CB  1 
ATOM   4517 C  CG  . TRP B 1 269 ? 19.730  2.604   58.229 1.00 13.97  ? 269 TRP B CG  1 
ATOM   4518 C  CD1 . TRP B 1 269 ? 18.656  1.772   58.376 1.00 14.05  ? 269 TRP B CD1 1 
ATOM   4519 C  CD2 . TRP B 1 269 ? 20.732  2.131   59.143 1.00 13.31  ? 269 TRP B CD2 1 
ATOM   4520 N  NE1 . TRP B 1 269 ? 18.934  0.800   59.320 1.00 12.49  ? 269 TRP B NE1 1 
ATOM   4521 C  CE2 . TRP B 1 269 ? 20.203  0.994   59.794 1.00 12.76  ? 269 TRP B CE2 1 
ATOM   4522 C  CE3 . TRP B 1 269 ? 22.030  2.552   59.465 1.00 11.72  ? 269 TRP B CE3 1 
ATOM   4523 C  CZ2 . TRP B 1 269 ? 20.922  0.280   60.758 1.00 12.81  ? 269 TRP B CZ2 1 
ATOM   4524 C  CZ3 . TRP B 1 269 ? 22.746  1.825   60.416 1.00 11.00  ? 269 TRP B CZ3 1 
ATOM   4525 C  CH2 . TRP B 1 269 ? 22.188  0.719   61.056 1.00 11.79  ? 269 TRP B CH2 1 
ATOM   4526 N  N   . ASN B 1 270 ? 19.362  5.805   55.299 1.00 13.36  ? 270 ASN B N   1 
ATOM   4527 C  CA  . ASN B 1 270 ? 19.708  7.117   54.769 1.00 16.41  ? 270 ASN B CA  1 
ATOM   4528 C  C   . ASN B 1 270 ? 20.431  7.983   55.815 1.00 18.25  ? 270 ASN B C   1 
ATOM   4529 O  O   . ASN B 1 270 ? 20.925  9.065   55.515 1.00 17.21  ? 270 ASN B O   1 
ATOM   4530 C  CB  . ASN B 1 270 ? 18.452  7.838   54.268 1.00 21.06  ? 270 ASN B CB  1 
ATOM   4531 C  CG  . ASN B 1 270 ? 17.838  7.169   53.037 1.00 27.86  ? 270 ASN B CG  1 
ATOM   4532 O  OD1 . ASN B 1 270 ? 18.535  6.540   52.241 1.00 29.69  ? 270 ASN B OD1 1 
ATOM   4533 N  ND2 . ASN B 1 270 ? 16.527  7.321   52.872 1.00 29.97  ? 270 ASN B ND2 1 
ATOM   4534 N  N   . THR B 1 271 ? 20.499  7.490   57.043 1.00 14.49  ? 271 THR B N   1 
ATOM   4535 C  CA  . THR B 1 271 ? 21.166  8.209   58.119 1.00 13.75  ? 271 THR B CA  1 
ATOM   4536 C  C   . THR B 1 271 ? 22.637  8.494   57.782 1.00 15.13  ? 271 THR B C   1 
ATOM   4537 O  O   . THR B 1 271 ? 23.337  7.628   57.262 1.00 15.18  ? 271 THR B O   1 
ATOM   4538 C  CB  . THR B 1 271 ? 21.099  7.372   59.401 1.00 14.63  ? 271 THR B CB  1 
ATOM   4539 O  OG1 . THR B 1 271 ? 19.752  6.934   59.593 1.00 17.64  ? 271 THR B OG1 1 
ATOM   4540 C  CG2 . THR B 1 271 ? 21.566  8.176   60.624 1.00 13.43  ? 271 THR B CG2 1 
ATOM   4541 N  N   . THR B 1 272 ? 23.105  9.701   58.095 1.00 13.88  ? 272 THR B N   1 
ATOM   4542 C  CA  . THR B 1 272 ? 24.507  10.063  57.870 1.00 12.84  ? 272 THR B CA  1 
ATOM   4543 C  C   . THR B 1 272 ? 25.274  10.100  59.187 1.00 12.37  ? 272 THR B C   1 
ATOM   4544 O  O   . THR B 1 272 ? 24.663  10.159  60.261 1.00 10.89  ? 272 THR B O   1 
ATOM   4545 C  CB  . THR B 1 272 ? 24.627  11.452  57.229 1.00 16.48  ? 272 THR B CB  1 
ATOM   4546 O  OG1 . THR B 1 272 ? 24.220  12.436  58.186 1.00 15.38  ? 272 THR B OG1 1 
ATOM   4547 C  CG2 . THR B 1 272 ? 23.768  11.528  55.969 1.00 17.88  ? 272 THR B CG2 1 
ATOM   4548 N  N   . PRO B 1 273 ? 26.616  10.054  59.120 1.00 11.33  ? 273 PRO B N   1 
ATOM   4549 C  CA  . PRO B 1 273 ? 27.383  10.216  60.366 1.00 12.14  ? 273 PRO B CA  1 
ATOM   4550 C  C   . PRO B 1 273 ? 27.051  11.545  61.061 1.00 12.76  ? 273 PRO B C   1 
ATOM   4551 O  O   . PRO B 1 273 ? 26.925  11.575  62.295 1.00 11.51  ? 273 PRO B O   1 
ATOM   4552 C  CB  . PRO B 1 273 ? 28.835  10.167  59.883 1.00 12.21  ? 273 PRO B CB  1 
ATOM   4553 C  CG  . PRO B 1 273 ? 28.762  9.239   58.688 1.00 13.38  ? 273 PRO B CG  1 
ATOM   4554 C  CD  . PRO B 1 273 ? 27.470  9.621   58.001 1.00 12.44  ? 273 PRO B CD  1 
ATOM   4555 N  N   . GLU B 1 274 ? 26.829  12.613  60.293 1.00 14.30  ? 274 GLU B N   1 
ATOM   4556 C  CA  . GLU B 1 274 ? 26.477  13.909  60.886 1.00 16.93  ? 274 GLU B CA  1 
ATOM   4557 C  C   . GLU B 1 274 ? 25.230  13.834  61.745 1.00 16.49  ? 274 GLU B C   1 
ATOM   4558 O  O   . GLU B 1 274 ? 25.155  14.429  62.794 1.00 18.37  ? 274 GLU B O   1 
ATOM   4559 C  CB  . GLU B 1 274 ? 26.291  14.982  59.809 1.00 19.17  ? 274 GLU B CB  1 
ATOM   4560 C  CG  . GLU B 1 274 ? 25.804  16.280  60.346 1.00 23.92  ? 274 GLU B CG  1 
ATOM   4561 C  CD  . GLU B 1 274 ? 25.679  17.359  59.273 1.00 30.11  ? 274 GLU B CD  1 
ATOM   4562 O  OE1 . GLU B 1 274 ? 26.001  18.504  59.583 1.00 34.65  ? 274 GLU B OE1 1 
ATOM   4563 O  OE2 . GLU B 1 274 ? 25.275  17.046  58.146 1.00 30.03  ? 274 GLU B OE2 1 
ATOM   4564 N  N   . ASP B 1 275 ? 24.273  13.044  61.279 1.00 14.23  ? 275 ASP B N   1 
ATOM   4565 C  CA  . ASP B 1 275 ? 23.009  12.871  61.987 1.00 17.13  ? 275 ASP B CA  1 
ATOM   4566 C  C   . ASP B 1 275 ? 23.185  12.289  63.400 1.00 17.08  ? 275 ASP B C   1 
ATOM   4567 O  O   . ASP B 1 275 ? 22.373  12.555  64.295 1.00 16.18  ? 275 ASP B O   1 
ATOM   4568 C  CB  . ASP B 1 275 ? 22.071  11.948  61.194 1.00 16.05  ? 275 ASP B CB  1 
ATOM   4569 C  CG  . ASP B 1 275 ? 21.532  12.594  59.915 1.00 21.76  ? 275 ASP B CG  1 
ATOM   4570 O  OD1 . ASP B 1 275 ? 21.527  13.840  59.831 1.00 22.94  ? 275 ASP B OD1 1 
ATOM   4571 O  OD2 . ASP B 1 275 ? 21.104  11.846  59.004 1.00 22.89  ? 275 ASP B OD2 1 
ATOM   4572 N  N   . VAL B 1 276 ? 24.217  11.473  63.605 1.00 13.80  ? 276 VAL B N   1 
ATOM   4573 C  CA  . VAL B 1 276 ? 24.392  10.852  64.916 1.00 13.77  ? 276 VAL B CA  1 
ATOM   4574 C  C   . VAL B 1 276 ? 25.640  11.302  65.693 1.00 14.32  ? 276 VAL B C   1 
ATOM   4575 O  O   . VAL B 1 276 ? 26.033  10.630  66.624 1.00 14.41  ? 276 VAL B O   1 
ATOM   4576 C  CB  . VAL B 1 276 ? 24.366  9.290   64.847 1.00 13.93  ? 276 VAL B CB  1 
ATOM   4577 C  CG1 . VAL B 1 276 ? 23.001  8.807   64.368 1.00 13.89  ? 276 VAL B CG1 1 
ATOM   4578 C  CG2 . VAL B 1 276 ? 25.477  8.769   63.927 1.00 11.13  ? 276 VAL B CG2 1 
ATOM   4579 N  N   . MET B 1 277 ? 26.243  12.434  65.333 1.00 15.00  ? 277 MET B N   1 
ATOM   4580 C  CA  . MET B 1 277 ? 27.494  12.869  65.978 1.00 18.15  ? 277 MET B CA  1 
ATOM   4581 C  C   . MET B 1 277 ? 27.316  13.230  67.449 1.00 18.99  ? 277 MET B C   1 
ATOM   4582 O  O   . MET B 1 277 ? 28.188  12.981  68.282 1.00 19.77  ? 277 MET B O   1 
ATOM   4583 C  CB  . MET B 1 277 ? 28.086  14.087  65.261 1.00 20.31  ? 277 MET B CB  1 
ATOM   4584 C  CG  . MET B 1 277 ? 29.043  13.760  64.154 1.00 25.33  ? 277 MET B CG  1 
ATOM   4585 S  SD  . MET B 1 277 ? 30.328  12.588  64.628 1.00 28.01  ? 277 MET B SD  1 
ATOM   4586 C  CE  . MET B 1 277 ? 29.837  11.229  63.570 1.00 20.19  ? 277 MET B CE  1 
ATOM   4587 N  N   . ASN B 1 278 ? 26.204  13.832  67.748 1.00 22.38  ? 278 ASN B N   1 
ATOM   4588 C  CA  . ASN B 1 278 ? 25.905  14.271  69.078 1.00 26.52  ? 278 ASN B CA  1 
ATOM   4589 C  C   . ASN B 1 278 ? 24.914  13.381  69.776 1.00 24.94  ? 278 ASN B C   1 
ATOM   4590 O  O   . ASN B 1 278 ? 23.759  13.476  69.554 1.00 23.39  ? 278 ASN B O   1 
ATOM   4591 C  CB  . ASN B 1 278 ? 25.374  15.692  69.035 1.00 31.12  ? 278 ASN B CB  1 
ATOM   4592 C  CG  . ASN B 1 278 ? 25.203  16.273  70.399 1.00 33.36  ? 278 ASN B CG  1 
ATOM   4593 O  OD1 . ASN B 1 278 ? 25.861  17.203  70.734 1.00 35.31  ? 278 ASN B OD1 1 
ATOM   4594 N  ND2 . ASN B 1 278 ? 24.327  15.744  71.160 1.00 40.29  ? 278 ASN B ND2 1 
ATOM   4595 N  N   . HIS B 1 279 ? 25.410  12.515  70.642 1.00 16.23  ? 279 HIS B N   1 
ATOM   4596 C  CA  . HIS B 1 279 ? 24.565  11.476  71.227 1.00 16.37  ? 279 HIS B CA  1 
ATOM   4597 C  C   . HIS B 1 279 ? 23.501  12.042  72.160 1.00 20.69  ? 279 HIS B C   1 
ATOM   4598 O  O   . HIS B 1 279 ? 22.393  11.517  72.230 1.00 18.83  ? 279 HIS B O   1 
ATOM   4599 C  CB  . HIS B 1 279 ? 25.396  10.383  71.926 1.00 17.03  ? 279 HIS B CB  1 
ATOM   4600 C  CG  . HIS B 1 279 ? 25.885  10.752  73.293 1.00 18.73  ? 279 HIS B CG  1 
ATOM   4601 N  ND1 . HIS B 1 279 ? 27.004  11.530  73.501 1.00 19.55  ? 279 HIS B ND1 1 
ATOM   4602 C  CD2 . HIS B 1 279 ? 25.421  10.425  74.521 1.00 21.09  ? 279 HIS B CD2 1 
ATOM   4603 C  CE1 . HIS B 1 279 ? 27.207  11.669  74.798 1.00 21.21  ? 279 HIS B CE1 1 
ATOM   4604 N  NE2 . HIS B 1 279 ? 26.262  11.009  75.440 1.00 25.39  ? 279 HIS B NE2 1 
ATOM   4605 N  N   . ARG B 1 280 ? 23.766  13.125  72.877 1.00 22.01  ? 280 ARG B N   1 
ATOM   4606 C  CA  . ARG B 1 280 ? 22.657  13.564  73.735 1.00 27.64  ? 280 ARG B CA  1 
ATOM   4607 C  C   . ARG B 1 280 ? 21.475  14.109  72.859 1.00 28.40  ? 280 ARG B C   1 
ATOM   4608 O  O   . ARG B 1 280 ? 20.281  13.930  73.190 1.00 28.84  ? 280 ARG B O   1 
ATOM   4609 C  CB  . ARG B 1 280 ? 23.129  14.499  74.867 1.00 31.36  ? 280 ARG B CB  1 
ATOM   4610 C  CG  . ARG B 1 280 ? 24.233  13.891  75.745 1.00 36.63  ? 280 ARG B CG  1 
ATOM   4611 C  CD  . ARG B 1 280 ? 25.355  14.868  76.104 1.00 47.84  ? 280 ARG B CD  1 
ATOM   4612 N  NE  . ARG B 1 280 ? 26.185  14.422  77.199 1.00 55.79  ? 280 ARG B NE  1 
ATOM   4613 C  CZ  . ARG B 1 280 ? 26.751  15.207  78.085 1.00 55.43  ? 280 ARG B CZ  1 
ATOM   4614 N  NH1 . ARG B 1 280 ? 26.559  16.503  78.024 1.00 53.41  ? 280 ARG B NH1 1 
ATOM   4615 N  NH2 . ARG B 1 280 ? 27.484  14.686  79.034 1.00 56.95  ? 280 ARG B NH2 1 
ATOM   4616 N  N   . LYS B 1 281 ? 21.790  14.705  71.709 1.00 27.53  ? 281 LYS B N   1 
ATOM   4617 C  CA  . LYS B 1 281 ? 20.681  15.159  70.864 1.00 28.31  ? 281 LYS B CA  1 
ATOM   4618 C  C   . LYS B 1 281 ? 19.817  14.015  70.395 1.00 28.33  ? 281 LYS B C   1 
ATOM   4619 O  O   . LYS B 1 281 ? 18.687  14.194  69.985 1.00 26.89  ? 281 LYS B O   1 
ATOM   4620 C  CB  . LYS B 1 281 ? 21.189  15.903  69.652 1.00 34.95  ? 281 LYS B CB  1 
ATOM   4621 C  CG  . LYS B 1 281 ? 21.902  17.163  69.988 1.00 43.11  ? 281 LYS B CG  1 
ATOM   4622 C  CD  . LYS B 1 281 ? 21.698  18.206  68.946 1.00 50.30  ? 281 LYS B CD  1 
ATOM   4623 C  CE  . LYS B 1 281 ? 22.389  17.889  67.665 1.00 56.35  ? 281 LYS B CE  1 
ATOM   4624 N  NZ  . LYS B 1 281 ? 22.410  19.154  66.900 1.00 58.97  ? 281 LYS B NZ  1 
ATOM   4625 N  N   . LEU B 1 282 ? 20.407  12.824  70.459 1.00 25.16  ? 282 LEU B N   1 
ATOM   4626 C  CA  . LEU B 1 282 ? 19.660  11.628  70.087 1.00 20.64  ? 282 LEU B CA  1 
