data_4J8V
# 
_entry.id   4J8V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4J8V         
NDB   NA2319       
RCSB  RCSB077742   
WWPDB D_1000077742 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4J8U . unspecified 
PDB 4J8V . unspecified 
PDB 4J8W . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4J8V 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adhireksan, Z.' 1 
'Davey, C.A.'    2 
# 
_citation.id                        primary 
_citation.title                     
'Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents' 
_citation.journal_abbrev            'CHEM SCI' 
_citation.journal_volume            4 
_citation.page_first                1837 
_citation.page_last                 1846 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-6520 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      10.1039/C3SC22294B 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meier, S.M.'     1  
primary 'Hanif, M.'       2  
primary 'Adhireksan, Z.'  3  
primary 'Pichler, V.'     4  
primary 'Novak, M.'       5  
primary 'Jirkovsky, E.'   6  
primary 'Jakupec, M.A.'   7  
primary 'Arion, V.B.'     8  
primary 'Davey, C.A.'     9  
primary 'Keppler, B.K.'   10 
primary 'Hartinger, C.G.' 11 
# 
_cell.entry_id           4J8V 
_cell.length_a           106.800 
_cell.length_b           109.810 
_cell.length_c           182.380 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4J8V 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'                   15303.930 2 ? ? ? ? 
2 polymer     man 'Histone H4'                     11263.231 2 ? ? ? ? 
3 polymer     man 'Histone H2A'                    13907.163 2 ? ? ? ? 
4 polymer     man 'Histone H2B 1.1'                13848.097 2 ? ? ? ? 
5 polymer     syn 'DNA (145-MER)'                  44749.664 1 ? ? ? ? 
6 polymer     syn 'DNA (145-MER)'                  44740.648 1 ? ? ? ? 
7 non-polymer syn 'SULFATE ION'                    96.063    3 ? ? ? ? 
8 non-polymer syn 'PARA-CYMENE RUTHENIUM CHLORIDE' 306.194   2 ? ? ? ? 
9 non-polymer syn 'MAGNESIUM ION'                  24.305    1 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 LYS n 
3 127 SER n 
3 128 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? 'synthetic construct' ? 32630 ? 
6 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA     P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 ? 
4 UNP H2B11_XENLA  P02281 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 ? 
5 PDB 4J8V         4J8V   5 ? ? ? 
6 PDB 4J8V         4J8V   6 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4J8V A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 4J8V B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 4J8V C 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
4  4 4J8V D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 4J8V E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 4J8V F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 4J8V G 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
8  4 4J8V H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 4J8V I 1 ? 145 ? 4J8V   -72 ? 72  ? -72 72  
10 6 4J8V J 1 ? 145 ? 4J8V   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4J8V ALA A 102 ? UNP P84233 GLY 103 CONFLICT 102 1 
3 4J8V ?   C ?   ? UNP Q6AZJ8 ALA 127 DELETION ?   2 
4 4J8V THR D 32  ? UNP P02281 SER 33  CONFLICT 29  3 
5 4J8V ALA E 102 ? UNP P84233 GLY 103 CONFLICT 102 4 
7 4J8V ?   G ?   ? UNP Q6AZJ8 ALA 127 DELETION ?   5 
8 4J8V THR H 32  ? UNP P02281 SER 33  CONFLICT 29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
RU7 non-polymer         . 'PARA-CYMENE RUTHENIUM CHLORIDE'     ? 'C10 H14 Cl2 Ru'  306.194 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4J8V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   54.42 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'40 mM MnCl2, 30 mM KCl, 20 mM K-Cacodylate pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.50 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.50 
# 
_reflns.entry_id                     4J8V 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             94.07 
_reflns.d_resolution_high            2.58 
_reflns.number_obs                   57178 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4J8V 
_refine.ls_number_reflns_obs                     55962 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             94.07 
_refine.ls_d_res_high                            2.58 
_refine.ls_percent_reflns_obs                    83.77 
_refine.ls_R_factor_obs                          0.25250 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25206 
_refine.ls_R_factor_R_free                       0.27342 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1163 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.925 
_refine.correlation_coeff_Fo_to_Fc_free          0.898 
_refine.B_iso_mean                               77.273 
_refine.aniso_B[1][1]                            2.18 
_refine.aniso_B[2][2]                            -1.58 
_refine.aniso_B[3][3]                            -0.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.869 
_refine.pdbx_overall_ESU_R_Free                  0.350 
_refine.overall_SU_ML                            0.256 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.367 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12063 
_refine_hist.d_res_high                       2.58 
_refine_hist.d_res_low                        94.07 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.008  0.021  ? 12873 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.296  2.546  ? 18668 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       4.749  5.000  ? 757   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       32.506 21.255 ? 271   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       16.663 15.000 ? 1183  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       20.017 15.000 ? 86    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.068  0.200  ? 2119  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.020  ? 7635  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.594  1.500  ? 3797  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.146  2.000  ? 6110  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.227  3.000  ? 9076  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 2.066  4.500  ? 12510 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.580 
_refine_ls_shell.d_res_low                        2.647 
_refine_ls_shell.number_reflns_R_work             2053 
_refine_ls_shell.R_factor_R_work                  0.411 
_refine_ls_shell.percent_reflns_obs               42.21 
_refine_ls_shell.R_factor_R_free                  0.405 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             49 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4J8V 
_struct.title                     
'X-ray structure of NCP145 with bound chlorido(eta-6-p-cymene)(N-phenyl-2-pyridinecarbothioamide)ruthenium(II)' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4J8V 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'nucleosome, histone, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 9 ? 
N N N 7 ? 
O N N 7 ? 
P N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASP B 24  ? ILE B 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 12 ILE C 79  ? ASN C 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 103 ? SER D 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 19 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? LYS F 77  ? LEU F 49  LYS F 77  1 ? 29 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 103 ? SER H 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 M MG  .   MG  ? ? E ASP 77  E MG  1001 1_555 ? ? ? ? ? ? ?               2.141 ? 
metalc2   metalc ? ? H HIS 82  NE2 ? ? ? 1_555 P RU7 .   RU1 ? ? H HIS 79  H RU7 203  1_555 ? ? ? ? ? ? ?               1.995 ? 
metalc3   metalc ? ? D HIS 82  NE2 ? ? ? 1_555 L RU7 .   RU1 ? ? D HIS 79  D RU7 1102 1_555 ? ? ? ? ? ? ?               2.189 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT  145 N3  ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT  145 O4  ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA  144 N1  ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA  144 N6  ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG  143 N2  ? ? I DC  -70 J DG  70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog6   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT  142 N3  ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J DT  142 O4  ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT  141 N3  ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  5   N6  ? ? ? 1_555 J DT  141 O4  ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA  140 N1  ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA  140 N6  ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT  139 N3  ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT  139 O4  ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA  138 N1  ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA  138 N6  ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  137 N1  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  137 O6  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  137 N2  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  136 N1  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG  136 O6  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  136 N2  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT  135 N3  ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J DT  135 O4  ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DC  12  N3  ? ? ? 1_555 J DG  134 N1  ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DC  12  N4  ? ? ? 1_555 J DG  134 O6  ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG  134 N2  ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DC  13  N3  ? ? ? 1_555 J DG  133 N1  ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DC  13  N4  ? ? ? 1_555 J DG  133 O6  ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG  133 N2  ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA  132 N1  ? ? I DT  -59 J DA  59   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog31  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC  131 N3  ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog32  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG  130 N1  ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog33  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT  129 N3  ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J DT  129 O4  ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC  128 N3  ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog36  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT  127 O4  ? ? I DA  -54 J DT  54   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog37  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J DA  126 N1  ? ? I DT  -53 J DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J DA  126 N6  ? ? I DT  -53 J DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT  125 N3  ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT  125 O4  ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J DG  124 N1  ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J DG  124 O6  ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG  124 N2  ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DT  122 N3  ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog45  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG  121 N1  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  121 O6  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  121 N2  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG  120 N2  ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog49  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT  119 N3  ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT  119 O4  ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT  118 N3  ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT  118 O4  ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT  117 N3  ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  117 O4  ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J DT  116 N3  ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J DT  116 O4  ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J DC  115 O2  ? ? I DG  -42 J DC  42   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog58  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J DA  114 N1  ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J DA  114 N6  ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC  113 N3  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J DC  113 O2  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J DC  113 N4  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA  112 N1  ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA  112 N6  ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DA  110 N1  ? ? I DA  -38 J DA  37   1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog66  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J DT  111 N3  ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT  111 O4  ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J DA  110 N1  ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog69  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA  109 N1  ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  109 N6  ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA  108 N1  ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DA  108 N6  ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC  106 N4  ? ? I DG  -34 J DC  33   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog74  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC  107 N3  ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC  107 O2  ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC  107 N4  ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC  106 N3  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC  106 O2  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J DC  106 N4  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J DT  105 N3  ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J DT  105 O4  ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT  104 N3  ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog83  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT  103 N3  ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog84  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG  102 N2  ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog85  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  101 N1  ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  101 N6  ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J DC  100 N3  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC  100 O2  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J DC  100 N4  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG  99  N1  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG  99  O6  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG  99  N2  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA  98  N1  ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DT  48  O4  ? ? ? 1_555 J DA  98  N6  ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG  97  N1  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG  97  O6  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG  97  N2  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DC  50  O2  ? ? ? 1_555 J DG  96  N2  ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog99  hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT  95  N3  ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J DT  95  O4  ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J DA  94  N1  ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DA  94  N6  ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG  93  N1  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG  93  O6  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG  93  N2  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DT  92  N3  ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DT  92  O4  ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J DT  91  N3  ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog109 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT  90  N3  ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog110 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J DT  89  N3  ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J DT  89  O4  ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  88  N3  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J DC  88  O2  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J DC  88  N4  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J DC  87  N3  ? ? I DG  -14 J DC  14   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog116 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J DG  86  N2  ? ? I DC  -13 J DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog117 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT  85  N3  ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT  85  O4  ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J DA  84  N1  ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J DA  84  N6  ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC  83  N3  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC  83  O2  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC  83  N4  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J DA  82  N1  ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J DA  82  N6  ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J DA  81  N1  ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J DA  81  N6  ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J DG  80  N2  ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog129 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J DT  79  N3  ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J DT  79  O4  ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC  78  N3  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC  78  O2  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC  78  N4  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG  77  N1  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG  77  O6  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG  77  N2  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J DA  76  N1  ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J DA  76  N6  ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J DC  75  N3  ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog140 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT  74  N3  ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT  74  O4  ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT  73  N3  ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT  73  O4  ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA  72  N1  ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA  72  N6  ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG  71  N1  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG  71  O6  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG  71  N2  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J DT  70  N3  ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J DT  70  O4  ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC  69  N3  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J DC  69  O2  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J DC  69  N4  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG  68  N1  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG  68  O6  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG  68  N2  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA  67  N1  ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA  67  N6  ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J DC  66  N3  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC  66  O2  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J DC  66  N4  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J DT  65  N3  ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J DT  65  O4  ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT  64  N3  ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J DT  64  O4  ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  63  N1  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  63  O6  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  63  N2  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J DT  62  N3  ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J DT  62  O4  ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA  61  N1  ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA  61  N6  ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC  60  N3  ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog174 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG  59  N1  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG  59  O6  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG  59  N2  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J DG  58  N1  ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J DG  58  O6  ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J DG  58  N2  ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA  57  N1  ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA  57  N6  ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J DA  56  N1  ? ? I DT  17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DT  90  O4  ? ? ? 1_555 J DA  56  N6  ? ? I DT  17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J DA  54  N1  ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J DA  54  N6  ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DG  93  N2  ? ? ? 1_555 J DC  53  O2  ? ? I DG  20  J DC  -20  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog187 hydrog ? ? I DA  94  N1  ? ? ? 1_555 J DT  52  N3  ? ? I DA  21  J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DA  94  N6  ? ? ? 1_555 J DT  52  O4  ? ? I DA  21  J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DT  95  N3  ? ? ? 1_555 J DA  51  N1  ? ? I DT  22  J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DT  95  O4  ? ? ? 1_555 J DA  51  N6  ? ? I DT  22  J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DG  96  O6  ? ? ? 1_555 J DC  50  N4  ? ? I DG  23  J DC  -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog192 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC  49  N3  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC  49  O2  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC  49  N4  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DC  47  N3  ? ? I DA  25  J DC  -26  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog196 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J DT  48  N3  ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog197 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC  47  N3  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J DC  47  O2  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J DC  47  N4  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J DG  46  N2  ? ? I DC  27  J DG  -27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog201 hydrog ? ? I DA  101 N1  ? ? ? 1_555 J DT  45  N3  ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog202 hydrog ? ? I DG  102 N1  ? ? ? 1_555 J DC  44  N3  ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DC  44  O2  ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DG  102 O6  ? ? ? 1_555 J DC  44  N4  ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA  43  N1  ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog206 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA  42  N1  ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DA  42  N6  ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA  41  N1  ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA  41  N6  ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J DG  40  N2  ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog211 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DG  39  N1  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J DG  39  O6  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG  39  N2  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J DT  38  N3  ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT  38  O4  ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT  37  N3  ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT  37  O4  ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT  36  N3  ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT  36  O4  ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA  35  N1  ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DT  111 O4  ? ? ? 1_555 J DA  35  N6  ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT  34  N3  ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT  34  O4  ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG  33  N1  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG  33  O6  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG  33  N2  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DT  32  N3  ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DT  32  O4  ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG  31  N1  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG  31  O6  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG  31  N2  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DA  30  N1  ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J DA  30  N6  ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA  29  N1  ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog235 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA  28  N1  ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog236 hydrog ? ? I DG  120 O6  ? ? ? 1_555 J DC  25  N4  ? ? I DG  47  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog237 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC  26  N3  ? ? I DG  47  J DC  -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog238 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DA  24  N6  ? ? I DG  48  J DA  -49  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog239 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC  25  O2  ? ? I DG  48  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog240 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT  23  N3  ? ? I DA  50  J DT  -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog241 hydrog ? ? I DG  124 N2  ? ? ? 1_555 J DC  22  O2  ? ? I DG  51  J DC  -51  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog242 hydrog ? ? I DA  126 N1  ? ? ? 1_555 J DT  20  N3  ? ? I DA  53  J DT  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DA  126 N6  ? ? ? 1_555 J DT  20  O4  ? ? I DA  53  J DT  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA  19  N1  ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J DA  19  N6  ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG  18  N1  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG  18  O6  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG  18  N2  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J DA  17  N1  ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J DA  17  N6  ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC  16  N3  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC  16  O2  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC  16  N4  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG  15  N1  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DG  15  O6  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG  15  N2  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT  14  N3  ? ? I DA  59  J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DA  132 N6  ? ? ? 1_555 J DT  14  O4  ? ? I DA  59  J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J DC  13  N3  ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog260 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC  12  N3  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC  12  O2  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC  12  N4  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA  11  N1  ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J DA  11  N6  ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC  10  N3  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC  10  O2  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC  10  N4  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC  9   N3  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC  9   O2  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC  9   N4  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT  8   N3  ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT  8   O4  ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA  7   N1  ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA  7   N6  ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT  6   N3  ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT  6   O4  ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA  5   N1  ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA  5   N6  ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA  4   N1  ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA  4   N6  ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC  3   N3  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC  3   O2  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC  3   N4  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  2   N3  ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  2   O4  ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA  1   N1  ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA  1   N6  ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N THR B 96  ? N THR B 96  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 D 1101' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE RU7 D 1102' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG E 1001'  
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 H 201'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 202'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE RU7 H 203'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLY C 44 ? GLY C 44 . ? 1_555 ? 
2  AC1 6 ALA C 45 ? ALA C 45 . ? 1_555 ? 
3  AC1 6 GLY C 46 ? GLY C 46 . ? 1_555 ? 
4  AC1 6 ALA C 47 ? ALA C 47 . ? 1_555 ? 
5  AC1 6 THR D 90 ? THR D 87 . ? 1_555 ? 
6  AC1 6 SER D 91 ? SER D 88 . ? 1_555 ? 
7  AC2 5 HIS D 82 ? HIS D 79 . ? 1_555 ? 
8  AC2 5 LEU G 33 ? LEU G 33 . ? 1_555 ? 
9  AC2 5 TYR G 39 ? TYR G 39 . ? 1_555 ? 
10 AC2 5 PHE H 70 ? PHE H 67 . ? 1_555 ? 
11 AC2 5 GLU H 71 ? GLU H 68 . ? 1_555 ? 
12 AC3 2 VAL D 48 ? VAL D 45 . ? 3_545 ? 
13 AC3 2 ASP E 77 ? ASP E 77 . ? 1_555 ? 
14 AC4 6 GLY G 44 ? GLY G 44 . ? 1_555 ? 
15 AC4 6 ALA G 45 ? ALA G 45 . ? 1_555 ? 
16 AC4 6 GLY G 46 ? GLY G 46 . ? 1_555 ? 
17 AC4 6 ALA G 47 ? ALA G 47 . ? 1_555 ? 
18 AC4 6 THR H 90 ? THR H 87 . ? 1_555 ? 
19 AC4 6 SER H 91 ? SER H 88 . ? 1_555 ? 
20 AC5 4 HIS H 49 ? HIS H 46 . ? 1_555 ? 
21 AC5 4 PRO H 50 ? PRO H 47 . ? 1_555 ? 
22 AC5 4 ASP H 51 ? ASP H 48 . ? 1_555 ? 
23 AC5 4 THR H 52 ? THR H 49 . ? 1_555 ? 
24 AC6 4 LYS C 36 ? LYS C 36 . ? 1_555 ? 
25 AC6 4 TYR C 39 ? TYR C 39 . ? 1_555 ? 
26 AC6 4 GLU D 71 ? GLU D 68 . ? 1_555 ? 
27 AC6 4 HIS H 82 ? HIS H 79 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4J8V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4J8V 
_atom_sites.fract_transf_matrix[1][1]   0.009363 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009107 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005483 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1 38  ? -60.848 -29.432 81.014 1.00 84.17  ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1 38  ? -59.730 -28.542 80.668 1.00 84.05  ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1 38  ? -58.468 -29.316 80.242 1.00 83.75  ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1 38  ? -57.910 -30.097 81.030 1.00 83.69  ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1 38  ? -59.489 -27.753 81.966 1.00 84.16  ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1 38  ? -59.957 -28.678 83.075 1.00 84.23  ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1 38  ? -60.942 -29.677 82.470 1.00 84.28  ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1 39  ? -58.031 -29.092 79.002 1.00 83.21  ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1 39  ? -56.946 -29.884 78.404 1.00 82.56  ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1 39  ? -55.805 -29.031 77.863 1.00 81.52  ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1 39  ? -56.031 -28.015 77.199 1.00 81.41  ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1 39  ? -57.480 -30.781 77.285 1.00 82.93  ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1 39  ? -56.469 -31.752 76.763 1.00 84.03  ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1 39  ? -55.744 -31.519 75.600 1.00 84.59  ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1 39  ? -56.049 -32.951 77.253 1.00 85.05  ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1 39  ? -54.933 -32.542 75.389 1.00 85.10  ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1 39  ? -55.099 -33.424 76.377 1.00 85.10  ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1 40  ? -54.579 -29.472 78.132 1.00 80.23  ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1 40  ? -53.402 -28.678 77.793 1.00 78.85  ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1 40  ? -52.194 -29.524 77.378 1.00 77.92  ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1 40  ? -51.724 -30.374 78.148 1.00 77.95  ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1 40  ? -53.044 -27.773 78.971 1.00 78.79  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1 40  ? -52.199 -26.595 78.594 1.00 78.03  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1 40  ? -52.182 -25.577 79.699 1.00 76.79  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1 40  ? -51.210 -24.527 79.424 1.00 76.56  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1 40  ? -51.448 -23.459 78.667 1.00 76.62  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1 40  ? -52.640 -23.283 78.098 1.00 76.76  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1 40  ? -50.488 -22.562 78.484 1.00 75.51  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1 41  ? -51.706 -29.284 76.159 1.00 76.51  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1 41  ? -50.506 -29.952 75.644 1.00 75.03  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1 41  ? -49.256 -29.257 76.178 1.00 74.21  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1 41  ? -49.211 -28.031 76.239 1.00 74.14  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1 41  ? -50.498 -29.972 74.106 1.00 74.79  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1 41  ? -51.433 -30.989 73.474 1.00 73.89  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1 41  ? -52.473 -30.587 72.634 1.00 73.13  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1 41  ? -51.273 -32.357 73.715 1.00 73.81  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1 41  ? -53.331 -31.523 72.048 1.00 72.91  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1 41  ? -52.125 -33.299 73.141 1.00 73.66  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1 41  ? -53.149 -32.878 72.309 1.00 73.37  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1 41  ? -53.979 -33.822 71.745 1.00 73.34  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1 42  ? -48.253 -30.041 76.572 1.00 73.09  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1 42  ? -47.015 -29.503 77.148 1.00 72.04  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1 42  ? -46.169 -28.754 76.115 1.00 71.12  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1 42  ? -46.263 -29.040 74.914 1.00 70.98  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1 42  ? -46.185 -30.621 77.787 1.00 72.18  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1 42  ? -47.017 -31.628 78.549 1.00 73.29  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1 42  ? -46.564 -31.749 79.983 1.00 74.88  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1 42  ? -45.538 -32.770 80.150 1.00 76.88  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1 42  ? -45.227 -33.322 81.321 1.00 78.23  ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1 42  ? -45.868 -32.946 82.422 1.00 79.04  ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1 42  ? -44.282 -34.253 81.394 1.00 78.93  ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1 43  ? -45.339 -27.792 76.578 1.00 70.13  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1 43  ? -44.436 -27.059 75.691 1.00 69.31  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1 43  ? -43.550 -28.012 74.913 1.00 68.42  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1 43  ? -42.887 -28.863 75.515 1.00 68.40  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1 43  ? -43.580 -26.237 76.657 1.00 69.29  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1 43  ? -44.408 -26.080 77.856 1.00 69.66  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1 43  ? -45.226 -27.325 77.972 1.00 70.15  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1 44  ? -43.558 -27.880 73.590 1.00 67.44  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1 44  ? -42.737 -28.729 72.730 1.00 66.44  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1 44  ? -43.516 -29.837 72.050 1.00 65.68  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1 44  ? -43.080 -30.362 71.029 1.00 66.11  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1 45  ? -44.667 -30.192 72.613 1.00 64.76  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1 45  ? -45.513 -31.233 72.049 1.00 63.90  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1 45  ? -46.090 -30.801 70.707 1.00 63.42  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1 45  ? -46.020 -31.547 69.730 1.00 63.79  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1 45  ? -46.650 -31.633 73.028 1.00 63.97  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 45  ? -46.070 -32.208 74.212 1.00 64.52  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 45  ? -47.583 -32.665 72.392 1.00 63.41  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 46  ? -46.652 -29.597 70.665 1.00 62.70  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 46  ? -47.234 -29.057 69.443 1.00 62.05  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 46  ? -46.123 -28.674 68.468 1.00 61.47  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1 46  ? -46.299 -28.777 67.249 1.00 61.51  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 46  ? -48.128 -27.814 69.720 1.00 62.03  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 46  ? -49.046 -27.530 68.532 1.00 62.05  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 46  ? -48.954 -28.026 70.974 1.00 62.15  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1 47  ? -44.984 -28.239 69.012 1.00 60.53  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1 47  ? -43.845 -27.834 68.193 1.00 59.68  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1 47  ? -43.353 -29.012 67.357 1.00 59.14  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1 47  ? -43.159 -28.876 66.150 1.00 59.04  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1 47  ? -42.735 -27.264 69.053 1.00 59.43  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1 48  ? -43.190 -30.169 67.996 1.00 58.58  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1 48  ? -42.894 -31.414 67.288 1.00 58.34  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1 48  ? -43.965 -31.753 66.247 1.00 58.08  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1 48  ? -43.653 -32.079 65.098 1.00 57.64  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1 48  ? -42.733 -32.559 68.288 1.00 58.27  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1 48  ? -41.334 -32.912 68.814 1.00 58.67  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1 48  ? -40.259 -31.869 68.457 1.00 59.44  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1 48  ? -41.375 -33.147 70.314 1.00 57.33  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1 49  ? -45.225 -31.653 66.661 1.00 58.08  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1 49  ? -46.363 -31.944 65.801 1.00 58.38  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1 49  ? -46.321 -31.087 64.534 1.00 58.16  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1 49  ? -46.708 -31.539 63.447 1.00 58.11  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1 49  ? -47.655 -31.706 66.578 1.00 58.61  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1 49  ? -48.912 -32.161 65.881 1.00 59.75  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1 49  ? -49.948 -32.642 66.885 1.00 61.39  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1 49  ? -50.652 -31.544 67.546 1.00 62.13  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1 49  ? -50.752 -31.404 68.867 1.00 62.22  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1 49  ? -50.212 -32.304 69.685 1.00 61.29  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1 49  ? -51.409 -30.366 69.370 1.00 61.96  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1 50  ? -45.823 -29.862 64.690 1.00 57.74  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1 50  ? -45.693 -28.921 63.594 1.00 57.63  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1 50  ? -44.493 -29.237 62.689 1.00 57.52  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1 50  ? -44.610 -29.177 61.453 1.00 57.79  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1 50  ? -45.615 -27.491 64.126 1.00 57.68  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1 50  ? -46.946 -26.946 64.620 1.00 58.32  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1 50  ? -46.853 -25.534 65.164 1.00 59.68  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1 50  ? -45.833 -24.848 64.933 1.00 61.21  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1 50  ? -47.816 -25.095 65.825 1.00 61.02  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1 51  ? -43.347 -29.564 63.288 1.00 57.01  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1 51  ? -42.169 -29.961 62.506 1.00 56.50  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1 51  ? -42.569 -31.078 61.553 1.00 56.49  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1 51  ? -42.279 -31.008 60.364 1.00 56.58  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1 51  ? -40.971 -30.405 63.393 1.00 56.28  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1 51  ? -40.450 -29.228 64.220 1.00 56.21  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1 51  ? -39.852 -30.971 62.542 1.00 55.69  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1 51  ? -39.414 -29.592 65.291 1.00 55.50  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1 52  ? -43.267 -32.083 62.078 1.00 56.67  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1 52  ? -43.748 -33.206 61.276 1.00 56.84  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1 52  ? -44.671 -32.744 60.158 1.00 56.56  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1 52  ? -44.497 -33.139 59.007 1.00 56.75  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1 52  ? -44.432 -34.253 62.162 1.00 57.00  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 52  ? -43.522 -34.771 63.254 1.00 58.79  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 52  ? -43.858 -36.182 63.705 1.00 62.82  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 52  ? -42.670 -36.807 64.297 1.00 66.04  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 52  ? -42.363 -36.808 65.598 1.00 67.90  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 52  ? -43.164 -36.229 66.492 1.00 67.43  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 52  ? -41.243 -37.401 66.007 1.00 69.36  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1 53  ? -45.634 -31.896 60.502 1.00 56.61  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1 53  ? -46.574 -31.349 59.531 1.00 56.82  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1 53  ? -45.860 -30.643 58.381 1.00 56.25  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1 53  ? -46.053 -30.997 57.214 1.00 56.39  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1 53  ? -47.563 -30.388 60.205 1.00 57.11  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1 53  ? -48.664 -29.908 59.280 1.00 59.31  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1 53  ? -49.466 -28.785 59.900 1.00 64.69  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1 53  ? -50.409 -28.218 58.935 1.00 69.49  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1 53  ? -51.198 -27.167 59.167 1.00 71.77  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1 53  ? -51.168 -26.546 60.341 1.00 72.97  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1 53  ? -52.021 -26.730 58.217 1.00 72.79  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1 54  ? -45.038 -29.653 58.713 1.00 55.62  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1 54  ? -44.398 -28.816 57.689 1.00 55.02  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1 54  ? -43.247 -29.488 56.932 1.00 54.49  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1 54  ? -42.891 -29.064 55.829 1.00 54.33  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1 54  ? -43.999 -27.455 58.268 1.00 54.81  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1 54  ? -45.203 -26.657 58.695 1.00 54.54  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1 54  ? -45.428 -26.362 60.040 1.00 55.08  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1 54  ? -46.139 -26.227 57.761 1.00 54.53  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1 54  ? -46.552 -25.636 60.449 1.00 54.83  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1 54  ? -47.263 -25.504 58.153 1.00 56.04  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1 54  ? -47.464 -25.213 59.503 1.00 55.95  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1 54  ? -48.581 -24.505 59.895 1.00 56.87  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1 55  ? -42.688 -30.545 57.505 1.00 54.08  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1 55  ? -41.690 -31.326 56.789 1.00 54.00  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1 55  ? -42.328 -32.269 55.783 1.00 54.18  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1 55  ? -41.664 -32.733 54.854 1.00 54.34  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1 55  ? -40.749 -32.050 57.748 1.00 53.70  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1 55  ? -39.794 -31.079 58.427 1.00 53.63  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1 55  ? -38.632 -31.737 59.149 1.00 53.87  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1 55  ? -38.560 -32.964 59.289 1.00 53.82  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1 55  ? -37.711 -30.908 59.624 1.00 52.31  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1 56  ? -43.620 -32.533 55.956 1.00 54.56  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1 56  ? -44.357 -33.389 55.029 1.00 55.17  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1 56  ? -44.809 -32.624 53.795 1.00 54.84  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1 56  ? -44.843 -33.180 52.695 1.00 54.81  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1 56  ? -45.566 -34.020 55.713 1.00 55.52  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1 56  ? -45.296 -35.398 56.266 1.00 57.94  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1 56  ? -46.283 -35.728 57.375 1.00 61.77  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1 56  ? -45.863 -36.990 58.148 1.00 63.76  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1 56  ? -46.582 -37.087 59.462 1.00 64.44  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1 57  ? -45.159 -31.353 53.985 1.00 54.49  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1 57  ? -45.743 -30.550 52.916 1.00 54.21  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1 57  ? -44.735 -29.640 52.203 1.00 54.20  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1 57  ? -43.573 -29.541 52.604 1.00 54.38  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1 57  ? -46.914 -29.741 53.458 1.00 54.16  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1 57  ? -46.483 -28.821 54.445 1.00 54.46  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1 58  ? -45.195 -28.981 51.139 1.00 54.23  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1 58  ? -44.350 -28.124 50.316 1.00 53.73  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1 58  ? -44.963 -26.746 50.055 1.00 53.80  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1 58  ? -44.382 -25.943 49.322 1.00 53.82  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1 58  ? -44.078 -28.771 48.964 1.00 53.44  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1 58  ? -45.315 -28.903 48.269 1.00 54.11  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1 58  ? -43.460 -30.147 49.121 1.00 53.69  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1 59  ? -46.132 -26.455 50.624 1.00 53.86  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1 59  ? -46.710 -25.128 50.382 1.00 54.39  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1 59  ? -45.835 -24.043 50.974 1.00 53.77  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1 59  ? -45.138 -24.264 51.969 1.00 53.40  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1 59  ? -48.186 -24.945 50.821 1.00 54.50  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1 59  ? -48.813 -25.947 51.782 1.00 57.86  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1 59  ? -48.124 -26.035 53.127 1.00 61.66  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1 59  ? -48.727 -25.604 54.136 1.00 62.35  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1 59  ? -46.989 -26.564 53.173 1.00 63.44  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1 60  ? -45.869 -22.881 50.333 1.00 53.30  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1 60  ? -45.206 -21.714 50.860 1.00 53.36  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1 60  ? -45.871 -21.305 52.164 1.00 53.34  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1 60  ? -47.085 -21.463 52.344 1.00 52.91  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1 60  ? -45.209 -20.570 49.845 1.00 53.62  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1 60  ? -44.617 -20.895 48.468 1.00 54.01  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1 60  ? -44.919 -19.777 47.486 1.00 55.09  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1 60  ? -43.113 -21.164 48.541 1.00 54.90  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1 61  ? -45.054 -20.781 53.069 1.00 53.52  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1 61  ? -45.450 -20.601 54.444 1.00 53.92  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1 61  ? -45.557 -19.128 54.824 1.00 54.53  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1 61  ? -45.980 -18.796 55.932 1.00 54.56  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1 61  ? -44.471 -21.344 55.354 1.00 53.94  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1 61  ? -44.251 -22.826 55.027 1.00 53.73  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1 61  ? -43.000 -23.359 55.690 1.00 54.14  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1 61  ? -45.455 -23.662 55.420 1.00 53.42  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1 62  ? -45.181 -18.249 53.899 1.00 55.27  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1 62  ? -45.402 -16.806 54.050 1.00 55.96  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1 62  ? -46.614 -16.440 53.207 1.00 56.62  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1 62  ? -46.772 -16.984 52.108 1.00 56.70  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1 62  ? -44.170 -16.001 53.582 1.00 55.78  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1 62  ? -42.934 -16.437 54.366 1.00 55.13  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1 62  ? -44.400 -14.495 53.725 1.00 55.82  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1 62  ? -41.645 -16.005 53.740 1.00 55.66  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1 63  ? -47.480 -15.553 53.709 1.00 57.52  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1 63  ? -48.669 -15.149 52.933 1.00 58.59  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1 63  ? -48.187 -14.375 51.711 1.00 58.68  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1 63  ? -47.239 -13.587 51.803 1.00 58.64  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1 63  ? -49.664 -14.306 53.749 1.00 59.03  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1 63  ? -49.991 -14.802 55.164 1.00 61.51  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1 63  ? -51.069 -15.881 55.206 1.00 66.07  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1 63  ? -52.433 -15.384 54.961 1.00 70.39  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1 63  ? -53.134 -14.578 55.770 1.00 72.38  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1 63  ? -52.617 -14.103 56.906 1.00 72.94  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1 63  ? -54.367 -14.220 55.425 1.00 72.94  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1 64  ? -48.821 -14.608 50.567 1.00 58.87  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1 64  ? -48.316 -14.072 49.303 1.00 59.16  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1 64  ? -48.257 -12.548 49.259 1.00 59.00  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1 64  ? -47.238 -11.971 48.865 1.00 59.17  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1 64  ? -49.107 -14.627 48.113 1.00 59.36  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1 64  ? -48.967 -16.141 47.972 1.00 61.65  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1 64  ? -49.318 -16.634 46.573 1.00 64.47  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1 64  ? -49.145 -18.163 46.509 1.00 65.60  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1 64  ? -49.090 -18.663 45.098 1.00 66.54  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1 65  ? -49.338 -11.901 49.680 1.00 58.74  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1 65  ? -49.458 -10.457 49.533 1.00 58.31  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1 65  ? -48.361 -9.682  50.286 1.00 57.82  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1 65  ? -47.652 -8.897  49.663 1.00 57.75  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1 65  ? -50.873 -9.978  49.910 1.00 58.66  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 65  ? -51.167 -8.473  49.882 1.00 58.93  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 65  ? -51.259 -7.957  48.452 1.00 58.47  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 65  ? -52.446 -8.179  50.648 1.00 60.14  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1 66  ? -48.216 -9.901  51.615 1.00 57.28  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1 66  ? -47.178 -9.195  52.366 1.00 56.93  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1 66  ? -45.782 -9.388  51.780 1.00 56.75  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1 66  ? -44.987 -8.440  51.753 1.00 56.81  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1 66  ? -47.248 -9.829  53.763 1.00 56.98  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1 66  ? -48.034 -11.061 53.609 1.00 57.31  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1 66  ? -48.991 -10.792 52.493 1.00 57.31  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1 67  ? -45.489 -10.603 51.314 1.00 56.50  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1 67  ? -44.221 -10.882 50.658 1.00 55.79  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1 67  ? -44.083 -10.048 49.395 1.00 55.91  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1 67  ? -43.017 -9.494  49.124 1.00 55.74  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1 67  ? -44.077 -12.358 50.308 1.00 55.66  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1 67  ? -42.748 -12.687 49.705 1.00 54.53  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1 67  ? -41.643 -12.881 50.515 1.00 53.26  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1 67  ? -42.589 -12.759 48.330 1.00 53.62  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1 67  ? -40.409 -13.152 49.971 1.00 52.18  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1 67  ? -41.355 -13.033 47.780 1.00 52.73  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1 67  ? -40.263 -13.228 48.604 1.00 52.46  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1 68  ? -45.167 -9.963  48.627 1.00 55.95  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1 68  ? -45.167 -9.183  47.391 1.00 56.14  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1 68  ? -44.869 -7.699  47.650 1.00 55.63  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1 68  ? -44.022 -7.102  46.975 1.00 55.53  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1 68  ? -46.481 -9.359  46.635 1.00 56.24  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1 68  ? -46.305 -9.233  45.144 1.00 59.10  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1 68  ? -47.614 -9.083  44.400 1.00 63.08  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1 68  ? -48.483 -8.288  44.794 1.00 65.42  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1 68  ? -47.759 -9.828  43.296 1.00 63.13  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1 69  ? -45.535 -7.113  48.641 1.00 54.97  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1 69  ? -45.259 -5.723  49.004 1.00 54.63  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1 69  ? -43.773 -5.512  49.313 1.00 54.13  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1 69  ? -43.149 -4.596  48.775 1.00 53.86  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1 69  ? -46.121 -5.264  50.185 1.00 54.71  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1 69  ? -47.589 -4.963  49.845 1.00 55.29  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1 69  ? -48.279 -4.112  50.936 1.00 55.63  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1 69  ? -48.128 -4.674  52.282 1.00 54.55  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1 69  ? -48.993 -5.507  52.856 1.00 55.37  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1 69  ? -50.096 -5.891  52.219 1.00 55.64  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1 69  ? -48.756 -5.966  54.080 1.00 56.46  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1 70  ? -43.210 -6.376  50.158 1.00 53.60  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1 70  ? -41.801 -6.280  50.536 1.00 53.14  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1 70  ? -40.893 -6.295  49.313 1.00 53.15  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1 70  ? -40.047 -5.420  49.148 1.00 53.25  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1 70  ? -41.425 -7.403  51.497 1.00 53.01  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 70  ? -40.032 -7.352  52.124 1.00 53.09  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 70  ? -39.839 -6.130  53.010 1.00 52.87  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 70  ? -39.816 -8.607  52.925 1.00 52.74  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1 71  ? -41.096 -7.279  48.444 1.00 53.05  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1 71  ? -40.374 -7.354  47.180 1.00 53.05  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1 71  ? -40.415 -6.024  46.422 1.00 53.03  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1 71  ? -39.380 -5.493  46.035 1.00 52.87  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1 71  ? -40.932 -8.497  46.311 1.00 53.26  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1 71  ? -40.377 -8.442  44.900 1.00 53.00  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1 71  ? -40.610 -9.842  46.948 1.00 53.46  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1 72  ? -41.613 -5.481  46.231 1.00 53.33  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1 72  ? -41.781 -4.229  45.493 1.00 53.55  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1 72  ? -41.082 -3.065  46.193 1.00 53.84  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1 72  ? -40.441 -2.236  45.538 1.00 53.97  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1 72  ? -43.261 -3.931  45.251 1.00 53.17  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1 72  ? -43.909 -4.900  44.277 1.00 53.51  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1 72  ? -45.419 -4.702  44.162 1.00 53.76  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1 72  ? -46.056 -5.810  43.446 1.00 54.24  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1 72  ? -46.079 -5.938  42.118 1.00 54.13  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1 72  ? -45.502 -5.029  41.351 1.00 53.62  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1 72  ? -46.674 -6.982  41.551 1.00 54.32  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1 73  ? -41.176 -3.026  47.520 1.00 54.11  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1 73  ? -40.535 -1.975  48.298 1.00 54.63  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1 73  ? -39.020 -1.988  48.076 1.00 54.88  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1 73  ? -38.425 -0.951  47.764 1.00 55.25  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1 73  ? -40.884 -2.117  49.782 1.00 54.69  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 73  ? -40.289 -1.036  50.682 1.00 55.93  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 73  ? -40.505 -1.321  52.162 1.00 57.61  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 73  ? -41.667 -1.463  52.584 1.00 59.25  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 73  ? -39.514 -1.404  52.913 1.00 58.73  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1 74  ? -38.408 -3.164  48.217 1.00 54.91  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1 74  ? -36.967 -3.323  48.019 1.00 54.98  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1 74  ? -36.544 -2.953  46.599 1.00 55.38  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1 74  ? -35.544 -2.259  46.408 1.00 55.48  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1 74  ? -36.491 -4.746  48.404 1.00 54.81  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 74  ? -36.493 -4.898  49.927 1.00 54.56  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 74  ? -35.089 -5.019  47.866 1.00 54.38  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 74  ? -36.781 -6.305  50.430 1.00 56.05  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1 75  ? -37.317 -3.395  45.613 1.00 56.01  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1 75  ? -37.021 -3.108  44.210 1.00 56.91  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1 75  ? -37.093 -1.612  43.881 1.00 57.81  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1 75  ? -36.280 -1.109  43.089 1.00 57.65  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1 75  ? -37.947 -3.897  43.308 1.00 56.74  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1 76  ? -38.053 -0.912  44.501 1.00 58.77  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1 76  ? -38.238 0.537   44.310 1.00 59.97  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1 76  ? -36.954 1.343   44.543 1.00 60.37  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1 76  ? -36.752 2.373   43.909 1.00 60.69  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1 76  ? -39.387 1.067   45.190 1.00 60.37  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 76  ? -39.825 2.539   44.938 1.00 61.54  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 76  ? -40.735 2.734   43.710 1.00 63.52  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 76  ? -41.277 1.778   43.153 1.00 64.31  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 76  ? -40.906 3.987   43.296 1.00 64.01  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1 77  ? -36.083 0.869   45.434 1.00 61.10  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1 77  ? -34.792 1.528   45.663 1.00 61.45  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1 77  ? -33.805 1.339   44.509 1.00 61.59  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1 77  ? -32.796 2.034   44.440 1.00 61.88  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1 77  ? -34.157 1.051   46.972 1.00 61.55  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1 77  ? -34.875 1.584   48.201 1.00 62.72  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1 77  ? -35.224 0.771   49.083 1.00 64.15  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1 77  ? -35.090 2.815   48.299 1.00 64.43  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1 78  ? -34.072 0.402   43.604 1.00 61.58  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1 78  ? -33.138 0.187   42.499 1.00 61.74  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1 78  ? -33.647 0.821   41.218 1.00 62.14  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1 78  ? -32.868 1.333   40.416 1.00 62.02  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1 78  ? -32.824 -1.306  42.296 1.00 61.65  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1 78  ? -32.266 -1.987  43.523 1.00 60.84  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1 78  ? -32.897 -3.104  44.062 1.00 60.07  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1 78  ? -31.122 -1.499  44.150 1.00 60.34  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1 78  ? -32.390 -3.731  45.205 1.00 59.99  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1 78  ? -30.607 -2.116  45.290 1.00 60.25  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1 78  ? -31.242 -3.233  45.819 1.00 59.74  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1 79  ? -34.962 0.772   41.033 1.00 62.75  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1 79  ? -35.624 1.402   39.899 1.00 63.25  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1 79  ? -37.088 1.638   40.233 1.00 63.46  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1 79  ? -37.757 0.768   40.803 1.00 63.68  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1 79  ? -35.503 0.557   38.629 1.00 63.42  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1 79  ? -36.092 1.243   37.405 1.00 64.93  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1 79  ? -35.848 0.475   36.117 1.00 66.94  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1 79  ? -36.196 1.345   34.901 1.00 68.86  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1 79  ? -35.898 0.675   33.598 1.00 69.56  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1 80  ? -37.580 2.820   39.871 1.00 63.64  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1 80  ? -38.950 3.214   40.176 1.00 63.48  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1 80  ? -39.898 2.763   39.076 1.00 63.05  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1 80  ? -39.470 2.454   37.962 1.00 62.69  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1 80  ? -39.060 4.732   40.371 1.00 63.75  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1 80  ? -38.686 5.400   39.156 1.00 64.32  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1 80  ? -38.144 5.190   41.509 1.00 64.20  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1 81  ? -41.186 2.717   39.412 1.00 62.93  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1 81  ? -42.252 2.299   38.489 1.00 62.86  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1 81  ? -41.983 0.942   37.825 1.00 62.37  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1 81  ? -41.964 0.821   36.600 1.00 62.61  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1 81  ? -42.547 3.393   37.440 1.00 62.98  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1 81  ? -43.883 3.182   36.721 1.00 63.86  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1 81  ? -44.868 2.731   37.368 1.00 63.93  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1 81  ? -43.941 3.467   35.502 1.00 64.55  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1 82  ? -41.766 -0.079  38.643 1.00 61.70  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1 82  ? -41.552 -1.409  38.111 1.00 60.92  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1 82  ? -42.832 -2.211  38.163 1.00 60.50  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1 82  ? -43.667 -1.999  39.040 1.00 60.49  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1 82  ? -40.441 -2.131  38.876 1.00 60.81  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1 82  ? -38.994 -1.778  38.520 1.00 60.22  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1 82  ? -38.066 -2.622  39.350 1.00 59.47  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1 82  ? -38.706 -1.984  37.042 1.00 59.28  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1 83  ? -42.993 -3.114  37.204 1.00 60.16  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1 83  ? -44.038 -4.128  37.286 1.00 60.08  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1 83  ? -43.342 -5.480  37.434 1.00 59.73  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1 83  ? -42.153 -5.611  37.098 1.00 59.65  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1 83  ? -44.956 -4.098  36.057 1.00 60.28  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1 83  ? -45.466 -2.703  35.679 1.00 61.38  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1 83  ? -46.402 -2.757  34.490 1.00 62.93  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1 83  ? -47.797 -2.557  34.880 1.00 65.28  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1 83  ? -48.847 -2.968  34.172 1.00 66.26  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1 83  ? -48.675 -3.626  33.029 1.00 65.96  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1 83  ? -50.078 -2.731  34.616 1.00 67.03  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1 84  ? -44.071 -6.469  37.950 1.00 59.05  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1 84  ? -43.526 -7.808  38.204 1.00 58.30  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1 84  ? -44.383 -8.870  37.547 1.00 57.76  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1 84  ? -45.599 -8.893  37.757 1.00 57.77  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1 84  ? -43.508 -8.096  39.710 1.00 58.41  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 84  ? -42.278 -7.608  40.418 1.00 58.63  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 84  ? -42.189 -6.295  40.870 1.00 59.39  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 84  ? -41.218 -8.473  40.662 1.00 59.30  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 84  ? -41.045 -5.844  41.532 1.00 59.62  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 84  ? -40.070 -8.035  41.326 1.00 59.55  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 84  ? -39.984 -6.719  41.756 1.00 59.73  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1 85  ? -43.769 -9.760  36.769 1.00 56.98  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1 85  ? -44.471 -10.972 36.348 1.00 56.44  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1 85  ? -44.865 -11.761 37.588 1.00 56.27  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1 85  ? -44.109 -11.813 38.554 1.00 56.54  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1 85  ? -43.613 -11.837 35.432 1.00 56.37  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 85  ? -43.751 -11.491 33.980 1.00 55.86  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 85  ? -42.880 -12.322 33.076 1.00 55.04  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 85  ? -42.196 -13.245 33.509 1.00 55.73  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 85  ? -42.904 -11.995 31.797 1.00 55.47  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1 86  ? -46.057 -12.347 37.567 1.00 55.88  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1 86  ? -46.578 -13.082 38.704 1.00 55.46  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1 86  ? -45.611 -14.189 39.090 1.00 54.98  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1 86  ? -45.317 -14.396 40.265 1.00 54.82  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1 86  ? -47.936 -13.680 38.367 1.00 55.55  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1 86  ? -48.353 -14.533 39.416 1.00 56.89  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1 87  ? -45.106 -14.878 38.076 1.00 54.55  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1 87  ? -44.170 -15.971 38.259 1.00 54.11  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1 87  ? -42.832 -15.477 38.813 1.00 53.73  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1 87  ? -42.127 -16.223 39.492 1.00 53.62  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1 87  ? -43.947 -16.676 36.931 1.00 53.86  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1 87  ? -43.370 -15.774 36.010 1.00 54.35  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1 88  ? -42.488 -14.225 38.518 1.00 53.27  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1 88  ? -41.262 -13.607 39.048 1.00 52.63  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1 88  ? -41.288 -13.493 40.568 1.00 52.17  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1 88  ? -40.320 -13.863 41.235 1.00 52.14  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1 88  ? -41.015 -12.245 38.408 1.00 52.41  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1 89  ? -42.397 -12.991 41.109 1.00 51.78  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1 89  ? -42.590 -12.929 42.560 1.00 51.45  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1 89  ? -42.524 -14.350 43.129 1.00 51.68  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1 89  ? -41.829 -14.600 44.113 1.00 51.48  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1 89  ? -43.941 -12.251 42.936 1.00 51.26  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1 89  ? -44.136 -12.205 44.447 1.00 50.08  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1 89  ? -44.013 -10.838 42.366 1.00 51.16  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1 90  ? -43.239 -15.268 42.479 1.00 51.81  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1 90  ? -43.281 -16.668 42.878 1.00 52.25  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1 90  ? -41.886 -17.270 42.985 1.00 51.72  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1 90  ? -41.511 -17.817 44.027 1.00 51.83  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1 90  ? -44.151 -17.484 41.911 1.00 53.08  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1 90  ? -45.640 -17.270 42.097 1.00 55.26  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1 90  ? -46.060 -17.308 43.847 1.00 63.84  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1 90  ? -45.908 -19.073 44.151 1.00 63.26  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1 91  ? -41.113 -17.148 41.909 1.00 50.84  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1 91  ? -39.721 -17.550 41.925 1.00 49.58  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1 91  ? -39.006 -16.984 43.162 1.00 49.09  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1 91  ? -38.359 -17.739 43.895 1.00 49.21  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1 91  ? -39.025 -17.132 40.633 1.00 49.01  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1 92  ? -39.150 -15.682 43.423 1.00 48.14  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1 92  ? -38.455 -15.076 44.559 1.00 47.17  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1 92  ? -38.895 -15.692 45.876 1.00 46.86  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1 92  ? -38.073 -15.898 46.771 1.00 46.67  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1 92  ? -38.627 -13.555 44.600 1.00 46.74  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1 92  ? -37.762 -12.730 43.646 1.00 46.46  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1 92  ? -38.369 -11.335 43.359 1.00 44.51  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1 92  ? -36.334 -12.621 44.146 1.00 45.42  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1 93  ? -40.184 -15.993 46.002 1.00 46.41  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1 93  ? -40.670 -16.554 47.257 1.00 46.19  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1 93  ? -40.121 -17.967 47.471 1.00 45.89  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1 93  ? -39.601 -18.281 48.544 1.00 45.51  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1 93  ? -42.196 -16.517 47.352 1.00 46.16  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1 93  ? -42.682 -16.493 48.788 1.00 46.86  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1 93  ? -44.191 -16.511 48.926 1.00 47.85  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1 93  ? -44.914 -15.969 48.091 1.00 50.49  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1 93  ? -44.674 -17.114 50.000 1.00 47.62  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1 94  ? -40.226 -18.801 46.439 1.00 45.40  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1 94  ? -39.653 -20.131 46.465 1.00 44.97  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1 94  ? -38.193 -20.074 46.883 1.00 44.56  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1 94  ? -37.779 -20.815 47.778 1.00 44.61  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1 94  ? -39.776 -20.807 45.103 1.00 45.16  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1 94  ? -41.203 -21.157 44.683 1.00 46.54  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1 94  ? -41.765 -22.373 45.397 1.00 48.39  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1 94  ? -43.011 -22.484 45.464 1.00 49.54  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1 94  ? -40.972 -23.215 45.878 1.00 47.89  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1 95  ? -37.416 -19.190 46.260 1.00 43.81  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1 95  ? -35.989 -19.092 46.580 1.00 43.35  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1 95  ? -35.755 -18.590 48.000 1.00 43.55  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1 95  ? -34.938 -19.166 48.725 1.00 44.33  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1 95  ? -35.249 -18.248 45.577 1.00 42.92  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1 96  ? -36.492 -17.559 48.414 1.00 43.19  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1 96  ? -36.337 -17.000 49.754 1.00 43.00  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1 96  ? -36.720 -17.979 50.854 1.00 43.06  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1 96  ? -36.047 -18.058 51.882 1.00 43.37  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1 96  ? -37.130 -15.706 49.909 1.00 42.96  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1 96  ? -36.656 -14.719 49.013 1.00 43.27  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1 97  ? -37.795 -18.732 50.644 1.00 42.99  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1 97  ? -38.212 -19.730 51.632 1.00 42.60  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1 97  ? -37.260 -20.936 51.697 1.00 41.98  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1 97  ? -36.907 -21.376 52.775 1.00 42.06  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1 97  ? -39.669 -20.152 51.419 1.00 42.86  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1 97  ? -40.665 -18.997 51.548 1.00 44.26  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1 97  ? -42.075 -19.466 51.865 1.00 46.41  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1 97  ? -42.244 -20.656 52.201 1.00 46.98  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1 97  ? -43.015 -18.645 51.774 1.00 47.42  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1 98  ? -36.811 -21.450 50.557 1.00 41.47  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1 98  ? -35.759 -22.480 50.568 1.00 40.78  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1 98  ? -34.533 -21.999 51.349 1.00 40.79  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1 98  ? -34.017 -22.718 52.197 1.00 40.67  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1 98  ? -35.372 -22.863 49.174 1.00 40.30  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1 99  ? -34.086 -20.772 51.070 1.00 40.74  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1 99  ? -32.925 -20.209 51.735 1.00 40.16  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1 99  ? -33.111 -20.194 53.244 1.00 40.37  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1 99  ? -32.260 -20.704 53.976 1.00 41.02  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1 99  ? -32.616 -18.806 51.208 1.00 40.31  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1 99  ? -31.633 -18.019 52.057 1.00 39.24  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1 99  ? -30.252 -18.218 51.947 1.00 38.77  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1 99  ? -32.087 -17.085 52.967 1.00 38.51  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1 99  ? -29.352 -17.499 52.733 1.00 37.80  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1 99  ? -31.205 -16.359 53.753 1.00 39.52  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1 99  ? -29.839 -16.567 53.633 1.00 40.30  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1 99  ? -28.983 -15.821 54.431 1.00 42.11  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1 100 ? -34.217 -19.622 53.708 1.00 40.02  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1 100 ? -34.444 -19.476 55.139 1.00 39.61  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1 100 ? -34.594 -20.815 55.844 1.00 39.68  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1 100 ? -34.110 -20.976 56.967 1.00 40.01  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1 100 ? -35.664 -18.605 55.410 1.00 39.27  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 100 ? -35.526 -17.116 55.096 1.00 39.64  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 100 ? -36.892 -16.438 55.218 1.00 39.93  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 100 ? -34.483 -16.411 55.980 1.00 37.29  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1 101 ? -35.259 -21.769 55.191 1.00 39.22  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1 101 ? -35.428 -23.111 55.739 1.00 39.15  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1 101 ? -34.066 -23.771 55.973 1.00 39.14  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1 101 ? -33.826 -24.362 57.029 1.00 39.26  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1 101 ? -36.278 -24.025 54.812 1.00 39.49  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1 101 ? -36.167 -25.485 55.259 1.00 39.66  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1 101 ? -37.742 -23.595 54.807 1.00 38.93  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1 102 ? -33.171 -23.659 54.995 1.00 38.82  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1 102 ? -31.844 -24.254 55.118 1.00 38.32  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1 102 ? -31.018 -23.512 56.167 1.00 38.58  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1 102 ? -30.252 -24.129 56.920 1.00 39.26  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1 102 ? -31.143 -24.305 53.784 1.00 37.60  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1 103 ? -31.204 -22.202 56.264 1.00 38.52  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1 103 ? -30.485 -21.426 57.275 1.00 38.55  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1 103 ? -30.912 -21.831 58.689 1.00 38.68  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1 103 ? -30.083 -21.918 59.592 1.00 38.07  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1 103 ? -30.664 -19.916 57.052 1.00 38.36  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1 103 ? -29.971 -18.970 58.037 1.00 37.82  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1 103 ? -28.491 -19.162 57.985 1.00 36.74  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1 103 ? -30.317 -17.518 57.735 1.00 39.02  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1 104 ? -32.204 -22.087 58.870 1.00 39.26  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1 104 ? -32.701 -22.590 60.154 1.00 40.05  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1 104 ? -32.128 -23.958 60.531 1.00 40.59  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1 104 ? -31.890 -24.213 61.704 1.00 40.81  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1 104 ? -34.234 -22.611 60.205 1.00 39.91  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1 104 ? -34.861 -21.250 60.414 1.00 39.34  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1 104 ? -35.771 -20.734 59.493 1.00 38.54  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1 104 ? -34.542 -20.485 61.532 1.00 38.76  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1 104 ? -36.356 -19.476 59.696 1.00 38.88  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1 104 ? -35.111 -19.231 61.736 1.00 37.99  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1 104 ? -36.020 -18.725 60.818 1.00 37.76  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1 105 ? -31.884 -24.825 59.551 1.00 41.01  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1 105 ? -31.255 -26.109 59.844 1.00 41.76  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1 105 ? -29.849 -25.882 60.383 1.00 41.76  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1 105 ? -29.491 -26.412 61.430 1.00 42.51  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1 105 ? -31.230 -27.021 58.610 1.00 42.06  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1 105 ? -32.592 -27.260 57.977 1.00 43.65  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1 105 ? -32.493 -27.869 56.577 1.00 48.08  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1 105 ? -31.377 -28.321 56.234 1.00 51.33  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1 105 ? -33.513 -27.910 55.821 1.00 46.75  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1 106 ? -29.054 -25.080 59.680 1.00 41.75  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1 106 ? -27.717 -24.735 60.150 1.00 41.39  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1 106 ? -27.773 -24.085 61.531 1.00 41.01  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1 106 ? -26.967 -24.412 62.418 1.00 40.94  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1 106 ? -27.027 -23.804 59.155 1.00 41.54  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1 106 ? -26.748 -24.473 57.809 1.00 43.60  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1 106 ? -27.099 -25.666 57.640 1.00 46.21  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1 106 ? -26.164 -23.805 56.913 1.00 45.17  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1 107 ? -28.727 -23.166 61.699 1.00 40.63  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1 107 ? -28.892 -22.403 62.934 1.00 40.23  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1 107 ? -29.145 -23.399 64.056 1.00 40.45  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1 107 ? -28.524 -23.333 65.131 1.00 40.64  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1 107 ? -30.075 -21.399 62.817 1.00 40.30  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1 107 ? -29.774 -20.411 61.824 1.00 39.75  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 107 ? -30.342 -20.704 64.126 1.00 39.05  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1 108 ? -30.040 -24.341 63.780 1.00 40.12  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1 108 ? -30.392 -25.367 64.737 1.00 40.10  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1 108 ? -29.197 -26.213 65.137 1.00 39.91  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1 108 ? -29.040 -26.518 66.319 1.00 40.36  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1 108 ? -31.537 -26.243 64.214 1.00 40.10  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1 108 ? -32.387 -26.808 65.328 1.00 40.56  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1 108 ? -32.543 -26.189 66.382 1.00 44.23  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1 108 ? -32.947 -27.977 65.106 1.00 39.22  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1 109 ? -28.347 -26.579 64.175 1.00 39.54  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1 109 ? -27.112 -27.286 64.517 1.00 39.42  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1 109 ? -26.238 -26.430 65.430 1.00 39.54  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1 109 ? -25.636 -26.938 66.372 1.00 40.28  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1 109 ? -26.347 -27.741 63.274 1.00 38.84  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 109 ? -27.084 -28.741 62.376 1.00 38.98  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 109 ? -26.398 -28.892 61.048 1.00 37.85  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 109 ? -27.244 -30.114 63.045 1.00 38.25  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1 110 ? -26.198 -25.129 65.176 1.00 39.78  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1 110 ? -25.377 -24.227 65.978 1.00 40.31  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1 110 ? -25.856 -24.109 67.441 1.00 40.47  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1 110 ? -25.044 -24.104 68.371 1.00 40.14  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1 110 ? -25.286 -22.858 65.309 1.00 40.46  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1 110 ? -24.292 -22.845 63.804 1.00 41.46  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1 111 ? -27.174 -24.038 67.635 1.00 40.59  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1 111 ? -27.773 -24.112 68.971 1.00 40.45  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1 111 ? -27.428 -25.413 69.676 1.00 40.74  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1 111 ? -27.037 -25.410 70.850 1.00 41.03  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1 111 ? -29.260 -23.962 68.892 1.00 40.55  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1 112 ? -27.573 -26.524 68.961 1.00 40.57  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1 112 ? -27.297 -27.840 69.527 1.00 40.61  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1 112 ? -25.806 -28.022 69.856 1.00 41.26  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1 112 ? -25.461 -28.660 70.863 1.00 41.47  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1 112 ? -27.840 -28.963 68.600 1.00 40.83  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1 112 ? -29.370 -28.944 68.615 1.00 39.19  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1 112 ? -27.322 -30.369 69.010 1.00 40.09  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1 112 ? -30.005 -29.645 67.452 1.00 36.92  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1 113 ? -24.927 -27.450 69.028 1.00 41.69  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1 113 ? -23.489 -27.461 69.318 1.00 41.84  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1 113 ? -23.199 -26.822 70.675 1.00 42.45  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1 113 ? -22.327 -27.284 71.403 1.00 42.81  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1 113 ? -22.705 -26.739 68.222 1.00 41.68  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1 113 ? -21.213 -26.839 68.371 1.00 40.61  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1 113 ? -20.503 -27.977 68.046 1.00 37.91  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1 113 ? -20.301 -25.937 68.806 1.00 38.97  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1 113 ? -19.217 -27.766 68.266 1.00 37.65  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1 113 ? -19.067 -26.537 68.728 1.00 36.13  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1 114 ? -23.937 -25.767 71.008 1.00 42.91  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1 114 ? -23.764 -25.075 72.282 1.00 43.66  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1 114 ? -24.639 -25.687 73.383 1.00 44.39  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1 114 ? -24.837 -25.082 74.434 1.00 44.45  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1 114 ? -24.058 -23.599 72.117 1.00 43.43  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1 115 ? -25.163 -26.889 73.123 1.00 45.17  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1 115 ? -25.914 -27.679 74.111 1.00 45.51  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1 115 ? -27.241 -27.035 74.538 1.00 45.25  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1 115 ? -27.690 -27.194 75.683 1.00 45.25  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1 115 ? -25.026 -28.036 75.317 1.00 45.88  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1 115 ? -23.761 -28.812 74.932 1.00 47.53  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1 115 ? -22.935 -29.164 76.144 1.00 51.74  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1 115 ? -21.680 -29.933 75.742 1.00 55.10  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1 115 ? -20.958 -30.490 76.931 1.00 57.27  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1 116 ? -27.855 -26.316 73.598 1.00 44.81  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1 116 ? -29.185 -25.731 73.779 1.00 44.54  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1 116 ? -30.153 -26.380 72.807 1.00 44.41  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1 116 ? -29.755 -27.091 71.890 1.00 44.27  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1 116 ? -29.175 -24.208 73.520 1.00 44.58  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1 116 ? -28.413 -23.354 74.538 1.00 43.88  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1 116 ? -28.472 -21.879 74.171 1.00 42.97  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1 116 ? -27.421 -21.488 73.236 1.00 43.54  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1 116 ? -27.592 -21.312 71.924 1.00 44.22  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1 116 ? -28.777 -21.483 71.368 1.00 44.36  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1 116 ? -26.574 -20.947 71.154 1.00 44.24  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1 117 ? -31.433 -26.105 73.004 1.00 44.42  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1 117 ? -32.473 -26.558 72.091 1.00 44.20  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1 117 ? -33.261 -25.344 71.589 1.00 44.52  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1 117 ? -34.201 -25.467 70.809 1.00 44.90  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1 117 ? -33.410 -27.612 72.769 1.00 44.29  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1 117 ? -32.661 -28.925 73.035 1.00 43.45  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1 117 ? -33.989 -27.069 74.055 1.00 43.27  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1 118 ? -32.856 -24.162 72.040 1.00 44.83  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1 118 ? -33.486 -22.909 71.641 1.00 44.88  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1 118 ? -32.578 -22.153 70.682 1.00 44.86  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1 118 ? -31.421 -21.901 71.007 1.00 44.56  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1 118 ? -33.718 -22.012 72.868 1.00 44.86  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1 118 ? -34.332 -22.779 73.913 1.00 45.66  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1 118 ? -34.590 -20.810 72.518 1.00 45.27  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1 119 ? -33.097 -21.782 69.507 1.00 44.99  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1 119 ? -32.304 -20.984 68.561 1.00 44.71  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1 119 ? -32.278 -19.493 68.922 1.00 44.87  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1 119 ? -33.291 -18.909 69.301 1.00 44.92  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1 119 ? -32.700 -21.205 67.083 1.00 44.29  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 119 ? -34.132 -20.755 66.821 1.00 44.14  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 119 ? -32.472 -22.664 66.685 1.00 44.38  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 119 ? -34.434 -20.535 65.356 1.00 44.15  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1 120 ? -31.098 -18.899 68.801 1.00 44.97  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1 120 ? -30.852 -17.520 69.183 1.00 45.40  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1 120 ? -30.143 -16.820 68.041 1.00 45.47  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1 120 ? -29.570 -17.481 67.181 1.00 45.65  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1 120 ? -29.988 -17.465 70.445 1.00 45.32  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1 120 ? -30.728 -17.856 71.692 1.00 47.03  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1 120 ? -29.687 -18.121 73.124 1.00 50.84  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1 120 ? -30.898 -18.817 74.252 1.00 48.89  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1 121 ? -30.172 -15.477 68.022 1.00 45.45  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1 121 ? -29.557 -14.785 66.907 1.00 45.05  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1 121 ? -28.086 -15.150 66.751 1.00 45.07  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1 121 ? -27.581 -15.207 65.619 1.00 45.47  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1 121 ? -29.715 -13.311 67.288 1.00 45.06  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1 121 ? -30.952 -13.287 68.109 1.00 45.29  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1 121 ? -30.854 -14.536 68.936 1.00 45.69  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1 122 ? -27.395 -15.415 67.857 1.00 44.23  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1 122 ? -25.976 -15.727 67.741 1.00 43.26  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1 122 ? -25.750 -17.032 66.973 1.00 42.56  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1 122 ? -24.684 -17.241 66.407 1.00 42.59  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1 122 ? -25.273 -15.724 69.096 1.00 42.98  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1 122 ? -25.817 -16.710 70.092 1.00 44.30  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1 122 ? -24.953 -16.722 71.330 1.00 46.34  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1 122 ? -25.808 -16.980 72.543 1.00 49.36  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1 122 ? -25.075 -16.618 73.773 1.00 51.54  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1 123 ? -26.767 -17.891 66.946 1.00 41.79  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1 123 ? -26.726 -19.117 66.155 1.00 40.82  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1 123 ? -26.869 -18.800 64.672 1.00 40.44  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1 123 ? -26.068 -19.254 63.875 1.00 40.12  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1 123 ? -27.820 -20.077 66.604 1.00 40.92  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1 123 ? -27.736 -20.411 68.076 1.00 41.09  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1 123 ? -26.647 -20.813 68.533 1.00 41.65  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1 123 ? -28.763 -20.307 68.777 1.00 41.27  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1 124 ? -27.880 -18.009 64.306 1.00 40.38  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1 124 ? -28.004 -17.482 62.940 1.00 40.37  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1 124 ? -26.715 -16.776 62.508 1.00 40.70  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1 124 ? -26.237 -16.986 61.398 1.00 40.92  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1 124 ? -29.220 -16.505 62.780 1.00 40.28  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1 124 ? -30.539 -17.235 63.022 1.00 40.01  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1 124 ? -29.275 -15.890 61.380 1.00 39.37  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1 124 ? -31.754 -16.331 63.023 1.00 40.81  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1 125 ? -26.152 -15.963 63.397 1.00 41.14  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1 125 ? -24.931 -15.207 63.111 1.00 41.50  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1 125 ? -23.768 -16.129 62.815 1.00 40.99  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1 125 ? -23.072 -15.930 61.831 1.00 41.37  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1 125 ? -24.587 -14.261 64.270 1.00 41.84  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 125 ? -25.358 -12.940 64.245 1.00 43.78  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 125 ? -25.552 -12.327 65.640 1.00 48.95  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 125 ? -24.693 -12.463 66.533 1.00 50.80  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 125 ? -26.687 -11.645 65.832 1.00 48.45  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1 126 ? -23.576 -17.148 63.649 1.00 40.47  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1 126 ? -22.484 -18.087 63.444 1.00 40.13  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1 126 ? -22.634 -18.804 62.115 1.00 40.23  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1 126 ? -21.669 -18.913 61.357 1.00 40.52  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1 126 ? -22.415 -19.110 64.572 1.00 39.72  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 126 ? -21.224 -20.054 64.425 1.00 40.08  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 126 ? -19.882 -19.296 64.645 1.00 39.01  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 126 ? -21.378 -21.251 65.369 1.00 40.24  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1 127 ? -23.841 -19.288 61.838 1.00 39.93  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1 127 ? -24.107 -19.993 60.609 1.00 40.53  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1 127 ? -23.783 -19.132 59.384 1.00 41.02  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1 127 ? -23.175 -19.604 58.431 1.00 41.20  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1 127 ? -25.545 -20.469 60.580 1.00 40.74  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1 128 ? -24.142 -17.856 59.423 1.00 41.57  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1 128 ? -23.844 -16.971 58.298 1.00 41.97  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1 128 ? -22.363 -16.661 58.153 1.00 42.24  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1 128 ? -21.863 -16.550 57.039 1.00 42.68  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1 128 ? -24.681 -15.697 58.361 1.00 41.69  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1 128 ? -26.150 -15.977 58.112 1.00 41.58  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1 128 ? -26.991 -14.720 58.050 1.00 42.12  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1 128 ? -26.814 -13.990 56.795 1.00 43.18  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1 128 ? -26.465 -12.706 56.721 1.00 42.81  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1 128 ? -26.269 -11.995 57.815 1.00 42.27  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1 128 ? -26.326 -12.121 55.547 1.00 43.61  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1 129 ? -21.658 -16.535 59.268 1.00 42.63  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1 129 ? -20.234 -16.245 59.211 1.00 43.53  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1 129 ? -19.495 -17.430 58.582 1.00 44.22  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1 129 ? -18.665 -17.250 57.693 1.00 44.44  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1 129 ? -19.701 -15.839 60.592 1.00 43.10  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1 129 ? -18.206 -16.029 60.822 1.00 44.98  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1 129 ? -17.300 -15.158 59.944 1.00 47.00  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1 129 ? -15.891 -15.547 60.077 1.00 48.68  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1 129 ? -15.337 -16.609 59.477 1.00 49.50  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1 129 ? -16.069 -17.399 58.693 1.00 48.26  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1 129 ? -14.048 -16.885 59.660 1.00 48.62  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1 130 ? -19.844 -18.641 59.002 1.00 44.90  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1 130 ? -19.198 -19.843 58.482 1.00 45.48  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1 130 ? -19.565 -20.111 57.019 1.00 46.33  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1 130 ? -18.691 -20.436 56.212 1.00 46.73  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1 130 ? -19.443 -21.052 59.402 1.00 45.31  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1 130 ? -18.736 -20.813 60.723 1.00 45.03  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1 130 ? -18.929 -22.343 58.788 1.00 44.22  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1 130 ? -19.278 -21.631 61.816 1.00 47.04  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1 131 ? -20.842 -19.950 56.675 1.00 47.12  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1 131 ? -21.270 -19.962 55.266 1.00 47.86  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1 131 ? -20.513 -18.940 54.413 1.00 48.96  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1 131 ? -20.552 -19.004 53.196 1.00 48.52  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1 131 ? -22.769 -19.694 55.136 1.00 47.33  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1 131 ? -23.672 -20.868 55.384 1.00 44.97  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1 131 ? -25.073 -20.351 55.526 1.00 43.87  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1 131 ? -26.090 -21.395 55.502 1.00 44.31  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1 131 ? -27.226 -21.309 54.811 1.00 43.45  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1 131 ? -27.474 -20.230 54.076 1.00 42.00  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1 131 ? -28.107 -22.305 54.845 1.00 42.16  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1 132 ? -19.834 -17.999 55.065 1.00 50.97  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1 132 ? -19.065 -16.971 54.368 1.00 53.14  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1 132 ? -19.942 -15.860 53.830 1.00 54.80  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1 132 ? -19.581 -15.195 52.865 1.00 55.17  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1 133 ? -21.101 -15.667 54.451 1.00 56.44  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1 133 ? -22.005 -14.591 54.082 1.00 58.20  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1 133 ? -21.636 -13.301 54.822 1.00 60.01  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1 133 ? -22.052 -12.209 54.425 1.00 60.38  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1 133 ? -23.470 -14.995 54.340 1.00 57.87  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1 133 ? -24.069 -15.903 53.245 1.00 56.90  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1 133 ? -25.392 -16.591 53.625 1.00 55.41  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1 133 ? -26.266 -15.963 54.260 1.00 54.20  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1 133 ? -25.562 -17.773 53.253 1.00 55.27  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1 134 ? -20.844 -13.428 55.890 1.00 61.93  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1 134 ? -20.425 -12.269 56.688 1.00 63.52  ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1 134 ? -19.008 -11.789 56.298 1.00 64.09  ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A 1 134 ? -18.111 -11.626 57.148 1.00 64.62  ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1 134 ? -20.536 -12.556 58.203 1.00 63.97  ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1 134 ? -21.940 -12.993 58.678 1.00 66.23  ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1 134 ? -22.399 -12.267 59.945 1.00 70.05  ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1 134 ? -22.729 -10.857 59.668 1.00 73.89  ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1 134 ? -23.391 -10.041 60.498 1.00 75.29  ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1 134 ? -23.820 -10.474 61.683 1.00 75.59  ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1 134 ? -23.627 -8.780  60.143 1.00 75.14  ? 134  ARG A NH2   1 
ATOM   803   N  N     . VAL B 2 21  ? -54.241 1.947   60.839 1.00 87.65  ? 21   VAL B N     1 
ATOM   804   C  CA    . VAL B 2 21  ? -53.340 0.943   61.487 1.00 87.66  ? 21   VAL B CA    1 
ATOM   805   C  C     . VAL B 2 21  ? -52.110 0.666   60.595 1.00 87.50  ? 21   VAL B C     1 
ATOM   806   O  O     . VAL B 2 21  ? -51.884 -0.474  60.158 1.00 87.54  ? 21   VAL B O     1 
ATOM   807   C  CB    . VAL B 2 21  ? -54.089 -0.393  61.834 1.00 87.72  ? 21   VAL B CB    1 
ATOM   808   C  CG1   . VAL B 2 21  ? -53.465 -1.050  63.068 1.00 87.79  ? 21   VAL B CG1   1 
ATOM   809   C  CG2   . VAL B 2 21  ? -55.593 -0.161  62.050 1.00 87.79  ? 21   VAL B CG2   1 
ATOM   810   N  N     . LEU B 2 22  ? -51.321 1.714   60.335 1.00 87.14  ? 22   LEU B N     1 
ATOM   811   C  CA    . LEU B 2 22  ? -50.125 1.617   59.475 1.00 86.66  ? 22   LEU B CA    1 
ATOM   812   C  C     . LEU B 2 22  ? -49.080 0.614   59.983 1.00 86.03  ? 22   LEU B C     1 
ATOM   813   O  O     . LEU B 2 22  ? -48.789 0.553   61.186 1.00 86.19  ? 22   LEU B O     1 
ATOM   814   C  CB    . LEU B 2 22  ? -49.475 2.995   59.242 1.00 86.89  ? 22   LEU B CB    1 
ATOM   815   C  CG    . LEU B 2 22  ? -49.321 4.116   60.293 1.00 87.71  ? 22   LEU B CG    1 
ATOM   816   C  CD1   . LEU B 2 22  ? -48.997 3.644   61.722 1.00 88.37  ? 22   LEU B CD1   1 
ATOM   817   C  CD2   . LEU B 2 22  ? -48.258 5.119   59.817 1.00 88.40  ? 22   LEU B CD2   1 
ATOM   818   N  N     . ARG B 2 23  ? -48.526 -0.170  59.059 1.00 84.86  ? 23   ARG B N     1 
ATOM   819   C  CA    . ARG B 2 23  ? -47.535 -1.188  59.401 1.00 83.74  ? 23   ARG B CA    1 
ATOM   820   C  C     . ARG B 2 23  ? -46.447 -1.294  58.330 1.00 82.57  ? 23   ARG B C     1 
ATOM   821   O  O     . ARG B 2 23  ? -46.753 -1.354  57.136 1.00 82.47  ? 23   ARG B O     1 