ATOM   4627 C  C   . LEU B 1 282 ? 18.714  11.180  71.195 1.00 21.34  ? 282 LEU B C   1 
ATOM   4628 O  O   . LEU B 1 282 ? 17.818  10.374  70.961 1.00 23.72  ? 282 LEU B O   1 
ATOM   4629 C  CB  . LEU B 1 282 ? 20.620  10.491  69.696 1.00 19.75  ? 282 LEU B CB  1 
ATOM   4630 C  CG  . LEU B 1 282 ? 21.573  10.805  68.535 1.00 18.58  ? 282 LEU B CG  1 
ATOM   4631 C  CD1 . LEU B 1 282 ? 22.532  9.645   68.290 1.00 16.81  ? 282 LEU B CD1 1 
ATOM   4632 C  CD2 . LEU B 1 282 ? 20.795  11.135  67.263 1.00 18.04  ? 282 LEU B CD2 1 
ATOM   4633 N  N   . GLY B 1 283 ? 18.930  11.689  72.406 1.00 24.32  ? 283 GLY B N   1 
ATOM   4634 C  CA  . GLY B 1 283 ? 17.992  11.458  73.491 1.00 26.50  ? 283 GLY B CA  1 
ATOM   4635 C  C   . GLY B 1 283 ? 18.495  10.590  74.628 1.00 29.46  ? 283 GLY B C   1 
ATOM   4636 O  O   . GLY B 1 283 ? 17.715  10.176  75.486 1.00 29.92  ? 283 GLY B O   1 
ATOM   4637 N  N   . TYR B 1 284 ? 19.795  10.321  74.660 1.00 20.43  ? 284 TYR B N   1 
ATOM   4638 C  CA  . TYR B 1 284 ? 20.319  9.455   75.700 1.00 21.41  ? 284 TYR B CA  1 
ATOM   4639 C  C   . TYR B 1 284 ? 21.669  9.916   76.206 1.00 21.72  ? 284 TYR B C   1 
ATOM   4640 O  O   . TYR B 1 284 ? 22.360  10.701  75.560 1.00 19.58  ? 284 TYR B O   1 
ATOM   4641 C  CB  . TYR B 1 284 ? 20.402  8.000   75.214 1.00 21.87  ? 284 TYR B CB  1 
ATOM   4642 C  CG  . TYR B 1 284 ? 21.486  7.737   74.180 1.00 18.18  ? 284 TYR B CG  1 
ATOM   4643 C  CD1 . TYR B 1 284 ? 22.768  7.349   74.563 1.00 16.69  ? 284 TYR B CD1 1 
ATOM   4644 C  CD2 . TYR B 1 284 ? 21.217  7.852   72.824 1.00 17.22  ? 284 TYR B CD2 1 
ATOM   4645 C  CE1 . TYR B 1 284 ? 23.762  7.102   73.617 1.00 14.65  ? 284 TYR B CE1 1 
ATOM   4646 C  CE2 . TYR B 1 284 ? 22.199  7.607   71.871 1.00 13.93  ? 284 TYR B CE2 1 
ATOM   4647 C  CZ  . TYR B 1 284 ? 23.464  7.229   72.273 1.00 16.69  ? 284 TYR B CZ  1 
ATOM   4648 O  OH  . TYR B 1 284 ? 24.432  6.982   71.321 1.00 14.29  ? 284 TYR B OH  1 
ATOM   4649 N  N   . VAL B 1 285 ? 22.041  9.362   77.348 1.00 19.22  ? 285 VAL B N   1 
ATOM   4650 C  CA  . VAL B 1 285 ? 23.284  9.674   77.985 1.00 19.36  ? 285 VAL B CA  1 
ATOM   4651 C  C   . VAL B 1 285 ? 23.789  8.427   78.724 1.00 18.39  ? 285 VAL B C   1 
ATOM   4652 O  O   . VAL B 1 285 ? 23.005  7.580   79.063 1.00 19.49  ? 285 VAL B O   1 
ATOM   4653 C  CB  . VAL B 1 285 ? 23.085  10.829  78.987 1.00 25.20  ? 285 VAL B CB  1 
ATOM   4654 C  CG1 . VAL B 1 285 ? 22.296  10.387  80.150 1.00 23.83  ? 285 VAL B CG1 1 
ATOM   4655 C  CG2 . VAL B 1 285 ? 24.355  11.294  79.465 1.00 29.01  ? 285 VAL B CG2 1 
ATOM   4656 N  N   . TYR B 1 286 ? 25.066  8.312   78.972 1.00 19.09  ? 286 TYR B N   1 
ATOM   4657 C  CA  . TYR B 1 286 ? 25.609  7.231   79.785 1.00 17.46  ? 286 TYR B CA  1 
ATOM   4658 C  C   . TYR B 1 286 ? 25.672  7.612   81.262 1.00 23.05  ? 286 TYR B C   1 
ATOM   4659 O  O   . TYR B 1 286 ? 26.047  8.692   81.573 1.00 21.94  ? 286 TYR B O   1 
ATOM   4660 C  CB  . TYR B 1 286 ? 26.986  6.794   79.249 1.00 18.12  ? 286 TYR B CB  1 
ATOM   4661 C  CG  . TYR B 1 286 ? 26.825  6.082   77.935 1.00 16.70  ? 286 TYR B CG  1 
ATOM   4662 C  CD1 . TYR B 1 286 ? 26.962  6.737   76.745 1.00 18.32  ? 286 TYR B CD1 1 
ATOM   4663 C  CD2 . TYR B 1 286 ? 26.412  4.795   77.901 1.00 16.50  ? 286 TYR B CD2 1 
ATOM   4664 C  CE1 . TYR B 1 286 ? 26.720  6.110   75.562 1.00 13.93  ? 286 TYR B CE1 1 
ATOM   4665 C  CE2 . TYR B 1 286 ? 26.166  4.171   76.725 1.00 13.91  ? 286 TYR B CE2 1 
ATOM   4666 C  CZ  . TYR B 1 286 ? 26.340  4.829   75.551 1.00 13.71  ? 286 TYR B CZ  1 
ATOM   4667 O  OH  . TYR B 1 286 ? 26.076  4.201   74.383 1.00 15.87  ? 286 TYR B OH  1 
ATOM   4668 N  N   . ASP B 1 287 ? 25.370  6.684   82.144 1.00 29.57  ? 287 ASP B N   1 
ATOM   4669 C  CA  . ASP B 1 287 ? 25.415  6.959   83.562 1.00 31.57  ? 287 ASP B CA  1 
ATOM   4670 C  C   . ASP B 1 287 ? 26.647  7.723   84.012 1.00 34.88  ? 287 ASP B C   1 
ATOM   4671 O  O   . ASP B 1 287 ? 26.540  8.622   84.770 1.00 41.62  ? 287 ASP B O   1 
ATOM   4672 C  CB  . ASP B 1 287 ? 25.177  5.712   84.417 1.00 33.56  ? 287 ASP B CB  1 
ATOM   4673 C  CG  . ASP B 1 287 ? 26.092  4.566   84.097 1.00 32.66  ? 287 ASP B CG  1 
ATOM   4674 O  OD1 . ASP B 1 287 ? 26.973  4.692   83.283 1.00 31.13  ? 287 ASP B OD1 1 
ATOM   4675 O  OD2 . ASP B 1 287 ? 25.921  3.537   84.712 1.00 32.14  ? 287 ASP B OD2 1 
ATOM   4676 N  N   . ILE B 1 288 ? 27.806  7.362   83.535 1.00 38.77  ? 288 ILE B N   1 
ATOM   4677 C  CA  . ILE B 1 288 ? 29.036  7.979   84.002 1.00 50.06  ? 288 ILE B CA  1 
ATOM   4678 C  C   . ILE B 1 288 ? 29.153  9.442   83.676 1.00 52.75  ? 288 ILE B C   1 
ATOM   4679 O  O   . ILE B 1 288 ? 30.037  10.079  84.148 1.00 44.87  ? 288 ILE B O   1 
ATOM   4680 C  CB  . ILE B 1 288 ? 30.299  7.332   83.449 1.00 45.79  ? 288 ILE B CB  1 
ATOM   4681 C  CG1 . ILE B 1 288 ? 30.274  7.301   81.946 1.00 47.48  ? 288 ILE B CG1 1 
ATOM   4682 C  CG2 . ILE B 1 288 ? 30.521  5.966   84.027 1.00 33.26  ? 288 ILE B CG2 1 
ATOM   4683 C  CD1 . ILE B 1 288 ? 31.630  7.011   81.359 1.00 47.66  ? 288 ILE B CD1 1 
ATOM   4684 N  N   . GLU B 1 289 ? 28.300  9.911   82.802 1.00 108.11 ? 289 GLU B N   1 
ATOM   4685 C  CA  . GLU B 1 289 ? 28.146  11.315  82.614 1.00 105.51 ? 289 GLU B CA  1 
ATOM   4686 C  C   . GLU B 1 289 ? 27.404  11.965  83.841 1.00 109.62 ? 289 GLU B C   1 
ATOM   4687 O  O   . GLU B 1 289 ? 27.731  13.086  84.078 1.00 114.38 ? 289 GLU B O   1 
ATOM   4688 C  CB  . GLU B 1 289 ? 27.520  11.644  81.228 1.00 99.07  ? 289 GLU B CB  1 
ATOM   4689 C  CG  . GLU B 1 289 ? 28.227  11.017  80.024 1.00 100.88 ? 289 GLU B CG  1 
ATOM   4690 C  CD  . GLU B 1 289 ? 27.576  11.257  78.633 1.00 99.71  ? 289 GLU B CD  1 
ATOM   4691 O  OE1 . GLU B 1 289 ? 27.015  10.342  78.017 1.00 100.09 ? 289 GLU B OE1 1 
ATOM   4692 O  OE2 . GLU B 1 289 ? 27.665  12.353  78.112 1.00 95.71  ? 289 GLU B OE2 1 
ATOM   4693 N  N   . LEU B 1 290 ? 26.470  11.277  84.572 1.00 30.00  ? 290 LEU B N   1 
ATOM   4694 C  CA  . LEU B 1 290 ? 25.672  11.797  85.677 1.00 30.00  ? 290 LEU B CA  1 
ATOM   4695 C  C   . LEU B 1 290 ? 26.150  11.238  87.013 1.00 30.00  ? 290 LEU B C   1 
ATOM   4696 O  O   . LEU B 1 290 ? 26.271  11.970  87.995 1.00 30.00  ? 290 LEU B O   1 
ATOM   4697 C  CB  . LEU B 1 290 ? 24.192  11.470  85.469 1.00 20.00  ? 290 LEU B CB  1 
ATOM   4698 C  CG  . LEU B 1 290 ? 23.687  11.500  84.026 1.00 20.00  ? 290 LEU B CG  1 
ATOM   4699 C  CD1 . LEU B 1 290 ? 22.365  10.758  83.902 1.00 20.00  ? 290 LEU B CD1 1 
ATOM   4700 C  CD2 . LEU B 1 290 ? 23.549  12.933  83.534 1.00 20.00  ? 290 LEU B CD2 1 
HETATM 4701 CU CU  . CU  C 2 .   ? 12.878  -8.324  42.903 0.36 27.23  ? 401 CU  A CU  1 
HETATM 4702 CU CU  . CU  D 2 .   ? 29.190  -5.062  63.432 0.41 33.04  ? 401 CU  B CU  1 
HETATM 4703 O  O   . HOH E 3 .   ? 12.453  3.564   55.979 1.00 14.97  ? 501 HOH A O   1 
HETATM 4704 O  O   . HOH E 3 .   ? 7.134   3.443   42.313 1.00 15.09  ? 502 HOH A O   1 
HETATM 4705 O  O   . HOH E 3 .   ? 19.401  -8.943  54.666 1.00 16.70  ? 503 HOH A O   1 
HETATM 4706 O  O   . HOH E 3 .   ? 5.216   -2.888  41.996 1.00 14.52  ? 504 HOH A O   1 
HETATM 4707 O  O   . HOH E 3 .   ? 27.049  2.489   42.373 1.00 16.74  ? 505 HOH A O   1 
HETATM 4708 O  O   . HOH E 3 .   ? 8.280   -7.325  53.370 1.00 16.92  ? 506 HOH A O   1 
HETATM 4709 O  O   . HOH E 3 .   ? -8.165  -8.316  47.492 1.00 23.99  ? 507 HOH A O   1 
HETATM 4710 O  O   . HOH E 3 .   ? 9.553   8.282   31.740 1.00 18.63  ? 508 HOH A O   1 
HETATM 4711 O  O   . HOH E 3 .   ? 12.620  -9.042  41.129 1.00 16.36  ? 509 HOH A O   1 
HETATM 4712 O  O   . HOH E 3 .   ? 7.307   -3.619  40.370 1.00 16.08  ? 510 HOH A O   1 
HETATM 4713 O  O   . HOH E 3 .   ? -2.603  2.929   42.974 1.00 24.69  ? 511 HOH A O   1 
HETATM 4714 O  O   . HOH E 3 .   ? -3.668  -3.794  45.939 1.00 21.66  ? 512 HOH A O   1 
HETATM 4715 O  O   . HOH E 3 .   ? 9.698   -12.630 42.174 1.00 22.35  ? 513 HOH A O   1 
HETATM 4716 O  O   . HOH E 3 .   ? 3.118   -15.031 30.640 1.00 21.12  ? 514 HOH A O   1 
HETATM 4717 O  O   . HOH E 3 .   ? 28.837  -4.511  31.531 1.00 28.62  ? 515 HOH A O   1 
HETATM 4718 O  O   . HOH E 3 .   ? 11.997  -6.723  23.640 1.00 28.90  ? 516 HOH A O   1 
HETATM 4719 O  O   . HOH E 3 .   ? 25.481  4.236   51.076 1.00 27.44  ? 517 HOH A O   1 
HETATM 4720 O  O   . HOH E 3 .   ? 20.895  -9.140  32.442 1.00 21.13  ? 518 HOH A O   1 
HETATM 4721 O  O   . HOH E 3 .   ? 28.917  2.091   46.545 1.00 27.35  ? 519 HOH A O   1 
HETATM 4722 O  O   . HOH E 3 .   ? 6.415   -18.736 48.391 1.00 21.32  ? 520 HOH A O   1 
HETATM 4723 O  O   . HOH E 3 .   ? 29.517  2.697   34.707 1.00 27.36  ? 521 HOH A O   1 
HETATM 4724 O  O   . HOH E 3 .   ? -7.901  -1.488  44.573 1.00 25.14  ? 522 HOH A O   1 
HETATM 4725 O  O   . HOH E 3 .   ? 24.234  -1.571  27.013 1.00 25.70  ? 523 HOH A O   1 
HETATM 4726 O  O   . HOH E 3 .   ? 1.262   1.959   57.638 1.00 26.24  ? 524 HOH A O   1 
HETATM 4727 O  O   . HOH E 3 .   ? 7.947   -0.359  26.022 1.00 26.23  ? 525 HOH A O   1 
HETATM 4728 O  O   . HOH E 3 .   ? 29.404  -3.867  47.397 1.00 25.65  ? 526 HOH A O   1 
HETATM 4729 O  O   . HOH E 3 .   ? 15.546  7.746   47.373 1.00 24.60  ? 527 HOH A O   1 
HETATM 4730 O  O   . HOH E 3 .   ? 14.683  11.130  30.769 1.00 30.14  ? 528 HOH A O   1 
HETATM 4731 O  O   . HOH E 3 .   ? 9.745   -7.579  55.667 1.00 24.65  ? 529 HOH A O   1 
HETATM 4732 O  O   . HOH E 3 .   ? 15.960  -10.292 45.810 1.00 30.41  ? 530 HOH A O   1 
HETATM 4733 O  O   . HOH E 3 .   ? -5.559  -2.019  46.012 1.00 23.74  ? 531 HOH A O   1 
HETATM 4734 O  O   . HOH E 3 .   ? 25.642  -3.040  37.968 1.00 27.63  ? 532 HOH A O   1 
HETATM 4735 O  O   . HOH E 3 .   ? 30.375  0.838   36.517 1.00 26.46  ? 533 HOH A O   1 