ATOM   822   C  CB    . ARG B 2 23  ? -48.217 -2.550  59.630 1.00 83.84  ? 23   ARG B CB    1 
ATOM   823   C  CG    . ARG B 2 23  ? -47.253 -3.674  60.009 1.00 84.88  ? 23   ARG B CG    1 
ATOM   824   C  CD    . ARG B 2 23  ? -47.936 -4.897  60.654 1.00 86.88  ? 23   ARG B CD    1 
ATOM   825   N  NE    . ARG B 2 23  ? -48.832 -5.688  59.788 1.00 88.28  ? 23   ARG B NE    1 
ATOM   826   C  CZ    . ARG B 2 23  ? -48.706 -5.895  58.470 1.00 88.92  ? 23   ARG B CZ    1 
ATOM   827   N  NH1   . ARG B 2 23  ? -47.693 -5.386  57.774 1.00 89.11  ? 23   ARG B NH1   1 
ATOM   828   N  NH2   . ARG B 2 23  ? -49.611 -6.637  57.839 1.00 88.41  ? 23   ARG B NH2   1 
ATOM   829   N  N     . ASP B 2 24  ? -45.185 -1.298  58.771 1.00 80.97  ? 24   ASP B N     1 
ATOM   830   C  CA    . ASP B 2 24  ? -44.025 -1.570  57.906 1.00 79.37  ? 24   ASP B CA    1 
ATOM   831   C  C     . ASP B 2 24  ? -44.182 -2.885  57.143 1.00 77.73  ? 24   ASP B C     1 
ATOM   832   O  O     . ASP B 2 24  ? -44.686 -3.869  57.694 1.00 77.45  ? 24   ASP B O     1 
ATOM   833   C  CB    . ASP B 2 24  ? -42.745 -1.646  58.745 1.00 79.90  ? 24   ASP B CB    1 
ATOM   834   C  CG    . ASP B 2 24  ? -41.936 -0.369  58.700 1.00 80.81  ? 24   ASP B CG    1 
ATOM   835   O  OD1   . ASP B 2 24  ? -41.359 -0.071  57.627 1.00 82.40  ? 24   ASP B OD1   1 
ATOM   836   O  OD2   . ASP B 2 24  ? -41.855 0.319   59.743 1.00 81.67  ? 24   ASP B OD2   1 
ATOM   837   N  N     . ASN B 2 25  ? -43.740 -2.900  55.886 1.00 75.61  ? 25   ASN B N     1 
ATOM   838   C  CA    . ASN B 2 25  ? -43.897 -4.079  55.031 1.00 73.67  ? 25   ASN B CA    1 
ATOM   839   C  C     . ASN B 2 25  ? -43.146 -5.307  55.544 1.00 72.38  ? 25   ASN B C     1 
ATOM   840   O  O     . ASN B 2 25  ? -43.670 -6.418  55.511 1.00 72.17  ? 25   ASN B O     1 
ATOM   841   C  CB    . ASN B 2 25  ? -43.500 -3.765  53.588 1.00 73.66  ? 25   ASN B CB    1 
ATOM   842   C  CG    . ASN B 2 25  ? -44.570 -2.972  52.840 1.00 73.24  ? 25   ASN B CG    1 
ATOM   843   O  OD1   . ASN B 2 25  ? -45.702 -3.430  52.662 1.00 71.79  ? 25   ASN B OD1   1 
ATOM   844   N  ND2   . ASN B 2 25  ? -44.206 -1.781  52.388 1.00 73.07  ? 25   ASN B ND2   1 
ATOM   845   N  N     . ILE B 2 26  ? -41.930 -5.092  56.038 1.00 70.72  ? 26   ILE B N     1 
ATOM   846   C  CA    . ILE B 2 26  ? -41.119 -6.172  56.591 1.00 69.15  ? 26   ILE B CA    1 
ATOM   847   C  C     . ILE B 2 26  ? -41.808 -6.897  57.754 1.00 68.25  ? 26   ILE B C     1 
ATOM   848   O  O     . ILE B 2 26  ? -41.615 -8.100  57.945 1.00 68.17  ? 26   ILE B O     1 
ATOM   849   C  CB    . ILE B 2 26  ? -39.700 -5.681  56.995 1.00 69.10  ? 26   ILE B CB    1 
ATOM   850   C  CG1   . ILE B 2 26  ? -38.797 -6.855  57.387 1.00 68.47  ? 26   ILE B CG1   1 
ATOM   851   C  CG2   . ILE B 2 26  ? -39.755 -4.640  58.101 1.00 68.96  ? 26   ILE B CG2   1 
ATOM   852   C  CD1   . ILE B 2 26  ? -38.194 -7.576  56.213 1.00 67.09  ? 26   ILE B CD1   1 
ATOM   853   N  N     . GLN B 2 27  ? -42.621 -6.169  58.513 1.00 66.84  ? 27   GLN B N     1 
ATOM   854   C  CA    . GLN B 2 27  ? -43.341 -6.756  59.633 1.00 65.54  ? 27   GLN B CA    1 
ATOM   855   C  C     . GLN B 2 27  ? -44.483 -7.625  59.130 1.00 64.56  ? 27   GLN B C     1 
ATOM   856   O  O     . GLN B 2 27  ? -45.040 -8.430  59.880 1.00 64.55  ? 27   GLN B O     1 
ATOM   857   C  CB    . GLN B 2 27  ? -43.854 -5.666  60.571 1.00 65.53  ? 27   GLN B CB    1 
ATOM   858   C  CG    . GLN B 2 27  ? -42.754 -4.808  61.165 1.00 65.51  ? 27   GLN B CG    1 
ATOM   859   C  CD    . GLN B 2 27  ? -41.797 -5.593  62.046 1.00 66.12  ? 27   GLN B CD    1 
ATOM   860   O  OE1   . GLN B 2 27  ? -42.211 -6.441  62.845 1.00 65.73  ? 27   GLN B OE1   1 
ATOM   861   N  NE2   . GLN B 2 27  ? -40.504 -5.306  61.909 1.00 66.69  ? 27   GLN B NE2   1 
ATOM   862   N  N     . GLY B 2 28  ? -44.812 -7.462  57.850 1.00 63.36  ? 28   GLY B N     1 
ATOM   863   C  CA    . GLY B 2 28  ? -45.792 -8.311  57.181 1.00 62.17  ? 28   GLY B CA    1 
ATOM   864   C  C     . GLY B 2 28  ? -45.317 -9.751  57.149 1.00 61.38  ? 28   GLY B C     1 
ATOM   865   O  O     . GLY B 2 28  ? -46.112 -10.673 56.954 1.00 61.71  ? 28   GLY B O     1 
ATOM   866   N  N     . ILE B 2 29  ? -44.010 -9.930  57.321 1.00 60.14  ? 29   ILE B N     1 
ATOM   867   C  CA    . ILE B 2 29  ? -43.408 -11.232 57.533 1.00 58.86  ? 29   ILE B CA    1 
ATOM   868   C  C     . ILE B 2 29  ? -43.576 -11.529 59.021 1.00 58.52  ? 29   ILE B C     1 
ATOM   869   O  O     . ILE B 2 29  ? -42.766 -11.137 59.855 1.00 58.36  ? 29   ILE B O     1 
ATOM   870   C  CB    . ILE B 2 29  ? -41.912 -11.241 57.121 1.00 58.67  ? 29   ILE B CB    1 
ATOM   871   C  CG1   . ILE B 2 29  ? -41.700 -10.613 55.728 1.00 57.50  ? 29   ILE B CG1   1 
ATOM   872   C  CG2   . ILE B 2 29  ? -41.320 -12.653 57.229 1.00 58.41  ? 29   ILE B CG2   1 
ATOM   873   C  CD1   . ILE B 2 29  ? -42.201 -11.429 54.555 1.00 55.63  ? 29   ILE B CD1   1 
ATOM   874   N  N     . THR B 2 30  ? -44.655 -12.216 59.345 1.00 58.22  ? 30   THR B N     1 
ATOM   875   C  CA    . THR B 2 30  ? -45.133 -12.284 60.716 1.00 58.15  ? 30   THR B CA    1 
ATOM   876   C  C     . THR B 2 30  ? -44.431 -13.368 61.529 1.00 58.09  ? 30   THR B C     1 
ATOM   877   O  O     . THR B 2 30  ? -43.827 -14.282 60.970 1.00 58.43  ? 30   THR B O     1 
ATOM   878   C  CB    . THR B 2 30  ? -46.654 -12.528 60.727 1.00 58.14  ? 30   THR B CB    1 
ATOM   879   O  OG1   . THR B 2 30  ? -46.937 -13.786 60.105 1.00 58.64  ? 30   THR B OG1   1 
ATOM   880   C  CG2   . THR B 2 30  ? -47.377 -11.436 59.952 1.00 57.89  ? 30   THR B CG2   1 
ATOM   881   N  N     . LYS B 2 31  ? -44.525 -13.257 62.851 1.00 57.78  ? 31   LYS B N     1 
ATOM   882   C  CA    . LYS B 2 31  ? -44.042 -14.285 63.762 1.00 57.33  ? 31   LYS B CA    1 
ATOM   883   C  C     . LYS B 2 31  ? -44.505 -15.707 63.381 1.00 56.97  ? 31   LYS B C     1 
ATOM   884   O  O     . LYS B 2 31  ? -43.669 -16.600 63.251 1.00 56.91  ? 31   LYS B O     1 
ATOM   885   C  CB    . LYS B 2 31  ? -44.430 -13.943 65.209 1.00 57.38  ? 31   LYS B CB    1 
ATOM   886   C  CG    . LYS B 2 31  ? -44.166 -15.073 66.197 1.00 58.41  ? 31   LYS B CG    1 
ATOM   887   C  CD    . LYS B 2 31  ? -44.479 -14.676 67.625 1.00 60.06  ? 31   LYS B CD    1 
ATOM   888   C  CE    . LYS B 2 31  ? -44.125 -15.798 68.590 1.00 60.46  ? 31   LYS B CE    1 
ATOM   889   N  NZ    . LYS B 2 31  ? -43.992 -15.264 69.980 1.00 61.00  ? 31   LYS B NZ    1 
ATOM   890   N  N     . PRO B 2 32  ? -45.828 -15.925 63.200 1.00 56.73  ? 32   PRO B N     1 
ATOM   891   C  CA    . PRO B 2 32  ? -46.287 -17.277 62.864 1.00 56.38  ? 32   PRO B CA    1 
ATOM   892   C  C     . PRO B 2 32  ? -45.664 -17.815 61.589 1.00 56.08  ? 32   PRO B C     1 
ATOM   893   O  O     . PRO B 2 32  ? -45.411 -19.014 61.484 1.00 56.50  ? 32   PRO B O     1 
ATOM   894   C  CB    . PRO B 2 32  ? -47.791 -17.093 62.642 1.00 56.62  ? 32   PRO B CB    1 
ATOM   895   C  CG    . PRO B 2 32  ? -48.145 -15.863 63.403 1.00 56.69  ? 32   PRO B CG    1 
ATOM   896   C  CD    . PRO B 2 32  ? -46.959 -14.975 63.281 1.00 56.58  ? 32   PRO B CD    1 
ATOM   897   N  N     . ALA B 2 33  ? -45.436 -16.927 60.627 1.00 55.62  ? 33   ALA B N     1 
ATOM   898   C  CA    . ALA B 2 33  ? -44.880 -17.300 59.331 1.00 54.88  ? 33   ALA B CA    1 
ATOM   899   C  C     . ALA B 2 33  ? -43.417 -17.694 59.458 1.00 54.38  ? 33   ALA B C     1 
ATOM   900   O  O     . ALA B 2 33  ? -42.982 -18.683 58.854 1.00 54.66  ? 33   ALA B O     1 
ATOM   901   C  CB    . ALA B 2 33  ? -45.042 -16.156 58.335 1.00 55.00  ? 33   ALA B CB    1 
ATOM   902   N  N     . ILE B 2 34  ? -42.661 -16.920 60.235 1.00 53.38  ? 34   ILE B N     1 
ATOM   903   C  CA    . ILE B 2 34  ? -41.270 -17.256 60.538 1.00 52.56  ? 34   ILE B CA    1 
ATOM   904   C  C     . ILE B 2 34  ? -41.204 -18.525 61.403 1.00 52.37  ? 34   ILE B C     1 
ATOM   905   O  O     . ILE B 2 34  ? -40.301 -19.349 61.253 1.00 52.44  ? 34   ILE B O     1 
ATOM   906   C  CB    . ILE B 2 34  ? -40.527 -16.080 61.206 1.00 52.37  ? 34   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2 34  ? -40.580 -14.839 60.312 1.00 51.91  ? 34   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2 34  ? -39.077 -16.441 61.473 1.00 52.41  ? 34   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2 34  ? -40.159 -13.557 61.006 1.00 50.97  ? 34   ILE B CD1   1 
ATOM   910   N  N     . ARG B 2 35  ? -42.181 -18.682 62.287 1.00 52.23  ? 35   ARG B N     1 
ATOM   911   C  CA    . ARG B 2 35  ? -42.312 -19.887 63.100 1.00 52.37  ? 35   ARG B CA    1 
ATOM   912   C  C     . ARG B 2 35  ? -42.467 -21.119 62.204 1.00 51.87  ? 35   ARG B C     1 
ATOM   913   O  O     . ARG B 2 35  ? -41.787 -22.129 62.419 1.00 51.58  ? 35   ARG B O     1 
ATOM   914   C  CB    . ARG B 2 35  ? -43.494 -19.740 64.060 1.00 52.70  ? 35   ARG B CB    1 
ATOM   915   C  CG    . ARG B 2 35  ? -43.746 -20.917 64.970 1.00 54.99  ? 35   ARG B CG    1 
ATOM   916   C  CD    . ARG B 2 35  ? -44.755 -20.539 66.034 1.00 57.32  ? 35   ARG B CD    1 
ATOM   917   N  NE    . ARG B 2 35  ? -44.117 -19.821 67.138 1.00 59.72  ? 35   ARG B NE    1 
ATOM   918   C  CZ    . ARG B 2 35  ? -44.031 -20.278 68.388 1.00 61.32  ? 35   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B 2 35  ? -44.561 -21.450 68.727 1.00 61.91  ? 35   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B 2 35  ? -43.432 -19.545 69.315 1.00 62.45  ? 35   ARG B NH2   1 
ATOM   921   N  N     . ARG B 2 36  ? -43.326 -21.011 61.181 1.00 51.28  ? 36   ARG B N     1 
ATOM   922   C  CA    . ARG B 2 36  ? -43.563 -22.109 60.231 1.00 50.65  ? 36   ARG B CA    1 
ATOM   923   C  C     . ARG B 2 36  ? -42.295 -22.490 59.472 1.00 49.80  ? 36   ARG B C     1 
ATOM   924   O  O     . ARG B 2 36  ? -42.004 -23.678 59.285 1.00 49.42  ? 36   ARG B O     1 
ATOM   925   C  CB    . ARG B 2 36  ? -44.679 -21.763 59.241 1.00 50.83  ? 36   ARG B CB    1 
ATOM   926   C  CG    . ARG B 2 36  ? -46.094 -21.889 59.808 1.00 51.80  ? 36   ARG B CG    1 
ATOM   927   C  CD    . ARG B 2 36  ? -47.156 -21.841 58.695 1.00 52.52  ? 36   ARG B CD    1 
ATOM   928   N  NE    . ARG B 2 36  ? -47.280 -20.510 58.105 1.00 53.03  ? 36   ARG B NE    1 
ATOM   929   C  CZ    . ARG B 2 36  ? -48.038 -19.537 58.607 1.00 54.21  ? 36   ARG B CZ    1 
ATOM   930   N  NH1   . ARG B 2 36  ? -48.757 -19.738 59.711 1.00 53.46  ? 36   ARG B NH1   1 
ATOM   931   N  NH2   . ARG B 2 36  ? -48.083 -18.358 58.001 1.00 53.83  ? 36   ARG B NH2   1 
ATOM   932   N  N     . LEU B 2 37  ? -41.540 -21.471 59.061 1.00 48.83  ? 37   LEU B N     1 
ATOM   933   C  CA    . LEU B 2 37  ? -40.302 -21.678 58.316 1.00 47.96  ? 37   LEU B CA    1 
ATOM   934   C  C     . LEU B 2 37  ? -39.301 -22.443 59.161 1.00 47.22  ? 37   LEU B C     1 
ATOM   935   O  O     . LEU B 2 37  ? -38.759 -23.450 58.731 1.00 47.17  ? 37   LEU B O     1 
ATOM   936   C  CB    . LEU B 2 37  ? -39.729 -20.341 57.846 1.00 47.86  ? 37   LEU B CB    1 
ATOM   937   C  CG    . LEU B 2 37  ? -40.426 -19.793 56.600 1.00 48.40  ? 37   LEU B CG    1 
ATOM   938   C  CD1   . LEU B 2 37  ? -40.194 -18.301 56.418 1.00 48.81  ? 37   LEU B CD1   1 
ATOM   939   C  CD2   . LEU B 2 37  ? -40.000 -20.553 55.359 1.00 48.42  ? 37   LEU B CD2   1 
ATOM   940   N  N     . ALA B 2 38  ? -39.099 -21.977 60.385 1.00 46.64  ? 38   ALA B N     1 
ATOM   941   C  CA    . ALA B 2 38  ? -38.233 -22.651 61.331 1.00 46.12  ? 38   ALA B CA    1 
ATOM   942   C  C     . ALA B 2 38  ? -38.656 -24.106 61.509 1.00 45.75  ? 38   ALA B C     1 
ATOM   943   O  O     . ALA B 2 38  ? -37.813 -24.999 61.530 1.00 45.38  ? 38   ALA B O     1 
ATOM   944   C  CB    . ALA B 2 38  ? -38.255 -21.920 62.655 1.00 46.03  ? 38   ALA B CB    1 
ATOM   945   N  N     . ARG B 2 39  ? -39.968 -24.329 61.616 1.00 45.53  ? 39   ARG B N     1 
ATOM   946   C  CA    . ARG B 2 39  ? -40.525 -25.661 61.816 1.00 45.16  ? 39   ARG B CA    1 
ATOM   947   C  C     . ARG B 2 39  ? -40.109 -26.597 60.693 1.00 45.05  ? 39   ARG B C     1 
ATOM   948   O  O     . ARG B 2 39  ? -39.661 -27.717 60.949 1.00 44.83  ? 39   ARG B O     1 
ATOM   949   C  CB    . ARG B 2 39  ? -42.050 -25.607 61.932 1.00 45.31  ? 39   ARG B CB    1 
ATOM   950   C  CG    . ARG B 2 39  ? -42.586 -24.892 63.183 1.00 46.89  ? 39   ARG B CG    1 
ATOM   951   C  CD    . ARG B 2 39  ? -42.348 -25.704 64.448 1.00 50.21  ? 39   ARG B CD    1 
ATOM   952   N  NE    . ARG B 2 39  ? -42.983 -25.115 65.622 1.00 52.07  ? 39   ARG B NE    1 
ATOM   953   C  CZ    . ARG B 2 39  ? -42.325 -24.545 66.623 1.00 54.26  ? 39   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B 2 39  ? -41.002 -24.481 66.606 1.00 53.88  ? 39   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B 2 39  ? -42.993 -24.037 67.649 1.00 55.94  ? 39   ARG B NH2   1 
ATOM   956   N  N     . ARG B 2 40  ? -40.232 -26.129 59.451 1.00 44.87  ? 40   ARG B N     1 
ATOM   957   C  CA    . ARG B 2 40  ? -39.817 -26.920 58.297 1.00 44.73  ? 40   ARG B CA    1 
ATOM   958   C  C     . ARG B 2 40  ? -38.323 -27.204 58.369 1.00 44.63  ? 40   ARG B C     1 
ATOM   959   O  O     . ARG B 2 40  ? -37.849 -28.245 57.894 1.00 44.75  ? 40   ARG B O     1 
ATOM   960   C  CB    . ARG B 2 40  ? -40.186 -26.215 56.991 1.00 44.94  ? 40   ARG B CB    1 
ATOM   961   C  CG    . ARG B 2 40  ? -40.000 -27.064 55.727 1.00 45.56  ? 40   ARG B CG    1 
ATOM   962   C  CD    . ARG B 2 40  ? -40.740 -26.473 54.538 1.00 46.20  ? 40   ARG B CD    1 
ATOM   963   N  NE    . ARG B 2 40  ? -42.137 -26.892 54.539 1.00 47.76  ? 40   ARG B NE    1 
ATOM   964   C  CZ    . ARG B 2 40  ? -43.085 -26.403 53.741 1.00 47.80  ? 40   ARG B CZ    1 
ATOM   965   N  NH1   . ARG B 2 40  ? -42.809 -25.454 52.852 1.00 46.17  ? 40   ARG B NH1   1 
ATOM   966   N  NH2   . ARG B 2 40  ? -44.322 -26.870 53.842 1.00 48.05  ? 40   ARG B NH2   1 
ATOM   967   N  N     . GLY B 2 41  ? -37.597 -26.277 58.991 1.00 44.48  ? 41   GLY B N     1 
ATOM   968   C  CA    . GLY B 2 41  ? -36.165 -26.419 59.218 1.00 44.21  ? 41   GLY B CA    1 
ATOM   969   C  C     . GLY B 2 41  ? -35.826 -27.271 60.423 1.00 43.96  ? 41   GLY B C     1 
ATOM   970   O  O     . GLY B 2 41  ? -34.660 -27.396 60.780 1.00 43.52  ? 41   GLY B O     1 
ATOM   971   N  N     . GLY B 2 42  ? -36.850 -27.845 61.052 1.00 44.32  ? 42   GLY B N     1 
ATOM   972   C  CA    . GLY B 2 42  ? -36.675 -28.751 62.197 1.00 44.60  ? 42   GLY B CA    1 
ATOM   973   C  C     . GLY B 2 42  ? -36.400 -28.092 63.541 1.00 45.05  ? 42   GLY B C     1 
ATOM   974   O  O     . GLY B 2 42  ? -35.770 -28.684 64.410 1.00 45.04  ? 42   GLY B O     1 
ATOM   975   N  N     . VAL B 2 43  ? -36.889 -26.874 63.721 1.00 45.49  ? 43   VAL B N     1 
ATOM   976   C  CA    . VAL B 2 43  ? -36.623 -26.109 64.928 1.00 46.38  ? 43   VAL B CA    1 
ATOM   977   C  C     . VAL B 2 43  ? -37.740 -26.274 65.957 1.00 46.78  ? 43   VAL B C     1 
ATOM   978   O  O     . VAL B 2 43  ? -38.903 -26.085 65.643 1.00 46.77  ? 43   VAL B O     1 
ATOM   979   C  CB    . VAL B 2 43  ? -36.425 -24.613 64.601 1.00 46.37  ? 43   VAL B CB    1 
ATOM   980   C  CG1   . VAL B 2 43  ? -36.146 -23.837 65.864 1.00 46.74  ? 43   VAL B CG1   1 
ATOM   981   C  CG2   . VAL B 2 43  ? -35.278 -24.434 63.616 1.00 46.58  ? 43   VAL B CG2   1 
ATOM   982   N  N     . LYS B 2 44  ? -37.375 -26.623 67.185 1.00 47.63  ? 44   LYS B N     1 
ATOM   983   C  CA    . LYS B 2 44  ? -38.347 -26.942 68.228 1.00 48.40  ? 44   LYS B CA    1 
ATOM   984   C  C     . LYS B 2 44  ? -38.689 -25.743 69.103 1.00 48.91  ? 44   LYS B C     1 
ATOM   985   O  O     . LYS B 2 44  ? -39.848 -25.535 69.455 1.00 49.54  ? 44   LYS B O     1 
ATOM   986   C  CB    . LYS B 2 44  ? -37.815 -28.075 69.101 1.00 48.56  ? 44   LYS B CB    1 
ATOM   987   C  CG    . LYS B 2 44  ? -38.696 -28.444 70.294 1.00 49.89  ? 44   LYS B CG    1 
ATOM   988   C  CD    . LYS B 2 44  ? -38.291 -29.802 70.836 1.00 52.08  ? 44   LYS B CD    1 
ATOM   989   C  CE    . LYS B 2 44  ? -38.969 -30.126 72.156 1.00 54.06  ? 44   LYS B CE    1 
ATOM   990   N  NZ    . LYS B 2 44  ? -38.648 -31.530 72.588 1.00 53.23  ? 44   LYS B NZ    1 
ATOM   991   N  N     . ARG B 2 45  ? -37.675 -24.960 69.453 1.00 49.17  ? 45   ARG B N     1 
ATOM   992   C  CA    . ARG B 2 45  ? -37.832 -23.864 70.379 1.00 49.46  ? 45   ARG B CA    1 
ATOM   993   C  C     . ARG B 2 45  ? -37.141 -22.620 69.838 1.00 49.44  ? 45   ARG B C     1 
ATOM   994   O  O     . ARG B 2 45  ? -36.008 -22.690 69.337 1.00 49.22  ? 45   ARG B O     1 
ATOM   995   C  CB    . ARG B 2 45  ? -37.250 -24.256 71.732 1.00 50.08  ? 45   ARG B CB    1 
ATOM   996   C  CG    . ARG B 2 45  ? -37.827 -23.478 72.897 1.00 51.00  ? 45   ARG B CG    1 
ATOM   997   C  CD    . ARG B 2 45  ? -37.467 -24.150 74.211 1.00 53.80  ? 45   ARG B CD    1 
ATOM   998   N  NE    . ARG B 2 45  ? -38.120 -23.520 75.356 1.00 55.22  ? 45   ARG B NE    1 
ATOM   999   C  CZ    . ARG B 2 45  ? -37.689 -22.410 75.956 1.00 56.89  ? 45   ARG B CZ    1 
ATOM   1000  N  NH1   . ARG B 2 45  ? -36.597 -21.780 75.531 1.00 56.01  ? 45   ARG B NH1   1 
ATOM   1001  N  NH2   . ARG B 2 45  ? -38.361 -21.927 76.994 1.00 58.26  ? 45   ARG B NH2   1 
ATOM   1002  N  N     . ILE B 2 46  ? -37.830 -21.483 69.960 1.00 49.14  ? 46   ILE B N     1 
ATOM   1003  C  CA    . ILE B 2 46  ? -37.463 -20.247 69.263 1.00 48.61  ? 46   ILE B CA    1 
ATOM   1004  C  C     . ILE B 2 46  ? -37.423 -19.023 70.193 1.00 48.71  ? 46   ILE B C     1 
ATOM   1005  O  O     . ILE B 2 46  ? -38.425 -18.674 70.821 1.00 49.16  ? 46   ILE B O     1 
ATOM   1006  C  CB    . ILE B 2 46  ? -38.437 -19.978 68.099 1.00 48.29  ? 46   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B 2 46  ? -38.461 -21.169 67.141 1.00 48.22  ? 46   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B 2 46  ? -38.073 -18.696 67.368 1.00 48.13  ? 46   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B 2 46  ? -39.540 -21.089 66.073 1.00 49.27  ? 46   ILE B CD1   1 
ATOM   1010  N  N     . SER B 2 47  ? -36.264 -18.372 70.259 1.00 48.33  ? 47   SER B N     1 
ATOM   1011  C  CA    . SER B 2 47  ? -36.078 -17.180 71.070 1.00 48.04  ? 47   SER B CA    1 
ATOM   1012  C  C     . SER B 2 47  ? -36.800 -15.983 70.495 1.00 48.28  ? 47   SER B C     1 
ATOM   1013  O  O     . SER B 2 47  ? -36.836 -15.786 69.275 1.00 48.19  ? 47   SER B O     1 
ATOM   1014  C  CB    . SER B 2 47  ? -34.590 -16.870 71.237 1.00 48.09  ? 47   SER B CB    1 
ATOM   1015  O  OG    . SER B 2 47  ? -34.309 -15.514 70.944 1.00 47.57  ? 47   SER B OG    1 
ATOM   1016  N  N     . GLY B 2 48  ? -37.348 -15.165 71.391 1.00 48.40  ? 48   GLY B N     1 
ATOM   1017  C  CA    . GLY B 2 48  ? -38.114 -13.981 71.010 1.00 48.31  ? 48   GLY B CA    1 
ATOM   1018  C  C     . GLY B 2 48  ? -37.385 -13.055 70.067 1.00 48.61  ? 48   GLY B C     1 
ATOM   1019  O  O     . GLY B 2 48  ? -38.004 -12.408 69.227 1.00 49.21  ? 48   GLY B O     1 
ATOM   1020  N  N     . LEU B 2 49  ? -36.062 -12.996 70.181 1.00 48.74  ? 49   LEU B N     1 
ATOM   1021  C  CA    . LEU B 2 49  ? -35.268 -12.111 69.324 1.00 48.53  ? 49   LEU B CA    1 
ATOM   1022  C  C     . LEU B 2 49  ? -35.071 -12.632 67.900 1.00 48.34  ? 49   LEU B C     1 
ATOM   1023  O  O     . LEU B 2 49  ? -34.592 -11.892 67.042 1.00 48.16  ? 49   LEU B O     1 
ATOM   1024  C  CB    . LEU B 2 49  ? -33.907 -11.806 69.964 1.00 48.66  ? 49   LEU B CB    1 
ATOM   1025  C  CG    . LEU B 2 49  ? -33.963 -11.061 71.302 1.00 49.17  ? 49   LEU B CG    1 
ATOM   1026  C  CD1   . LEU B 2 49  ? -32.636 -11.167 72.022 1.00 49.56  ? 49   LEU B CD1   1 
ATOM   1027  C  CD2   . LEU B 2 49  ? -34.374 -9.599  71.097 1.00 48.05  ? 49   LEU B CD2   1 
ATOM   1028  N  N     . ILE B 2 50  ? -35.441 -13.893 67.649 1.00 48.16  ? 50   ILE B N     1 
ATOM   1029  C  CA    . ILE B 2 50  ? -35.192 -14.528 66.340 1.00 47.60  ? 50   ILE B CA    1 
ATOM   1030  C  C     . ILE B 2 50  ? -36.001 -13.902 65.213 1.00 47.36  ? 50   ILE B C     1 
ATOM   1031  O  O     . ILE B 2 50  ? -35.552 -13.883 64.066 1.00 47.61  ? 50   ILE B O     1 
ATOM   1032  C  CB    . ILE B 2 50  ? -35.425 -16.071 66.368 1.00 47.43  ? 50   ILE B CB    1 
ATOM   1033  C  CG1   . ILE B 2 50  ? -34.257 -16.797 67.051 1.00 47.09  ? 50   ILE B CG1   1 
ATOM   1034  C  CG2   . ILE B 2 50  ? -35.672 -16.625 64.967 1.00 47.13  ? 50   ILE B CG2   1 
ATOM   1035  C  CD1   . ILE B 2 50  ? -32.941 -16.772 66.280 1.00 47.93  ? 50   ILE B CD1   1 
ATOM   1036  N  N     . TYR B 2 51  ? -37.181 -13.386 65.538 1.00 47.07  ? 51   TYR B N     1 
ATOM   1037  C  CA    . TYR B 2 51  ? -38.093 -12.893 64.505 1.00 46.91  ? 51   TYR B CA    1 
ATOM   1038  C  C     . TYR B 2 51  ? -37.500 -11.671 63.821 1.00 47.24  ? 51   TYR B C     1 
ATOM   1039  O  O     . TYR B 2 51  ? -37.446 -11.593 62.586 1.00 47.42  ? 51   TYR B O     1 
ATOM   1040  C  CB    . TYR B 2 51  ? -39.519 -12.697 65.057 1.00 46.47  ? 51   TYR B CB    1 
ATOM   1041  C  CG    . TYR B 2 51  ? -39.999 -13.935 65.810 1.00 45.26  ? 51   TYR B CG    1 
ATOM   1042  C  CD1   . TYR B 2 51  ? -40.394 -15.084 65.125 1.00 44.58  ? 51   TYR B CD1   1 
ATOM   1043  C  CD2   . TYR B 2 51  ? -40.003 -13.972 67.207 1.00 44.20  ? 51   TYR B CD2   1 
ATOM   1044  C  CE1   . TYR B 2 51  ? -40.805 -16.237 65.806 1.00 44.31  ? 51   TYR B CE1   1 
ATOM   1045  C  CE2   . TYR B 2 51  ? -40.416 -15.123 67.904 1.00 44.24  ? 51   TYR B CE2   1 
ATOM   1046  C  CZ    . TYR B 2 51  ? -40.814 -16.254 67.195 1.00 44.39  ? 51   TYR B CZ    1 
ATOM   1047  O  OH    . TYR B 2 51  ? -41.212 -17.402 67.867 1.00 44.21  ? 51   TYR B OH    1 
ATOM   1048  N  N     . GLU B 2 52  ? -36.969 -10.753 64.614 1.00 47.69  ? 52   GLU B N     1 
ATOM   1049  C  CA    . GLU B 2 52  ? -36.300 -9.591  64.037 1.00 48.40  ? 52   GLU B CA    1 
ATOM   1050  C  C     . GLU B 2 52  ? -35.018 -9.946  63.288 1.00 47.82  ? 52   GLU B C     1 
ATOM   1051  O  O     . GLU B 2 52  ? -34.783 -9.419  62.206 1.00 47.95  ? 52   GLU B O     1 
ATOM   1052  C  CB    . GLU B 2 52  ? -36.058 -8.490  65.077 1.00 48.93  ? 52   GLU B CB    1 
ATOM   1053  C  CG    . GLU B 2 52  ? -37.295 -7.627  65.369 1.00 51.59  ? 52   GLU B CG    1 
ATOM   1054  C  CD    . GLU B 2 52  ? -37.764 -6.828  64.156 1.00 56.27  ? 52   GLU B CD    1 
ATOM   1055  O  OE1   . GLU B 2 52  ? -37.010 -5.939  63.682 1.00 57.75  ? 52   GLU B OE1   1 
ATOM   1056  O  OE2   . GLU B 2 52  ? -38.896 -7.089  63.678 1.00 57.33  ? 52   GLU B OE2   1 
ATOM   1057  N  N     . GLU B 2 53  ? -34.200 -10.841 63.836 1.00 47.37  ? 53   GLU B N     1 
ATOM   1058  C  CA    . GLU B 2 53  ? -33.002 -11.288 63.108 1.00 46.92  ? 53   GLU B CA    1 
ATOM   1059  C  C     . GLU B 2 53  ? -33.369 -11.873 61.730 1.00 46.33  ? 53   GLU B C     1 
ATOM   1060  O  O     . GLU B 2 53  ? -32.746 -11.525 60.720 1.00 46.29  ? 53   GLU B O     1 
ATOM   1061  C  CB    . GLU B 2 53  ? -32.184 -12.288 63.931 1.00 47.06  ? 53   GLU B CB    1 
ATOM   1062  C  CG    . GLU B 2 53  ? -30.720 -12.432 63.500 1.00 48.13  ? 53   GLU B CG    1 
ATOM   1063  C  CD    . GLU B 2 53  ? -29.826 -11.299 64.007 1.00 50.47  ? 53   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B 2 53  ? -30.198 -10.629 65.001 1.00 51.81  ? 53   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B 2 53  ? -28.742 -11.084 63.415 1.00 50.97  ? 53   GLU B OE2   1 
ATOM   1066  N  N     . THR B 2 54  ? -34.397 -12.721 61.686 1.00 45.40  ? 54   THR B N     1 
ATOM   1067  C  CA    . THR B 2 54  ? -34.806 -13.345 60.435 1.00 45.56  ? 54   THR B CA    1 
ATOM   1068  C  C     . THR B 2 54  ? -35.214 -12.314 59.381 1.00 45.47  ? 54   THR B C     1 
ATOM   1069  O  O     . THR B 2 54  ? -34.871 -12.446 58.200 1.00 45.86  ? 54   THR B O     1 
ATOM   1070  C  CB    . THR B 2 54  ? -35.946 -14.360 60.640 1.00 45.57  ? 54   THR B CB    1 
ATOM   1071  O  OG1   . THR B 2 54  ? -35.603 -15.268 61.687 1.00 45.87  ? 54   THR B OG1   1 
ATOM   1072  C  CG2   . THR B 2 54  ? -36.191 -15.161 59.386 1.00 45.93  ? 54   THR B CG2   1 
ATOM   1073  N  N     . ARG B 2 55  ? -35.935 -11.283 59.801 1.00 45.20  ? 55   ARG B N     1 
ATOM   1074  C  CA    . ARG B 2 55  ? -36.386 -10.258 58.854 1.00 44.69  ? 55   ARG B CA    1 
ATOM   1075  C  C     . ARG B 2 55  ? -35.200 -9.548  58.225 1.00 44.02  ? 55   ARG B C     1 
ATOM   1076  O  O     . ARG B 2 55  ? -35.176 -9.317  57.008 1.00 43.98  ? 55   ARG B O     1 
ATOM   1077  C  CB    . ARG B 2 55  ? -37.352 -9.275  59.517 1.00 44.60  ? 55   ARG B CB    1 
ATOM   1078  C  CG    . ARG B 2 55  ? -38.652 -9.935  59.966 1.00 45.29  ? 55   ARG B CG    1 
ATOM   1079  C  CD    . ARG B 2 55  ? -39.669 -8.916  60.473 1.00 46.11  ? 55   ARG B CD    1 
ATOM   1080  N  NE    . ARG B 2 55  ? -40.874 -9.560  60.999 1.00 45.50  ? 55   ARG B NE    1 
ATOM   1081  C  CZ    . ARG B 2 55  ? -41.110 -9.768  62.291 1.00 46.16  ? 55   ARG B CZ    1 
ATOM   1082  N  NH1   . ARG B 2 55  ? -40.232 -9.376  63.213 1.00 45.04  ? 55   ARG B NH1   1 
ATOM   1083  N  NH2   . ARG B 2 55  ? -42.234 -10.369 62.666 1.00 47.54  ? 55   ARG B NH2   1 
ATOM   1084  N  N     . GLY B 2 56  ? -34.210 -9.224  59.051 1.00 43.41  ? 56   GLY B N     1 
ATOM   1085  C  CA    . GLY B 2 56  ? -32.973 -8.613  58.568 1.00 42.87  ? 56   GLY B CA    1 
ATOM   1086  C  C     . GLY B 2 56  ? -32.271 -9.498  57.553 1.00 42.56  ? 56   GLY B C     1 
ATOM   1087  O  O     . GLY B 2 56  ? -31.842 -9.038  56.499 1.00 42.45  ? 56   GLY B O     1 
ATOM   1088  N  N     . VAL B 2 57  ? -32.172 -10.784 57.862 1.00 42.27  ? 57   VAL B N     1 
ATOM   1089  C  CA    . VAL B 2 57  ? -31.538 -11.724 56.944 1.00 42.10  ? 57   VAL B CA    1 
ATOM   1090  C  C     . VAL B 2 57  ? -32.298 -11.807 55.614 1.00 41.55  ? 57   VAL B C     1 
ATOM   1091  O  O     . VAL B 2 57  ? -31.690 -11.769 54.549 1.00 41.25  ? 57   VAL B O     1 
ATOM   1092  C  CB    . VAL B 2 57  ? -31.344 -13.100 57.601 1.00 42.09  ? 57   VAL B CB    1 
ATOM   1093  C  CG1   . VAL B 2 57  ? -30.912 -14.106 56.591 1.00 43.26  ? 57   VAL B CG1   1 
ATOM   1094  C  CG2   . VAL B 2 57  ? -30.302 -13.009 58.724 1.00 42.42  ? 57   VAL B CG2   1 
ATOM   1095  N  N     . LEU B 2 58  ? -33.624 -11.883 55.679 1.00 41.24  ? 58   LEU B N     1 
ATOM   1096  C  CA    . LEU B 2 58  ? -34.443 -11.936 54.469 1.00 41.28  ? 58   LEU B CA    1 
ATOM   1097  C  C     . LEU B 2 58  ? -34.265 -10.687 53.608 1.00 41.69  ? 58   LEU B C     1 
ATOM   1098  O  O     . LEU B 2 58  ? -34.221 -10.753 52.365 1.00 41.40  ? 58   LEU B O     1 
ATOM   1099  C  CB    . LEU B 2 58  ? -35.914 -12.124 54.822 1.00 40.92  ? 58   LEU B CB    1 
ATOM   1100  C  CG    . LEU B 2 58  ? -36.891 -12.149 53.646 1.00 41.18  ? 58   LEU B CG    1 
ATOM   1101  C  CD1   . LEU B 2 58  ? -36.507 -13.199 52.590 1.00 39.52  ? 58   LEU B CD1   1 
ATOM   1102  C  CD2   . LEU B 2 58  ? -38.305 -12.380 54.150 1.00 41.23  ? 58   LEU B CD2   1 
ATOM   1103  N  N     . LYS B 2 59  ? -34.164 -9.548  54.283 1.00 42.03  ? 59   LYS B N     1 
ATOM   1104  C  CA    . LYS B 2 59  ? -33.957 -8.276  53.615 1.00 42.04  ? 59   LYS B CA    1 
ATOM   1105  C  C     . LYS B 2 59  ? -32.643 -8.281  52.835 1.00 41.80  ? 59   LYS B C     1 
ATOM   1106  O  O     . LYS B 2 59  ? -32.636 -7.920  51.660 1.00 42.03  ? 59   LYS B O     1 
ATOM   1107  C  CB    . LYS B 2 59  ? -33.988 -7.134  54.628 1.00 42.37  ? 59   LYS B CB    1 
ATOM   1108  C  CG    . LYS B 2 59  ? -34.236 -5.771  54.027 1.00 44.49  ? 59   LYS B CG    1 
ATOM   1109  C  CD    . LYS B 2 59  ? -34.456 -4.710  55.107 1.00 47.40  ? 59   LYS B CD    1 
ATOM   1110  C  CE    . LYS B 2 59  ? -34.368 -3.298  54.520 1.00 48.62  ? 59   LYS B CE    1 
ATOM   1111  N  NZ    . LYS B 2 59  ? -32.952 -2.852  54.337 1.00 49.23  ? 59   LYS B NZ    1 
ATOM   1112  N  N     . VAL B 2 60  ? -31.536 -8.681  53.466 1.00 41.14  ? 60   VAL B N     1 
ATOM   1113  C  CA    . VAL B 2 60  ? -30.259 -8.749  52.747 1.00 40.74  ? 60   VAL B CA    1 
ATOM   1114  C  C     . VAL B 2 60  ? -30.357 -9.778  51.611 1.00 40.69  ? 60   VAL B C     1 
ATOM   1115  O  O     . VAL B 2 60  ? -29.925 -9.517  50.497 1.00 40.90  ? 60   VAL B O     1 
ATOM   1116  C  CB    . VAL B 2 60  ? -29.065 -9.064  53.670 1.00 40.88  ? 60   VAL B CB    1 
ATOM   1117  C  CG1   . VAL B 2 60  ? -27.838 -9.340  52.857 1.00 40.91  ? 60   VAL B CG1   1 
ATOM   1118  C  CG2   . VAL B 2 60  ? -28.792 -7.914  54.629 1.00 41.40  ? 60   VAL B CG2   1 
ATOM   1119  N  N     . PHE B 2 61  ? -30.947 -10.936 51.875 1.00 40.54  ? 61   PHE B N     1 
ATOM   1120  C  CA    . PHE B 2 61  ? -31.153 -11.904 50.811 1.00 40.77  ? 61   PHE B CA    1 
ATOM   1121  C  C     . PHE B 2 61  ? -31.874 -11.282 49.606 1.00 41.10  ? 61   PHE B C     1 
ATOM   1122  O  O     . PHE B 2 61  ? -31.359 -11.322 48.486 1.00 41.72  ? 61   PHE B O     1 
ATOM   1123  C  CB    . PHE B 2 61  ? -31.888 -13.159 51.312 1.00 40.62  ? 61   PHE B CB    1 
ATOM   1124  C  CG    . PHE B 2 61  ? -32.038 -14.220 50.260 1.00 40.68  ? 61   PHE B CG    1 
ATOM   1125  C  CD1   . PHE B 2 61  ? -31.005 -15.125 50.008 1.00 40.49  ? 61   PHE B CD1   1 
ATOM   1126  C  CD2   . PHE B 2 61  ? -33.196 -14.297 49.485 1.00 40.64  ? 61   PHE B CD2   1 
ATOM   1127  C  CE1   . PHE B 2 61  ? -31.135 -16.100 49.011 1.00 38.95  ? 61   PHE B CE1   1 
ATOM   1128  C  CE2   . PHE B 2 61  ? -33.320 -15.264 48.482 1.00 39.63  ? 61   PHE B CE2   1 
ATOM   1129  C  CZ    . PHE B 2 61  ? -32.293 -16.160 48.252 1.00 38.64  ? 61   PHE B CZ    1 
ATOM   1130  N  N     . LEU B 2 62  ? -33.051 -10.697 49.826 1.00 41.40  ? 62   LEU B N     1 
ATOM   1131  C  CA    . LEU B 2 62  ? -33.827 -10.111 48.714 1.00 41.44  ? 62   LEU B CA    1 
ATOM   1132  C  C     . LEU B 2 62  ? -33.148 -8.922  48.031 1.00 41.86  ? 62   LEU B C     1 
ATOM   1133  O  O     . LEU B 2 62  ? -33.207 -8.805  46.810 1.00 42.39  ? 62   LEU B O     1 
ATOM   1134  C  CB    . LEU B 2 62  ? -35.254 -9.753  49.141 1.00 41.37  ? 62   LEU B CB    1 
ATOM   1135  C  CG    . LEU B 2 62  ? -36.191 -10.913 49.505 1.00 40.82  ? 62   LEU B CG    1 
ATOM   1136  C  CD1   . LEU B 2 62  ? -37.412 -10.397 50.212 1.00 40.48  ? 62   LEU B CD1   1 
ATOM   1137  C  CD2   . LEU B 2 62  ? -36.600 -11.707 48.277 1.00 40.11  ? 62   LEU B CD2   1 
ATOM   1138  N  N     . GLU B 2 63  ? -32.506 -8.042  48.793 1.00 41.89  ? 63   GLU B N     1 
ATOM   1139  C  CA    . GLU B 2 63  ? -31.736 -6.955  48.188 1.00 42.22  ? 63   GLU B CA    1 
ATOM   1140  C  C     . GLU B 2 63  ? -30.746 -7.504  47.173 1.00 41.87  ? 63   GLU B C     1 
ATOM   1141  O  O     . GLU B 2 63  ? -30.770 -7.110  46.010 1.00 41.45  ? 63   GLU B O     1 
ATOM   1142  C  CB    . GLU B 2 63  ? -30.999 -6.125  49.247 1.00 42.73  ? 63   GLU B CB    1 
ATOM   1143  C  CG    . GLU B 2 63  ? -31.911 -5.206  50.031 1.00 45.98  ? 63   GLU B CG    1 
ATOM   1144  C  CD    . GLU B 2 63  ? -31.302 -4.685  51.315 1.00 50.22  ? 63   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B 2 63  ? -30.158 -5.066  51.670 1.00 50.86  ? 63   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B 2 63  ? -31.993 -3.873  51.972 1.00 52.98  ? 63   GLU B OE2   1 
ATOM   1147  N  N     . ASN B 2 64  ? -29.891 -8.430  47.612 1.00 41.94  ? 64   ASN B N     1 
ATOM   1148  C  CA    . ASN B 2 64  ? -28.851 -8.993  46.748 1.00 42.00  ? 64   ASN B CA    1 
ATOM   1149  C  C     . ASN B 2 64  ? -29.404 -9.592  45.461 1.00 41.85  ? 64   ASN B C     1 
ATOM   1150  O  O     . ASN B 2 64  ? -28.839 -9.390  44.391 1.00 42.02  ? 64   ASN B O     1 
ATOM   1151  C  CB    . ASN B 2 64  ? -28.016 -10.026 47.504 1.00 42.25  ? 64   ASN B CB    1 
ATOM   1152  C  CG    . ASN B 2 64  ? -26.977 -9.390  48.403 1.00 43.03  ? 64   ASN B CG    1 
ATOM   1153  O  OD1   . ASN B 2 64  ? -26.321 -8.427  48.022 1.00 45.77  ? 64   ASN B OD1   1 
ATOM   1154  N  ND2   . ASN B 2 64  ? -26.819 -9.927  49.601 1.00 44.28  ? 64   ASN B ND2   1 
ATOM   1155  N  N     . VAL B 2 65  ? -30.525 -10.300 45.571 1.00 41.74  ? 65   VAL B N     1 
ATOM   1156  C  CA    . VAL B 2 65  ? -31.128 -10.967 44.424 1.00 41.74  ? 65   VAL B CA    1 
ATOM   1157  C  C     . VAL B 2 65  ? -31.899 -9.985  43.529 1.00 41.85  ? 65   VAL B C     1 
ATOM   1158  O  O     . VAL B 2 65  ? -31.703 -9.973  42.304 1.00 41.84  ? 65   VAL B O     1 
ATOM   1159  C  CB    . VAL B 2 65  ? -32.030 -12.152 44.859 1.00 41.84  ? 65   VAL B CB    1 
ATOM   1160  C  CG1   . VAL B 2 65  ? -32.547 -12.889 43.644 1.00 41.70  ? 65   VAL B CG1   1 
ATOM   1161  C  CG2   . VAL B 2 65  ? -31.253 -13.124 45.739 1.00 41.75  ? 65   VAL B CG2   1 
ATOM   1162  N  N     . ILE B 2 66  ? -32.763 -9.166  44.133 1.00 41.67  ? 66   ILE B N     1 
ATOM   1163  C  CA    . ILE B 2 66  ? -33.527 -8.180  43.372 1.00 41.87  ? 66   ILE B CA    1 
ATOM   1164  C  C     . ILE B 2 66  ? -32.602 -7.203  42.651 1.00 41.89  ? 66   ILE B C     1 
ATOM   1165  O  O     . ILE B 2 66  ? -32.800 -6.917  41.472 1.00 41.32  ? 66   ILE B O     1 
ATOM   1166  C  CB    . ILE B 2 66  ? -34.551 -7.434  44.243 1.00 42.29  ? 66   ILE B CB    1 
ATOM   1167  C  CG1   . ILE B 2 66  ? -35.601 -8.427  44.766 1.00 42.40  ? 66   ILE B CG1   1 
ATOM   1168  C  CG2   . ILE B 2 66  ? -35.209 -6.310  43.442 1.00 41.26  ? 66   ILE B CG2   1 
ATOM   1169  C  CD1   . ILE B 2 66  ? -36.461 -7.902  45.875 1.00 42.46  ? 66   ILE B CD1   1 
ATOM   1170  N  N     . ARG B 2 67  ? -31.571 -6.727  43.349 1.00 42.23  ? 67   ARG B N     1 
ATOM   1171  C  CA    . ARG B 2 67  ? -30.568 -5.869  42.722 1.00 42.57  ? 67   ARG B CA    1 
ATOM   1172  C  C     . ARG B 2 67  ? -30.134 -6.438  41.376 1.00 42.51  ? 67   ARG B C     1 
ATOM   1173  O  O     . ARG B 2 67  ? -30.212 -5.752  40.358 1.00 42.68  ? 67   ARG B O     1 
ATOM   1174  C  CB    . ARG B 2 67  ? -29.361 -5.667  43.637 1.00 42.73  ? 67   ARG B CB    1 
ATOM   1175  C  CG    . ARG B 2 67  ? -28.317 -4.719  43.072 1.00 44.74  ? 67   ARG B CG    1 
ATOM   1176  C  CD    . ARG B 2 67  ? -27.071 -4.652  43.955 1.00 48.55  ? 67   ARG B CD    1 
ATOM   1177  N  NE    . ARG B 2 67  ? -27.304 -3.897  45.192 1.00 52.19  ? 67   ARG B NE    1 
ATOM   1178  C  CZ    . ARG B 2 67  ? -27.242 -4.406  46.423 1.00 54.03  ? 67   ARG B CZ    1 
ATOM   1179  N  NH1   . ARG B 2 67  ? -26.941 -5.689  46.616 1.00 54.42  ? 67   ARG B NH1   1 
ATOM   1180  N  NH2   . ARG B 2 67  ? -27.467 -3.624  47.473 1.00 54.76  ? 67   ARG B NH2   1 
ATOM   1181  N  N     . ASP B 2 68  ? -29.703 -7.699  41.372 1.00 42.52  ? 68   ASP B N     1 
ATOM   1182  C  CA    . ASP B 2 68  ? -29.207 -8.325  40.154 1.00 42.27  ? 68   ASP B CA    1 
ATOM   1183  C  C     . ASP B 2 68  ? -30.321 -8.532  39.122 1.00 41.87  ? 68   ASP B C     1 
ATOM   1184  O  O     . ASP B 2 68  ? -30.095 -8.343  37.929 1.00 40.97  ? 68   ASP B O     1 
ATOM   1185  C  CB    . ASP B 2 68  ? -28.460 -9.627  40.466 1.00 42.55  ? 68   ASP B CB    1 
ATOM   1186  C  CG    . ASP B 2 68  ? -27.044 -9.390  41.025 1.00 44.75  ? 68   ASP B CG    1 
ATOM   1187  O  OD1   . ASP B 2 68  ? -26.709 -8.259  41.460 1.00 48.79  ? 68   ASP B OD1   1 
ATOM   1188  O  OD2   . ASP B 2 68  ? -26.244 -10.350 41.038 1.00 45.64  ? 68   ASP B OD2   1 
ATOM   1189  N  N     . ALA B 2 69  ? -31.520 -8.907  39.570 1.00 41.92  ? 69   ALA B N     1 
ATOM   1190  C  CA    . ALA B 2 69  ? -32.628 -9.149  38.627 1.00 42.20  ? 69   ALA B CA    1 
ATOM   1191  C  C     . ALA B 2 69  ? -33.027 -7.846  37.931 1.00 42.39  ? 69   ALA B C     1 
ATOM   1192  O  O     . ALA B 2 69  ? -33.050 -7.773  36.698 1.00 42.07  ? 69   ALA B O     1 
ATOM   1193  C  CB    . ALA B 2 69  ? -33.820 -9.799  39.318 1.00 42.22  ? 69   ALA B CB    1 
ATOM   1194  N  N     . VAL B 2 70  ? -33.280 -6.804  38.724 1.00 42.49  ? 70   VAL B N     1 
ATOM   1195  C  CA    . VAL B 2 70  ? -33.523 -5.473  38.176 1.00 42.63  ? 70   VAL B CA    1 
ATOM   1196  C  C     . VAL B 2 70  ? -32.432 -5.088  37.177 1.00 42.78  ? 70   VAL B C     1 
ATOM   1197  O  O     . VAL B 2 70  ? -32.741 -4.648  36.073 1.00 43.42  ? 70   VAL B O     1 
ATOM   1198  C  CB    . VAL B 2 70  ? -33.677 -4.411  39.280 1.00 42.70  ? 70   VAL B CB    1 
ATOM   1199  C  CG1   . VAL B 2 70  ? -33.707 -3.010  38.681 1.00 42.88  ? 70   VAL B CG1   1 
ATOM   1200  C  CG2   . VAL B 2 70  ? -34.939 -4.679  40.096 1.00 42.23  ? 70   VAL B CG2   1 
ATOM   1201  N  N     . THR B 2 71  ? -31.167 -5.265  37.545 1.00 42.87  ? 71   THR B N     1 
ATOM   1202  C  CA    . THR B 2 71  ? -30.065 -5.006  36.614 1.00 43.12  ? 71   THR B CA    1 
ATOM   1203  C  C     . THR B 2 71  ? -30.261 -5.729  35.286 1.00 43.66  ? 71   THR B C     1 
ATOM   1204  O  O     . THR B 2 71  ? -29.948 -5.175  34.246 1.00 44.44  ? 71   THR B O     1 
ATOM   1205  C  CB    . THR B 2 71  ? -28.720 -5.402  37.216 1.00 43.12  ? 71   THR B CB    1 
ATOM   1206  O  OG1   . THR B 2 71  ? -28.472 -4.584  38.363 1.00 42.58  ? 71   THR B OG1   1 
ATOM   1207  C  CG2   . THR B 2 71  ? -27.595 -5.209  36.207 1.00 43.10  ? 71   THR B CG2   1 
ATOM   1208  N  N     . TYR B 2 72  ? -30.793 -6.950  35.322 1.00 43.93  ? 72   TYR B N     1 
ATOM   1209  C  CA    . TYR B 2 72  ? -31.125 -7.668  34.088 1.00 44.76  ? 72   TYR B CA    1 
ATOM   1210  C  C     . TYR B 2 72  ? -32.308 -7.032  33.353 1.00 45.31  ? 72   TYR B C     1 
ATOM   1211  O  O     . TYR B 2 72  ? -32.328 -7.007  32.135 1.00 44.81  ? 72   TYR B O     1 
ATOM   1212  C  CB    . TYR B 2 72  ? -31.428 -9.151  34.358 1.00 44.42  ? 72   TYR B CB    1 
ATOM   1213  C  CG    . TYR B 2 72  ? -30.207 -10.030 34.545 1.00 43.82  ? 72   TYR B CG    1 
ATOM   1214  C  CD1   . TYR B 2 72  ? -29.999 -10.724 35.737 1.00 43.32  ? 72   TYR B CD1   1 
ATOM   1215  C  CD2   . TYR B 2 72  ? -29.277 -10.187 33.522 1.00 43.03  ? 72   TYR B CD2   1 
ATOM   1216  C  CE1   . TYR B 2 72  ? -28.886 -11.544 35.907 1.00 43.52  ? 72   TYR B CE1   1 
ATOM   1217  C  CE2   . TYR B 2 72  ? -28.171 -11.001 33.677 1.00 43.83  ? 72   TYR B CE2   1 
ATOM   1218  C  CZ    . TYR B 2 72  ? -27.979 -11.679 34.875 1.00 43.68  ? 72   TYR B CZ    1 
ATOM   1219  O  OH    . TYR B 2 72  ? -26.875 -12.483 35.035 1.00 43.08  ? 72   TYR B OH    1 
ATOM   1220  N  N     . THR B 2 73  ? -33.291 -6.542  34.110 1.00 46.46  ? 73   THR B N     1 
ATOM   1221  C  CA    . THR B 2 73  ? -34.450 -5.873  33.540 1.00 47.32  ? 73   THR B CA    1 
ATOM   1222  C  C     . THR B 2 73  ? -33.989 -4.639  32.769 1.00 48.64  ? 73   THR B C     1 
ATOM   1223  O  O     . THR B 2 73  ? -34.212 -4.559  31.551 1.00 48.85  ? 73   THR B O     1 
ATOM   1224  C  CB    . THR B 2 73  ? -35.483 -5.495  34.613 1.00 46.99  ? 73   THR B CB    1 
ATOM   1225  O  OG1   . THR B 2 73  ? -35.795 -6.648  35.399 1.00 45.95  ? 73   THR B OG1   1 
ATOM   1226  C  CG2   . THR B 2 73  ? -36.763 -4.984  33.971 1.00 46.52  ? 73   THR B CG2   1 
ATOM   1227  N  N     . GLU B 2 74  ? -33.316 -3.713  33.463 1.00 49.71  ? 74   GLU B N     1 
ATOM   1228  C  CA    . GLU B 2 74  ? -32.755 -2.509  32.830 1.00 51.04  ? 74   GLU B CA    1 
ATOM   1229  C  C     . GLU B 2 74  ? -31.980 -2.824  31.553 1.00 51.03  ? 74   GLU B C     1 
ATOM   1230  O  O     . GLU B 2 74  ? -32.148 -2.138  30.542 1.00 51.52  ? 74   GLU B O     1 
ATOM   1231  C  CB    . GLU B 2 74  ? -31.864 -1.706  33.795 1.00 51.56  ? 74   GLU B CB    1 
ATOM   1232  C  CG    . GLU B 2 74  ? -32.619 -0.935  34.872 1.00 54.41  ? 74   GLU B CG    1 
ATOM   1233  C  CD    . GLU B 2 74  ? -31.713 -0.032  35.704 1.00 58.21  ? 74   GLU B CD    1 
ATOM   1234  O  OE1   . GLU B 2 74  ? -31.739 1.204   35.484 1.00 60.15  ? 74   GLU B OE1   1 
ATOM   1235  O  OE2   . GLU B 2 74  ? -30.978 -0.550  36.578 1.00 59.46  ? 74   GLU B OE2   1 
ATOM   1236  N  N     . HIS B 2 75  ? -31.145 -3.857  31.577 1.00 51.08  ? 75   HIS B N     1 
ATOM   1237  C  CA    . HIS B 2 75  ? -30.373 -4.197  30.372 1.00 51.32  ? 75   HIS B CA    1 
ATOM   1238  C  C     . HIS B 2 75  ? -31.265 -4.506  29.165 1.00 51.77  ? 75   HIS B C     1 
ATOM   1239  O  O     . HIS B 2 75  ? -30.934 -4.161  28.040 1.00 51.90  ? 75   HIS B O     1 
ATOM   1240  C  CB    . HIS B 2 75  ? -29.393 -5.350  30.611 1.00 50.73  ? 75   HIS B CB    1 
ATOM   1241  C  CG    . HIS B 2 75  ? -28.451 -5.567  29.471 1.00 48.85  ? 75   HIS B CG    1 
ATOM   1242  N  ND1   . HIS B 2 75  ? -27.285 -4.851  29.327 1.00 46.47  ? 75   HIS B ND1   1 
ATOM   1243  C  CD2   . HIS B 2 75  ? -28.523 -6.389  28.399 1.00 47.81  ? 75   HIS B CD2   1 
ATOM   1244  C  CE1   . HIS B 2 75  ? -26.670 -5.232  28.223 1.00 47.23  ? 75   HIS B CE1   1 
ATOM   1245  N  NE2   . HIS B 2 75  ? -27.399 -6.168  27.642 1.00 47.17  ? 75   HIS B NE2   1 
ATOM   1246  N  N     . ALA B 2 76  ? -32.399 -5.147  29.412 1.00 52.41  ? 76   ALA B N     1 
ATOM   1247  C  CA    . ALA B 2 76  ? -33.300 -5.537  28.343 1.00 53.17  ? 76   ALA B CA    1 
ATOM   1248  C  C     . ALA B 2 76  ? -34.250 -4.401  27.930 1.00 53.66  ? 76   ALA B C     1 
ATOM   1249  O  O     . ALA B 2 76  ? -35.019 -4.550  26.979 1.00 53.83  ? 76   ALA B O     1 
ATOM   1250  C  CB    . ALA B 2 76  ? -34.079 -6.777  28.747 1.00 52.85  ? 76   ALA B CB    1 
ATOM   1251  N  N     . LYS B 2 77  ? -34.186 -3.278  28.646 1.00 54.14  ? 77   LYS B N     1 
ATOM   1252  C  CA    . LYS B 2 77  ? -35.054 -2.116  28.402 1.00 54.75  ? 77   LYS B CA    1 
ATOM   1253  C  C     . LYS B 2 77  ? -36.521 -2.431  28.695 1.00 54.93  ? 77   LYS B C     1 
ATOM   1254  O  O     . LYS B 2 77  ? -37.413 -2.096  27.905 1.00 55.21  ? 77   LYS B O     1 
ATOM   1255  C  CB    . LYS B 2 77  ? -34.883 -1.591  26.968 1.00 54.74  ? 77   LYS B CB    1 
ATOM   1256  C  CG    . LYS B 2 77  ? -33.471 -1.102  26.654 1.00 56.46  ? 77   LYS B CG    1 
ATOM   1257  C  CD    . LYS B 2 77  ? -33.085 -1.411  25.214 1.00 58.27  ? 77   LYS B CD    1 
ATOM   1258  C  CE    . LYS B 2 77  ? -31.599 -1.059  24.967 1.00 60.16  ? 77   LYS B CE    1 
ATOM   1259  N  NZ    . LYS B 2 77  ? -31.277 -0.786  23.515 1.00 60.39  ? 77   LYS B NZ    1 
ATOM   1260  N  N     . ARG B 2 78  ? -36.768 -3.080  29.829 1.00 54.86  ? 78   ARG B N     1 
ATOM   1261  C  CA    . ARG B 2 78  ? -38.127 -3.406  30.235 1.00 54.97  ? 78   ARG B CA    1 
ATOM   1262  C  C     . ARG B 2 78  ? -38.493 -2.657  31.505 1.00 55.10  ? 78   ARG B C     1 
ATOM   1263  O  O     . ARG B 2 78  ? -37.631 -2.077  32.154 1.00 55.02  ? 78   ARG B O     1 
ATOM   1264  C  CB    . ARG B 2 78  ? -38.299 -4.921  30.408 1.00 55.10  ? 78   ARG B CB    1 
ATOM   1265  C  CG    . ARG B 2 78  ? -38.287 -5.688  29.094 1.00 54.94  ? 78   ARG B CG    1 
ATOM   1266  C  CD    . ARG B 2 78  ? -38.575 -7.166  29.287 1.00 54.58  ? 78   ARG B CD    1 
ATOM   1267  N  NE    . ARG B 2 78  ? -37.348 -7.930  29.503 1.00 54.68  ? 78   ARG B NE    1 
ATOM   1268  C  CZ    . ARG B 2 78  ? -36.885 -8.280  30.702 1.00 55.01  ? 78   ARG B CZ    1 
ATOM   1269  N  NH1   . ARG B 2 78  ? -37.554 -7.942  31.809 1.00 54.62  ? 78   ARG B NH1   1 
ATOM   1270  N  NH2   . ARG B 2 78  ? -35.755 -8.971  30.793 1.00 52.04  ? 78   ARG B NH2   1 
ATOM   1271  N  N     . LYS B 2 79  ? -39.781 -2.634  31.828 1.00 55.45  ? 79   LYS B N     1 
ATOM   1272  C  CA    . LYS B 2 79  ? -40.261 -2.027  33.060 1.00 55.82  ? 79   LYS B CA    1 
ATOM   1273  C  C     . LYS B 2 79  ? -40.876 -3.124  33.921 1.00 55.32  ? 79   LYS B C     1 
ATOM   1274  O  O     . LYS B 2 79  ? -41.400 -2.868  35.013 1.00 55.36  ? 79   LYS B O     1 
ATOM   1275  C  CB    . LYS B 2 79  ? -41.288 -0.936  32.754 1.00 56.56  ? 79   LYS B CB    1 
ATOM   1276  C  CG    . LYS B 2 79  ? -40.746 0.237   31.927 1.00 59.24  ? 79   LYS B CG    1 
ATOM   1277  C  CD    . LYS B 2 79  ? -41.750 1.386   31.867 1.00 63.46  ? 79   LYS B CD    1 
ATOM   1278  C  CE    . LYS B 2 79  ? -41.379 2.371   30.753 1.00 66.93  ? 79   LYS B CE    1 
ATOM   1279  N  NZ    . LYS B 2 79  ? -42.515 3.290   30.382 1.00 68.75  ? 79   LYS B NZ    1 
ATOM   1280  N  N     . THR B 2 80  ? -40.796 -4.353  33.412 1.00 54.74  ? 80   THR B N     1 
ATOM   1281  C  CA    . THR B 2 80  ? -41.323 -5.530  34.099 1.00 54.33  ? 80   THR B CA    1 
ATOM   1282  C  C     . THR B 2 80  ? -40.197 -6.494  34.428 1.00 53.34  ? 80   THR B C     1 
ATOM   1283  O  O     . THR B 2 80  ? -39.444 -6.903  33.547 1.00 53.34  ? 80   THR B O     1 
ATOM   1284  C  CB    . THR B 2 80  ? -42.336 -6.285  33.213 1.00 54.56  ? 80   THR B CB    1 
ATOM   1285  O  OG1   . THR B 2 80  ? -43.114 -5.336  32.467 1.00 55.08  ? 80   THR B OG1   1 
ATOM   1286  C  CG2   . THR B 2 80  ? -43.256 -7.169  34.070 1.00 54.60  ? 80   THR B CG2   1 
ATOM   1287  N  N     . VAL B 2 81  ? -40.080 -6.856  35.696 1.00 52.46  ? 81   VAL B N     1 
ATOM   1288  C  CA    . VAL B 2 81  ? -39.121 -7.888  36.090 1.00 51.43  ? 81   VAL B CA    1 
ATOM   1289  C  C     . VAL B 2 81  ? -39.730 -9.232  35.714 1.00 50.61  ? 81   VAL B C     1 
ATOM   1290  O  O     . VAL B 2 81  ? -40.847 -9.555  36.128 1.00 50.41  ? 81   VAL B O     1 
ATOM   1291  C  CB    . VAL B 2 81  ? -38.810 -7.853  37.595 1.00 51.58  ? 81   VAL B CB    1 
ATOM   1292  C  CG1   . VAL B 2 81  ? -37.694 -8.833  37.927 1.00 52.06  ? 81   VAL B CG1   1 
ATOM   1293  C  CG2   . VAL B 2 81  ? -38.427 -6.443  38.037 1.00 51.35  ? 81   VAL B CG2   1 
ATOM   1294  N  N     . THR B 2 82  ? -39.014 -10.000 34.899 1.00 49.65  ? 82   THR B N     1 
ATOM   1295  C  CA    . THR B 2 82  ? -39.516 -11.303 34.477 1.00 49.00  ? 82   THR B CA    1 
ATOM   1296  C  C     . THR B 2 82  ? -38.968 -12.436 35.336 1.00 48.37  ? 82   THR B C     1 
ATOM   1297  O  O     . THR B 2 82  ? -37.896 -12.324 35.924 1.00 48.08  ? 82   THR B O     1 
ATOM   1298  C  CB    . THR B 2 82  ? -39.173 -11.612 33.023 1.00 48.94  ? 82   THR B CB    1 
ATOM   1299  O  OG1   . THR B 2 82  ? -37.755 -11.730 32.887 1.00 49.31  ? 82   THR B OG1   1 
ATOM   1300  C  CG2   . THR B 2 82  ? -39.681 -10.514 32.105 1.00 49.87  ? 82   THR B CG2   1 
ATOM   1301  N  N     . ALA B 2 83  ? -39.715 -13.532 35.393 1.00 47.79  ? 83   ALA B N     1 
ATOM   1302  C  CA    . ALA B 2 83  ? -39.221 -14.755 36.006 1.00 47.30  ? 83   ALA B CA    1 
ATOM   1303  C  C     . ALA B 2 83  ? -37.774 -15.022 35.606 1.00 46.93  ? 83   ALA B C     1 
ATOM   1304  O  O     . ALA B 2 83  ? -36.974 -15.372 36.458 1.00 47.19  ? 83   ALA B O     1 
ATOM   1305  C  CB    . ALA B 2 83  ? -40.093 -15.929 35.629 1.00 47.26  ? 83   ALA B CB    1 
ATOM   1306  N  N     . MET B 2 84  ? -37.438 -14.846 34.328 1.00 46.32  ? 84   MET B N     1 
ATOM   1307  C  CA    . MET B 2 84  ? -36.089 -15.124 33.854 1.00 46.21  ? 84   MET B CA    1 
ATOM   1308  C  C     . MET B 2 84  ? -35.080 -14.196 34.485 1.00 46.39  ? 84   MET B C     1 
ATOM   1309  O  O     . MET B 2 84  ? -33.992 -14.636 34.857 1.00 46.76  ? 84   MET B O     1 
ATOM   1310  C  CB    . MET B 2 84  ? -35.967 -15.031 32.338 1.00 46.09  ? 84   MET B CB    1 
ATOM   1311  C  CG    . MET B 2 84  ? -36.560 -16.219 31.589 1.00 47.24  ? 84   MET B CG    1 
ATOM   1312  S  SD    . MET B 2 84  ? -36.342 -17.805 32.409 1.00 50.60  ? 84   MET B SD    1 
ATOM   1313  C  CE    . MET B 2 84  ? -34.609 -18.150 32.055 1.00 48.75  ? 84   MET B CE    1 
ATOM   1314  N  N     . ASP B 2 85  ? -35.434 -12.917 34.603 1.00 45.80  ? 85   ASP B N     1 
ATOM   1315  C  CA    . ASP B 2 85  ? -34.587 -11.970 35.297 1.00 45.14  ? 85   ASP B CA    1 
ATOM   1316  C  C     . ASP B 2 85  ? -34.217 -12.548 36.646 1.00 44.67  ? 85   ASP B C     1 
ATOM   1317  O  O     . ASP B 2 85  ? -33.050 -12.508 37.032 1.00 45.28  ? 85   ASP B O     1 
ATOM   1318  C  CB    . ASP B 2 85  ? -35.292 -10.626 35.485 1.00 45.36  ? 85   ASP B CB    1 
ATOM   1319  C  CG    . ASP B 2 85  ? -35.446 -9.856  34.190 1.00 46.29  ? 85   ASP B CG    1 
ATOM   1320  O  OD1   . ASP B 2 85  ? -34.649 -10.096 33.254 1.00 47.21  ? 85   ASP B OD1   1 
ATOM   1321  O  OD2   . ASP B 2 85  ? -36.361 -9.000  34.119 1.00 46.77  ? 85   ASP B OD2   1 
ATOM   1322  N  N     . VAL B 2 86  ? -35.208 -13.100 37.343 1.00 43.64  ? 86   VAL B N     1 
ATOM   1323  C  CA    . VAL B 2 86  ? -35.032 -13.600 38.703 1.00 43.34  ? 86   VAL B CA    1 
ATOM   1324  C  C     . VAL B 2 86  ? -34.228 -14.897 38.715 1.00 43.43  ? 86   VAL B C     1 
ATOM   1325  O  O     . VAL B 2 86  ? -33.282 -15.049 39.500 1.00 43.66  ? 86   VAL B O     1 
ATOM   1326  C  CB    . VAL B 2 86  ? -36.393 -13.795 39.409 1.00 43.18  ? 86   VAL B CB    1 
ATOM   1327  C  CG1   . VAL B 2 86  ? -36.244 -14.564 40.703 1.00 43.18  ? 86   VAL B CG1   1 
ATOM   1328  C  CG2   . VAL B 2 86  ? -37.041 -12.444 39.690 1.00 43.99  ? 86   VAL B CG2   1 
ATOM   1329  N  N     . VAL B 2 87  ? -34.600 -15.816 37.828 1.00 42.90  ? 87   VAL B N     1 
ATOM   1330  C  CA    . VAL B 2 87  ? -33.888 -17.069 37.656 1.00 42.02  ? 87   VAL B CA    1 
ATOM   1331  C  C     . VAL B 2 87  ? -32.410 -16.838 37.340 1.00 42.27  ? 87   VAL B C     1 
ATOM   1332  O  O     . VAL B 2 87  ? -31.550 -17.510 37.907 1.00 42.18  ? 87   VAL B O     1 
ATOM   1333  C  CB    . VAL B 2 87  ? -34.567 -17.949 36.590 1.00 42.05  ? 87   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B 2 87  ? -33.681 -19.136 36.187 1.00 41.23  ? 87   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B 2 87  ? -35.911 -18.430 37.100 1.00 40.76  ? 87   VAL B CG2   1 
ATOM   1336  N  N     . TYR B 2 88  ? -32.108 -15.883 36.466 1.00 42.43  ? 88   TYR B N     1 
ATOM   1337  C  CA    . TYR B 2 88  ? -30.716 -15.586 36.150 1.00 42.98  ? 88   TYR B CA    1 
ATOM   1338  C  C     . TYR B 2 88  ? -29.967 -14.984 37.342 1.00 43.03  ? 88   TYR B C     1 
ATOM   1339  O  O     . TYR B 2 88  ? -28.765 -15.243 37.525 1.00 43.05  ? 88   TYR B O     1 
ATOM   1340  C  CB    . TYR B 2 88  ? -30.611 -14.624 34.987 1.00 43.37  ? 88   TYR B CB    1 
ATOM   1341  C  CG    . TYR B 2 88  ? -31.096 -15.158 33.669 1.00 45.61  ? 88   TYR B CG    1 
ATOM   1342  C  CD1   . TYR B 2 88  ? -31.819 -14.343 32.805 1.00 47.17  ? 88   TYR B CD1   1 
ATOM   1343  C  CD2   . TYR B 2 88  ? -30.818 -16.463 33.272 1.00 46.60  ? 88   TYR B CD2   1 
ATOM   1344  C  CE1   . TYR B 2 88  ? -32.256 -14.813 31.582 1.00 49.16  ? 88   TYR B CE1   1 
ATOM   1345  C  CE2   . TYR B 2 88  ? -31.257 -16.942 32.049 1.00 48.91  ? 88   TYR B CE2   1 
ATOM   1346  C  CZ    . TYR B 2 88  ? -31.976 -16.105 31.211 1.00 49.31  ? 88   TYR B CZ    1 
ATOM   1347  O  OH    . TYR B 2 88  ? -32.422 -16.557 29.997 1.00 51.36  ? 88   TYR B OH    1 
ATOM   1348  N  N     . ALA B 2 89  ? -30.667 -14.175 38.138 1.00 42.29  ? 89   ALA B N     1 
ATOM   1349  C  CA    . ALA B 2 89  ? -30.030 -13.528 39.281 1.00 41.84  ? 89   ALA B CA    1 
ATOM   1350  C  C     . ALA B 2 89  ? -29.689 -14.595 40.296 1.00 41.46  ? 89   ALA B C     1 
ATOM   1351  O  O     . ALA B 2 89  ? -28.569 -14.644 40.793 1.00 41.57  ? 89   ALA B O     1 
ATOM   1352  C  CB    . ALA B 2 89  ? -30.925 -12.462 39.894 1.00 41.67  ? 89   ALA B CB    1 
ATOM   1353  N  N     . LEU B 2 90  ? -30.653 -15.461 40.582 1.00 41.12  ? 90   LEU B N     1 
ATOM   1354  C  CA    . LEU B 2 90  ? -30.419 -16.617 41.448 1.00 41.13  ? 90   LEU B CA    1 
ATOM   1355  C  C     . LEU B 2 90  ? -29.238 -17.506 40.989 1.00 41.29  ? 90   LEU B C     1 
ATOM   1356  O  O     . LEU B 2 90  ? -28.422 -17.913 41.801 1.00 41.23  ? 90   LEU B O     1 
ATOM   1357  C  CB    . LEU B 2 90  ? -31.694 -17.436 41.592 1.00 40.59  ? 90   LEU B CB    1 
ATOM   1358  C  CG    . LEU B 2 90  ? -32.815 -16.778 42.404 1.00 40.39  ? 90   LEU B CG    1 
ATOM   1359  C  CD1   . LEU B 2 90  ? -34.154 -17.427 42.109 1.00 39.50  ? 90   LEU B CD1   1 
ATOM   1360  C  CD2   . LEU B 2 90  ? -32.535 -16.802 43.912 1.00 39.28  ? 90   LEU B CD2   1 
ATOM   1361  N  N     . LYS B 2 91  ? -29.122 -17.769 39.695 1.00 41.79  ? 91   LYS B N     1 
ATOM   1362  C  CA    . LYS B 2 91  ? -28.023 -18.589 39.206 1.00 42.56  ? 91   LYS B CA    1 
ATOM   1363  C  C     . LYS B 2 91  ? -26.665 -17.961 39.523 1.00 42.86  ? 91   LYS B C     1 
ATOM   1364  O  O     . LYS B 2 91  ? -25.768 -18.644 40.027 1.00 43.59  ? 91   LYS B O     1 
ATOM   1365  C  CB    . LYS B 2 91  ? -28.167 -18.893 37.713 1.00 42.61  ? 91   LYS B CB    1 
ATOM   1366  C  CG    . LYS B 2 91  ? -27.035 -19.746 37.159 1.00 44.75  ? 91   LYS B CG    1 
ATOM   1367  C  CD    . LYS B 2 91  ? -27.515 -20.894 36.249 1.00 48.25  ? 91   LYS B CD    1 
ATOM   1368  C  CE    . LYS B 2 91  ? -27.876 -20.400 34.839 1.00 51.53  ? 91   LYS B CE    1 
ATOM   1369  N  NZ    . LYS B 2 91  ? -28.024 -21.538 33.856 1.00 52.85  ? 91   LYS B NZ    1 
ATOM   1370  N  N     . ARG B 2 92  ? -26.514 -16.666 39.271 1.00 42.49  ? 92   ARG B N     1 
ATOM   1371  C  CA    . ARG B 2 92  ? -25.227 -16.036 39.497 1.00 42.60  ? 92   ARG B CA    1 
ATOM   1372  C  C     . ARG B 2 92  ? -24.899 -15.802 40.981 1.00 42.88  ? 92   ARG B C     1 
ATOM   1373  O  O     . ARG B 2 92  ? -23.723 -15.651 41.326 1.00 42.89  ? 92   ARG B O     1 
ATOM   1374  C  CB    . ARG B 2 92  ? -25.063 -14.756 38.662 1.00 42.55  ? 92   ARG B CB    1 
ATOM   1375  C  CG    . ARG B 2 92  ? -25.853 -13.547 39.150 1.00 42.95  ? 92   ARG B CG    1 
ATOM   1376  C  CD    . ARG B 2 92  ? -25.405 -12.311 38.397 1.00 45.12  ? 92   ARG B CD    1 
ATOM   1377  N  NE    . ARG B 2 92  ? -23.945 -12.188 38.374 1.00 46.18  ? 92   ARG B NE    1 
ATOM   1378  C  CZ    . ARG B 2 92  ? -23.213 -11.717 39.381 1.00 45.81  ? 92   ARG B CZ    1 
ATOM   1379  N  NH1   . ARG B 2 92  ? -23.800 -11.312 40.496 1.00 44.90  ? 92   ARG B NH1   1 
ATOM   1380  N  NH2   . ARG B 2 92  ? -21.891 -11.653 39.273 1.00 47.48  ? 92   ARG B NH2   1 
ATOM   1381  N  N     . GLN B 2 93  ? -25.918 -15.773 41.849 1.00 42.85  ? 93   GLN B N     1 
ATOM   1382  C  CA    . GLN B 2 93  ? -25.682 -15.731 43.295 1.00 43.09  ? 93   GLN B CA    1 
ATOM   1383  C  C     . GLN B 2 93  ? -25.383 -17.129 43.846 1.00 42.97  ? 93   GLN B C     1 
ATOM   1384  O  O     . GLN B 2 93  ? -25.260 -17.307 45.062 1.00 43.06  ? 93   GLN B O     1 
ATOM   1385  C  CB    . GLN B 2 93  ? -26.888 -15.175 44.054 1.00 43.25  ? 93   GLN B CB    1 
ATOM   1386  C  CG    . GLN B 2 93  ? -27.388 -13.822 43.624 1.00 44.58  ? 93   GLN B CG    1 
ATOM   1387  C  CD    . GLN B 2 93  ? -26.504 -12.680 44.080 1.00 47.43  ? 93   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B 2 93  ? -25.762 -12.795 45.056 1.00 47.89  ? 93   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B 2 93  ? -26.583 -11.560 43.366 1.00 47.79  ? 93   GLN B NE2   1 
ATOM   1390  N  N     . GLY B 2 94  ? -25.310 -18.117 42.960 1.00 42.78  ? 94   GLY B N     1 
ATOM   1391  C  CA    . GLY B 2 94  ? -25.098 -19.502 43.360 1.00 42.76  ? 94   GLY B CA    1 
ATOM   1392  C  C     . GLY B 2 94  ? -26.267 -20.107 44.123 1.00 42.55  ? 94   GLY B C     1 
ATOM   1393  O  O     . GLY B 2 94  ? -26.079 -20.936 45.011 1.00 42.48  ? 94   GLY B O     1 
ATOM   1394  N  N     . ARG B 2 95  ? -27.477 -19.679 43.783 1.00 42.27  ? 95   ARG B N     1 
ATOM   1395  C  CA    . ARG B 2 95  ? -28.690 -20.257 44.347 1.00 41.94  ? 95   ARG B CA    1 
ATOM   1396  C  C     . ARG B 2 95  ? -29.646 -20.659 43.221 1.00 41.19  ? 95   ARG B C     1 
ATOM   1397  O  O     . ARG B 2 95  ? -30.797 -20.224 43.219 1.00 41.33  ? 95   ARG B O     1 
ATOM   1398  C  CB    . ARG B 2 95  ? -29.409 -19.269 45.278 1.00 42.06  ? 95   ARG B CB    1 
ATOM   1399  C  CG    . ARG B 2 95  ? -28.533 -18.431 46.194 1.00 44.45  ? 95   ARG B CG    1 
ATOM   1400  C  CD    . ARG B 2 95  ? -28.537 -18.925 47.615 1.00 46.51  ? 95   ARG B CD    1 
ATOM   1401  N  NE    . ARG B 2 95  ? -29.659 -19.826 47.864 1.00 48.42  ? 95   ARG B NE    1 