HETATM 4736 O  O   . HOH E 3 .   ? 13.173  -12.955 59.048 1.00 27.02  ? 534 HOH A O   1 
HETATM 4737 O  O   . HOH E 3 .   ? 21.552  -16.502 30.770 1.00 29.50  ? 535 HOH A O   1 
HETATM 4738 O  O   . HOH E 3 .   ? 17.404  -16.514 28.773 1.00 27.85  ? 536 HOH A O   1 
HETATM 4739 O  O   . HOH E 3 .   ? -4.609  -20.411 47.720 1.00 26.55  ? 537 HOH A O   1 
HETATM 4740 O  O   . HOH E 3 .   ? 21.176  -16.173 34.293 1.00 32.34  ? 538 HOH A O   1 
HETATM 4741 O  O   . HOH E 3 .   ? 19.803  -15.171 22.873 1.00 32.33  ? 539 HOH A O   1 
HETATM 4742 O  O   . HOH E 3 .   ? 12.612  10.178  31.978 1.00 25.39  ? 540 HOH A O   1 
HETATM 4743 O  O   . HOH E 3 .   ? 7.158   5.707   50.609 1.00 26.67  ? 541 HOH A O   1 
HETATM 4744 O  O   . HOH E 3 .   ? 29.204  5.176   35.545 1.00 29.44  ? 542 HOH A O   1 
HETATM 4745 O  O   . HOH E 3 .   ? 21.469  13.963  33.775 1.00 28.33  ? 543 HOH A O   1 
HETATM 4746 O  O   . HOH E 3 .   ? 19.194  -17.835 30.177 1.00 30.11  ? 544 HOH A O   1 
HETATM 4747 O  O   . HOH E 3 .   ? 14.031  -20.511 53.385 1.00 26.01  ? 545 HOH A O   1 
HETATM 4748 O  O   . HOH E 3 .   ? 22.968  -7.416  49.565 1.00 27.16  ? 546 HOH A O   1 
HETATM 4749 O  O   . HOH E 3 .   ? 7.697   -22.256 52.992 1.00 35.68  ? 547 HOH A O   1 
HETATM 4750 O  O   . HOH E 3 .   ? 6.191   -21.593 27.533 1.00 35.10  ? 548 HOH A O   1 
HETATM 4751 O  O   . HOH E 3 .   ? 13.259  -14.670 45.400 1.00 31.81  ? 549 HOH A O   1 
HETATM 4752 O  O   . HOH E 3 .   ? -1.469  -15.597 24.970 1.00 36.65  ? 550 HOH A O   1 
HETATM 4753 O  O   . HOH E 3 .   ? 29.971  -10.996 34.107 1.00 32.54  ? 551 HOH A O   1 
HETATM 4754 O  O   . HOH E 3 .   ? -8.314  -6.617  52.281 1.00 36.30  ? 552 HOH A O   1 
HETATM 4755 O  O   . HOH E 3 .   ? 2.046   2.299   26.568 1.00 41.25  ? 553 HOH A O   1 
HETATM 4756 O  O   . HOH E 3 .   ? 6.099   -14.402 60.846 1.00 31.41  ? 554 HOH A O   1 
HETATM 4757 O  O   . HOH E 3 .   ? 8.115   -13.359 59.462 1.00 30.83  ? 555 HOH A O   1 
HETATM 4758 O  O   . HOH E 3 .   ? -7.960  -13.721 50.056 1.00 35.89  ? 556 HOH A O   1 
HETATM 4759 O  O   . HOH E 3 .   ? 1.917   -8.251  62.032 1.00 37.34  ? 557 HOH A O   1 
HETATM 4760 O  O   . HOH E 3 .   ? 6.837   -2.306  24.124 1.00 33.60  ? 558 HOH A O   1 
HETATM 4761 O  O   . HOH E 3 .   ? 1.358   -16.903 36.947 1.00 26.97  ? 559 HOH A O   1 
HETATM 4762 O  O   . HOH E 3 .   ? 13.234  12.063  19.578 1.00 44.45  ? 560 HOH A O   1 
HETATM 4763 O  O   . HOH E 3 .   ? -4.184  2.651   36.597 1.00 35.34  ? 561 HOH A O   1 
HETATM 4764 O  O   . HOH E 3 .   ? 10.020  10.930  30.566 1.00 27.39  ? 562 HOH A O   1 
HETATM 4765 O  O   . HOH E 3 .   ? 1.089   -9.620  23.077 1.00 28.34  ? 563 HOH A O   1 
HETATM 4766 O  O   . HOH E 3 .   ? 4.435   -0.587  23.867 1.00 35.91  ? 564 HOH A O   1 
HETATM 4767 O  O   . HOH E 3 .   ? 10.839  -19.790 61.578 1.00 33.67  ? 565 HOH A O   1 
HETATM 4768 O  O   . HOH E 3 .   ? 10.041  6.370   50.895 1.00 35.21  ? 566 HOH A O   1 
HETATM 4769 O  O   . HOH E 3 .   ? 6.899   0.793   60.362 1.00 42.53  ? 567 HOH A O   1 
HETATM 4770 O  O   . HOH E 3 .   ? 35.329  -7.174  49.385 1.00 35.40  ? 568 HOH A O   1 
HETATM 4771 O  O   . HOH E 3 .   ? 19.440  -12.629 48.056 1.00 30.00  ? 569 HOH A O   1 
HETATM 4772 O  O   . HOH E 3 .   ? -2.435  -14.462 33.016 1.00 35.60  ? 570 HOH A O   1 
HETATM 4773 O  O   . HOH E 3 .   ? 16.159  6.152   49.694 1.00 35.43  ? 571 HOH A O   1 
HETATM 4774 O  O   . HOH E 3 .   ? 8.744   -13.112 22.880 1.00 33.45  ? 572 HOH A O   1 
HETATM 4775 O  O   . HOH E 3 .   ? 11.376  -14.398 21.952 1.00 34.27  ? 573 HOH A O   1 
HETATM 4776 O  O   . HOH E 3 .   ? 26.932  -10.189 38.697 1.00 32.02  ? 574 HOH A O   1 
HETATM 4777 O  O   . HOH E 3 .   ? 7.238   -23.059 30.128 1.00 42.58  ? 575 HOH A O   1 
HETATM 4778 O  O   . HOH E 3 .   ? 25.299  -6.579  22.685 1.00 40.05  ? 576 HOH A O   1 
HETATM 4779 O  O   . HOH E 3 .   ? 5.460   -20.523 52.282 1.00 34.11  ? 577 HOH A O   1 
HETATM 4780 O  O   . HOH E 3 .   ? -8.766  -7.856  31.735 1.00 32.26  ? 578 HOH A O   1 
HETATM 4781 O  O   . HOH E 3 .   ? -6.001  -10.898 56.883 1.00 41.60  ? 579 HOH A O   1 
HETATM 4782 O  O   . HOH E 3 .   ? 17.612  17.925  28.217 1.00 38.28  ? 580 HOH A O   1 
HETATM 4783 O  O   . HOH E 3 .   ? 24.232  -13.647 38.089 1.00 40.88  ? 581 HOH A O   1 
HETATM 4784 O  O   . HOH E 3 .   ? 13.233  -17.969 22.179 1.00 34.47  ? 582 HOH A O   1 
HETATM 4785 O  O   . HOH E 3 .   ? -5.011  3.217   44.350 1.00 44.77  ? 583 HOH A O   1 
HETATM 4786 O  O   . HOH E 3 .   ? 29.947  9.842   45.500 1.00 31.60  ? 584 HOH A O   1 
HETATM 4787 O  O   . HOH E 3 .   ? 27.406  6.519   27.760 1.00 49.24  ? 585 HOH A O   1 
HETATM 4788 O  O   . HOH E 3 .   ? 32.123  6.484   44.144 1.00 46.69  ? 586 HOH A O   1 
HETATM 4789 O  O   . HOH E 3 .   ? -10.898 -14.372 40.418 1.00 40.82  ? 587 HOH A O   1 
HETATM 4790 O  O   . HOH E 3 .   ? 2.245   -23.416 51.948 1.00 45.34  ? 588 HOH A O   1 
HETATM 4791 O  O   . HOH E 3 .   ? 0.183   5.626   49.006 1.00 34.31  ? 589 HOH A O   1 
HETATM 4792 O  O   . HOH E 3 .   ? 13.164  8.054   20.479 1.00 32.89  ? 590 HOH A O   1 
HETATM 4793 O  O   . HOH E 3 .   ? 27.347  0.279   21.057 1.00 35.34  ? 591 HOH A O   1 
HETATM 4794 O  O   . HOH E 3 .   ? -15.010 1.840   47.920 1.00 59.90  ? 592 HOH A O   1 
HETATM 4795 O  O   . HOH E 3 .   ? 5.234   -20.491 56.713 1.00 38.35  ? 593 HOH A O   1 
HETATM 4796 O  O   . HOH E 3 .   ? -6.878  -10.318 54.472 1.00 36.48  ? 594 HOH A O   1 
HETATM 4797 O  O   . HOH E 3 .   ? 14.008  13.916  30.755 1.00 36.65  ? 595 HOH A O   1 
HETATM 4798 O  O   . HOH E 3 .   ? 8.442   5.078   54.404 1.00 46.81  ? 596 HOH A O   1 
HETATM 4799 O  O   . HOH E 3 .   ? 22.697  17.842  38.902 1.00 39.76  ? 597 HOH A O   1 
HETATM 4800 O  O   . HOH E 3 .   ? 22.983  7.455   25.395 1.00 38.45  ? 598 HOH A O   1 
HETATM 4801 O  O   . HOH E 3 .   ? 16.018  -15.824 48.599 1.00 47.01  ? 599 HOH A O   1 
HETATM 4802 O  O   . HOH E 3 .   ? 8.923   -0.203  61.798 1.00 50.95  ? 600 HOH A O   1 
HETATM 4803 O  O   . HOH E 3 .   ? 2.993   -18.634 28.335 1.00 41.35  ? 601 HOH A O   1 
HETATM 4804 O  O   . HOH E 3 .   ? -5.919  2.630   34.426 1.00 35.42  ? 602 HOH A O   1 
HETATM 4805 O  O   . HOH E 3 .   ? 13.572  8.721   48.996 1.00 38.22  ? 603 HOH A O   1 
HETATM 4806 O  O   . HOH E 3 .   ? 20.693  10.929  44.004 1.00 34.17  ? 604 HOH A O   1 
HETATM 4807 O  O   . HOH E 3 .   ? 33.835  -9.768  52.938 1.00 50.19  ? 605 HOH A O   1 
HETATM 4808 O  O   . HOH E 3 .   ? 20.416  -20.488 29.773 1.00 45.94  ? 606 HOH A O   1 
HETATM 4809 O  O   . HOH E 3 .   ? -2.066  -11.521 23.281 1.00 40.38  ? 607 HOH A O   1 
HETATM 4810 O  O   . HOH E 3 .   ? 1.504   -24.692 33.844 1.00 52.78  ? 608 HOH A O   1 
HETATM 4811 O  O   . HOH E 3 .   ? -10.101 -6.414  49.886 1.00 38.38  ? 609 HOH A O   1 
HETATM 4812 O  O   . HOH E 3 .   ? 5.372   -22.566 49.117 1.00 36.01  ? 610 HOH A O   1 
HETATM 4813 O  O   . HOH E 3 .   ? -8.528  -0.210  48.239 1.00 50.52  ? 611 HOH A O   1 
HETATM 4814 O  O   . HOH E 3 .   ? 28.488  4.184   28.903 1.00 40.70  ? 612 HOH A O   1 
HETATM 4815 O  O   . HOH E 3 .   ? 31.019  -9.775  51.405 1.00 31.37  ? 613 HOH A O   1 
HETATM 4816 O  O   . HOH E 3 .   ? 9.514   2.210   63.286 1.00 53.87  ? 614 HOH A O   1 
HETATM 4817 O  O   . HOH E 3 .   ? 25.736  8.176   28.208 1.00 54.17  ? 615 HOH A O   1 
HETATM 4818 O  O   . HOH E 3 .   ? 31.732  -3.360  40.390 1.00 47.92  ? 616 HOH A O   1 
HETATM 4819 O  O   . HOH E 3 .   ? 7.925   12.512  32.119 1.00 32.08  ? 617 HOH A O   1 
HETATM 4820 O  O   . HOH E 3 .   ? 23.585  9.322   27.439 1.00 31.99  ? 618 HOH A O   1 
HETATM 4821 O  O   . HOH E 3 .   ? -4.251  2.880   40.245 1.00 41.66  ? 619 HOH A O   1 
HETATM 4822 O  O   . HOH E 3 .   ? -5.272  -19.901 40.378 1.00 33.88  ? 620 HOH A O   1 
HETATM 4823 O  O   . HOH E 3 .   ? 6.906   14.307  34.662 1.00 40.48  ? 621 HOH A O   1 
HETATM 4824 O  O   . HOH E 3 .   ? 5.011   -16.641 60.481 1.00 40.56  ? 622 HOH A O   1 
HETATM 4825 O  O   . HOH E 3 .   ? 1.680   2.169   59.848 1.00 54.60  ? 623 HOH A O   1 
HETATM 4826 O  O   . HOH E 3 .   ? 14.099  13.755  44.635 1.00 40.00  ? 624 HOH A O   1 
HETATM 4827 O  O   . HOH E 3 .   ? 13.528  4.421   58.721 1.00 43.97  ? 625 HOH A O   1 
HETATM 4828 O  O   . HOH E 3 .   ? 2.497   -16.714 26.767 1.00 36.90  ? 626 HOH A O   1 
HETATM 4829 O  O   . HOH E 3 .   ? 21.103  -18.489 23.296 1.00 48.14  ? 627 HOH A O   1 
HETATM 4830 O  O   . HOH E 3 .   ? 4.697   -0.546  61.075 1.00 35.15  ? 628 HOH A O   1 
HETATM 4831 O  O   . HOH E 3 .   ? 21.417  0.040   18.137 1.00 48.85  ? 629 HOH A O   1 
HETATM 4832 O  O   . HOH E 3 .   ? -1.553  2.248   35.468 1.00 37.44  ? 630 HOH A O   1 
HETATM 4833 O  O   . HOH E 3 .   ? -10.870 -0.798  49.706 1.00 44.21  ? 631 HOH A O   1 
HETATM 4834 O  O   . HOH E 3 .   ? -4.425  2.116   31.962 1.00 44.40  ? 632 HOH A O   1 
HETATM 4835 O  O   . HOH E 3 .   ? -11.389 -4.312  32.851 1.00 51.37  ? 633 HOH A O   1 
HETATM 4836 O  O   . HOH E 3 .   ? 20.315  -3.950  19.904 1.00 42.60  ? 634 HOH A O   1 
HETATM 4837 O  O   . HOH E 3 .   ? 23.105  -20.348 25.282 1.00 48.51  ? 635 HOH A O   1 
HETATM 4838 O  O   . HOH E 3 .   ? -7.004  5.280   34.652 1.00 49.01  ? 636 HOH A O   1 
HETATM 4839 O  O   . HOH E 3 .   ? 19.794  -11.201 19.453 1.00 37.33  ? 637 HOH A O   1 
HETATM 4840 O  O   . HOH E 3 .   ? -10.675 -7.224  33.990 1.00 50.78  ? 638 HOH A O   1 
HETATM 4841 O  O   . HOH E 3 .   ? -5.190  7.382   37.791 1.00 46.88  ? 639 HOH A O   1 
HETATM 4842 O  O   . HOH E 3 .   ? 28.550  -12.809 35.357 1.00 51.59  ? 640 HOH A O   1 
HETATM 4843 O  O   . HOH E 3 .   ? 30.088  -0.928  41.173 1.00 40.79  ? 641 HOH A O   1 
HETATM 4844 O  O   . HOH E 3 .   ? 17.326  -16.442 40.902 1.00 43.64  ? 642 HOH A O   1 
HETATM 4845 O  O   . HOH E 3 .   ? -3.925  -3.258  59.879 1.00 52.03  ? 643 HOH A O   1 
HETATM 4846 O  O   . HOH E 3 .   ? -8.089  -14.879 34.607 1.00 52.08  ? 644 HOH A O   1 
HETATM 4847 O  O   . HOH E 3 .   ? -13.913 -3.964  43.044 1.00 30.18  ? 645 HOH A O   1 
HETATM 4848 O  O   . HOH E 3 .   ? 14.572  -17.934 28.405 1.00 32.26  ? 646 HOH A O   1 
HETATM 4849 O  O   . HOH E 3 .   ? 14.692  14.468  21.381 1.00 32.20  ? 647 HOH A O   1 
HETATM 4850 O  O   . HOH E 3 .   ? 27.553  9.752   30.476 1.00 35.33  ? 648 HOH A O   1 
HETATM 4851 O  O   . HOH E 3 .   ? 20.341  11.227  46.412 1.00 50.04  ? 649 HOH A O   1 
HETATM 4852 O  O   . HOH E 3 .   ? 22.647  16.117  43.139 1.00 30.68  ? 650 HOH A O   1 
HETATM 4853 O  O   . HOH E 3 .   ? -1.497  1.875   32.390 1.00 41.99  ? 651 HOH A O   1 
HETATM 4854 O  O   . HOH E 3 .   ? 7.990   -23.762 27.511 1.00 54.68  ? 652 HOH A O   1 
HETATM 4855 O  O   . HOH E 3 .   ? 16.220  -24.694 29.480 1.00 48.11  ? 653 HOH A O   1 
HETATM 4856 O  O   . HOH E 3 .   ? 3.886   -21.522 26.058 1.00 44.57  ? 654 HOH A O   1 
HETATM 4857 O  O   . HOH E 3 .   ? 25.536  -13.439 34.633 1.00 43.57  ? 655 HOH A O   1 
HETATM 4858 O  O   . HOH E 3 .   ? 16.837  11.523  46.880 1.00 51.17  ? 656 HOH A O   1 
HETATM 4859 O  O   . HOH E 3 .   ? 25.057  -15.285 33.399 1.00 48.78  ? 657 HOH A O   1 
HETATM 4860 O  O   . HOH E 3 .   ? 19.397  -7.021  20.484 1.00 51.82  ? 658 HOH A O   1 
HETATM 4861 O  O   . HOH E 3 .   ? 19.746  6.540   47.970 1.00 38.32  ? 659 HOH A O   1 
HETATM 4862 O  O   . HOH E 3 .   ? 5.714   3.442   58.069 1.00 46.11  ? 660 HOH A O   1 
HETATM 4863 O  O   . HOH E 3 .   ? 0.102   -24.561 49.650 1.00 45.07  ? 661 HOH A O   1 
HETATM 4864 O  O   . HOH E 3 .   ? 22.208  12.354  44.764 1.00 42.43  ? 662 HOH A O   1 
HETATM 4865 O  O   . HOH E 3 .   ? 4.733   -16.001 25.550 1.00 43.89  ? 663 HOH A O   1 
HETATM 4866 O  O   . HOH E 3 .   ? 6.507   -11.213 49.612 1.00 30.00  ? 664 HOH A O   1 
HETATM 4867 O  O   . HOH E 3 .   ? -6.481  -3.677  53.530 1.00 30.00  ? 665 HOH A O   1 
HETATM 4868 O  O   . HOH F 3 .   ? 16.660  5.684   56.876 1.00 11.77  ? 501 HOH B O   1 
HETATM 4869 O  O   . HOH F 3 .   ? 29.036  0.754   68.925 1.00 15.82  ? 502 HOH B O   1 
HETATM 4870 O  O   . HOH F 3 .   ? 23.186  -5.758  51.595 1.00 17.71  ? 503 HOH B O   1 
HETATM 4871 O  O   . HOH F 3 .   ? 12.557  -11.665 65.334 1.00 18.84  ? 504 HOH B O   1 
HETATM 4872 O  O   . HOH F 3 .   ? 28.320  3.344   55.871 1.00 16.30  ? 505 HOH B O   1 
HETATM 4873 O  O   . HOH F 3 .   ? 16.549  1.247   55.444 1.00 20.30  ? 506 HOH B O   1 
HETATM 4874 O  O   . HOH F 3 .   ? 21.037  -17.375 77.854 1.00 20.03  ? 507 HOH B O   1 
HETATM 4875 O  O   . HOH F 3 .   ? 22.889  4.684   70.167 1.00 18.55  ? 508 HOH B O   1 
HETATM 4876 O  O   . HOH F 3 .   ? 42.649  -4.760  73.677 1.00 18.90  ? 509 HOH B O   1 
HETATM 4877 O  O   . HOH F 3 .   ? 36.688  -17.718 71.908 1.00 18.80  ? 510 HOH B O   1 
HETATM 4878 O  O   . HOH F 3 .   ? 28.422  12.712  71.417 1.00 21.79  ? 511 HOH B O   1 
HETATM 4879 O  O   . HOH F 3 .   ? 29.469  -4.221  82.910 1.00 25.80  ? 512 HOH B O   1 
HETATM 4880 O  O   . HOH F 3 .   ? 39.351  14.130  64.053 1.00 23.66  ? 513 HOH B O   1 
HETATM 4881 O  O   . HOH F 3 .   ? 19.753  -20.430 71.844 1.00 18.94  ? 514 HOH B O   1 
HETATM 4882 O  O   . HOH F 3 .   ? 15.398  -14.439 57.709 1.00 25.45  ? 515 HOH B O   1 
HETATM 4883 O  O   . HOH F 3 .   ? 33.701  -20.229 69.042 1.00 29.52  ? 516 HOH B O   1 
HETATM 4884 O  O   . HOH F 3 .   ? 29.077  3.387   68.215 1.00 17.25  ? 517 HOH B O   1 
HETATM 4885 O  O   . HOH F 3 .   ? 34.505  15.667  69.300 1.00 22.63  ? 518 HOH B O   1 
HETATM 4886 O  O   . HOH F 3 .   ? 27.231  3.108   53.332 1.00 19.69  ? 519 HOH B O   1 
HETATM 4887 O  O   . HOH F 3 .   ? 27.536  -10.253 55.577 1.00 25.98  ? 520 HOH B O   1 
HETATM 4888 O  O   . HOH F 3 .   ? 33.691  11.691  66.176 1.00 23.55  ? 521 HOH B O   1 
HETATM 4889 O  O   . HOH F 3 .   ? 27.774  -15.706 70.804 1.00 18.06  ? 522 HOH B O   1 
HETATM 4890 O  O   . HOH F 3 .   ? 18.956  -14.779 67.371 1.00 23.54  ? 523 HOH B O   1 
HETATM 4891 O  O   . HOH F 3 .   ? 34.520  -4.419  63.075 1.00 23.09  ? 524 HOH B O   1 
HETATM 4892 O  O   . HOH F 3 .   ? 20.334  0.836   80.991 1.00 24.11  ? 525 HOH B O   1 
HETATM 4893 O  O   . HOH F 3 .   ? 44.497  -1.881  82.849 1.00 23.96  ? 526 HOH B O   1 
HETATM 4894 O  O   . HOH F 3 .   ? 36.265  -19.087 69.474 1.00 27.19  ? 527 HOH B O   1 
HETATM 4895 O  O   . HOH F 3 .   ? 32.978  -11.254 81.571 1.00 22.62  ? 528 HOH B O   1 
HETATM 4896 O  O   . HOH F 3 .   ? 33.128  18.514  76.288 1.00 19.86  ? 529 HOH B O   1 
HETATM 4897 O  O   . HOH F 3 .   ? 15.389  -2.649  81.937 1.00 28.19  ? 530 HOH B O   1 
HETATM 4898 O  O   . HOH F 3 .   ? 10.193  -6.408  58.397 1.00 28.01  ? 531 HOH B O   1 
HETATM 4899 O  O   . HOH F 3 .   ? 32.731  -23.509 76.843 1.00 25.83  ? 532 HOH B O   1 
HETATM 4900 O  O   . HOH F 3 .   ? 19.004  -21.559 83.186 1.00 27.67  ? 533 HOH B O   1 
HETATM 4901 O  O   . HOH F 3 .   ? 13.463  1.866   66.032 1.00 31.45  ? 534 HOH B O   1 
HETATM 4902 O  O   . HOH F 3 .   ? 30.468  14.799  53.618 1.00 27.16  ? 535 HOH B O   1 
HETATM 4903 O  O   . HOH F 3 .   ? 32.904  -18.661 66.407 1.00 30.16  ? 536 HOH B O   1 
HETATM 4904 O  O   . HOH F 3 .   ? 23.487  -18.210 63.764 1.00 29.18  ? 537 HOH B O   1 
HETATM 4905 O  O   . HOH F 3 .   ? 28.996  -0.423  47.399 1.00 29.56  ? 538 HOH B O   1 
HETATM 4906 O  O   . HOH F 3 .   ? 24.001  14.905  57.069 1.00 22.86  ? 539 HOH B O   1 
HETATM 4907 O  O   . HOH F 3 .   ? 25.850  -23.613 78.759 1.00 32.18  ? 540 HOH B O   1 
HETATM 4908 O  O   . HOH F 3 .   ? 43.572  -1.654  68.049 1.00 24.58  ? 541 HOH B O   1 
HETATM 4909 O  O   . HOH F 3 .   ? 29.263  -20.000 82.324 1.00 24.70  ? 542 HOH B O   1 
HETATM 4910 O  O   . HOH F 3 .   ? 35.406  -21.151 77.555 1.00 28.58  ? 543 HOH B O   1 
HETATM 4911 O  O   . HOH F 3 .   ? 26.652  12.102  49.615 1.00 33.91  ? 544 HOH B O   1 
HETATM 4912 O  O   . HOH F 3 .   ? 28.994  15.455  71.116 1.00 35.51  ? 545 HOH B O   1 
HETATM 4913 O  O   . HOH F 3 .   ? 48.774  8.235   68.070 1.00 45.88  ? 546 HOH B O   1 
HETATM 4914 O  O   . HOH F 3 .   ? 31.515  3.126   47.951 1.00 30.49  ? 547 HOH B O   1 
HETATM 4915 O  O   . HOH F 3 .   ? 12.804  -16.649 71.694 1.00 27.87  ? 548 HOH B O   1 
HETATM 4916 O  O   . HOH F 3 .   ? 46.115  -5.455  63.357 1.00 42.78  ? 549 HOH B O   1 
HETATM 4917 O  O   . HOH F 3 .   ? 43.741  -8.318  77.861 1.00 35.88  ? 550 HOH B O   1 
HETATM 4918 O  O   . HOH F 3 .   ? 21.358  -10.153 55.722 1.00 22.03  ? 551 HOH B O   1 
HETATM 4919 O  O   . HOH F 3 .   ? 18.262  0.669   83.169 1.00 30.20  ? 552 HOH B O   1 
HETATM 4920 O  O   . HOH F 3 .   ? 39.746  -14.580 80.035 1.00 32.32  ? 553 HOH B O   1 
HETATM 4921 O  O   . HOH F 3 .   ? 47.234  6.340   58.539 1.00 32.42  ? 554 HOH B O   1 
HETATM 4922 O  O   . HOH F 3 .   ? 47.410  10.921  68.481 1.00 32.19  ? 555 HOH B O   1 
HETATM 4923 O  O   . HOH F 3 .   ? 40.036  18.952  70.506 1.00 34.97  ? 556 HOH B O   1 
HETATM 4924 O  O   . HOH F 3 .   ? 41.349  -3.983  83.152 1.00 31.37  ? 557 HOH B O   1 
HETATM 4925 O  O   . HOH F 3 .   ? 46.853  -3.527  79.452 1.00 39.56  ? 558 HOH B O   1 
HETATM 4926 O  O   . HOH F 3 .   ? 23.183  -28.203 81.179 1.00 35.42  ? 559 HOH B O   1 
HETATM 4927 O  O   . HOH F 3 .   ? 41.455  -17.814 77.988 1.00 35.72  ? 560 HOH B O   1 
HETATM 4928 O  O   . HOH F 3 .   ? 47.663  1.461   53.529 1.00 33.92  ? 561 HOH B O   1 
HETATM 4929 O  O   . HOH F 3 .   ? 12.636  -11.941 82.374 1.00 36.11  ? 562 HOH B O   1 
HETATM 4930 O  O   . HOH F 3 .   ? 20.845  -23.681 53.977 1.00 30.13  ? 563 HOH B O   1 
HETATM 4931 O  O   . HOH F 3 .   ? 35.043  -0.967  42.792 1.00 37.34  ? 564 HOH B O   1 
HETATM 4932 O  O   . HOH F 3 .   ? 30.658  2.248   84.833 1.00 37.82  ? 565 HOH B O   1 
HETATM 4933 O  O   . HOH F 3 .   ? 48.819  4.188   65.356 1.00 25.92  ? 566 HOH B O   1 
HETATM 4934 O  O   . HOH F 3 .   ? 13.760  -17.331 77.802 1.00 29.24  ? 567 HOH B O   1 
HETATM 4935 O  O   . HOH F 3 .   ? 19.107  8.951   63.486 1.00 32.52  ? 568 HOH B O   1 
HETATM 4936 O  O   . HOH F 3 .   ? 44.860  13.351  74.286 1.00 35.99  ? 569 HOH B O   1 
HETATM 4937 O  O   . HOH F 3 .   ? 38.439  17.291  62.958 1.00 38.29  ? 570 HOH B O   1 
HETATM 4938 O  O   . HOH F 3 .   ? 29.267  13.613  51.437 1.00 42.04  ? 571 HOH B O   1 
HETATM 4939 O  O   . HOH F 3 .   ? 39.845  -2.142  55.947 1.00 29.10  ? 572 HOH B O   1 
HETATM 4940 O  O   . HOH F 3 .   ? 39.894  -11.802 80.220 1.00 28.94  ? 573 HOH B O   1 
HETATM 4941 O  O   . HOH F 3 .   ? 30.196  -9.162  88.041 1.00 28.70  ? 574 HOH B O   1 
HETATM 4942 O  O   . HOH F 3 .   ? 43.196  8.509   78.496 1.00 37.13  ? 575 HOH B O   1 
HETATM 4943 O  O   . HOH F 3 .   ? 13.583  -1.143  83.579 1.00 40.22  ? 576 HOH B O   1 
HETATM 4944 O  O   . HOH F 3 .   ? 46.035  10.898  65.938 1.00 37.22  ? 577 HOH B O   1 
HETATM 4945 O  O   . HOH F 3 .   ? 18.431  -17.457 51.743 1.00 41.64  ? 578 HOH B O   1 
HETATM 4946 O  O   . HOH F 3 .   ? 37.050  -23.294 75.534 1.00 36.29  ? 579 HOH B O   1 
HETATM 4947 O  O   . HOH F 3 .   ? 33.865  17.123  60.325 1.00 40.12  ? 580 HOH B O   1 
HETATM 4948 O  O   . HOH F 3 .   ? 42.677  17.094  71.851 1.00 36.44  ? 581 HOH B O   1 
HETATM 4949 O  O   . HOH F 3 .   ? 44.617  0.877   72.995 1.00 24.79  ? 582 HOH B O   1 
HETATM 4950 O  O   . HOH F 3 .   ? 46.730  -1.940  61.074 1.00 38.14  ? 583 HOH B O   1 
HETATM 4951 O  O   . HOH F 3 .   ? 24.223  -18.657 83.631 1.00 34.39  ? 584 HOH B O   1 
HETATM 4952 O  O   . HOH F 3 .   ? 18.562  -5.888  92.690 1.00 45.29  ? 585 HOH B O   1 
HETATM 4953 O  O   . HOH F 3 .   ? 20.072  -22.064 55.793 1.00 44.00  ? 586 HOH B O   1 
HETATM 4954 O  O   . HOH F 3 .   ? 23.698  -23.269 66.385 1.00 35.30  ? 587 HOH B O   1 
HETATM 4955 O  O   . HOH F 3 .   ? 37.077  16.795  60.696 1.00 36.31  ? 588 HOH B O   1 