ATOM   1402  C  CZ    . ARG B 2 95  ? -29.672 -20.769 48.807 1.00 48.06  ? 95   ARG B CZ    1 
ATOM   1403  N  NH1   . ARG B 2 95  ? -28.613 -20.937 49.606 1.00 46.95  ? 95   ARG B NH1   1 
ATOM   1404  N  NH2   . ARG B 2 95  ? -30.749 -21.539 48.950 1.00 46.72  ? 95   ARG B NH2   1 
ATOM   1405  N  N     . THR B 2 96  ? -29.167 -21.477 42.280 1.00 40.48  ? 96   THR B N     1 
ATOM   1406  C  CA    . THR B 2 96  ? -29.944 -21.982 41.133 1.00 39.90  ? 96   THR B CA    1 
ATOM   1407  C  C     . THR B 2 96  ? -31.319 -22.508 41.520 1.00 40.35  ? 96   THR B C     1 
ATOM   1408  O  O     . THR B 2 96  ? -31.450 -23.305 42.461 1.00 40.71  ? 96   THR B O     1 
ATOM   1409  C  CB    . THR B 2 96  ? -29.170 -23.114 40.415 1.00 39.68  ? 96   THR B CB    1 
ATOM   1410  O  OG1   . THR B 2 96  ? -27.945 -22.591 39.916 1.00 39.62  ? 96   THR B OG1   1 
ATOM   1411  C  CG2   . THR B 2 96  ? -29.942 -23.709 39.252 1.00 38.63  ? 96   THR B CG2   1 
ATOM   1412  N  N     . LEU B 2 97  ? -32.332 -22.064 40.780 1.00 40.52  ? 97   LEU B N     1 
ATOM   1413  C  CA    . LEU B 2 97  ? -33.716 -22.479 40.988 1.00 41.21  ? 97   LEU B CA    1 
ATOM   1414  C  C     . LEU B 2 97  ? -34.262 -23.148 39.731 1.00 41.92  ? 97   LEU B C     1 
ATOM   1415  O  O     . LEU B 2 97  ? -34.060 -22.658 38.616 1.00 42.26  ? 97   LEU B O     1 
ATOM   1416  C  CB    . LEU B 2 97  ? -34.584 -21.275 41.379 1.00 40.91  ? 97   LEU B CB    1 
ATOM   1417  C  CG    . LEU B 2 97  ? -36.080 -21.427 41.698 1.00 40.88  ? 97   LEU B CG    1 
ATOM   1418  C  CD1   . LEU B 2 97  ? -36.313 -22.097 43.030 1.00 40.28  ? 97   LEU B CD1   1 
ATOM   1419  C  CD2   . LEU B 2 97  ? -36.821 -20.082 41.673 1.00 40.08  ? 97   LEU B CD2   1 
ATOM   1420  N  N     . TYR B 2 98  ? -34.941 -24.279 39.930 1.00 42.66  ? 98   TYR B N     1 
ATOM   1421  C  CA    . TYR B 2 98  ? -35.616 -25.011 38.866 1.00 43.14  ? 98   TYR B CA    1 
ATOM   1422  C  C     . TYR B 2 98  ? -37.117 -24.840 39.007 1.00 44.05  ? 98   TYR B C     1 
ATOM   1423  O  O     . TYR B 2 98  ? -37.638 -24.848 40.123 1.00 44.28  ? 98   TYR B O     1 
ATOM   1424  C  CB    . TYR B 2 98  ? -35.329 -26.506 38.980 1.00 42.89  ? 98   TYR B CB    1 
ATOM   1425  C  CG    . TYR B 2 98  ? -33.940 -26.975 38.624 1.00 41.05  ? 98   TYR B CG    1 
ATOM   1426  C  CD1   . TYR B 2 98  ? -32.963 -26.101 38.142 1.00 39.82  ? 98   TYR B CD1   1 
ATOM   1427  C  CD2   . TYR B 2 98  ? -33.621 -28.318 38.730 1.00 39.89  ? 98   TYR B CD2   1 
ATOM   1428  C  CE1   . TYR B 2 98  ? -31.697 -26.560 37.795 1.00 39.21  ? 98   TYR B CE1   1 
ATOM   1429  C  CE2   . TYR B 2 98  ? -32.368 -28.787 38.384 1.00 40.12  ? 98   TYR B CE2   1 
ATOM   1430  C  CZ    . TYR B 2 98  ? -31.411 -27.907 37.916 1.00 40.13  ? 98   TYR B CZ    1 
ATOM   1431  O  OH    . TYR B 2 98  ? -30.176 -28.394 37.581 1.00 38.70  ? 98   TYR B OH    1 
ATOM   1432  N  N     . GLY B 2 99  ? -37.811 -24.696 37.879 1.00 45.04  ? 99   GLY B N     1 
ATOM   1433  C  CA    . GLY B 2 99  ? -39.264 -24.572 37.881 1.00 46.15  ? 99   GLY B CA    1 
ATOM   1434  C  C     . GLY B 2 99  ? -39.866 -23.353 37.211 1.00 47.03  ? 99   GLY B C     1 
ATOM   1435  O  O     . GLY B 2 99  ? -41.071 -23.288 37.042 1.00 47.91  ? 99   GLY B O     1 
ATOM   1436  N  N     . PHE B 2 100 ? -39.050 -22.382 36.823 1.00 47.80  ? 100  PHE B N     1 
ATOM   1437  C  CA    . PHE B 2 100 ? -39.593 -21.134 36.301 1.00 48.13  ? 100  PHE B CA    1 
ATOM   1438  C  C     . PHE B 2 100 ? -39.010 -20.738 34.946 1.00 48.82  ? 100  PHE B C     1 
ATOM   1439  O  O     . PHE B 2 100 ? -39.210 -19.620 34.484 1.00 48.95  ? 100  PHE B O     1 
ATOM   1440  C  CB    . PHE B 2 100 ? -39.435 -20.018 37.338 1.00 47.90  ? 100  PHE B CB    1 
ATOM   1441  C  CG    . PHE B 2 100 ? -40.265 -20.225 38.580 1.00 47.65  ? 100  PHE B CG    1 
ATOM   1442  C  CD1   . PHE B 2 100 ? -39.749 -20.916 39.672 1.00 47.77  ? 100  PHE B CD1   1 
ATOM   1443  C  CD2   . PHE B 2 100 ? -41.563 -19.735 38.658 1.00 47.56  ? 100  PHE B CD2   1 
ATOM   1444  C  CE1   . PHE B 2 100 ? -40.512 -21.112 40.820 1.00 47.15  ? 100  PHE B CE1   1 
ATOM   1445  C  CE2   . PHE B 2 100 ? -42.336 -19.927 39.805 1.00 47.83  ? 100  PHE B CE2   1 
ATOM   1446  C  CZ    . PHE B 2 100 ? -41.808 -20.617 40.886 1.00 47.52  ? 100  PHE B CZ    1 
ATOM   1447  N  N     . GLY B 2 101 ? -38.314 -21.670 34.301 1.00 49.78  ? 101  GLY B N     1 
ATOM   1448  C  CA    . GLY B 2 101 ? -37.731 -21.432 32.982 1.00 51.07  ? 101  GLY B CA    1 
ATOM   1449  C  C     . GLY B 2 101 ? -36.219 -21.509 33.003 1.00 51.96  ? 101  GLY B C     1 
ATOM   1450  O  O     . GLY B 2 101 ? -35.620 -21.666 34.066 1.00 52.64  ? 101  GLY B O     1 
ATOM   1451  N  N     . GLY B 2 102 ? -35.598 -21.394 31.832 1.00 52.54  ? 102  GLY B N     1 
ATOM   1452  C  CA    . GLY B 2 102 ? -34.141 -21.518 31.712 1.00 53.05  ? 102  GLY B CA    1 
ATOM   1453  C  C     . GLY B 2 102 ? -33.629 -22.940 31.861 1.00 53.42  ? 102  GLY B C     1 
ATOM   1454  O  O     . GLY B 2 102 ? -32.438 -23.145 32.113 1.00 53.46  ? 102  GLY B O     1 
ATOM   1455  O  OXT   . GLY B 2 102 ? -34.384 -23.918 31.725 1.00 53.63  ? 102  GLY B OXT   1 
ATOM   1456  N  N     . ALA C 3 14  ? -0.182  7.268   13.124 1.00 74.16  ? 14   ALA C N     1 
ATOM   1457  C  CA    . ALA C 3 14  ? -0.589  5.928   13.653 1.00 74.13  ? 14   ALA C CA    1 
ATOM   1458  C  C     . ALA C 3 14  ? -0.653  5.888   15.187 1.00 73.91  ? 14   ALA C C     1 
ATOM   1459  O  O     . ALA C 3 14  ? 0.301   5.479   15.860 1.00 73.88  ? 14   ALA C O     1 
ATOM   1460  C  CB    . ALA C 3 14  ? 0.336   4.828   13.112 1.00 74.11  ? 14   ALA C CB    1 
ATOM   1461  N  N     . LYS C 3 15  ? -1.785  6.315   15.736 1.00 73.53  ? 15   LYS C N     1 
ATOM   1462  C  CA    . LYS C 3 15  ? -1.970  6.303   17.184 1.00 73.13  ? 15   LYS C CA    1 
ATOM   1463  C  C     . LYS C 3 15  ? -2.701  5.046   17.667 1.00 72.23  ? 15   LYS C C     1 
ATOM   1464  O  O     . LYS C 3 15  ? -3.802  4.739   17.192 1.00 72.27  ? 15   LYS C O     1 
ATOM   1465  C  CB    . LYS C 3 15  ? -2.677  7.580   17.644 1.00 73.30  ? 15   LYS C CB    1 
ATOM   1466  C  CG    . LYS C 3 15  ? -1.762  8.802   17.611 1.00 74.73  ? 15   LYS C CG    1 
ATOM   1467  C  CD    . LYS C 3 15  ? -2.509  10.074  17.997 1.00 77.40  ? 15   LYS C CD    1 
ATOM   1468  C  CE    . LYS C 3 15  ? -1.628  11.309  17.779 1.00 78.79  ? 15   LYS C CE    1 
ATOM   1469  N  NZ    . LYS C 3 15  ? -2.274  12.563  18.287 1.00 79.86  ? 15   LYS C NZ    1 
ATOM   1470  N  N     . THR C 3 16  ? -2.076  4.323   18.603 1.00 70.84  ? 16   THR C N     1 
ATOM   1471  C  CA    . THR C 3 16  ? -2.697  3.152   19.237 1.00 69.45  ? 16   THR C CA    1 
ATOM   1472  C  C     . THR C 3 16  ? -4.099  3.479   19.746 1.00 68.44  ? 16   THR C C     1 
ATOM   1473  O  O     . THR C 3 16  ? -4.389  4.617   20.129 1.00 68.07  ? 16   THR C O     1 
ATOM   1474  C  CB    . THR C 3 16  ? -1.880  2.609   20.443 1.00 69.33  ? 16   THR C CB    1 
ATOM   1475  O  OG1   . THR C 3 16  ? -1.999  3.506   21.554 1.00 69.49  ? 16   THR C OG1   1 
ATOM   1476  C  CG2   . THR C 3 16  ? -0.420  2.428   20.096 1.00 69.17  ? 16   THR C CG2   1 
ATOM   1477  N  N     . ARG C 3 17  ? -4.959  2.467   19.755 1.00 67.32  ? 17   ARG C N     1 
ATOM   1478  C  CA    . ARG C 3 17  ? -6.314  2.600   20.280 1.00 66.36  ? 17   ARG C CA    1 
ATOM   1479  C  C     . ARG C 3 17  ? -6.327  2.861   21.781 1.00 65.41  ? 17   ARG C C     1 
ATOM   1480  O  O     . ARG C 3 17  ? -7.303  3.377   22.325 1.00 65.07  ? 17   ARG C O     1 
ATOM   1481  C  CB    . ARG C 3 17  ? -7.120  1.351   19.960 1.00 66.56  ? 17   ARG C CB    1 
ATOM   1482  C  CG    . ARG C 3 17  ? -7.583  1.294   18.527 1.00 67.06  ? 17   ARG C CG    1 
ATOM   1483  C  CD    . ARG C 3 17  ? -8.780  0.386   18.396 1.00 67.04  ? 17   ARG C CD    1 
ATOM   1484  N  NE    . ARG C 3 17  ? -8.396  -1.018  18.347 1.00 66.03  ? 17   ARG C NE    1 
ATOM   1485  C  CZ    . ARG C 3 17  ? -9.227  -2.020  18.600 1.00 66.10  ? 17   ARG C CZ    1 
ATOM   1486  N  NH1   . ARG C 3 17  ? -10.494 -1.778  18.930 1.00 66.64  ? 17   ARG C NH1   1 
ATOM   1487  N  NH2   . ARG C 3 17  ? -8.789  -3.265  18.530 1.00 65.41  ? 17   ARG C NH2   1 
ATOM   1488  N  N     . SER C 3 18  ? -5.231  2.494   22.440 1.00 64.56  ? 18   SER C N     1 
ATOM   1489  C  CA    . SER C 3 18  ? -5.019  2.816   23.844 1.00 63.73  ? 18   SER C CA    1 
ATOM   1490  C  C     . SER C 3 18  ? -4.915  4.335   24.030 1.00 63.10  ? 18   SER C C     1 
ATOM   1491  O  O     . SER C 3 18  ? -5.757  4.930   24.699 1.00 62.81  ? 18   SER C O     1 
ATOM   1492  C  CB    . SER C 3 18  ? -3.774  2.096   24.378 1.00 63.77  ? 18   SER C CB    1 
ATOM   1493  O  OG    . SER C 3 18  ? -3.936  0.692   24.326 1.00 63.26  ? 18   SER C OG    1 
ATOM   1494  N  N     . SER C 3 19  ? -3.902  4.953   23.418 1.00 62.59  ? 19   SER C N     1 
ATOM   1495  C  CA    . SER C 3 19  ? -3.754  6.420   23.437 1.00 62.05  ? 19   SER C CA    1 
ATOM   1496  C  C     . SER C 3 19  ? -5.017  7.159   22.995 1.00 61.47  ? 19   SER C C     1 
ATOM   1497  O  O     . SER C 3 19  ? -5.378  8.171   23.597 1.00 61.17  ? 19   SER C O     1 
ATOM   1498  C  CB    . SER C 3 19  ? -2.522  6.889   22.642 1.00 62.02  ? 19   SER C CB    1 
ATOM   1499  O  OG    . SER C 3 19  ? -2.322  6.123   21.464 1.00 62.11  ? 19   SER C OG    1 
ATOM   1500  N  N     . ARG C 3 20  ? -5.698  6.634   21.976 1.00 60.99  ? 20   ARG C N     1 
ATOM   1501  C  CA    . ARG C 3 20  ? -6.990  7.179   21.550 1.00 61.25  ? 20   ARG C CA    1 
ATOM   1502  C  C     . ARG C 3 20  ? -8.008  7.271   22.695 1.00 60.61  ? 20   ARG C C     1 
ATOM   1503  O  O     . ARG C 3 20  ? -8.747  8.262   22.804 1.00 60.74  ? 20   ARG C O     1 
ATOM   1504  C  CB    . ARG C 3 20  ? -7.592  6.354   20.405 1.00 61.88  ? 20   ARG C CB    1 
ATOM   1505  C  CG    . ARG C 3 20  ? -6.918  6.492   19.034 1.00 63.84  ? 20   ARG C CG    1 
ATOM   1506  C  CD    . ARG C 3 20  ? -7.829  5.942   17.929 1.00 66.95  ? 20   ARG C CD    1 
ATOM   1507  N  NE    . ARG C 3 20  ? -7.085  5.516   16.740 1.00 70.41  ? 20   ARG C NE    1 
ATOM   1508  C  CZ    . ARG C 3 20  ? -6.769  6.304   15.705 1.00 73.04  ? 20   ARG C CZ    1 
ATOM   1509  N  NH1   . ARG C 3 20  ? -7.116  7.593   15.684 1.00 73.63  ? 20   ARG C NH1   1 
ATOM   1510  N  NH2   . ARG C 3 20  ? -6.092  5.801   14.676 1.00 74.33  ? 20   ARG C NH2   1 
ATOM   1511  N  N     . ALA C 3 21  ? -8.050  6.229   23.529 1.00 59.78  ? 21   ALA C N     1 
ATOM   1512  C  CA    . ALA C 3 21  ? -8.956  6.174   24.682 1.00 58.87  ? 21   ALA C CA    1 
ATOM   1513  C  C     . ALA C 3 21  ? -8.316  6.717   25.961 1.00 58.08  ? 21   ALA C C     1 
ATOM   1514  O  O     . ALA C 3 21  ? -8.993  6.921   26.963 1.00 58.18  ? 21   ALA C O     1 
ATOM   1515  C  CB    . ALA C 3 21  ? -9.448  4.754   24.897 1.00 58.92  ? 21   ALA C CB    1 
ATOM   1516  N  N     . GLY C 3 22  ? -7.008  6.946   25.916 1.00 57.40  ? 22   GLY C N     1 
ATOM   1517  C  CA    . GLY C 3 22  ? -6.279  7.533   27.037 1.00 56.38  ? 22   GLY C CA    1 
ATOM   1518  C  C     . GLY C 3 22  ? -6.001  6.519   28.118 1.00 55.79  ? 22   GLY C C     1 
ATOM   1519  O  O     . GLY C 3 22  ? -6.204  6.786   29.305 1.00 55.70  ? 22   GLY C O     1 
ATOM   1520  N  N     . LEU C 3 23  ? -5.511  5.358   27.686 1.00 55.30  ? 23   LEU C N     1 
ATOM   1521  C  CA    . LEU C 3 23  ? -5.313  4.209   28.552 1.00 54.47  ? 23   LEU C CA    1 
ATOM   1522  C  C     . LEU C 3 23  ? -3.907  3.640   28.456 1.00 54.15  ? 23   LEU C C     1 
ATOM   1523  O  O     . LEU C 3 23  ? -3.253  3.725   27.417 1.00 53.91  ? 23   LEU C O     1 
ATOM   1524  C  CB    . LEU C 3 23  ? -6.338  3.116   28.226 1.00 54.36  ? 23   LEU C CB    1 
ATOM   1525  C  CG    . LEU C 3 23  ? -7.826  3.420   28.436 1.00 53.85  ? 23   LEU C CG    1 
ATOM   1526  C  CD1   . LEU C 3 23  ? -8.660  2.182   28.111 1.00 52.62  ? 23   LEU C CD1   1 
ATOM   1527  C  CD2   . LEU C 3 23  ? -8.108  3.894   29.854 1.00 52.37  ? 23   LEU C CD2   1 
ATOM   1528  N  N     . GLN C 3 24  ? -3.458  3.064   29.566 1.00 54.01  ? 24   GLN C N     1 
ATOM   1529  C  CA    . GLN C 3 24  ? -2.178  2.378   29.647 1.00 53.88  ? 24   GLN C CA    1 
ATOM   1530  C  C     . GLN C 3 24  ? -2.340  0.948   29.179 1.00 53.97  ? 24   GLN C C     1 
ATOM   1531  O  O     . GLN C 3 24  ? -1.467  0.403   28.518 1.00 54.10  ? 24   GLN C O     1 
ATOM   1532  C  CB    . GLN C 3 24  ? -1.677  2.374   31.091 1.00 53.98  ? 24   GLN C CB    1 
ATOM   1533  C  CG    . GLN C 3 24  ? -1.524  3.750   31.712 1.00 53.46  ? 24   GLN C CG    1 
ATOM   1534  C  CD    . GLN C 3 24  ? -0.640  4.651   30.875 1.00 52.63  ? 24   GLN C CD    1 
ATOM   1535  O  OE1   . GLN C 3 24  ? 0.483   4.285   30.513 1.00 51.34  ? 24   GLN C OE1   1 
ATOM   1536  N  NE2   . GLN C 3 24  ? -1.148  5.832   30.554 1.00 52.03  ? 24   GLN C NE2   1 
ATOM   1537  N  N     . PHE C 3 25  ? -3.474  0.353   29.528 1.00 54.00  ? 25   PHE C N     1 
ATOM   1538  C  CA    . PHE C 3 25  ? -3.766  -1.033  29.214 1.00 54.23  ? 25   PHE C CA    1 
ATOM   1539  C  C     . PHE C 3 25  ? -4.046  -1.238  27.730 1.00 54.50  ? 25   PHE C C     1 
ATOM   1540  O  O     . PHE C 3 25  ? -4.700  -0.405  27.110 1.00 54.85  ? 25   PHE C O     1 
ATOM   1541  C  CB    . PHE C 3 25  ? -4.939  -1.521  30.064 1.00 54.29  ? 25   PHE C CB    1 
ATOM   1542  C  CG    . PHE C 3 25  ? -4.521  -2.171  31.350 1.00 54.22  ? 25   PHE C CG    1 
ATOM   1543  C  CD1   . PHE C 3 25  ? -3.682  -1.519  32.241 1.00 54.09  ? 25   PHE C CD1   1 
ATOM   1544  C  CD2   . PHE C 3 25  ? -4.968  -3.446  31.669 1.00 54.95  ? 25   PHE C CD2   1 
ATOM   1545  C  CE1   . PHE C 3 25  ? -3.297  -2.126  33.423 1.00 54.46  ? 25   PHE C CE1   1 
ATOM   1546  C  CE2   . PHE C 3 25  ? -4.588  -4.064  32.855 1.00 53.57  ? 25   PHE C CE2   1 
ATOM   1547  C  CZ    . PHE C 3 25  ? -3.756  -3.409  33.727 1.00 53.98  ? 25   PHE C CZ    1 
ATOM   1548  N  N     . PRO C 3 26  ? -3.551  -2.357  27.160 1.00 54.53  ? 26   PRO C N     1 
ATOM   1549  C  CA    . PRO C 3 26  ? -3.572  -2.620  25.723 1.00 54.41  ? 26   PRO C CA    1 
ATOM   1550  C  C     . PRO C 3 26  ? -4.953  -2.955  25.182 1.00 54.41  ? 26   PRO C C     1 
ATOM   1551  O  O     . PRO C 3 26  ? -5.425  -4.082  25.351 1.00 54.31  ? 26   PRO C O     1 
ATOM   1552  C  CB    . PRO C 3 26  ? -2.640  -3.826  25.580 1.00 54.31  ? 26   PRO C CB    1 
ATOM   1553  C  CG    . PRO C 3 26  ? -2.760  -4.531  26.860 1.00 54.58  ? 26   PRO C CG    1 
ATOM   1554  C  CD    . PRO C 3 26  ? -2.932  -3.470  27.904 1.00 54.62  ? 26   PRO C CD    1 
ATOM   1555  N  N     . VAL C 3 27  ? -5.584  -1.980  24.527 1.00 54.47  ? 27   VAL C N     1 
ATOM   1556  C  CA    . VAL C 3 27  ? -6.915  -2.159  23.926 1.00 54.19  ? 27   VAL C CA    1 
ATOM   1557  C  C     . VAL C 3 27  ? -6.869  -3.169  22.786 1.00 54.41  ? 27   VAL C C     1 
ATOM   1558  O  O     . VAL C 3 27  ? -7.807  -3.942  22.593 1.00 54.15  ? 27   VAL C O     1 
ATOM   1559  C  CB    . VAL C 3 27  ? -7.494  -0.817  23.422 1.00 54.15  ? 27   VAL C CB    1 
ATOM   1560  C  CG1   . VAL C 3 27  ? -8.757  -1.034  22.589 1.00 53.85  ? 27   VAL C CG1   1 
ATOM   1561  C  CG2   . VAL C 3 27  ? -7.793  0.098   24.595 1.00 53.84  ? 27   VAL C CG2   1 
ATOM   1562  N  N     . GLY C 3 28  ? -5.770  -3.163  22.035 1.00 54.66  ? 28   GLY C N     1 
ATOM   1563  C  CA    . GLY C 3 28  ? -5.595  -4.120  20.951 1.00 54.85  ? 28   GLY C CA    1 
ATOM   1564  C  C     . GLY C 3 28  ? -5.639  -5.539  21.478 1.00 54.79  ? 28   GLY C C     1 
ATOM   1565  O  O     . GLY C 3 28  ? -6.416  -6.364  21.008 1.00 54.76  ? 28   GLY C O     1 
ATOM   1566  N  N     . ARG C 3 29  ? -4.805  -5.799  22.477 1.00 55.07  ? 29   ARG C N     1 
ATOM   1567  C  CA    . ARG C 3 29  ? -4.694  -7.102  23.122 1.00 55.18  ? 29   ARG C CA    1 
ATOM   1568  C  C     . ARG C 3 29  ? -6.048  -7.570  23.646 1.00 55.54  ? 29   ARG C C     1 
ATOM   1569  O  O     . ARG C 3 29  ? -6.445  -8.708  23.416 1.00 55.66  ? 29   ARG C O     1 
ATOM   1570  C  CB    . ARG C 3 29  ? -3.701  -7.011  24.280 1.00 54.94  ? 29   ARG C CB    1 
ATOM   1571  C  CG    . ARG C 3 29  ? -3.383  -8.328  24.949 1.00 54.99  ? 29   ARG C CG    1 
ATOM   1572  C  CD    . ARG C 3 29  ? -1.933  -8.672  24.737 1.00 55.30  ? 29   ARG C CD    1 
ATOM   1573  N  NE    . ARG C 3 29  ? -1.178  -8.544  25.971 1.00 54.74  ? 29   ARG C NE    1 
ATOM   1574  C  CZ    . ARG C 3 29  ? 0.147   -8.620  26.054 1.00 55.55  ? 29   ARG C CZ    1 
ATOM   1575  N  NH1   . ARG C 3 29  ? 0.879   -8.798  24.968 1.00 55.67  ? 29   ARG C NH1   1 
ATOM   1576  N  NH2   . ARG C 3 29  ? 0.746   -8.505  27.232 1.00 57.09  ? 29   ARG C NH2   1 
ATOM   1577  N  N     . VAL C 3 30  ? -6.752  -6.685  24.342 1.00 55.75  ? 30   VAL C N     1 
ATOM   1578  C  CA    . VAL C 3 30  ? -8.050  -7.014  24.909 1.00 56.20  ? 30   VAL C CA    1 
ATOM   1579  C  C     . VAL C 3 30  ? -9.095  -7.326  23.824 1.00 57.12  ? 30   VAL C C     1 
ATOM   1580  O  O     . VAL C 3 30  ? -9.920  -8.229  23.999 1.00 57.34  ? 30   VAL C O     1 
ATOM   1581  C  CB    . VAL C 3 30  ? -8.546  -5.904  25.859 1.00 55.98  ? 30   VAL C CB    1 
ATOM   1582  C  CG1   . VAL C 3 30  ? -9.967  -6.174  26.328 1.00 55.69  ? 30   VAL C CG1   1 
ATOM   1583  C  CG2   . VAL C 3 30  ? -7.612  -5.770  27.045 1.00 54.83  ? 30   VAL C CG2   1 
ATOM   1584  N  N     . HIS C 3 31  ? -9.057  -6.596  22.709 1.00 57.91  ? 31   HIS C N     1 
ATOM   1585  C  CA    . HIS C 3 31  ? -9.973  -6.865  21.598 1.00 58.41  ? 31   HIS C CA    1 
ATOM   1586  C  C     . HIS C 3 31  ? -9.739  -8.273  21.110 1.00 58.60  ? 31   HIS C C     1 
ATOM   1587  O  O     . HIS C 3 31  ? -10.682 -8.999  20.815 1.00 58.70  ? 31   HIS C O     1 
ATOM   1588  C  CB    . HIS C 3 31  ? -9.753  -5.904  20.426 1.00 58.51  ? 31   HIS C CB    1 
ATOM   1589  C  CG    . HIS C 3 31  ? -10.949 -5.751  19.536 1.00 58.82  ? 31   HIS C CG    1 
ATOM   1590  N  ND1   . HIS C 3 31  ? -11.987 -6.658  19.517 1.00 59.31  ? 31   HIS C ND1   1 
ATOM   1591  C  CD2   . HIS C 3 31  ? -11.265 -4.801  18.623 1.00 59.41  ? 31   HIS C CD2   1 
ATOM   1592  C  CE1   . HIS C 3 31  ? -12.903 -6.259  18.651 1.00 59.30  ? 31   HIS C CE1   1 
ATOM   1593  N  NE2   . HIS C 3 31  ? -12.484 -5.140  18.087 1.00 59.57  ? 31   HIS C NE2   1 
ATOM   1594  N  N     . ARG C 3 32  ? -8.465  -8.643  21.041 1.00 58.83  ? 32   ARG C N     1 
ATOM   1595  C  CA    . ARG C 3 32  ? -8.048  -9.906  20.472 1.00 59.07  ? 32   ARG C CA    1 
ATOM   1596  C  C     . ARG C 3 32  ? -8.479  -11.063 21.350 1.00 59.14  ? 32   ARG C C     1 
ATOM   1597  O  O     . ARG C 3 32  ? -9.019  -12.060 20.861 1.00 59.78  ? 32   ARG C O     1 
ATOM   1598  C  CB    . ARG C 3 32  ? -6.538  -9.927  20.309 1.00 59.08  ? 32   ARG C CB    1 
ATOM   1599  C  CG    . ARG C 3 32  ? -6.072  -10.964 19.328 1.00 60.36  ? 32   ARG C CG    1 
ATOM   1600  C  CD    . ARG C 3 32  ? -4.570  -11.000 19.249 1.00 61.79  ? 32   ARG C CD    1 
ATOM   1601  N  NE    . ARG C 3 32  ? -4.003  -11.731 20.371 1.00 61.53  ? 32   ARG C NE    1 
ATOM   1602  C  CZ    . ARG C 3 32  ? -3.122  -11.232 21.230 1.00 62.82  ? 32   ARG C CZ    1 
ATOM   1603  N  NH1   . ARG C 3 32  ? -2.682  -9.986  21.113 1.00 64.52  ? 32   ARG C NH1   1 
ATOM   1604  N  NH2   . ARG C 3 32  ? -2.670  -11.990 22.208 1.00 63.10  ? 32   ARG C NH2   1 
ATOM   1605  N  N     . LEU C 3 33  ? -8.241  -10.919 22.648 1.00 58.81  ? 33   LEU C N     1 
ATOM   1606  C  CA    . LEU C 3 33  ? -8.604  -11.935 23.613 1.00 58.44  ? 33   LEU C CA    1 
ATOM   1607  C  C     . LEU C 3 33  ? -10.112 -12.164 23.669 1.00 58.81  ? 33   LEU C C     1 
ATOM   1608  O  O     . LEU C 3 33  ? -10.545 -13.278 23.936 1.00 59.19  ? 33   LEU C O     1 
ATOM   1609  C  CB    . LEU C 3 33  ? -8.060  -11.595 24.998 1.00 57.97  ? 33   LEU C CB    1 
ATOM   1610  C  CG    . LEU C 3 33  ? -6.542  -11.550 25.191 1.00 57.30  ? 33   LEU C CG    1 
ATOM   1611  C  CD1   . LEU C 3 33  ? -6.209  -10.890 26.518 1.00 57.51  ? 33   LEU C CD1   1 
ATOM   1612  C  CD2   . LEU C 3 33  ? -5.901  -12.917 25.112 1.00 55.08  ? 33   LEU C CD2   1 
ATOM   1613  N  N     . LEU C 3 34  ? -10.908 -11.128 23.409 1.00 58.84  ? 34   LEU C N     1 
ATOM   1614  C  CA    . LEU C 3 34  ? -12.359 -11.298 23.366 1.00 59.16  ? 34   LEU C CA    1 
ATOM   1615  C  C     . LEU C 3 34  ? -12.813 -12.176 22.188 1.00 59.85  ? 34   LEU C C     1 
ATOM   1616  O  O     . LEU C 3 34  ? -13.774 -12.945 22.316 1.00 59.72  ? 34   LEU C O     1 
ATOM   1617  C  CB    . LEU C 3 34  ? -13.085 -9.947  23.356 1.00 58.72  ? 34   LEU C CB    1 
ATOM   1618  C  CG    . LEU C 3 34  ? -13.215 -9.155  24.669 1.00 58.03  ? 34   LEU C CG    1 
ATOM   1619  C  CD1   . LEU C 3 34  ? -13.897 -7.807  24.438 1.00 57.11  ? 34   LEU C CD1   1 
ATOM   1620  C  CD2   . LEU C 3 34  ? -13.947 -9.915  25.759 1.00 56.28  ? 34   LEU C CD2   1 
ATOM   1621  N  N     . ARG C 3 35  ? -12.114 -12.057 21.056 1.00 60.60  ? 35   ARG C N     1 
ATOM   1622  C  CA    . ARG C 3 35  ? -12.389 -12.864 19.865 1.00 61.48  ? 35   ARG C CA    1 
ATOM   1623  C  C     . ARG C 3 35  ? -12.035 -14.326 20.108 1.00 61.71  ? 35   ARG C C     1 
ATOM   1624  O  O     . ARG C 3 35  ? -12.882 -15.209 19.986 1.00 61.69  ? 35   ARG C O     1 
ATOM   1625  C  CB    . ARG C 3 35  ? -11.594 -12.349 18.659 1.00 61.72  ? 35   ARG C CB    1 
ATOM   1626  C  CG    . ARG C 3 35  ? -11.806 -10.882 18.326 1.00 62.77  ? 35   ARG C CG    1 
ATOM   1627  C  CD    . ARG C 3 35  ? -11.403 -10.585 16.891 1.00 63.89  ? 35   ARG C CD    1 
ATOM   1628  N  NE    . ARG C 3 35  ? -11.584 -9.172  16.554 1.00 66.57  ? 35   ARG C NE    1 
ATOM   1629  C  CZ    . ARG C 3 35  ? -12.758 -8.579  16.325 1.00 67.58  ? 35   ARG C CZ    1 
ATOM   1630  N  NH1   . ARG C 3 35  ? -13.901 -9.253  16.406 1.00 67.99  ? 35   ARG C NH1   1 
ATOM   1631  N  NH2   . ARG C 3 35  ? -12.792 -7.291  16.015 1.00 68.68  ? 35   ARG C NH2   1 
ATOM   1632  N  N     . LYS C 3 36  ? -10.774 -14.553 20.467 1.00 62.29  ? 36   LYS C N     1 
ATOM   1633  C  CA    . LYS C 3 36  ? -10.214 -15.882 20.696 1.00 62.85  ? 36   LYS C CA    1 
ATOM   1634  C  C     . LYS C 3 36  ? -10.934 -16.614 21.836 1.00 62.79  ? 36   LYS C C     1 
ATOM   1635  O  O     . LYS C 3 36  ? -10.891 -17.844 21.938 1.00 62.84  ? 36   LYS C O     1 
ATOM   1636  C  CB    . LYS C 3 36  ? -8.718  -15.740 21.012 1.00 63.16  ? 36   LYS C CB    1 
ATOM   1637  C  CG    . LYS C 3 36  ? -7.934  -17.048 21.153 1.00 64.67  ? 36   LYS C CG    1 
ATOM   1638  C  CD    . LYS C 3 36  ? -6.429  -16.794 21.343 1.00 66.72  ? 36   LYS C CD    1 
ATOM   1639  C  CE    . LYS C 3 36  ? -6.090  -16.300 22.757 1.00 67.69  ? 36   LYS C CE    1 
ATOM   1640  N  NZ    . LYS C 3 36  ? -6.447  -17.294 23.824 1.00 67.41  ? 36   LYS C NZ    1 
ATOM   1641  N  N     . GLY C 3 37  ? -11.607 -15.848 22.683 1.00 62.50  ? 37   GLY C N     1 
ATOM   1642  C  CA    . GLY C 3 37  ? -12.198 -16.396 23.890 1.00 61.87  ? 37   GLY C CA    1 
ATOM   1643  C  C     . GLY C 3 37  ? -13.575 -16.994 23.714 1.00 61.56  ? 37   GLY C C     1 
ATOM   1644  O  O     . GLY C 3 37  ? -14.116 -17.568 24.662 1.00 61.67  ? 37   GLY C O     1 
ATOM   1645  N  N     . ASN C 3 38  ? -14.142 -16.866 22.514 1.00 61.07  ? 38   ASN C N     1 
ATOM   1646  C  CA    . ASN C 3 38  ? -15.455 -17.442 22.196 1.00 60.88  ? 38   ASN C CA    1 
ATOM   1647  C  C     . ASN C 3 38  ? -16.539 -16.981 23.161 1.00 60.36  ? 38   ASN C C     1 
ATOM   1648  O  O     . ASN C 3 38  ? -17.136 -17.789 23.888 1.00 60.41  ? 38   ASN C O     1 
ATOM   1649  C  CB    . ASN C 3 38  ? -15.400 -18.978 22.179 1.00 61.29  ? 38   ASN C CB    1 
ATOM   1650  C  CG    . ASN C 3 38  ? -14.499 -19.516 21.077 1.00 62.53  ? 38   ASN C CG    1 
ATOM   1651  O  OD1   . ASN C 3 38  ? -13.431 -20.082 21.354 1.00 62.86  ? 38   ASN C OD1   1 
ATOM   1652  N  ND2   . ASN C 3 38  ? -14.921 -19.336 19.818 1.00 62.88  ? 38   ASN C ND2   1 
ATOM   1653  N  N     . TYR C 3 39  ? -16.795 -15.679 23.166 1.00 59.36  ? 39   TYR C N     1 
ATOM   1654  C  CA    . TYR C 3 39  ? -17.782 -15.128 24.069 1.00 58.46  ? 39   TYR C CA    1 
ATOM   1655  C  C     . TYR C 3 39  ? -19.081 -14.799 23.355 1.00 58.81  ? 39   TYR C C     1 
ATOM   1656  O  O     . TYR C 3 39  ? -20.149 -14.891 23.956 1.00 58.74  ? 39   TYR C O     1 
ATOM   1657  C  CB    . TYR C 3 39  ? -17.221 -13.914 24.802 1.00 57.96  ? 39   TYR C CB    1 
ATOM   1658  C  CG    . TYR C 3 39  ? -16.045 -14.238 25.697 1.00 55.49  ? 39   TYR C CG    1 
ATOM   1659  C  CD1   . TYR C 3 39  ? -14.759 -13.834 25.358 1.00 53.27  ? 39   TYR C CD1   1 
ATOM   1660  C  CD2   . TYR C 3 39  ? -16.220 -14.954 26.878 1.00 53.36  ? 39   TYR C CD2   1 
ATOM   1661  C  CE1   . TYR C 3 39  ? -13.683 -14.132 26.168 1.00 52.45  ? 39   TYR C CE1   1 
ATOM   1662  C  CE2   . TYR C 3 39  ? -15.144 -15.255 27.699 1.00 51.50  ? 39   TYR C CE2   1 
ATOM   1663  C  CZ    . TYR C 3 39  ? -13.884 -14.842 27.331 1.00 51.67  ? 39   TYR C CZ    1 
ATOM   1664  O  OH    . TYR C 3 39  ? -12.811 -15.120 28.126 1.00 51.81  ? 39   TYR C OH    1 
ATOM   1665  N  N     . ALA C 3 40  ? -18.984 -14.419 22.080 1.00 59.07  ? 40   ALA C N     1 
ATOM   1666  C  CA    . ALA C 3 40  ? -20.146 -14.183 21.222 1.00 59.41  ? 40   ALA C CA    1 
ATOM   1667  C  C     . ALA C 3 40  ? -19.678 -14.179 19.780 1.00 59.85  ? 40   ALA C C     1 
ATOM   1668  O  O     . ALA C 3 40  ? -18.477 -14.252 19.525 1.00 59.77  ? 40   ALA C O     1 
ATOM   1669  C  CB    . ALA C 3 40  ? -20.819 -12.870 21.571 1.00 59.30  ? 40   ALA C CB    1 
ATOM   1670  N  N     . GLU C 3 41  ? -20.613 -14.120 18.833 1.00 60.64  ? 41   GLU C N     1 
ATOM   1671  C  CA    . GLU C 3 41  ? -20.238 -14.046 17.415 1.00 61.35  ? 41   GLU C CA    1 
ATOM   1672  C  C     . GLU C 3 41  ? -19.382 -12.806 17.167 1.00 61.03  ? 41   GLU C C     1 
ATOM   1673  O  O     . GLU C 3 41  ? -18.291 -12.894 16.596 1.00 60.80  ? 41   GLU C O     1 
ATOM   1674  C  CB    . GLU C 3 41  ? -21.473 -14.017 16.502 1.00 61.84  ? 41   GLU C CB    1 
ATOM   1675  C  CG    . GLU C 3 41  ? -22.293 -15.299 16.485 1.00 64.76  ? 41   GLU C CG    1 
ATOM   1676  C  CD    . GLU C 3 41  ? -21.456 -16.511 16.123 1.00 68.76  ? 41   GLU C CD    1 
ATOM   1677  O  OE1   . GLU C 3 41  ? -20.831 -16.494 15.037 1.00 70.29  ? 41   GLU C OE1   1 
ATOM   1678  O  OE2   . GLU C 3 41  ? -21.424 -17.476 16.926 1.00 70.13  ? 41   GLU C OE2   1 
ATOM   1679  N  N     . ARG C 3 42  ? -19.878 -11.661 17.633 1.00 60.71  ? 42   ARG C N     1 
ATOM   1680  C  CA    . ARG C 3 42  ? -19.269 -10.382 17.320 1.00 60.62  ? 42   ARG C CA    1 
ATOM   1681  C  C     . ARG C 3 42  ? -18.784 -9.663  18.567 1.00 59.85  ? 42   ARG C C     1 
ATOM   1682  O  O     . ARG C 3 42  ? -19.382 -9.782  19.640 1.00 59.87  ? 42   ARG C O     1 
ATOM   1683  C  CB    . ARG C 3 42  ? -20.272 -9.496  16.575 1.00 61.17  ? 42   ARG C CB    1 
ATOM   1684  C  CG    . ARG C 3 42  ? -20.767 -10.074 15.267 1.00 62.86  ? 42   ARG C CG    1 
ATOM   1685  C  CD    . ARG C 3 42  ? -21.550 -9.065  14.462 1.00 66.14  ? 42   ARG C CD    1 
ATOM   1686  N  NE    . ARG C 3 42  ? -21.555 -9.464  13.059 1.00 69.35  ? 42   ARG C NE    1 
ATOM   1687  C  CZ    . ARG C 3 42  ? -22.033 -8.733  12.057 1.00 71.38  ? 42   ARG C CZ    1 
ATOM   1688  N  NH1   . ARG C 3 42  ? -22.569 -7.533  12.284 1.00 71.75  ? 42   ARG C NH1   1 
ATOM   1689  N  NH2   . ARG C 3 42  ? -21.978 -9.215  10.820 1.00 72.08  ? 42   ARG C NH2   1 
ATOM   1690  N  N     . VAL C 3 43  ? -17.703 -8.909  18.409 1.00 58.94  ? 43   VAL C N     1 
ATOM   1691  C  CA    . VAL C 3 43  ? -17.249 -7.982  19.438 1.00 58.05  ? 43   VAL C CA    1 
ATOM   1692  C  C     . VAL C 3 43  ? -17.358 -6.553  18.924 1.00 57.18  ? 43   VAL C C     1 
ATOM   1693  O  O     . VAL C 3 43  ? -16.726 -6.187  17.933 1.00 57.12  ? 43   VAL C O     1 
ATOM   1694  C  CB    . VAL C 3 43  ? -15.801 -8.269  19.878 1.00 58.16  ? 43   VAL C CB    1 
ATOM   1695  C  CG1   . VAL C 3 43  ? -15.425 -7.407  21.059 1.00 57.81  ? 43   VAL C CG1   1 
ATOM   1696  C  CG2   . VAL C 3 43  ? -15.639 -9.735  20.242 1.00 58.39  ? 43   VAL C CG2   1 
ATOM   1697  N  N     . GLY C 3 44  ? -18.180 -5.759  19.599 1.00 56.47  ? 44   GLY C N     1 
ATOM   1698  C  CA    . GLY C 3 44  ? -18.268 -4.324  19.343 1.00 55.53  ? 44   GLY C CA    1 
ATOM   1699  C  C     . GLY C 3 44  ? -16.966 -3.612  19.654 1.00 54.69  ? 44   GLY C C     1 
ATOM   1700  O  O     . GLY C 3 44  ? -16.224 -4.026  20.543 1.00 54.50  ? 44   GLY C O     1 
ATOM   1701  N  N     . ALA C 3 45  ? -16.703 -2.544  18.906 1.00 54.17  ? 45   ALA C N     1 
ATOM   1702  C  CA    . ALA C 3 45  ? -15.463 -1.766  18.989 1.00 53.55  ? 45   ALA C CA    1 
ATOM   1703  C  C     . ALA C 3 45  ? -15.230 -1.092  20.345 1.00 52.88  ? 45   ALA C C     1 
ATOM   1704  O  O     . ALA C 3 45  ? -14.092 -0.937  20.762 1.00 52.94  ? 45   ALA C O     1 
ATOM   1705  C  CB    . ALA C 3 45  ? -15.425 -0.720  17.861 1.00 53.89  ? 45   ALA C CB    1 
ATOM   1706  N  N     . GLY C 3 46  ? -16.302 -0.692  21.019 1.00 52.22  ? 46   GLY C N     1 
ATOM   1707  C  CA    . GLY C 3 46  ? -16.191 -0.051  22.323 1.00 51.82  ? 46   GLY C CA    1 
ATOM   1708  C  C     . GLY C 3 46  ? -15.972 -1.031  23.472 1.00 51.53  ? 46   GLY C C     1 
ATOM   1709  O  O     . GLY C 3 46  ? -15.471 -0.648  24.538 1.00 51.93  ? 46   GLY C O     1 
ATOM   1710  N  N     . ALA C 3 47  ? -16.343 -2.290  23.263 1.00 50.56  ? 47   ALA C N     1 
ATOM   1711  C  CA    . ALA C 3 47  ? -16.195 -3.326  24.288 1.00 49.75  ? 47   ALA C CA    1 
ATOM   1712  C  C     . ALA C 3 47  ? -14.771 -3.487  24.839 1.00 48.93  ? 47   ALA C C     1 
ATOM   1713  O  O     . ALA C 3 47  ? -14.584 -3.429  26.045 1.00 48.92  ? 47   ALA C O     1 
ATOM   1714  C  CB    . ALA C 3 47  ? -16.740 -4.669  23.795 1.00 50.05  ? 47   ALA C CB    1 
ATOM   1715  N  N     . PRO C 3 48  ? -13.762 -3.670  23.969 1.00 48.27  ? 48   PRO C N     1 
ATOM   1716  C  CA    . PRO C 3 48  ? -12.409 -3.764  24.529 1.00 47.73  ? 48   PRO C CA    1 
ATOM   1717  C  C     . PRO C 3 48  ? -11.909 -2.454  25.140 1.00 47.44  ? 48   PRO C C     1 
ATOM   1718  O  O     . PRO C 3 48  ? -11.028 -2.473  26.000 1.00 47.30  ? 48   PRO C O     1 
ATOM   1719  C  CB    . PRO C 3 48  ? -11.548 -4.136  23.324 1.00 47.78  ? 48   PRO C CB    1 
ATOM   1720  C  CG    . PRO C 3 48  ? -12.327 -3.678  22.137 1.00 48.31  ? 48   PRO C CG    1 
ATOM   1721  C  CD    . PRO C 3 48  ? -13.768 -3.822  22.503 1.00 48.26  ? 48   PRO C CD    1 
ATOM   1722  N  N     . VAL C 3 49  ? -12.465 -1.325  24.705 1.00 46.90  ? 49   VAL C N     1 
ATOM   1723  C  CA    . VAL C 3 49  ? -12.083 -0.048  25.280 1.00 46.04  ? 49   VAL C CA    1 
ATOM   1724  C  C     . VAL C 3 49  ? -12.593 0.001   26.717 1.00 45.69  ? 49   VAL C C     1 
ATOM   1725  O  O     . VAL C 3 49  ? -11.804 0.191   27.638 1.00 46.03  ? 49   VAL C O     1 
ATOM   1726  C  CB    . VAL C 3 49  ? -12.573 1.157   24.414 1.00 46.39  ? 49   VAL C CB    1 
ATOM   1727  C  CG1   . VAL C 3 49  ? -12.395 2.476   25.148 1.00 45.74  ? 49   VAL C CG1   1 
ATOM   1728  C  CG2   . VAL C 3 49  ? -11.832 1.199   23.076 1.00 45.73  ? 49   VAL C CG2   1 
ATOM   1729  N  N     . TYR C 3 50  ? -13.896 -0.199  26.906 1.00 44.73  ? 50   TYR C N     1 
ATOM   1730  C  CA    . TYR C 3 50  ? -14.512 -0.177  28.231 1.00 44.11  ? 50   TYR C CA    1 
ATOM   1731  C  C     . TYR C 3 50  ? -13.872 -1.218  29.143 1.00 44.41  ? 50   TYR C C     1 
ATOM   1732  O  O     . TYR C 3 50  ? -13.512 -0.924  30.287 1.00 45.03  ? 50   TYR C O     1 
ATOM   1733  C  CB    . TYR C 3 50  ? -15.995 -0.487  28.096 1.00 43.99  ? 50   TYR C CB    1 
ATOM   1734  C  CG    . TYR C 3 50  ? -16.900 -0.030  29.215 1.00 42.13  ? 50   TYR C CG    1 
ATOM   1735  C  CD1   . TYR C 3 50  ? -17.988 0.798   28.944 1.00 42.62  ? 50   TYR C CD1   1 
ATOM   1736  C  CD2   . TYR C 3 50  ? -16.710 -0.452  30.526 1.00 41.10  ? 50   TYR C CD2   1 
ATOM   1737  C  CE1   . TYR C 3 50  ? -18.859 1.214   29.948 1.00 41.33  ? 50   TYR C CE1   1 
ATOM   1738  C  CE2   . TYR C 3 50  ? -17.578 -0.046  31.543 1.00 41.31  ? 50   TYR C CE2   1 
ATOM   1739  C  CZ    . TYR C 3 50  ? -18.651 0.789   31.240 1.00 42.43  ? 50   TYR C CZ    1 
ATOM   1740  O  OH    . TYR C 3 50  ? -19.518 1.209   32.227 1.00 45.12  ? 50   TYR C OH    1 
ATOM   1741  N  N     . LEU C 3 51  ? -13.726 -2.436  28.636 1.00 43.87  ? 51   LEU C N     1 
ATOM   1742  C  CA    . LEU C 3 51  ? -13.114 -3.503  29.415 1.00 43.52  ? 51   LEU C CA    1 
ATOM   1743  C  C     . LEU C 3 51  ? -11.688 -3.191  29.864 1.00 43.24  ? 51   LEU C C     1 
ATOM   1744  O  O     . LEU C 3 51  ? -11.358 -3.372  31.041 1.00 43.23  ? 51   LEU C O     1 
ATOM   1745  C  CB    . LEU C 3 51  ? -13.162 -4.839  28.662 1.00 43.69  ? 51   LEU C CB    1 
ATOM   1746  C  CG    . LEU C 3 51  ? -12.622 -6.091  29.373 1.00 43.66  ? 51   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C 3 51  ? -13.175 -6.259  30.775 1.00 41.64  ? 51   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C 3 51  ? -12.904 -7.333  28.550 1.00 43.36  ? 51   LEU C CD2   1 
ATOM   1749  N  N     . ALA C 3 52  ? -10.848 -2.727  28.941 1.00 42.89  ? 52   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3 52  ? -9.461  -2.371  29.284 1.00 42.29  ? 52   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3 52  ? -9.386  -1.278  30.340 1.00 42.00  ? 52   ALA C C     1 
ATOM   1752  O  O     . ALA C 3 52  ? -8.447  -1.254  31.134 1.00 42.71  ? 52   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3 52  ? -8.682  -1.971  28.065 1.00 41.92  ? 52   ALA C CB    1 
ATOM   1754  N  N     . ALA C 3 53  ? -10.374 -0.393  30.369 1.00 41.26  ? 53   ALA C N     1 
ATOM   1755  C  CA    . ALA C 3 53  ? -10.382 0.676   31.364 1.00 41.07  ? 53   ALA C CA    1 
ATOM   1756  C  C     . ALA C 3 53  ? -10.771 0.159   32.739 1.00 40.77  ? 53   ALA C C     1 
ATOM   1757  O  O     . ALA C 3 53  ? -10.159 0.539   33.738 1.00 41.23  ? 53   ALA C O     1 
ATOM   1758  C  CB    . ALA C 3 53  ? -11.310 1.825   30.941 1.00 40.89  ? 53   ALA C CB    1 
ATOM   1759  N  N     . VAL C 3 54  ? -11.806 -0.680  32.795 1.00 40.36  ? 54   VAL C N     1 
ATOM   1760  C  CA    . VAL C 3 54  ? -12.187 -1.320  34.053 1.00 39.73  ? 54   VAL C CA    1 
ATOM   1761  C  C     . VAL C 3 54  ? -10.989 -2.096  34.616 1.00 39.74  ? 54   VAL C C     1 
ATOM   1762  O  O     . VAL C 3 54  ? -10.673 -1.990  35.809 1.00 39.28  ? 54   VAL C O     1 
ATOM   1763  C  CB    . VAL C 3 54  ? -13.419 -2.232  33.896 1.00 39.70  ? 54   VAL C CB    1 
ATOM   1764  C  CG1   . VAL C 3 54  ? -13.697 -2.993  35.183 1.00 38.31  ? 54   VAL C CG1   1 
ATOM   1765  C  CG2   . VAL C 3 54  ? -14.632 -1.416  33.492 1.00 38.99  ? 54   VAL C CG2   1 
ATOM   1766  N  N     . LEU C 3 55  ? -10.306 -2.832  33.741 1.00 39.99  ? 55   LEU C N     1 
ATOM   1767  C  CA    . LEU C 3 55  ? -9.135  -3.613  34.138 1.00 40.52  ? 55   LEU C CA    1 
ATOM   1768  C  C     . LEU C 3 55  ? -8.057  -2.736  34.714 1.00 40.84  ? 55   LEU C C     1 
ATOM   1769  O  O     . LEU C 3 55  ? -7.510  -3.053  35.755 1.00 40.87  ? 55   LEU C O     1 
ATOM   1770  C  CB    . LEU C 3 55  ? -8.578  -4.423  32.969 1.00 40.49  ? 55   LEU C CB    1 
ATOM   1771  C  CG    . LEU C 3 55  ? -9.513  -5.530  32.461 1.00 40.48  ? 55   LEU C CG    1 
ATOM   1772  C  CD1   . LEU C 3 55  ? -8.955  -6.166  31.208 1.00 40.58  ? 55   LEU C CD1   1 
ATOM   1773  C  CD2   . LEU C 3 55  ? -9.785  -6.575  33.516 1.00 38.33  ? 55   LEU C CD2   1 
ATOM   1774  N  N     . GLU C 3 56  ? -7.778  -1.622  34.037 1.00 41.69  ? 56   GLU C N     1 
ATOM   1775  C  CA    . GLU C 3 56  ? -6.776  -0.646  34.471 1.00 41.78  ? 56   GLU C CA    1 
ATOM   1776  C  C     . GLU C 3 56  ? -7.187  0.025   35.776 1.00 41.56  ? 56   GLU C C     1 
ATOM   1777  O  O     . GLU C 3 56  ? -6.366  0.169   36.676 1.00 41.67  ? 56   GLU C O     1 
ATOM   1778  C  CB    . GLU C 3 56  ? -6.575  0.406   33.381 1.00 42.09  ? 56   GLU C CB    1 
ATOM   1779  C  CG    . GLU C 3 56  ? -5.431  1.373   33.625 1.00 43.32  ? 56   GLU C CG    1 
ATOM   1780  C  CD    . GLU C 3 56  ? -5.236  2.312   32.461 1.00 45.73  ? 56   GLU C CD    1 
ATOM   1781  O  OE1   . GLU C 3 56  ? -5.018  1.803   31.333 1.00 46.91  ? 56   GLU C OE1   1 
ATOM   1782  O  OE2   . GLU C 3 56  ? -5.304  3.549   32.669 1.00 45.61  ? 56   GLU C OE2   1 
ATOM   1783  N  N     . TYR C 3 57  ? -8.447  0.444   35.875 1.00 41.27  ? 57   TYR C N     1 
ATOM   1784  C  CA    . TYR C 3 57  ? -8.934  1.040   37.116 1.00 41.37  ? 57   TYR C CA    1 
ATOM   1785  C  C     . TYR C 3 57  ? -8.681  0.075   38.273 1.00 41.44  ? 57   TYR C C     1 
ATOM   1786  O  O     . TYR C 3 57  ? -8.066  0.462   39.267 1.00 42.25  ? 57   TYR C O     1 
ATOM   1787  C  CB    . TYR C 3 57  ? -10.421 1.407   37.029 1.00 41.38  ? 57   TYR C CB    1 
ATOM   1788  C  CG    . TYR C 3 57  ? -11.091 1.587   38.377 1.00 42.30  ? 57   TYR C CG    1 
ATOM   1789  C  CD1   . TYR C 3 57  ? -10.885 2.742   39.135 1.00 44.08  ? 57   TYR C CD1   1 
ATOM   1790  C  CD2   . TYR C 3 57  ? -11.936 0.604   38.893 1.00 43.02  ? 57   TYR C CD2   1 
ATOM   1791  C  CE1   . TYR C 3 57  ? -11.504 2.907   40.389 1.00 44.85  ? 57   TYR C CE1   1 
ATOM   1792  C  CE2   . TYR C 3 57  ? -12.564 0.756   40.132 1.00 43.15  ? 57   TYR C CE2   1 
ATOM   1793  C  CZ    . TYR C 3 57  ? -12.342 1.897   40.883 1.00 44.73  ? 57   TYR C CZ    1 
ATOM   1794  O  OH    . TYR C 3 57  ? -12.961 2.043   42.118 1.00 44.32  ? 57   TYR C OH    1 
ATOM   1795  N  N     . LEU C 3 58  ? -9.116  -1.181  38.128 1.00 40.48  ? 58   LEU C N     1 
ATOM   1796  C  CA    . LEU C 3 58  ? -9.023  -2.144  39.226 1.00 39.40  ? 58   LEU C CA    1 
ATOM   1797  C  C     . LEU C 3 58  ? -7.595  -2.355  39.693 1.00 39.20  ? 58   LEU C C     1 
ATOM   1798  O  O     . LEU C 3 58  ? -7.328  -2.416  40.906 1.00 39.61  ? 58   LEU C O     1 
ATOM   1799  C  CB    . LEU C 3 58  ? -9.674  -3.481  38.864 1.00 39.04  ? 58   LEU C CB    1 
ATOM   1800  C  CG    . LEU C 3 58  ? -11.203 -3.473  38.943 1.00 37.71  ? 58   LEU C CG    1 
ATOM   1801  C  CD1   . LEU C 3 58  ? -11.782 -4.795  38.480 1.00 36.25  ? 58   LEU C CD1   1 
ATOM   1802  C  CD2   . LEU C 3 58  ? -11.674 -3.150  40.344 1.00 36.43  ? 58   LEU C CD2   1 
ATOM   1803  N  N     . THR C 3 59  ? -6.668  -2.444  38.750 1.00 38.18  ? 59   THR C N     1 
ATOM   1804  C  CA    . THR C 3 59  ? -5.289  -2.650  39.136 1.00 37.36  ? 59   THR C CA    1 
ATOM   1805  C  C     . THR C 3 59  ? -4.654  -1.402  39.753 1.00 37.66  ? 59   THR C C     1 
ATOM   1806  O  O     . THR C 3 59  ? -3.744  -1.507  40.592 1.00 38.21  ? 59   THR C O     1 
ATOM   1807  C  CB    . THR C 3 59  ? -4.445  -3.318  38.023 1.00 37.47  ? 59   THR C CB    1 
ATOM   1808  O  OG1   . THR C 3 59  ? -3.309  -2.507  37.710 1.00 37.12  ? 59   THR C OG1   1 
ATOM   1809  C  CG2   . THR C 3 59  ? -5.257  -3.574  36.787 1.00 35.00  ? 59   THR C CG2   1 
ATOM   1810  N  N     . ALA C 3 60  ? -5.158  -0.220  39.400 1.00 37.11  ? 60   ALA C N     1 
ATOM   1811  C  CA    . ALA C 3 60  ? -4.708  1.002   40.086 1.00 36.79  ? 60   ALA C CA    1 
ATOM   1812  C  C     . ALA C 3 60  ? -5.178  1.002   41.532 1.00 36.70  ? 60   ALA C C     1 
ATOM   1813  O  O     . ALA C 3 60  ? -4.408  1.291   42.456 1.00 36.90  ? 60   ALA C O     1 
ATOM   1814  C  CB    . ALA C 3 60  ? -5.173  2.253   39.360 1.00 36.71  ? 60   ALA C CB    1 
ATOM   1815  N  N     . GLU C 3 61  ? -6.435  0.627   41.732 1.00 36.66  ? 61   GLU C N     1 
ATOM   1816  C  CA    . GLU C 3 61  ? -6.986  0.509   43.078 1.00 37.20  ? 61   GLU C CA    1 
ATOM   1817  C  C     . GLU C 3 61  ? -6.146  -0.411  43.981 1.00 36.90  ? 61   GLU C C     1 
ATOM   1818  O  O     . GLU C 3 61  ? -5.837  -0.059  45.121 1.00 36.93  ? 61   GLU C O     1 
ATOM   1819  C  CB    . GLU C 3 61  ? -8.438  0.057   42.996 1.00 37.16  ? 61   GLU C CB    1 
ATOM   1820  C  CG    . GLU C 3 61  ? -9.210  0.125   44.298 1.00 40.51  ? 61   GLU C CG    1 
ATOM   1821  C  CD    . GLU C 3 61  ? -9.507  1.547   44.804 1.00 46.17  ? 61   GLU C CD    1 
ATOM   1822  O  OE1   . GLU C 3 61  ? -9.553  2.517   43.988 1.00 46.97  ? 61   GLU C OE1   1 
ATOM   1823  O  OE2   . GLU C 3 61  ? -9.711  1.674   46.045 1.00 47.98  ? 61   GLU C OE2   1 
ATOM   1824  N  N     . ILE C 3 62  ? -5.745  -1.569  43.468 1.00 36.56  ? 62   ILE C N     1 
ATOM   1825  C  CA    . ILE C 3 62  ? -5.021  -2.528  44.307 1.00 36.65  ? 62   ILE C CA    1 
ATOM   1826  C  C     . ILE C 3 62  ? -3.562  -2.099  44.547 1.00 35.87  ? 62   ILE C C     1 
ATOM   1827  O  O     . ILE C 3 62  ? -3.055  -2.242  45.656 1.00 35.34  ? 62   ILE C O     1 
ATOM   1828  C  CB    . ILE C 3 62  ? -5.146  -3.978  43.756 1.00 36.61  ? 62   ILE C CB    1 
ATOM   1829  C  CG1   . ILE C 3 62  ? -4.539  -5.000  44.693 1.00 37.83  ? 62   ILE C CG1   1 
ATOM   1830  C  CG2   . ILE C 3 62  ? -4.446  -4.115  42.443 1.00 38.15  ? 62   ILE C CG2   1 
ATOM   1831  C  CD1   . ILE C 3 62  ? -5.050  -6.450  44.402 1.00 41.96  ? 62   ILE C CD1   1 
ATOM   1832  N  N     . LEU C 3 63  ? -2.900  -1.566  43.516 1.00 35.43  ? 63   LEU C N     1 
ATOM   1833  C  CA    . LEU C 3 63  ? -1.514  -1.110  43.663 1.00 35.04  ? 63   LEU C CA    1 
ATOM   1834  C  C     . LEU C 3 63  ? -1.410  0.121   44.559 1.00 35.28  ? 63   LEU C C     1 
ATOM   1835  O  O     . LEU C 3 63  ? -0.431  0.288   45.264 1.00 35.10  ? 63   LEU C O     1 
ATOM   1836  C  CB    . LEU C 3 63  ? -0.866  -0.840  42.312 1.00 35.20  ? 63   LEU C CB    1 
ATOM   1837  C  CG    . LEU C 3 63  ? -0.648  -2.011  41.351 1.00 34.73  ? 63   LEU C CG    1 
ATOM   1838  C  CD1   . LEU C 3 63  ? -0.455  -1.504  39.936 1.00 33.90  ? 63   LEU C CD1   1 
ATOM   1839  C  CD2   . LEU C 3 63  ? 0.522   -2.876  41.799 1.00 34.23  ? 63   LEU C CD2   1 
ATOM   1840  N  N     . GLU C 3 64  ? -2.437  0.966   44.555 1.00 35.98  ? 64   GLU C N     1 
ATOM   1841  C  CA    . GLU C 3 64  ? -2.497  2.067   45.487 1.00 37.19  ? 64   GLU C CA    1 
ATOM   1842  C  C     . GLU C 3 64  ? -2.434  1.554   46.909 1.00 37.65  ? 64   GLU C C     1 
ATOM   1843  O  O     . GLU C 3 64  ? -1.494  1.878   47.648 1.00 38.24  ? 64   GLU C O     1 
ATOM   1844  C  CB    . GLU C 3 64  ? -3.762  2.888   45.267 1.00 37.50  ? 64   GLU C CB    1 
ATOM   1845  C  CG    . GLU C 3 64  ? -3.999  4.002   46.297 1.00 40.26  ? 64   GLU C CG    1 
ATOM   1846  C  CD    . GLU C 3 64  ? -2.959  5.131   46.277 1.00 42.29  ? 64   GLU C CD    1 
ATOM   1847  O  OE1   . GLU C 3 64  ? -3.076  6.063   47.105 1.00 45.27  ? 64   GLU C OE1   1 
ATOM   1848  O  OE2   . GLU C 3 64  ? -2.027  5.094   45.462 1.00 42.60  ? 64   GLU C OE2   1 
ATOM   1849  N  N     . LEU C 3 65  ? -3.421  0.724   47.272 1.00 37.72  ? 65   LEU C N     1 
ATOM   1850  C  CA    . LEU C 3 65  ? -3.544  0.151   48.618 1.00 36.89  ? 65   LEU C CA    1 
ATOM   1851  C  C     . LEU C 3 65  ? -2.339  -0.700  49.018 1.00 37.01  ? 65   LEU C C     1 
ATOM   1852  O  O     . LEU C 3 65  ? -1.884  -0.640  50.164 1.00 36.98  ? 65   LEU C O     1 
ATOM   1853  C  CB    . LEU C 3 65  ? -4.834  -0.665  48.723 1.00 36.65  ? 65   LEU C CB    1 
ATOM   1854  C  CG    . LEU C 3 65  ? -6.134  0.132   48.663 1.00 35.67  ? 65   LEU C CG    1 
ATOM   1855  C  CD1   . LEU C 3 65  ? -7.359  -0.787  48.552 1.00 33.23  ? 65   LEU C CD1   1 
ATOM   1856  C  CD2   . LEU C 3 65  ? -6.234  1.064   49.891 1.00 32.39  ? 65   LEU C CD2   1 
ATOM   1857  N  N     . ALA C 3 66  ? -1.823  -1.483  48.076 1.00 37.23  ? 66   ALA C N     1 
ATOM   1858  C  CA    . ALA C 3 66  ? -0.719  -2.411  48.361 1.00 37.78  ? 66   ALA C CA    1 
ATOM   1859  C  C     . ALA C 3 66  ? 0.583   -1.639  48.590 1.00 38.20  ? 66   ALA C C     1 
ATOM   1860  O  O     . ALA C 3 66  ? 1.382   -1.964  49.483 1.00 37.39  ? 66   ALA C O     1 
ATOM   1861  C  CB    . ALA C 3 66  ? -0.566  -3.416  47.224 1.00 37.29  ? 66   ALA C CB    1 
ATOM   1862  N  N     . GLY C 3 67  ? 0.774   -0.603  47.779 1.00 38.88  ? 67   GLY C N     1 
ATOM   1863  C  CA    . GLY C 3 67  ? 1.863   0.339   47.976 1.00 39.88  ? 67   GLY C CA    1 
ATOM   1864  C  C     . GLY C 3 67  ? 1.833   0.943   49.368 1.00 40.67  ? 67   GLY C C     1 
ATOM   1865  O  O     . GLY C 3 67  ? 2.886   1.132   49.993 1.00 40.86  ? 67   GLY C O     1 
ATOM   1866  N  N     . ASN C 3 68  ? 0.641   1.246   49.869 1.00 41.02  ? 68   ASN C N     1 
ATOM   1867  C  CA    . ASN C 3 68  ? 0.557   1.794   51.204 1.00 42.25  ? 68   ASN C CA    1 
ATOM   1868  C  C     . ASN C 3 68  ? 1.000   0.802   52.241 1.00 43.05  ? 68   ASN C C     1 
ATOM   1869  O  O     . ASN C 3 68  ? 1.695   1.171   53.189 1.00 43.65  ? 68   ASN C O     1 
ATOM   1870  C  CB    . ASN C 3 68  ? -0.838  2.309   51.520 1.00 42.34  ? 68   ASN C CB    1 
ATOM   1871  C  CG    . ASN C 3 68  ? -1.206  3.508   50.696 1.00 42.90  ? 68   ASN C CG    1 
ATOM   1872  O  OD1   . ASN C 3 68  ? -0.344  4.162   50.087 1.00 43.85  ? 68   ASN C OD1   1 
ATOM   1873  N  ND2   . ASN C 3 68  ? -2.496  3.816   50.671 1.00 44.26  ? 68   ASN C ND2   1 
ATOM   1874  N  N     . ALA C 3 69  ? 0.624   -0.463  52.055 1.00 43.83  ? 69   ALA C N     1 
ATOM   1875  C  CA    . ALA C 3 69  ? 1.014   -1.498  53.003 1.00 44.50  ? 69   ALA C CA    1 
ATOM   1876  C  C     . ALA C 3 69  ? 2.516   -1.684  52.986 1.00 45.26  ? 69   ALA C C     1 
ATOM   1877  O  O     . ALA C 3 69  ? 3.123   -1.891  54.025 1.00 45.91  ? 69   ALA C O     1 
ATOM   1878  C  CB    . ALA C 3 69  ? 0.310   -2.798  52.719 1.00 44.40  ? 69   ALA C CB    1 
ATOM   1879  N  N     . ALA C 3 70  ? 3.115   -1.589  51.809 1.00 46.29  ? 70   ALA C N     1 
ATOM   1880  C  CA    . ALA C 3 70  ? 4.560   -1.670  51.689 1.00 47.67  ? 70   ALA C CA    1 
ATOM   1881  C  C     . ALA C 3 70  ? 5.244   -0.539  52.461 1.00 48.90  ? 70   ALA C C     1 
ATOM   1882  O  O     . ALA C 3 70  ? 6.197   -0.786  53.201 1.00 49.53  ? 70   ALA C O     1 
ATOM   1883  C  CB    . ALA C 3 70  ? 4.972   -1.650  50.245 1.00 47.38  ? 70   ALA C CB    1 
ATOM   1884  N  N     . ARG C 3 71  ? 4.751   0.687   52.300 1.00 50.08  ? 71   ARG C N     1 
ATOM   1885  C  CA    . ARG C 3 71  ? 5.280   1.832   53.036 1.00 51.53  ? 71   ARG C CA    1 
ATOM   1886  C  C     . ARG C 3 71  ? 5.097   1.663   54.531 1.00 51.99  ? 71   ARG C C     1 
ATOM   1887  O  O     . ARG C 3 71  ? 6.044   1.862   55.280 1.00 52.06  ? 71   ARG C O     1 
ATOM   1888  C  CB    . ARG C 3 71  ? 4.643   3.155   52.577 1.00 51.88  ? 71   ARG C CB    1 
ATOM   1889  C  CG    . ARG C 3 71  ? 4.965   4.349   53.508 1.00 54.64  ? 71   ARG C CG    1 
ATOM   1890  C  CD    . ARG C 3 71  ? 4.642   5.715   52.922 1.00 59.05  ? 71   ARG C CD    1 
ATOM   1891  N  NE    . ARG C 3 71  ? 5.404   5.971   51.698 1.00 63.74  ? 71   ARG C NE    1 
ATOM   1892  C  CZ    . ARG C 3 71  ? 5.353   7.094   50.979 1.00 65.36  ? 71   ARG C CZ    1 
ATOM   1893  N  NH1   . ARG C 3 71  ? 4.572   8.109   51.348 1.00 65.74  ? 71   ARG C NH1   1 
ATOM   1894  N  NH2   . ARG C 3 71  ? 6.087   7.196   49.874 1.00 66.40  ? 71   ARG C NH2   1 
ATOM   1895  N  N     . ASP C 3 72  ? 3.884   1.295   54.952 1.00 52.83  ? 72   ASP C N     1 
ATOM   1896  C  CA    . ASP C 3 72  ? 3.563   1.057   56.363 1.00 53.70  ? 72   ASP C CA    1 
ATOM   1897  C  C     . ASP C 3 72  ? 4.554   0.076   56.997 1.00 54.34  ? 72   ASP C C     1 
ATOM   1898  O  O     . ASP C 3 72  ? 4.762   0.085   58.211 1.00 54.45  ? 72   ASP C O     1 
ATOM   1899  C  CB    . ASP C 3 72  ? 2.153   0.469   56.502 1.00 53.70  ? 72   ASP C CB    1 
ATOM   1900  C  CG    . ASP C 3 72  ? 1.046   1.481   56.248 1.00 54.75  ? 72   ASP C CG    1 
ATOM   1901  O  OD1   . ASP C 3 72  ? 1.251   2.707   56.414 1.00 55.41  ? 72   ASP C OD1   1 
ATOM   1902  O  OD2   . ASP C 3 72  ? -0.064  1.030   55.889 1.00 56.16  ? 72   ASP C OD2   1 
ATOM   1903  N  N     . ASN C 3 73  ? 5.139   -0.771  56.152 1.00 55.01  ? 73   ASN C N     1 
ATOM   1904  C  CA    . ASN C 3 73  ? 6.074   -1.811  56.555 1.00 55.69  ? 73   ASN C CA    1 
ATOM   1905  C  C     . ASN C 3 73  ? 7.516   -1.421  56.299 1.00 55.48  ? 73   ASN C C     1 
ATOM   1906  O  O     . ASN C 3 73  ? 8.411   -2.276  56.306 1.00 55.44  ? 73   ASN C O     1 
ATOM   1907  C  CB    . ASN C 3 73  ? 5.781   -3.090  55.778 1.00 56.33  ? 73   ASN C CB    1 
ATOM   1908  C  CG    . ASN C 3 73  ? 5.076   -4.113  56.607 1.00 58.27  ? 73   ASN C CG    1 
ATOM   1909  O  OD1   . ASN C 3 73  ? 5.703   -4.785  57.426 1.00 61.54  ? 73   ASN C OD1   1 
ATOM   1910  N  ND2   . ASN C 3 73  ? 3.761   -4.246  56.411 1.00 59.60  ? 73   ASN C ND2   1 
ATOM   1911  N  N     . LYS C 3 74  ? 7.736   -0.134  56.056 1.00 55.17  ? 74   LYS C N     1 
ATOM   1912  C  CA    . LYS C 3 74  ? 9.070   0.377   55.742 1.00 55.20  ? 74   LYS C CA    1 
ATOM   1913  C  C     . LYS C 3 74  ? 9.762   -0.430  54.632 1.00 54.41  ? 74   LYS C C     1 
ATOM   1914  O  O     . LYS C 3 74  ? 10.967  -0.697  54.703 1.00 54.28  ? 74   LYS C O     1 
ATOM   1915  C  CB    . LYS C 3 74  ? 9.922   0.444   57.021 1.00 55.75  ? 74   LYS C CB    1 
ATOM   1916  C  CG    . LYS C 3 74  ? 9.488   1.564   57.976 1.00 57.66  ? 74   LYS C CG    1 
ATOM   1917  C  CD    . LYS C 3 74  ? 9.616   1.170   59.440 1.00 60.59  ? 74   LYS C CD    1 
ATOM   1918  C  CE    . LYS C 3 74  ? 8.717   2.065   60.288 1.00 62.61  ? 74   LYS C CE    1 
ATOM   1919  N  NZ    . LYS C 3 74  ? 8.749   1.693   61.730 1.00 64.72  ? 74   LYS C NZ    1 
ATOM   1920  N  N     . LYS C 3 75  ? 8.981   -0.819  53.620 1.00 53.41  ? 75   LYS C N     1 
ATOM   1921  C  CA    . LYS C 3 75  ? 9.493   -1.560  52.457 1.00 52.80  ? 75   LYS C CA    1 
ATOM   1922  C  C     . LYS C 3 75  ? 9.267   -0.776  51.178 1.00 51.96  ? 75   LYS C C     1 
ATOM   1923  O  O     . LYS C 3 75  ? 8.325   0.017   51.080 1.00 52.26  ? 75   LYS C O     1 
ATOM   1924  C  CB    . LYS C 3 75  ? 8.838   -2.948  52.308 1.00 53.00  ? 75   LYS C CB    1 
ATOM   1925  C  CG    . LYS C 3 75  ? 8.972   -3.891  53.504 1.00 52.80  ? 75   LYS C CG    1 
ATOM   1926  C  CD    . LYS C 3 75  ? 10.346  -4.535  53.586 1.00 52.70  ? 75   LYS C CD    1 
ATOM   1927  C  CE    . LYS C 3 75  ? 10.414  -5.571  54.713 1.00 52.32  ? 75   LYS C CE    1 
ATOM   1928  N  NZ    . LYS C 3 75  ? 10.144  -5.009  56.063 1.00 52.39  ? 75   LYS C NZ    1 
ATOM   1929  N  N     . THR C 3 76  ? 10.129  -1.020  50.200 1.00 50.66  ? 76   THR C N     1 
ATOM   1930  C  CA    . THR C 3 76  ? 10.134  -0.291  48.942 1.00 49.68  ? 76   THR C CA    1 
ATOM   1931  C  C     . THR C 3 76  ? 9.556   -1.157  47.830 1.00 49.18  ? 76   THR C C     1 
ATOM   1932  O  O     . THR C 3 76  ? 9.100   -0.647  46.794 1.00 49.47  ? 76   THR C O     1 
ATOM   1933  C  CB    . THR C 3 76  ? 11.575  0.164   48.597 1.00 49.92  ? 76   THR C CB    1 
ATOM   1934  O  OG1   . THR C 3 76  ? 11.748  1.529   49.001 1.00 51.04  ? 76   THR C OG1   1 
ATOM   1935  C  CG2   . THR C 3 76  ? 11.900  0.018   47.102 1.00 49.49  ? 76   THR C CG2   1 
ATOM   1936  N  N     . ARG C 3 77  ? 9.581   -2.468  48.045 1.00 47.63  ? 77   ARG C N     1 
ATOM   1937  C  CA    . ARG C 3 77  ? 9.089   -3.406  47.058 1.00 46.27  ? 77   ARG C CA    1 
ATOM   1938  C  C     . ARG C 3 77  ? 7.812   -4.112  47.516 1.00 44.69  ? 77   ARG C C     1 
ATOM   1939  O  O     . ARG C 3 77  ? 7.781   -4.710  48.590 1.00 44.98  ? 77   ARG C O     1 
ATOM   1940  C  CB    . ARG C 3 77  ? 10.167  -4.437  46.757 1.00 46.84  ? 77   ARG C CB    1 
ATOM   1941  C  CG    . ARG C 3 77  ? 9.848   -5.292  45.552 1.00 48.13  ? 77   ARG C CG    1 
ATOM   1942  C  CD    . ARG C 3 77  ? 10.919  -6.316  45.323 1.00 49.25  ? 77   ARG C CD    1 
ATOM   1943  N  NE    . ARG C 3 77  ? 12.123  -5.701  44.782 1.00 52.72  ? 77   ARG C NE    1 
ATOM   1944  C  CZ    . ARG C 3 77  ? 13.333  -5.810  45.326 1.00 54.25  ? 77   ARG C CZ    1 
ATOM   1945  N  NH1   . ARG C 3 77  ? 13.514  -6.532  46.431 1.00 55.64  ? 77   ARG C NH1   1 
ATOM   1946  N  NH2   . ARG C 3 77  ? 14.371  -5.222  44.747 1.00 53.87  ? 77   ARG C NH2   1 
ATOM   1947  N  N     . ILE C 3 78  ? 6.775   -4.039  46.687 1.00 42.40  ? 78   ILE C N     1 
ATOM   1948  C  CA    . ILE C 3 78  ? 5.516   -4.723  46.930 1.00 40.65  ? 78   ILE C CA    1 
ATOM   1949  C  C     . ILE C 3 78  ? 5.717   -6.239  46.817 1.00 40.33  ? 78   ILE C C     1 
ATOM   1950  O  O     . ILE C 3 78  ? 6.169   -6.753  45.779 1.00 40.85  ? 78   ILE C O     1 
ATOM   1951  C  CB    . ILE C 3 78  ? 4.439   -4.250  45.929 1.00 40.22  ? 78   ILE C CB    1 
ATOM   1952  C  CG1   . ILE C 3 78  ? 3.908   -2.875  46.342 1.00 39.50  ? 78   ILE C CG1   1 
ATOM   1953  C  CG2   . ILE C 3 78  ? 3.293   -5.228  45.845 1.00 39.40  ? 78   ILE C CG2   1 
ATOM   1954  C  CD1   . ILE C 3 78  ? 3.178   -2.143  45.243 1.00 37.72  ? 78   ILE C CD1   1 
ATOM   1955  N  N     . ILE C 3 79  ? 5.420   -6.952  47.892 1.00 38.93  ? 79   ILE C N     1 
ATOM   1956  C  CA    . ILE C 3 79  ? 5.487   -8.418  47.861 1.00 37.87  ? 79   ILE C CA    1 
ATOM   1957  C  C     . ILE C 3 79  ? 4.084   -8.972  48.060 1.00 37.46  ? 79   ILE C C     1 
ATOM   1958  O  O     . ILE C 3 79  ? 3.155   -8.199  48.343 1.00 38.07  ? 79   ILE C O     1 
ATOM   1959  C  CB    . ILE C 3 79  ? 6.474   -9.004  48.906 1.00 37.11  ? 79   ILE C CB    1 
ATOM   1960  C  CG1   . ILE C 3 79  ? 5.979   -8.726  50.339 1.00 35.74  ? 79   ILE C CG1   1 
ATOM   1961  C  CG2   . ILE C 3 79  ? 7.874   -8.496  48.617 1.00 36.40  ? 79   ILE C CG2   1 
ATOM   1962  C  CD1   . ILE C 3 79  ? 6.813   -9.352  51.451 1.00 33.12  ? 79   ILE C CD1   1 
ATOM   1963  N  N     . PRO C 3 80  ? 3.912   -10.301 47.909 1.00 36.35  ? 80   PRO C N     1 
ATOM   1964  C  CA    . PRO C 3 80  ? 2.571   -10.863 48.041 1.00 35.26  ? 80   PRO C CA    1 
ATOM   1965  C  C     . PRO C 3 80  ? 1.910   -10.579 49.382 1.00 34.55  ? 80   PRO C C     1 
ATOM   1966  O  O     . PRO C 3 80  ? 0.701   -10.393 49.415 1.00 34.81  ? 80   PRO C O     1 
ATOM   1967  C  CB    . PRO C 3 80  ? 2.802   -12.350 47.818 1.00 35.53  ? 80   PRO C CB    1 
ATOM   1968  C  CG    . PRO C 3 80  ? 3.963   -12.383 46.878 1.00 35.27  ? 80   PRO C CG    1 
ATOM   1969  C  CD    . PRO C 3 80  ? 4.863   -11.294 47.384 1.00 36.03  ? 80   PRO C CD    1 
ATOM   1970  N  N     . ARG C 3 81  ? 2.661   -10.490 50.477 1.00 33.98  ? 81   ARG C N     1 
ATOM   1971  C  CA    . ARG C 3 81  ? 2.012   -10.091 51.744 1.00 33.79  ? 81   ARG C CA    1 
ATOM   1972  C  C     . ARG C 3 81  ? 1.300   -8.734  51.636 1.00 33.46  ? 81   ARG C C     1 
ATOM   1973  O  O     . ARG C 3 81  ? 0.237   -8.522  52.246 1.00 33.56  ? 81   ARG C O     1 
ATOM   1974  C  CB    . ARG C 3 81  ? 2.941   -10.161 52.975 1.00 33.11  ? 81   ARG C CB    1 
ATOM   1975  C  CG    . ARG C 3 81  ? 2.490   -9.217  54.076 1.00 34.71  ? 81   ARG C CG    1 
ATOM   1976  C  CD    . ARG C 3 81  ? 2.235   -9.822  55.454 1.00 36.61  ? 81   ARG C CD    1 
ATOM   1977  N  NE    . ARG C 3 81  ? 1.007   -10.614 55.478 1.00 38.99  ? 81   ARG C NE    1 
ATOM   1978  C  CZ    . ARG C 3 81  ? 0.316   -10.946 56.572 1.00 38.07  ? 81   ARG C CZ    1 
ATOM   1979  N  NH1   . ARG C 3 81  ? 0.700   -10.553 57.778 1.00 35.76  ? 81   ARG C NH1   1 
ATOM   1980  N  NH2   . ARG C 3 81  ? -0.775  -11.687 56.449 1.00 37.23  ? 81   ARG C NH2   1 
ATOM   1981  N  N     . HIS C 3 82  ? 1.866   -7.827  50.842 1.00 33.01  ? 82   HIS C N     1 
ATOM   1982  C  CA    . HIS C 3 82  ? 1.307   -6.474  50.732 1.00 32.59  ? 82   HIS C CA    1 
ATOM   1983  C  C     . HIS C 3 82  ? 0.011   -6.461  49.953 1.00 32.41  ? 82   HIS C C     1 