HETATM 4956 O  O   . HOH F 3 .   ? 23.413  12.410  52.545 1.00 37.54  ? 589 HOH B O   1 
HETATM 4957 O  O   . HOH F 3 .   ? 36.013  -16.580 68.351 1.00 37.46  ? 590 HOH B O   1 
HETATM 4958 O  O   . HOH F 3 .   ? 17.483  -20.307 52.022 1.00 30.00  ? 591 HOH B O   1 
HETATM 4959 O  O   . HOH F 3 .   ? 21.985  16.092  60.564 1.00 44.08  ? 592 HOH B O   1 
HETATM 4960 O  O   . HOH F 3 .   ? 36.874  2.131   81.478 1.00 48.21  ? 593 HOH B O   1 
HETATM 4961 O  O   . HOH F 3 .   ? 38.642  -21.291 76.927 1.00 43.47  ? 594 HOH B O   1 
HETATM 4962 O  O   . HOH F 3 .   ? 27.104  19.103  61.756 1.00 37.05  ? 595 HOH B O   1 
HETATM 4963 O  O   . HOH F 3 .   ? 40.894  -3.470  50.443 1.00 39.51  ? 596 HOH B O   1 
HETATM 4964 O  O   . HOH F 3 .   ? 8.736   -5.413  78.815 1.00 38.89  ? 597 HOH B O   1 
HETATM 4965 O  O   . HOH F 3 .   ? 11.632  -13.250 80.537 1.00 49.02  ? 598 HOH B O   1 
HETATM 4966 O  O   . HOH F 3 .   ? 10.849  -14.865 72.235 1.00 29.84  ? 599 HOH B O   1 
HETATM 4967 O  O   . HOH F 3 .   ? 21.187  -26.604 81.723 1.00 34.74  ? 600 HOH B O   1 
HETATM 4968 O  O   . HOH F 3 .   ? 26.543  -5.212  47.697 1.00 45.93  ? 601 HOH B O   1 
HETATM 4969 O  O   . HOH F 3 .   ? 31.687  -5.021  83.964 1.00 30.46  ? 602 HOH B O   1 
HETATM 4970 O  O   . HOH F 3 .   ? 23.427  -26.366 66.550 1.00 40.05  ? 603 HOH B O   1 
HETATM 4971 O  O   . HOH F 3 .   ? 25.738  -18.327 59.079 1.00 42.29  ? 604 HOH B O   1 
HETATM 4972 O  O   . HOH F 3 .   ? 13.987  -16.458 64.512 1.00 38.47  ? 605 HOH B O   1 
HETATM 4973 O  O   . HOH F 3 .   ? 42.373  -7.756  64.529 1.00 47.80  ? 606 HOH B O   1 
HETATM 4974 O  O   . HOH F 3 .   ? 11.754  -18.108 75.293 1.00 46.46  ? 607 HOH B O   1 
HETATM 4975 O  O   . HOH F 3 .   ? 43.189  12.638  59.590 1.00 40.14  ? 608 HOH B O   1 
HETATM 4976 O  O   . HOH F 3 .   ? 33.161  -6.949  58.562 1.00 38.12  ? 609 HOH B O   1 
HETATM 4977 O  O   . HOH F 3 .   ? 28.867  -7.767  90.200 1.00 36.34  ? 610 HOH B O   1 
HETATM 4978 O  O   . HOH F 3 .   ? 43.093  -19.140 74.425 1.00 43.49  ? 611 HOH B O   1 
HETATM 4979 O  O   . HOH F 3 .   ? 13.657  7.857   51.521 1.00 47.02  ? 612 HOH B O   1 
HETATM 4980 O  O   . HOH F 3 .   ? 22.528  17.511  57.952 1.00 46.56  ? 613 HOH B O   1 
HETATM 4981 O  O   . HOH F 3 .   ? 30.836  -11.821 90.066 1.00 46.98  ? 614 HOH B O   1 
HETATM 4982 O  O   . HOH F 3 .   ? 39.480  -16.030 72.138 1.00 28.44  ? 615 HOH B O   1 
HETATM 4983 O  O   . HOH F 3 .   ? 17.083  -1.068  80.921 1.00 32.14  ? 616 HOH B O   1 
HETATM 4984 O  O   . HOH F 3 .   ? 28.323  -18.399 63.371 1.00 33.98  ? 617 HOH B O   1 
HETATM 4985 O  O   . HOH F 3 .   ? 29.329  -16.293 85.565 1.00 46.53  ? 618 HOH B O   1 
HETATM 4986 O  O   . HOH F 3 .   ? 26.227  -21.751 64.930 1.00 39.80  ? 619 HOH B O   1 
HETATM 4987 O  O   . HOH F 3 .   ? 23.595  19.443  58.212 1.00 46.43  ? 620 HOH B O   1 
HETATM 4988 O  O   . HOH F 3 .   ? 35.215  -24.347 77.400 1.00 48.46  ? 621 HOH B O   1 
HETATM 4989 O  O   . HOH F 3 .   ? 33.814  -22.951 69.338 1.00 37.63  ? 622 HOH B O   1 
HETATM 4990 O  O   . HOH F 3 .   ? 25.088  -7.357  87.046 1.00 48.75  ? 623 HOH B O   1 
HETATM 4991 O  O   . HOH F 3 .   ? 34.828  -6.214  54.425 1.00 38.08  ? 624 HOH B O   1 
HETATM 4992 O  O   . HOH F 3 .   ? 19.947  11.973  56.623 1.00 44.27  ? 625 HOH B O   1 
HETATM 4993 O  O   . HOH F 3 .   ? 45.279  -6.357  76.607 1.00 42.75  ? 626 HOH B O   1 
HETATM 4994 O  O   . HOH F 3 .   ? 30.489  -21.405 66.282 1.00 37.79  ? 627 HOH B O   1 
HETATM 4995 O  O   . HOH F 3 .   ? 41.603  10.210  51.442 1.00 49.51  ? 628 HOH B O   1 
HETATM 4996 O  O   . HOH F 3 .   ? 32.660  -8.218  86.999 1.00 46.83  ? 629 HOH B O   1 
HETATM 4997 O  O   . HOH F 3 .   ? 44.259  -7.316  62.931 1.00 54.08  ? 630 HOH B O   1 
HETATM 4998 O  O   . HOH F 3 .   ? 30.835  15.661  73.093 1.00 32.16  ? 631 HOH B O   1 
HETATM 4999 O  O   . HOH F 3 .   ? 27.955  -19.974 65.707 1.00 43.68  ? 632 HOH B O   1 
HETATM 5000 O  O   . HOH F 3 .   ? 19.783  -22.616 51.641 1.00 47.99  ? 633 HOH B O   1 
HETATM 5001 O  O   . HOH F 3 .   ? 48.346  4.275   56.848 1.00 44.39  ? 634 HOH B O   1 
HETATM 5002 O  O   . HOH F 3 .   ? 30.268  -5.766  65.100 1.00 14.22  ? 635 HOH B O   1 
HETATM 5003 O  O   . HOH F 3 .   ? 22.282  15.060  54.918 1.00 36.74  ? 636 HOH B O   1 
HETATM 5004 O  O   . HOH F 3 .   ? 48.044  7.777   55.667 1.00 39.73  ? 637 HOH B O   1 
HETATM 5005 O  O   . HOH F 3 .   ? 49.494  3.040   54.549 1.00 43.43  ? 638 HOH B O   1 
HETATM 5006 O  O   . HOH F 3 .   ? 20.654  -13.247 58.852 1.00 35.92  ? 639 HOH B O   1 
HETATM 5007 O  O   . HOH F 3 .   ? 47.401  -1.701  69.901 1.00 44.31  ? 640 HOH B O   1 
HETATM 5008 O  O   . HOH F 3 .   ? 30.378  17.364  75.064 1.00 44.12  ? 641 HOH B O   1 
HETATM 5009 O  O   . HOH F 3 .   ? 33.191  14.199  67.229 1.00 22.48  ? 642 HOH B O   1 
HETATM 5010 O  O   . HOH F 3 .   ? 29.407  16.555  68.142 1.00 33.33  ? 643 HOH B O   1 
HETATM 5011 O  O   . HOH F 3 .   ? 14.238  1.583   62.638 1.00 29.85  ? 644 HOH B O   1 
HETATM 5012 O  O   . HOH F 3 .   ? 24.198  3.450   86.968 1.00 46.27  ? 645 HOH B O   1 
HETATM 5013 O  O   . HOH F 3 .   ? 31.967  -2.663  85.485 1.00 36.30  ? 646 HOH B O   1 
HETATM 5014 O  O   . HOH F 3 .   ? 34.638  3.080   82.525 1.00 36.51  ? 647 HOH B O   1 
HETATM 5015 O  O   . HOH F 3 .   ? 31.594  16.364  66.346 1.00 32.95  ? 648 HOH B O   1 
HETATM 5016 O  O   . HOH F 3 .   ? 39.814  2.559   81.332 1.00 38.23  ? 649 HOH B O   1 
HETATM 5017 O  O   . HOH F 3 .   ? 19.082  -25.453 76.381 1.00 38.52  ? 650 HOH B O   1 
HETATM 5018 O  O   . HOH F 3 .   ? 40.402  3.115   84.304 1.00 50.47  ? 651 HOH B O   1 
HETATM 5019 O  O   . HOH F 3 .   ? 28.109  14.292  86.278 1.00 45.00  ? 652 HOH B O   1 
HETATM 5020 O  O   . HOH F 3 .   ? 23.276  -17.266 87.637 1.00 42.43  ? 653 HOH B O   1 
HETATM 5021 O  O   . HOH F 3 .   ? 5.015   -10.894 64.656 1.00 51.46  ? 654 HOH B O   1 
HETATM 5022 O  O   . HOH F 3 .   ? 14.989  -5.270  92.126 1.00 47.58  ? 655 HOH B O   1 
HETATM 5023 O  O   . HOH F 3 .   ? 13.833  5.622   79.910 1.00 48.48  ? 656 HOH B O   1 
HETATM 5024 O  O   . HOH F 3 .   ? 30.229  11.438  49.068 1.00 40.81  ? 657 HOH B O   1 
HETATM 5025 O  O   . HOH F 3 .   ? 21.436  -26.839 68.050 1.00 51.16  ? 658 HOH B O   1 
HETATM 5026 O  O   . HOH F 3 .   ? 21.781  -12.347 56.812 1.00 53.74  ? 659 HOH B O   1 
HETATM 5027 O  O   . HOH F 3 .   ? 32.586  13.654  49.477 1.00 40.73  ? 660 HOH B O   1 
HETATM 5028 O  O   . HOH F 3 .   ? 28.352  -7.001  59.382 1.00 28.77  ? 661 HOH B O   1 
HETATM 5029 O  O   . HOH F 3 .   ? 13.424  -17.524 69.238 1.00 27.31  ? 662 HOH B O   1 
HETATM 5030 O  O   . HOH F 3 .   ? 23.398  14.130  66.427 1.00 32.57  ? 663 HOH B O   1 
HETATM 5031 O  O   . HOH F 3 .   ? 11.053  -12.131 61.107 1.00 35.26  ? 664 HOH B O   1 
HETATM 5032 O  O   . HOH F 3 .   ? 30.769  -7.675  58.351 1.00 39.28  ? 665 HOH B O   1 
HETATM 5033 O  O   . HOH F 3 .   ? 45.242  17.013  72.613 1.00 50.18  ? 666 HOH B O   1 
HETATM 5034 O  O   . HOH F 3 .   ? 33.792  -12.361 61.533 1.00 45.11  ? 667 HOH B O   1 
HETATM 5035 O  O   . HOH F 3 .   ? 17.165  -21.980 65.796 1.00 44.85  ? 668 HOH B O   1 
HETATM 5036 O  O   . HOH F 3 .   ? 35.185  -7.068  60.507 1.00 42.80  ? 669 HOH B O   1 
HETATM 5037 O  O   . HOH F 3 .   ? 25.834  -21.732 80.357 1.00 30.00  ? 670 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  TRP 68  68  68  TRP TRP A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  TRP 92  92  92  TRP TRP A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 TRP 136 136 136 TRP TRP A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 THR 161 161 161 THR THR A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 TYR 177 177 177 TYR TYR A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 ASN 192 192 192 ASN ASN A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 PRO 201 201 201 PRO PRO A . n 
A 1 202 GLN 202 202 202 GLN GLN A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 HIS 204 204 204 HIS HIS A . n 
A 1 205 ASP 205 205 205 ASP ASP A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 TRP 210 210 210 TRP TRP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 PRO 219 219 219 PRO PRO A . n 
A 1 220 THR 220 220 220 THR THR A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 ASN 223 223 223 ASN ASN A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 HIS 231 231 231 HIS HIS A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 TRP 238 238 238 TRP TRP A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 TRP 241 241 241 TRP TRP A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ASN 247 247 247 ASN ASN A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 TYR 250 250 250 TYR TYR A . n 
A 1 251 GLN 251 251 251 GLN GLN A . n 
A 1 252 PRO 252 252 252 PRO PRO A . n 
A 1 253 MET 253 253 253 MET MET A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 GLN 260 260 260 GLN GLN A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 PHE 262 262 262 PHE PHE A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 PRO 265 265 265 PRO PRO A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 TYR 267 267 267 TYR TYR A . n 
A 1 268 PRO 268 268 268 PRO PRO A . n 
A 1 269 TRP 269 269 269 TRP TRP A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 THR 272 272 272 THR THR A . n 
A 1 273 PRO 273 273 273 PRO PRO A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
A 1 280 ARG 280 280 280 ARG ARG A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 TYR 284 284 284 TYR TYR A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 TYR 286 286 286 TYR TYR A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 LEU 290 290 ?   ?   ?   A . n 
A 1 291 ARG 291 291 ?   ?   ?   A . n 
A 1 292 LYS 292 292 ?   ?   ?   A . n 
A 1 293 SER 293 293 ?   ?   ?   A . n 
A 1 294 LYS 294 294 ?   ?   ?   A . n 
A 1 295 ARG 295 295 ?   ?   ?   A . n 
A 1 296 SER 296 296 ?   ?   ?   A . n 
A 1 297 SER 297 297 ?   ?   ?   A . n 
A 1 298 HIS 298 298 ?   ?   ?   A . n 
A 1 299 HIS 299 299 ?   ?   ?   A . n 
A 1 300 HIS 300 300 ?   ?   ?   A . n 
A 1 301 HIS 301 301 ?   ?   ?   A . n 
A 1 302 HIS 302 302 ?   ?   ?   A . n 
A 1 303 HIS 303 303 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ASN 3   3   ?   ?   ?   B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   TYR 5   5   5   TYR TYR B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   ARG 8   8   8   ARG ARG B . n 
B 1 9   LYS 9   9   9   LYS LYS B . n 
B 1 10  ASN 10  10  10  ASN ASN B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  HIS 13  13  13  HIS HIS B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  ASP 16  16  16  ASP ASP B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  GLU 18  18  18  GLU GLU B . n 
B 1 19  LYS 19  19  19  LYS LYS B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  PHE 22  22  22  PHE PHE B . n 
B 1 23  VAL 23  23  23  VAL VAL B . n 
B 1 24  ARG 24  24  24  ARG ARG B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  VAL 26  26  26  VAL VAL B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  ILE 28  28  28  ILE ILE B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  GLU 31  31  31  GLU GLU B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  GLY 33  33  33  GLY GLY B . n 
B 1 34  ILE 34  34  34  ILE ILE B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  TYR 38  38  38  TYR TYR B . n 
B 1 39  ILE 39  39  39  ILE ILE B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  TRP 41  41  41  TRP TRP B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  LYS 47  47  47  LYS LYS B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  HIS 49  49  49  HIS HIS B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  GLY 53  53  53  GLY GLY B . n 
B 1 54  SER 54  54  54  SER SER B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  ALA 59  59  59  ALA ALA B . n 
B 1 60  HIS 60  60  60  HIS HIS B . n 
B 1 61  MET 61  61  61  MET MET B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  PRO 67  67  67  PRO PRO B . n 
B 1 68  TRP 68  68  68  TRP TRP B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  ARG 70  70  70  ARG ARG B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  ARG 75  75  75  ARG ARG B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  ARG 78  78  78  ARG ARG B . n 
B 1 79  ASP 79  79  79  ASP ASP B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  GLN 81  81  81  GLN GLN B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  ILE 83  83  83  ILE ILE B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  PRO 85  85  85  PRO PRO B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  THR 88  88  88  THR THR B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  PRO 90  90  90  PRO PRO B . n 
B 1 91  TYR 91  91  91  TYR TYR B . n 
B 1 92  TRP 92  92  92  TRP TRP B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 MET 100 100 100 MET MET B . n 
B 1 101 GLN 101 101 101 GLN GLN B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 PRO 103 103 103 PRO PRO B . n 
B 1 104 SER 104 104 104 SER SER B . n 
B 1 105 GLN 105 105 105 GLN GLN B . n 
B 1 106 SER 106 106 106 SER SER B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 TRP 109 109 109 TRP TRP B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 PHE 113 113 113 PHE PHE B . n 
B 1 114 MET 114 114 114 MET MET B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 PRO 120 120 120 PRO PRO B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 LYS 122 122 122 LYS LYS B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 ASP 127 127 127 ASP ASP B . n 
B 1 128 THR 128 128 128 THR THR B . n 
B 1 129 GLY 129 129 129 GLY GLY B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 PHE 131 131 131 PHE PHE B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 ARG 135 135 135 ARG ARG B . n 
B 1 136 TRP 136 136 136 TRP TRP B . n 
B 1 137 THR 137 137 137 THR THR B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 GLU 141 141 141 GLU GLU B . n 
B 1 142 GLN 142 142 142 GLN GLN B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ASN 144 144 144 ASN ASN B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 GLY 147 147 147 GLY GLY B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 ASN 152 152 152 ASN ASN B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 ALA 155 155 155 ALA ALA B . n 
B 1 156 THR 156 156 156 THR THR B . n 
B 1 157 LYS 157 157 157 LYS LYS B . n 
B 1 158 GLU 158 158 158 GLU GLU B . n 
B 1 159 ALA 159 159 159 ALA ALA B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 THR 161 161 161 THR THR B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 PRO 163 163 163 PRO PRO B . n 
B 1 164 THR 164 164 164 THR THR B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 LYS 173 173 173 LYS LYS B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 TYR 177 177 177 TYR TYR B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 THR 179 179 179 THR THR B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 MET 184 184 184 MET MET B . n 
B 1 185 THR 185 185 185 THR THR B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 GLN 187 187 187 GLN GLN B . n 
B 1 188 ASN 188 188 188 ASN ASN B . n 
B 1 189 SER 189 189 189 SER SER B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 ASN 192 192 192 ASN ASN B . n 
B 1 193 GLN 193 193 193 GLN GLN B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 GLU 195 195 195 GLU GLU B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 ILE 198 198 198 ILE ILE B . n 
B 1 199 ASN 199 199 199 ASN ASN B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 PRO 201 201 201 PRO PRO B . n 
B 1 202 GLN 202 202 202 GLN GLN B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 HIS 204 204 204 HIS HIS B . n 
B 1 205 ASP 205 205 205 ASP ASP B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 VAL 207 207 207 VAL VAL B . n 
B 1 208 HIS 208 208 208 HIS HIS B . n 
B 1 209 ARG 209 209 209 ARG ARG B . n 
B 1 210 TRP 210 210 210 TRP TRP B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 GLN 214 214 214 GLN GLN B . n 
B 1 215 MET 215 215 215 MET MET B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 VAL 217 217 217 VAL VAL B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
B 1 219 PRO 219 219 219 PRO PRO B . n 
B 1 220 THR 220 220 220 THR THR B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 PRO 222 222 222 PRO PRO B . n 
B 1 223 ASN 223 223 223 ASN ASN B . n 
B 1 224 ASP 224 224 224 ASP ASP B . n 
B 1 225 PRO 225 225 225 PRO PRO B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 PHE 227 227 227 PHE PHE B . n 
B 1 228 PHE 228 228 228 PHE PHE B . n 
B 1 229 LEU 229 229 229 LEU LEU B . n 
B 1 230 HIS 230 230 230 HIS HIS B . n 
B 1 231 HIS 231 231 231 HIS HIS B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 VAL 234 234 234 VAL VAL B . n 
B 1 235 ASP 235 235 235 ASP ASP B . n 
B 1 236 ARG 236 236 236 ARG ARG B . n 
B 1 237 ILE 237 237 237 ILE ILE B . n 
B 1 238 TRP 238 238 238 TRP TRP B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 VAL 240 240 240 VAL VAL B . n 
B 1 241 TRP 241 241 241 TRP TRP B . n 
B 1 242 GLN 242 242 242 GLN GLN B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 ILE 244 244 244 ILE ILE B . n 
B 1 245 HIS 245 245 245 HIS HIS B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ASN 247 247 247 ASN ASN B . n 
B 1 248 GLN 248 248 248 GLN GLN B . n 
B 1 249 ASN 249 249 249 ASN ASN B . n 
B 1 250 TYR 250 250 250 TYR TYR B . n 
B 1 251 GLN 251 251 251 GLN GLN B . n 
B 1 252 PRO 252 252 252 PRO PRO B . n 
B 1 253 MET 253 253 253 MET MET B . n 
B 1 254 LYS 254 254 254 LYS LYS B . n 
B 1 255 ASN 255 255 255 ASN ASN B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 PRO 257 257 257 PRO PRO B . n 
B 1 258 PHE 258 258 258 PHE PHE B . n 
B 1 259 GLY 259 259 259 GLY GLY B . n 
B 1 260 GLN 260 260 260 GLN GLN B . n 
B 1 261 ASN 261 261 261 ASN ASN B . n 
B 1 262 PHE 262 262 262 PHE PHE B . n 
B 1 263 ARG 263 263 263 ARG ARG B . n 
B 1 264 ASP 264 264 264 ASP ASP B . n 
B 1 265 PRO 265 265 265 PRO PRO B . n 
B 1 266 MET 266 266 266 MET MET B . n 
B 1 267 TYR 267 267 267 TYR TYR B . n 
B 1 268 PRO 268 268 268 PRO PRO B . n 
B 1 269 TRP 269 269 269 TRP TRP B . n 
B 1 270 ASN 270 270 270 ASN ASN B . n 
B 1 271 THR 271 271 271 THR THR B . n 
B 1 272 THR 272 272 272 THR THR B . n 
B 1 273 PRO 273 273 273 PRO PRO B . n 
B 1 274 GLU 274 274 274 GLU GLU B . n 
B 1 275 ASP 275 275 275 ASP ASP B . n 
B 1 276 VAL 276 276 276 VAL VAL B . n 
B 1 277 MET 277 277 277 MET MET B . n 
B 1 278 ASN 278 278 278 ASN ASN B . n 
B 1 279 HIS 279 279 279 HIS HIS B . n 
B 1 280 ARG 280 280 280 ARG ARG B . n 
B 1 281 LYS 281 281 281 LYS LYS B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 TYR 284 284 284 TYR TYR B . n 
B 1 285 VAL 285 285 285 VAL VAL B . n 
B 1 286 TYR 286 286 286 TYR TYR B . n 
B 1 287 ASP 287 287 287 ASP ASP B . n 
B 1 288 ILE 288 288 288 ILE ILE B . n 
B 1 289 GLU 289 289 289 GLU GLU B . n 
B 1 290 LEU 290 290 290 LEU LEU B . n 
B 1 291 ARG 291 291 ?   ?   ?   B . n 
B 1 292 LYS 292 292 ?   ?   ?   B . n 
B 1 293 SER 293 293 ?   ?   ?   B . n 
B 1 294 LYS 294 294 ?   ?   ?   B . n 
B 1 295 ARG 295 295 ?   ?   ?   B . n 
B 1 296 SER 296 296 ?   ?   ?   B . n 
B 1 297 SER 297 297 ?   ?   ?   B . n 
B 1 298 HIS 298 298 ?   ?   ?   B . n 
B 1 299 HIS 299 299 ?   ?   ?   B . n 
B 1 300 HIS 300 300 ?   ?   ?   B . n 
B 1 301 HIS 301 301 ?   ?   ?   B . n 
B 1 302 HIS 302 302 ?   ?   ?   B . n 
B 1 303 HIS 303 303 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 42 ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 401 ? 1_555 O   ? E HOH .  ? A HOH 509 ? 1_555 122.3 ? 