ATOM   1984  O  O     . HIS C 3 82  ? -0.925  -5.752  50.323 1.00 32.58  ? 82   HIS C O     1 
ATOM   1985  C  CB    . HIS C 3 82  ? 2.310   -5.485  50.150 1.00 32.04  ? 82   HIS C CB    1 
ATOM   1986  C  CG    . HIS C 3 82  ? 3.594   -5.434  50.901 1.00 30.36  ? 82   HIS C CG    1 
ATOM   1987  N  ND1   . HIS C 3 82  ? 4.819   -5.348  50.273 1.00 31.40  ? 82   HIS C ND1   1 
ATOM   1988  C  CD2   . HIS C 3 82  ? 3.852   -5.494  52.228 1.00 30.02  ? 82   HIS C CD2   1 
ATOM   1989  C  CE1   . HIS C 3 82  ? 5.778   -5.335  51.182 1.00 30.61  ? 82   HIS C CE1   1 
ATOM   1990  N  NE2   . HIS C 3 82  ? 5.217   -5.424  52.379 1.00 30.81  ? 82   HIS C NE2   1 
ATOM   1991  N  N     . LEU C 3 83  ? -0.052  -7.260  48.894 1.00 32.12  ? 83   LEU C N     1 
ATOM   1992  C  CA    . LEU C 3 83  ? -1.312  -7.468  48.172 1.00 32.27  ? 83   LEU C CA    1 
ATOM   1993  C  C     . LEU C 3 83  ? -2.404  -8.076  49.074 1.00 32.66  ? 83   LEU C C     1 
ATOM   1994  O  O     . LEU C 3 83  ? -3.583  -7.689  48.998 1.00 32.45  ? 83   LEU C O     1 
ATOM   1995  C  CB    . LEU C 3 83  ? -1.089  -8.344  46.947 1.00 32.00  ? 83   LEU C CB    1 
ATOM   1996  C  CG    . LEU C 3 83  ? -0.121  -7.768  45.903 1.00 32.92  ? 83   LEU C CG    1 
ATOM   1997  C  CD1   . LEU C 3 83  ? 0.177   -8.777  44.785 1.00 30.02  ? 83   LEU C CD1   1 
ATOM   1998  C  CD2   . LEU C 3 83  ? -0.653  -6.431  45.329 1.00 33.37  ? 83   LEU C CD2   1 
ATOM   1999  N  N     . GLN C 3 84  ? -2.009  -9.003  49.947 1.00 32.49  ? 84   GLN C N     1 
ATOM   2000  C  CA    . GLN C 3 84  ? -2.987  -9.628  50.813 1.00 32.78  ? 84   GLN C CA    1 
ATOM   2001  C  C     . GLN C 3 84  ? -3.547  -8.608  51.803 1.00 33.10  ? 84   GLN C C     1 
ATOM   2002  O  O     . GLN C 3 84  ? -4.772  -8.494  51.974 1.00 32.84  ? 84   GLN C O     1 
ATOM   2003  C  CB    . GLN C 3 84  ? -2.395  -10.864 51.497 1.00 32.53  ? 84   GLN C CB    1 
ATOM   2004  C  CG    . GLN C 3 84  ? -3.220  -11.446 52.619 1.00 32.25  ? 84   GLN C CG    1 
ATOM   2005  C  CD    . GLN C 3 84  ? -4.425  -12.302 52.160 1.00 32.75  ? 84   GLN C CD    1 
ATOM   2006  O  OE1   . GLN C 3 84  ? -5.006  -12.097 51.080 1.00 31.47  ? 84   GLN C OE1   1 
ATOM   2007  N  NE2   . GLN C 3 84  ? -4.812  -13.247 53.005 1.00 29.32  ? 84   GLN C NE2   1 
ATOM   2008  N  N     . LEU C 3 85  ? -2.658  -7.847  52.434 1.00 33.82  ? 85   LEU C N     1 
ATOM   2009  C  CA    . LEU C 3 85  ? -3.088  -6.853  53.410 1.00 34.44  ? 85   LEU C CA    1 
ATOM   2010  C  C     . LEU C 3 85  ? -4.009  -5.832  52.749 1.00 34.93  ? 85   LEU C C     1 
ATOM   2011  O  O     . LEU C 3 85  ? -5.061  -5.482  53.294 1.00 35.42  ? 85   LEU C O     1 
ATOM   2012  C  CB    . LEU C 3 85  ? -1.889  -6.144  54.037 1.00 34.91  ? 85   LEU C CB    1 
ATOM   2013  C  CG    . LEU C 3 85  ? -0.971  -6.943  54.958 1.00 34.35  ? 85   LEU C CG    1 
ATOM   2014  C  CD1   . LEU C 3 85  ? 0.296   -6.147  55.205 1.00 32.34  ? 85   LEU C CD1   1 
ATOM   2015  C  CD2   . LEU C 3 85  ? -1.677  -7.300  56.255 1.00 34.18  ? 85   LEU C CD2   1 
ATOM   2016  N  N     . ALA C 3 86  ? -3.624  -5.386  51.555 1.00 34.75  ? 86   ALA C N     1 
ATOM   2017  C  CA    . ALA C 3 86  ? -4.440  -4.473  50.766 1.00 34.47  ? 86   ALA C CA    1 
ATOM   2018  C  C     . ALA C 3 86  ? -5.834  -5.003  50.480 1.00 34.57  ? 86   ALA C C     1 
ATOM   2019  O  O     . ALA C 3 86  ? -6.817  -4.284  50.645 1.00 34.94  ? 86   ALA C O     1 
ATOM   2020  C  CB    . ALA C 3 86  ? -3.739  -4.129  49.468 1.00 34.77  ? 86   ALA C CB    1 
ATOM   2021  N  N     . VAL C 3 87  ? -5.924  -6.253  50.035 1.00 34.86  ? 87   VAL C N     1 
ATOM   2022  C  CA    . VAL C 3 87  ? -7.207  -6.845  49.662 1.00 34.69  ? 87   VAL C CA    1 
ATOM   2023  C  C     . VAL C 3 87  ? -8.078  -7.139  50.878 1.00 35.04  ? 87   VAL C C     1 
ATOM   2024  O  O     . VAL C 3 87  ? -9.254  -6.799  50.894 1.00 35.10  ? 87   VAL C O     1 
ATOM   2025  C  CB    . VAL C 3 87  ? -7.014  -8.105  48.805 1.00 34.68  ? 87   VAL C CB    1 
ATOM   2026  C  CG1   . VAL C 3 87  ? -8.337  -8.809  48.552 1.00 34.69  ? 87   VAL C CG1   1 
ATOM   2027  C  CG2   . VAL C 3 87  ? -6.383  -7.736  47.494 1.00 34.98  ? 87   VAL C CG2   1 
ATOM   2028  N  N     . ARG C 3 88  ? -7.501  -7.750  51.907 1.00 35.55  ? 88   ARG C N     1 
ATOM   2029  C  CA    . ARG C 3 88  ? -8.310  -8.169  53.041 1.00 35.71  ? 88   ARG C CA    1 
ATOM   2030  C  C     . ARG C 3 88  ? -8.724  -7.018  53.932 1.00 36.32  ? 88   ARG C C     1 
ATOM   2031  O  O     . ARG C 3 88  ? -9.732  -7.119  54.621 1.00 36.49  ? 88   ARG C O     1 
ATOM   2032  C  CB    . ARG C 3 88  ? -7.596  -9.244  53.856 1.00 35.71  ? 88   ARG C CB    1 
ATOM   2033  C  CG    . ARG C 3 88  ? -7.207  -10.489 53.056 1.00 33.99  ? 88   ARG C CG    1 
ATOM   2034  C  CD    . ARG C 3 88  ? -8.385  -11.083 52.311 1.00 29.07  ? 88   ARG C CD    1 
ATOM   2035  N  NE    . ARG C 3 88  ? -7.968  -11.862 51.147 1.00 24.10  ? 88   ARG C NE    1 
ATOM   2036  C  CZ    . ARG C 3 88  ? -8.808  -12.286 50.212 1.00 23.66  ? 88   ARG C CZ    1 
ATOM   2037  N  NH1   . ARG C 3 88  ? -10.103 -11.987 50.310 1.00 23.90  ? 88   ARG C NH1   1 
ATOM   2038  N  NH2   . ARG C 3 88  ? -8.369  -13.011 49.184 1.00 22.40  ? 88   ARG C NH2   1 
ATOM   2039  N  N     . ASN C 3 89  ? -7.951  -5.932  53.922 1.00 37.32  ? 89   ASN C N     1 
ATOM   2040  C  CA    . ASN C 3 89  ? -8.301  -4.741  54.711 1.00 38.50  ? 89   ASN C CA    1 
ATOM   2041  C  C     . ASN C 3 89  ? -9.361  -3.850  54.056 1.00 39.02  ? 89   ASN C C     1 
ATOM   2042  O  O     . ASN C 3 89  ? -9.891  -2.962  54.700 1.00 39.32  ? 89   ASN C O     1 
ATOM   2043  C  CB    . ASN C 3 89  ? -7.057  -3.930  55.099 1.00 38.58  ? 89   ASN C CB    1 
ATOM   2044  C  CG    . ASN C 3 89  ? -6.284  -4.564  56.250 1.00 39.13  ? 89   ASN C CG    1 
ATOM   2045  O  OD1   . ASN C 3 89  ? -6.864  -4.928  57.266 1.00 40.89  ? 89   ASN C OD1   1 
ATOM   2046  N  ND2   . ASN C 3 89  ? -4.976  -4.705  56.089 1.00 39.98  ? 89   ASN C ND2   1 
ATOM   2047  N  N     . ASP C 3 90  ? -9.676  -4.116  52.787 1.00 40.14  ? 90   ASP C N     1 
ATOM   2048  C  CA    . ASP C 3 90  ? -10.649 -3.336  52.016 1.00 40.73  ? 90   ASP C CA    1 
ATOM   2049  C  C     . ASP C 3 90  ? -11.921 -4.132  51.754 1.00 41.36  ? 90   ASP C C     1 
ATOM   2050  O  O     . ASP C 3 90  ? -11.896 -5.120  51.018 1.00 41.87  ? 90   ASP C O     1 
ATOM   2051  C  CB    . ASP C 3 90  ? -10.054 -2.934  50.677 1.00 40.93  ? 90   ASP C CB    1 
ATOM   2052  C  CG    . ASP C 3 90  ? -10.974 -2.032  49.888 1.00 42.12  ? 90   ASP C CG    1 
ATOM   2053  O  OD1   . ASP C 3 90  ? -10.986 -0.827  50.194 1.00 45.85  ? 90   ASP C OD1   1 
ATOM   2054  O  OD2   . ASP C 3 90  ? -11.694 -2.510  48.984 1.00 42.44  ? 90   ASP C OD2   1 
ATOM   2055  N  N     . GLU C 3 91  ? -13.034 -3.681  52.327 1.00 41.65  ? 91   GLU C N     1 
ATOM   2056  C  CA    . GLU C 3 91  ? -14.291 -4.407  52.271 1.00 42.10  ? 91   GLU C CA    1 
ATOM   2057  C  C     . GLU C 3 91  ? -14.638 -4.945  50.891 1.00 41.55  ? 91   GLU C C     1 
ATOM   2058  O  O     . GLU C 3 91  ? -15.077 -6.089  50.765 1.00 41.73  ? 91   GLU C O     1 
ATOM   2059  C  CB    . GLU C 3 91  ? -15.431 -3.529  52.769 1.00 42.76  ? 91   GLU C CB    1 
ATOM   2060  C  CG    . GLU C 3 91  ? -15.947 -3.874  54.160 1.00 46.81  ? 91   GLU C CG    1 
ATOM   2061  C  CD    . GLU C 3 91  ? -17.312 -3.242  54.416 1.00 53.68  ? 91   GLU C CD    1 
ATOM   2062  O  OE1   . GLU C 3 91  ? -18.233 -3.448  53.578 1.00 54.21  ? 91   GLU C OE1   1 
ATOM   2063  O  OE2   . GLU C 3 91  ? -17.459 -2.532  55.449 1.00 57.08  ? 91   GLU C OE2   1 
ATOM   2064  N  N     . GLU C 3 92  ? -14.421 -4.127  49.868 1.00 40.97  ? 92   GLU C N     1 
ATOM   2065  C  CA    . GLU C 3 92  ? -14.938 -4.402  48.542 1.00 40.62  ? 92   GLU C CA    1 
ATOM   2066  C  C     . GLU C 3 92  ? -14.039 -5.326  47.729 1.00 39.92  ? 92   GLU C C     1 
ATOM   2067  O  O     . GLU C 3 92  ? -14.510 -6.250  47.060 1.00 39.42  ? 92   GLU C O     1 
ATOM   2068  C  CB    . GLU C 3 92  ? -15.297 -3.095  47.816 1.00 40.58  ? 92   GLU C CB    1 
ATOM   2069  C  CG    . GLU C 3 92  ? -16.640 -2.532  48.328 1.00 42.78  ? 92   GLU C CG    1 
ATOM   2070  C  CD    . GLU C 3 92  ? -17.172 -1.326  47.542 1.00 45.96  ? 92   GLU C CD    1 
ATOM   2071  O  OE1   . GLU C 3 92  ? -16.456 -0.835  46.644 1.00 45.62  ? 92   GLU C OE1   1 
ATOM   2072  O  OE2   . GLU C 3 92  ? -18.310 -0.867  47.837 1.00 46.98  ? 92   GLU C OE2   1 
ATOM   2073  N  N     . LEU C 3 93  ? -12.742 -5.070  47.801 1.00 39.26  ? 93   LEU C N     1 
ATOM   2074  C  CA    . LEU C 3 93  ? -11.772 -5.963  47.230 1.00 38.80  ? 93   LEU C CA    1 
ATOM   2075  C  C     . LEU C 3 93  ? -11.819 -7.324  47.917 1.00 39.07  ? 93   LEU C C     1 
ATOM   2076  O  O     . LEU C 3 93  ? -11.752 -8.363  47.249 1.00 39.28  ? 93   LEU C O     1 
ATOM   2077  C  CB    . LEU C 3 93  ? -10.388 -5.353  47.350 1.00 38.87  ? 93   LEU C CB    1 
ATOM   2078  C  CG    . LEU C 3 93  ? -10.077 -4.210  46.382 1.00 37.08  ? 93   LEU C CG    1 
ATOM   2079  C  CD1   . LEU C 3 93  ? -8.700  -3.686  46.690 1.00 37.17  ? 93   LEU C CD1   1 
ATOM   2080  C  CD2   . LEU C 3 93  ? -10.138 -4.651  44.933 1.00 35.28  ? 93   LEU C CD2   1 
ATOM   2081  N  N     . ASN C 3 94  ? -11.979 -7.319  49.242 1.00 38.90  ? 94   ASN C N     1 
ATOM   2082  C  CA    . ASN C 3 94  ? -12.184 -8.558  49.973 1.00 39.07  ? 94   ASN C CA    1 
ATOM   2083  C  C     . ASN C 3 94  ? -13.341 -9.422  49.446 1.00 39.21  ? 94   ASN C C     1 
ATOM   2084  O  O     . ASN C 3 94  ? -13.193 -10.645 49.292 1.00 39.68  ? 94   ASN C O     1 
ATOM   2085  C  CB    . ASN C 3 94  ? -12.344 -8.328  51.472 1.00 38.45  ? 94   ASN C CB    1 
ATOM   2086  C  CG    . ASN C 3 94  ? -12.359 -9.632  52.242 1.00 38.59  ? 94   ASN C CG    1 
ATOM   2087  O  OD1   . ASN C 3 94  ? -11.529 -10.507 51.998 1.00 42.28  ? 94   ASN C OD1   1 
ATOM   2088  N  ND2   . ASN C 3 94  ? -13.318 -9.792  53.133 1.00 36.82  ? 94   ASN C ND2   1 
ATOM   2089  N  N     . LYS C 3 95  ? -14.479 -8.790  49.195 1.00 39.01  ? 95   LYS C N     1 
ATOM   2090  C  CA    . LYS C 3 95  ? -15.644 -9.480  48.665 1.00 39.58  ? 95   LYS C CA    1 
ATOM   2091  C  C     . LYS C 3 95  ? -15.432 -9.900  47.214 1.00 38.77  ? 95   LYS C C     1 
ATOM   2092  O  O     . LYS C 3 95  ? -15.815 -10.988 46.816 1.00 39.18  ? 95   LYS C O     1 
ATOM   2093  C  CB    . LYS C 3 95  ? -16.880 -8.595  48.773 1.00 40.12  ? 95   LYS C CB    1 
ATOM   2094  C  CG    . LYS C 3 95  ? -18.149 -9.224  48.207 1.00 43.26  ? 95   LYS C CG    1 
ATOM   2095  C  CD    . LYS C 3 95  ? -19.355 -8.383  48.610 1.00 49.94  ? 95   LYS C CD    1 
ATOM   2096  C  CE    . LYS C 3 95  ? -20.545 -9.254  49.029 1.00 53.75  ? 95   LYS C CE    1 
ATOM   2097  N  NZ    . LYS C 3 95  ? -21.539 -8.476  49.853 1.00 56.21  ? 95   LYS C NZ    1 
ATOM   2098  N  N     . LEU C 3 96  ? -14.811 -9.036  46.429 1.00 38.08  ? 96   LEU C N     1 
ATOM   2099  C  CA    . LEU C 3 96  ? -14.537 -9.351  45.032 1.00 37.66  ? 96   LEU C CA    1 
ATOM   2100  C  C     . LEU C 3 96  ? -13.586 -10.542 44.878 1.00 37.43  ? 96   LEU C C     1 
ATOM   2101  O  O     . LEU C 3 96  ? -13.694 -11.313 43.921 1.00 37.85  ? 96   LEU C O     1 
ATOM   2102  C  CB    . LEU C 3 96  ? -13.997 -8.122  44.292 1.00 36.90  ? 96   LEU C CB    1 
ATOM   2103  C  CG    . LEU C 3 96  ? -13.438 -8.407  42.895 1.00 37.14  ? 96   LEU C CG    1 
ATOM   2104  C  CD1   . LEU C 3 96  ? -14.545 -8.782  41.893 1.00 37.38  ? 96   LEU C CD1   1 
ATOM   2105  C  CD2   . LEU C 3 96  ? -12.597 -7.272  42.378 1.00 35.61  ? 96   LEU C CD2   1 
ATOM   2106  N  N     . LEU C 3 97  ? -12.654 -10.675 45.811 1.00 37.32  ? 97   LEU C N     1 
ATOM   2107  C  CA    . LEU C 3 97  ? -11.723 -11.795 45.828 1.00 37.23  ? 97   LEU C CA    1 
ATOM   2108  C  C     . LEU C 3 97  ? -12.042 -12.697 47.009 1.00 37.75  ? 97   LEU C C     1 
ATOM   2109  O  O     . LEU C 3 97  ? -11.136 -13.255 47.667 1.00 38.25  ? 97   LEU C O     1 
ATOM   2110  C  CB    . LEU C 3 97  ? -10.291 -11.284 45.914 1.00 36.84  ? 97   LEU C CB    1 
ATOM   2111  C  CG    . LEU C 3 97  ? -9.837  -10.343 44.794 1.00 36.46  ? 97   LEU C CG    1 
ATOM   2112  C  CD1   . LEU C 3 97  ? -8.444  -9.855  45.063 1.00 33.50  ? 97   LEU C CD1   1 
ATOM   2113  C  CD2   . LEU C 3 97  ? -9.910  -11.024 43.424 1.00 36.46  ? 97   LEU C CD2   1 
ATOM   2114  N  N     . GLY C 3 98  ? -13.334 -12.827 47.291 1.00 37.67  ? 98   GLY C N     1 
ATOM   2115  C  CA    . GLY C 3 98  ? -13.783 -13.590 48.450 1.00 38.68  ? 98   GLY C CA    1 
ATOM   2116  C  C     . GLY C 3 98  ? -13.512 -15.083 48.357 1.00 39.13  ? 98   GLY C C     1 
ATOM   2117  O  O     . GLY C 3 98  ? -13.407 -15.755 49.364 1.00 39.37  ? 98   GLY C O     1 
ATOM   2118  N  N     . ARG C 3 99  ? -13.394 -15.598 47.142 1.00 39.58  ? 99   ARG C N     1 
ATOM   2119  C  CA    . ARG C 3 99  ? -13.102 -17.007 46.931 1.00 39.76  ? 99   ARG C CA    1 
ATOM   2120  C  C     . ARG C 3 99  ? -11.787 -17.179 46.157 1.00 38.70  ? 99   ARG C C     1 
ATOM   2121  O  O     . ARG C 3 99  ? -11.677 -18.018 45.260 1.00 39.15  ? 99   ARG C O     1 
ATOM   2122  C  CB    . ARG C 3 99  ? -14.289 -17.658 46.230 1.00 40.15  ? 99   ARG C CB    1 
ATOM   2123  C  CG    . ARG C 3 99  ? -15.403 -17.993 47.214 1.00 45.40  ? 99   ARG C CG    1 
ATOM   2124  C  CD    . ARG C 3 99  ? -16.764 -18.130 46.509 1.00 54.29  ? 99   ARG C CD    1 
ATOM   2125  N  NE    . ARG C 3 99  ? -17.683 -18.982 47.283 1.00 60.87  ? 99   ARG C NE    1 
ATOM   2126  C  CZ    . ARG C 3 99  ? -18.948 -19.257 46.948 1.00 63.44  ? 99   ARG C CZ    1 
ATOM   2127  N  NH1   . ARG C 3 99  ? -19.495 -18.747 45.841 1.00 65.46  ? 99   ARG C NH1   1 
ATOM   2128  N  NH2   . ARG C 3 99  ? -19.677 -20.046 47.729 1.00 64.53  ? 99   ARG C NH2   1 
ATOM   2129  N  N     . VAL C 3 100 ? -10.798 -16.360 46.511 1.00 37.09  ? 100  VAL C N     1 
ATOM   2130  C  CA    . VAL C 3 100 ? -9.483  -16.367 45.867 1.00 35.76  ? 100  VAL C CA    1 
ATOM   2131  C  C     . VAL C 3 100 ? -8.358  -16.475 46.909 1.00 35.22  ? 100  VAL C C     1 
ATOM   2132  O  O     . VAL C 3 100 ? -8.462  -15.950 48.008 1.00 34.82  ? 100  VAL C O     1 
ATOM   2133  C  CB    . VAL C 3 100 ? -9.269  -15.083 45.032 1.00 35.75  ? 100  VAL C CB    1 
ATOM   2134  C  CG1   . VAL C 3 100 ? -7.809  -14.912 44.677 1.00 36.33  ? 100  VAL C CG1   1 
ATOM   2135  C  CG2   . VAL C 3 100 ? -10.110 -15.103 43.767 1.00 34.84  ? 100  VAL C CG2   1 
ATOM   2136  N  N     . THR C 3 101 ? -7.284  -17.174 46.568 1.00 34.76  ? 101  THR C N     1 
ATOM   2137  C  CA    . THR C 3 101 ? -6.151  -17.297 47.464 1.00 33.66  ? 101  THR C CA    1 
ATOM   2138  C  C     . THR C 3 101 ? -4.937  -16.648 46.811 1.00 33.62  ? 101  THR C C     1 
ATOM   2139  O  O     . THR C 3 101 ? -4.578  -16.963 45.665 1.00 33.51  ? 101  THR C O     1 
ATOM   2140  C  CB    . THR C 3 101 ? -5.858  -18.780 47.812 1.00 34.07  ? 101  THR C CB    1 
ATOM   2141  O  OG1   . THR C 3 101 ? -6.993  -19.365 48.472 1.00 34.24  ? 101  THR C OG1   1 
ATOM   2142  C  CG2   . THR C 3 101 ? -4.633  -18.911 48.719 1.00 32.96  ? 101  THR C CG2   1 
ATOM   2143  N  N     . ILE C 3 102 ? -4.324  -15.738 47.557 1.00 33.34  ? 102  ILE C N     1 
ATOM   2144  C  CA    . ILE C 3 102 ? -3.072  -15.101 47.189 1.00 33.31  ? 102  ILE C CA    1 
ATOM   2145  C  C     . ILE C 3 102 ? -1.955  -15.874 47.851 1.00 33.60  ? 102  ILE C C     1 
ATOM   2146  O  O     . ILE C 3 102 ? -1.808  -15.842 49.074 1.00 33.67  ? 102  ILE C O     1 
ATOM   2147  C  CB    . ILE C 3 102 ? -3.042  -13.603 47.636 1.00 33.45  ? 102  ILE C CB    1 
ATOM   2148  C  CG1   . ILE C 3 102 ? -4.074  -12.787 46.845 1.00 32.75  ? 102  ILE C CG1   1 
ATOM   2149  C  CG2   . ILE C 3 102 ? -1.653  -13.008 47.484 1.00 32.15  ? 102  ILE C CG2   1 
ATOM   2150  C  CD1   . ILE C 3 102 ? -4.430  -11.471 47.452 1.00 31.20  ? 102  ILE C CD1   1 
ATOM   2151  N  N     . ALA C 3 103 ? -1.183  -16.589 47.039 1.00 34.08  ? 103  ALA C N     1 
ATOM   2152  C  CA    . ALA C 3 103 ? -0.099  -17.417 47.533 1.00 34.66  ? 103  ALA C CA    1 
ATOM   2153  C  C     . ALA C 3 103 ? 0.866   -16.520 48.259 1.00 34.88  ? 103  ALA C C     1 
ATOM   2154  O  O     . ALA C 3 103 ? 1.071   -15.397 47.826 1.00 35.74  ? 103  ALA C O     1 
ATOM   2155  C  CB    . ALA C 3 103 ? 0.587   -18.128 46.374 1.00 34.93  ? 103  ALA C CB    1 
ATOM   2156  N  N     . GLN C 3 104 ? 1.429   -17.002 49.369 1.00 35.10  ? 104  GLN C N     1 
ATOM   2157  C  CA    . GLN C 3 104 ? 2.402   -16.259 50.173 1.00 35.29  ? 104  GLN C CA    1 
ATOM   2158  C  C     . GLN C 3 104 ? 1.851   -14.934 50.739 1.00 35.30  ? 104  GLN C C     1 
ATOM   2159  O  O     . GLN C 3 104 ? 2.619   -13.977 51.009 1.00 35.75  ? 104  GLN C O     1 
ATOM   2160  C  CB    . GLN C 3 104 ? 3.728   -16.073 49.407 1.00 35.52  ? 104  GLN C CB    1 
ATOM   2161  C  CG    . GLN C 3 104 ? 4.642   -17.313 49.413 1.00 37.99  ? 104  GLN C CG    1 
ATOM   2162  C  CD    . GLN C 3 104 ? 5.073   -17.732 50.842 1.00 43.32  ? 104  GLN C CD    1 
ATOM   2163  O  OE1   . GLN C 3 104 ? 5.646   -16.925 51.590 1.00 46.88  ? 104  GLN C OE1   1 
ATOM   2164  N  NE2   . GLN C 3 104 ? 4.785   -18.985 51.222 1.00 42.07  ? 104  GLN C NE2   1 
ATOM   2165  N  N     . GLY C 3 105 ? 0.532   -14.892 50.938 1.00 34.19  ? 105  GLY C N     1 
ATOM   2166  C  CA    . GLY C 3 105 ? -0.115  -13.740 51.557 1.00 33.77  ? 105  GLY C CA    1 
ATOM   2167  C  C     . GLY C 3 105 ? -0.353  -13.805 53.066 1.00 33.71  ? 105  GLY C C     1 
ATOM   2168  O  O     . GLY C 3 105 ? -0.480  -12.752 53.733 1.00 33.46  ? 105  GLY C O     1 
ATOM   2169  N  N     . GLY C 3 106 ? -0.413  -15.028 53.613 1.00 33.13  ? 106  GLY C N     1 
ATOM   2170  C  CA    . GLY C 3 106 ? -0.765  -15.235 55.018 1.00 32.42  ? 106  GLY C CA    1 
ATOM   2171  C  C     . GLY C 3 106 ? -2.090  -14.590 55.330 1.00 32.33  ? 106  GLY C C     1 
ATOM   2172  O  O     . GLY C 3 106 ? -2.880  -14.350 54.430 1.00 32.44  ? 106  GLY C O     1 
ATOM   2173  N  N     . VAL C 3 107 ? -2.320  -14.282 56.601 1.00 32.86  ? 107  VAL C N     1 
ATOM   2174  C  CA    . VAL C 3 107 ? -3.620  -13.800 57.087 1.00 33.03  ? 107  VAL C CA    1 
ATOM   2175  C  C     . VAL C 3 107 ? -3.490  -12.478 57.838 1.00 34.04  ? 107  VAL C C     1 
ATOM   2176  O  O     . VAL C 3 107 ? -2.391  -12.046 58.138 1.00 33.78  ? 107  VAL C O     1 
ATOM   2177  C  CB    . VAL C 3 107 ? -4.276  -14.855 58.053 1.00 33.04  ? 107  VAL C CB    1 
ATOM   2178  C  CG1   . VAL C 3 107 ? -4.438  -16.221 57.362 1.00 31.09  ? 107  VAL C CG1   1 
ATOM   2179  C  CG2   . VAL C 3 107 ? -3.482  -14.985 59.349 1.00 31.85  ? 107  VAL C CG2   1 
ATOM   2180  N  N     . LEU C 3 108 ? -4.619  -11.850 58.156 1.00 35.74  ? 108  LEU C N     1 
ATOM   2181  C  CA    . LEU C 3 108 ? -4.640  -10.679 59.026 1.00 37.07  ? 108  LEU C CA    1 
ATOM   2182  C  C     . LEU C 3 108 ? -4.430  -11.069 60.486 1.00 38.62  ? 108  LEU C C     1 
ATOM   2183  O  O     . LEU C 3 108 ? -5.068  -12.015 60.977 1.00 39.30  ? 108  LEU C O     1 
ATOM   2184  C  CB    . LEU C 3 108 ? -5.984  -9.959  58.904 1.00 36.91  ? 108  LEU C CB    1 
ATOM   2185  C  CG    . LEU C 3 108 ? -6.303  -9.231  57.590 1.00 36.97  ? 108  LEU C CG    1 
ATOM   2186  C  CD1   . LEU C 3 108 ? -7.629  -8.486  57.695 1.00 33.72  ? 108  LEU C CD1   1 
ATOM   2187  C  CD2   . LEU C 3 108 ? -5.175  -8.286  57.198 1.00 35.98  ? 108  LEU C CD2   1 
ATOM   2188  N  N     . PRO C 3 109 ? -3.548  -10.345 61.205 1.00 40.07  ? 109  PRO C N     1 
ATOM   2189  C  CA    . PRO C 3 109 ? -3.497  -10.567 62.651 1.00 40.75  ? 109  PRO C CA    1 
ATOM   2190  C  C     . PRO C 3 109 ? -4.889  -10.386 63.245 1.00 41.66  ? 109  PRO C C     1 
ATOM   2191  O  O     . PRO C 3 109 ? -5.490  -9.341  63.067 1.00 42.02  ? 109  PRO C O     1 
ATOM   2192  C  CB    . PRO C 3 109 ? -2.564  -9.458  63.133 1.00 40.68  ? 109  PRO C CB    1 
ATOM   2193  C  CG    . PRO C 3 109 ? -1.640  -9.248  61.994 1.00 40.39  ? 109  PRO C CG    1 
ATOM   2194  C  CD    . PRO C 3 109 ? -2.529  -9.369  60.770 1.00 39.98  ? 109  PRO C CD    1 
ATOM   2195  N  N     . ASN C 3 110 ? -5.417  -11.426 63.880 1.00 42.96  ? 110  ASN C N     1 
ATOM   2196  C  CA    . ASN C 3 110 ? -6.717  -11.365 64.525 1.00 44.32  ? 110  ASN C CA    1 
ATOM   2197  C  C     . ASN C 3 110 ? -6.861  -12.487 65.538 1.00 45.05  ? 110  ASN C C     1 
ATOM   2198  O  O     . ASN C 3 110 ? -6.889  -13.679 65.173 1.00 45.54  ? 110  ASN C O     1 
ATOM   2199  C  CB    . ASN C 3 110 ? -7.857  -11.412 63.497 1.00 44.40  ? 110  ASN C CB    1 
ATOM   2200  C  CG    . ASN C 3 110 ? -9.220  -11.121 64.113 1.00 46.74  ? 110  ASN C CG    1 
ATOM   2201  O  OD1   . ASN C 3 110 ? -9.327  -10.741 65.298 1.00 50.75  ? 110  ASN C OD1   1 
ATOM   2202  N  ND2   . ASN C 3 110 ? -10.280 -11.294 63.313 1.00 46.05  ? 110  ASN C ND2   1 
ATOM   2203  N  N     . ILE C 3 111 ? -6.955  -12.082 66.809 1.00 45.50  ? 111  ILE C N     1 
ATOM   2204  C  CA    . ILE C 3 111 ? -7.135  -12.972 67.948 1.00 45.60  ? 111  ILE C CA    1 
ATOM   2205  C  C     . ILE C 3 111 ? -8.489  -12.657 68.582 1.00 46.39  ? 111  ILE C C     1 
ATOM   2206  O  O     . ILE C 3 111 ? -8.800  -11.498 68.839 1.00 46.78  ? 111  ILE C O     1 
ATOM   2207  C  CB    . ILE C 3 111 ? -6.012  -12.755 68.979 1.00 45.50  ? 111  ILE C CB    1 
ATOM   2208  C  CG1   . ILE C 3 111 ? -4.645  -12.776 68.275 1.00 45.98  ? 111  ILE C CG1   1 
ATOM   2209  C  CG2   . ILE C 3 111 ? -6.104  -13.773 70.129 1.00 44.51  ? 111  ILE C CG2   1 
ATOM   2210  C  CD1   . ILE C 3 111 ? -3.439  -12.575 69.195 1.00 46.10  ? 111  ILE C CD1   1 
ATOM   2211  N  N     . GLN C 3 112 ? -9.295  -13.686 68.819 1.00 47.08  ? 112  GLN C N     1 
ATOM   2212  C  CA    . GLN C 3 112 ? -10.597 -13.520 69.423 1.00 47.69  ? 112  GLN C CA    1 
ATOM   2213  C  C     . GLN C 3 112 ? -10.465 -13.122 70.890 1.00 48.77  ? 112  GLN C C     1 
ATOM   2214  O  O     . GLN C 3 112 ? -9.596  -13.645 71.605 1.00 48.64  ? 112  GLN C O     1 
ATOM   2215  C  CB    . GLN C 3 112 ? -11.382 -14.830 69.314 1.00 48.09  ? 112  GLN C CB    1 
ATOM   2216  C  CG    . GLN C 3 112 ? -11.635 -15.289 67.884 1.00 47.48  ? 112  GLN C CG    1 
ATOM   2217  C  CD    . GLN C 3 112 ? -12.611 -14.386 67.163 1.00 46.67  ? 112  GLN C CD    1 
ATOM   2218  O  OE1   . GLN C 3 112 ? -13.647 -14.008 67.714 1.00 45.44  ? 112  GLN C OE1   1 
ATOM   2219  N  NE2   . GLN C 3 112 ? -12.276 -14.019 65.931 1.00 45.43  ? 112  GLN C NE2   1 
ATOM   2220  N  N     . SER C 3 113 ? -11.353 -12.220 71.324 1.00 49.66  ? 113  SER C N     1 
ATOM   2221  C  CA    . SER C 3 113 ? -11.367 -11.649 72.686 1.00 50.68  ? 113  SER C CA    1 
ATOM   2222  C  C     . SER C 3 113 ? -11.177 -12.605 73.851 1.00 51.55  ? 113  SER C C     1 
ATOM   2223  O  O     . SER C 3 113 ? -10.289 -12.400 74.683 1.00 51.80  ? 113  SER C O     1 
ATOM   2224  C  CB    . SER C 3 113 ? -12.655 -10.861 72.927 1.00 50.52  ? 113  SER C CB    1 
ATOM   2225  O  OG    . SER C 3 113 ? -12.603 -9.641  72.239 1.00 48.92  ? 113  SER C OG    1 
ATOM   2226  N  N     . VAL C 3 114 ? -12.021 -13.632 73.916 1.00 52.44  ? 114  VAL C N     1 
ATOM   2227  C  CA    . VAL C 3 114 ? -12.032 -14.562 75.049 1.00 53.36  ? 114  VAL C CA    1 
ATOM   2228  C  C     . VAL C 3 114 ? -10.703 -15.285 75.216 1.00 54.35  ? 114  VAL C C     1 
ATOM   2229  O  O     . VAL C 3 114 ? -10.465 -15.911 76.254 1.00 55.00  ? 114  VAL C O     1 
ATOM   2230  C  CB    . VAL C 3 114 ? -13.184 -15.595 74.947 1.00 53.05  ? 114  VAL C CB    1 
ATOM   2231  C  CG1   . VAL C 3 114 ? -14.524 -14.887 74.920 1.00 53.82  ? 114  VAL C CG1   1 
ATOM   2232  C  CG2   . VAL C 3 114 ? -13.032 -16.488 73.708 1.00 52.59  ? 114  VAL C CG2   1 
ATOM   2233  N  N     . LEU C 3 115 ? -9.849  -15.189 74.198 1.00 55.34  ? 115  LEU C N     1 
ATOM   2234  C  CA    . LEU C 3 115 ? -8.550  -15.861 74.193 1.00 56.82  ? 115  LEU C CA    1 
ATOM   2235  C  C     . LEU C 3 115 ? -7.449  -15.092 74.914 1.00 58.09  ? 115  LEU C C     1 
ATOM   2236  O  O     . LEU C 3 115 ? -6.430  -15.678 75.284 1.00 58.34  ? 115  LEU C O     1 
ATOM   2237  C  CB    . LEU C 3 115 ? -8.106  -16.189 72.761 1.00 56.64  ? 115  LEU C CB    1 
ATOM   2238  C  CG    . LEU C 3 115 ? -9.000  -17.104 71.920 1.00 55.86  ? 115  LEU C CG    1 
ATOM   2239  C  CD1   . LEU C 3 115 ? -8.344  -17.333 70.567 1.00 54.29  ? 115  LEU C CD1   1 
ATOM   2240  C  CD2   . LEU C 3 115 ? -9.281  -18.436 72.642 1.00 54.54  ? 115  LEU C CD2   1 
ATOM   2241  N  N     . LEU C 3 116 ? -7.660  -13.794 75.111 1.00 59.91  ? 116  LEU C N     1 
ATOM   2242  C  CA    . LEU C 3 116 ? -6.730  -12.939 75.865 1.00 61.87  ? 116  LEU C CA    1 
ATOM   2243  C  C     . LEU C 3 116 ? -6.747  -13.219 77.371 1.00 63.53  ? 116  LEU C C     1 
ATOM   2244  O  O     . LEU C 3 116 ? -7.784  -13.608 77.920 1.00 63.76  ? 116  LEU C O     1 
ATOM   2245  C  CB    . LEU C 3 116 ? -7.024  -11.456 75.614 1.00 61.47  ? 116  LEU C CB    1 
ATOM   2246  C  CG    . LEU C 3 116 ? -6.943  -10.937 74.175 1.00 61.55  ? 116  LEU C CG    1 
ATOM   2247  C  CD1   . LEU C 3 116 ? -7.401  -9.490  74.103 1.00 61.37  ? 116  LEU C CD1   1 
ATOM   2248  C  CD2   . LEU C 3 116 ? -5.556  -11.093 73.577 1.00 59.18  ? 116  LEU C CD2   1 
ATOM   2249  N  N     . PRO C 3 117 ? -5.599  -13.007 78.043 1.00 65.31  ? 117  PRO C N     1 
ATOM   2250  C  CA    . PRO C 3 117 ? -5.429  -13.300 79.477 1.00 67.03  ? 117  PRO C CA    1 
ATOM   2251  C  C     . PRO C 3 117 ? -6.163  -12.361 80.458 1.00 68.99  ? 117  PRO C C     1 
ATOM   2252  O  O     . PRO C 3 117 ? -6.688  -11.318 80.049 1.00 68.99  ? 117  PRO C O     1 
ATOM   2253  C  CB    . PRO C 3 117 ? -3.915  -13.194 79.674 1.00 66.91  ? 117  PRO C CB    1 
ATOM   2254  C  CG    . PRO C 3 117 ? -3.463  -12.268 78.601 1.00 66.07  ? 117  PRO C CG    1 
ATOM   2255  C  CD    . PRO C 3 117 ? -4.347  -12.522 77.427 1.00 65.21  ? 117  PRO C CD    1 
ATOM   2256  N  N     . LYS C 3 118 ? -6.162  -12.756 81.742 1.00 71.41  ? 118  LYS C N     1 
ATOM   2257  C  CA    . LYS C 3 118 ? -6.802  -12.056 82.887 1.00 73.46  ? 118  LYS C CA    1 
ATOM   2258  C  C     . LYS C 3 118 ? -8.318  -11.866 82.715 1.00 74.69  ? 118  LYS C C     1 
ATOM   2259  O  O     . LYS C 3 118 ? -9.075  -12.849 82.681 1.00 75.02  ? 118  LYS C O     1 
ATOM   2260  C  CB    . LYS C 3 118 ? -6.133  -10.705 83.216 1.00 73.58  ? 118  LYS C CB    1 
ATOM   2261  C  CG    . LYS C 3 118 ? -4.627  -10.608 82.994 1.00 74.93  ? 118  LYS C CG    1 
ATOM   2262  C  CD    . LYS C 3 118 ? -4.245  -9.166  82.626 1.00 76.79  ? 118  LYS C CD    1 
ATOM   2263  C  CE    . LYS C 3 118 ? -4.837  -8.764  81.263 1.00 77.81  ? 118  LYS C CE    1 
ATOM   2264  N  NZ    . LYS C 3 118 ? -4.858  -7.286  81.016 1.00 78.05  ? 118  LYS C NZ    1 
ATOM   2265  N  N     . LYS C 3 119 ? -8.744  -10.600 82.625 1.00 76.11  ? 119  LYS C N     1 
ATOM   2266  C  CA    . LYS C 3 119 ? -10.151 -10.223 82.406 1.00 77.31  ? 119  LYS C CA    1 
ATOM   2267  C  C     . LYS C 3 119 ? -10.269 -8.776  81.918 1.00 77.48  ? 119  LYS C C     1 
ATOM   2268  O  O     . LYS C 3 119 ? -9.560  -7.890  82.404 1.00 77.91  ? 119  LYS C O     1 
ATOM   2269  C  CB    . LYS C 3 119 ? -11.006 -10.426 83.677 1.00 77.76  ? 119  LYS C CB    1 
ATOM   2270  C  CG    . LYS C 3 119 ? -10.717 -9.461  84.841 1.00 79.55  ? 119  LYS C CG    1 
ATOM   2271  C  CD    . LYS C 3 119 ? -9.687  -10.025 85.822 1.00 82.33  ? 119  LYS C CD    1 
ATOM   2272  C  CE    . LYS C 3 119 ? -9.605  -9.151  87.071 1.00 84.50  ? 119  LYS C CE    1 
ATOM   2273  N  NZ    . LYS C 3 119 ? -8.715  -9.737  88.116 1.00 86.06  ? 119  LYS C NZ    1 
ATOM   2274  N  N     . LYS D 4 31  ? 10.619  -21.132 20.348 1.00 81.51  ? 28   LYS D N     1 
ATOM   2275  C  CA    . LYS D 4 31  ? 10.859  -20.682 21.758 1.00 81.58  ? 28   LYS D CA    1 
ATOM   2276  C  C     . LYS D 4 31  ? 9.701   -19.774 22.216 1.00 81.40  ? 28   LYS D C     1 
ATOM   2277  O  O     . LYS D 4 31  ? 9.897   -18.585 22.523 1.00 81.26  ? 28   LYS D O     1 
ATOM   2278  C  CB    . LYS D 4 31  ? 12.225  -19.981 21.874 1.00 81.73  ? 28   LYS D CB    1 
ATOM   2279  C  CG    . LYS D 4 31  ? 13.418  -20.825 21.401 1.00 81.87  ? 28   LYS D CG    1 
ATOM   2280  C  CD    . LYS D 4 31  ? 13.840  -20.482 19.959 1.00 82.40  ? 28   LYS D CD    1 
ATOM   2281  C  CE    . LYS D 4 31  ? 14.092  -21.746 19.112 1.00 82.56  ? 28   LYS D CE    1 
ATOM   2282  N  NZ    . LYS D 4 31  ? 15.029  -22.726 19.750 1.00 82.70  ? 28   LYS D NZ    1 
ATOM   2283  N  N     . THR D 4 32  ? 8.511   -20.384 22.289 1.00 81.10  ? 29   THR D N     1 
ATOM   2284  C  CA    . THR D 4 32  ? 7.203   -19.699 22.237 1.00 80.70  ? 29   THR D CA    1 
ATOM   2285  C  C     . THR D 4 32  ? 7.009   -18.464 23.133 1.00 80.00  ? 29   THR D C     1 
ATOM   2286  O  O     . THR D 4 32  ? 7.517   -18.400 24.263 1.00 80.07  ? 29   THR D O     1 
ATOM   2287  C  CB    . THR D 4 32  ? 6.025   -20.702 22.430 1.00 80.87  ? 29   THR D CB    1 
ATOM   2288  O  OG1   . THR D 4 32  ? 4.895   -20.283 21.649 1.00 81.72  ? 29   THR D OG1   1 
ATOM   2289  C  CG2   . THR D 4 32  ? 5.620   -20.822 23.907 1.00 81.45  ? 29   THR D CG2   1 
ATOM   2290  N  N     . ARG D 4 33  ? 6.254   -17.500 22.603 1.00 78.91  ? 30   ARG D N     1 
ATOM   2291  C  CA    . ARG D 4 33  ? 6.022   -16.212 23.259 1.00 77.64  ? 30   ARG D CA    1 
ATOM   2292  C  C     . ARG D 4 33  ? 4.900   -16.308 24.296 1.00 76.23  ? 30   ARG D C     1 
ATOM   2293  O  O     . ARG D 4 33  ? 3.811   -16.817 24.005 1.00 76.35  ? 30   ARG D O     1 
ATOM   2294  C  CB    . ARG D 4 33  ? 5.703   -15.125 22.215 1.00 78.00  ? 30   ARG D CB    1 
ATOM   2295  C  CG    . ARG D 4 33  ? 4.315   -15.246 21.548 1.00 79.27  ? 30   ARG D CG    1 
ATOM   2296  C  CD    . ARG D 4 33  ? 3.871   -13.954 20.854 1.00 81.43  ? 30   ARG D CD    1 
ATOM   2297  N  NE    . ARG D 4 33  ? 4.400   -12.746 21.493 1.00 82.86  ? 30   ARG D NE    1 
ATOM   2298  C  CZ    . ARG D 4 33  ? 3.900   -11.519 21.342 1.00 83.94  ? 30   ARG D CZ    1 
ATOM   2299  N  NH1   . ARG D 4 33  ? 2.829   -11.307 20.584 1.00 84.73  ? 30   ARG D NH1   1 
ATOM   2300  N  NH2   . ARG D 4 33  ? 4.467   -10.495 21.964 1.00 84.35  ? 30   ARG D NH2   1 
ATOM   2301  N  N     . LYS D 4 34  ? 5.170   -15.821 25.502 1.00 74.14  ? 31   LYS D N     1 
ATOM   2302  C  CA    . LYS D 4 34  ? 4.153   -15.807 26.548 1.00 72.24  ? 31   LYS D CA    1 
ATOM   2303  C  C     . LYS D 4 34  ? 3.808   -14.404 27.040 1.00 70.58  ? 31   LYS D C     1 
ATOM   2304  O  O     . LYS D 4 34  ? 4.554   -13.786 27.800 1.00 70.29  ? 31   LYS D O     1 
ATOM   2305  C  CB    . LYS D 4 34  ? 4.521   -16.747 27.707 1.00 72.52  ? 31   LYS D CB    1 
ATOM   2306  C  CG    . LYS D 4 34  ? 5.989   -16.750 28.101 1.00 72.97  ? 31   LYS D CG    1 
ATOM   2307  C  CD    . LYS D 4 34  ? 6.229   -17.607 29.341 1.00 73.92  ? 31   LYS D CD    1 
ATOM   2308  C  CE    . LYS D 4 34  ? 7.709   -17.598 29.752 1.00 74.12  ? 31   LYS D CE    1 
ATOM   2309  N  NZ    . LYS D 4 34  ? 7.929   -18.168 31.118 1.00 73.18  ? 31   LYS D NZ    1 
ATOM   2310  N  N     . GLU D 4 35  ? 2.661   -13.917 26.579 1.00 68.63  ? 32   GLU D N     1 
ATOM   2311  C  CA    . GLU D 4 35  ? 2.140   -12.607 26.931 1.00 66.75  ? 32   GLU D CA    1 
ATOM   2312  C  C     . GLU D 4 35  ? 1.764   -12.502 28.407 1.00 65.14  ? 32   GLU D C     1 
ATOM   2313  O  O     . GLU D 4 35  ? 1.313   -13.487 29.003 1.00 65.09  ? 32   GLU D O     1 
ATOM   2314  C  CB    . GLU D 4 35  ? 0.875   -12.332 26.123 1.00 67.22  ? 32   GLU D CB    1 
ATOM   2315  C  CG    . GLU D 4 35  ? 1.038   -12.220 24.620 1.00 68.43  ? 32   GLU D CG    1 
ATOM   2316  C  CD    . GLU D 4 35  ? -0.233  -11.716 23.971 1.00 70.96  ? 32   GLU D CD    1 
ATOM   2317  O  OE1   . GLU D 4 35  ? -1.329  -12.046 24.490 1.00 71.65  ? 32   GLU D OE1   1 
ATOM   2318  O  OE2   . GLU D 4 35  ? -0.144  -10.975 22.959 1.00 71.90  ? 32   GLU D OE2   1 
ATOM   2319  N  N     . SER D 4 36  ? 1.937   -11.306 28.981 1.00 62.84  ? 33   SER D N     1 
ATOM   2320  C  CA    . SER D 4 36  ? 1.372   -10.971 30.290 1.00 60.65  ? 33   SER D CA    1 
ATOM   2321  C  C     . SER D 4 36  ? 1.055   -9.491  30.379 1.00 59.04  ? 33   SER D C     1 
ATOM   2322  O  O     . SER D 4 36  ? 1.450   -8.717  29.526 1.00 59.07  ? 33   SER D O     1 
ATOM   2323  C  CB    . SER D 4 36  ? 2.282   -11.409 31.447 1.00 60.78  ? 33   SER D CB    1 
ATOM   2324  O  OG    . SER D 4 36  ? 3.306   -10.476 31.715 1.00 60.62  ? 33   SER D OG    1 
ATOM   2325  N  N     . TYR D 4 37  ? 0.334   -9.103  31.417 1.00 57.12  ? 34   TYR D N     1 
ATOM   2326  C  CA    . TYR D 4 37  ? -0.001  -7.709  31.644 1.00 55.29  ? 34   TYR D CA    1 
ATOM   2327  C  C     . TYR D 4 37  ? 1.080   -6.944  32.404 1.00 54.40  ? 34   TYR D C     1 
ATOM   2328  O  O     . TYR D 4 37  ? 0.852   -5.821  32.821 1.00 54.08  ? 34   TYR D O     1 
ATOM   2329  C  CB    . TYR D 4 37  ? -1.306  -7.627  32.411 1.00 54.94  ? 34   TYR D CB    1 
ATOM   2330  C  CG    . TYR D 4 37  ? -2.502  -8.009  31.597 1.00 54.16  ? 34   TYR D CG    1 
ATOM   2331  C  CD1   . TYR D 4 37  ? -3.031  -9.298  31.656 1.00 53.95  ? 34   TYR D CD1   1 
ATOM   2332  C  CD2   . TYR D 4 37  ? -3.115  -7.083  30.764 1.00 53.15  ? 34   TYR D CD2   1 
ATOM   2333  C  CE1   . TYR D 4 37  ? -4.151  -9.651  30.899 1.00 52.64  ? 34   TYR D CE1   1 
ATOM   2334  C  CE2   . TYR D 4 37  ? -4.225  -7.433  30.002 1.00 53.45  ? 34   TYR D CE2   1 
ATOM   2335  C  CZ    . TYR D 4 37  ? -4.736  -8.713  30.081 1.00 52.19  ? 34   TYR D CZ    1 
ATOM   2336  O  OH    . TYR D 4 37  ? -5.837  -9.042  29.332 1.00 53.93  ? 34   TYR D OH    1 
ATOM   2337  N  N     . ALA D 4 38  ? 2.258   -7.545  32.556 1.00 53.63  ? 35   ALA D N     1 
ATOM   2338  C  CA    . ALA D 4 38  ? 3.315   -7.007  33.417 1.00 52.96  ? 35   ALA D CA    1 
ATOM   2339  C  C     . ALA D 4 38  ? 3.696   -5.554  33.153 1.00 52.45  ? 35   ALA D C     1 
ATOM   2340  O  O     . ALA D 4 38  ? 3.729   -4.733  34.079 1.00 52.56  ? 35   ALA D O     1 
ATOM   2341  C  CB    . ALA D 4 38  ? 4.558   -7.898  33.380 1.00 52.98  ? 35   ALA D CB    1 
ATOM   2342  N  N     . ILE D 4 39  ? 3.992   -5.229  31.901 1.00 51.56  ? 36   ILE D N     1 
ATOM   2343  C  CA    . ILE D 4 39  ? 4.486   -3.891  31.591 1.00 50.89  ? 36   ILE D CA    1 
ATOM   2344  C  C     . ILE D 4 39  ? 3.413   -2.836  31.867 1.00 50.22  ? 36   ILE D C     1 
ATOM   2345  O  O     . ILE D 4 39  ? 3.710   -1.732  32.321 1.00 49.55  ? 36   ILE D O     1 
ATOM   2346  C  CB    . ILE D 4 39  ? 5.078   -3.770  30.155 1.00 50.86  ? 36   ILE D CB    1 
ATOM   2347  C  CG1   . ILE D 4 39  ? 4.032   -4.095  29.094 1.00 51.82  ? 36   ILE D CG1   1 
ATOM   2348  C  CG2   . ILE D 4 39  ? 6.298   -4.684  29.995 1.00 50.89  ? 36   ILE D CG2   1 
ATOM   2349  C  CD1   . ILE D 4 39  ? 4.391   -3.580  27.713 1.00 53.49  ? 36   ILE D CD1   1 
ATOM   2350  N  N     . TYR D 4 40  ? 2.165   -3.210  31.623 1.00 49.65  ? 37   TYR D N     1 
ATOM   2351  C  CA    . TYR D 4 40  ? 1.038   -2.343  31.894 1.00 49.42  ? 37   TYR D CA    1 
ATOM   2352  C  C     . TYR D 4 40  ? 0.809   -2.173  33.390 1.00 48.84  ? 37   TYR D C     1 
ATOM   2353  O  O     . TYR D 4 40  ? 0.525   -1.066  33.858 1.00 48.68  ? 37   TYR D O     1 
ATOM   2354  C  CB    . TYR D 4 40  ? -0.193  -2.875  31.178 1.00 49.69  ? 37   TYR D CB    1 
ATOM   2355  C  CG    . TYR D 4 40  ? 0.121   -3.168  29.732 1.00 51.91  ? 37   TYR D CG    1 
ATOM   2356  C  CD1   . TYR D 4 40  ? 0.227   -4.480  29.267 1.00 53.95  ? 37   TYR D CD1   1 
ATOM   2357  C  CD2   . TYR D 4 40  ? 0.379   -2.126  28.839 1.00 53.02  ? 37   TYR D CD2   1 
ATOM   2358  C  CE1   . TYR D 4 40  ? 0.540   -4.739  27.923 1.00 56.22  ? 37   TYR D CE1   1 
ATOM   2359  C  CE2   . TYR D 4 40  ? 0.699   -2.371  27.524 1.00 54.49  ? 37   TYR D CE2   1 
ATOM   2360  C  CZ    . TYR D 4 40  ? 0.776   -3.673  27.064 1.00 56.24  ? 37   TYR D CZ    1 
ATOM   2361  O  OH    . TYR D 4 40  ? 1.092   -3.893  25.740 1.00 59.23  ? 37   TYR D OH    1 
ATOM   2362  N  N     . VAL D 4 41  ? 0.970   -3.261  34.138 1.00 47.99  ? 38   VAL D N     1 
ATOM   2363  C  CA    . VAL D 4 41  ? 0.824   -3.217  35.590 1.00 47.23  ? 38   VAL D CA    1 
ATOM   2364  C  C     . VAL D 4 41  ? 1.905   -2.319  36.172 1.00 47.08  ? 38   VAL D C     1 
ATOM   2365  O  O     . VAL D 4 41  ? 1.621   -1.495  37.042 1.00 46.68  ? 38   VAL D O     1 
ATOM   2366  C  CB    . VAL D 4 41  ? 0.835   -4.641  36.231 1.00 46.79  ? 38   VAL D CB    1 
ATOM   2367  C  CG1   . VAL D 4 41  ? 0.950   -4.565  37.738 1.00 46.16  ? 38   VAL D CG1   1 
ATOM   2368  C  CG2   . VAL D 4 41  ? -0.431  -5.371  35.871 1.00 46.15  ? 38   VAL D CG2   1 
ATOM   2369  N  N     . TYR D 4 42  ? 3.127   -2.471  35.661 1.00 47.15  ? 39   TYR D N     1 
ATOM   2370  C  CA    . TYR D 4 42  ? 4.262   -1.642  36.052 1.00 47.42  ? 39   TYR D CA    1 
ATOM   2371  C  C     . TYR D 4 42  ? 4.043   -0.153  35.716 1.00 46.81  ? 39   TYR D C     1 
ATOM   2372  O  O     . TYR D 4 42  ? 4.289   0.700   36.558 1.00 47.29  ? 39   TYR D O     1 
ATOM   2373  C  CB    . TYR D 4 42  ? 5.562   -2.180  35.434 1.00 48.07  ? 39   TYR D CB    1 
ATOM   2374  C  CG    . TYR D 4 42  ? 6.811   -1.571  36.019 1.00 51.04  ? 39   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D 4 42  ? 7.347   -2.050  37.224 1.00 54.87  ? 39   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D 4 42  ? 7.454   -0.504  35.385 1.00 53.96  ? 39   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D 4 42  ? 8.503   -1.473  37.794 1.00 56.87  ? 39   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D 4 42  ? 8.612   0.080   35.933 1.00 56.74  ? 39   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D 4 42  ? 9.135   -0.408  37.140 1.00 58.09  ? 39   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D 4 42  ? 10.276  0.170   37.688 1.00 59.43  ? 39   TYR D OH    1 
ATOM   2381  N  N     . LYS D 4 43  ? 3.555   0.153   34.516 1.00 46.22  ? 40   LYS D N     1 
ATOM   2382  C  CA    . LYS D 4 43  ? 3.234   1.538   34.128 1.00 46.08  ? 40   LYS D CA    1 
ATOM   2383  C  C     . LYS D 4 43  ? 2.300   2.199   35.134 1.00 45.90  ? 40   LYS D C     1 
ATOM   2384  O  O     . LYS D 4 43  ? 2.565   3.302   35.619 1.00 46.48  ? 40   LYS D O     1 
ATOM   2385  C  CB    . LYS D 4 43  ? 2.601   1.600   32.733 1.00 45.87  ? 40   LYS D CB    1 
ATOM   2386  C  CG    . LYS D 4 43  ? 3.600   1.616   31.584 1.00 47.25  ? 40   LYS D CG    1 
ATOM   2387  C  CD    . LYS D 4 43  ? 2.952   1.299   30.228 1.00 49.34  ? 40   LYS D CD    1 
ATOM   2388  C  CE    . LYS D 4 43  ? 4.000   1.363   29.101 1.00 51.99  ? 40   LYS D CE    1 
ATOM   2389  N  NZ    . LYS D 4 43  ? 3.466   1.009   27.738 1.00 53.46  ? 40   LYS D NZ    1 
ATOM   2390  N  N     . VAL D 4 44  ? 1.219   1.499   35.449 1.00 45.40  ? 41   VAL D N     1 
ATOM   2391  C  CA    . VAL D 4 44  ? 0.194   1.969   36.360 1.00 44.59  ? 41   VAL D CA    1 
ATOM   2392  C  C     . VAL D 4 44  ? 0.781   2.091   37.756 1.00 44.86  ? 41   VAL D C     1 
ATOM   2393  O  O     . VAL D 4 44  ? 0.434   3.003   38.510 1.00 45.46  ? 41   VAL D O     1 
ATOM   2394  C  CB    . VAL D 4 44  ? -1.001  0.985   36.372 1.00 44.47  ? 41   VAL D CB    1 
ATOM   2395  C  CG1   . VAL D 4 44  ? -2.023  1.371   37.433 1.00 43.28  ? 41   VAL D CG1   1 
ATOM   2396  C  CG2   . VAL D 4 44  ? -1.640  0.899   34.986 1.00 43.06  ? 41   VAL D CG2   1 
ATOM   2397  N  N     . LEU D 4 45  ? 1.681   1.174   38.095 1.00 44.33  ? 42   LEU D N     1 
ATOM   2398  C  CA    . LEU D 4 45  ? 2.330   1.211   39.394 1.00 44.16  ? 42   LEU D CA    1 
ATOM   2399  C  C     . LEU D 4 45  ? 3.162   2.489   39.565 1.00 44.31  ? 42   LEU D C     1 
ATOM   2400  O  O     . LEU D 4 45  ? 3.192   3.068   40.663 1.00 44.76  ? 42   LEU D O     1 
ATOM   2401  C  CB    . LEU D 4 45  ? 3.193   -0.040  39.617 1.00 43.45  ? 42   LEU D CB    1 
ATOM   2402  C  CG    . LEU D 4 45  ? 4.127   -0.048  40.831 1.00 42.24  ? 42   LEU D CG    1 
ATOM   2403  C  CD1   . LEU D 4 45  ? 3.363   0.058   42.151 1.00 38.92  ? 42   LEU D CD1   1 
ATOM   2404  C  CD2   . LEU D 4 45  ? 5.045   -1.277  40.799 1.00 41.49  ? 42   LEU D CD2   1 
ATOM   2405  N  N     . LYS D 4 46  ? 3.831   2.920   38.493 1.00 43.89  ? 43   LYS D N     1 
ATOM   2406  C  CA    . LYS D 4 46  ? 4.697   4.107   38.576 1.00 43.72  ? 43   LYS D CA    1 
ATOM   2407  C  C     . LYS D 4 46  ? 3.864   5.355   38.723 1.00 43.09  ? 43   LYS D C     1 
ATOM   2408  O  O     . LYS D 4 46  ? 4.238   6.268   39.458 1.00 43.44  ? 43   LYS D O     1 
ATOM   2409  C  CB    . LYS D 4 46  ? 5.644   4.215   37.383 1.00 43.83  ? 43   LYS D CB    1 
ATOM   2410  C  CG    . LYS D 4 46  ? 6.802   3.218   37.450 1.00 44.60  ? 43   LYS D CG    1 
ATOM   2411  C  CD    . LYS D 4 46  ? 7.636   3.457   38.705 1.00 44.99  ? 43   LYS D CD    1 
ATOM   2412  C  CE    . LYS D 4 46  ? 8.099   2.153   39.336 1.00 45.60  ? 43   LYS D CE    1 
ATOM   2413  N  NZ    . LYS D 4 46  ? 9.018   2.426   40.478 1.00 45.24  ? 43   LYS D NZ    1 
ATOM   2414  N  N     . GLN D 4 47  ? 2.706   5.349   38.067 1.00 42.26  ? 44   GLN D N     1 
ATOM   2415  C  CA    . GLN D 4 47  ? 1.721   6.414   38.182 1.00 41.43  ? 44   GLN D CA    1 
ATOM   2416  C  C     . GLN D 4 47  ? 1.295   6.687   39.624 1.00 41.12  ? 44   GLN D C     1 
ATOM   2417  O  O     . GLN D 4 47  ? 1.172   7.839   40.027 1.00 40.00  ? 44   GLN D O     1 
ATOM   2418  C  CB    . GLN D 4 47  ? 0.488   6.083   37.346 1.00 41.35  ? 44   GLN D CB    1 
ATOM   2419  C  CG    . GLN D 4 47  ? 0.695   6.165   35.836 1.00 41.95  ? 44   GLN D CG    1 
ATOM   2420  C  CD    . GLN D 4 47  ? -0.613  6.028   35.051 1.00 43.33  ? 44   GLN D CD    1 
ATOM   2421  O  OE1   . GLN D 4 47  ? -1.471  5.189   35.372 1.00 44.90  ? 44   GLN D OE1   1 
ATOM   2422  N  NE2   . GLN D 4 47  ? -0.767  6.845   34.019 1.00 42.00  ? 44   GLN D NE2   1 
ATOM   2423  N  N     . VAL D 4 48  ? 1.088   5.622   40.404 1.00 41.32  ? 45   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4 48  ? 0.468   5.767   41.713 1.00 41.13  ? 45   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4 48  ? 1.469   5.803   42.866 1.00 41.26  ? 45   VAL D C     1 
ATOM   2426  O  O     . VAL D 4 48  ? 1.192   6.361   43.928 1.00 40.89  ? 45   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4 48  ? -0.622  4.704   41.933 1.00 41.47  ? 45   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4 48  ? -1.589  4.710   40.760 1.00 41.03  ? 45   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4 48  ? -0.015  3.287   42.160 1.00 41.74  ? 45   VAL D CG2   1 
ATOM   2430  N  N     . HIS D 4 49  ? 2.629   5.202   42.650 1.00 41.91  ? 46   HIS D N     1 
ATOM   2431  C  CA    . HIS D 4 49  ? 3.659   5.112   43.674 1.00 42.70  ? 46   HIS D CA    1 
ATOM   2432  C  C     . HIS D 4 49  ? 5.000   5.097   42.941 1.00 43.68  ? 46   HIS D C     1 
ATOM   2433  O  O     . HIS D 4 49  ? 5.589   4.026   42.716 1.00 43.59  ? 46   HIS D O     1 
ATOM   2434  C  CB    . HIS D 4 49  ? 3.517   3.861   44.523 1.00 42.05  ? 46   HIS D CB    1 
ATOM   2435  C  CG    . HIS D 4 49  ? 2.357   3.873   45.464 1.00 42.42  ? 46   HIS D CG    1 
ATOM   2436  N  ND1   . HIS D 4 49  ? 2.314   4.662   46.593 1.00 42.83  ? 46   HIS D ND1   1 
ATOM   2437  C  CD2   . HIS D 4 49  ? 1.218   3.137   45.477 1.00 43.37  ? 46   HIS D CD2   1 
ATOM   2438  C  CE1   . HIS D 4 49  ? 1.192   4.430   47.251 1.00 42.09  ? 46   HIS D CE1   1 
ATOM   2439  N  NE2   . HIS D 4 49  ? 0.506   3.511   46.591 1.00 43.64  ? 46   HIS D NE2   1 
ATOM   2440  N  N     . PRO D 4 50  ? 5.490   6.295   42.569 1.00 44.43  ? 47   PRO D N     1 
ATOM   2441  C  CA    . PRO D 4 50  ? 6.640   6.408   41.670 1.00 44.64  ? 47   PRO D CA    1 
ATOM   2442  C  C     . PRO D 4 50  ? 7.921   5.776   42.214 1.00 45.16  ? 47   PRO D C     1 
ATOM   2443  O  O     . PRO D 4 50  ? 8.761   5.383   41.421 1.00 45.58  ? 47   PRO D O     1 
ATOM   2444  C  CB    . PRO D 4 50  ? 6.807   7.917   41.494 1.00 44.70  ? 47   PRO D CB    1 
ATOM   2445  C  CG    . PRO D 4 50  ? 5.502   8.523   41.946 1.00 44.45  ? 47   PRO D CG    1 
ATOM   2446  C  CD    . PRO D 4 50  ? 4.999   7.616   43.012 1.00 44.17  ? 47   PRO D CD    1 
ATOM   2447  N  N     . ASP D 4 51  ? 8.065   5.663   43.534 1.00 45.64  ? 48   ASP D N     1 
ATOM   2448  C  CA    . ASP D 4 51  ? 9.311   5.128   44.119 1.00 46.15  ? 48   ASP D CA    1 
ATOM   2449  C  C     . ASP D 4 51  ? 9.195   3.680   44.638 1.00 46.13  ? 48   ASP D C     1 
ATOM   2450  O  O     . ASP D 4 51  ? 10.106  3.167   45.292 1.00 46.64  ? 48   ASP D O     1 
ATOM   2451  C  CB    . ASP D 4 51  ? 9.825   6.059   45.236 1.00 46.54  ? 48   ASP D CB    1 
ATOM   2452  C  CG    . ASP D 4 51  ? 10.228  7.463   44.716 1.00 48.24  ? 48   ASP D CG    1 
ATOM   2453  O  OD1   . ASP D 4 51  ? 10.821  7.573   43.613 1.00 48.84  ? 48   ASP D OD1   1 
ATOM   2454  O  OD2   . ASP D 4 51  ? 9.949   8.462   45.424 1.00 50.36  ? 48   ASP D OD2   1 
ATOM   2455  N  N     . THR D 4 52  ? 8.079   3.026   44.332 1.00 45.49  ? 49   THR D N     1 
ATOM   2456  C  CA    . THR D 4 52  ? 7.800   1.695   44.819 1.00 44.69  ? 49   THR D CA    1 
ATOM   2457  C  C     . THR D 4 52  ? 7.998   0.678   43.697 1.00 44.15  ? 49   THR D C     1 
ATOM   2458  O  O     . THR D 4 52  ? 7.552   0.898   42.565 1.00 43.81  ? 49   THR D O     1 
ATOM   2459  C  CB    . THR D 4 52  ? 6.351   1.636   45.345 1.00 44.83  ? 49   THR D CB    1 
ATOM   2460  O  OG1   . THR D 4 52  ? 6.145   2.711   46.267 1.00 45.29  ? 49   THR D OG1   1 
ATOM   2461  C  CG2   . THR D 4 52  ? 6.061   0.321   46.052 1.00 44.96  ? 49   THR D CG2   1 
ATOM   2462  N  N     . GLY D 4 53  ? 8.667   -0.429  44.006 1.00 43.46  ? 50   GLY D N     1 
ATOM   2463  C  CA    . GLY D 4 53  ? 8.782   -1.537  43.050 1.00 43.28  ? 50   GLY D CA    1 
ATOM   2464  C  C     . GLY D 4 53  ? 7.812   -2.693  43.320 1.00 43.01  ? 50   GLY D C     1 
ATOM   2465  O  O     . GLY D 4 53  ? 6.994   -2.647  44.246 1.00 42.85  ? 50   GLY D O     1 
ATOM   2466  N  N     . ILE D 4 54  ? 7.920   -3.745  42.517 1.00 42.83  ? 51   ILE D N     1 
ATOM   2467  C  CA    . ILE D 4 54  ? 7.094   -4.944  42.688 1.00 42.44  ? 51   ILE D CA    1 
ATOM   2468  C  C     . ILE D 4 54  ? 7.952   -6.198  42.483 1.00 42.70  ? 51   ILE D C     1 
ATOM   2469  O  O     . ILE D 4 54  ? 8.696   -6.277  41.503 1.00 42.91  ? 51   ILE D O     1 
ATOM   2470  C  CB    . ILE D 4 54  ? 5.868   -4.908  41.733 1.00 42.07  ? 51   ILE D CB    1 
ATOM   2471  C  CG1   . ILE D 4 54  ? 4.830   -5.983  42.106 1.00 42.07  ? 51   ILE D CG1   1 
ATOM   2472  C  CG2   . ILE D 4 54  ? 6.307   -4.987  40.274 1.00 41.13  ? 51   ILE D CG2   1 
ATOM   2473  C  CD1   . ILE D 4 54  ? 3.407   -5.778  41.507 1.00 37.59  ? 51   ILE D CD1   1 
ATOM   2474  N  N     . SER D 4 55  ? 7.863   -7.158  43.414 1.00 42.64  ? 52   SER D N     1 
ATOM   2475  C  CA    . SER D 4 55  ? 8.566   -8.456  43.292 1.00 42.52  ? 52   SER D CA    1 
ATOM   2476  C  C     . SER D 4 55  ? 7.963   -9.258  42.150 1.00 42.58  ? 52   SER D C     1 
ATOM   2477  O  O     . SER D 4 55  ? 6.821   -9.002  41.771 1.00 42.17  ? 52   SER D O     1 
ATOM   2478  C  CB    . SER D 4 55  ? 8.467   -9.273  44.586 1.00 42.50  ? 52   SER D CB    1 
ATOM   2479  O  OG    . SER D 4 55  ? 7.258   -10.035 44.622 1.00 42.83  ? 52   SER D OG    1 
ATOM   2480  N  N     . SER D 4 56  ? 8.710   -10.222 41.602 1.00 42.93  ? 53   SER D N     1 
ATOM   2481  C  CA    . SER D 4 56  ? 8.190   -10.969 40.454 1.00 43.66  ? 53   SER D CA    1 
ATOM   2482  C  C     . SER D 4 56  ? 7.003   -11.830 40.853 1.00 43.23  ? 53   SER D C     1 
ATOM   2483  O  O     . SER D 4 56  ? 6.092   -12.036 40.043 1.00 43.53  ? 53   SER D O     1 
ATOM   2484  C  CB    . SER D 4 56  ? 9.261   -11.765 39.682 1.00 43.99  ? 53   SER D CB    1 
ATOM   2485  O  OG    . SER D 4 56  ? 10.179  -12.415 40.539 1.00 46.58  ? 53   SER D OG    1 
ATOM   2486  N  N     . LYS D 4 57  ? 6.986   -12.292 42.101 1.00 42.70  ? 54   LYS D N     1 
ATOM   2487  C  CA    . LYS D 4 57  ? 5.846   -13.064 42.590 1.00 42.80  ? 54   LYS D CA    1 
ATOM   2488  C  C     . LYS D 4 57  ? 4.593   -12.202 42.719 1.00 42.24  ? 54   LYS D C     1 
ATOM   2489  O  O     . LYS D 4 57  ? 3.505   -12.639 42.315 1.00 42.25  ? 54   LYS D O     1 
ATOM   2490  C  CB    . LYS D 4 57  ? 6.155   -13.773 43.905 1.00 43.25  ? 54   LYS D CB    1 
ATOM   2491  C  CG    . LYS D 4 57  ? 7.021   -15.015 43.767 1.00 46.12  ? 54   LYS D CG    1 
ATOM   2492  C  CD    . LYS D 4 57  ? 7.547   -15.454 45.159 1.00 52.20  ? 54   LYS D CD    1 
ATOM   2493  C  CE    . LYS D 4 57  ? 8.857   -16.290 45.068 1.00 53.46  ? 54   LYS D CE    1 
ATOM   2494  N  NZ    . LYS D 4 57  ? 9.756   -16.024 46.266 1.00 54.63  ? 54   LYS D NZ    1 
ATOM   2495  N  N     . ALA D 4 58  ? 4.739   -10.985 43.264 1.00 41.16  ? 55   ALA D N     1 
ATOM   2496  C  CA    . ALA D 4 58  ? 3.625   -10.031 43.318 1.00 39.66  ? 55   ALA D CA    1 
ATOM   2497  C  C     . ALA D 4 58  ? 3.128   -9.723  41.921 1.00 38.99  ? 55   ALA D C     1 
ATOM   2498  O  O     . ALA D 4 58  ? 1.932   -9.612  41.686 1.00 38.37  ? 55   ALA D O     1 
ATOM   2499  C  CB    . ALA D 4 58  ? 4.042   -8.762  44.012 1.00 40.20  ? 55   ALA D CB    1 
ATOM   2500  N  N     . MET D 4 59  ? 4.047   -9.587  40.977 1.00 38.95  ? 56   MET D N     1 
ATOM   2501  C  CA    . MET D 4 59  ? 3.641   -9.319  39.612 1.00 39.02  ? 56   MET D CA    1 
ATOM   2502  C  C     . MET D 4 59  ? 2.847   -10.504 39.085 1.00 39.02  ? 56   MET D C     1 
ATOM   2503  O  O     . MET D 4 59  ? 1.791   -10.336 38.458 1.00 38.72  ? 56   MET D O     1 
ATOM   2504  C  CB    . MET D 4 59  ? 4.839   -9.024  38.713 1.00 39.13  ? 56   MET D CB    1 
ATOM   2505  C  CG    . MET D 4 59  ? 4.445   -8.692  37.279 1.00 39.60  ? 56   MET D CG    1 
ATOM   2506  S  SD    . MET D 4 59  ? 3.390   -7.228  37.229 1.00 43.87  ? 56   MET D SD    1 
ATOM   2507  C  CE    . MET D 4 59  ? 4.639   -5.939  37.159 1.00 42.35  ? 56   MET D CE    1 
ATOM   2508  N  N     . SER D 4 60  ? 3.339   -11.705 39.362 1.00 38.87  ? 57   SER D N     1 
ATOM   2509  C  CA    . SER D 4 60  ? 2.624   -12.901 38.934 1.00 39.22  ? 57   SER D CA    1 
ATOM   2510  C  C     . SER D 4 60  ? 1.185   -12.893 39.444 1.00 38.87  ? 57   SER D C     1 
ATOM   2511  O  O     . SER D 4 60  ? 0.258   -13.173 38.683 1.00 39.25  ? 57   SER D O     1 
ATOM   2512  C  CB    . SER D 4 60  ? 3.350   -14.161 39.367 1.00 39.32  ? 57   SER D CB    1 
ATOM   2513  O  OG    . SER D 4 60  ? 2.732   -15.276 38.767 1.00 40.99  ? 57   SER D OG    1 
ATOM   2514  N  N     . ILE D 4 61  ? 1.003   -12.528 40.712 1.00 38.57  ? 58   ILE D N     1 
ATOM   2515  C  CA    . ILE D 4 61  ? -0.333  -12.377 41.299 1.00 38.67  ? 58   ILE D CA    1 
ATOM   2516  C  C     . ILE D 4 61  ? -1.150  -11.259 40.621 1.00 39.09  ? 58   ILE D C     1 
ATOM   2517  O  O     . ILE D 4 61  ? -2.354  -11.412 40.367 1.00 39.17  ? 58   ILE D O     1 
ATOM   2518  C  CB    . ILE D 4 61  ? -0.262  -12.139 42.823 1.00 38.47  ? 58   ILE D CB    1 
ATOM   2519  C  CG1   . ILE D 4 61  ? 0.188   -13.413 43.539 1.00 38.27  ? 58   ILE D CG1   1 
ATOM   2520  C  CG2   . ILE D 4 61  ? -1.602  -11.653 43.363 1.00 37.11  ? 58   ILE D CG2   1 
ATOM   2521  C  CD1   . ILE D 4 61  ? 0.807   -13.164 44.892 1.00 37.12  ? 58   ILE D CD1   1 
ATOM   2522  N  N     . MET D 4 62  ? -0.497  -10.147 40.311 1.00 39.22  ? 59   MET D N     1 
ATOM   2523  C  CA    . MET D 4 62  ? -1.185  -9.074  39.588 1.00 39.47  ? 59   MET D CA    1 
ATOM   2524  C  C     . MET D 4 62  ? -1.629  -9.573  38.232 1.00 39.06  ? 59   MET D C     1 
ATOM   2525  O  O     . MET D 4 62  ? -2.771  -9.369  37.829 1.00 39.01  ? 59   MET D O     1 
ATOM   2526  C  CB    . MET D 4 62  ? -0.318  -7.814  39.467 1.00 39.42  ? 59   MET D CB    1 
ATOM   2527  C  CG    . MET D 4 62  ? -0.206  -7.037  40.770 1.00 39.43  ? 59   MET D CG    1 
ATOM   2528  S  SD    . MET D 4 62  ? -1.819  -6.727  41.521 1.00 40.53  ? 59   MET D SD    1 
ATOM   2529  C  CE    . MET D 4 62  ? -2.580  -5.710  40.255 1.00 39.68  ? 59   MET D CE    1 
ATOM   2530  N  N     . ASN D 4 63  ? -0.742  -10.280 37.551 1.00 39.29  ? 60   ASN D N     1 
ATOM   2531  C  CA    . ASN D 4 63  ? -1.112  -10.845 36.255 1.00 39.46  ? 60   ASN D CA    1 
ATOM   2532  C  C     . ASN D 4 63  ? -2.296  -11.797 36.329 1.00 39.19  ? 60   ASN D C     1 
ATOM   2533  O  O     . ASN D 4 63  ? -3.164  -11.781 35.448 1.00 37.95  ? 60   ASN D O     1 
ATOM   2534  C  CB    . ASN D 4 63  ? 0.055   -11.530 35.580 1.00 39.54  ? 60   ASN D CB    1 
ATOM   2535  C  CG    . ASN D 4 63  ? -0.236  -11.830 34.128 1.00 41.44  ? 60   ASN D CG    1 
ATOM   2536  O  OD1   . ASN D 4 63  ? -0.758  -10.985 33.407 1.00 42.36  ? 60   ASN D OD1   1 
ATOM   2537  N  ND2   . ASN D 4 63  ? 0.090   -13.044 33.690 1.00 43.58  ? 60   ASN D ND2   1 
ATOM   2538  N  N     . SER D 4 64  ? -2.327  -12.623 37.385 1.00 39.37  ? 61   SER D N     1 
ATOM   2539  C  CA    . SER D 4 64  ? -3.428  -13.560 37.575 1.00 39.62  ? 61   SER D CA    1 
ATOM   2540  C  C     . SER D 4 64  ? -4.744  -12.812 37.832 1.00 39.85  ? 61   SER D C     1 
ATOM   2541  O  O     . SER D 4 64  ? -5.781  -13.154 37.270 1.00 39.95  ? 61   SER D O     1 
ATOM   2542  C  CB    . SER D 4 64  ? -3.131  -14.506 38.726 1.00 40.00  ? 61   SER D CB    1 
ATOM   2543  O  OG    . SER D 4 64  ? -2.250  -15.547 38.333 1.00 42.50  ? 61   SER D OG    1 
ATOM   2544  N  N     . PHE D 4 65  ? -4.690  -11.787 38.681 1.00 39.69  ? 62   PHE D N     1 
ATOM   2545  C  CA    . PHE D 4 65  ? -5.856  -10.972 38.993 1.00 39.33  ? 62   PHE D CA    1 
ATOM   2546  C  C     . PHE D 4 65  ? -6.487  -10.350 37.734 1.00 39.53  ? 62   PHE D C     1 
ATOM   2547  O  O     . PHE D 4 65  ? -7.724  -10.342 37.578 1.00 39.19  ? 62   PHE D O     1 
ATOM   2548  C  CB    . PHE D 4 65  ? -5.461  -9.885  40.000 1.00 39.32  ? 62   PHE D CB    1 
ATOM   2549  C  CG    . PHE D 4 65  ? -6.492  -8.816  40.185 1.00 39.04  ? 62   PHE D CG    1 
ATOM   2550  C  CD1   . PHE D 4 65  ? -7.679  -9.082  40.844 1.00 39.66  ? 62   PHE D CD1   1 
ATOM   2551  C  CD2   . PHE D 4 65  ? -6.267  -7.534  39.708 1.00 39.80  ? 62   PHE D CD2   1 
ATOM   2552  C  CE1   . PHE D 4 65  ? -8.631  -8.094  41.024 1.00 40.19  ? 62   PHE D CE1   1 
ATOM   2553  C  CE2   . PHE D 4 65  ? -7.208  -6.539  39.882 1.00 40.46  ? 62   PHE D CE2   1 
ATOM   2554  C  CZ    . PHE D 4 65  ? -8.399  -6.819  40.539 1.00 40.51  ? 62   PHE D CZ    1 
ATOM   2555  N  N     . VAL D 4 66  ? -5.642  -9.828  36.844 1.00 39.18  ? 63   VAL D N     1 
ATOM   2556  C  CA    . VAL D 4 66  ? -6.134  -9.171  35.637 1.00 38.85  ? 63   VAL D CA    1 
ATOM   2557  C  C     . VAL D 4 66  ? -6.826  -10.176 34.743 1.00 38.90  ? 63   VAL D C     1 
ATOM   2558  O  O     . VAL D 4 66  ? -7.937  -9.932  34.278 1.00 39.68  ? 63   VAL D O     1 
ATOM   2559  C  CB    . VAL D 4 66  ? -5.019  -8.437  34.853 1.00 38.68  ? 63   VAL D CB    1 
ATOM   2560  C  CG1   . VAL D 4 66  ? -5.611  -7.707  33.676 1.00 37.94  ? 63   VAL D CG1   1 
ATOM   2561  C  CG2   . VAL D 4 66  ? -4.285  -7.458  35.752 1.00 38.45  ? 63   VAL D CG2   1 
ATOM   2562  N  N     . ASN D 4 67  ? -6.165  -11.305 34.505 1.00 39.11  ? 64   ASN D N     1 
ATOM   2563  C  CA    . ASN D 4 67  ? -6.749  -12.401 33.743 1.00 38.80  ? 64   ASN D CA    1 
ATOM   2564  C  C     . ASN D 4 67  ? -8.070  -12.848 34.344 1.00 38.35  ? 64   ASN D C     1 