2  NE2 ? A HIS 42 ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 401 ? 1_555 NE2 ? A HIS 60 ? A HIS 60  ? 1_555 107.9 ? 
3  O   ? E HOH .  ? A HOH 509 ? 1_555 CU ? C CU . ? A CU 401 ? 1_555 NE2 ? A HIS 60 ? A HIS 60  ? 1_555 94.2  ? 
4  NE2 ? A HIS 42 ? A HIS 42  ? 1_555 CU ? C CU . ? A CU 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69  ? 1_555 107.1 ? 
5  O   ? E HOH .  ? A HOH 509 ? 1_555 CU ? C CU . ? A CU 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69  ? 1_555 115.3 ? 
6  NE2 ? A HIS 60 ? A HIS 60  ? 1_555 CU ? C CU . ? A CU 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69  ? 1_555 108.3 ? 
7  NE2 ? B HIS 42 ? B HIS 42  ? 1_555 CU ? D CU . ? B CU 401 ? 1_555 NE2 ? B HIS 60 ? B HIS 60  ? 1_555 107.0 ? 
8  NE2 ? B HIS 42 ? B HIS 42  ? 1_555 CU ? D CU . ? B CU 401 ? 1_555 O   ? F HOH .  ? B HOH 635 ? 1_555 123.4 ? 
9  NE2 ? B HIS 60 ? B HIS 60  ? 1_555 CU ? D CU . ? B CU 401 ? 1_555 O   ? F HOH .  ? B HOH 635 ? 1_555 104.4 ? 
10 NE2 ? B HIS 42 ? B HIS 42  ? 1_555 CU ? D CU . ? B CU 401 ? 1_555 NE2 ? B HIS 69 ? B HIS 69  ? 1_555 108.2 ? 
11 NE2 ? B HIS 60 ? B HIS 60  ? 1_555 CU ? D CU . ? B CU 401 ? 1_555 NE2 ? B HIS 69 ? B HIS 69  ? 1_555 108.8 ? 
12 O   ? F HOH .  ? B HOH 635 ? 1_555 CU ? D CU . ? B CU 401 ? 1_555 NE2 ? B HIS 69 ? B HIS 69  ? 1_555 104.4 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_phasing_MR.entry_id                     4J6V 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           43.840 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        43.840 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .         ?                                 package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    
'data reduction'  http://www.mrc-lmb.cam.ac.uk/harry/mosflm/  ?          ? 
2 SCALA       3.3.20    2011/05/18                        other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling' 
http://www.ccp4.ac.uk/dist/html/scala.html  Fortran_77 ? 
3 PHASER      2.3.0     'Tue Oct 18 19:46:39 2011 (svn )' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing 
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 
4 PHENIX      1.7.3_928 ?                                 package 'Paul D. Adams'      PDAdams@lbl.gov             refinement 
http://www.phenix-online.org/               C++        ? 
5 PDB_EXTRACT 3.11      'April 22, 2011'                  package PDB                  deposit@deposit.rcsb.org    
'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/   C++        ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_1              147 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_2              147 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_3              147 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.73 
_pdbx_validate_rmsd_angle.angle_target_value         113.10 
_pdbx_validate_rmsd_angle.angle_deviation            15.63 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 109 ? ? -95.88  33.82   
2  1 PHE A 113 ? ? -137.33 -100.12 
3  1 TRP A 136 ? ? -163.75 108.54  
4  1 LEU A 203 ? ? 65.72   -124.90 
5  1 HIS A 245 ? ? -105.59 72.41   
6  1 LYS A 254 ? ? -137.90 -66.83  
7  1 ASN A 255 ? ? -84.92  36.93   
8  1 TYR B 5   ? ? -131.94 -60.74  
9  1 PHE B 113 ? ? -122.40 -92.52  
10 1 LEU B 203 ? ? 63.32   -126.77 
11 1 HIS B 245 ? ? -112.54 72.30   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    4 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   TYR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    5 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -128.65 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLY 2   ? A GLY 2   
3  1 Y 1 A ASN 3   ? A ASN 3   
4  1 Y 1 A LEU 290 ? A LEU 290 
5  1 Y 1 A ARG 291 ? A ARG 291 
6  1 Y 1 A LYS 292 ? A LYS 292 
7  1 Y 1 A SER 293 ? A SER 293 
8  1 Y 1 A LYS 294 ? A LYS 294 
9  1 Y 1 A ARG 295 ? A ARG 295 
10 1 Y 1 A SER 296 ? A SER 296 
11 1 Y 1 A SER 297 ? A SER 297 
12 1 Y 1 A HIS 298 ? A HIS 298 
13 1 Y 1 A HIS 299 ? A HIS 299 
14 1 Y 1 A HIS 300 ? A HIS 300 
15 1 Y 1 A HIS 301 ? A HIS 301 
16 1 Y 1 A HIS 302 ? A HIS 302 
17 1 Y 1 A HIS 303 ? A HIS 303 
18 1 Y 1 B MET 1   ? B MET 1   
19 1 Y 1 B GLY 2   ? B GLY 2   
20 1 Y 1 B ASN 3   ? B ASN 3   
21 1 Y 1 B ARG 291 ? B ARG 291 
22 1 Y 1 B LYS 292 ? B LYS 292 
23 1 Y 1 B SER 293 ? B SER 293 
24 1 Y 1 B LYS 294 ? B LYS 294 
25 1 Y 1 B ARG 295 ? B ARG 295 
26 1 Y 1 B SER 296 ? B SER 296 
27 1 Y 1 B SER 297 ? B SER 297 
28 1 Y 1 B HIS 298 ? B HIS 298 
29 1 Y 1 B HIS 299 ? B HIS 299 
30 1 Y 1 B HIS 300 ? B HIS 300 
31 1 Y 1 B HIS 301 ? B HIS 301 
32 1 Y 1 B HIS 302 ? B HIS 302 
33 1 Y 1 B HIS 303 ? B HIS 303 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COPPER (II) ION' CU  
3 water             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CU  1   401 1   CU  CU  A . 
D 2 CU  1   401 1   CU  CU  B . 
E 3 HOH 1   501 2   HOH HOH A . 
E 3 HOH 2   502 3   HOH HOH A . 
E 3 HOH 3   503 5   HOH HOH A . 
E 3 HOH 4   504 9   HOH HOH A . 
E 3 HOH 5   505 10  HOH HOH A . 
E 3 HOH 6   506 13  HOH HOH A . 
E 3 HOH 7   507 15  HOH HOH A . 
E 3 HOH 8   508 16  HOH HOH A . 
E 3 HOH 9   509 17  HOH HOH A . 
E 3 HOH 10  510 18  HOH HOH A . 
E 3 HOH 11  511 20  HOH HOH A . 
E 3 HOH 12  512 21  HOH HOH A . 
E 3 HOH 13  513 28  HOH HOH A . 
E 3 HOH 14  514 29  HOH HOH A . 
E 3 HOH 15  515 30  HOH HOH A . 
E 3 HOH 16  516 32  HOH HOH A . 
E 3 HOH 17  517 34  HOH HOH A . 
E 3 HOH 18  518 35  HOH HOH A . 
E 3 HOH 19  519 37  HOH HOH A . 
E 3 HOH 20  520 39  HOH HOH A . 
E 3 HOH 21  521 42  HOH HOH A . 
E 3 HOH 22  522 43  HOH HOH A . 
E 3 HOH 23  523 44  HOH HOH A . 
E 3 HOH 24  524 46  HOH HOH A . 
E 3 HOH 25  525 50  HOH HOH A . 
E 3 HOH 26  526 51  HOH HOH A . 
E 3 HOH 27  527 52  HOH HOH A . 
E 3 HOH 28  528 54  HOH HOH A . 
E 3 HOH 29  529 55  HOH HOH A . 
E 3 HOH 30  530 56  HOH HOH A . 
E 3 HOH 31  531 57  HOH HOH A . 
E 3 HOH 32  532 59  HOH HOH A . 
E 3 HOH 33  533 60  HOH HOH A . 
E 3 HOH 34  534 61  HOH HOH A . 
E 3 HOH 35  535 62  HOH HOH A . 
E 3 HOH 36  536 67  HOH HOH A . 
E 3 HOH 37  537 70  HOH HOH A . 
E 3 HOH 38  538 71  HOH HOH A . 
E 3 HOH 39  539 72  HOH HOH A . 
E 3 HOH 40  540 74  HOH HOH A . 
E 3 HOH 41  541 75  HOH HOH A . 
E 3 HOH 42  542 76  HOH HOH A . 
E 3 HOH 43  543 77  HOH HOH A . 
E 3 HOH 44  544 78  HOH HOH A . 
E 3 HOH 45  545 81  HOH HOH A . 
E 3 HOH 46  546 87  HOH HOH A . 
E 3 HOH 47  547 88  HOH HOH A . 
E 3 HOH 48  548 90  HOH HOH A . 
E 3 HOH 49  549 98  HOH HOH A . 
E 3 HOH 50  550 100 HOH HOH A . 
E 3 HOH 51  551 108 HOH HOH A . 
E 3 HOH 52  552 110 HOH HOH A . 
E 3 HOH 53  553 111 HOH HOH A . 
E 3 HOH 54  554 114 HOH HOH A . 
E 3 HOH 55  555 115 HOH HOH A . 
E 3 HOH 56  556 117 HOH HOH A . 
E 3 HOH 57  557 118 HOH HOH A . 
E 3 HOH 58  558 120 HOH HOH A . 
E 3 HOH 59  559 122 HOH HOH A . 
E 3 HOH 60  560 124 HOH HOH A . 
E 3 HOH 61  561 127 HOH HOH A . 
E 3 HOH 62  562 129 HOH HOH A . 
E 3 HOH 63  563 130 HOH HOH A . 
E 3 HOH 64  564 131 HOH HOH A . 
E 3 HOH 65  565 134 HOH HOH A . 
E 3 HOH 66  566 135 HOH HOH A . 
E 3 HOH 67  567 138 HOH HOH A . 
E 3 HOH 68  568 140 HOH HOH A . 
E 3 HOH 69  569 141 HOH HOH A . 
E 3 HOH 70  570 144 HOH HOH A . 
E 3 HOH 71  571 146 HOH HOH A . 
E 3 HOH 72  572 147 HOH HOH A . 
E 3 HOH 73  573 149 HOH HOH A . 
E 3 HOH 74  574 150 HOH HOH A . 
E 3 HOH 75  575 151 HOH HOH A . 
E 3 HOH 76  576 152 HOH HOH A . 
E 3 HOH 77  577 154 HOH HOH A . 
E 3 HOH 78  578 157 HOH HOH A . 
E 3 HOH 79  579 158 HOH HOH A . 
E 3 HOH 80  580 159 HOH HOH A . 
E 3 HOH 81  581 161 HOH HOH A . 
E 3 HOH 82  582 164 HOH HOH A . 
E 3 HOH 83  583 165 HOH HOH A . 
E 3 HOH 84  584 171 HOH HOH A . 
E 3 HOH 85  585 172 HOH HOH A . 
E 3 HOH 86  586 173 HOH HOH A . 
E 3 HOH 87  587 174 HOH HOH A . 
E 3 HOH 88  588 179 HOH HOH A . 
E 3 HOH 89  589 183 HOH HOH A . 
E 3 HOH 90  590 185 HOH HOH A . 
E 3 HOH 91  591 187 HOH HOH A . 
E 3 HOH 92  592 188 HOH HOH A . 
E 3 HOH 93  593 190 HOH HOH A . 
E 3 HOH 94  594 191 HOH HOH A . 
E 3 HOH 95  595 193 HOH HOH A . 
E 3 HOH 96  596 197 HOH HOH A . 
E 3 HOH 97  597 198 HOH HOH A . 
E 3 HOH 98  598 199 HOH HOH A . 
E 3 HOH 99  599 201 HOH HOH A . 
E 3 HOH 100 600 206 HOH HOH A . 
E 3 HOH 101 601 207 HOH HOH A . 
E 3 HOH 102 602 208 HOH HOH A . 
E 3 HOH 103 603 210 HOH HOH A . 
E 3 HOH 104 604 216 HOH HOH A . 
E 3 HOH 105 605 218 HOH HOH A . 
E 3 HOH 106 606 219 HOH HOH A . 
E 3 HOH 107 607 221 HOH HOH A . 
E 3 HOH 108 608 222 HOH HOH A . 
E 3 HOH 109 609 225 HOH HOH A . 
E 3 HOH 110 610 226 HOH HOH A . 
E 3 HOH 111 611 227 HOH HOH A . 
E 3 HOH 112 612 229 HOH HOH A . 
E 3 HOH 113 613 231 HOH HOH A . 
E 3 HOH 114 614 232 HOH HOH A . 
E 3 HOH 115 615 235 HOH HOH A . 
E 3 HOH 116 616 239 HOH HOH A . 
E 3 HOH 117 617 246 HOH HOH A . 
E 3 HOH 118 618 249 HOH HOH A . 
E 3 HOH 119 619 254 HOH HOH A . 
E 3 HOH 120 620 258 HOH HOH A . 
E 3 HOH 121 621 261 HOH HOH A . 
E 3 HOH 122 622 264 HOH HOH A . 
E 3 HOH 123 623 265 HOH HOH A . 
E 3 HOH 124 624 270 HOH HOH A . 
E 3 HOH 125 625 271 HOH HOH A . 
E 3 HOH 126 626 274 HOH HOH A . 
E 3 HOH 127 627 275 HOH HOH A . 
E 3 HOH 128 628 278 HOH HOH A . 
E 3 HOH 129 629 281 HOH HOH A . 
E 3 HOH 130 630 282 HOH HOH A . 
E 3 HOH 131 631 284 HOH HOH A . 
E 3 HOH 132 632 286 HOH HOH A . 
E 3 HOH 133 633 289 HOH HOH A . 
E 3 HOH 134 634 296 HOH HOH A . 
E 3 HOH 135 635 297 HOH HOH A . 
E 3 HOH 136 636 299 HOH HOH A . 
E 3 HOH 137 637 300 HOH HOH A . 
E 3 HOH 138 638 301 HOH HOH A . 
E 3 HOH 139 639 302 HOH HOH A . 
E 3 HOH 140 640 303 HOH HOH A . 
E 3 HOH 141 641 309 HOH HOH A . 
E 3 HOH 142 642 313 HOH HOH A . 
E 3 HOH 143 643 316 HOH HOH A . 
E 3 HOH 144 644 326 HOH HOH A . 
E 3 HOH 145 645 332 HOH HOH A . 
E 3 HOH 146 646 333 HOH HOH A . 
E 3 HOH 147 647 336 HOH HOH A . 
E 3 HOH 148 648 344 HOH HOH A . 
E 3 HOH 149 649 345 HOH HOH A . 
E 3 HOH 150 650 347 HOH HOH A . 
E 3 HOH 151 651 351 HOH HOH A . 
E 3 HOH 152 652 353 HOH HOH A . 
E 3 HOH 153 653 355 HOH HOH A . 
E 3 HOH 154 654 357 HOH HOH A . 
E 3 HOH 155 655 368 HOH HOH A . 
E 3 HOH 156 656 373 HOH HOH A . 
E 3 HOH 157 657 374 HOH HOH A . 
E 3 HOH 158 658 375 HOH HOH A . 
E 3 HOH 159 659 398 HOH HOH A . 
E 3 HOH 160 660 401 HOH HOH A . 
E 3 HOH 161 661 413 HOH HOH A . 
E 3 HOH 162 662 420 HOH HOH A . 
E 3 HOH 163 663 462 HOH HOH A . 
E 3 HOH 164 664 467 HOH HOH A . 
E 3 HOH 165 665 468 HOH HOH A . 
F 3 HOH 1   501 1   HOH HOH B . 
F 3 HOH 2   502 4   HOH HOH B . 
F 3 HOH 3   503 6   HOH HOH B . 
F 3 HOH 4   504 7   HOH HOH B . 
F 3 HOH 5   505 8   HOH HOH B . 
F 3 HOH 6   506 11  HOH HOH B . 
F 3 HOH 7   507 12  HOH HOH B . 
F 3 HOH 8   508 14  HOH HOH B . 
F 3 HOH 9   509 19  HOH HOH B . 
F 3 HOH 10  510 22  HOH HOH B . 
F 3 HOH 11  511 23  HOH HOH B . 
F 3 HOH 12  512 24  HOH HOH B . 
F 3 HOH 13  513 25  HOH HOH B . 
F 3 HOH 14  514 26  HOH HOH B . 
F 3 HOH 15  515 27  HOH HOH B . 
F 3 HOH 16  516 31  HOH HOH B . 
F 3 HOH 17  517 33  HOH HOH B . 
F 3 HOH 18  518 36  HOH HOH B . 
F 3 HOH 19  519 38  HOH HOH B . 
F 3 HOH 20  520 40  HOH HOH B . 
F 3 HOH 21  521 41  HOH HOH B . 
F 3 HOH 22  522 45  HOH HOH B . 
F 3 HOH 23  523 47  HOH HOH B . 
F 3 HOH 24  524 48  HOH HOH B . 
F 3 HOH 25  525 49  HOH HOH B . 
F 3 HOH 26  526 53  HOH HOH B . 
F 3 HOH 27  527 58  HOH HOH B . 
F 3 HOH 28  528 63  HOH HOH B . 
F 3 HOH 29  529 64  HOH HOH B . 
F 3 HOH 30  530 65  HOH HOH B . 
F 3 HOH 31  531 66  HOH HOH B . 
F 3 HOH 32  532 68  HOH HOH B . 
F 3 HOH 33  533 69  HOH HOH B . 
F 3 HOH 34  534 73  HOH HOH B . 
F 3 HOH 35  535 79  HOH HOH B . 
F 3 HOH 36  536 80  HOH HOH B . 
F 3 HOH 37  537 82  HOH HOH B . 
F 3 HOH 38  538 83  HOH HOH B . 
F 3 HOH 39  539 84  HOH HOH B . 
F 3 HOH 40  540 85  HOH HOH B . 
F 3 HOH 41  541 86  HOH HOH B . 
F 3 HOH 42  542 89  HOH HOH B . 
F 3 HOH 43  543 91  HOH HOH B . 
F 3 HOH 44  544 92  HOH HOH B . 
F 3 HOH 45  545 93  HOH HOH B . 
F 3 HOH 46  546 94  HOH HOH B . 
F 3 HOH 47  547 95  HOH HOH B . 
F 3 HOH 48  548 96  HOH HOH B . 
F 3 HOH 49  549 97  HOH HOH B . 
F 3 HOH 50  550 99  HOH HOH B . 
F 3 HOH 51  551 101 HOH HOH B . 
F 3 HOH 52  552 103 HOH HOH B . 
F 3 HOH 53  553 104 HOH HOH B . 
F 3 HOH 54  554 105 HOH HOH B . 
F 3 HOH 55  555 106 HOH HOH B . 
F 3 HOH 56  556 107 HOH HOH B . 
F 3 HOH 57  557 109 HOH HOH B . 
F 3 HOH 58  558 112 HOH HOH B . 
F 3 HOH 59  559 113 HOH HOH B . 
F 3 HOH 60  560 116 HOH HOH B . 
F 3 HOH 61  561 119 HOH HOH B . 
F 3 HOH 62  562 121 HOH HOH B . 
F 3 HOH 63  563 123 HOH HOH B . 
F 3 HOH 64  564 125 HOH HOH B . 
F 3 HOH 65  565 126 HOH HOH B . 
F 3 HOH 66  566 128 HOH HOH B . 
F 3 HOH 67  567 132 HOH HOH B . 
F 3 HOH 68  568 133 HOH HOH B . 
F 3 HOH 69  569 136 HOH HOH B . 
F 3 HOH 70  570 137 HOH HOH B . 
F 3 HOH 71  571 139 HOH HOH B . 
F 3 HOH 72  572 142 HOH HOH B . 
F 3 HOH 73  573 143 HOH HOH B . 
F 3 HOH 74  574 145 HOH HOH B . 
F 3 HOH 75  575 148 HOH HOH B . 
F 3 HOH 76  576 153 HOH HOH B . 
F 3 HOH 77  577 155 HOH HOH B . 
F 3 HOH 78  578 156 HOH HOH B . 
F 3 HOH 79  579 163 HOH HOH B . 
F 3 HOH 80  580 166 HOH HOH B . 
F 3 HOH 81  581 167 HOH HOH B . 
F 3 HOH 82  582 168 HOH HOH B . 
F 3 HOH 83  583 169 HOH HOH B . 
F 3 HOH 84  584 170 HOH HOH B . 
F 3 HOH 85  585 175 HOH HOH B . 
F 3 HOH 86  586 176 HOH HOH B . 
F 3 HOH 87  587 177 HOH HOH B . 
F 3 HOH 88  588 178 HOH HOH B . 
F 3 HOH 89  589 180 HOH HOH B . 
F 3 HOH 90  590 181 HOH HOH B . 
F 3 HOH 91  591 186 HOH HOH B . 
F 3 HOH 92  592 189 HOH HOH B . 
F 3 HOH 93  593 192 HOH HOH B . 
F 3 HOH 94  594 195 HOH HOH B . 
F 3 HOH 95  595 196 HOH HOH B . 
F 3 HOH 96  596 200 HOH HOH B . 
F 3 HOH 97  597 202 HOH HOH B . 
F 3 HOH 98  598 205 HOH HOH B . 
F 3 HOH 99  599 209 HOH HOH B . 
F 3 HOH 100 600 211 HOH HOH B . 
F 3 HOH 101 601 212 HOH HOH B . 
F 3 HOH 102 602 213 HOH HOH B . 
F 3 HOH 103 603 215 HOH HOH B . 
F 3 HOH 104 604 220 HOH HOH B . 
F 3 HOH 105 605 223 HOH HOH B . 
F 3 HOH 106 606 224 HOH HOH B . 
F 3 HOH 107 607 228 HOH HOH B . 
F 3 HOH 108 608 230 HOH HOH B . 
F 3 HOH 109 609 233 HOH HOH B . 
F 3 HOH 110 610 236 HOH HOH B . 
F 3 HOH 111 611 238 HOH HOH B . 
F 3 HOH 112 612 240 HOH HOH B . 
F 3 HOH 113 613 241 HOH HOH B . 
F 3 HOH 114 614 243 HOH HOH B . 
F 3 HOH 115 615 244 HOH HOH B . 
F 3 HOH 116 616 247 HOH HOH B . 
F 3 HOH 117 617 248 HOH HOH B . 
F 3 HOH 118 618 251 HOH HOH B . 
F 3 HOH 119 619 252 HOH HOH B . 
F 3 HOH 120 620 253 HOH HOH B . 
F 3 HOH 121 621 255 HOH HOH B . 
F 3 HOH 122 622 257 HOH HOH B . 
F 3 HOH 123 623 260 HOH HOH B . 
F 3 HOH 124 624 263 HOH HOH B . 
F 3 HOH 125 625 267 HOH HOH B . 
F 3 HOH 126 626 268 HOH HOH B . 
F 3 HOH 127 627 272 HOH HOH B . 
F 3 HOH 128 628 276 HOH HOH B . 
F 3 HOH 129 629 277 HOH HOH B . 
F 3 HOH 130 630 279 HOH HOH B . 
F 3 HOH 131 631 283 HOH HOH B . 
F 3 HOH 132 632 287 HOH HOH B . 
F 3 HOH 133 633 295 HOH HOH B . 
F 3 HOH 134 634 305 HOH HOH B . 
F 3 HOH 135 635 307 HOH HOH B . 
F 3 HOH 136 636 308 HOH HOH B . 
F 3 HOH 137 637 310 HOH HOH B . 
F 3 HOH 138 638 311 HOH HOH B . 
F 3 HOH 139 639 315 HOH HOH B . 
F 3 HOH 140 640 322 HOH HOH B . 
F 3 HOH 141 641 327 HOH HOH B . 
F 3 HOH 142 642 330 HOH HOH B . 
F 3 HOH 143 643 334 HOH HOH B . 
F 3 HOH 144 644 335 HOH HOH B . 
F 3 HOH 145 645 337 HOH HOH B . 
F 3 HOH 146 646 339 HOH HOH B . 
F 3 HOH 147 647 340 HOH HOH B . 
F 3 HOH 148 648 343 HOH HOH B . 
F 3 HOH 149 649 349 HOH HOH B . 
F 3 HOH 150 650 350 HOH HOH B . 
F 3 HOH 151 651 352 HOH HOH B . 
F 3 HOH 152 652 358 HOH HOH B . 
F 3 HOH 153 653 359 HOH HOH B . 
F 3 HOH 154 654 360 HOH HOH B . 
F 3 HOH 155 655 363 HOH HOH B . 
F 3 HOH 156 656 364 HOH HOH B . 
F 3 HOH 157 657 365 HOH HOH B . 
F 3 HOH 158 658 366 HOH HOH B . 
F 3 HOH 159 659 372 HOH HOH B . 
F 3 HOH 160 660 378 HOH HOH B . 
F 3 HOH 161 661 394 HOH HOH B . 
F 3 HOH 162 662 395 HOH HOH B . 
F 3 HOH 163 663 396 HOH HOH B . 
F 3 HOH 164 664 397 HOH HOH B . 
F 3 HOH 165 665 403 HOH HOH B . 
F 3 HOH 166 666 414 HOH HOH B . 
F 3 HOH 167 667 435 HOH HOH B . 
F 3 HOH 168 668 436 HOH HOH B . 
F 3 HOH 169 669 466 HOH HOH B . 
F 3 HOH 170 670 469 HOH HOH B . 
#