ATOM   2565  O  O     . ASN D 4 67  ? -9.069  -12.956 33.639 1.00 38.93  ? 64   ASN D O     1 
ATOM   2566  C  CB    . ASN D 4 67  ? -5.772  -13.575 33.658 1.00 38.65  ? 64   ASN D CB    1 
ATOM   2567  C  CG    . ASN D 4 67  ? -4.559  -13.271 32.775 1.00 40.71  ? 64   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D 4 67  ? -4.683  -12.669 31.696 1.00 42.63  ? 64   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D 4 67  ? -3.374  -13.704 33.223 1.00 41.68  ? 64   ASN D ND2   1 
ATOM   2570  N  N     . ASP D 4 68  ? -8.068  -13.107 35.646 1.00 37.93  ? 65   ASP D N     1 
ATOM   2571  C  CA    . ASP D 4 68  ? -9.267  -13.513 36.369 1.00 37.91  ? 65   ASP D CA    1 
ATOM   2572  C  C     . ASP D 4 68  ? -10.466 -12.564 36.165 1.00 38.00  ? 65   ASP D C     1 
ATOM   2573  O  O     . ASP D 4 68  ? -11.519 -12.973 35.694 1.00 38.22  ? 65   ASP D O     1 
ATOM   2574  C  CB    . ASP D 4 68  ? -8.943  -13.676 37.855 1.00 37.85  ? 65   ASP D CB    1 
ATOM   2575  C  CG    . ASP D 4 68  ? -10.135 -14.171 38.673 1.00 38.82  ? 65   ASP D CG    1 
ATOM   2576  O  OD1   . ASP D 4 68  ? -11.090 -14.753 38.089 1.00 39.44  ? 65   ASP D OD1   1 
ATOM   2577  O  OD2   . ASP D 4 68  ? -10.117 -13.969 39.909 1.00 37.07  ? 65   ASP D OD2   1 
ATOM   2578  N  N     . VAL D 4 69  ? -10.298 -11.294 36.496 1.00 38.42  ? 66   VAL D N     1 
ATOM   2579  C  CA    . VAL D 4 69  ? -11.367 -10.307 36.305 1.00 38.73  ? 66   VAL D CA    1 
ATOM   2580  C  C     . VAL D 4 69  ? -11.808 -10.214 34.836 1.00 38.93  ? 66   VAL D C     1 
ATOM   2581  O  O     . VAL D 4 69  ? -13.007 -10.144 34.549 1.00 38.35  ? 66   VAL D O     1 
ATOM   2582  C  CB    . VAL D 4 69  ? -10.972 -8.908  36.890 1.00 38.55  ? 66   VAL D CB    1 
ATOM   2583  C  CG1   . VAL D 4 69  ? -12.035 -7.905  36.618 1.00 39.26  ? 66   VAL D CG1   1 
ATOM   2584  C  CG2   . VAL D 4 69  ? -10.796 -9.000  38.386 1.00 37.60  ? 66   VAL D CG2   1 
ATOM   2585  N  N     . PHE D 4 70  ? -10.844 -10.238 33.916 1.00 39.63  ? 67   PHE D N     1 
ATOM   2586  C  CA    . PHE D 4 70  ? -11.163 -10.285 32.493 1.00 40.84  ? 67   PHE D CA    1 
ATOM   2587  C  C     . PHE D 4 70  ? -12.138 -11.435 32.221 1.00 41.50  ? 67   PHE D C     1 
ATOM   2588  O  O     . PHE D 4 70  ? -13.216 -11.202 31.666 1.00 42.05  ? 67   PHE D O     1 
ATOM   2589  C  CB    . PHE D 4 70  ? -9.895  -10.400 31.638 1.00 41.22  ? 67   PHE D CB    1 
ATOM   2590  C  CG    . PHE D 4 70  ? -10.157 -10.552 30.155 1.00 42.31  ? 67   PHE D CG    1 
ATOM   2591  C  CD1   . PHE D 4 70  ? -10.048 -9.465  29.303 1.00 44.14  ? 67   PHE D CD1   1 
ATOM   2592  C  CD2   . PHE D 4 70  ? -10.471 -11.786 29.610 1.00 43.75  ? 67   PHE D CD2   1 
ATOM   2593  C  CE1   . PHE D 4 70  ? -10.280 -9.597  27.936 1.00 44.39  ? 67   PHE D CE1   1 
ATOM   2594  C  CE2   . PHE D 4 70  ? -10.707 -11.924 28.240 1.00 44.92  ? 67   PHE D CE2   1 
ATOM   2595  C  CZ    . PHE D 4 70  ? -10.608 -10.823 27.409 1.00 44.51  ? 67   PHE D CZ    1 
ATOM   2596  N  N     . GLU D 4 71  ? -11.781 -12.657 32.632 1.00 42.03  ? 68   GLU D N     1 
ATOM   2597  C  CA    . GLU D 4 71  ? -12.626 -13.840 32.389 1.00 43.06  ? 68   GLU D CA    1 
ATOM   2598  C  C     . GLU D 4 71  ? -14.005 -13.724 33.016 1.00 42.49  ? 68   GLU D C     1 
ATOM   2599  O  O     . GLU D 4 71  ? -15.005 -14.125 32.422 1.00 42.01  ? 68   GLU D O     1 
ATOM   2600  C  CB    . GLU D 4 71  ? -11.970 -15.106 32.919 1.00 44.02  ? 68   GLU D CB    1 
ATOM   2601  C  CG    . GLU D 4 71  ? -10.921 -15.731 32.005 1.00 48.61  ? 68   GLU D CG    1 
ATOM   2602  C  CD    . GLU D 4 71  ? -9.913  -16.580 32.784 1.00 55.21  ? 68   GLU D CD    1 
ATOM   2603  O  OE1   . GLU D 4 71  ? -10.346 -17.412 33.632 1.00 56.63  ? 68   GLU D OE1   1 
ATOM   2604  O  OE2   . GLU D 4 71  ? -8.683  -16.406 32.558 1.00 59.22  ? 68   GLU D OE2   1 
ATOM   2605  N  N     . ARG D 4 72  ? -14.061 -13.169 34.220 1.00 41.93  ? 69   ARG D N     1 
ATOM   2606  C  CA    . ARG D 4 72  ? -15.349 -12.997 34.873 1.00 41.46  ? 69   ARG D CA    1 
ATOM   2607  C  C     . ARG D 4 72  ? -16.254 -11.978 34.192 1.00 41.12  ? 69   ARG D C     1 
ATOM   2608  O  O     . ARG D 4 72  ? -17.466 -12.192 34.133 1.00 41.61  ? 69   ARG D O     1 
ATOM   2609  C  CB    . ARG D 4 72  ? -15.190 -12.664 36.343 1.00 41.34  ? 69   ARG D CB    1 
ATOM   2610  C  CG    . ARG D 4 72  ? -14.390 -13.680 37.131 1.00 42.26  ? 69   ARG D CG    1 
ATOM   2611  C  CD    . ARG D 4 72  ? -14.752 -13.563 38.613 1.00 43.54  ? 69   ARG D CD    1 
ATOM   2612  N  NE    . ARG D 4 72  ? -13.564 -13.473 39.438 1.00 41.23  ? 69   ARG D NE    1 
ATOM   2613  C  CZ    . ARG D 4 72  ? -13.557 -13.046 40.692 1.00 41.45  ? 69   ARG D CZ    1 
ATOM   2614  N  NH1   . ARG D 4 72  ? -14.691 -12.668 41.274 1.00 39.47  ? 69   ARG D NH1   1 
ATOM   2615  N  NH2   . ARG D 4 72  ? -12.403 -12.995 41.364 1.00 41.68  ? 69   ARG D NH2   1 
ATOM   2616  N  N     . ILE D 4 73  ? -15.693 -10.888 33.662 1.00 40.60  ? 70   ILE D N     1 
ATOM   2617  C  CA    . ILE D 4 73  ? -16.532 -9.866  32.998 1.00 39.81  ? 70   ILE D CA    1 
ATOM   2618  C  C     . ILE D 4 73  ? -16.978 -10.343 31.613 1.00 40.08  ? 70   ILE D C     1 
ATOM   2619  O  O     . ILE D 4 73  ? -18.170 -10.299 31.292 1.00 40.02  ? 70   ILE D O     1 
ATOM   2620  C  CB    . ILE D 4 73  ? -15.856 -8.471  32.960 1.00 39.62  ? 70   ILE D CB    1 
ATOM   2621  C  CG1   . ILE D 4 73  ? -15.842 -7.876  34.371 1.00 38.44  ? 70   ILE D CG1   1 
ATOM   2622  C  CG2   . ILE D 4 73  ? -16.590 -7.531  31.971 1.00 39.42  ? 70   ILE D CG2   1 
ATOM   2623  C  CD1   . ILE D 4 73  ? -14.811 -6.796  34.614 1.00 37.02  ? 70   ILE D CD1   1 
ATOM   2624  N  N     . ALA D 4 74  ? -16.029 -10.827 30.810 1.00 40.34  ? 71   ALA D N     1 
ATOM   2625  C  CA    . ALA D 4 74  ? -16.344 -11.419 29.498 1.00 40.74  ? 71   ALA D CA    1 
ATOM   2626  C  C     . ALA D 4 74  ? -17.432 -12.504 29.596 1.00 41.14  ? 71   ALA D C     1 
ATOM   2627  O  O     . ALA D 4 74  ? -18.373 -12.527 28.800 1.00 41.30  ? 71   ALA D O     1 
ATOM   2628  C  CB    . ALA D 4 74  ? -15.086 -11.965 28.852 1.00 40.37  ? 71   ALA D CB    1 
ATOM   2629  N  N     . GLY D 4 75  ? -17.311 -13.372 30.597 1.00 41.31  ? 72   GLY D N     1 
ATOM   2630  C  CA    . GLY D 4 75  ? -18.282 -14.428 30.838 1.00 41.98  ? 72   GLY D CA    1 
ATOM   2631  C  C     . GLY D 4 75  ? -19.683 -13.925 31.116 1.00 42.60  ? 72   GLY D C     1 
ATOM   2632  O  O     . GLY D 4 75  ? -20.627 -14.365 30.472 1.00 42.28  ? 72   GLY D O     1 
ATOM   2633  N  N     . GLU D 4 76  ? -19.828 -13.020 32.084 1.00 43.57  ? 73   GLU D N     1 
ATOM   2634  C  CA    . GLU D 4 76  ? -21.127 -12.377 32.327 1.00 44.57  ? 73   GLU D CA    1 
ATOM   2635  C  C     . GLU D 4 76  ? -21.652 -11.735 31.053 1.00 44.85  ? 73   GLU D C     1 
ATOM   2636  O  O     . GLU D 4 76  ? -22.830 -11.896 30.724 1.00 44.95  ? 73   GLU D O     1 
ATOM   2637  C  CB    . GLU D 4 76  ? -21.044 -11.298 33.407 1.00 44.89  ? 73   GLU D CB    1 
ATOM   2638  C  CG    . GLU D 4 76  ? -20.893 -11.791 34.825 1.00 47.48  ? 73   GLU D CG    1 
ATOM   2639  C  CD    . GLU D 4 76  ? -22.126 -12.548 35.361 1.00 50.67  ? 73   GLU D CD    1 
ATOM   2640  O  OE1   . GLU D 4 76  ? -23.125 -12.757 34.618 1.00 51.28  ? 73   GLU D OE1   1 
ATOM   2641  O  OE2   . GLU D 4 76  ? -22.070 -12.943 36.546 1.00 50.59  ? 73   GLU D OE2   1 
ATOM   2642  N  N     . ALA D 4 77  ? -20.780 -11.007 30.345 1.00 45.01  ? 74   ALA D N     1 
ATOM   2643  C  CA    . ALA D 4 77  ? -21.160 -10.374 29.087 1.00 45.66  ? 74   ALA D CA    1 
ATOM   2644  C  C     . ALA D 4 77  ? -21.671 -11.429 28.113 1.00 46.29  ? 74   ALA D C     1 
ATOM   2645  O  O     . ALA D 4 77  ? -22.712 -11.246 27.482 1.00 46.49  ? 74   ALA D O     1 
ATOM   2646  C  CB    . ALA D 4 77  ? -19.989 -9.611  28.489 1.00 45.39  ? 74   ALA D CB    1 
ATOM   2647  N  N     . SER D 4 78  ? -20.942 -12.541 28.019 1.00 46.92  ? 75   SER D N     1 
ATOM   2648  C  CA    . SER D 4 78  ? -21.299 -13.633 27.131 1.00 47.86  ? 75   SER D CA    1 
ATOM   2649  C  C     . SER D 4 78  ? -22.727 -14.073 27.389 1.00 48.57  ? 75   SER D C     1 
ATOM   2650  O  O     . SER D 4 78  ? -23.555 -14.084 26.466 1.00 49.08  ? 75   SER D O     1 
ATOM   2651  C  CB    . SER D 4 78  ? -20.353 -14.812 27.332 1.00 47.84  ? 75   SER D CB    1 
ATOM   2652  O  OG    . SER D 4 78  ? -20.583 -15.815 26.365 1.00 48.09  ? 75   SER D OG    1 
ATOM   2653  N  N     . ARG D 4 79  ? -22.995 -14.409 28.650 1.00 49.20  ? 76   ARG D N     1 
ATOM   2654  C  CA    . ARG D 4 79  ? -24.286 -14.896 29.111 1.00 50.12  ? 76   ARG D CA    1 
ATOM   2655  C  C     . ARG D 4 79  ? -25.377 -13.889 28.831 1.00 50.53  ? 76   ARG D C     1 
ATOM   2656  O  O     . ARG D 4 79  ? -26.381 -14.204 28.189 1.00 50.69  ? 76   ARG D O     1 
ATOM   2657  C  CB    . ARG D 4 79  ? -24.235 -15.192 30.613 1.00 50.06  ? 76   ARG D CB    1 
ATOM   2658  C  CG    . ARG D 4 79  ? -24.188 -16.654 30.959 1.00 50.50  ? 76   ARG D CG    1 
ATOM   2659  C  CD    . ARG D 4 79  ? -23.782 -16.880 32.426 1.00 51.32  ? 76   ARG D CD    1 
ATOM   2660  N  NE    . ARG D 4 79  ? -22.351 -17.169 32.545 1.00 50.64  ? 76   ARG D NE    1 
ATOM   2661  C  CZ    . ARG D 4 79  ? -21.500 -16.512 33.325 1.00 50.33  ? 76   ARG D CZ    1 
ATOM   2662  N  NH1   . ARG D 4 79  ? -21.920 -15.514 34.098 1.00 51.17  ? 76   ARG D NH1   1 
ATOM   2663  N  NH2   . ARG D 4 79  ? -20.223 -16.862 33.334 1.00 49.51  ? 76   ARG D NH2   1 
ATOM   2664  N  N     . LEU D 4 80  ? -25.163 -12.674 29.312 1.00 51.32  ? 77   LEU D N     1 
ATOM   2665  C  CA    . LEU D 4 80  ? -26.105 -11.580 29.123 1.00 52.28  ? 77   LEU D CA    1 
ATOM   2666  C  C     . LEU D 4 80  ? -26.555 -11.452 27.668 1.00 52.92  ? 77   LEU D C     1 
ATOM   2667  O  O     . LEU D 4 80  ? -27.750 -11.316 27.393 1.00 52.81  ? 77   LEU D O     1 
ATOM   2668  C  CB    . LEU D 4 80  ? -25.477 -10.277 29.606 1.00 51.99  ? 77   LEU D CB    1 
ATOM   2669  C  CG    . LEU D 4 80  ? -26.324 -9.010  29.586 1.00 52.49  ? 77   LEU D CG    1 
ATOM   2670  C  CD1   . LEU D 4 80  ? -27.488 -9.056  30.578 1.00 52.17  ? 77   LEU D CD1   1 
ATOM   2671  C  CD2   . LEU D 4 80  ? -25.406 -7.861  29.899 1.00 53.20  ? 77   LEU D CD2   1 
ATOM   2672  N  N     . ALA D 4 81  ? -25.594 -11.508 26.749 1.00 53.94  ? 78   ALA D N     1 
ATOM   2673  C  CA    . ALA D 4 81  ? -25.878 -11.427 25.325 1.00 55.58  ? 78   ALA D CA    1 
ATOM   2674  C  C     . ALA D 4 81  ? -26.781 -12.572 24.884 1.00 56.78  ? 78   ALA D C     1 
ATOM   2675  O  O     . ALA D 4 81  ? -27.783 -12.364 24.183 1.00 57.21  ? 78   ALA D O     1 
ATOM   2676  C  CB    . ALA D 4 81  ? -24.595 -11.443 24.537 1.00 55.49  ? 78   ALA D CB    1 
ATOM   2677  N  N     . HIS D 4 82  ? -26.432 -13.780 25.310 1.00 57.92  ? 79   HIS D N     1 
ATOM   2678  C  CA    . HIS D 4 82  ? -27.215 -14.942 24.961 1.00 59.07  ? 79   HIS D CA    1 
ATOM   2679  C  C     . HIS D 4 82  ? -28.642 -14.772 25.467 1.00 59.09  ? 79   HIS D C     1 
ATOM   2680  O  O     . HIS D 4 82  ? -29.588 -14.979 24.713 1.00 59.10  ? 79   HIS D O     1 
ATOM   2681  C  CB    . HIS D 4 82  ? -26.568 -16.216 25.500 1.00 59.76  ? 79   HIS D CB    1 
ATOM   2682  C  CG    . HIS D 4 82  ? -27.292 -17.463 25.102 1.00 62.88  ? 79   HIS D CG    1 
ATOM   2683  N  ND1   . HIS D 4 82  ? -27.284 -17.948 23.805 1.00 65.36  ? 79   HIS D ND1   1 
ATOM   2684  C  CD2   . HIS D 4 82  ? -28.067 -18.312 25.824 1.00 64.98  ? 79   HIS D CD2   1 
ATOM   2685  C  CE1   . HIS D 4 82  ? -28.020 -19.045 23.747 1.00 66.11  ? 79   HIS D CE1   1 
ATOM   2686  N  NE2   . HIS D 4 82  ? -28.509 -19.285 24.957 1.00 66.42  ? 79   HIS D NE2   1 
ATOM   2687  N  N     . TYR D 4 83  ? -28.787 -14.338 26.720 1.00 59.33  ? 80   TYR D N     1 
ATOM   2688  C  CA    . TYR D 4 83  ? -30.097 -14.175 27.345 1.00 59.61  ? 80   TYR D CA    1 
ATOM   2689  C  C     . TYR D 4 83  ? -31.015 -13.232 26.577 1.00 59.75  ? 80   TYR D C     1 
ATOM   2690  O  O     . TYR D 4 83  ? -32.240 -13.382 26.628 1.00 59.63  ? 80   TYR D O     1 
ATOM   2691  C  CB    . TYR D 4 83  ? -29.970 -13.676 28.783 1.00 59.73  ? 80   TYR D CB    1 
ATOM   2692  C  CG    . TYR D 4 83  ? -29.220 -14.587 29.736 1.00 60.82  ? 80   TYR D CG    1 
ATOM   2693  C  CD1   . TYR D 4 83  ? -28.669 -14.072 30.913 1.00 61.32  ? 80   TYR D CD1   1 
ATOM   2694  C  CD2   . TYR D 4 83  ? -29.052 -15.954 29.471 1.00 61.25  ? 80   TYR D CD2   1 
ATOM   2695  C  CE1   . TYR D 4 83  ? -27.980 -14.882 31.811 1.00 60.46  ? 80   TYR D CE1   1 
ATOM   2696  C  CE2   . TYR D 4 83  ? -28.351 -16.779 30.364 1.00 61.40  ? 80   TYR D CE2   1 
ATOM   2697  C  CZ    . TYR D 4 83  ? -27.819 -16.229 31.534 1.00 61.80  ? 80   TYR D CZ    1 
ATOM   2698  O  OH    . TYR D 4 83  ? -27.128 -17.022 32.435 1.00 62.20  ? 80   TYR D OH    1 
ATOM   2699  N  N     . ASN D 4 84  ? -30.419 -12.265 25.874 1.00 60.01  ? 81   ASN D N     1 
ATOM   2700  C  CA    . ASN D 4 84  ? -31.177 -11.275 25.106 1.00 60.10  ? 81   ASN D CA    1 
ATOM   2701  C  C     . ASN D 4 84  ? -31.137 -11.530 23.602 1.00 60.55  ? 81   ASN D C     1 
ATOM   2702  O  O     . ASN D 4 84  ? -31.469 -10.639 22.810 1.00 61.01  ? 81   ASN D O     1 
ATOM   2703  C  CB    . ASN D 4 84  ? -30.684 -9.853  25.397 1.00 60.05  ? 81   ASN D CB    1 
ATOM   2704  C  CG    . ASN D 4 84  ? -30.941 -9.424  26.818 1.00 59.10  ? 81   ASN D CG    1 
ATOM   2705  O  OD1   . ASN D 4 84  ? -31.984 -8.857  27.128 1.00 58.23  ? 81   ASN D OD1   1 
ATOM   2706  N  ND2   . ASN D 4 84  ? -29.989 -9.696  27.695 1.00 59.04  ? 81   ASN D ND2   1 
ATOM   2707  N  N     . LYS D 4 85  ? -30.728 -12.739 23.212 1.00 60.84  ? 82   LYS D N     1 
ATOM   2708  C  CA    . LYS D 4 85  ? -30.680 -13.146 21.798 1.00 60.98  ? 82   LYS D CA    1 
ATOM   2709  C  C     . LYS D 4 85  ? -29.864 -12.175 20.946 1.00 60.53  ? 82   LYS D C     1 
ATOM   2710  O  O     . LYS D 4 85  ? -30.317 -11.722 19.900 1.00 60.89  ? 82   LYS D O     1 
ATOM   2711  C  CB    . LYS D 4 85  ? -32.093 -13.310 21.228 1.00 61.16  ? 82   LYS D CB    1 
ATOM   2712  C  CG    . LYS D 4 85  ? -32.933 -14.373 21.920 1.00 62.83  ? 82   LYS D CG    1 
ATOM   2713  C  CD    . LYS D 4 85  ? -34.382 -13.915 22.076 1.00 65.61  ? 82   LYS D CD    1 
ATOM   2714  C  CE    . LYS D 4 85  ? -35.236 -14.967 22.794 1.00 67.31  ? 82   LYS D CE    1 
ATOM   2715  N  NZ    . LYS D 4 85  ? -35.673 -16.070 21.867 1.00 68.46  ? 82   LYS D NZ    1 
ATOM   2716  N  N     . ARG D 4 86  ? -28.663 -11.859 21.414 1.00 60.05  ? 83   ARG D N     1 
ATOM   2717  C  CA    . ARG D 4 86  ? -27.766 -10.953 20.717 1.00 59.78  ? 83   ARG D CA    1 
ATOM   2718  C  C     . ARG D 4 86  ? -26.477 -11.675 20.378 1.00 59.00  ? 83   ARG D C     1 
ATOM   2719  O  O     . ARG D 4 86  ? -25.976 -12.468 21.172 1.00 59.44  ? 83   ARG D O     1 
ATOM   2720  C  CB    . ARG D 4 86  ? -27.453 -9.734  21.590 1.00 60.15  ? 83   ARG D CB    1 
ATOM   2721  C  CG    . ARG D 4 86  ? -28.670 -8.902  21.972 1.00 61.58  ? 83   ARG D CG    1 
ATOM   2722  C  CD    . ARG D 4 86  ? -29.002 -7.876  20.903 1.00 64.14  ? 83   ARG D CD    1 
ATOM   2723  N  NE    . ARG D 4 86  ? -30.227 -7.153  21.225 1.00 66.14  ? 83   ARG D NE    1 
ATOM   2724  C  CZ    . ARG D 4 86  ? -31.429 -7.462  20.742 1.00 67.83  ? 83   ARG D CZ    1 
ATOM   2725  N  NH1   . ARG D 4 86  ? -31.579 -8.479  19.897 1.00 68.63  ? 83   ARG D NH1   1 
ATOM   2726  N  NH2   . ARG D 4 86  ? -32.486 -6.746  21.102 1.00 68.86  ? 83   ARG D NH2   1 
ATOM   2727  N  N     . SER D 4 87  ? -25.934 -11.393 19.202 1.00 57.85  ? 84   SER D N     1 
ATOM   2728  C  CA    . SER D 4 87  ? -24.699 -12.029 18.771 1.00 56.72  ? 84   SER D CA    1 
ATOM   2729  C  C     . SER D 4 87  ? -23.481 -11.124 18.983 1.00 56.06  ? 84   SER D C     1 
ATOM   2730  O  O     . SER D 4 87  ? -22.344 -11.498 18.656 1.00 55.84  ? 84   SER D O     1 
ATOM   2731  C  CB    . SER D 4 87  ? -24.817 -12.441 17.305 1.00 56.79  ? 84   SER D CB    1 
ATOM   2732  O  OG    . SER D 4 87  ? -25.247 -11.355 16.516 1.00 56.57  ? 84   SER D OG    1 
ATOM   2733  N  N     . THR D 4 88  ? -23.717 -9.941  19.541 1.00 54.97  ? 85   THR D N     1 
ATOM   2734  C  CA    . THR D 4 88  ? -22.654 -8.951  19.671 1.00 54.37  ? 85   THR D CA    1 
ATOM   2735  C  C     . THR D 4 88  ? -22.417 -8.556  21.126 1.00 53.57  ? 85   THR D C     1 
ATOM   2736  O  O     . THR D 4 88  ? -23.358 -8.239  21.852 1.00 53.26  ? 85   THR D O     1 
ATOM   2737  C  CB    . THR D 4 88  ? -22.938 -7.662  18.829 1.00 54.50  ? 85   THR D CB    1 
ATOM   2738  O  OG1   . THR D 4 88  ? -23.649 -7.996  17.631 1.00 54.46  ? 85   THR D OG1   1 
ATOM   2739  C  CG2   . THR D 4 88  ? -21.637 -6.960  18.461 1.00 54.26  ? 85   THR D CG2   1 
ATOM   2740  N  N     . ILE D 4 89  ? -21.157 -8.587  21.550 1.00 52.82  ? 86   ILE D N     1 
ATOM   2741  C  CA    . ILE D 4 89  ? -20.794 -8.021  22.851 1.00 52.07  ? 86   ILE D CA    1 
ATOM   2742  C  C     . ILE D 4 89  ? -20.337 -6.576  22.655 1.00 51.67  ? 86   ILE D C     1 
ATOM   2743  O  O     . ILE D 4 89  ? -19.307 -6.309  22.033 1.00 51.41  ? 86   ILE D O     1 
ATOM   2744  C  CB    . ILE D 4 89  ? -19.727 -8.847  23.598 1.00 51.63  ? 86   ILE D CB    1 
ATOM   2745  C  CG1   . ILE D 4 89  ? -20.340 -10.139 24.133 1.00 52.04  ? 86   ILE D CG1   1 
ATOM   2746  C  CG2   . ILE D 4 89  ? -19.192 -8.067  24.777 1.00 51.66  ? 86   ILE D CG2   1 
ATOM   2747  C  CD1   . ILE D 4 89  ? -19.317 -11.206 24.465 1.00 50.78  ? 86   ILE D CD1   1 
ATOM   2748  N  N     . THR D 4 90  ? -21.130 -5.651  23.172 1.00 51.21  ? 87   THR D N     1 
ATOM   2749  C  CA    . THR D 4 90  ? -20.813 -4.237  23.073 1.00 51.18  ? 87   THR D CA    1 
ATOM   2750  C  C     . THR D 4 90  ? -20.480 -3.688  24.455 1.00 50.84  ? 87   THR D C     1 
ATOM   2751  O  O     . THR D 4 90  ? -20.773 -4.318  25.473 1.00 51.21  ? 87   THR D O     1 
ATOM   2752  C  CB    . THR D 4 90  ? -21.997 -3.431  22.482 1.00 51.21  ? 87   THR D CB    1 
ATOM   2753  O  OG1   . THR D 4 90  ? -23.008 -3.254  23.484 1.00 52.25  ? 87   THR D OG1   1 
ATOM   2754  C  CG2   . THR D 4 90  ? -22.599 -4.138  21.269 1.00 50.66  ? 87   THR D CG2   1 
ATOM   2755  N  N     . SER D 4 91  ? -19.894 -2.499  24.489 1.00 50.36  ? 88   SER D N     1 
ATOM   2756  C  CA    . SER D 4 91  ? -19.600 -1.814  25.745 1.00 49.82  ? 88   SER D CA    1 
ATOM   2757  C  C     . SER D 4 91  ? -20.805 -1.765  26.680 1.00 49.41  ? 88   SER D C     1 
ATOM   2758  O  O     . SER D 4 91  ? -20.638 -1.669  27.895 1.00 49.78  ? 88   SER D O     1 
ATOM   2759  C  CB    . SER D 4 91  ? -19.058 -0.402  25.481 1.00 49.82  ? 88   SER D CB    1 
ATOM   2760  O  OG    . SER D 4 91  ? -20.110 0.532   25.333 1.00 50.03  ? 88   SER D OG    1 
ATOM   2761  N  N     . ARG D 4 92  ? -22.011 -1.851  26.121 1.00 48.83  ? 89   ARG D N     1 
ATOM   2762  C  CA    . ARG D 4 92  ? -23.226 -1.946  26.934 1.00 48.59  ? 89   ARG D CA    1 
ATOM   2763  C  C     . ARG D 4 92  ? -23.326 -3.276  27.716 1.00 48.03  ? 89   ARG D C     1 
ATOM   2764  O  O     . ARG D 4 92  ? -23.671 -3.283  28.898 1.00 48.07  ? 89   ARG D O     1 
ATOM   2765  C  CB    . ARG D 4 92  ? -24.472 -1.728  26.079 1.00 48.63  ? 89   ARG D CB    1 
ATOM   2766  C  CG    . ARG D 4 92  ? -25.714 -1.534  26.909 1.00 50.37  ? 89   ARG D CG    1 
ATOM   2767  C  CD    . ARG D 4 92  ? -26.882 -1.010  26.092 1.00 54.99  ? 89   ARG D CD    1 
ATOM   2768  N  NE    . ARG D 4 92  ? -28.038 -0.754  26.955 1.00 57.26  ? 89   ARG D NE    1 
ATOM   2769  C  CZ    . ARG D 4 92  ? -28.928 -1.676  27.305 1.00 58.12  ? 89   ARG D CZ    1 
ATOM   2770  N  NH1   . ARG D 4 92  ? -28.808 -2.926  26.860 1.00 57.64  ? 89   ARG D NH1   1 
ATOM   2771  N  NH2   . ARG D 4 92  ? -29.942 -1.343  28.096 1.00 59.36  ? 89   ARG D NH2   1 
ATOM   2772  N  N     . GLU D 4 93  ? -23.049 -4.393  27.046 1.00 47.27  ? 90   GLU D N     1 
ATOM   2773  C  CA    . GLU D 4 93  ? -22.956 -5.695  27.708 1.00 46.48  ? 90   GLU D CA    1 
ATOM   2774  C  C     . GLU D 4 93  ? -21.880 -5.685  28.800 1.00 45.80  ? 90   GLU D C     1 
ATOM   2775  O  O     . GLU D 4 93  ? -22.134 -6.126  29.929 1.00 45.65  ? 90   GLU D O     1 
ATOM   2776  C  CB    . GLU D 4 93  ? -22.676 -6.816  26.695 1.00 46.30  ? 90   GLU D CB    1 
ATOM   2777  C  CG    . GLU D 4 93  ? -23.919 -7.350  26.011 1.00 47.31  ? 90   GLU D CG    1 
ATOM   2778  C  CD    . GLU D 4 93  ? -24.631 -6.299  25.179 1.00 48.26  ? 90   GLU D CD    1 
ATOM   2779  O  OE1   . GLU D 4 93  ? -25.865 -6.142  25.337 1.00 48.22  ? 90   GLU D OE1   1 
ATOM   2780  O  OE2   . GLU D 4 93  ? -23.944 -5.625  24.380 1.00 48.18  ? 90   GLU D OE2   1 
ATOM   2781  N  N     . ILE D 4 94  ? -20.690 -5.178  28.468 1.00 44.47  ? 91   ILE D N     1 
ATOM   2782  C  CA    . ILE D 4 94  ? -19.609 -5.074  29.449 1.00 43.62  ? 91   ILE D CA    1 
ATOM   2783  C  C     . ILE D 4 94  ? -20.066 -4.278  30.675 1.00 43.86  ? 91   ILE D C     1 
ATOM   2784  O  O     . ILE D 4 94  ? -19.738 -4.627  31.809 1.00 43.60  ? 91   ILE D O     1 
ATOM   2785  C  CB    . ILE D 4 94  ? -18.348 -4.397  28.859 1.00 43.15  ? 91   ILE D CB    1 
ATOM   2786  C  CG1   . ILE D 4 94  ? -17.886 -5.076  27.559 1.00 43.15  ? 91   ILE D CG1   1 
ATOM   2787  C  CG2   . ILE D 4 94  ? -17.232 -4.330  29.883 1.00 41.92  ? 91   ILE D CG2   1 
ATOM   2788  C  CD1   . ILE D 4 94  ? -17.263 -6.459  27.708 1.00 41.55  ? 91   ILE D CD1   1 
ATOM   2789  N  N     . GLN D 4 95  ? -20.831 -3.213  30.440 1.00 44.17  ? 92   GLN D N     1 
ATOM   2790  C  CA    . GLN D 4 95  ? -21.261 -2.336  31.525 1.00 44.39  ? 92   GLN D CA    1 
ATOM   2791  C  C     . GLN D 4 95  ? -22.199 -3.054  32.480 1.00 43.55  ? 92   GLN D C     1 
ATOM   2792  O  O     . GLN D 4 95  ? -22.018 -2.975  33.686 1.00 43.78  ? 92   GLN D O     1 
ATOM   2793  C  CB    . GLN D 4 95  ? -21.891 -1.046  30.979 1.00 44.77  ? 92   GLN D CB    1 
ATOM   2794  C  CG    . GLN D 4 95  ? -22.321 -0.057  32.065 1.00 47.09  ? 92   GLN D CG    1 
ATOM   2795  C  CD    . GLN D 4 95  ? -22.659 1.315   31.518 1.00 49.46  ? 92   GLN D CD    1 
ATOM   2796  O  OE1   . GLN D 4 95  ? -23.826 1.673   31.405 1.00 52.93  ? 92   GLN D OE1   1 
ATOM   2797  N  NE2   . GLN D 4 95  ? -21.644 2.087   31.182 1.00 48.33  ? 92   GLN D NE2   1 
ATOM   2798  N  N     . THR D 4 96  ? -23.187 -3.764  31.954 1.00 43.03  ? 93   THR D N     1 
ATOM   2799  C  CA    . THR D 4 96  ? -24.051 -4.558  32.818 1.00 42.94  ? 93   THR D CA    1 
ATOM   2800  C  C     . THR D 4 96  ? -23.234 -5.640  33.565 1.00 42.76  ? 93   THR D C     1 
ATOM   2801  O  O     . THR D 4 96  ? -23.474 -5.913  34.746 1.00 42.77  ? 93   THR D O     1 
ATOM   2802  C  CB    . THR D 4 96  ? -25.218 -5.160  32.044 1.00 42.61  ? 93   THR D CB    1 
ATOM   2803  O  OG1   . THR D 4 96  ? -25.861 -4.127  31.286 1.00 43.92  ? 93   THR D OG1   1 
ATOM   2804  C  CG2   . THR D 4 96  ? -26.232 -5.779  32.987 1.00 42.48  ? 93   THR D CG2   1 
ATOM   2805  N  N     . ALA D 4 97  ? -22.245 -6.217  32.891 1.00 42.50  ? 94   ALA D N     1 
ATOM   2806  C  CA    . ALA D 4 97  ? -21.415 -7.259  33.495 1.00 42.53  ? 94   ALA D CA    1 
ATOM   2807  C  C     . ALA D 4 97  ? -20.686 -6.701  34.692 1.00 42.90  ? 94   ALA D C     1 
ATOM   2808  O  O     . ALA D 4 97  ? -20.622 -7.343  35.746 1.00 43.13  ? 94   ALA D O     1 
ATOM   2809  C  CB    . ALA D 4 97  ? -20.435 -7.832  32.498 1.00 42.20  ? 94   ALA D CB    1 
ATOM   2810  N  N     . VAL D 4 98  ? -20.168 -5.488  34.529 1.00 43.15  ? 95   VAL D N     1 
ATOM   2811  C  CA    . VAL D 4 98  ? -19.452 -4.786  35.587 1.00 43.26  ? 95   VAL D CA    1 
ATOM   2812  C  C     . VAL D 4 98  ? -20.357 -4.518  36.785 1.00 43.78  ? 95   VAL D C     1 
ATOM   2813  O  O     . VAL D 4 98  ? -19.957 -4.738  37.924 1.00 43.73  ? 95   VAL D O     1 
ATOM   2814  C  CB    . VAL D 4 98  ? -18.795 -3.491  35.046 1.00 43.28  ? 95   VAL D CB    1 
ATOM   2815  C  CG1   . VAL D 4 98  ? -18.406 -2.554  36.169 1.00 43.10  ? 95   VAL D CG1   1 
ATOM   2816  C  CG2   . VAL D 4 98  ? -17.561 -3.834  34.185 1.00 42.63  ? 95   VAL D CG2   1 
ATOM   2817  N  N     . ARG D 4 99  ? -21.588 -4.083  36.527 1.00 44.60  ? 96   ARG D N     1 
ATOM   2818  C  CA    . ARG D 4 99  ? -22.550 -3.842  37.598 1.00 45.10  ? 96   ARG D CA    1 
ATOM   2819  C  C     . ARG D 4 99  ? -22.968 -5.128  38.302 1.00 44.85  ? 96   ARG D C     1 
ATOM   2820  O  O     . ARG D 4 99  ? -23.231 -5.108  39.507 1.00 45.10  ? 96   ARG D O     1 
ATOM   2821  C  CB    . ARG D 4 99  ? -23.775 -3.095  37.072 1.00 45.64  ? 96   ARG D CB    1 
ATOM   2822  C  CG    . ARG D 4 99  ? -23.576 -1.591  36.925 1.00 48.60  ? 96   ARG D CG    1 
ATOM   2823  C  CD    . ARG D 4 99  ? -24.817 -0.889  36.338 1.00 53.19  ? 96   ARG D CD    1 
ATOM   2824  N  NE    . ARG D 4 99  ? -24.656 0.567   36.335 1.00 58.11  ? 96   ARG D NE    1 
ATOM   2825  C  CZ    . ARG D 4 99  ? -25.104 1.395   35.382 1.00 60.71  ? 96   ARG D CZ    1 
ATOM   2826  N  NH1   . ARG D 4 99  ? -25.760 0.931   34.315 1.00 60.93  ? 96   ARG D NH1   1 
ATOM   2827  N  NH2   . ARG D 4 99  ? -24.883 2.705   35.493 1.00 60.55  ? 96   ARG D NH2   1 
ATOM   2828  N  N     . LEU D 4 100 ? -23.034 -6.236  37.558 1.00 44.52  ? 97   LEU D N     1 
ATOM   2829  C  CA    . LEU D 4 100 ? -23.365 -7.534  38.147 1.00 44.10  ? 97   LEU D CA    1 
ATOM   2830  C  C     . LEU D 4 100 ? -22.206 -8.077  38.968 1.00 44.50  ? 97   LEU D C     1 
ATOM   2831  O  O     . LEU D 4 100 ? -22.413 -8.602  40.049 1.00 44.85  ? 97   LEU D O     1 
ATOM   2832  C  CB    . LEU D 4 100 ? -23.789 -8.545  37.082 1.00 43.60  ? 97   LEU D CB    1 
ATOM   2833  C  CG    . LEU D 4 100 ? -25.140 -8.323  36.399 1.00 42.80  ? 97   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D 4 100 ? -25.259 -9.162  35.153 1.00 41.63  ? 97   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D 4 100 ? -26.302 -8.596  37.336 1.00 42.92  ? 97   LEU D CD2   1 
ATOM   2836  N  N     . LEU D 4 101 ? -20.982 -7.905  38.479 1.00 44.98  ? 98   LEU D N     1 
ATOM   2837  C  CA    . LEU D 4 101 ? -19.817 -8.520  39.102 1.00 45.09  ? 98   LEU D CA    1 
ATOM   2838  C  C     . LEU D 4 101 ? -19.212 -7.764  40.287 1.00 45.31  ? 98   LEU D C     1 
ATOM   2839  O  O     . LEU D 4 101 ? -18.855 -8.377  41.288 1.00 46.11  ? 98   LEU D O     1 
ATOM   2840  C  CB    . LEU D 4 101 ? -18.745 -8.798  38.055 1.00 44.96  ? 98   LEU D CB    1 
ATOM   2841  C  CG    . LEU D 4 101 ? -17.495 -9.548  38.529 1.00 46.29  ? 98   LEU D CG    1 
ATOM   2842  C  CD1   . LEU D 4 101 ? -17.768 -11.049 38.728 1.00 47.19  ? 98   LEU D CD1   1 
ATOM   2843  C  CD2   . LEU D 4 101 ? -16.336 -9.333  37.556 1.00 46.28  ? 98   LEU D CD2   1 
ATOM   2844  N  N     . LEU D 4 102 ? -19.082 -6.450  40.186 1.00 45.37  ? 99   LEU D N     1 
ATOM   2845  C  CA    . LEU D 4 102 ? -18.342 -5.693  41.191 1.00 45.45  ? 99   LEU D CA    1 
ATOM   2846  C  C     . LEU D 4 102 ? -19.233 -5.216  42.341 1.00 45.83  ? 99   LEU D C     1 
ATOM   2847  O  O     . LEU D 4 102 ? -20.410 -4.903  42.128 1.00 45.96  ? 99   LEU D O     1 
ATOM   2848  C  CB    . LEU D 4 102 ? -17.605 -4.508  40.547 1.00 45.33  ? 99   LEU D CB    1 
ATOM   2849  C  CG    . LEU D 4 102 ? -16.578 -4.746  39.424 1.00 45.56  ? 99   LEU D CG    1 
ATOM   2850  C  CD1   . LEU D 4 102 ? -15.737 -3.492  39.220 1.00 45.37  ? 99   LEU D CD1   1 
ATOM   2851  C  CD2   . LEU D 4 102 ? -15.664 -5.917  39.692 1.00 44.94  ? 99   LEU D CD2   1 
ATOM   2852  N  N     . PRO D 4 103 ? -18.684 -5.169  43.573 1.00 46.22  ? 100  PRO D N     1 
ATOM   2853  C  CA    . PRO D 4 103 ? -19.503 -4.637  44.671 1.00 46.45  ? 100  PRO D CA    1 
ATOM   2854  C  C     . PRO D 4 103 ? -19.654 -3.117  44.610 1.00 46.85  ? 100  PRO D C     1 
ATOM   2855  O  O     . PRO D 4 103 ? -18.731 -2.423  44.166 1.00 46.67  ? 100  PRO D O     1 
ATOM   2856  C  CB    . PRO D 4 103 ? -18.732 -5.050  45.924 1.00 46.34  ? 100  PRO D CB    1 
ATOM   2857  C  CG    . PRO D 4 103 ? -17.307 -5.275  45.452 1.00 46.23  ? 100  PRO D CG    1 
ATOM   2858  C  CD    . PRO D 4 103 ? -17.424 -5.776  44.056 1.00 46.04  ? 100  PRO D CD    1 
ATOM   2859  N  N     . GLY D 4 104 ? -20.831 -2.644  45.033 1.00 47.33  ? 101  GLY D N     1 
ATOM   2860  C  CA    . GLY D 4 104 ? -21.172 -1.225  45.212 1.00 47.66  ? 101  GLY D CA    1 
ATOM   2861  C  C     . GLY D 4 104 ? -20.274 -0.143  44.651 1.00 48.14  ? 101  GLY D C     1 
ATOM   2862  O  O     . GLY D 4 104 ? -20.466 0.310   43.523 1.00 48.46  ? 101  GLY D O     1 
ATOM   2863  N  N     . GLU D 4 105 ? -19.290 0.273   45.436 1.00 48.48  ? 102  GLU D N     1 
ATOM   2864  C  CA    . GLU D 4 105 ? -18.481 1.430   45.078 1.00 49.11  ? 102  GLU D CA    1 
ATOM   2865  C  C     . GLU D 4 105 ? -17.446 1.149   43.991 1.00 49.09  ? 102  GLU D C     1 
ATOM   2866  O  O     . GLU D 4 105 ? -17.039 2.059   43.269 1.00 49.65  ? 102  GLU D O     1 
ATOM   2867  C  CB    . GLU D 4 105 ? -17.811 2.025   46.317 1.00 48.99  ? 102  GLU D CB    1 
ATOM   2868  C  CG    . GLU D 4 105 ? -17.628 3.528   46.266 1.00 51.77  ? 102  GLU D CG    1 
ATOM   2869  C  CD    . GLU D 4 105 ? -18.961 4.302   46.201 1.00 55.83  ? 102  GLU D CD    1 
ATOM   2870  O  OE1   . GLU D 4 105 ? -19.980 3.852   46.782 1.00 56.06  ? 102  GLU D OE1   1 
ATOM   2871  O  OE2   . GLU D 4 105 ? -18.984 5.378   45.562 1.00 58.38  ? 102  GLU D OE2   1 
ATOM   2872  N  N     . LEU D 4 106 ? -17.002 -0.093  43.864 1.00 49.03  ? 103  LEU D N     1 
ATOM   2873  C  CA    . LEU D 4 106 ? -16.043 -0.391  42.804 1.00 48.91  ? 103  LEU D CA    1 
ATOM   2874  C  C     . LEU D 4 106 ? -16.768 -0.373  41.473 1.00 49.02  ? 103  LEU D C     1 
ATOM   2875  O  O     . LEU D 4 106 ? -16.192 0.013   40.464 1.00 48.58  ? 103  LEU D O     1 
ATOM   2876  C  CB    . LEU D 4 106 ? -15.331 -1.735  43.016 1.00 48.60  ? 103  LEU D CB    1 
ATOM   2877  C  CG    . LEU D 4 106 ? -14.190 -1.863  44.024 1.00 47.56  ? 103  LEU D CG    1 
ATOM   2878  C  CD1   . LEU D 4 106 ? -13.756 -3.315  44.064 1.00 48.07  ? 103  LEU D CD1   1 
ATOM   2879  C  CD2   . LEU D 4 106 ? -13.003 -0.991  43.685 1.00 46.01  ? 103  LEU D CD2   1 
ATOM   2880  N  N     . ALA D 4 107 ? -18.039 -0.773  41.489 1.00 49.57  ? 104  ALA D N     1 
ATOM   2881  C  CA    . ALA D 4 107 ? -18.846 -0.807  40.278 1.00 50.50  ? 104  ALA D CA    1 
ATOM   2882  C  C     . ALA D 4 107 ? -19.034 0.611   39.751 1.00 51.40  ? 104  ALA D C     1 
ATOM   2883  O  O     . ALA D 4 107 ? -18.657 0.915   38.616 1.00 51.40  ? 104  ALA D O     1 
ATOM   2884  C  CB    . ALA D 4 107 ? -20.172 -1.473  40.542 1.00 50.25  ? 104  ALA D CB    1 
ATOM   2885  N  N     . LYS D 4 108 ? -19.589 1.472   40.606 1.00 52.64  ? 105  LYS D N     1 
ATOM   2886  C  CA    . LYS D 4 108 ? -19.794 2.892   40.328 1.00 53.19  ? 105  LYS D CA    1 
ATOM   2887  C  C     . LYS D 4 108 ? -18.573 3.514   39.665 1.00 52.88  ? 105  LYS D C     1 
ATOM   2888  O  O     . LYS D 4 108 ? -18.688 4.135   38.608 1.00 53.16  ? 105  LYS D O     1 
ATOM   2889  C  CB    . LYS D 4 108 ? -20.128 3.623   41.626 1.00 53.62  ? 105  LYS D CB    1 
ATOM   2890  C  CG    . LYS D 4 108 ? -20.672 5.037   41.453 1.00 56.33  ? 105  LYS D CG    1 
ATOM   2891  C  CD    . LYS D 4 108 ? -20.764 5.791   42.797 1.00 60.28  ? 105  LYS D CD    1 
ATOM   2892  C  CE    . LYS D 4 108 ? -21.882 5.246   43.701 1.00 62.41  ? 105  LYS D CE    1 
ATOM   2893  N  NZ    . LYS D 4 108 ? -21.975 6.013   45.004 1.00 63.44  ? 105  LYS D NZ    1 
ATOM   2894  N  N     . HIS D 4 109 ? -17.402 3.314   40.254 1.00 52.59  ? 106  HIS D N     1 
ATOM   2895  C  CA    . HIS D 4 109 ? -16.182 3.901   39.702 1.00 52.60  ? 106  HIS D CA    1 
ATOM   2896  C  C     . HIS D 4 109 ? -15.677 3.239   38.432 1.00 52.21  ? 106  HIS D C     1 
ATOM   2897  O  O     . HIS D 4 109 ? -15.109 3.910   37.571 1.00 52.39  ? 106  HIS D O     1 
ATOM   2898  C  CB    . HIS D 4 109 ? -15.068 3.918   40.735 1.00 52.80  ? 106  HIS D CB    1 
ATOM   2899  C  CG    . HIS D 4 109 ? -15.137 5.077   41.669 1.00 54.69  ? 106  HIS D CG    1 
ATOM   2900  N  ND1   . HIS D 4 109 ? -15.727 4.994   42.913 1.00 56.86  ? 106  HIS D ND1   1 
ATOM   2901  C  CD2   . HIS D 4 109 ? -14.698 6.352   41.540 1.00 56.14  ? 106  HIS D CD2   1 
ATOM   2902  C  CE1   . HIS D 4 109 ? -15.639 6.166   43.515 1.00 57.85  ? 106  HIS D CE1   1 
ATOM   2903  N  NE2   . HIS D 4 109 ? -15.024 7.009   42.700 1.00 57.52  ? 106  HIS D NE2   1 
ATOM   2904  N  N     . ALA D 4 110 ? -15.854 1.925   38.317 1.00 51.99  ? 107  ALA D N     1 
ATOM   2905  C  CA    . ALA D 4 110 ? -15.432 1.222   37.102 1.00 51.45  ? 107  ALA D CA    1 
ATOM   2906  C  C     . ALA D 4 110 ? -16.288 1.688   35.946 1.00 51.11  ? 107  ALA D C     1 
ATOM   2907  O  O     . ALA D 4 110 ? -15.776 1.911   34.858 1.00 50.77  ? 107  ALA D O     1 
ATOM   2908  C  CB    . ALA D 4 110 ? -15.512 -0.286  37.270 1.00 51.21  ? 107  ALA D CB    1 
ATOM   2909  N  N     . VAL D 4 111 ? -17.582 1.861   36.211 1.00 51.38  ? 108  VAL D N     1 
ATOM   2910  C  CA    . VAL D 4 111 ? -18.556 2.324   35.222 1.00 52.00  ? 108  VAL D CA    1 
ATOM   2911  C  C     . VAL D 4 111 ? -18.218 3.697   34.655 1.00 52.46  ? 108  VAL D C     1 
ATOM   2912  O  O     . VAL D 4 111 ? -18.323 3.904   33.450 1.00 52.31  ? 108  VAL D O     1 
ATOM   2913  C  CB    . VAL D 4 111 ? -19.995 2.297   35.791 1.00 52.13  ? 108  VAL D CB    1 
ATOM   2914  C  CG1   . VAL D 4 111 ? -20.982 3.055   34.891 1.00 51.63  ? 108  VAL D CG1   1 
ATOM   2915  C  CG2   . VAL D 4 111 ? -20.446 0.860   35.975 1.00 52.55  ? 108  VAL D CG2   1 
ATOM   2916  N  N     . SER D 4 112 ? -17.813 4.628   35.520 1.00 53.43  ? 109  SER D N     1 
ATOM   2917  C  CA    . SER D 4 112 ? -17.366 5.956   35.070 1.00 54.38  ? 109  SER D CA    1 
ATOM   2918  C  C     . SER D 4 112 ? -16.113 5.848   34.220 1.00 54.53  ? 109  SER D C     1 
ATOM   2919  O  O     . SER D 4 112 ? -16.040 6.428   33.141 1.00 55.15  ? 109  SER D O     1 
ATOM   2920  C  CB    . SER D 4 112 ? -17.110 6.911   36.244 1.00 54.29  ? 109  SER D CB    1 
ATOM   2921  O  OG    . SER D 4 112 ? -18.290 7.108   37.002 1.00 56.32  ? 109  SER D OG    1 
ATOM   2922  N  N     . GLU D 4 113 ? -15.131 5.102   34.700 1.00 54.73  ? 110  GLU D N     1 
ATOM   2923  C  CA    . GLU D 4 113 ? -13.875 4.953   33.972 1.00 55.34  ? 110  GLU D CA    1 
ATOM   2924  C  C     . GLU D 4 113 ? -14.059 4.322   32.590 1.00 55.00  ? 110  GLU D C     1 
ATOM   2925  O  O     . GLU D 4 113 ? -13.389 4.697   31.632 1.00 54.80  ? 110  GLU D O     1 
ATOM   2926  C  CB    . GLU D 4 113 ? -12.887 4.153   34.805 1.00 55.65  ? 110  GLU D CB    1 
ATOM   2927  C  CG    . GLU D 4 113 ? -12.168 4.989   35.835 1.00 57.70  ? 110  GLU D CG    1 
ATOM   2928  C  CD    . GLU D 4 113 ? -10.832 5.452   35.330 1.00 61.65  ? 110  GLU D CD    1 
ATOM   2929  O  OE1   . GLU D 4 113 ? -10.569 6.680   35.376 1.00 63.12  ? 110  GLU D OE1   1 
ATOM   2930  O  OE2   . GLU D 4 113 ? -10.049 4.584   34.860 1.00 64.20  ? 110  GLU D OE2   1 
ATOM   2931  N  N     . GLY D 4 114 ? -14.985 3.376   32.493 1.00 55.03  ? 111  GLY D N     1 
ATOM   2932  C  CA    . GLY D 4 114 ? -15.248 2.694   31.238 1.00 54.86  ? 111  GLY D CA    1 
ATOM   2933  C  C     . GLY D 4 114 ? -16.015 3.567   30.271 1.00 54.83  ? 111  GLY D C     1 
ATOM   2934  O  O     . GLY D 4 114 ? -15.684 3.616   29.086 1.00 54.17  ? 111  GLY D O     1 
ATOM   2935  N  N     . THR D 4 115 ? -17.045 4.248   30.782 1.00 55.27  ? 112  THR D N     1 
ATOM   2936  C  CA    . THR D 4 115 ? -17.803 5.224   29.995 1.00 55.74  ? 112  THR D CA    1 
ATOM   2937  C  C     . THR D 4 115 ? -16.846 6.273   29.434 1.00 56.25  ? 112  THR D C     1 
ATOM   2938  O  O     . THR D 4 115 ? -16.773 6.478   28.229 1.00 56.34  ? 112  THR D O     1 
ATOM   2939  C  CB    . THR D 4 115 ? -18.891 5.930   30.823 1.00 55.58  ? 112  THR D CB    1 
ATOM   2940  O  OG1   . THR D 4 115 ? -19.802 4.966   31.365 1.00 55.39  ? 112  THR D OG1   1 
ATOM   2941  C  CG2   . THR D 4 115 ? -19.663 6.925   29.950 1.00 55.40  ? 112  THR D CG2   1 
ATOM   2942  N  N     . LYS D 4 116 ? -16.093 6.895   30.332 1.00 56.94  ? 113  LYS D N     1 
ATOM   2943  C  CA    . LYS D 4 116 ? -15.097 7.904   29.996 1.00 57.93  ? 113  LYS D CA    1 
ATOM   2944  C  C     . LYS D 4 116 ? -14.174 7.469   28.866 1.00 58.01  ? 113  LYS D C     1 
ATOM   2945  O  O     . LYS D 4 116 ? -13.964 8.218   27.925 1.00 58.55  ? 113  LYS D O     1 
ATOM   2946  C  CB    . LYS D 4 116 ? -14.290 8.259   31.256 1.00 58.26  ? 113  LYS D CB    1 
ATOM   2947  C  CG    . LYS D 4 116 ? -13.177 9.270   31.092 1.00 59.16  ? 113  LYS D CG    1 
ATOM   2948  C  CD    . LYS D 4 116 ? -12.593 9.577   32.471 1.00 61.97  ? 113  LYS D CD    1 
ATOM   2949  C  CE    . LYS D 4 116 ? -11.317 10.409  32.378 1.00 64.40  ? 113  LYS D CE    1 
ATOM   2950  N  NZ    . LYS D 4 116 ? -10.225 9.710   31.613 1.00 64.68  ? 113  LYS D NZ    1 
ATOM   2951  N  N     . ALA D 4 117 ? -13.636 6.260   28.958 1.00 58.44  ? 114  ALA D N     1 
ATOM   2952  C  CA    . ALA D 4 117 ? -12.703 5.760   27.956 1.00 58.71  ? 114  ALA D CA    1 
ATOM   2953  C  C     . ALA D 4 117 ? -13.350 5.629   26.586 1.00 59.04  ? 114  ALA D C     1 
ATOM   2954  O  O     . ALA D 4 117 ? -12.721 5.927   25.572 1.00 59.09  ? 114  ALA D O     1 
ATOM   2955  C  CB    . ALA D 4 117 ? -12.126 4.433   28.388 1.00 58.64  ? 114  ALA D CB    1 
ATOM   2956  N  N     . VAL D 4 118 ? -14.601 5.178   26.561 1.00 59.54  ? 115  VAL D N     1 
ATOM   2957  C  CA    . VAL D 4 118 ? -15.304 4.938   25.303 1.00 60.02  ? 115  VAL D CA    1 
ATOM   2958  C  C     . VAL D 4 118 ? -15.695 6.266   24.660 1.00 60.72  ? 115  VAL D C     1 
ATOM   2959  O  O     . VAL D 4 118 ? -15.390 6.507   23.497 1.00 60.69  ? 115  VAL D O     1 
ATOM   2960  C  CB    . VAL D 4 118 ? -16.528 4.000   25.498 1.00 60.03  ? 115  VAL D CB    1 
ATOM   2961  C  CG1   . VAL D 4 118 ? -17.399 3.940   24.238 1.00 58.75  ? 115  VAL D CG1   1 
ATOM   2962  C  CG2   . VAL D 4 118 ? -16.060 2.598   25.907 1.00 59.64  ? 115  VAL D CG2   1 
ATOM   2963  N  N     . THR D 4 119 ? -16.359 7.119   25.433 1.00 61.59  ? 116  THR D N     1 
ATOM   2964  C  CA    . THR D 4 119 ? -16.616 8.498   25.044 1.00 62.53  ? 116  THR D CA    1 
ATOM   2965  C  C     . THR D 4 119 ? -15.355 9.152   24.465 1.00 63.26  ? 116  THR D C     1 
ATOM   2966  O  O     . THR D 4 119 ? -15.382 9.665   23.352 1.00 63.43  ? 116  THR D O     1 
ATOM   2967  C  CB    . THR D 4 119 ? -17.154 9.322   26.231 1.00 62.47  ? 116  THR D CB    1 
ATOM   2968  O  OG1   . THR D 4 119 ? -18.357 8.716   26.735 1.00 62.12  ? 116  THR D OG1   1 
ATOM   2969  C  CG2   . THR D 4 119 ? -17.457 10.738  25.791 1.00 62.58  ? 116  THR D CG2   1 
ATOM   2970  N  N     . LYS D 4 120 ? -14.246 9.112   25.197 1.00 64.21  ? 117  LYS D N     1 
ATOM   2971  C  CA    . LYS D 4 120 ? -13.003 9.675   24.674 1.00 65.29  ? 117  LYS D CA    1 
ATOM   2972  C  C     . LYS D 4 120 ? -12.601 8.993   23.373 1.00 65.87  ? 117  LYS D C     1 
ATOM   2973  O  O     . LYS D 4 120 ? -12.165 9.648   22.424 1.00 66.25  ? 117  LYS D O     1 
ATOM   2974  C  CB    . LYS D 4 120 ? -11.855 9.604   25.694 1.00 65.26  ? 117  LYS D CB    1 
ATOM   2975  C  CG    . LYS D 4 120 ? -10.468 9.821   25.063 1.00 65.95  ? 117  LYS D CG    1 
ATOM   2976  C  CD    . LYS D 4 120 ? -9.453  10.448  26.014 1.00 67.85  ? 117  LYS D CD    1 
ATOM   2977  C  CE    . LYS D 4 120 ? -8.120  10.733  25.294 1.00 68.57  ? 117  LYS D CE    1 
ATOM   2978  N  NZ    . LYS D 4 120 ? -7.154  11.546  26.110 1.00 69.17  ? 117  LYS D NZ    1 
ATOM   2979  N  N     . TYR D 4 121 ? -12.764 7.679   23.335 1.00 66.58  ? 118  TYR D N     1 
ATOM   2980  C  CA    . TYR D 4 121 ? -12.369 6.884   22.185 1.00 67.23  ? 118  TYR D CA    1 
ATOM   2981  C  C     . TYR D 4 121 ? -13.178 7.183   20.922 1.00 68.22  ? 118  TYR D C     1 
ATOM   2982  O  O     . TYR D 4 121 ? -12.643 7.131   19.815 1.00 67.82  ? 118  TYR D O     1 
ATOM   2983  C  CB    . TYR D 4 121 ? -12.491 5.406   22.525 1.00 66.88  ? 118  TYR D CB    1 
ATOM   2984  C  CG    . TYR D 4 121 ? -12.123 4.510   21.382 1.00 65.47  ? 118  TYR D CG    1 
ATOM   2985  C  CD1   . TYR D 4 121 ? -10.792 4.213   21.119 1.00 64.40  ? 118  TYR D CD1   1 
ATOM   2986  C  CD2   . TYR D 4 121 ? -13.105 3.962   20.559 1.00 64.21  ? 118  TYR D CD2   1 
ATOM   2987  C  CE1   . TYR D 4 121 ? -10.441 3.387   20.066 1.00 64.71  ? 118  TYR D CE1   1 
ATOM   2988  C  CE2   . TYR D 4 121 ? -12.768 3.145   19.502 1.00 64.11  ? 118  TYR D CE2   1 
ATOM   2989  C  CZ    . TYR D 4 121 ? -11.434 2.861   19.260 1.00 65.08  ? 118  TYR D CZ    1 
ATOM   2990  O  OH    . TYR D 4 121 ? -11.087 2.039   18.216 1.00 66.91  ? 118  TYR D OH    1 
ATOM   2991  N  N     . THR D 4 122 ? -14.467 7.465   21.108 1.00 69.81  ? 119  THR D N     1 
ATOM   2992  C  CA    . THR D 4 122 ? -15.402 7.733   20.021 1.00 71.44  ? 119  THR D CA    1 
ATOM   2993  C  C     . THR D 4 122 ? -15.015 9.022   19.296 1.00 72.65  ? 119  THR D C     1 
ATOM   2994  O  O     . THR D 4 122 ? -15.020 9.072   18.062 1.00 72.77  ? 119  THR D O     1 
ATOM   2995  C  CB    . THR D 4 122 ? -16.856 7.837   20.557 1.00 71.53  ? 119  THR D CB    1 
ATOM   2996  O  OG1   . THR D 4 122 ? -17.215 6.614   21.216 1.00 71.69  ? 119  THR D OG1   1 
ATOM   2997  C  CG2   . THR D 4 122 ? -17.859 8.107   19.432 1.00 71.83  ? 119  THR D CG2   1 
ATOM   2998  N  N     . SER D 4 123 ? -14.662 10.051  20.067 1.00 74.19  ? 120  SER D N     1 
ATOM   2999  C  CA    . SER D 4 123 ? -14.307 11.361  19.511 1.00 75.60  ? 120  SER D CA    1 
ATOM   3000  C  C     . SER D 4 123 ? -12.867 11.434  18.980 1.00 76.47  ? 120  SER D C     1 
ATOM   3001  O  O     . SER D 4 123 ? -12.421 12.504  18.533 1.00 76.60  ? 120  SER D O     1 
ATOM   3002  C  CB    . SER D 4 123 ? -14.531 12.458  20.554 1.00 75.55  ? 120  SER D CB    1 
ATOM   3003  O  OG    . SER D 4 123 ? -13.428 12.539  21.437 1.00 75.66  ? 120  SER D OG    1 
ATOM   3004  N  N     . ALA D 4 124 ? -12.154 10.305  19.006 1.00 77.60  ? 121  ALA D N     1 
ATOM   3005  C  CA    . ALA D 4 124 ? -10.724 10.306  18.693 1.00 79.03  ? 121  ALA D CA    1 
ATOM   3006  C  C     . ALA D 4 124 ? -10.297 9.614   17.379 1.00 80.17  ? 121  ALA D C     1 
ATOM   3007  O  O     . ALA D 4 124 ? -9.180  9.093   17.285 1.00 80.42  ? 121  ALA D O     1 
ATOM   3008  C  CB    . ALA D 4 124 ? -9.922  9.771   19.884 1.00 78.88  ? 121  ALA D CB    1 
ATOM   3009  N  N     . LYS D 4 125 ? -11.170 9.612   16.369 1.00 81.49  ? 122  LYS D N     1 
ATOM   3010  C  CA    . LYS D 4 125 ? -10.765 9.191   15.011 1.00 82.71  ? 122  LYS D CA    1 
ATOM   3011  C  C     . LYS D 4 125 ? -11.489 9.978   13.906 1.00 83.11  ? 122  LYS D C     1 
ATOM   3012  O  O     . LYS D 4 125 ? -11.020 11.043  13.475 1.00 83.30  ? 122  LYS D O     1 
ATOM   3013  C  CB    . LYS D 4 125 ? -10.909 7.671   14.795 1.00 82.96  ? 122  LYS D CB    1 
ATOM   3014  C  CG    . LYS D 4 125 ? -10.243 7.172   13.498 1.00 84.05  ? 122  LYS D CG    1 
ATOM   3015  C  CD    . LYS D 4 125 ? -10.327 5.654   13.331 1.00 85.85  ? 122  LYS D CD    1 
ATOM   3016  C  CE    . LYS D 4 125 ? -9.644  5.233   12.019 1.00 86.56  ? 122  LYS D CE    1 
ATOM   3017  N  NZ    . LYS D 4 125 ? -9.558  3.730   11.877 1.00 87.28  ? 122  LYS D NZ    1 
ATOM   3018  O  OXT   . LYS D 4 125 ? -12.548 9.562   13.412 1.00 83.46  ? 122  LYS D OXT   1 
ATOM   3019  N  N     . PRO E 1 38  ? 14.158  -22.580 88.297 1.00 71.93  ? 38   PRO E N     1 
ATOM   3020  C  CA    . PRO E 1 38  ? 13.843  -22.847 86.889 1.00 71.59  ? 38   PRO E CA    1 
ATOM   3021  C  C     . PRO E 1 38  ? 12.556  -22.152 86.462 1.00 71.21  ? 38   PRO E C     1 
ATOM   3022  O  O     . PRO E 1 38  ? 11.506  -22.361 87.073 1.00 71.47  ? 38   PRO E O     1 
ATOM   3023  C  CB    . PRO E 1 38  ? 13.674  -24.377 86.834 1.00 71.59  ? 38   PRO E CB    1 
ATOM   3024  C  CG    . PRO E 1 38  ? 13.824  -24.877 88.276 1.00 72.18  ? 38   PRO E CG    1 
ATOM   3025  C  CD    . PRO E 1 38  ? 13.743  -23.682 89.181 1.00 72.04  ? 38   PRO E CD    1 
ATOM   3026  N  N     . HIS E 1 39  ? 12.642  -21.346 85.410 1.00 70.44  ? 39   HIS E N     1 
ATOM   3027  C  CA    . HIS E 1 39  ? 11.534  -20.485 84.988 1.00 69.67  ? 39   HIS E CA    1 
ATOM   3028  C  C     . HIS E 1 39  ? 10.492  -21.169 84.076 1.00 68.32  ? 39   HIS E C     1 
ATOM   3029  O  O     . HIS E 1 39  ? 10.850  -22.021 83.247 1.00 68.42  ? 39   HIS E O     1 
ATOM   3030  C  CB    . HIS E 1 39  ? 12.100  -19.244 84.298 1.00 70.28  ? 39   HIS E CB    1 
ATOM   3031  C  CG    . HIS E 1 39  ? 11.061  -18.393 83.641 1.00 71.97  ? 39   HIS E CG    1 
ATOM   3032  N  ND1   . HIS E 1 39  ? 10.634  -18.608 82.345 1.00 73.55  ? 39   HIS E ND1   1 
ATOM   3033  C  CD2   . HIS E 1 39  ? 10.361  -17.329 84.099 1.00 73.37  ? 39   HIS E CD2   1 
ATOM   3034  C  CE1   . HIS E 1 39  ? 9.717   -17.709 82.033 1.00 73.99  ? 39   HIS E CE1   1 
ATOM   3035  N  NE2   . HIS E 1 39  ? 9.535   -16.920 83.079 1.00 74.60  ? 39   HIS E NE2   1 
ATOM   3036  N  N     . ARG E 1 40  ? 9.221   -20.760 84.224 1.00 66.28  ? 40   ARG E N     1 
ATOM   3037  C  CA    . ARG E 1 40  ? 8.085   -21.310 83.448 1.00 64.02  ? 40   ARG E CA    1 
ATOM   3038  C  C     . ARG E 1 40  ? 7.012   -20.291 83.068 1.00 62.46  ? 40   ARG E C     1 
ATOM   3039  O  O     . ARG E 1 40  ? 6.447   -19.616 83.938 1.00 62.09  ? 40   ARG E O     1 
ATOM   3040  C  CB    . ARG E 1 40  ? 7.390   -22.456 84.199 1.00 63.93  ? 40   ARG E CB    1 
ATOM   3041  C  CG    . ARG E 1 40  ? 7.985   -23.815 83.942 1.00 63.89  ? 40   ARG E CG    1 
ATOM   3042  C  CD    . ARG E 1 40  ? 6.943   -24.919 84.063 1.00 63.52  ? 40   ARG E CD    1 
ATOM   3043  N  NE    . ARG E 1 40  ? 7.516   -26.159 83.560 1.00 64.19  ? 40   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E 1 40  ? 7.036   -26.865 82.546 1.00 64.91  ? 40   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E 1 40  ? 5.931   -26.486 81.918 1.00 63.97  ? 40   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E 1 40  ? 7.660   -27.982 82.183 1.00 67.02  ? 40   ARG E NH2   1 
ATOM   3047  N  N     . TYR E 1 41  ? 6.708   -20.214 81.772 1.00 60.32  ? 41   TYR E N     1 
ATOM   3048  C  CA    . TYR E 1 41  ? 5.501   -19.525 81.323 1.00 58.43  ? 41   TYR E CA    1 
ATOM   3049  C  C     . TYR E 1 41  ? 4.258   -20.357 81.596 1.00 57.34  ? 41   TYR E C     1 
ATOM   3050  O  O     . TYR E 1 41  ? 4.282   -21.583 81.538 1.00 56.88  ? 41   TYR E O     1 
ATOM   3051  C  CB    . TYR E 1 41  ? 5.572   -19.154 79.839 1.00 58.33  ? 41   TYR E CB    1 
ATOM   3052  C  CG    . TYR E 1 41  ? 6.627   -18.129 79.539 1.00 57.48  ? 41   TYR E CG    1 
ATOM   3053  C  CD1   . TYR E 1 41  ? 7.775   -18.469 78.828 1.00 57.05  ? 41   TYR E CD1   1 
ATOM   3054  C  CD2   . TYR E 1 41  ? 6.498   -16.819 80.002 1.00 57.08  ? 41   TYR E CD2   1 
ATOM   3055  C  CE1   . TYR E 1 41  ? 8.759   -17.527 78.569 1.00 56.93  ? 41   TYR E CE1   1 
ATOM   3056  C  CE2   . TYR E 1 41  ? 7.472   -15.872 79.753 1.00 56.03  ? 41   TYR E CE2   1 
ATOM   3057  C  CZ    . TYR E 1 41  ? 8.598   -16.228 79.036 1.00 56.52  ? 41   TYR E CZ    1 
ATOM   3058  O  OH    . TYR E 1 41  ? 9.566   -15.283 78.794 1.00 56.46  ? 41   TYR E OH    1 
ATOM   3059  N  N     . ARG E 1 42  ? 3.174   -19.657 81.894 1.00 56.33  ? 42   ARG E N     1 
ATOM   3060  C  CA    . ARG E 1 42  ? 1.889   -20.261 82.213 1.00 55.58  ? 42   ARG E CA    1 
ATOM   3061  C  C     . ARG E 1 42  ? 1.155   -20.781 80.978 1.00 54.35  ? 42   ARG E C     1 
ATOM   3062  O  O     . ARG E 1 42  ? 1.282   -20.205 79.903 1.00 54.25  ? 42   ARG E O     1 
ATOM   3063  C  CB    . ARG E 1 42  ? 1.045   -19.225 82.929 1.00 55.75  ? 42   ARG E CB    1 
ATOM   3064  C  CG    . ARG E 1 42  ? 1.622   -18.862 84.287 1.00 58.26  ? 42   ARG E CG    1 
ATOM   3065  C  CD    . ARG E 1 42  ? 0.914   -17.682 84.889 1.00 61.37  ? 42   ARG E CD    1 
ATOM   3066  N  NE    . ARG E 1 42  ? -0.527  -17.794 84.698 1.00 64.53  ? 42   ARG E NE    1 
ATOM   3067  C  CZ    . ARG E 1 42  ? -1.431  -17.077 85.354 1.00 66.08  ? 42   ARG E CZ    1 
ATOM   3068  N  NH1   . ARG E 1 42  ? -1.043  -16.190 86.265 1.00 67.00  ? 42   ARG E NH1   1 
ATOM   3069  N  NH2   . ARG E 1 42  ? -2.724  -17.261 85.103 1.00 66.04  ? 42   ARG E NH2   1 
ATOM   3070  N  N     . PRO E 1 43  ? 0.378   -21.872 81.121 1.00 53.41  ? 43   PRO E N     1 
ATOM   3071  C  CA    . PRO E 1 43  ? -0.257  -22.395 79.918 1.00 52.66  ? 43   PRO E CA    1 
ATOM   3072  C  C     . PRO E 1 43  ? -1.155  -21.359 79.261 1.00 51.78  ? 43   PRO E C     1 
ATOM   3073  O  O     . PRO E 1 43  ? -2.026  -20.787 79.903 1.00 51.82  ? 43   PRO E O     1 
ATOM   3074  C  CB    . PRO E 1 43  ? -1.070  -23.593 80.423 1.00 52.52  ? 43   PRO E CB    1 
ATOM   3075  C  CG    . PRO E 1 43  ? -1.129  -23.462 81.863 1.00 52.88  ? 43   PRO E CG    1 
ATOM   3076  C  CD    . PRO E 1 43  ? 0.045   -22.675 82.308 1.00 53.37  ? 43   PRO E CD    1 
ATOM   3077  N  N     . GLY E 1 44  ? -0.927  -21.123 77.981 1.00 51.08  ? 44   GLY E N     1 
ATOM   3078  C  CA    . GLY E 1 44  ? -1.683  -20.124 77.260 1.00 50.38  ? 44   GLY E CA    1 
ATOM   3079  C  C     . GLY E 1 44  ? -0.778  -19.022 76.767 1.00 50.10  ? 44   GLY E C     1 
ATOM   3080  O  O     . GLY E 1 44  ? -1.021  -18.450 75.720 1.00 50.50  ? 44   GLY E O     1 
ATOM   3081  N  N     . THR E 1 45  ? 0.276   -18.727 77.521 1.00 49.73  ? 45   THR E N     1 
ATOM   3082  C  CA    . THR E 1 45  ? 1.146   -17.601 77.202 1.00 48.85  ? 45   THR E CA    1 
ATOM   3083  C  C     . THR E 1 45  ? 1.978   -17.849 75.938 1.00 48.24  ? 45   THR E C     1 
ATOM   3084  O  O     . THR E 1 45  ? 1.947   -17.026 75.022 1.00 48.56  ? 45   THR E O     1 
ATOM   3085  C  CB    . THR E 1 45  ? 2.028   -17.198 78.409 1.00 49.26  ? 45   THR E CB    1 
ATOM   3086  O  OG1   . THR E 1 45  ? 1.201   -16.975 79.563 1.00 49.55  ? 45   THR E OG1   1 
ATOM   3087  C  CG2   . THR E 1 45  ? 2.822   -15.939 78.118 1.00 48.09  ? 45   THR E CG2   1 
ATOM   3088  N  N     . VAL E 1 46  ? 2.699   -18.969 75.869 1.00 47.29  ? 46   VAL E N     1 
ATOM   3089  C  CA    . VAL E 1 46  ? 3.495   -19.280 74.672 1.00 46.16  ? 46   VAL E CA    1 
ATOM   3090  C  C     . VAL E 1 46  ? 2.581   -19.451 73.447 1.00 45.76  ? 46   VAL E C     1 
ATOM   3091  O  O     . VAL E 1 46  ? 2.952   -19.077 72.327 1.00 45.86  ? 46   VAL E O     1 
ATOM   3092  C  CB    . VAL E 1 46  ? 4.388   -20.530 74.859 1.00 46.25  ? 46   VAL E CB    1 
ATOM   3093  C  CG1   . VAL E 1 46  ? 5.403   -20.675 73.700 1.00 44.88  ? 46   VAL E CG1   1 
ATOM   3094  C  CG2   . VAL E 1 46  ? 5.113   -20.467 76.189 1.00 46.55  ? 46   VAL E CG2   1 
ATOM   3095  N  N     . ALA E 1 47  ? 1.386   -19.992 73.670 1.00 44.89  ? 47   ALA E N     1 
ATOM   3096  C  CA    . ALA E 1 47  ? 0.395   -20.181 72.607 1.00 44.35  ? 47   ALA E CA    1 
ATOM   3097  C  C     . ALA E 1 47  ? -0.036  -18.859 71.951 1.00 44.34  ? 47   ALA E C     1 
ATOM   3098  O  O     . ALA E 1 47  ? -0.093  -18.769 70.724 1.00 44.09  ? 47   ALA E O     1 
ATOM   3099  C  CB    . ALA E 1 47  ? -0.818  -20.960 73.127 1.00 43.89  ? 47   ALA E CB    1 
ATOM   3100  N  N     . LEU E 1 48  ? -0.313  -17.835 72.761 1.00 44.43  ? 48   LEU E N     1 
ATOM   3101  C  CA    . LEU E 1 48  ? -0.606  -16.485 72.232 1.00 44.69  ? 48   LEU E CA    1 
ATOM   3102  C  C     . LEU E 1 48  ? 0.605   -15.852 71.558 1.00 44.65  ? 48   LEU E C     1 
ATOM   3103  O  O     . LEU E 1 48  ? 0.449   -15.088 70.618 1.00 45.20  ? 48   LEU E O     1 
ATOM   3104  C  CB    . LEU E 1 48  ? -1.130  -15.543 73.313 1.00 44.47  ? 48   LEU E CB    1 
ATOM   3105  C  CG    . LEU E 1 48  ? -2.491  -15.882 73.910 1.00 45.60  ? 48   LEU E CG    1 
ATOM   3106  C  CD1   . LEU E 1 48  ? -2.721  -15.078 75.191 1.00 45.09  ? 48   LEU E CD1   1 
ATOM   3107  C  CD2   . LEU E 1 48  ? -3.620  -15.658 72.891 1.00 45.01  ? 48   LEU E CD2   1 
ATOM   3108  N  N     . ARG E 1 49  ? 1.805   -16.164 72.038 1.00 44.48  ? 49   ARG E N     1 
ATOM   3109  C  CA    . ARG E 1 49  ? 3.026   -15.704 71.397 1.00 44.75  ? 49   ARG E CA    1 
ATOM   3110  C  C     . ARG E 1 49  ? 3.106   -16.314 70.000 1.00 44.81  ? 49   ARG E C     1 
ATOM   3111  O  O     . ARG E 1 49  ? 3.476   -15.644 69.035 1.00 44.98  ? 49   ARG E O     1 
ATOM   3112  C  CB    . ARG E 1 49  ? 4.246   -16.141 72.216 1.00 45.32  ? 49   ARG E CB    1 
ATOM   3113  C  CG    . ARG E 1 49  ? 5.458   -15.218 72.111 1.00 47.04  ? 49   ARG E CG    1 
ATOM   3114  C  CD    . ARG E 1 49  ? 6.815   -15.958 72.231 1.00 51.04  ? 49   ARG E CD    1 
ATOM   3115  N  NE    . ARG E 1 49  ? 7.189   -16.503 73.552 1.00 52.93  ? 49   ARG E NE    1 
ATOM   3116  C  CZ    . ARG E 1 49  ? 6.671   -16.163 74.731 1.00 54.03  ? 49   ARG E CZ    1 
ATOM   3117  N  NH1   . ARG E 1 49  ? 5.726   -15.231 74.837 1.00 54.04  ? 49   ARG E NH1   1 
ATOM   3118  N  NH2   . ARG E 1 49  ? 7.124   -16.761 75.822 1.00 55.28  ? 49   ARG E NH2   1 
ATOM   3119  N  N     . GLU E 1 50  ? 2.750   -17.592 69.889 1.00 44.53  ? 50   GLU E N     1 
ATOM   3120  C  CA    . GLU E 1 50  ? 2.865   -18.284 68.616 1.00 44.28  ? 50   GLU E CA    1 
ATOM   3121  C  C     . GLU E 1 50  ? 1.824   -17.766 67.625 1.00 43.57  ? 50   GLU E C     1 
ATOM   3122  O  O     . GLU E 1 50  ? 2.105   -17.650 66.432 1.00 43.36  ? 50   GLU E O     1 
ATOM   3123  C  CB    . GLU E 1 50  ? 2.757   -19.799 68.799 1.00 44.79  ? 50   GLU E CB    1 
ATOM   3124  C  CG    . GLU E 1 50  ? 3.973   -20.445 69.444 1.00 45.73  ? 50   GLU E CG    1 
ATOM   3125  C  CD    . GLU E 1 50  ? 3.721   -21.880 69.808 1.00 49.14  ? 50   GLU E CD    1 
ATOM   3126  O  OE1   . GLU E 1 50  ? 4.473   -22.430 70.647 1.00 52.13  ? 50   GLU E OE1   1 
ATOM   3127  O  OE2   . GLU E 1 50  ? 2.751   -22.462 69.274 1.00 51.36  ? 50   GLU E OE2   1 
ATOM   3128  N  N     . ILE E 1 51  ? 0.636   -17.438 68.126 1.00 42.66  ? 51   ILE E N     1 
ATOM   3129  C  CA    . ILE E 1 51  ? -0.421  -16.881 67.286 1.00 41.69  ? 51   ILE E CA    1 
ATOM   3130  C  C     . ILE E 1 51  ? 0.045   -15.555 66.672 1.00 42.25  ? 51   ILE E C     1 
ATOM   3131  O  O     . ILE E 1 51  ? -0.129  -15.325 65.469 1.00 41.91  ? 51   ILE E O     1 
ATOM   3132  C  CB    . ILE E 1 51  ? -1.746  -16.640 68.067 1.00 41.40  ? 51   ILE E CB    1 
ATOM   3133  C  CG1   . ILE E 1 51  ? -2.297  -17.935 68.669 1.00 39.53  ? 51   ILE E CG1   1 
ATOM   3134  C  CG2   . ILE E 1 51  ? -2.792  -16.001 67.162 1.00 40.60  ? 51   ILE E CG2   1 
ATOM   3135  C  CD1   . ILE E 1 51  ? -3.648  -17.779 69.338 1.00 36.91  ? 51   ILE E CD1   1 
ATOM   3136  N  N     . ARG E 1 52  ? 0.641   -14.684 67.492 1.00 42.24  ? 52   ARG E N     1 
ATOM   3137  C  CA    . ARG E 1 52  ? 1.157   -13.418 66.977 1.00 42.27  ? 52   ARG E CA    1 
ATOM   3138  C  C     . ARG E 1 52  ? 2.263   -13.695 65.984 1.00 41.74  ? 52   ARG E C     1 
ATOM   3139  O  O     . ARG E 1 52  ? 2.332   -13.063 64.943 1.00 41.84  ? 52   ARG E O     1 
ATOM   3140  C  CB    . ARG E 1 52  ? 1.666   -12.500 68.102 1.00 42.54  ? 52   ARG E CB    1 
ATOM   3141  C  CG    . ARG E 1 52  ? 0.572   -12.053 69.086 1.00 44.95  ? 52   ARG E CG    1 
ATOM   3142  C  CD    . ARG E 1 52  ? 1.091   -11.141 70.204 1.00 47.20  ? 52   ARG E CD    1 
ATOM   3143  N  NE    . ARG E 1 52  ? 0.530   -11.514 71.510 1.00 50.16  ? 52   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E 1 52  ? -0.685  -11.176 71.943 1.00 52.51  ? 52   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E 1 52  ? -1.496  -10.452 71.178 1.00 54.79  ? 52   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E 1 52  ? -1.097  -11.556 73.146 1.00 52.81  ? 52   ARG E NH2   1 
ATOM   3147  N  N     . ARG E 1 53  ? 3.135   -14.644 66.308 1.00 41.65  ? 53   ARG E N     1 
ATOM   3148  C  CA    . ARG E 1 53  ? 4.262   -14.925 65.449 1.00 41.40  ? 53   ARG E CA    1 
ATOM   3149  C  C     . ARG E 1 53  ? 3.781   -15.425 64.088 1.00 41.29  ? 53   ARG E C     1 
ATOM   3150  O  O     . ARG E 1 53  ? 4.218   -14.903 63.067 1.00 41.83  ? 53   ARG E O     1 
ATOM   3151  C  CB    . ARG E 1 53  ? 5.216   -15.919 66.104 1.00 41.87  ? 53   ARG E CB    1 
ATOM   3152  C  CG    . ARG E 1 53  ? 6.465   -16.189 65.288 1.00 43.62  ? 53   ARG E CG    1 
ATOM   3153  C  CD    . ARG E 1 53  ? 7.157   -17.461 65.718 1.00 47.32  ? 53   ARG E CD    1 
ATOM   3154  N  NE    . ARG E 1 53  ? 8.050   -17.922 64.660 1.00 50.55  ? 53   ARG E NE    1 
ATOM   3155  C  CZ    . ARG E 1 53  ? 8.824   -19.003 64.726 1.00 51.23  ? 53   ARG E CZ    1 
ATOM   3156  N  NH1   . ARG E 1 53  ? 8.849   -19.756 65.828 1.00 50.83  ? 53   ARG E NH1   1 
ATOM   3157  N  NH2   . ARG E 1 53  ? 9.582   -19.317 63.684 1.00 50.63  ? 53   ARG E NH2   1 
ATOM   3158  N  N     . TYR E 1 54  ? 2.867   -16.400 64.059 1.00 40.29  ? 54   TYR E N     1 
ATOM   3159  C  CA    . TYR E 1 54  ? 2.467   -16.998 62.774 1.00 39.56  ? 54   TYR E CA    1 
ATOM   3160  C  C     . TYR E 1 54  ? 1.456   -16.177 61.972 1.00 39.79  ? 54   TYR E C     1 
ATOM   3161  O  O     . TYR E 1 54  ? 1.373   -16.316 60.745 1.00 39.14  ? 54   TYR E O     1 
ATOM   3162  C  CB    . TYR E 1 54  ? 2.021   -18.465 62.925 1.00 38.83  ? 54   TYR E CB    1 
ATOM   3163  C  CG    . TYR E 1 54  ? 3.149   -19.345 63.386 1.00 36.11  ? 54   TYR E CG    1 
ATOM   3164  C  CD1   . TYR E 1 54  ? 3.081   -20.012 64.599 1.00 34.52  ? 54   TYR E CD1   1 
ATOM   3165  C  CD2   . TYR E 1 54  ? 4.299   -19.487 62.621 1.00 32.59  ? 54   TYR E CD2   1 
ATOM   3166  C  CE1   . TYR E 1 54  ? 4.128   -20.807 65.034 1.00 32.87  ? 54   TYR E CE1   1 
ATOM   3167  C  CE2   . TYR E 1 54  ? 5.342   -20.261 63.056 1.00 32.11  ? 54   TYR E CE2   1 
ATOM   3168  C  CZ    . TYR E 1 54  ? 5.252   -20.914 64.260 1.00 32.57  ? 54   TYR E CZ    1 
ATOM   3169  O  OH    . TYR E 1 54  ? 6.290   -21.698 64.688 1.00 35.85  ? 54   TYR E OH    1 
ATOM   3170  N  N     . GLN E 1 55  ? 0.692   -15.334 62.660 1.00 40.21  ? 55   GLN E N     1 
ATOM   3171  C  CA    . GLN E 1 55  ? -0.205  -14.407 61.971 1.00 40.90  ? 55   GLN E CA    1 
ATOM   3172  C  C     . GLN E 1 55  ? 0.560   -13.266 61.290 1.00 41.63  ? 55   GLN E C     1 
ATOM   3173  O  O     . GLN E 1 55  ? 0.056   -12.630 60.371 1.00 41.90  ? 55   GLN E O     1 
ATOM   3174  C  CB    . GLN E 1 55  ? -1.290  -13.885 62.904 1.00 40.56  ? 55   GLN E CB    1 
ATOM   3175  C  CG    . GLN E 1 55  ? -2.462  -14.824 62.964 1.00 40.50  ? 55   GLN E CG    1 
ATOM   3176  C  CD    . GLN E 1 55  ? -3.592  -14.335 63.837 1.00 39.51  ? 55   GLN E CD    1 
ATOM   3177  O  OE1   . GLN E 1 55  ? -3.495  -13.300 64.488 1.00 38.50  ? 55   GLN E OE1   1 
ATOM   3178  N  NE2   . GLN E 1 55  ? -4.678  -15.103 63.868 1.00 39.41  ? 55   GLN E NE2   1 
ATOM   3179  N  N     . LYS E 1 56  ? 1.799   -13.062 61.712 1.00 42.50  ? 56   LYS E N     1 
ATOM   3180  C  CA    . LYS E 1 56  ? 2.647   -11.998 61.205 1.00 43.41  ? 56   LYS E CA    1 
ATOM   3181  C  C     . LYS E 1 56  ? 3.365   -12.437 59.933 1.00 42.92  ? 56   LYS E C     1 
ATOM   3182  O  O     . LYS E 1 56  ? 3.697   -11.613 59.092 1.00 43.71  ? 56   LYS E O     1 
ATOM   3183  C  CB    . LYS E 1 56  ? 3.678   -11.657 62.293 1.00 44.24  ? 56   LYS E CB    1 
ATOM   3184  C  CG    . LYS E 1 56  ? 4.378   -10.324 62.175 1.00 47.40  ? 56   LYS E CG    1 
ATOM   3185  C  CD    . LYS E 1 56  ? 5.121   -9.996  63.496 1.00 52.57  ? 56   LYS E CD    1 
ATOM   3186  C  CE    . LYS E 1 56  ? 5.585   -8.516  63.489 1.00 56.71  ? 56   LYS E CE    1 
ATOM   3187  N  NZ    . LYS E 1 56  ? 5.615   -7.932  64.890 1.00 58.51  ? 56   LYS E NZ    1 
ATOM   3188  N  N     . SER E 1 57  ? 3.634   -13.729 59.795 1.00 42.12  ? 57   SER E N     1 
ATOM   3189  C  CA    . SER E 1 57  ? 4.489   -14.189 58.706 1.00 41.23  ? 57   SER E CA    1 
ATOM   3190  C  C     . SER E 1 57  ? 3.719   -14.955 57.657 1.00 40.88  ? 57   SER E C     1 
ATOM   3191  O  O     . SER E 1 57  ? 2.542   -15.278 57.850 1.00 40.85  ? 57   SER E O     1 
ATOM   3192  C  CB    . SER E 1 57  ? 5.619   -15.046 59.244 1.00 41.38  ? 57   SER E CB    1 
ATOM   3193  O  OG    . SER E 1 57  ? 5.094   -16.065 60.054 1.00 41.57  ? 57   SER E OG    1 
ATOM   3194  N  N     . THR E 1 58  ? 4.393   -15.255 56.546 1.00 40.42  ? 58   THR E N     1 
ATOM   3195  C  CA    . THR E 1 58  ? 3.742   -15.890 55.407 1.00 39.46  ? 58   THR E CA    1 
ATOM   3196  C  C     . THR E 1 58  ? 4.395   -17.190 54.927 1.00 39.88  ? 58   THR E C     1 
ATOM   3197  O  O     . THR E 1 58  ? 3.908   -17.792 53.963 1.00 39.88  ? 58   THR E O     1 
ATOM   3198  C  CB    . THR E 1 58  ? 3.687   -14.938 54.184 1.00 39.57  ? 58   THR E CB    1 
ATOM   3199  O  OG1   . THR E 1 58  ? 4.986   -14.813 53.618 1.00 37.08  ? 58   THR E OG1   1 
ATOM   3200  C  CG2   . THR E 1 58  ? 3.166   -13.557 54.555 1.00 39.65  ? 58   THR E CG2   1 
ATOM   3201  N  N     . GLU E 1 59  ? 5.492   -17.633 55.547 1.00 39.88  ? 59   GLU E N     1 
ATOM   3202  C  CA    . GLU E 1 59  ? 6.125   -18.871 55.071 1.00 40.27  ? 59   GLU E CA    1 
ATOM   3203  C  C     . GLU E 1 59  ? 5.229   -20.086 55.297 1.00 39.61  ? 59   GLU E C     1 
ATOM   3204  O  O     . GLU E 1 59  ? 4.421   -20.101 56.225 1.00 39.70  ? 59   GLU E O     1 
ATOM   3205  C  CB    . GLU E 1 59  ? 7.532   -19.083 55.633 1.00 40.22  ? 59   GLU E CB    1 
ATOM   3206  C  CG    . GLU E 1 59  ? 7.797   -18.441 56.983 1.00 44.65  ? 59   GLU E CG    1 
ATOM   3207  C  CD    . GLU E 1 59  ? 7.178   -19.211 58.127 1.00 49.06  ? 59   GLU E CD    1 
ATOM   3208  O  OE1   . GLU E 1 59  ? 6.746   -20.360 57.879 1.00 51.90  ? 59   GLU E OE1   1 
ATOM   3209  O  OE2   . GLU E 1 59  ? 7.124   -18.677 59.264 1.00 49.55  ? 59   GLU E OE2   1 
ATOM   3210  N  N     . LEU E 1 60  ? 5.360   -21.084 54.425 1.00 39.13  ? 60   LEU E N     1 
ATOM   3211  C  CA    . LEU E 1 60  ? 4.626   -22.344 54.571 1.00 38.87  ? 60   LEU E CA    1 
ATOM   3212  C  C     . LEU E 1 60  ? 5.017   -23.065 55.847 1.00 38.72  ? 60   LEU E C     1 
ATOM   3213  O  O     . LEU E 1 60  ? 6.186   -23.066 56.238 1.00 39.03  ? 60   LEU E O     1 
ATOM   3214  C  CB    . LEU E 1 60  ? 4.868   -23.256 53.379 1.00 38.72  ? 60   LEU E CB    1 
ATOM   3215  C  CG    . LEU E 1 60  ? 4.309   -22.757 52.063 1.00 39.14  ? 60   LEU E CG    1 
ATOM   3216  C  CD1   . LEU E 1 60  ? 4.713   -23.727 50.992 1.00 40.12  ? 60   LEU E CD1   1 
ATOM   3217  C  CD2   . LEU E 1 60  ? 2.784   -22.591 52.140 1.00 40.38  ? 60   LEU E CD2   1 
ATOM   3218  N  N     . LEU E 1 61  ? 4.033   -23.682 56.480 1.00 38.29  ? 61   LEU E N     1 
ATOM   3219  C  CA    . LEU E 1 61  ? 4.189   -24.195 57.824 1.00 38.88  ? 61   LEU E CA    1 
ATOM   3220  C  C     . LEU E 1 61  ? 4.417   -25.713 57.910 1.00 39.41  ? 61   LEU E C     1 
ATOM   3221  O  O     . LEU E 1 61  ? 4.848   -26.217 58.945 1.00 39.26  ? 61   LEU E O     1 
ATOM   3222  C  CB    . LEU E 1 61  ? 2.994   -23.757 58.673 1.00 38.76  ? 61   LEU E CB    1 
ATOM   3223  C  CG    . LEU E 1 61  ? 2.837   -22.237 58.848 1.00 38.98  ? 61   LEU E CG    1 
ATOM   3224  C  CD1   . LEU E 1 61  ? 1.511   -21.919 59.509 1.00 38.76  ? 61   LEU E CD1   1 
ATOM   3225  C  CD2   . LEU E 1 61  ? 4.000   -21.635 59.631 1.00 36.65  ? 61   LEU E CD2   1 
ATOM   3226  N  N     . ILE E 1 62  ? 4.137   -26.416 56.814 1.00 39.98  ? 62   ILE E N     1 
ATOM   3227  C  CA    . ILE E 1 62  ? 4.374   -27.842 56.679 1.00 40.51  ? 62   ILE E CA    1 
ATOM   3228  C  C     . ILE E 1 62  ? 5.713   -28.025 55.976 1.00 41.10  ? 62   ILE E C     1 
ATOM   3229  O  O     . ILE E 1 62  ? 5.995   -27.299 55.030 1.00 41.58  ? 62   ILE E O     1 
ATOM   3230  C  CB    . ILE E 1 62  ? 3.255   -28.500 55.833 1.00 40.41  ? 62   ILE E CB    1 
ATOM   3231  C  CG1   . ILE E 1 62  ? 1.896   -28.305 56.516 1.00 40.20  ? 62   ILE E CG1   1 
ATOM   3232  C  CG2   . ILE E 1 62  ? 3.556   -29.979 55.572 1.00 40.20  ? 62   ILE E CG2   1 
ATOM   3233  C  CD1   . ILE E 1 62  ? 0.714   -28.755 55.715 1.00 41.56  ? 62   ILE E CD1   1 
ATOM   3234  N  N     . ARG E 1 63  ? 6.526   -28.982 56.432 1.00 41.52  ? 63   ARG E N     1 
ATOM   3235  C  CA    . ARG E 1 63  ? 7.827   -29.257 55.824 1.00 42.22  ? 63   ARG E CA    1 
ATOM   3236  C  C     . ARG E 1 63  ? 7.642   -29.698 54.362 1.00 42.23  ? 63   ARG E C     1 
ATOM   3237  O  O     . ARG E 1 63  ? 6.711   -30.439 54.054 1.00 42.28  ? 63   ARG E O     1 
ATOM   3238  C  CB    . ARG E 1 63  ? 8.585   -30.323 56.627 1.00 42.83  ? 63   ARG E CB    1 
ATOM   3239  C  CG    . ARG E 1 63  ? 8.960   -29.972 58.087 1.00 44.14  ? 63   ARG E CG    1 
ATOM   3240  C  CD    . ARG E 1 63  ? 10.154  -29.020 58.183 1.00 49.47  ? 63   ARG E CD    1 
ATOM   3241  N  NE    . ARG E 1 63  ? 9.738   -27.659 58.575 1.00 54.65  ? 63   ARG E NE    1 
ATOM   3242  C  CZ    . ARG E 1 63  ? 9.835   -26.577 57.801 1.00 56.03  ? 63   ARG E CZ    1 
ATOM   3243  N  NH1   . ARG E 1 63  ? 10.351  -26.676 56.576 1.00 58.32  ? 63   ARG E NH1   1 
ATOM   3244  N  NH2   . ARG E 1 63  ? 9.422   -25.396 58.248 1.00 54.98  ? 63   ARG E NH2   1 
ATOM   3245  N  N     . LYS E 1 64  ? 8.517   -29.238 53.468 1.00 42.37  ? 64   LYS E N     1 
ATOM   3246  C  CA    . LYS E 1 64  ? 8.331   -29.434 52.022 1.00 42.49  ? 64   LYS E CA    1 
ATOM   3247  C  C     . LYS E 1 64  ? 8.266   -30.882 51.575 1.00 42.04  ? 64   LYS E C     1 
ATOM   3248  O  O     . LYS E 1 64  ? 7.288   -31.293 50.957 1.00 42.08  ? 64   LYS E O     1 
ATOM   3249  C  CB    . LYS E 1 64  ? 9.411   -28.709 51.214 1.00 43.01  ? 64   LYS E CB    1 
ATOM   3250  C  CG    . LYS E 1 64  ? 9.133   -27.249 50.997 1.00 45.02  ? 64   LYS E CG    1 
ATOM   3251  C  CD    . LYS E 1 64  ? 9.987   -26.683 49.866 1.00 49.57  ? 64   LYS E CD    1 
ATOM   3252  C  CE    . LYS E 1 64  ? 10.155  -25.148 50.004 1.00 51.77  ? 64   LYS E CE    1 
ATOM   3253  N  NZ    . LYS E 1 64  ? 8.980   -24.452 50.648 1.00 52.19  ? 64   LYS E NZ    1 
ATOM   3254  N  N     . LEU E 1 65  ? 9.315   -31.642 51.884 1.00 41.88  ? 65   LEU E N     1 
ATOM   3255  C  CA    . LEU E 1 65  ? 9.446   -33.024 51.433 1.00 41.32  ? 65   LEU E CA    1 
ATOM   3256  C  C     . LEU E 1 65  ? 8.317   -33.946 51.900 1.00 40.60  ? 65   LEU E C     1 
ATOM   3257  O  O     . LEU E 1 65  ? 7.732   -34.661 51.088 1.00 40.50  ? 65   LEU E O     1 
ATOM   3258  C  CB    . LEU E 1 65  ? 10.808  -33.585 51.833 1.00 41.93  ? 65   LEU E CB    1 
ATOM   3259  C  CG    . LEU E 1 65  ? 11.129  -34.991 51.324 1.00 42.17  ? 65   LEU E CG    1 
ATOM   3260  C  CD1   . LEU E 1 65  ? 11.033  -35.057 49.791 1.00 43.70  ? 65   LEU E CD1   1 
ATOM   3261  C  CD2   . LEU E 1 65  ? 12.500  -35.353 51.811 1.00 41.58  ? 65   LEU E CD2   1 
ATOM   3262  N  N     . PRO E 1 66  ? 7.994   -33.935 53.203 1.00 39.90  ? 66   PRO E N     1 
ATOM   3263  C  CA    . PRO E 1 66  ? 6.860   -34.749 53.649 1.00 39.33  ? 66   PRO E CA    1 
ATOM   3264  C  C     . PRO E 1 66  ? 5.567   -34.434 52.886 1.00 38.89  ? 66   PRO E C     1 
ATOM   3265  O  O     . PRO E 1 66  ? 4.804   -35.336 52.544 1.00 38.45  ? 66   PRO E O     1 
ATOM   3266  C  CB    . PRO E 1 66  ? 6.708   -34.357 55.109 1.00 39.35  ? 66   PRO E CB    1 
ATOM   3267  C  CG    . PRO E 1 66  ? 8.039   -33.890 55.511 1.00 39.89  ? 66   PRO E CG    1 
ATOM   3268  C  CD    . PRO E 1 66  ? 8.659   -33.256 54.322 1.00 39.60  ? 66   PRO E CD    1 
ATOM   3269  N  N     . PHE E 1 67  ? 5.327   -33.157 52.605 1.00 39.23  ? 67   PHE E N     1 
ATOM   3270  C  CA    . PHE E 1 67  ? 4.138   -32.779 51.834 1.00 38.44  ? 67   PHE E CA    1 
ATOM   3271  C  C     . PHE E 1 67  ? 4.221   -33.308 50.398 1.00 38.80  ? 67   PHE E C     1 
ATOM   3272  O  O     . PHE E 1 67  ? 3.235   -33.825 49.866 1.00 38.72  ? 67   PHE E O     1 
ATOM   3273  C  CB    . PHE E 1 67  ? 3.911   -31.271 51.857 1.00 37.61  ? 67   PHE E CB    1 
ATOM   3274  C  CG    . PHE E 1 67  ? 2.665   -30.857 51.152 1.00 34.17  ? 67   PHE E CG    1 
ATOM   3275  C  CD1   . PHE E 1 67  ? 1.457   -30.802 51.828 1.00 32.30  ? 67   PHE E CD1   1 
ATOM   3276  C  CD2   . PHE E 1 67  ? 2.692   -30.561 49.807 1.00 30.75  ? 67   PHE E CD2   1 
ATOM   3277  C  CE1   . PHE E 1 67  ? 0.301   -30.437 51.179 1.00 31.12  ? 67   PHE E CE1   1 
ATOM   3278  C  CE2   . PHE E 1 67  ? 1.553   -30.215 49.156 1.00 30.71  ? 67   PHE E CE2   1 
ATOM   3279  C  CZ    . PHE E 1 67  ? 0.345   -30.148 49.839 1.00 31.27  ? 67   PHE E CZ    1 
ATOM   3280  N  N     . GLN E 1 68  ? 5.400   -33.187 49.792 1.00 39.41  ? 68   GLN E N     1 
ATOM   3281  C  CA    . GLN E 1 68  ? 5.667   -33.715 48.447 1.00 40.55  ? 68   GLN E CA    1 
ATOM   3282  C  C     . GLN E 1 68  ? 5.409   -35.237 48.376 1.00 40.56  ? 68   GLN E C     1 
ATOM   3283  O  O     . GLN E 1 68  ? 4.861   -35.744 47.384 1.00 40.99  ? 68   GLN E O     1 
ATOM   3284  C  CB    . GLN E 1 68  ? 7.099   -33.381 48.001 1.00 40.40  ? 68   GLN E CB    1 
ATOM   3285  C  CG    . GLN E 1 68  ? 7.251   -33.290 46.496 1.00 45.10  ? 68   GLN E CG    1 
ATOM   3286  C  CD    . GLN E 1 68  ? 8.683   -32.994 45.994 1.00 51.18  ? 68   GLN E CD    1 
ATOM   3287  O  OE1   . GLN E 1 68  ? 9.688   -33.364 46.621 1.00 52.89  ? 68   GLN E OE1   1 
ATOM   3288  N  NE2   . GLN E 1 68  ? 8.767   -32.330 44.832 1.00 53.76  ? 68   GLN E NE2   1 
ATOM   3289  N  N     . ARG E 1 69  ? 5.783   -35.954 49.429 1.00 40.22  ? 69   ARG E N     1 
ATOM   3290  C  CA    . ARG E 1 69  ? 5.547   -37.399 49.499 1.00 40.78  ? 69   ARG E CA    1 
ATOM   3291  C  C     . ARG E 1 69  ? 4.057   -37.746 49.539 1.00 40.41  ? 69   ARG E C     1 
ATOM   3292  O  O     . ARG E 1 69  ? 3.573   -38.591 48.767 1.00 40.69  ? 69   ARG E O     1 
ATOM   3293  C  CB    . ARG E 1 69  ? 6.251   -38.006 50.710 1.00 40.95  ? 69   ARG E CB    1 
ATOM   3294  C  CG    . ARG E 1 69  ? 7.691   -38.375 50.461 1.00 41.67  ? 69   ARG E CG    1 
ATOM   3295  C  CD    . ARG E 1 69  ? 8.190   -39.335 51.544 1.00 42.71  ? 69   ARG E CD    1 
ATOM   3296  N  NE    . ARG E 1 69  ? 9.153   -38.703 52.444 1.00 44.44  ? 69   ARG E NE    1 
ATOM   3297  C  CZ    . ARG E 1 69  ? 8.919   -38.371 53.712 1.00 44.22  ? 69   ARG E CZ    1 
ATOM   3298  N  NH1   . ARG E 1 69  ? 7.751   -38.609 54.281 1.00 45.33  ? 69   ARG E NH1   1 
ATOM   3299  N  NH2   . ARG E 1 69  ? 9.875   -37.808 54.423 1.00 44.17  ? 69   ARG E NH2   1 
ATOM   3300  N  N     . LEU E 1 70  ? 3.338   -37.084 50.437 1.00 39.62  ? 70   LEU E N     1 
ATOM   3301  C  CA    . LEU E 1 70  ? 1.883   -37.198 50.493 1.00 39.22  ? 70   LEU E CA    1 
ATOM   3302  C  C     . LEU E 1 70  ? 1.216   -36.914 49.146 1.00 39.16  ? 70   LEU E C     1 
ATOM   3303  O  O     . LEU E 1 70  ? 0.396   -37.703 48.693 1.00 39.10  ? 70   LEU E O     1 
ATOM   3304  C  CB    . LEU E 1 70  ? 1.309   -36.301 51.586 1.00 38.87  ? 70   LEU E CB    1 
ATOM   3305  C  CG    . LEU E 1 70  ? -0.194  -36.422 51.841 1.00 38.94  ? 70   LEU E CG    1 
ATOM   3306  C  CD1   . LEU E 1 70  ? -0.617  -37.870 52.190 1.00 37.47  ? 70   LEU E CD1   1 
ATOM   3307  C  CD2   . LEU E 1 70  ? -0.609  -35.444 52.929 1.00 36.54  ? 70   LEU E CD2   1 
ATOM   3308  N  N     . VAL E 1 71  ? 1.585   -35.812 48.492 1.00 39.21  ? 71   VAL E N     1 
ATOM   3309  C  CA    . VAL E 1 71  ? 1.075   -35.542 47.148 1.00 38.99  ? 71   VAL E CA    1 
ATOM   3310  C  C     . VAL E 1 71  ? 1.289   -36.756 46.225 1.00 39.04  ? 71   VAL E C     1 
ATOM   3311  O  O     . VAL E 1 71  ? 0.349   -37.223 45.577 1.00 39.36  ? 71   VAL E O     1 
ATOM   3312  C  CB    . VAL E 1 71  ? 1.680   -34.246 46.551 1.00 38.95  ? 71   VAL E CB    1 
ATOM   3313  C  CG1   . VAL E 1 71  ? 1.334   -34.109 45.074 1.00 38.42  ? 71   VAL E CG1   1 
ATOM   3314  C  CG2   . VAL E 1 71  ? 1.175   -33.020 47.329 1.00 38.56  ? 71   VAL E CG2   1 
ATOM   3315  N  N     . ARG E 1 72  ? 2.510   -37.285 46.196 1.00 38.90  ? 72   ARG E N     1 
ATOM   3316  C  CA    . ARG E 1 72  ? 2.852   -38.357 45.256 1.00 38.73  ? 72   ARG E CA    1 
ATOM   3317  C  C     . ARG E 1 72  ? 2.145   -39.680 45.594 1.00 38.54  ? 72   ARG E C     1 
ATOM   3318  O  O     . ARG E 1 72  ? 1.648   -40.369 44.714 1.00 38.71  ? 72   ARG E O     1 
ATOM   3319  C  CB    . ARG E 1 72  ? 4.362   -38.540 45.174 1.00 38.57  ? 72   ARG E CB    1 
ATOM   3320  C  CG    . ARG E 1 72  ? 5.079   -37.407 44.495 1.00 39.81  ? 72   ARG E CG    1 
ATOM   3321  C  CD    . ARG E 1 72  ? 6.568   -37.606 44.578 1.00 43.98  ? 72   ARG E CD    1 
ATOM   3322  N  NE    . ARG E 1 72  ? 7.294   -36.375 44.302 1.00 48.16  ? 72   ARG E NE    1 
ATOM   3323  C  CZ    . ARG E 1 72  ? 7.610   -35.944 43.086 1.00 49.78  ? 72   ARG E CZ    1 
ATOM   3324  N  NH1   . ARG E 1 72  ? 7.258   -36.630 42.005 1.00 50.38  ? 72   ARG E NH1   1 
ATOM   3325  N  NH2   . ARG E 1 72  ? 8.273   -34.808 42.958 1.00 52.34  ? 72   ARG E NH2   1 
ATOM   3326  N  N     . GLU E 1 73  ? 2.094   -40.019 46.870 1.00 38.01  ? 73   GLU E N     1 
ATOM   3327  C  CA    . GLU E 1 73  ? 1.290   -41.133 47.304 1.00 37.68  ? 73   GLU E CA    1 
ATOM   3328  C  C     . GLU E 1 73  ? -0.157  -41.016 46.840 1.00 37.76  ? 73   GLU E C     1 
ATOM   3329  O  O     . GLU E 1 73  ? -0.688  -41.950 46.248 1.00 38.17  ? 73   GLU E O     1 
ATOM   3330  C  CB    . GLU E 1 73  ? 1.350   -41.291 48.821 1.00 37.54  ? 73   GLU E CB    1 
ATOM   3331  C  CG    . GLU E 1 73  ? 0.550   -42.489 49.320 1.00 36.58  ? 73   GLU E CG    1 
ATOM   3332  C  CD    . GLU E 1 73  ? 0.543   -42.616 50.832 1.00 35.76  ? 73   GLU E CD    1 
ATOM   3333  O  OE1   . GLU E 1 73  ? 1.604   -42.411 51.449 1.00 34.78  ? 73   GLU E OE1   1 
ATOM   3334  O  OE2   . GLU E 1 73  ? -0.532  -42.922 51.405 1.00 36.99  ? 73   GLU E OE2   1 
ATOM   3335  N  N     . ILE E 1 74  ? -0.810  -39.888 47.106 1.00 37.97  ? 74   ILE E N     1 
ATOM   3336  C  CA    . ILE E 1 74  ? -2.225  -39.745 46.705 1.00 37.62  ? 74   ILE E CA    1 
ATOM   3337  C  C     . ILE E 1 74  ? -2.398  -39.810 45.186 1.00 37.74  ? 74   ILE E C     1 
ATOM   3338  O  O     . ILE E 1 74  ? -3.282  -40.511 44.702 1.00 37.72  ? 74   ILE E O     1 
ATOM   3339  C  CB    . ILE E 1 74  ? -2.906  -38.496 47.315 1.00 37.58  ? 74   ILE E CB    1 
ATOM   3340  C  CG1   . ILE E 1 74  ? -3.007  -38.649 48.823 1.00 36.28  ? 74   ILE E CG1   1 
ATOM   3341  C  CG2   . ILE E 1 74  ? -4.333  -38.277 46.761 1.00 37.09  ? 74   ILE E CG2   1 
ATOM   3342  C  CD1   . ILE E 1 74  ? -3.120  -37.326 49.562 1.00 34.18  ? 74   ILE E CD1   1 
ATOM   3343  N  N     . ALA E 1 75  ? -1.550  -39.102 44.445 1.00 37.87  ? 75   ALA E N     1 
ATOM   3344  C  CA    . ALA E 1 75  ? -1.620  -39.113 42.981 1.00 38.59  ? 75   ALA E CA    1 
ATOM   3345  C  C     . ALA E 1 75  ? -1.399  -40.508 42.397 1.00 38.86  ? 75   ALA E C     1 
ATOM   3346  O  O     . ALA E 1 75  ? -2.089  -40.920 41.467 1.00 38.84  ? 75   ALA E O     1 
ATOM   3347  C  CB    . ALA E 1 75  ? -0.630  -38.105 42.384 1.00 38.08  ? 75   ALA E CB    1 
ATOM   3348  N  N     . GLN E 1 76  ? -0.447  -41.234 42.972 1.00 40.09  ? 76   GLN E N     1 
ATOM   3349  C  CA    . GLN E 1 76  ? -0.070  -42.572 42.501 1.00 41.24  ? 76   GLN E CA    1 
ATOM   3350  C  C     . GLN E 1 76  ? -1.247  -43.539 42.555 1.00 41.83  ? 76   GLN E C     1 
ATOM   3351  O  O     . GLN E 1 76  ? -1.464  -44.304 41.614 1.00 42.30  ? 76   GLN E O     1 
ATOM   3352  C  CB    . GLN E 1 76  ? 1.091   -43.116 43.315 1.00 40.85  ? 76   GLN E CB    1 
ATOM   3353  C  CG    . GLN E 1 76  ? 1.797   -44.283 42.672 1.00 42.51  ? 76   GLN E CG    1 
ATOM   3354  C  CD    . GLN E 1 76  ? 2.981   -44.765 43.504 1.00 44.43  ? 76   GLN E CD    1 
ATOM   3355  O  OE1   . GLN E 1 76  ? 2.837   -45.082 44.686 1.00 44.59  ? 76   GLN E OE1   1 
ATOM   3356  N  NE2   . GLN E 1 76  ? 4.160   -44.812 42.888 1.00 44.86  ? 76   GLN E NE2   1 
ATOM   3357  N  N     . ASP E 1 77  ? -2.008  -43.477 43.644 1.00 42.19  ? 77   ASP E N     1 
ATOM   3358  C  CA    . ASP E 1 77  ? -3.249  -44.215 43.766 1.00 43.05  ? 77   ASP E CA    1 
ATOM   3359  C  C     . ASP E 1 77  ? -4.314  -43.863 42.708 1.00 44.37  ? 77   ASP E C     1 
ATOM   3360  O  O     . ASP E 1 77  ? -5.192  -44.696 42.439 1.00 44.93  ? 77   ASP E O     1 
ATOM   3361  C  CB    . ASP E 1 77  ? -3.829  -44.064 45.175 1.00 42.70  ? 77   ASP E CB    1 
ATOM   3362  C  CG    . ASP E 1 77  ? -2.981  -44.752 46.246 1.00 43.36  ? 77   ASP E CG    1 
ATOM   3363  O  OD1   . ASP E 1 77  ? -2.196  -45.677 45.939 1.00 43.50  ? 77   ASP E OD1   1 
ATOM   3364  O  OD2   . ASP E 1 77  ? -3.104  -44.377 47.424 1.00 44.18  ? 77   ASP E OD2   1 
ATOM   3365  N  N     . PHE E 1 78  ? -4.262  -42.660 42.122 1.00 44.92  ? 78   PHE E N     1 
ATOM   3366  C  CA    . PHE E 1 78  ? -5.116  -42.376 40.979 1.00 46.15  ? 78   PHE E CA    1 
ATOM   3367  C  C     . PHE E 1 78  ? -4.493  -42.887 39.691 1.00 47.44  ? 78   PHE E C     1 
ATOM   3368  O  O     . PHE E 1 78  ? -5.199  -43.434 38.846 1.00 47.91  ? 78   PHE E O     1 
ATOM   3369  C  CB    . PHE E 1 78  ? -5.465  -40.885 40.860 1.00 46.23  ? 78   PHE E CB    1 
ATOM   3370  C  CG    . PHE E 1 78  ? -6.462  -40.425 41.882 1.00 46.48  ? 78   PHE E CG    1 
ATOM   3371  C  CD1   . PHE E 1 78  ? -6.092  -39.530 42.892 1.00 46.72  ? 78   PHE E CD1   1 
ATOM   3372  C  CD2   . PHE E 1 78  ? -7.762  -40.917 41.871 1.00 46.62  ? 78   PHE E CD2   1 
ATOM   3373  C  CE1   . PHE E 1 78  ? -7.012  -39.118 43.881 1.00 45.69  ? 78   PHE E CE1   1 
ATOM   3374  C  CE2   . PHE E 1 78  ? -8.697  -40.504 42.857 1.00 48.12  ? 78   PHE E CE2   1 
ATOM   3375  C  CZ    . PHE E 1 78  ? -8.315  -39.601 43.859 1.00 46.09  ? 78   PHE E CZ    1 
ATOM   3376  N  N     . LYS E 1 79  ? -3.179  -42.714 39.543 1.00 48.50  ? 79   LYS E N     1 
ATOM   3377  C  CA    . LYS E 1 79  ? -2.514  -43.004 38.282 1.00 49.81  ? 79   LYS E CA    1 
ATOM   3378  C  C     . LYS E 1 79  ? -1.008  -43.186 38.477 1.00 50.74  ? 79   LYS E C     1 
ATOM   3379  O  O     . LYS E 1 79  ? -0.324  -42.316 39.020 1.00 51.38  ? 79   LYS E O     1 
ATOM   3380  C  CB    . LYS E 1 79  ? -2.769  -41.874 37.288 1.00 49.67  ? 79   LYS E CB    1 
ATOM   3381  C  CG    . LYS E 1 79  ? -3.012  -42.322 35.874 1.00 50.67  ? 79   LYS E CG    1 
ATOM   3382  C  CD    . LYS E 1 79  ? -1.735  -42.500 35.087 1.00 51.76  ? 79   LYS E CD    1 
ATOM   3383  C  CE    . LYS E 1 79  ? -2.002  -43.346 33.861 1.00 51.38  ? 79   LYS E CE    1 
ATOM   3384  N  NZ    . LYS E 1 79  ? -0.771  -44.099 33.530 1.00 53.62  ? 79   LYS E NZ    1 
ATOM   3385  N  N     . THR E 1 80  ? -0.492  -44.315 38.015 1.00 51.47  ? 80   THR E N     1 
ATOM   3386  C  CA    . THR E 1 80  ? 0.927   -44.615 38.153 1.00 51.97  ? 80   THR E CA    1 
ATOM   3387  C  C     . THR E 1 80  ? 1.775   -43.850 37.152 1.00 52.39  ? 80   THR E C     1 
ATOM   3388  O  O     . THR E 1 80  ? 1.269   -43.347 36.137 1.00 52.75  ? 80   THR E O     1 
ATOM   3389  C  CB    . THR E 1 80  ? 1.195   -46.116 37.952 1.00 52.42  ? 80   THR E CB    1 
ATOM   3390  O  OG1   . THR E 1 80  ? 0.715   -46.527 36.656 1.00 51.84  ? 80   THR E OG1   1 
ATOM   3391  C  CG2   . THR E 1 80  ? 0.517   -46.927 39.049 1.00 51.71  ? 80   THR E CG2   1 
ATOM   3392  N  N     . ASP E 1 81  ? 3.069   -43.778 37.452 1.00 52.84  ? 81   ASP E N     1 
ATOM   3393  C  CA    . ASP E 1 81  ? 4.071   -43.180 36.572 1.00 53.84  ? 81   ASP E CA    1 
ATOM   3394  C  C     . ASP E 1 81  ? 3.800   -41.712 36.240 1.00 53.40  ? 81   ASP E C     1 
ATOM   3395  O  O     . ASP E 1 81  ? 4.052   -41.273 35.117 1.00 53.76  ? 81   ASP E O     1 
ATOM   3396  C  CB    . ASP E 1 81  ? 4.207   -44.002 35.280 1.00 54.65  ? 81   ASP E CB    1 
ATOM   3397  C  CG    . ASP E 1 81  ? 4.240   -45.495 35.544 1.00 57.46  ? 81   ASP E CG    1 
ATOM   3398  O  OD1   . ASP E 1 81  ? 3.235   -46.183 35.215 1.00 61.01  ? 81   ASP E OD1   1 
ATOM   3399  O  OD2   . ASP E 1 81  ? 5.257   -45.973 36.106 1.00 59.73  ? 81   ASP E OD2   1 
ATOM   3400  N  N     . LEU E 1 82  ? 3.283   -40.963 37.214 1.00 52.90  ? 82   LEU E N     1 
ATOM   3401  C  CA    . LEU E 1 82  ? 3.143   -39.515 37.080 1.00 52.27  ? 82   LEU E CA    1 
ATOM   3402  C  C     . LEU E 1 82  ? 4.401   -38.784 37.556 1.00 51.98  ? 82   LEU E C     1 
ATOM   3403  O  O     . LEU E 1 82  ? 5.106   -39.243 38.451 1.00 51.95  ? 82   LEU E O     1 
ATOM   3404  C  CB    . LEU E 1 82  ? 1.919   -39.005 37.845 1.00 51.93  ? 82   LEU E CB    1 
ATOM   3405  C  CG    . LEU E 1 82  ? 0.536   -39.314 37.270 1.00 51.40  ? 82   LEU E CG    1 
ATOM   3406  C  CD1   . LEU E 1 82  ? -0.535  -39.184 38.359 1.00 49.86  ? 82   LEU E CD1   1 
ATOM   3407  C  CD2   . LEU E 1 82  ? 0.209   -38.426 36.067 1.00 50.05  ? 82   LEU E CD2   1 
ATOM   3408  N  N     . ARG E 1 83  ? 4.681   -37.660 36.919 1.00 51.68  ? 83   ARG E N     1 
ATOM   3409  C  CA    . ARG E 1 83  ? 5.706   -36.736 37.374 1.00 51.49  ? 83   ARG E CA    1 
ATOM   3410  C  C     . ARG E 1 83  ? 5.012   -35.431 37.795 1.00 50.55  ? 83   ARG E C     1 
ATOM   3411  O  O     . ARG E 1 83  ? 3.847   -35.199 37.439 1.00 50.07  ? 83   ARG E O     1 
ATOM   3412  C  CB    . ARG E 1 83  ? 6.707   -36.476 36.243 1.00 51.69  ? 83   ARG E CB    1 
ATOM   3413  C  CG    . ARG E 1 83  ? 7.604   -37.648 35.925 1.00 53.90  ? 83   ARG E CG    1 
ATOM   3414  C  CD    . ARG E 1 83  ? 8.197   -37.522 34.515 1.00 58.26  ? 83   ARG E CD    1 
ATOM   3415  N  NE    . ARG E 1 83  ? 9.531   -38.125 34.422 1.00 61.17  ? 83   ARG E NE    1 
ATOM   3416  C  CZ    . ARG E 1 83  ? 10.675  -37.438 34.376 1.00 62.96  ? 83   ARG E CZ    1 
ATOM   3417  N  NH1   . ARG E 1 83  ? 10.678  -36.106 34.397 1.00 63.45  ? 83   ARG E NH1   1 
ATOM   3418  N  NH2   . ARG E 1 83  ? 11.830  -38.090 34.301 1.00 64.89  ? 83   ARG E NH2   1 
ATOM   3419  N  N     . PHE E 1 84  ? 5.728   -34.585 38.538 1.00 49.47  ? 84   PHE E N     1 
ATOM   3420  C  CA    . PHE E 1 84  ? 5.189   -33.303 38.991 1.00 48.12  ? 84   PHE E CA    1 
ATOM   3421  C  C     . PHE E 1 84  ? 6.174   -32.187 38.779 1.00 47.66  ? 84   PHE E C     1 
ATOM   3422  O  O     . PHE E 1 84  ? 7.337   -32.300 39.177 1.00 47.92  ? 84   PHE E O     1 
ATOM   3423  C  CB    . PHE E 1 84  ? 4.877   -33.349 40.481 1.00 47.89  ? 84   PHE E CB    1 
ATOM   3424  C  CG    . PHE E 1 84  ? 3.570   -33.990 40.815 1.00 47.02  ? 84   PHE E CG    1 
ATOM   3425  C  CD1   . PHE E 1 84  ? 3.467   -35.373 40.937 1.00 45.71  ? 84   PHE E CD1   1 
ATOM   3426  C  CD2   . PHE E 1 84  ? 2.442   -33.211 41.050 1.00 46.25  ? 84   PHE E CD2   1 
ATOM   3427  C  CE1   . PHE E 1 84  ? 2.255   -35.971 41.275 1.00 43.85  ? 84   PHE E CE1   1 
ATOM   3428  C  CE2   . PHE E 1 84  ? 1.220   -33.803 41.383 1.00 44.91  ? 84   PHE E CE2   1 
ATOM   3429  C  CZ    . PHE E 1 84  ? 1.129   -35.180 41.490 1.00 44.10  ? 84   PHE E CZ    1 
ATOM   3430  N  N     . GLN E 1 85  ? 5.709   -31.095 38.180 1.00 46.87  ? 85   GLN E N     1 
ATOM   3431  C  CA    . GLN E 1 85  ? 6.480   -29.863 38.180 1.00 46.29  ? 85   GLN E CA    1 
ATOM   3432  C  C     . GLN E 1 85  ? 6.590   -29.444 39.625 1.00 45.67  ? 85   GLN E C     1 
ATOM   3433  O  O     . GLN E 1 85  ? 5.627   -29.562 40.359 1.00 45.86  ? 85   GLN E O     1 
ATOM   3434  C  CB    . GLN E 1 85  ? 5.774   -28.778 37.371 1.00 46.36  ? 85   GLN E CB    1 
ATOM   3435  C  CG    . GLN E 1 85  ? 5.674   -29.063 35.875 1.00 46.56  ? 85   GLN E CG    1 
ATOM   3436  C  CD    . GLN E 1 85  ? 5.192   -27.864 35.085 1.00 48.56  ? 85   GLN E CD    1 
ATOM   3437  O  OE1   . GLN E 1 85  ? 4.479   -27.001 35.605 1.00 49.74  ? 85   GLN E OE1   1 
ATOM   3438  N  NE2   . GLN E 1 85  ? 5.574   -27.803 33.816 1.00 49.71  ? 85   GLN E NE2   1 
ATOM   3439  N  N     . SER E 1 86  ? 7.754   -28.975 40.052 1.00 45.26  ? 86   SER E N     1 
ATOM   3440  C  CA    . SER E 1 86  ? 7.900   -28.561 41.441 1.00 45.03  ? 86   SER E CA    1 
ATOM   3441  C  C     . SER E 1 86  ? 6.918   -27.465 41.803 1.00 44.53  ? 86   SER E C     1 
ATOM   3442  O  O     . SER E 1 86  ? 6.429   -27.440 42.919 1.00 45.10  ? 86   SER E O     1 
ATOM   3443  C  CB    . SER E 1 86  ? 9.324   -28.129 41.748 1.00 45.23  ? 86   SER E CB    1 
ATOM   3444  O  OG    . SER E 1 86  ? 9.729   -27.136 40.833 1.00 47.08  ? 86   SER E OG    1 
ATOM   3445  N  N     . SER E 1 87  ? 6.603   -26.579 40.864 1.00 43.86  ? 87   SER E N     1 
ATOM   3446  C  CA    . SER E 1 87  ? 5.616   -25.535 41.131 1.00 43.45  ? 87   SER E CA    1 
ATOM   3447  C  C     . SER E 1 87  ? 4.200   -26.101 41.270 1.00 42.66  ? 87   SER E C     1 
ATOM   3448  O  O     . SER E 1 87  ? 3.360   -25.518 41.966 1.00 42.68  ? 87   SER E O     1 
ATOM   3449  C  CB    . SER E 1 87  ? 5.661   -24.420 40.090 1.00 43.00  ? 87   SER E CB    1 
ATOM   3450  O  OG    . SER E 1 87  ? 5.264   -24.914 38.825 1.00 46.87  ? 87   SER E OG    1 
ATOM   3451  N  N     . ALA E 1 88  ? 3.933   -27.240 40.642 1.00 41.82  ? 88   ALA E N     1 
ATOM   3452  C  CA    . ALA E 1 88  ? 2.651   -27.931 40.850 1.00 40.95  ? 88   ALA E CA    1 
ATOM   3453  C  C     . ALA E 1 88  ? 2.486   -28.353 42.307 1.00 40.82  ? 88   ALA E C     1 
ATOM   3454  O  O     . ALA E 1 88  ? 1.408   -28.161 42.898 1.00 41.05  ? 88   ALA E O     1 
ATOM   3455  C  CB    . ALA E 1 88  ? 2.532   -29.124 39.947 1.00 40.83  ? 88   ALA E CB    1 
ATOM   3456  N  N     . VAL E 1 89  ? 3.557   -28.888 42.900 1.00 39.92  ? 89   VAL E N     1 
ATOM   3457  C  CA    . VAL E 1 89  ? 3.505   -29.321 44.304 1.00 39.21  ? 89   VAL E CA    1 
ATOM   3458  C  C     . VAL E 1 89  ? 3.376   -28.125 45.223 1.00 38.99  ? 89   VAL E C     1 
ATOM   3459  O  O     . VAL E 1 89  ? 2.676   -28.188 46.232 1.00 39.10  ? 89   VAL E O     1 
ATOM   3460  C  CB    . VAL E 1 89  ? 4.728   -30.205 44.741 1.00 38.96  ? 89   VAL E CB    1 
ATOM   3461  C  CG1   . VAL E 1 89  ? 4.606   -30.612 46.191 1.00 38.18  ? 89   VAL E CG1   1 
ATOM   3462  C  CG2   . VAL E 1 89  ? 4.839   -31.448 43.896 1.00 37.51  ? 89   VAL E CG2   1 
ATOM   3463  N  N     . MET E 1 90  ? 4.057   -27.041 44.867 1.00 39.19  ? 90   MET E N     1 
ATOM   3464  C  CA    . MET E 1 90  ? 4.040   -25.818 45.662 1.00 39.09  ? 90   MET E CA    1 
ATOM   3465  C  C     . MET E 1 90  ? 2.643   -25.196 45.619 1.00 38.24  ? 90   MET E C     1 
ATOM   3466  O  O     . MET E 1 90  ? 2.118   -24.769 46.650 1.00 38.10  ? 90   MET E O     1 
ATOM   3467  C  CB    . MET E 1 90  ? 5.127   -24.853 45.188 1.00 39.76  ? 90   MET E CB    1 
ATOM   3468  C  CG    . MET E 1 90  ? 6.583   -25.317 45.470 1.00 42.80  ? 90   MET E CG    1 
ATOM   3469  S  SD    . MET E 1 90  ? 6.876   -25.956 47.152 1.00 50.58  ? 90   MET E SD    1 
ATOM   3470  C  CE    . MET E 1 90  ? 6.680   -24.453 48.122 1.00 49.43  ? 90   MET E CE    1 
ATOM   3471  N  N     . ALA E 1 91  ? 2.017   -25.204 44.440 1.00 37.05  ? 91   ALA E N     1 
ATOM   3472  C  CA    . ALA E 1 91  ? 0.646   -24.694 44.306 1.00 35.88  ? 91   ALA E CA    1 
ATOM   3473  C  C     . ALA E 1 91  ? -0.310  -25.481 45.200 1.00 35.27  ? 91   ALA E C     1 
ATOM   3474  O  O     . ALA E 1 91  ? -1.162  -24.905 45.882 1.00 35.57  ? 91   ALA E O     1 
ATOM   3475  C  CB    . ALA E 1 91  ? 0.188   -24.711 42.849 1.00 35.07  ? 91   ALA E CB    1 
ATOM   3476  N  N     . LEU E 1 92  ? -0.150  -26.798 45.220 1.00 34.74  ? 92   LEU E N     1 
ATOM   3477  C  CA    . LEU E 1 92  ? -0.970  -27.656 46.086 1.00 34.08  ? 92   LEU E CA    1 
ATOM   3478  C  C     . LEU E 1 92  ? -0.739  -27.339 47.538 1.00 33.69  ? 92   LEU E C     1 
ATOM   3479  O  O     . LEU E 1 92  ? -1.671  -27.385 48.337 1.00 33.64  ? 92   LEU E O     1 
ATOM   3480  C  CB    . LEU E 1 92  ? -0.689  -29.144 45.838 1.00 33.80  ? 92   LEU E CB    1 
ATOM   3481  C  CG    . LEU E 1 92  ? -1.312  -29.724 44.556 1.00 33.55  ? 92   LEU E CG    1 
ATOM   3482  C  CD1   . LEU E 1 92  ? -0.632  -31.003 44.093 1.00 33.64  ? 92   LEU E CD1   1 
ATOM   3483  C  CD2   . LEU E 1 92  ? -2.796  -29.950 44.700 1.00 31.49  ? 92   LEU E CD2   1 
ATOM   3484  N  N     . GLN E 1 93  ? 0.499   -26.989 47.882 1.00 33.55  ? 93   GLN E N     1 
ATOM   3485  C  CA    . GLN E 1 93  ? 0.802   -26.693 49.268 1.00 32.57  ? 93   GLN E CA    1 
ATOM   3486  C  C     . GLN E 1 93  ? 0.208   -25.372 49.702 1.00 32.61  ? 93   GLN E C     1 
ATOM   3487  O  O     . GLN E 1 93  ? -0.376  -25.287 50.789 1.00 32.65  ? 93   GLN E O     1 
ATOM   3488  C  CB    . GLN E 1 93  ? 2.297   -26.782 49.583 1.00 32.29  ? 93   GLN E CB    1 
ATOM   3489  C  CG    . GLN E 1 93  ? 2.511   -27.150 51.049 1.00 31.72  ? 93   GLN E CG    1 
ATOM   3490  C  CD    . GLN E 1 93  ? 3.952   -27.175 51.470 1.00 32.00  ? 93   GLN E CD    1 
ATOM   3491  O  OE1   . GLN E 1 93  ? 4.830   -27.604 50.720 1.00 32.46  ? 93   GLN E OE1   1 
ATOM   3492  N  NE2   . GLN E 1 93  ? 4.210   -26.736 52.702 1.00 32.79  ? 93   GLN E NE2   1 
ATOM   3493  N  N     . GLU E 1 94  ? 0.343   -24.350 48.857 1.00 32.15  ? 94   GLU E N     1 
ATOM   3494  C  CA    . GLU E 1 94  ? -0.218  -23.038 49.145 1.00 31.56  ? 94   GLU E CA    1 
ATOM   3495  C  C     . GLU E 1 94  ? -1.725  -23.145 49.267 1.00 31.16  ? 94   GLU E C     1 
ATOM   3496  O  O     . GLU E 1 94  ? -2.338  -22.514 50.129 1.00 30.79  ? 94   GLU E O     1 
ATOM   3497  C  CB    . GLU E 1 94  ? 0.147   -22.051 48.038 1.00 32.08  ? 94   GLU E CB    1 
ATOM   3498  C  CG    . GLU E 1 94  ? 1.610   -21.614 48.026 1.00 32.17  ? 94   GLU E CG    1 
ATOM   3499  C  CD    . GLU E 1 94  ? 1.943   -20.577 49.094 1.00 34.55  ? 94   GLU E CD    1 
ATOM   3500  O  OE1   . GLU E 1 94  ? 1.022   -19.995 49.723 1.00 33.06  ? 94   GLU E OE1   1 
ATOM   3501  O  OE2   . GLU E 1 94  ? 3.160   -20.356 49.308 1.00 37.51  ? 94   GLU E OE2   1 
ATOM   3502  N  N     . ALA E 1 95  ? -2.332  -23.969 48.424 1.00 30.80  ? 95   ALA E N     1 
ATOM   3503  C  CA    . ALA E 1 95  ? -3.781  -24.100 48.479 1.00 30.87  ? 95   ALA E CA    1 
ATOM   3504  C  C     . ALA E 1 95  ? -4.239  -24.818 49.742 1.00 31.13  ? 95   ALA E C     1 
ATOM   3505  O  O     . ALA E 1 95  ? -5.222  -24.406 50.362 1.00 31.99  ? 95   ALA E O     1 
ATOM   3506  C  CB    . ALA E 1 95  ? -4.320  -24.774 47.236 1.00 30.77  ? 95   ALA E CB    1 
ATOM   3507  N  N     . SER E 1 96  ? -3.511  -25.860 50.134 1.00 31.19  ? 96   SER E N     1 
ATOM   3508  C  CA    . SER E 1 96  ? -3.878  -26.716 51.268 1.00 31.46  ? 96   SER E CA    1 
ATOM   3509  C  C     . SER E 1 96  ? -3.683  -26.027 52.596 1.00 31.70  ? 96   SER E C     1 
ATOM   3510  O  O     . SER E 1 96  ? -4.528  -26.135 53.479 1.00 32.12  ? 96   SER E O     1 
ATOM   3511  C  CB    . SER E 1 96  ? -3.054  -28.015 51.265 1.00 31.66  ? 96   SER E CB    1 
ATOM   3512  O  OG    . SER E 1 96  ? -3.207  -28.736 50.044 1.00 31.57  ? 96   SER E OG    1 
ATOM   3513  N  N     . GLU E 1 97  ? -2.552  -25.343 52.751 1.00 32.04  ? 97   GLU E N     1 
ATOM   3514  C  CA    . GLU E 1 97  ? -2.312  -24.512 53.936 1.00 31.82  ? 97   GLU E CA    1 
ATOM   3515  C  C     . GLU E 1 97  ? -3.313  -23.343 54.037 1.00 31.52  ? 97   GLU E C     1 
ATOM   3516  O  O     . GLU E 1 97  ? -3.748  -22.991 55.132 1.00 32.46  ? 97   GLU E O     1 
ATOM   3517  C  CB    . GLU E 1 97  ? -0.853  -24.032 54.012 1.00 31.89  ? 97   GLU E CB    1 
ATOM   3518  C  CG    . GLU E 1 97  ? 0.216   -25.169 53.961 1.00 33.94  ? 97   GLU E CG    1 
ATOM   3519  C  CD    . GLU E 1 97  ? 1.525   -24.836 54.721 1.00 36.13  ? 97   GLU E CD    1 
ATOM   3520  O  OE1   . GLU E 1 97  ? 1.551   -23.836 55.463 1.00 37.29  ? 97   GLU E OE1   1 
ATOM   3521  O  OE2   . GLU E 1 97  ? 2.533   -25.575 54.590 1.00 36.48  ? 97   GLU E OE2   1 
ATOM   3522  N  N     . ALA E 1 98  ? -3.716  -22.741 52.932 1.00 30.57  ? 98   ALA E N     1 
ATOM   3523  C  CA    . ALA E 1 98  ? -4.703  -21.672 53.067 1.00 30.64  ? 98   ALA E CA    1 
ATOM   3524  C  C     . ALA E 1 98  ? -6.038  -22.269 53.448 1.00 31.26  ? 98   ALA E C     1 
ATOM   3525  O  O     . ALA E 1 98  ? -6.794  -21.672 54.227 1.00 31.73  ? 98   ALA E O     1 
ATOM   3526  C  CB    . ALA E 1 98  ? -4.830  -20.842 51.804 1.00 29.73  ? 98   ALA E CB    1 
ATOM   3527  N  N     . TYR E 1 99  ? -6.343  -23.450 52.914 1.00 31.36  ? 99   TYR E N     1 
ATOM   3528  C  CA    . TYR E 1 99  ? -7.600  -24.094 53.270 1.00 31.81  ? 99   TYR E CA    1 
ATOM   3529  C  C     . TYR E 1 99  ? -7.627  -24.479 54.758 1.00 32.36  ? 99   TYR E C     1 
ATOM   3530  O  O     . TYR E 1 99  ? -8.624  -24.225 55.452 1.00 32.35  ? 99   TYR E O     1 
ATOM   3531  C  CB    . TYR E 1 99  ? -7.877  -25.289 52.367 1.00 32.29  ? 99   TYR E CB    1 
ATOM   3532  C  CG    . TYR E 1 99  ? -9.002  -26.169 52.836 1.00 32.63  ? 99   TYR E CG    1 
ATOM   3533  C  CD1   . TYR E 1 99  ? -10.330 -25.898 52.493 1.00 33.66  ? 99   TYR E CD1   1 
ATOM   3534  C  CD2   . TYR E 1 99  ? -8.741  -27.282 53.616 1.00 32.15  ? 99   TYR E CD2   1 
ATOM   3535  C  CE1   . TYR E 1 99  ? -11.367 -26.734 52.946 1.00 32.28  ? 99   TYR E CE1   1 
ATOM   3536  C  CE2   . TYR E 1 99  ? -9.752  -28.108 54.059 1.00 31.88  ? 99   TYR E CE2   1 
ATOM   3537  C  CZ    . TYR E 1 99  ? -11.055 -27.833 53.734 1.00 31.68  ? 99   TYR E CZ    1 
ATOM   3538  O  OH    . TYR E 1 99  ? -12.043 -28.678 54.204 1.00 32.62  ? 99   TYR E OH    1 
ATOM   3539  N  N     . LEU E 1 100 ? -6.518  -25.032 55.260 1.00 32.28  ? 100  LEU E N     1 
ATOM   3540  C  CA    . LEU E 1 100 ? -6.472  -25.468 56.650 1.00 32.17  ? 100  LEU E CA    1 
ATOM   3541  C  C     . LEU E 1 100 ? -6.520  -24.334 57.664 1.00 32.22  ? 100  LEU E C     1 
ATOM   3542  O  O     . LEU E 1 100 ? -7.209  -24.453 58.681 1.00 32.28  ? 100  LEU E O     1 
ATOM   3543  C  CB    . LEU E 1 100 ? -5.287  -26.396 56.909 1.00 32.34  ? 100  LEU E CB    1 
ATOM   3544  C  CG    . LEU E 1 100 ? -5.310  -27.795 56.248 1.00 32.87  ? 100  LEU E CG    1 
ATOM   3545  C  CD1   . LEU E 1 100 ? -3.990  -28.558 56.498 1.00 29.10  ? 100  LEU E CD1   1 
ATOM   3546  C  CD2   . LEU E 1 100 ? -6.547  -28.617 56.670 1.00 30.04  ? 100  LEU E CD2   1 
ATOM   3547  N  N     . VAL E 1 101 ? -5.790  -23.242 57.385 1.00 31.90  ? 101  VAL E N     1 
ATOM   3548  C  CA    . VAL E 1 101 ? -5.827  -22.026 58.211 1.00 30.92  ? 101  VAL E CA    1 
ATOM   3549  C  C     . VAL E 1 101 ? -7.265  -21.494 58.296 1.00 30.47  ? 101  VAL E C     1 
ATOM   3550  O  O     . VAL E 1 101 ? -7.782  -21.265 59.379 1.00 30.41  ? 101  VAL E O     1 
ATOM   3551  C  CB    . VAL E 1 101 ? -4.831  -20.928 57.705 1.00 31.13  ? 101  VAL E CB    1 
ATOM   3552  C  CG1   . VAL E 1 101 ? -5.033  -19.636 58.440 1.00 30.46  ? 101  VAL E CG1   1 
ATOM   3553  C  CG2   . VAL E 1 101 ? -3.372  -21.368 57.898 1.00 31.66  ? 101  VAL E CG2   1 
ATOM   3554  N  N     . ALA E 1 102 ? -7.923  -21.346 57.154 1.00 30.13  ? 102  ALA E N     1 
ATOM   3555  C  CA    . ALA E 1 102 ? -9.279  -20.818 57.132 1.00 29.71  ? 102  ALA E CA    1 
ATOM   3556  C  C     . ALA E 1 102 ? -10.273 -21.741 57.852 1.00 30.13  ? 102  ALA E C     1 
ATOM   3557  O  O     . ALA E 1 102 ? -11.176 -21.253 58.539 1.00 31.26  ? 102  ALA E O     1 
ATOM   3558  C  CB    . ALA E 1 102 ? -9.718  -20.506 55.722 1.00 28.36  ? 102  ALA E CB    1 
ATOM   3559  N  N     . LEU E 1 103 ? -10.095 -23.056 57.734 1.00 30.79  ? 103  LEU E N     1 
ATOM   3560  C  CA    . LEU E 1 103 ? -10.923 -24.032 58.479 1.00 31.04  ? 103  LEU E CA    1 
ATOM   3561  C  C     . LEU E 1 103 ? -10.717 -23.905 59.988 1.00 31.84  ? 103  LEU E C     1 
ATOM   3562  O  O     . LEU E 1 103 ? -11.683 -23.900 60.775 1.00 31.87  ? 103  LEU E O     1 
ATOM   3563  C  CB    . LEU E 1 103 ? -10.612 -25.455 58.034 1.00 30.85  ? 103  LEU E CB    1 
ATOM   3564  C  CG    . LEU E 1 103 ? -11.413 -26.584 58.696 1.00 31.38  ? 103  LEU E CG    1 
ATOM   3565  C  CD1   . LEU E 1 103 ? -12.889 -26.481 58.396 1.00 30.78  ? 103  LEU E CD1   1 
ATOM   3566  C  CD2   . LEU E 1 103 ? -10.902 -27.938 58.247 1.00 30.90  ? 103  LEU E CD2   1 
ATOM   3567  N  N     . PHE E 1 104 ? -9.464  -23.769 60.404 1.00 32.46  ? 104  PHE E N     1 
ATOM   3568  C  CA    . PHE E 1 104 ? -9.187  -23.586 61.823 1.00 33.45  ? 104  PHE E CA    1 
ATOM   3569  C  C     . PHE E 1 104 ? -9.856  -22.339 62.396 1.00 34.19  ? 104  PHE E C     1 
ATOM   3570  O  O     . PHE E 1 104 ? -10.302 -22.350 63.554 1.00 35.04  ? 104  PHE E O     1 
ATOM   3571  C  CB    . PHE E 1 104 ? -7.690  -23.618 62.128 1.00 32.94  ? 104  PHE E CB    1 
ATOM   3572  C  CG    . PHE E 1 104 ? -7.109  -25.009 62.189 1.00 33.92  ? 104  PHE E CG    1 
ATOM   3573  C  CD1   . PHE E 1 104 ? -6.029  -25.358 61.386 1.00 34.77  ? 104  PHE E CD1   1 
ATOM   3574  C  CD2   . PHE E 1 104 ? -7.627  -25.967 63.061 1.00 34.08  ? 104  PHE E CD2   1 
ATOM   3575  C  CE1   . PHE E 1 104 ? -5.472  -26.637 61.446 1.00 34.89  ? 104  PHE E CE1   1 
ATOM   3576  C  CE2   . PHE E 1 104 ? -7.068  -27.252 63.135 1.00 34.18  ? 104  PHE E CE2   1 
ATOM   3577  C  CZ    . PHE E 1 104 ? -5.991  -27.583 62.312 1.00 35.28  ? 104  PHE E CZ    1 
ATOM   3578  N  N     . GLU E 1 105 ? -9.959  -21.276 61.603 1.00 34.62  ? 105  GLU E N     1 
ATOM   3579  C  CA    . GLU E 1 105 ? -10.628 -20.057 62.083 1.00 35.51  ? 105  GLU E CA    1 
ATOM   3580  C  C     . GLU E 1 105 ? -12.082 -20.372 62.327 1.00 35.14  ? 105  GLU E C     1 
ATOM   3581  O  O     . GLU E 1 105 ? -12.608 -20.059 63.385 1.00 35.21  ? 105  GLU E O     1 
ATOM   3582  C  CB    . GLU E 1 105 ? -10.522 -18.894 61.085 1.00 35.98  ? 105  GLU E CB    1 
ATOM   3583  C  CG    . GLU E 1 105 ? -9.104  -18.387 60.820 1.00 39.23  ? 105  GLU E CG    1 
ATOM   3584  C  CD    . GLU E 1 105 ? -8.970  -17.613 59.508 1.00 44.16  ? 105  GLU E CD    1 
ATOM   3585  O  OE1   . GLU E 1 105 ? -10.011 -17.346 58.862 1.00 47.33  ? 105  GLU E OE1   1 
ATOM   3586  O  OE2   . GLU E 1 105 ? -7.821  -17.272 59.115 1.00 45.59  ? 105  GLU E OE2   1 
ATOM   3587  N  N     . ASP E 1 106 ? -12.729 -21.008 61.348 1.00 35.07  ? 106  ASP E N     1 
ATOM   3588  C  CA    . ASP E 1 106 ? -14.129 -21.394 61.493 1.00 34.91  ? 106  ASP E CA    1 
ATOM   3589  C  C     . ASP E 1 106 ? -14.300 -22.292 62.717 1.00 34.66  ? 106  ASP E C     1 
ATOM   3590  O  O     . ASP E 1 106 ? -15.262 -22.158 63.475 1.00 34.44  ? 106  ASP E O     1 
ATOM   3591  C  CB    . ASP E 1 106 ? -14.644 -22.065 60.211 1.00 34.79  ? 106  ASP E CB    1 
ATOM   3592  C  CG    . ASP E 1 106 ? -14.769 -21.079 59.033 1.00 36.09  ? 106  ASP E CG    1 
ATOM   3593  O  OD1   . ASP E 1 106 ? -14.486 -19.883 59.232 1.00 37.95  ? 106  ASP E OD1   1 
ATOM   3594  O  OD2   . ASP E 1 106 ? -15.160 -21.484 57.907 1.00 38.19  ? 106  ASP E OD2   1 
ATOM   3595  N  N     . THR E 1 107 ? -13.332 -23.189 62.905 1.00 34.53  ? 107  THR E N     1 
ATOM   3596  C  CA    . THR E 1 107 ? -13.382 -24.179 63.961 1.00 34.45  ? 107  THR E CA    1 
ATOM   3597  C  C     . THR E 1 107 ? -13.325 -23.473 65.293 1.00 34.35  ? 107  THR E C     1 
ATOM   3598  O  O     . THR E 1 107 ? -14.126 -23.763 66.182 1.00 34.44  ? 107  THR E O     1 
ATOM   3599  C  CB    . THR E 1 107 ? -12.212 -25.162 63.842 1.00 34.51  ? 107  THR E CB    1 
ATOM   3600  O  OG1   . THR E 1 107 ? -12.319 -25.883 62.613 1.00 34.86  ? 107  THR E OG1   1 
ATOM   3601  C  CG2   . THR E 1 107 ? -12.225 -26.121 64.976 1.00 33.50  ? 107  THR E CG2   1 
ATOM   3602  N  N     . ASN E 1 108 ? -12.380 -22.538 65.412 1.00 34.03  ? 108  ASN E N     1 
ATOM   3603  C  CA    . ASN E 1 108 ? -12.239 -21.724 66.603 1.00 33.99  ? 108  ASN E CA    1 
ATOM   3604  C  C     . ASN E 1 108 ? -13.541 -21.046 66.995 1.00 34.37  ? 108  ASN E C     1 
ATOM   3605  O  O     . ASN E 1 108 ? -13.901 -21.032 68.176 1.00 34.60  ? 108  ASN E O     1 
ATOM   3606  C  CB    . ASN E 1 108 ? -11.155 -20.675 66.405 1.00 34.25  ? 108  ASN E CB    1 
ATOM   3607  C  CG    . ASN E 1 108 ? -10.413 -20.379 67.669 1.00 35.00  ? 108  ASN E CG    1 
ATOM   3608  O  OD1   . ASN E 1 108 ? -10.473 -21.144 68.634 1.00 39.72  ? 108  ASN E OD1   1 
ATOM   3609  N  ND2   . ASN E 1 108 ? -9.706  -19.286 67.683 1.00 34.03  ? 108  ASN E ND2   1 
ATOM   3610  N  N     . LEU E 1 109 ? -14.248 -20.502 65.999 1.00 34.63  ? 109  LEU E N     1 
ATOM   3611  C  CA    . LEU E 1 109 ? -15.535 -19.856 66.216 1.00 35.04  ? 109  LEU E CA    1 
ATOM   3612  C  C     . LEU E 1 109 ? -16.584 -20.819 66.744 1.00 35.66  ? 109  LEU E C     1 
ATOM   3613  O  O     . LEU E 1 109 ? -17.369 -20.454 67.629 1.00 36.60  ? 109  LEU E O     1 
ATOM   3614  C  CB    . LEU E 1 109 ? -16.030 -19.168 64.942 1.00 34.69  ? 109  LEU E CB    1 
ATOM   3615  C  CG    . LEU E 1 109 ? -15.341 -17.871 64.502 1.00 33.79  ? 109  LEU E CG    1 
ATOM   3616  C  CD1   . LEU E 1 109 ? -15.957 -17.429 63.213 1.00 33.40  ? 109  LEU E CD1   1 
ATOM   3617  C  CD2   . LEU E 1 109 ? -15.410 -16.736 65.527 1.00 31.23  ? 109  LEU E CD2   1 
ATOM   3618  N  N     . CYS E 1 110 ? -16.583 -22.046 66.229 1.00 35.93  ? 110  CYS E N     1 
ATOM   3619  C  CA    . CYS E 1 110 ? -17.506 -23.075 66.709 1.00 36.25  ? 110  CYS E CA    1 
ATOM   3620  C  C     . CYS E 1 110 ? -17.225 -23.448 68.163 1.00 36.43  ? 110  CYS E C     1 
ATOM   3621  O  O     . CYS E 1 110 ? -18.155 -23.583 68.959 1.00 36.78  ? 110  CYS E O     1 
ATOM   3622  C  CB    . CYS E 1 110 ? -17.497 -24.309 65.796 1.00 35.83  ? 110  CYS E CB    1 
ATOM   3623  S  SG    . CYS E 1 110 ? -18.082 -23.972 64.118 1.00 36.55  ? 110  CYS E SG    1 
ATOM   3624  N  N     . ALA E 1 111 ? -15.954 -23.594 68.521 1.00 36.53  ? 111  ALA E N     1 
ATOM   3625  C  CA    . ALA E 1 111 ? -15.613 -23.840 69.922 1.00 37.11  ? 111  ALA E CA    1 
ATOM   3626  C  C     . ALA E 1 111 ? -16.113 -22.707 70.816 1.00 37.48  ? 111  ALA E C     1 
ATOM   3627  O  O     . ALA E 1 111 ? -16.792 -22.951 71.806 1.00 38.16  ? 111  ALA E O     1 
ATOM   3628  C  CB    . ALA E 1 111 ? -14.114 -24.042 70.098 1.00 37.03  ? 111  ALA E CB    1 
ATOM   3629  N  N     . ILE E 1 112 ? -15.796 -21.467 70.450 1.00 37.71  ? 112  ILE E N     1 
ATOM   3630  C  CA    . ILE E 1 112 ? -16.133 -20.298 71.272 1.00 37.46  ? 112  ILE E CA    1 
ATOM   3631  C  C     . ILE E 1 112 ? -17.645 -20.157 71.415 1.00 38.50  ? 112  ILE E C     1 
ATOM   3632  O  O     . ILE E 1 112 ? -18.143 -19.786 72.483 1.00 38.70  ? 112  ILE E O     1 
ATOM   3633  C  CB    . ILE E 1 112 ? -15.487 -19.004 70.696 1.00 37.27  ? 112  ILE E CB    1 
ATOM   3634  C  CG1   . ILE E 1 112 ? -13.994 -18.975 71.008 1.00 36.57  ? 112  ILE E CG1   1 
ATOM   3635  C  CG2   . ILE E 1 112 ? -16.134 -17.751 71.243 1.00 35.45  ? 112  ILE E CG2   1 
ATOM   3636  C  CD1   . ILE E 1 112 ? -13.183 -18.335 69.914 1.00 37.70  ? 112  ILE E CD1   1 
ATOM   3637  N  N     . HIS E 1 113 ? -18.377 -20.481 70.347 1.00 39.00  ? 113  HIS E N     1 
ATOM   3638  C  CA    . HIS E 1 113 ? -19.835 -20.587 70.419 1.00 39.47  ? 113  HIS E CA    1 
ATOM   3639  C  C     . HIS E 1 113 ? -20.275 -21.543 71.528 1.00 40.14  ? 113  HIS E C     1 
ATOM   3640  O  O     . HIS E 1 113 ? -21.319 -21.342 72.155 1.00 40.55  ? 113  HIS E O     1 
ATOM   3641  C  CB    . HIS E 1 113 ? -20.384 -21.077 69.089 1.00 39.26  ? 113  HIS E CB    1 
ATOM   3642  C  CG    . HIS E 1 113 ? -21.877 -21.035 68.998 1.00 38.88  ? 113  HIS E CG    1 
ATOM   3643  N  ND1   . HIS E 1 113 ? -22.582 -19.855 68.875 1.00 38.93  ? 113  HIS E ND1   1 
ATOM   3644  C  CD2   . HIS E 1 113 ? -22.796 -22.028 68.977 1.00 36.90  ? 113  HIS E CD2   1 
ATOM   3645  C  CE1   . HIS E 1 113 ? -23.873 -20.123 68.795 1.00 37.74  ? 113  HIS E CE1   1 
ATOM   3646  N  NE2   . HIS E 1 113 ? -24.029 -21.435 68.849 1.00 37.76  ? 113  HIS E NE2   1 
ATOM   3647  N  N     . ALA E 1 114 ? -19.483 -22.589 71.761 1.00 40.75  ? 114  ALA E N     1 
ATOM   3648  C  CA    . ALA E 1 114 ? -19.822 -23.584 72.780 1.00 41.37  ? 114  ALA E CA    1 
ATOM   3649  C  C     . ALA E 1 114 ? -19.305 -23.152 74.138 1.00 41.95  ? 114  ALA E C     1 
ATOM   3650  O  O     . ALA E 1 114 ? -19.457 -23.871 75.113 1.00 42.33  ? 114  ALA E O     1 
ATOM   3651  C  CB    . ALA E 1 114 ? -19.268 -24.930 72.413 1.00 41.19  ? 114  ALA E CB    1 
ATOM   3652  N  N     . LYS E 1 115 ? -18.710 -21.960 74.193 1.00 42.77  ? 115  LYS E N     1 
ATOM   3653  C  CA    . LYS E 1 115 ? -18.174 -21.382 75.434 1.00 42.95  ? 115  LYS E CA    1 
ATOM   3654  C  C     . LYS E 1 115 ? -16.911 -22.115 75.892 1.00 42.61  ? 115  LYS E C     1 
ATOM   3655  O  O     . LYS E 1 115 ? -16.628 -22.204 77.087 1.00 42.50  ? 115  LYS E O     1 
ATOM   3656  C  CB    . LYS E 1 115 ? -19.249 -21.352 76.529 1.00 43.49  ? 115  LYS E CB    1 
ATOM   3657  C  CG    . LYS E 1 115 ? -20.372 -20.336 76.261 1.00 45.89  ? 115  LYS E CG    1 
ATOM   3658  C  CD    . LYS E 1 115 ? -21.533 -20.509 77.226 1.00 49.79  ? 115  LYS E CD    1 
ATOM   3659  C  CE    . LYS E 1 115 ? -22.568 -19.397 77.023 1.00 53.75  ? 115  LYS E CE    1 
ATOM   3660  N  NZ    . LYS E 1 115 ? -23.452 -19.235 78.237 1.00 57.56  ? 115  LYS E NZ    1 
ATOM   3661  N  N     . ARG E 1 116 ? -16.165 -22.642 74.920 1.00 42.02  ? 116  ARG E N     1 
ATOM   3662  C  CA    . ARG E 1 116 ? -14.882 -23.298 75.164 1.00 41.66  ? 116  ARG E CA    1 
ATOM   3663  C  C     . ARG E 1 116 ? -13.788 -22.464 74.502 1.00 41.73  ? 116  ARG E C     1 
ATOM   3664  O  O     . ARG E 1 116 ? -14.082 -21.536 73.746 1.00 42.10  ? 116  ARG E O     1 
ATOM   3665  C  CB    . ARG E 1 116 ? -14.880 -24.730 74.587 1.00 41.46  ? 116  ARG E CB    1 
ATOM   3666  C  CG    . ARG E 1 116 ? -15.745 -25.733 75.346 1.00 40.24  ? 116  ARG E CG    1 
ATOM   3667  C  CD    . ARG E 1 116 ? -15.727 -27.107 74.699 1.00 39.71  ? 116  ARG E CD    1 
ATOM   3668  N  NE    . ARG E 1 116 ? -16.619 -27.202 73.534 1.00 39.65  ? 116  ARG E NE    1 
ATOM   3669  C  CZ    . ARG E 1 116 ? -16.227 -27.204 72.259 1.00 37.04  ? 116  ARG E CZ    1 
ATOM   3670  N  NH1   . ARG E 1 116 ? -14.944 -27.136 71.924 1.00 37.25  ? 116  ARG E NH1   1 
ATOM   3671  N  NH2   . ARG E 1 116 ? -17.126 -27.296 71.309 1.00 35.61  ? 116  ARG E NH2   1 
ATOM   3672  N  N     . VAL E 1 117 ? -12.530 -22.791 74.785 1.00 41.51  ? 117  VAL E N     1 
ATOM   3673  C  CA    . VAL E 1 117 ? -11.384 -22.174 74.109 1.00 40.90  ? 117  VAL E CA    1 
ATOM   3674  C  C     . VAL E 1 117 ? -10.531 -23.274 73.465 1.00 40.96  ? 117  VAL E C     1 
ATOM   3675  O  O     . VAL E 1 117 ? -9.502  -23.017 72.855 1.00 41.25  ? 117  VAL E O     1 
ATOM   3676  C  CB    . VAL E 1 117 ? -10.538 -21.269 75.081 1.00 40.81  ? 117  VAL E CB    1 
ATOM   3677  C  CG1   . VAL E 1 117 ? -11.382 -20.140 75.626 1.00 40.65  ? 117  VAL E CG1   1 
ATOM   3678  C  CG2   . VAL E 1 117 ? -9.960  -22.061 76.241 1.00 40.87  ? 117  VAL E CG2   1 
ATOM   3679  N  N     . THR E 1 118 ? -10.979 -24.512 73.622 1.00 41.10  ? 118  THR E N     1 
ATOM   3680  C  CA    . THR E 1 118 ? -10.301 -25.678 73.079 1.00 40.84  ? 118  THR E CA    1 
ATOM   3681  C  C     . THR E 1 118 ? -11.058 -26.181 71.866 1.00 40.32  ? 118  THR E C     1 
ATOM   3682  O  O     . THR E 1 118 ? -12.244 -26.541 71.979 1.00 39.80  ? 118  THR E O     1 
ATOM   3683  C  CB    . THR E 1 118 ? -10.272 -26.815 74.106 1.00 40.96  ? 118  THR E CB    1 
ATOM   3684  O  OG1   . THR E 1 118 ? -9.792  -26.311 75.355 1.00 42.80  ? 118  THR E OG1   1 
ATOM   3685  C  CG2   . THR E 1 118 ? -9.373  -27.946 73.643 1.00 41.35  ? 118  THR E CG2   1 
ATOM   3686  N  N     . ILE E 1 119 ? -10.380 -26.210 70.716 1.00 39.52  ? 119  ILE E N     1 
ATOM   3687  C  CA    . ILE E 1 119 ? -10.978 -26.777 69.513 1.00 39.10  ? 119  ILE E CA    1 
ATOM   3688  C  C     . ILE E 1 119 ? -11.007 -28.312 69.560 1.00 38.89  ? 119  ILE E C     1 
ATOM   3689  O  O     . ILE E 1 119 ? -10.027 -28.953 69.919 1.00 38.97  ? 119  ILE E O     1 
ATOM   3690  C  CB    . ILE E 1 119 ? -10.324 -26.259 68.200 1.00 39.03  ? 119  ILE E CB    1 
ATOM   3691  C  CG1   . ILE E 1 119 ? -8.836  -26.616 68.115 1.00 37.30  ? 119  ILE E CG1   1 
ATOM   3692  C  CG2   . ILE E 1 119 ? -10.551 -24.763 68.049 1.00 39.50  ? 119  ILE E CG2   1 
ATOM   3693  C  CD1   . ILE E 1 119 ? -8.315  -26.619 66.718 1.00 33.90  ? 119  ILE E CD1   1 
ATOM   3694  N  N     . MET E 1 120 ? -12.155 -28.873 69.208 1.00 38.92  ? 120  MET E N     1 
ATOM   3695  C  CA    . MET E 1 120 ? -12.395 -30.321 69.217 1.00 38.85  ? 120  MET E CA    1 
ATOM   3696  C  C     . MET E 1 120 ? -12.923 -30.805 67.864 1.00 38.26  ? 120  MET E C     1 
ATOM   3697  O  O     . MET E 1 120 ? -13.420 -29.998 67.065 1.00 39.14  ? 120  MET E O     1 
ATOM   3698  C  CB    . MET E 1 120 ? -13.395 -30.650 70.317 1.00 38.85  ? 120  MET E CB    1 
ATOM   3699  C  CG    . MET E 1 120 ? -13.052 -30.002 71.626 1.00 40.67  ? 120  MET E CG    1 
ATOM   3700  S  SD    . MET E 1 120 ? -13.924 -30.651 73.052 1.00 45.38  ? 120  MET E SD    1 
ATOM   3701  C  CE    . MET E 1 120 ? -15.642 -30.504 72.591 1.00 47.75  ? 120  MET E CE    1 
ATOM   3702  N  N     . PRO E 1 121 ? -12.827 -32.114 67.591 1.00 38.08  ? 121  PRO E N     1 
ATOM   3703  C  CA    . PRO E 1 121 ? -13.373 -32.653 66.335 1.00 37.71  ? 121  PRO E CA    1 
ATOM   3704  C  C     . PRO E 1 121 ? -14.837 -32.265 66.054 1.00 38.03  ? 121  PRO E C     1 
ATOM   3705  O  O     . PRO E 1 121 ? -15.190 -32.016 64.891 1.00 38.14  ? 121  PRO E O     1 
ATOM   3706  C  CB    . PRO E 1 121 ? -13.210 -34.165 66.520 1.00 37.62  ? 121  PRO E CB    1 
ATOM   3707  C  CG    . PRO E 1 121 ? -11.951 -34.285 67.309 1.00 36.83  ? 121  PRO E CG    1 
ATOM   3708  C  CD    . PRO E 1 121 ? -12.042 -33.142 68.314 1.00 38.18  ? 121  PRO E CD    1 
ATOM   3709  N  N     . LYS E 1 122 ? -15.672 -32.180 67.090 1.00 38.03  ? 122  LYS E N     1 
ATOM   3710  C  CA    . LYS E 1 122 ? -17.047 -31.741 66.875 1.00 38.40  ? 122  LYS E CA    1 
ATOM   3711  C  C     . LYS E 1 122 ? -17.110 -30.313 66.275 1.00 38.03  ? 122  LYS E C     1 
ATOM   3712  O  O     . LYS E 1 122 ? -18.000 -30.018 65.470 1.00 38.00  ? 122  LYS E O     1 
ATOM   3713  C  CB    . LYS E 1 122 ? -17.956 -31.949 68.118 1.00 38.39  ? 122  LYS E CB    1 
ATOM   3714  C  CG    . LYS E 1 122 ? -17.662 -31.079 69.341 1.00 41.16  ? 122  LYS E CG    1 
ATOM   3715  C  CD    . LYS E 1 122 ? -18.102 -31.741 70.645 1.00 44.31  ? 122  LYS E CD    1 
ATOM   3716  C  CE    . LYS E 1 122 ? -19.599 -31.576 70.913 1.00 48.16  ? 122  LYS E CE    1 
ATOM   3717  N  NZ    . LYS E 1 122 ? -20.055 -32.576 71.963 1.00 49.83  ? 122  LYS E NZ    1 
ATOM   3718  N  N     . ASP E 1 123 ? -16.144 -29.462 66.619 1.00 37.45  ? 123  ASP E N     1 
ATOM   3719  C  CA    . ASP E 1 123 ? -16.086 -28.095 66.056 1.00 37.08  ? 123  ASP E CA    1 
ATOM   3720  C  C     . ASP E 1 123 ? -15.742 -28.133 64.568 1.00 36.58  ? 123  ASP E C     1 
ATOM   3721  O  O     . ASP E 1 123 ? -16.397 -27.476 63.763 1.00 36.71  ? 123  ASP E O     1 
ATOM   3722  C  CB    . ASP E 1 123 ? -15.084 -27.201 66.810 1.00 36.81  ? 123  ASP E CB    1 
ATOM   3723  C  CG    . ASP E 1 123 ? -15.374 -27.116 68.301 1.00 37.73  ? 123  ASP E CG    1 
ATOM   3724  O  OD1   . ASP E 1 123 ? -16.531 -26.803 68.664 1.00 38.12  ? 123  ASP E OD1   1 
ATOM   3725  O  OD2   . ASP E 1 123 ? -14.450 -27.364 69.109 1.00 36.72  ? 123  ASP E OD2   1 
ATOM   3726  N  N     . ILE E 1 124 ? -14.723 -28.908 64.207 1.00 36.17  ? 124  ILE E N     1 
ATOM   3727  C  CA    . ILE E 1 124 ? -14.333 -29.058 62.810 1.00 35.97  ? 124  ILE E CA    1 
ATOM   3728  C  C     . ILE E 1 124 ? -15.502 -29.604 62.005 1.00 36.31  ? 124  ILE E C     1 
ATOM   3729  O  O     . ILE E 1 124 ? -15.841 -29.058 60.961 1.00 36.73  ? 124  ILE E O     1 
ATOM   3730  C  CB    . ILE E 1 124 ? -13.107 -29.977 62.641 1.00 35.47  ? 124  ILE E CB    1 
ATOM   3731  C  CG1   . ILE E 1 124 ? -11.872 -29.340 63.285 1.00 35.18  ? 124  ILE E CG1   1 
ATOM   3732  C  CG2   . ILE E 1 124 ? -12.853 -30.243 61.176 1.00 35.52  ? 124  ILE E CG2   1 
ATOM   3733  C  CD1   . ILE E 1 124 ? -10.549 -30.107 63.053 1.00 34.26  ? 124  ILE E CD1   1 
ATOM   3734  N  N     . GLN E 1 125 ? -16.125 -30.669 62.510 1.00 36.67  ? 125  GLN E N     1 
ATOM   3735  C  CA    . GLN E 1 125 ? -17.275 -31.290 61.855 1.00 36.38  ? 125  GLN E CA    1 
ATOM   3736  C  C     . GLN E 1 125 ? -18.418 -30.276 61.691 1.00 36.41  ? 125  GLN E C     1 
ATOM   3737  O  O     . GLN E 1 125 ? -19.076 -30.238 60.661 1.00 36.94  ? 125  GLN E O     1 
ATOM   3738  C  CB    . GLN E 1 125 ? -17.723 -32.566 62.608 1.00 36.15  ? 125  GLN E CB    1 
ATOM   3739  C  CG    . GLN E 1 125 ? -16.757 -33.772 62.468 1.00 35.71  ? 125  GLN E CG    1 
ATOM   3740  C  CD    . GLN E 1 125 ? -16.656 -34.663 63.731 1.00 38.07  ? 125  GLN E CD    1 
ATOM   3741  O  OE1   . GLN E 1 125 ? -17.526 -34.642 64.621 1.00 39.03  ? 125  GLN E OE1   1 
ATOM   3742  N  NE2   . GLN E 1 125 ? -15.575 -35.436 63.814 1.00 36.80  ? 125  GLN E NE2   1 
ATOM   3743  N  N     . LEU E 1 126 ? -18.646 -29.431 62.681 1.00 36.22  ? 126  LEU E N     1 
ATOM   3744  C  CA    . LEU E 1 126 ? -19.701 -28.440 62.543 1.00 36.39  ? 126  LEU E CA    1 
ATOM   3745  C  C     . LEU E 1 126 ? -19.370 -27.446 61.432 1.00 36.56  ? 126  LEU E C     1 
ATOM   3746  O  O     . LEU E 1 126 ? -20.212 -27.129 60.579 1.00 36.18  ? 126  LEU E O     1 
ATOM   3747  C  CB    . LEU E 1 126 ? -19.966 -27.715 63.861 1.00 35.74  ? 126  LEU E CB    1 
ATOM   3748  C  CG    . LEU E 1 126 ? -21.133 -26.735 63.747 1.00 36.23  ? 126  LEU E CG    1 
ATOM   3749  C  CD1   . LEU E 1 126 ? -22.439 -27.459 63.487 1.00 36.03  ? 126  LEU E CD1   1 
ATOM   3750  C  CD2   . LEU E 1 126 ? -21.254 -25.868 64.996 1.00 36.51  ? 126  LEU E CD2   1 
ATOM   3751  N  N     . ALA E 1 127 ? -18.129 -26.976 61.438 1.00 36.97  ? 127  ALA E N     1 
ATOM   3752  C  CA    . ALA E 1 127 ? -17.668 -26.019 60.442 1.00 37.62  ? 127  ALA E CA    1 
ATOM   3753  C  C     . ALA E 1 127 ? -17.832 -26.578 59.033 1.00 38.31  ? 127  ALA E C     1 
ATOM   3754  O  O     . ALA E 1 127 ? -18.325 -25.898 58.125 1.00 37.64  ? 127  ALA E O     1 
ATOM   3755  C  CB    . ALA E 1 127 ? -16.224 -25.644 60.708 1.00 37.51  ? 127  ALA E CB    1 
ATOM   3756  N  N     . ARG E 1 128 ? -17.427 -27.836 58.863 1.00 39.38  ? 128  ARG E N     1 
ATOM   3757  C  CA    . ARG E 1 128 ? -17.504 -28.491 57.562 1.00 40.00  ? 128  ARG E CA    1 
ATOM   3758  C  C     . ARG E 1 128 ? -18.939 -28.751 57.111 1.00 40.66  ? 128  ARG E C     1 
ATOM   3759  O  O     . ARG E 1 128 ? -19.231 -28.662 55.919 1.00 40.79  ? 128  ARG E O     1 
ATOM   3760  C  CB    . ARG E 1 128 ? -16.653 -29.747 57.536 1.00 39.41  ? 128  ARG E CB    1 
ATOM   3761  C  CG    . ARG E 1 128 ? -15.168 -29.454 57.741 1.00 39.90  ? 128  ARG E CG    1 
ATOM   3762  C  CD    . ARG E 1 128 ? -14.283 -30.278 56.831 1.00 40.08  ? 128  ARG E CD    1 
ATOM   3763  N  NE    . ARG E 1 128 ? -14.626 -31.684 56.929 1.00 43.13  ? 128  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E 1 128 ? -14.741 -32.516 55.900 1.00 43.36  ? 128  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E 1 128 ? -14.531 -32.111 54.650 1.00 44.05  ? 128  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E 1 128 ? -15.078 -33.770 56.133 1.00 44.05  ? 128  ARG E NH2   1 
ATOM   3767  N  N     . ARG E 1 129 ? -19.830 -29.045 58.054 1.00 41.69  ? 129  ARG E N     1 
ATOM   3768  C  CA    . ARG E 1 129 ? -21.240 -29.243 57.731 1.00 43.24  ? 129  ARG E CA    1 
ATOM   3769  C  C     . ARG E 1 129 ? -21.881 -27.933 57.269 1.00 43.48  ? 129  ARG E C     1 
ATOM   3770  O  O     . ARG E 1 129 ? -22.536 -27.884 56.227 1.00 43.70  ? 129  ARG E O     1 
ATOM   3771  C  CB    . ARG E 1 129 ? -22.012 -29.867 58.907 1.00 43.18  ? 129  ARG E CB    1 
ATOM   3772  C  CG    . ARG E 1 129 ? -23.461 -30.261 58.569 1.00 46.51  ? 129  ARG E CG    1 
ATOM   3773  C  CD    . ARG E 1 129 ? -23.951 -31.467 59.422 1.00 52.72  ? 129  ARG E CD    1 
ATOM   3774  N  NE    . ARG E 1 129 ? -25.348 -31.848 59.135 1.00 57.07  ? 129  ARG E NE    1 
ATOM   3775  C  CZ    . ARG E 1 129 ? -26.151 -32.524 59.968 1.00 58.69  ? 129  ARG E CZ    1 
ATOM   3776  N  NH1   . ARG E 1 129 ? -25.725 -32.909 61.170 1.00 59.39  ? 129  ARG E NH1   1 
ATOM   3777  N  NH2   . ARG E 1 129 ? -27.400 -32.810 59.602 1.00 59.31  ? 129  ARG E NH2   1 
ATOM   3778  N  N     . ILE E 1 130 ? -21.665 -26.869 58.031 1.00 44.17  ? 130  ILE E N     1 
ATOM   3779  C  CA    . ILE E 1 130 ? -22.220 -25.565 57.686 1.00 44.95  ? 130  ILE E CA    1 
ATOM   3780  C  C     . ILE E 1 130 ? -21.643 -25.012 56.385 1.00 45.50  ? 130  ILE E C     1 
ATOM   3781  O  O     . ILE E 1 130 ? -22.378 -24.408 55.603 1.00 46.23  ? 130  ILE E O     1 
ATOM   3782  C  CB    . ILE E 1 130 ? -22.092 -24.558 58.840 1.00 44.97  ? 130  ILE E CB    1 
ATOM   3783  C  CG1   . ILE E 1 130 ? -22.868 -25.071 60.052 1.00 45.08  ? 130  ILE E CG1   1 
ATOM   3784  C  CG2   . ILE E 1 130 ? -22.620 -23.173 58.433 1.00 44.36  ? 130  ILE E CG2   1 
ATOM   3785  C  CD1   . ILE E 1 130 ? -22.586 -24.285 61.303 1.00 46.14  ? 130  ILE E CD1   1 
ATOM   3786  N  N     . ARG E 1 131 ? -20.354 -25.244 56.142 1.00 45.97  ? 131  ARG E N     1 
ATOM   3787  C  CA    . ARG E 1 131 ? -19.710 -24.855 54.875 1.00 46.72  ? 131  ARG E CA    1 
ATOM   3788  C  C     . ARG E 1 131 ? -20.245 -25.538 53.621 1.00 48.03  ? 131  ARG E C     1 
ATOM   3789  O  O     . ARG E 1 131 ? -19.997 -25.064 52.511 1.00 48.06  ? 131  ARG E O     1 
ATOM   3790  C  CB    . ARG E 1 131 ? -18.218 -25.117 54.921 1.00 45.80  ? 131  ARG E CB    1 
ATOM   3791  C  CG    . ARG E 1 131 ? -17.440 -24.103 55.630 1.00 43.42  ? 131  ARG E CG    1 
ATOM   3792  C  CD    . ARG E 1 131 ? -16.083 -24.687 55.862 1.00 40.97  ? 131  ARG E CD    1 
ATOM   3793  N  NE    . ARG E 1 131 ? -15.117 -23.674 56.239 1.00 38.02  ? 131  ARG E NE    1 
ATOM   3794  C  CZ    . ARG E 1 131 ? -13.901 -23.599 55.727 1.00 37.74  ? 131  ARG E CZ    1 
ATOM   3795  N  NH1   . ARG E 1 131 ? -13.507 -24.480 54.823 1.00 37.49  ? 131  ARG E NH1   1 
ATOM   3796  N  NH2   . ARG E 1 131 ? -13.076 -22.639 56.119 1.00 39.62  ? 131  ARG E NH2   1 
ATOM   3797  N  N     . GLY E 1 132 ? -20.940 -26.659 53.785 1.00 49.41  ? 132  GLY E N     1 
ATOM   3798  C  CA    . GLY E 1 132 ? -21.446 -27.392 52.634 1.00 51.80  ? 132  GLY E CA    1 
ATOM   3799  C  C     . GLY E 1 132 ? -20.503 -28.476 52.169 1.00 53.38  ? 132  GLY E C     1 
ATOM   3800  O  O     . GLY E 1 132 ? -20.823 -29.226 51.254 1.00 53.97  ? 132  GLY E O     1 
ATOM   3801  N  N     . GLU E 1 133 ? -19.336 -28.566 52.803 1.00 55.17  ? 133  GLU E N     1 
ATOM   3802  C  CA    . GLU E 1 133 ? -18.413 -29.673 52.565 1.00 56.67  ? 133  GLU E CA    1 
ATOM   3803  C  C     . GLU E 1 133 ? -19.095 -30.968 52.980 1.00 58.14  ? 133  GLU E C     1 
ATOM   3804  O  O     . GLU E 1 133 ? -18.556 -32.067 52.803 1.00 58.65  ? 133  GLU E O     1 
ATOM   3805  C  CB    . GLU E 1 133 ? -17.094 -29.442 53.303 1.00 56.31  ? 133  GLU E CB    1 
ATOM   3806  C  CG    . GLU E 1 133 ? -16.219 -28.401 52.610 1.00 55.31  ? 133  GLU E CG    1 
ATOM   3807  C  CD    . GLU E 1 133 ? -15.044 -27.906 53.454 1.00 54.87  ? 133  GLU E CD    1 
ATOM   3808  O  OE1   . GLU E 1 133 ? -14.327 -28.736 54.063 1.00 53.50  ? 133  GLU E OE1   1 
ATOM   3809  O  OE2   . GLU E 1 133 ? -14.825 -26.670 53.486 1.00 54.01  ? 133  GLU E OE2   1 
ATOM   3810  N  N     . ARG E 1 134 ? -20.298 -30.802 53.537 1.00 60.16  ? 134  ARG E N     1 
ATOM   3811  C  CA    . ARG E 1 134 ? -21.292 -31.873 53.719 1.00 61.69  ? 134  ARG E CA    1 
ATOM   3812  C  C     . ARG E 1 134 ? -22.731 -31.330 53.590 1.00 61.95  ? 134  ARG E C     1 
ATOM   3813  O  O     . ARG E 1 134 ? -23.420 -31.100 54.601 1.00 62.63  ? 134  ARG E O     1 
ATOM   3814  C  CB    . ARG E 1 134 ? -21.080 -32.589 55.049 1.00 62.03  ? 134  ARG E CB    1 
ATOM   3815  C  CG    . ARG E 1 134 ? -20.032 -33.701 54.969 1.00 64.81  ? 134  ARG E CG    1 
ATOM   3816  C  CD    . ARG E 1 134 ? -19.666 -34.190 56.351 1.00 68.25  ? 134  ARG E CD    1 
ATOM   3817  N  NE    . ARG E 1 134 ? -19.379 -33.046 57.208 1.00 70.97  ? 134  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E 1 134 ? -19.291 -33.088 58.534 1.00 72.49  ? 134  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E 1 134 ? -19.465 -34.230 59.201 1.00 73.38  ? 134  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E 1 134 ? -19.023 -31.973 59.192 1.00 72.96  ? 134  ARG E NH2   1 
ATOM   3821  N  N     . LYS F 2 16  ? 14.385  -48.762 33.706 1.00 93.03  ? 16   LYS F N     1 
ATOM   3822  C  CA    . LYS F 2 16  ? 14.390  -48.326 35.138 1.00 93.08  ? 16   LYS F CA    1 
ATOM   3823  C  C     . LYS F 2 16  ? 14.496  -49.516 36.092 1.00 92.85  ? 16   LYS F C     1 
ATOM   3824  O  O     . LYS F 2 16  ? 13.853  -50.556 35.880 1.00 92.94  ? 16   LYS F O     1 
ATOM   3825  C  CB    . LYS F 2 16  ? 13.145  -47.484 35.471 1.00 93.32  ? 16   LYS F CB    1 
ATOM   3826  C  CG    . LYS F 2 16  ? 11.801  -48.196 35.258 1.00 93.97  ? 16   LYS F CG    1 
ATOM   3827  C  CD    . LYS F 2 16  ? 10.676  -47.531 36.048 1.00 94.35  ? 16   LYS F CD    1 
ATOM   3828  C  CE    . LYS F 2 16  ? 9.449   -48.442 36.074 1.00 94.76  ? 16   LYS F CE    1 
ATOM   3829  N  NZ    . LYS F 2 16  ? 8.351   -47.879 36.917 1.00 94.87  ? 16   LYS F NZ    1 
ATOM   3830  N  N     . ARG F 2 17  ? 15.313  -49.354 37.135 1.00 92.34  ? 17   ARG F N     1 
ATOM   3831  C  CA    . ARG F 2 17  ? 15.495  -50.391 38.152 1.00 91.65  ? 17   ARG F CA    1 
ATOM   3832  C  C     . ARG F 2 17  ? 15.074  -49.943 39.556 1.00 90.81  ? 17   ARG F C     1 
ATOM   3833  O  O     . ARG F 2 17  ? 15.819  -49.236 40.254 1.00 90.72  ? 17   ARG F O     1 
ATOM   3834  C  CB    . ARG F 2 17  ? 16.932  -50.925 38.143 1.00 91.95  ? 17   ARG F CB    1 
ATOM   3835  C  CG    . ARG F 2 17  ? 17.150  -52.062 37.151 1.00 93.22  ? 17   ARG F CG    1 
ATOM   3836  C  CD    . ARG F 2 17  ? 18.622  -52.431 37.031 1.00 95.46  ? 17   ARG F CD    1 
ATOM   3837  N  NE    . ARG F 2 17  ? 18.809  -53.713 36.344 1.00 96.67  ? 17   ARG F NE    1 
ATOM   3838  C  CZ    . ARG F 2 17  ? 19.992  -54.280 36.094 1.00 97.08  ? 17   ARG F CZ    1 
ATOM   3839  N  NH1   . ARG F 2 17  ? 21.122  -53.684 36.467 1.00 96.77  ? 17   ARG F NH1   1 
ATOM   3840  N  NH2   . ARG F 2 17  ? 20.045  -55.451 35.463 1.00 97.14  ? 17   ARG F NH2   1 
ATOM   3841  N  N     . HIS F 2 18  ? 13.862  -50.363 39.937 1.00 89.71  ? 18   HIS F N     1 
ATOM   3842  C  CA    . HIS F 2 18  ? 13.266  -50.154 41.275 1.00 88.44  ? 18   HIS F CA    1 
ATOM   3843  C  C     . HIS F 2 18  ? 12.804  -48.719 41.540 1.00 87.00  ? 18   HIS F C     1 
ATOM   3844  O  O     . HIS F 2 18  ? 13.370  -47.760 41.003 1.00 87.01  ? 18   HIS F O     1 
ATOM   3845  C  CB    . HIS F 2 18  ? 14.191  -50.648 42.413 1.00 88.86  ? 18   HIS F CB    1 
ATOM   3846  C  CG    . HIS F 2 18  ? 14.480  -52.122 42.375 1.00 90.12  ? 18   HIS F CG    1 
ATOM   3847  N  ND1   . HIS F 2 18  ? 13.701  -53.056 43.035 1.00 91.67  ? 18   HIS F ND1   1 
ATOM   3848  C  CD2   . HIS F 2 18  ? 15.473  -52.822 41.769 1.00 90.72  ? 18   HIS F CD2   1 
ATOM   3849  C  CE1   . HIS F 2 18  ? 14.196  -54.265 42.832 1.00 91.88  ? 18   HIS F CE1   1 
ATOM   3850  N  NE2   . HIS F 2 18  ? 15.271  -54.151 42.066 1.00 91.72  ? 18   HIS F NE2   1 
ATOM   3851  N  N     . ARG F 2 19  ? 11.770  -48.596 42.374 1.00 84.95  ? 19   ARG F N     1 
ATOM   3852  C  CA    . ARG F 2 19  ? 11.247  -47.308 42.829 1.00 82.80  ? 19   ARG F CA    1 
ATOM   3853  C  C     . ARG F 2 19  ? 10.495  -47.493 44.155 1.00 80.56  ? 19   ARG F C     1 
ATOM   3854  O  O     . ARG F 2 19  ? 9.487   -48.200 44.201 1.00 80.62  ? 19   ARG F O     1 
ATOM   3855  C  CB    . ARG F 2 19  ? 10.339  -46.687 41.756 1.00 83.33  ? 19   ARG F CB    1 
ATOM   3856  C  CG    . ARG F 2 19  ? 10.228  -45.158 41.825 1.00 84.98  ? 19   ARG F CG    1 
ATOM   3857  C  CD    . ARG F 2 19  ? 8.962   -44.736 42.560 1.00 87.82  ? 19   ARG F CD    1 
ATOM   3858  N  NE    . ARG F 2 19  ? 9.037   -43.372 43.092 1.00 89.39  ? 19   ARG F NE    1 
ATOM   3859  C  CZ    . ARG F 2 19  ? 8.019   -42.740 43.679 1.00 90.22  ? 19   ARG F CZ    1 
ATOM   3860  N  NH1   . ARG F 2 19  ? 6.839   -43.346 43.801 1.00 90.17  ? 19   ARG F NH1   1 
ATOM   3861  N  NH2   . ARG F 2 19  ? 8.176   -41.499 44.137 1.00 90.32  ? 19   ARG F NH2   1 
ATOM   3862  N  N     . LYS F 2 20  ? 10.996  -46.851 45.215 1.00 77.33  ? 20   LYS F N     1 
ATOM   3863  C  CA    . LYS F 2 20  ? 10.494  -46.993 46.597 1.00 74.23  ? 20   LYS F CA    1 
ATOM   3864  C  C     . LYS F 2 20  ? 8.960   -46.940 46.762 1.00 71.34  ? 20   LYS F C     1 
ATOM   3865  O  O     . LYS F 2 20  ? 8.272   -46.240 46.017 1.00 71.59  ? 20   LYS F O     1 
ATOM   3866  C  CB    . LYS F 2 20  ? 11.174  -45.942 47.497 1.00 74.86  ? 20   LYS F CB    1 
ATOM   3867  C  CG    . LYS F 2 20  ? 10.859  -46.015 49.006 1.00 76.25  ? 20   LYS F CG    1 
ATOM   3868  C  CD    . LYS F 2 20  ? 11.233  -47.356 49.653 1.00 78.20  ? 20   LYS F CD    1 
ATOM   3869  C  CE    . LYS F 2 20  ? 11.008  -47.287 51.162 1.00 79.86  ? 20   LYS F CE    1 
ATOM   3870  N  NZ    . LYS F 2 20  ? 10.926  -48.640 51.782 1.00 81.64  ? 20   LYS F NZ    1 
ATOM   3871  N  N     . VAL F 2 21  ? 8.446   -47.683 47.743 1.00 67.35  ? 21   VAL F N     1 
ATOM   3872  C  CA    . VAL F 2 21  ? 7.007   -47.807 47.988 1.00 63.36  ? 21   VAL F CA    1 
ATOM   3873  C  C     . VAL F 2 21  ? 6.525   -46.687 48.911 1.00 60.97  ? 21   VAL F C     1 
ATOM   3874  O  O     . VAL F 2 21  ? 7.029   -46.529 50.026 1.00 60.53  ? 21   VAL F O     1 
ATOM   3875  C  CB    . VAL F 2 21  ? 6.648   -49.199 48.596 1.00 63.32  ? 21   VAL F CB    1 
ATOM   3876  C  CG1   . VAL F 2 21  ? 5.214   -49.242 49.102 1.00 62.31  ? 21   VAL F CG1   1 
ATOM   3877  C  CG2   . VAL F 2 21  ? 6.860   -50.294 47.577 1.00 63.75  ? 21   VAL F CG2   1 
ATOM   3878  N  N     . LEU F 2 22  ? 5.540   -45.923 48.440 1.00 57.55  ? 22   LEU F N     1 
ATOM   3879  C  CA    . LEU F 2 22  ? 4.999   -44.811 49.206 1.00 54.18  ? 22   LEU F CA    1 
ATOM   3880  C  C     . LEU F 2 22  ? 3.836   -45.261 50.068 1.00 52.36  ? 22   LEU F C     1 
ATOM   3881  O  O     . LEU F 2 22  ? 2.804   -45.681 49.559 1.00 51.96  ? 22   LEU F O     1 
ATOM   3882  C  CB    . LEU F 2 22  ? 4.570   -43.669 48.277 1.00 54.04  ? 22   LEU F CB    1 
ATOM   3883  C  CG    . LEU F 2 22  ? 5.646   -43.106 47.339 1.00 52.78  ? 22   LEU F CG    1 
ATOM   3884  C  CD1   . LEU F 2 22  ? 5.056   -42.126 46.343 1.00 51.22  ? 22   LEU F CD1   1 
ATOM   3885  C  CD2   . LEU F 2 22  ? 6.793   -42.470 48.120 1.00 51.84  ? 22   LEU F CD2   1 
ATOM   3886  N  N     . ARG F 2 23  ? 4.018   -45.186 51.381 1.00 50.38  ? 23   ARG F N     1 
ATOM   3887  C  CA    . ARG F 2 23  ? 2.954   -45.512 52.326 1.00 48.35  ? 23   ARG F CA    1 
ATOM   3888  C  C     . ARG F 2 23  ? 3.013   -44.653 53.582 1.00 47.60  ? 23   ARG F C     1 
ATOM   3889  O  O     . ARG F 2 23  ? 4.093   -44.312 54.059 1.00 47.30  ? 23   ARG F O     1 
ATOM   3890  C  CB    . ARG F 2 23  ? 2.983   -46.992 52.703 1.00 48.14  ? 23   ARG F CB    1 
ATOM   3891  C  CG    . ARG F 2 23  ? 4.363   -47.539 52.993 1.00 46.68  ? 23   ARG F CG    1 
ATOM   3892  C  CD    . ARG F 2 23  ? 4.394   -49.055 52.867 1.00 42.25  ? 23   ARG F CD    1 
ATOM   3893  N  NE    . ARG F 2 23  ? 4.048   -49.676 54.135 1.00 40.16  ? 23   ARG F NE    1 
ATOM   3894  C  CZ    . ARG F 2 23  ? 4.925   -49.984 55.087 1.00 36.91  ? 23   ARG F CZ    1 
ATOM   3895  N  NH1   . ARG F 2 23  ? 6.221   -49.753 54.926 1.00 33.85  ? 23   ARG F NH1   1 
ATOM   3896  N  NH2   . ARG F 2 23  ? 4.495   -50.533 56.202 1.00 35.33  ? 23   ARG F NH2   1 
ATOM   3897  N  N     . ASP F 2 24  ? 1.832   -44.305 54.094 1.00 46.45  ? 24   ASP F N     1 
ATOM   3898  C  CA    . ASP F 2 24  ? 1.670   -43.645 55.397 1.00 45.60  ? 24   ASP F CA    1 
ATOM   3899  C  C     . ASP F 2 24  ? 2.317   -42.260 55.501 1.00 44.72  ? 24   ASP F C     1 
ATOM   3900  O  O     . ASP F 2 24  ? 2.660   -41.787 56.576 1.00 44.01  ? 24   ASP F O     1 
ATOM   3901  C  CB    . ASP F 2 24  ? 2.168   -44.554 56.521 1.00 45.53  ? 24   ASP F CB    1 
ATOM   3902  C  CG    . ASP F 2 24  ? 1.414   -44.343 57.796 1.00 46.49  ? 24   ASP F CG    1 
ATOM   3903  O  OD1   . ASP F 2 24  ? 0.186   -44.068 57.714 1.00 48.86  ? 24   ASP F OD1   1 
ATOM   3904  O  OD2   . ASP F 2 24  ? 2.039   -44.458 58.874 1.00 46.08  ? 24   ASP F OD2   1 
ATOM   3905  N  N     . ASN F 2 25  ? 2.455   -41.606 54.364 1.00 44.31  ? 25   ASN F N     1 
ATOM   3906  C  CA    . ASN F 2 25  ? 3.042   -40.289 54.311 1.00 43.57  ? 25   ASN F CA    1 
ATOM   3907  C  C     . ASN F 2 25  ? 2.175   -39.214 54.949 1.00 43.93  ? 25   ASN F C     1 
ATOM   3908  O  O     . ASN F 2 25  ? 2.658   -38.102 55.207 1.00 44.42  ? 25   ASN F O     1 
ATOM   3909  C  CB    . ASN F 2 25  ? 3.379   -39.955 52.883 1.00 42.95  ? 25   ASN F CB    1 
ATOM   3910  C  CG    . ASN F 2 25  ? 4.521   -40.772 52.384 1.00 42.01  ? 25   ASN F CG    1 
ATOM   3911  O  OD1   . ASN F 2 25  ? 5.652   -40.550 52.784 1.00 41.77  ? 25   ASN F OD1   1 
ATOM   3912  N  ND2   . ASN F 2 25  ? 4.240   -41.746 51.527 1.00 41.20  ? 25   ASN F ND2   1 
ATOM   3913  N  N     . ILE F 2 26  ? 0.921   -39.562 55.249 1.00 43.68  ? 26   ILE F N     1 
ATOM   3914  C  CA    . ILE F 2 26  ? 0.020   -38.671 55.974 1.00 43.48  ? 26   ILE F CA    1 
ATOM   3915  C  C     . ILE F 2 26  ? 0.625   -38.280 57.323 1.00 43.69  ? 26   ILE F C     1 
ATOM   3916  O  O     . ILE F 2 26  ? 0.300   -37.232 57.870 1.00 43.45  ? 26   ILE F O     1 
ATOM   3917  C  CB    . ILE F 2 26  ? -1.419  -39.283 56.173 1.00 43.41  ? 26   ILE F CB    1 
ATOM   3918  C  CG1   . ILE F 2 26  ? -2.440  -38.226 56.634 1.00 42.86  ? 26   ILE F CG1   1 
ATOM   3919  C  CG2   . ILE F 2 26  ? -1.414  -40.393 57.220 1.00 42.27  ? 26   ILE F CG2   1 
ATOM   3920  C  CD1   . ILE F 2 26  ? -2.517  -36.979 55.793 1.00 42.49  ? 26   ILE F CD1   1 
ATOM   3921  N  N     . GLN F 2 27  ? 1.512   -39.119 57.844 1.00 43.96  ? 27   GLN F N     1 
ATOM   3922  C  CA    . GLN F 2 27  ? 2.071   -38.902 59.181 1.00 44.18  ? 27   GLN F CA    1 
ATOM   3923  C  C     . GLN F 2 27  ? 3.229   -37.930 59.100 1.00 44.15  ? 27   GLN F C     1 
ATOM   3924  O  O     . GLN F 2 27  ? 3.741   -37.465 60.126 1.00 44.73  ? 27   GLN F O     1 
ATOM   3925  C  CB    . GLN F 2 27  ? 2.484   -40.229 59.836 1.00 43.93  ? 27   GLN F CB    1 
ATOM   3926  C  CG    . GLN F 2 27  ? 1.296   -41.164 60.147 1.00 43.44  ? 27   GLN F CG    1 
ATOM   3927  C  CD    . GLN F 2 27  ? 0.406   -40.639 61.267 1.00 44.33  ? 27   GLN F CD    1 
ATOM   3928  O  OE1   . GLN F 2 27  ? 0.874   -39.932 62.164 1.00 47.50  ? 27   GLN F OE1   1 
ATOM   3929  N  NE2   . GLN F 2 27  ? -0.882  -40.975 61.220 1.00 43.21  ? 27   GLN F NE2   1 
ATOM   3930  N  N     . GLY F 2 28  ? 3.625   -37.611 57.873 1.00 43.67  ? 28   GLY F N     1 
ATOM   3931  C  CA    . GLY F 2 28  ? 4.607   -36.548 57.648 1.00 43.90  ? 28   GLY F CA    1 
ATOM   3932  C  C     . GLY F 2 28  ? 4.015   -35.181 57.952 1.00 43.90  ? 28   GLY F C     1 
ATOM   3933  O  O     . GLY F 2 28  ? 4.740   -34.179 57.979 1.00 44.45  ? 28   GLY F O     1 
ATOM   3934  N  N     . ILE F 2 29  ? 2.696   -35.137 58.155 1.00 43.07  ? 29   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2 29  ? 2.030   -33.935 58.622 1.00 42.52  ? 29   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2 29  ? 2.016   -34.016 60.147 1.00 42.40  ? 29   ILE F C     1 
ATOM   3937  O  O     . ILE F 2 29  ? 1.063   -34.529 60.764 1.00 41.82  ? 29   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2 29  ? 0.587   -33.791 58.072 1.00 42.53  ? 29   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2 29  ? 0.478   -34.176 56.585 1.00 42.99  ? 29   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2 29  ? 0.084   -32.391 58.286 1.00 43.11  ? 29   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2 29  ? 1.308   -33.339 55.603 1.00 41.89  ? 29   ILE F CD1   1 
ATOM   3942  N  N     . THR F 2 30  ? 3.086   -33.502 60.747 1.00 42.07  ? 30   THR F N     1 
ATOM   3943  C  CA    . THR F 2 30  ? 3.358   -33.732 62.160 1.00 42.29  ? 30   THR F CA    1 
ATOM   3944  C  C     . THR F 2 30  ? 2.469   -32.907 63.080 1.00 42.42  ? 30   THR F C     1 
ATOM   3945  O  O     . THR F 2 30  ? 1.839   -31.945 62.669 1.00 42.35  ? 30   THR F O     1 
ATOM   3946  C  CB    . THR F 2 30  ? 4.864   -33.531 62.501 1.00 42.15  ? 30   THR F CB    1 
ATOM   3947  O  OG1   . THR F 2 30  ? 5.239   -32.174 62.242 1.00 44.13  ? 30   THR F OG1   1 
ATOM   3948  C  CG2   . THR F 2 30  ? 5.745   -34.447 61.640 1.00 41.84  ? 30   THR F CG2   1 
ATOM   3949  N  N     . LYS F 2 31  ? 2.407   -33.315 64.336 1.00 42.82  ? 31   LYS F N     1 
ATOM   3950  C  CA    . LYS F 2 31  ? 1.719   -32.559 65.358 1.00 43.01  ? 31   LYS F CA    1 
ATOM   3951  C  C     . LYS F 2 31  ? 2.195   -31.082 65.402 1.00 42.73  ? 31   LYS F C     1 
ATOM   3952  O  O     . LYS F 2 31  ? 1.362   -30.175 65.392 1.00 42.78  ? 31   LYS F O     1 
ATOM   3953  C  CB    . LYS F 2 31  ? 1.902   -33.264 66.699 1.00 43.58  ? 31   LYS F CB    1 
ATOM   3954  C  CG    . LYS F 2 31  ? 1.097   -32.705 67.846 1.00 45.86  ? 31   LYS F CG    1 
ATOM   3955  C  CD    . LYS F 2 31  ? 1.362   -33.486 69.127 1.00 49.35  ? 31   LYS F CD    1 
ATOM   3956  C  CE    . LYS F 2 31  ? 1.056   -32.617 70.338 1.00 52.26  ? 31   LYS F CE    1 
ATOM   3957  N  NZ    . LYS F 2 31  ? 0.670   -33.420 71.540 1.00 55.53  ? 31   LYS F NZ    1 
ATOM   3958  N  N     . PRO F 2 32  ? 3.521   -30.828 65.422 1.00 42.34  ? 32   PRO F N     1 
ATOM   3959  C  CA    . PRO F 2 32  ? 3.925   -29.407 65.420 1.00 42.06  ? 32   PRO F CA    1 
ATOM   3960  C  C     . PRO F 2 32  ? 3.490   -28.617 64.183 1.00 41.78  ? 32   PRO F C     1 
ATOM   3961  O  O     . PRO F 2 32  ? 3.145   -27.443 64.308 1.00 42.24  ? 32   PRO F O     1 
ATOM   3962  C  CB    . PRO F 2 32  ? 5.456   -29.470 65.487 1.00 41.96  ? 32   PRO F CB    1 
ATOM   3963  C  CG    . PRO F 2 32  ? 5.748   -30.803 66.104 1.00 42.57  ? 32   PRO F CG    1 
ATOM   3964  C  CD    . PRO F 2 32  ? 4.684   -31.723 65.579 1.00 41.94  ? 32   PRO F CD    1 
ATOM   3965  N  N     . ALA F 2 33  ? 3.513   -29.236 63.005 1.00 40.96  ? 33   ALA F N     1 
ATOM   3966  C  CA    . ALA F 2 33  ? 3.108   -28.537 61.792 1.00 40.27  ? 33   ALA F CA    1 
ATOM   3967  C  C     . ALA F 2 33  ? 1.622   -28.175 61.832 1.00 40.23  ? 33   ALA F C     1 
ATOM   3968  O  O     . ALA F 2 33  ? 1.223   -27.098 61.400 1.00 40.59  ? 33   ALA F O     1 
ATOM   3969  C  CB    . ALA F 2 33  ? 3.420   -29.365 60.572 1.00 39.83  ? 33   ALA F CB    1 
ATOM   3970  N  N     . ILE F 2 34  ? 0.804   -29.084 62.346 1.00 40.21  ? 34   ILE F N     1 
ATOM   3971  C  CA    . ILE F 2 34  ? -0.628  -28.857 62.460 1.00 39.74  ? 34   ILE F CA    1 
ATOM   3972  C  C     . ILE F 2 34  ? -0.882  -27.768 63.497 1.00 40.24  ? 34   ILE F C     1 
ATOM   3973  O  O     . ILE F 2 34  ? -1.690  -26.869 63.278 1.00 40.18  ? 34   ILE F O     1 
ATOM   3974  C  CB    . ILE F 2 34  ? -1.377  -30.154 62.840 1.00 39.42  ? 34   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F 2 34  ? -1.210  -31.201 61.730 1.00 39.14  ? 34   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F 2 34  ? -2.851  -29.860 63.132 1.00 37.80  ? 34   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F 2 34  ? -1.675  -32.595 62.098 1.00 40.10  ? 34   ILE F CD1   1 
ATOM   3978  N  N     . ARG F 2 35  ? -0.187  -27.847 64.626 1.00 40.55  ? 35   ARG F N     1 
ATOM   3979  C  CA    . ARG F 2 35  ? -0.301  -26.819 65.656 1.00 41.01  ? 35   ARG F CA    1 
ATOM   3980  C  C     . ARG F 2 35  ? 0.028   -25.437 65.091 1.00 40.24  ? 35   ARG F C     1 
ATOM   3981  O  O     . ARG F 2 35  ? -0.715  -24.489 65.319 1.00 40.75  ? 35   ARG F O     1 
ATOM   3982  C  CB    . ARG F 2 35  ? 0.597   -27.140 66.839 1.00 41.52  ? 35   ARG F CB    1 
ATOM   3983  C  CG    . ARG F 2 35  ? 0.440   -26.171 67.986 1.00 46.05  ? 35   ARG F CG    1 
ATOM   3984  C  CD    . ARG F 2 35  ? 1.639   -26.209 68.952 1.00 51.12  ? 35   ARG F CD    1 
ATOM   3985  N  NE    . ARG F 2 35  ? 2.044   -27.582 69.222 1.00 54.15  ? 35   ARG F NE    1 
ATOM   3986  C  CZ    . ARG F 2 35  ? 1.276   -28.485 69.824 1.00 56.12  ? 35   ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F 2 35  ? 0.044   -28.163 70.219 1.00 55.08  ? 35   ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F 2 35  ? 1.754   -29.714 70.029 1.00 57.86  ? 35   ARG F NH2   1 
ATOM   3989  N  N     . ARG F 2 36  ? 1.113   -25.325 64.329 1.00 39.09  ? 36   ARG F N     1 
ATOM   3990  C  CA    . ARG F 2 36  ? 1.446   -24.059 63.679 1.00 38.06  ? 36   ARG F CA    1 
ATOM   3991  C  C     . ARG F 2 36  ? 0.299   -23.544 62.811 1.00 37.48  ? 36   ARG F C     1 
ATOM   3992  O  O     . ARG F 2 36  ? -0.060  -22.378 62.890 1.00 37.51  ? 36   ARG F O     1 
ATOM   3993  C  CB    . ARG F 2 36  ? 2.736   -24.164 62.857 1.00 38.01  ? 36   ARG F CB    1 
ATOM   3994  C  CG    . ARG F 2 36  ? 4.005   -24.271 63.685 1.00 37.68  ? 36   ARG F CG    1 
ATOM   3995  C  CD    . ARG F 2 36  ? 5.256   -24.128 62.819 1.00 38.13  ? 36   ARG F CD    1 
ATOM   3996  N  NE    . ARG F 2 36  ? 5.468   -25.239 61.883 1.00 38.66  ? 36   ARG F NE    1 
ATOM   3997  C  CZ    . ARG F 2 36  ? 6.180   -26.347 62.140 1.00 37.06  ? 36   ARG F CZ    1 
ATOM   3998  N  NH1   . ARG F 2 36  ? 6.763   -26.540 63.325 1.00 33.18  ? 36   ARG F NH1   1 
ATOM   3999  N  NH2   . ARG F 2 36  ? 6.313   -27.274 61.189 1.00 36.59  ? 36   ARG F NH2   1 
ATOM   4000  N  N     . LEU F 2 37  ? -0.274  -24.414 61.984 1.00 36.82  ? 37   LEU F N     1 
ATOM   4001  C  CA    . LEU F 2 37  ? -1.406  -24.035 61.135 1.00 36.05  ? 37   LEU F CA    1 
ATOM   4002  C  C     . LEU F 2 37  ? -2.590  -23.563 61.981 1.00 36.03  ? 37   LEU F C     1 
ATOM   4003  O  O     . LEU F 2 37  ? -3.289  -22.633 61.617 1.00 36.44  ? 37   LEU F O     1 
ATOM   4004  C  CB    . LEU F 2 37  ? -1.836  -25.186 60.227 1.00 35.72  ? 37   LEU F CB    1 
ATOM   4005  C  CG    . LEU F 2 37  ? -0.933  -25.665 59.080 1.00 35.29  ? 37   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F 2 37  ? -1.265  -27.076 58.696 1.00 35.41  ? 37   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F 2 37  ? -1.087  -24.802 57.857 1.00 35.73  ? 37   LEU F CD2   1 
ATOM   4008  N  N     . ALA F 2 38  ? -2.807  -24.188 63.124 1.00 35.94  ? 38   ALA F N     1 
ATOM   4009  C  CA    . ALA F 2 38  ? -3.882  -23.758 64.007 1.00 35.54  ? 38   ALA F CA    1 
ATOM   4010  C  C     . ALA F 2 38  ? -3.585  -22.363 64.574 1.00 35.27  ? 38   ALA F C     1 
ATOM   4011  O  O     . ALA F 2 38  ? -4.497  -21.534 64.729 1.00 35.08  ? 38   ALA F O     1 
ATOM   4012  C  CB    . ALA F 2 38  ? -4.089  -24.764 65.126 1.00 35.09  ? 38   ALA F CB    1 
ATOM   4013  N  N     . ARG F 2 39  ? -2.311  -22.121 64.883 1.00 34.63  ? 39   ARG F N     1 
ATOM   4014  C  CA    . ARG F 2 39  ? -1.881  -20.843 65.413 1.00 34.35  ? 39   ARG F CA    1 
ATOM   4015  C  C     . ARG F 2 39  ? -2.193  -19.748 64.407 1.00 34.19  ? 39   ARG F C     1 
ATOM   4016  O  O     . ARG F 2 39  ? -2.800  -18.729 64.761 1.00 34.82  ? 39   ARG F O     1 
ATOM   4017  C  CB    . ARG F 2 39  ? -0.387  -20.847 65.743 1.00 34.19  ? 39   ARG F CB    1 
ATOM   4018  C  CG    . ARG F 2 39  ? 0.009   -21.768 66.874 1.00 34.86  ? 39   ARG F CG    1 
ATOM   4019  C  CD    . ARG F 2 39  ? -0.615  -21.406 68.227 1.00 35.91  ? 39   ARG F CD    1 
ATOM   4020  N  NE    . ARG F 2 39  ? -0.025  -22.232 69.280 1.00 38.28  ? 39   ARG F NE    1 
ATOM   4021  C  CZ    . ARG F 2 39  ? -0.712  -22.963 70.148 1.00 39.45  ? 39   ARG F CZ    1 
ATOM   4022  N  NH1   . ARG F 2 39  ? -2.037  -22.953 70.137 1.00 40.30  ? 39   ARG F NH1   1 
ATOM   4023  N  NH2   . ARG F 2 39  ? -0.064  -23.685 71.048 1.00 40.70  ? 39   ARG F NH2   1 
ATOM   4024  N  N     . ARG F 2 40  ? -1.815  -19.959 63.150 1.00 33.22  ? 40   ARG F N     1 
ATOM   4025  C  CA    . ARG F 2 40  ? -2.118  -18.971 62.120 1.00 32.38  ? 40   ARG F CA    1 
ATOM   4026  C  C     . ARG F 2 40  ? -3.619  -18.716 62.012 1.00 32.63  ? 40   ARG F C     1 
ATOM   4027  O  O     . ARG F 2 40  ? -4.031  -17.615 61.638 1.00 32.76  ? 40   ARG F O     1 
ATOM   4028  C  CB    . ARG F 2 40  ? -1.527  -19.368 60.765 1.00 32.37  ? 40   ARG F CB    1 
ATOM   4029  C  CG    . ARG F 2 40  ? -1.539  -18.266 59.674 1.00 29.67  ? 40   ARG F CG    1 
ATOM   4030  C  CD    . ARG F 2 40  ? -0.549  -18.582 58.517 1.00 27.33  ? 40   ARG F CD    1 
ATOM   4031  N  NE    . ARG F 2 40  ? 0.819   -18.190 58.859 1.00 29.32  ? 40   ARG F NE    1 
ATOM   4032  C  CZ    . ARG F 2 40  ? 1.915   -18.472 58.155 1.00 28.16  ? 40   ARG F CZ    1 
ATOM   4033  N  NH1   . ARG F 2 40  ? 1.827   -19.178 57.047 1.00 27.07  ? 40   ARG F NH1   1 
ATOM   4034  N  NH2   . ARG F 2 40  ? 3.118   -18.068 58.582 1.00 28.10  ? 40   ARG F NH2   1 
ATOM   4035  N  N     . GLY F 2 41  ? -4.425  -19.715 62.381 1.00 32.30  ? 41   GLY F N     1 
ATOM   4036  C  CA    . GLY F 2 41  ? -5.867  -19.610 62.305 1.00 32.35  ? 41   GLY F CA    1 
ATOM   4037  C  C     . GLY F 2 41  ? -6.438  -19.064 63.584 1.00 32.81  ? 41   GLY F C     1 
ATOM   4038  O  O     . GLY F 2 41  ? -7.658  -19.013 63.737 1.00 33.22  ? 41   GLY F O     1 
ATOM   4039  N  N     . GLY F 2 42  ? -5.555  -18.693 64.514 1.00 33.30  ? 42   GLY F N     1 
ATOM   4040  C  CA    . GLY F 2 42  ? -5.939  -18.048 65.779 1.00 33.79  ? 42   GLY F CA    1 
ATOM   4041  C  C     . GLY F 2 42  ? -6.288  -18.961 66.933 1.00 34.45  ? 42   GLY F C     1 
ATOM   4042  O  O     . GLY F 2 42  ? -6.881  -18.530 67.909 1.00 34.99  ? 42   GLY F O     1 
ATOM   4043  N  N     . VAL F 2 43  ? -5.921  -20.232 66.837 1.00 35.45  ? 43   VAL F N     1 
ATOM   4044  C  CA    . VAL F 2 43  ? -6.328  -21.209 67.834 1.00 35.54  ? 43   VAL F CA    1 
ATOM   4045  C  C     . VAL F 2 43  ? -5.391  -21.182 69.007 1.00 35.47  ? 43   VAL F C     1 
ATOM   4046  O  O     . VAL F 2 43  ? -4.188  -21.201 68.836 1.00 35.42  ? 43   VAL F O     1 
ATOM   4047  C  CB    . VAL F 2 43  ? -6.426  -22.610 67.224 1.00 35.37  ? 43   VAL F CB    1 
ATOM   4048  C  CG1   . VAL F 2 43  ? -6.704  -23.623 68.293 1.00 34.64  ? 43   VAL F CG1   1 
ATOM   4049  C  CG2   . VAL F 2 43  ? -7.550  -22.605 66.192 1.00 36.64  ? 43   VAL F CG2   1 
ATOM   4050  N  N     . LYS F 2 44  ? -5.962  -21.141 70.202 1.00 36.43  ? 44   LYS F N     1 
ATOM   4051  C  CA    . LYS F 2 44  ? -5.173  -21.056 71.425 1.00 37.34  ? 44   LYS F CA    1 
ATOM   4052  C  C     . LYS F 2 44  ? -4.988  -22.402 72.134 1.00 36.99  ? 44   LYS F C     1 
ATOM   4053  O  O     . LYS F 2 44  ? -3.938  -22.645 72.700 1.00 37.60  ? 44   LYS F O     1 
ATOM   4054  C  CB    . LYS F 2 44  ? -5.779  -20.006 72.370 1.00 37.25  ? 44   LYS F CB    1 
ATOM   4055  C  CG    . LYS F 2 44  ? -4.924  -19.694 73.588 1.00 39.10  ? 44   LYS F CG    1 
ATOM   4056  C  CD    . LYS F 2 44  ? -5.747  -19.033 74.668 1.00 41.89  ? 44   LYS F CD    1 
ATOM   4057  C  CE    . LYS F 2 44  ? -4.884  -18.519 75.797 1.00 42.83  ? 44   LYS F CE    1 
ATOM   4058  N  NZ    . LYS F 2 44  ? -5.747  -18.198 76.967 1.00 45.06  ? 44   LYS F NZ    1 
ATOM   4059  N  N     . ARG F 2 45  ? -6.002  -23.260 72.118 1.00 37.20  ? 45   ARG F N     1 
ATOM   4060  C  CA    . ARG F 2 45  ? -5.908  -24.543 72.803 1.00 37.57  ? 45   ARG F CA    1 
ATOM   4061  C  C     . ARG F 2 45  ? -6.421  -25.661 71.900 1.00 37.15  ? 45   ARG F C     1 
ATOM   4062  O  O     . ARG F 2 45  ? -7.478  -25.512 71.276 1.00 36.91  ? 45   ARG F O     1 
ATOM   4063  C  CB    . ARG F 2 45  ? -6.675  -24.479 74.129 1.00 38.04  ? 45   ARG F CB    1 
ATOM   4064  C  CG    . ARG F 2 45  ? -6.000  -25.153 75.291 1.00 38.29  ? 45   ARG F CG    1 
ATOM   4065  C  CD    . ARG F 2 45  ? -6.854  -25.056 76.542 1.00 40.85  ? 45   ARG F CD    1 
ATOM   4066  N  NE    . ARG F 2 45  ? -6.432  -26.005 77.573 1.00 43.42  ? 45   ARG F NE    1 
ATOM   4067  C  CZ    . ARG F 2 45  ? -6.995  -27.196 77.765 1.00 46.73  ? 45   ARG F CZ    1 
ATOM   4068  N  NH1   . ARG F 2 45  ? -8.018  -27.584 77.008 1.00 46.76  ? 45   ARG F NH1   1 
ATOM   4069  N  NH2   . ARG F 2 45  ? -6.543  -28.000 78.729 1.00 49.33  ? 45   ARG F NH2   1 
ATOM   4070  N  N     . ILE F 2 46  ? -5.656  -26.758 71.843 1.00 36.87  ? 46   ILE F N     1 
ATOM   4071  C  CA    . ILE F 2 46  ? -5.886  -27.876 70.915 1.00 37.04  ? 46   ILE F CA    1 
ATOM   4072  C  C     . ILE F 2 46  ? -6.051  -29.242 71.610 1.00 37.49  ? 46   ILE F C     1 
ATOM   4073  O  O     . ILE F 2 46  ? -5.101  -29.783 72.230 1.00 37.73  ? 46   ILE F O     1 
ATOM   4074  C  CB    . ILE F 2 46  ? -4.723  -27.987 69.923 1.00 36.82  ? 46   ILE F CB    1 
ATOM   4075  C  CG1   . ILE F 2 46  ? -4.522  -26.656 69.184 1.00 37.33  ? 46   ILE F CG1   1 
ATOM   4076  C  CG2   . ILE F 2 46  ? -4.953  -29.134 68.961 1.00 37.10  ? 46   ILE F CG2   1 
ATOM   4077  C  CD1   . ILE F 2 46  ? -3.206  -26.535 68.464 1.00 35.57  ? 46   ILE F CD1   1 
ATOM   4078  N  N     . SER F 2 47  ? -7.250  -29.807 71.488 1.00 37.34  ? 47   SER F N     1 
ATOM   4079  C  CA    . SER F 2 47  ? -7.516  -31.172 71.945 1.00 37.09  ? 47   SER F CA    1 
ATOM   4080  C  C     . SER F 2 47  ? -6.611  -32.199 71.249 1.00 36.48  ? 47   SER F C     1 
ATOM   4081  O  O     . SER F 2 47  ? -6.309  -32.069 70.058 1.00 36.67  ? 47   SER F O     1 
ATOM   4082  C  CB    . SER F 2 47  ? -8.986  -31.518 71.713 1.00 37.03  ? 47   SER F CB    1 
ATOM   4083  O  OG    . SER F 2 47  ? -9.111  -32.860 71.274 1.00 39.94  ? 47   SER F OG    1 
ATOM   4084  N  N     . GLY F 2 48  ? -6.205  -33.230 71.985 1.00 35.82  ? 48   GLY F N     1 
ATOM   4085  C  CA    . GLY F 2 48  ? -5.366  -34.302 71.433 1.00 35.44  ? 48   GLY F CA    1 
ATOM   4086  C  C     . GLY F 2 48  ? -5.879  -34.994 70.169 1.00 35.42  ? 48   GLY F C     1 
ATOM   4087  O  O     . GLY F 2 48  ? -5.082  -35.434 69.331 1.00 34.90  ? 48   GLY F O     1 
ATOM   4088  N  N     . LEU F 2 49  ? -7.200  -35.075 70.012 1.00 35.34  ? 49   LEU F N     1 
ATOM   4089  C  CA    . LEU F 2 49  ? -7.777  -35.765 68.859 1.00 36.14  ? 49   LEU F CA    1 
ATOM   4090  C  C     . LEU F 2 49  ? -7.753  -34.946 67.552 1.00 36.19  ? 49   LEU F C     1 
ATOM   4091  O  O     . LEU F 2 49  ? -8.060  -35.481 66.474 1.00 36.01  ? 49   LEU F O     1 
ATOM   4092  C  CB    . LEU F 2 49  ? -9.201  -36.253 69.163 1.00 35.95  ? 49   LEU F CB    1 
ATOM   4093  C  CG    . LEU F 2 49  ? -9.370  -37.351 70.223 1.00 37.41  ? 49   LEU F CG    1 
ATOM   4094  C  CD1   . LEU F 2 49  ? -10.851 -37.487 70.513 1.00 38.97  ? 49   LEU F CD1   1 
ATOM   4095  C  CD2   . LEU F 2 49  ? -8.756  -38.698 69.831 1.00 37.58  ? 49   LEU F CD2   1 
ATOM   4096  N  N     . ILE F 2 50  ? -7.379  -33.664 67.655 1.00 36.05  ? 50   ILE F N     1 
ATOM   4097  C  CA    . ILE F 2 50  ? -7.434  -32.732 66.525 1.00 35.77  ? 50   ILE F CA    1 
ATOM   4098  C  C     . ILE F 2 50  ? -6.497  -33.156 65.418 1.00 35.94  ? 50   ILE F C     1 
ATOM   4099  O  O     . ILE F 2 50  ? -6.768  -32.909 64.236 1.00 36.02  ? 50   ILE F O     1 
ATOM   4100  C  CB    . ILE F 2 50  ? -7.117  -31.248 66.961 1.00 35.83  ? 50   ILE F CB    1 
ATOM   4101  C  CG1   . ILE F 2 50  ? -8.337  -30.558 67.582 1.00 35.49  ? 50   ILE F CG1   1 
ATOM   4102  C  CG2   . ILE F 2 50  ? -6.572  -30.404 65.814 1.00 34.50  ? 50   ILE F CG2   1 
ATOM   4103  C  CD1   . ILE F 2 50  ? -9.598  -30.555 66.722 1.00 35.68  ? 50   ILE F CD1   1 
ATOM   4104  N  N     . TYR F 2 51  ? -5.398  -33.797 65.803 1.00 35.77  ? 51   TYR F N     1 
ATOM   4105  C  CA    . TYR F 2 51  ? -4.359  -34.130 64.853 1.00 36.23  ? 51   TYR F CA    1 
ATOM   4106  C  C     . TYR F 2 51  ? -4.808  -35.197 63.861 1.00 36.73  ? 51   TYR F C     1 
ATOM   4107  O  O     . TYR F 2 51  ? -4.584  -35.048 62.660 1.00 37.37  ? 51   TYR F O     1 
ATOM   4108  C  CB    . TYR F 2 51  ? -3.034  -34.442 65.568 1.00 36.30  ? 51   TYR F CB    1 
ATOM   4109  C  CG    . TYR F 2 51  ? -2.678  -33.377 66.582 1.00 36.39  ? 51   TYR F CG    1 
ATOM   4110  C  CD1   . TYR F 2 51  ? -2.792  -33.626 67.957 1.00 36.82  ? 51   TYR F CD1   1 
ATOM   4111  C  CD2   . TYR F 2 51  ? -2.268  -32.096 66.169 1.00 36.99  ? 51   TYR F CD2   1 
ATOM   4112  C  CE1   . TYR F 2 51  ? -2.494  -32.632 68.905 1.00 37.51  ? 51   TYR F CE1   1 
ATOM   4113  C  CE2   . TYR F 2 51  ? -1.968  -31.098 67.099 1.00 37.05  ? 51   TYR F CE2   1 
ATOM   4114  C  CZ    . TYR F 2 51  ? -2.082  -31.374 68.464 1.00 39.23  ? 51   TYR F CZ    1 
ATOM   4115  O  OH    . TYR F 2 51  ? -1.785  -30.397 69.394 1.00 41.06  ? 51   TYR F OH    1 
ATOM   4116  N  N     . GLU F 2 52  ? -5.484  -36.243 64.325 1.00 37.42  ? 52   GLU F N     1 
ATOM   4117  C  CA    . GLU F 2 52  ? -5.972  -37.261 63.379 1.00 38.20  ? 52   GLU F CA    1 
ATOM   4118  C  C     . GLU F 2 52  ? -7.121  -36.744 62.517 1.00 37.48  ? 52   GLU F C     1 
ATOM   4119  O  O     . GLU F 2 52  ? -7.223  -37.099 61.338 1.00 37.15  ? 52   GLU F O     1 
ATOM   4120  C  CB    . GLU F 2 52  ? -6.341  -38.578 64.067 1.00 38.55  ? 52   GLU F CB    1 
ATOM   4121  C  CG    . GLU F 2 52  ? -5.142  -39.499 64.299 1.00 42.26  ? 52   GLU F CG    1 
ATOM   4122  C  CD    . GLU F 2 52  ? -4.308  -39.752 63.037 1.00 47.26  ? 52   GLU F CD    1 
ATOM   4123  O  OE1   . GLU F 2 52  ? -4.876  -40.070 61.959 1.00 51.34  ? 52   GLU F OE1   1 
ATOM   4124  O  OE2   . GLU F 2 52  ? -3.069  -39.653 63.123 1.00 49.14  ? 52   GLU F OE2   1 
ATOM   4125  N  N     . GLU F 2 53  ? -7.947  -35.881 63.101 1.00 36.61  ? 53   GLU F N     1 
ATOM   4126  C  CA    . GLU F 2 53  ? -9.092  -35.333 62.403 1.00 36.60  ? 53   GLU F CA    1 
ATOM   4127  C  C     . GLU F 2 53  ? -8.611  -34.466 61.247 1.00 36.51  ? 53   GLU F C     1 
ATOM   4128  O  O     . GLU F 2 53  ? -9.104  -34.589 60.119 1.00 36.53  ? 53   GLU F O     1 
ATOM   4129  C  CB    . GLU F 2 53  ? -9.957  -34.519 63.369 1.00 36.68  ? 53   GLU F CB    1 
ATOM   4130  C  CG    . GLU F 2 53  ? -11.318 -34.098 62.821 1.00 37.45  ? 53   GLU F CG    1 
ATOM   4131  C  CD    . GLU F 2 53  ? -12.374 -35.211 62.865 1.00 39.76  ? 53   GLU F CD    1 
ATOM   4132  O  OE1   . GLU F 2 53  ? -12.106 -36.287 63.440 1.00 41.04  ? 53   GLU F OE1   1 
ATOM   4133  O  OE2   . GLU F 2 53  ? -13.481 -35.006 62.319 1.00 41.15  ? 53   GLU F OE2   1 
ATOM   4134  N  N     . THR F 2 54  ? -7.625  -33.619 61.539 1.00 36.20  ? 54   THR F N     1 
ATOM   4135  C  CA    . THR F 2 54  ? -7.009  -32.733 60.555 1.00 36.14  ? 54   THR F CA    1 
ATOM   4136  C  C     . THR F 2 54  ? -6.357  -33.522 59.421 1.00 36.21  ? 54   THR F C     1 
ATOM   4137  O  O     . THR F 2 54  ? -6.561  -33.209 58.246 1.00 36.70  ? 54   THR F O     1 
ATOM   4138  C  CB    . THR F 2 54  ? -5.959  -31.774 61.200 1.00 36.32  ? 54   THR F CB    1 
ATOM   4139  O  OG1   . THR F 2 54  ? -6.560  -31.015 62.259 1.00 35.22  ? 54   THR F OG1   1 
ATOM   4140  C  CG2   . THR F 2 54  ? -5.418  -30.812 60.178 1.00 35.57  ? 54   THR F CG2   1 
ATOM   4141  N  N     . ARG F 2 55  ? -5.583  -34.550 59.758 1.00 36.03  ? 55   ARG F N     1 
ATOM   4142  C  CA    . ARG F 2 55  ? -4.973  -35.396 58.723 1.00 35.35  ? 55   ARG F CA    1 
ATOM   4143  C  C     . ARG F 2 55  ? -6.059  -35.945 57.793 1.00 34.58  ? 55   ARG F C     1 
ATOM   4144  O  O     . ARG F 2 55  ? -5.955  -35.835 56.567 1.00 34.21  ? 55   ARG F O     1 
ATOM   4145  C  CB    . ARG F 2 55  ? -4.131  -36.510 59.355 1.00 35.78  ? 55   ARG F CB    1 
ATOM   4146  C  CG    . ARG F 2 55  ? -2.912  -35.968 60.071 1.00 36.06  ? 55   ARG F CG    1 
ATOM   4147  C  CD    . ARG F 2 55  ? -1.939  -37.046 60.481 1.00 37.60  ? 55   ARG F CD    1 
ATOM   4148  N  NE    . ARG F 2 55  ? -0.889  -36.490 61.338 1.00 38.85  ? 55   ARG F NE    1 
ATOM   4149  C  CZ    . ARG F 2 55  ? -0.845  -36.614 62.664 1.00 38.54  ? 55   ARG F CZ    1 
ATOM   4150  N  NH1   . ARG F 2 55  ? -1.780  -37.295 63.311 1.00 38.97  ? 55   ARG F NH1   1 
ATOM   4151  N  NH2   . ARG F 2 55  ? 0.136   -36.053 63.346 1.00 38.50  ? 55   ARG F NH2   1 
ATOM   4152  N  N     . GLY F 2 56  ? -7.118  -36.485 58.389 1.00 34.04  ? 56   GLY F N     1 
ATOM   4153  C  CA    . GLY F 2 56  ? -8.279  -36.970 57.635 1.00 33.30  ? 56   GLY F CA    1 
ATOM   4154  C  C     . GLY F 2 56  ? -8.795  -35.921 56.666 1.00 33.03  ? 56   GLY F C     1 
ATOM   4155  O  O     . GLY F 2 56  ? -8.845  -36.175 55.452 1.00 33.10  ? 56   GLY F O     1 
ATOM   4156  N  N     . VAL F 2 57  ? -9.139  -34.741 57.203 1.00 32.10  ? 57   VAL F N     1 
ATOM   4157  C  CA    . VAL F 2 57  ? -9.655  -33.602 56.426 1.00 31.56  ? 57   VAL F CA    1 
ATOM   4158  C  C     . VAL F 2 57  ? -8.715  -33.160 55.296 1.00 31.69  ? 57   VAL F C     1 
ATOM   4159  O  O     . VAL F 2 57  ? -9.155  -32.898 54.178 1.00 31.33  ? 57   VAL F O     1 
ATOM   4160  C  CB    . VAL F 2 57  ? -9.989  -32.395 57.341 1.00 31.47  ? 57   VAL F CB    1 
ATOM   4161  C  CG1   . VAL F 2 57  ? -10.204 -31.143 56.527 1.00 31.41  ? 57   VAL F CG1   1 
ATOM   4162  C  CG2   . VAL F 2 57  ? -11.209 -32.679 58.209 1.00 31.21  ? 57   VAL F CG2   1 
ATOM   4163  N  N     . LEU F 2 58  ? -7.422  -33.090 55.576 1.00 32.46  ? 58   LEU F N     1 
ATOM   4164  C  CA    . LEU F 2 58  ? -6.444  -32.753 54.538 1.00 33.65  ? 58   LEU F CA    1 
ATOM   4165  C  C     . LEU F 2 58  ? -6.404  -33.787 53.408 1.00 34.70  ? 58   LEU F C     1 
ATOM   4166  O  O     . LEU F 2 58  ? -6.338  -33.428 52.235 1.00 35.65  ? 58   LEU F O     1 
ATOM   4167  C  CB    . LEU F 2 58  ? -5.045  -32.541 55.135 1.00 33.55  ? 58   LEU F CB    1 
ATOM   4168  C  CG    . LEU F 2 58  ? -3.909  -32.348 54.115 1.00 33.26  ? 58   LEU F CG    1 
ATOM   4169  C  CD1   . LEU F 2 58  ? -4.122  -31.114 53.206 1.00 31.48  ? 58   LEU F CD1   1 
ATOM   4170  C  CD2   . LEU F 2 58  ? -2.551  -32.314 54.781 1.00 31.09  ? 58   LEU F CD2   1 
ATOM   4171  N  N     . LYS F 2 59  ? -6.484  -35.067 53.751 1.00 35.90  ? 59   LYS F N     1 
ATOM   4172  C  CA    . LYS F 2 59  ? -6.478  -36.136 52.747 1.00 36.89  ? 59   LYS F CA    1 
ATOM   4173  C  C     . LYS F 2 59  ? -7.642  -36.007 51.772 1.00 37.15  ? 59   LYS F C     1 
ATOM   4174  O  O     . LYS F 2 59  ? -7.476  -36.193 50.560 1.00 37.80  ? 59   LYS F O     1 
ATOM   4175  C  CB    . LYS F 2 59  ? -6.474  -37.505 53.433 1.00 37.44  ? 59   LYS F CB    1 
ATOM   4176  C  CG    . LYS F 2 59  ? -6.575  -38.705 52.500 1.00 40.25  ? 59   LYS F CG    1 
ATOM   4177  C  CD    . LYS F 2 59  ? -5.963  -39.962 53.144 1.00 42.89  ? 59   LYS F CD    1 
ATOM   4178  C  CE    . LYS F 2 59  ? -6.530  -41.254 52.525 1.00 46.08  ? 59   LYS F CE    1 
ATOM   4179  N  NZ    . LYS F 2 59  ? -8.040  -41.402 52.619 1.00 46.68  ? 59   LYS F NZ    1 
ATOM   4180  N  N     . VAL F 2 60  ? -8.817  -35.675 52.292 1.00 37.17  ? 60   VAL F N     1 
ATOM   4181  C  CA    . VAL F 2 60  ? -9.989  -35.514 51.445 1.00 37.16  ? 60   VAL F CA    1 
ATOM   4182  C  C     . VAL F 2 60  ? -9.757  -34.325 50.547 1.00 37.45  ? 60   VAL F C     1 
ATOM   4183  O  O     . VAL F 2 60  ? -10.017 -34.386 49.343 1.00 38.53  ? 60   VAL F O     1 
ATOM   4184  C  CB    . VAL F 2 60  ? -11.291 -35.351 52.270 1.00 37.53  ? 60   VAL F CB    1 
ATOM   4185  C  CG1   . VAL F 2 60  ? -12.392 -34.706 51.442 1.00 36.83  ? 60   VAL F CG1   1 
ATOM   4186  C  CG2   . VAL F 2 60  ? -11.742 -36.715 52.838 1.00 36.38  ? 60   VAL F CG2   1 
ATOM   4187  N  N     . PHE F 2 61  ? -9.228  -33.250 51.114 1.00 37.05  ? 61   PHE F N     1 
ATOM   4188  C  CA    . PHE F 2 61  ? -8.991  -32.060 50.328 1.00 36.16  ? 61   PHE F CA    1 
ATOM   4189  C  C     . PHE F 2 61  ? -8.044  -32.371 49.179 1.00 36.51  ? 61   PHE F C     1 
ATOM   4190  O  O     . PHE F 2 61  ? -8.356  -32.066 48.025 1.00 36.60  ? 61   PHE F O     1 
ATOM   4191  C  CB    . PHE F 2 61  ? -8.450  -30.920 51.190 1.00 35.75  ? 61   PHE F CB    1 
ATOM   4192  C  CG    . PHE F 2 61  ? -8.176  -29.668 50.417 1.00 33.89  ? 61   PHE F CG    1 
ATOM   4193  C  CD1   . PHE F 2 61  ? -9.187  -28.739 50.207 1.00 32.51  ? 61   PHE F CD1   1 
ATOM   4194  C  CD2   . PHE F 2 61  ? -6.913  -29.421 49.882 1.00 32.57  ? 61   PHE F CD2   1 
ATOM   4195  C  CE1   . PHE F 2 61  ? -8.944  -27.583 49.485 1.00 32.36  ? 61   PHE F CE1   1 
ATOM   4196  C  CE2   . PHE F 2 61  ? -6.663  -28.259 49.152 1.00 32.61  ? 61   PHE F CE2   1 
ATOM   4197  C  CZ    . PHE F 2 61  ? -7.681  -27.342 48.955 1.00 32.21  ? 61   PHE F CZ    1 
ATOM   4198  N  N     . LEU F 2 62  ? -6.898  -32.978 49.478 1.00 36.54  ? 62   LEU F N     1 
ATOM   4199  C  CA    . LEU F 2 62  ? -5.964  -33.370 48.414 1.00 37.27  ? 62   LEU F CA    1 
ATOM   4200  C  C     . LEU F 2 62  ? -6.525  -34.360 47.359 1.00 37.67  ? 62   LEU F C     1 
ATOM   4201  O  O     . LEU F 2 62  ? -6.304  -34.193 46.162 1.00 37.32  ? 62   LEU F O     1 
ATOM   4202  C  CB    . LEU F 2 62  ? -4.665  -33.905 49.011 1.00 37.47  ? 62   LEU F CB    1 
ATOM   4203  C  CG    . LEU F 2 62  ? -3.686  -32.862 49.571 1.00 37.83  ? 62   LEU F CG    1 
ATOM   4204  C  CD1   . LEU F 2 62  ? -2.521  -33.556 50.277 1.00 35.27  ? 62   LEU F CD1   1 
ATOM   4205  C  CD2   . LEU F 2 62  ? -3.177  -31.880 48.473 1.00 36.85  ? 62   LEU F CD2   1 
ATOM   4206  N  N     . GLU F 2 63  ? -7.240  -35.395 47.795 1.00 38.44  ? 63   GLU F N     1 
ATOM   4207  C  CA    . GLU F 2 63  ? -7.795  -36.367 46.851 1.00 39.16  ? 63   GLU F CA    1 
ATOM   4208  C  C     . GLU F 2 63  ? -8.648  -35.665 45.800 1.00 39.34  ? 63   GLU F C     1 
ATOM   4209  O  O     . GLU F 2 63  ? -8.551  -35.966 44.599 1.00 39.42  ? 63   GLU F O     1 
ATOM   4210  C  CB    . GLU F 2 63  ? -8.644  -37.403 47.577 1.00 39.60  ? 63   GLU F CB    1 
ATOM   4211  C  CG    . GLU F 2 63  ? -7.863  -38.540 48.194 1.00 41.64  ? 63   GLU F CG    1 
ATOM   4212  C  CD    . GLU F 2 63  ? -8.602  -39.238 49.332 1.00 44.24  ? 63   GLU F CD    1 
ATOM   4213  O  OE1   . GLU F 2 63  ? -9.762  -38.869 49.647 1.00 42.77  ? 63   GLU F OE1   1 
ATOM   4214  O  OE2   . GLU F 2 63  ? -7.995  -40.168 49.920 1.00 47.11  ? 63   GLU F OE2   1 
ATOM   4215  N  N     . ASN F 2 64  ? -9.490  -34.737 46.260 1.00 38.95  ? 64   ASN F N     1 
ATOM   4216  C  CA    . ASN F 2 64  ? -10.357 -33.998 45.365 1.00 38.73  ? 64   ASN F CA    1 
ATOM   4217  C  C     . ASN F 2 64  ? -9.585  -33.161 44.381 1.00 38.10  ? 64   ASN F C     1 
ATOM   4218  O  O     . ASN F 2 64  ? -9.901  -33.155 43.205 1.00 38.29  ? 64   ASN F O     1 
ATOM   4219  C  CB    . ASN F 2 64  ? -11.403 -33.176 46.137 1.00 38.98  ? 64   ASN F CB    1 
ATOM   4220  C  CG    . ASN F 2 64  ? -12.372 -34.059 46.897 1.00 40.46  ? 64   ASN F CG    1 
ATOM   4221  O  OD1   . ASN F 2 64  ? -12.443 -35.260 46.650 1.00 43.11  ? 64   ASN F OD1   1 
ATOM   4222  N  ND2   . ASN F 2 64  ? -13.107 -33.481 47.834 1.00 43.05  ? 64   ASN F ND2   1 
ATOM   4223  N  N     . VAL F 2 65  ? -8.563  -32.465 44.846 1.00 38.22  ? 65   VAL F N     1 
ATOM   4224  C  CA    . VAL F 2 65  ? -7.861  -31.546 43.962 1.00 38.25  ? 65   VAL F CA    1 
ATOM   4225  C  C     . VAL F 2 65  ? -6.954  -32.315 43.037 1.00 38.00  ? 65   VAL F C     1 
ATOM   4226  O  O     . VAL F 2 65  ? -6.904  -32.018 41.851 1.00 38.37  ? 65   VAL F O     1 
ATOM   4227  C  CB    . VAL F 2 65  ? -7.074  -30.450 44.715 1.00 38.43  ? 65   VAL F CB    1 
ATOM   4228  C  CG1   . VAL F 2 65  ? -6.462  -29.463 43.726 1.00 38.30  ? 65   VAL F CG1   1 
ATOM   4229  C  CG2   . VAL F 2 65  ? -7.994  -29.701 45.643 1.00 38.84  ? 65   VAL F CG2   1 
ATOM   4230  N  N     . ILE F 2 66  ? -6.239  -33.298 43.570 1.00 37.86  ? 66   ILE F N     1 
ATOM   4231  C  CA    . ILE F 2 66  ? -5.353  -34.112 42.747 1.00 37.91  ? 66   ILE F CA    1 
ATOM   4232  C  C     . ILE F 2 66  ? -6.115  -34.882 41.666 1.00 38.22  ? 66   ILE F C     1 
ATOM   4233  O  O     . ILE F 2 66  ? -5.682  -34.907 40.514 1.00 38.32  ? 66   ILE F O     1 
ATOM   4234  C  CB    . ILE F 2 66  ? -4.459  -35.019 43.600 1.00 38.03  ? 66   ILE F CB    1 
ATOM   4235  C  CG1   . ILE F 2 66  ? -3.399  -34.161 44.298 1.00 37.24  ? 66   ILE F CG1   1 
ATOM   4236  C  CG2   . ILE F 2 66  ? -3.782  -36.058 42.740 1.00 37.30  ? 66   ILE F CG2   1 
ATOM   4237  C  CD1   . ILE F 2 66  ? -3.049  -34.618 45.652 1.00 37.50  ? 66   ILE F CD1   1 
ATOM   4238  N  N     . ARG F 2 67  ? -7.265  -35.455 42.019 1.00 38.45  ? 67   ARG F N     1 
ATOM   4239  C  CA    . ARG F 2 67  ? -8.102  -36.159 41.044 1.00 39.12  ? 67   ARG F CA    1 
ATOM   4240  C  C     . ARG F 2 67  ? -8.435  -35.291 39.814 1.00 38.31  ? 67   ARG F C     1 
ATOM   4241  O  O     . ARG F 2 67  ? -8.225  -35.721 38.675 1.00 38.50  ? 67   ARG F O     1 
ATOM   4242  C  CB    . ARG F 2 67  ? -9.373  -36.740 41.701 1.00 39.64  ? 67   ARG F CB    1 
ATOM   4243  C  CG    . ARG F 2 67  ? -10.362 -37.430 40.725 1.00 42.38  ? 67   ARG F CG    1 
ATOM   4244  C  CD    . ARG F 2 67  ? -11.728 -37.696 41.391 1.00 48.12  ? 67   ARG F CD    1 
ATOM   4245  N  NE    . ARG F 2 67  ? -11.584 -38.550 42.584 1.00 53.66  ? 67   ARG F NE    1 
ATOM   4246  C  CZ    . ARG F 2 67  ? -11.864 -38.184 43.842 1.00 54.63  ? 67   ARG F CZ    1 
ATOM   4247  N  NH1   . ARG F 2 67  ? -12.352 -36.971 44.109 1.00 55.48  ? 67   ARG F NH1   1 
ATOM   4248  N  NH2   . ARG F 2 67  ? -11.668 -39.039 44.842 1.00 53.63  ? 67   ARG F NH2   1 
ATOM   4249  N  N     . ASP F 2 68  ? -8.931  -34.077 40.040 1.00 37.45  ? 68   ASP F N     1 
ATOM   4250  C  CA    . ASP F 2 68  ? -9.230  -33.152 38.931 1.00 36.68  ? 68   ASP F CA    1 
ATOM   4251  C  C     . ASP F 2 68  ? -7.968  -32.725 38.192 1.00 36.07  ? 68   ASP F C     1 
ATOM   4252  O  O     . ASP F 2 68  ? -7.958  -32.680 36.968 1.00 35.89  ? 68   ASP F O     1 
ATOM   4253  C  CB    . ASP F 2 68  ? -10.029 -31.938 39.416 1.00 36.65  ? 68   ASP F CB    1 
ATOM   4254  C  CG    . ASP F 2 68  ? -11.443 -32.302 39.837 1.00 38.46  ? 68   ASP F CG    1 
ATOM   4255  O  OD1   . ASP F 2 68  ? -11.836 -33.493 39.704 1.00 41.18  ? 68   ASP F OD1   1 
ATOM   4256  O  OD2   . ASP F 2 68  ? -12.177 -31.396 40.295 1.00 39.79  ? 68   ASP F OD2   1 
ATOM   4257  N  N     . ALA F 2 69  ? -6.902  -32.435 38.932 1.00 35.66  ? 69   ALA F N     1 
ATOM   4258  C  CA    . ALA F 2 69  ? -5.641  -32.029 38.323 1.00 35.71  ? 69   ALA F CA    1 
ATOM   4259  C  C     . ALA F 2 69  ? -5.108  -33.144 37.433 1.00 35.90  ? 69   ALA F C     1 
ATOM   4260  O  O     . ALA F 2 69  ? -4.794  -32.908 36.257 1.00 35.90  ? 69   ALA F O     1 
ATOM   4261  C  CB    . ALA F 2 69  ? -4.611  -31.620 39.394 1.00 35.81  ? 69   ALA F CB    1 
ATOM   4262  N  N     . VAL F 2 70  ? -5.053  -34.364 37.973 1.00 36.14  ? 70   VAL F N     1 
ATOM   4263  C  CA    . VAL F 2 70  ? -4.666  -35.556 37.178 1.00 36.26  ? 70   VAL F CA    1 
ATOM   4264  C  C     . VAL F 2 70  ? -5.578  -35.785 35.959 1.00 36.51  ? 70   VAL F C     1 
ATOM   4265  O  O     . VAL F 2 70  ? -5.085  -36.146 34.885 1.00 36.85  ? 70   VAL F O     1 
ATOM   4266  C  CB    . VAL F 2 70  ? -4.516  -36.860 38.040 1.00 35.86  ? 70   VAL F CB    1 
ATOM   4267  C  CG1   . VAL F 2 70  ? -4.316  -38.065 37.160 1.00 34.95  ? 70   VAL F CG1   1 
ATOM   4268  C  CG2   . VAL F 2 70  ? -3.329  -36.730 39.006 1.00 35.30  ? 70   VAL F CG2   1 
ATOM   4269  N  N     . THR F 2 71  ? -6.882  -35.553 36.105 1.00 36.65  ? 71   THR F N     1 
ATOM   4270  C  CA    . THR F 2 71  ? -7.775  -35.620 34.946 1.00 37.09  ? 71   THR F CA    1 
ATOM   4271  C  C     . THR F 2 71  ? -7.335  -34.672 33.825 1.00 38.42  ? 71   THR F C     1 
ATOM   4272  O  O     . THR F 2 71  ? -7.187  -35.105 32.675 1.00 38.97  ? 71   THR F O     1 
ATOM   4273  C  CB    . THR F 2 71  ? -9.219  -35.357 35.323 1.00 36.52  ? 71   THR F CB    1 
ATOM   4274  O  OG1   . THR F 2 71  ? -9.599  -36.296 36.318 1.00 35.49  ? 71   THR F OG1   1 
ATOM   4275  C  CG2   . THR F 2 71  ? -10.125 -35.543 34.136 1.00 35.56  ? 71   THR F CG2   1 
ATOM   4276  N  N     . TYR F 2 72  ? -7.091  -33.398 34.157 1.00 39.33  ? 72   TYR F N     1 
ATOM   4277  C  CA    . TYR F 2 72  ? -6.548  -32.450 33.172 1.00 39.83  ? 72   TYR F CA    1 
ATOM   4278  C  C     . TYR F 2 72  ? -5.244  -32.968 32.538 1.00 40.80  ? 72   TYR F C     1 
ATOM   4279  O  O     . TYR F 2 72  ? -5.042  -32.834 31.329 1.00 40.72  ? 72   TYR F O     1 
ATOM   4280  C  CB    . TYR F 2 72  ? -6.325  -31.077 33.805 1.00 39.48  ? 72   TYR F CB    1 
ATOM   4281  C  CG    . TYR F 2 72  ? -7.596  -30.290 34.069 1.00 39.05  ? 72   TYR F CG    1 
ATOM   4282  C  CD1   . TYR F 2 72  ? -7.955  -29.925 35.363 1.00 39.95  ? 72   TYR F CD1   1 
ATOM   4283  C  CD2   . TYR F 2 72  ? -8.426  -29.894 33.027 1.00 37.98  ? 72   TYR F CD2   1 
ATOM   4284  C  CE1   . TYR F 2 72  ? -9.127  -29.202 35.612 1.00 39.46  ? 72   TYR F CE1   1 
ATOM   4285  C  CE2   . TYR F 2 72  ? -9.581  -29.177 33.264 1.00 39.40  ? 72   TYR F CE2   1 
ATOM   4286  C  CZ    . TYR F 2 72  ? -9.926  -28.833 34.556 1.00 39.75  ? 72   TYR F CZ    1 
ATOM   4287  O  OH    . TYR F 2 72  ? -11.072 -28.110 34.773 1.00 40.91  ? 72   TYR F OH    1 
ATOM   4288  N  N     . THR F 2 73  ? -4.370  -33.558 33.360 1.00 41.82  ? 73   THR F N     1 
ATOM   4289  C  CA    . THR F 2 73  ? -3.110  -34.135 32.882 1.00 42.69  ? 73   THR F CA    1 
ATOM   4290  C  C     . THR F 2 73  ? -3.387  -35.157 31.791 1.00 43.60  ? 73   THR F C     1 
ATOM   4291  O  O     . THR F 2 73  ? -2.850  -35.053 30.700 1.00 43.80  ? 73   THR F O     1 
ATOM   4292  C  CB    . THR F 2 73  ? -2.312  -34.814 34.018 1.00 42.35  ? 73   THR F CB    1 
ATOM   4293  O  OG1   . THR F 2 73  ? -2.120  -33.891 35.098 1.00 42.98  ? 73   THR F OG1   1 
ATOM   4294  C  CG2   . THR F 2 73  ? -0.973  -35.270 33.524 1.00 41.28  ? 73   THR F CG2   1 
ATOM   4295  N  N     . GLU F 2 74  ? -4.249  -36.124 32.084 1.00 44.76  ? 74   GLU F N     1 
ATOM   4296  C  CA    . GLU F 2 74  ? -4.507  -37.229 31.159 1.00 46.24  ? 74   GLU F CA    1 
ATOM   4297  C  C     . GLU F 2 74  ? -5.191  -36.734 29.908 1.00 46.50  ? 74   GLU F C     1 
ATOM   4298  O  O     . GLU F 2 74  ? -4.927  -37.238 28.808 1.00 46.53  ? 74   GLU F O     1 
ATOM   4299  C  CB    . GLU F 2 74  ? -5.371  -38.323 31.795 1.00 46.59  ? 74   GLU F CB    1 
ATOM   4300  C  CG    . GLU F 2 74  ? -4.662  -39.165 32.838 1.00 49.75  ? 74   GLU F CG    1 
ATOM   4301  C  CD    . GLU F 2 74  ? -5.623  -39.809 33.860 1.00 54.74  ? 74   GLU F CD    1 
ATOM   4302  O  OE1   . GLU F 2 74  ? -6.861  -39.797 33.645 1.00 56.21  ? 74   GLU F OE1   1 
ATOM   4303  O  OE2   . GLU F 2 74  ? -5.133  -40.323 34.896 1.00 55.58  ? 74   GLU F OE2   1 
ATOM   4304  N  N     . HIS F 2 75  ? -6.070  -35.747 30.067 1.00 46.94  ? 75   HIS F N     1 
ATOM   4305  C  CA    . HIS F 2 75  ? -6.747  -35.202 28.906 1.00 47.23  ? 75   HIS F CA    1 
ATOM   4306  C  C     . HIS F 2 75  ? -5.747  -34.593 27.934 1.00 47.53  ? 75   HIS F C     1 
ATOM   4307  O  O     . HIS F 2 75  ? -5.908  -34.709 26.718 1.00 48.10  ? 75   HIS F O     1 
ATOM   4308  C  CB    . HIS F 2 75  ? -7.825  -34.194 29.262 1.00 47.12  ? 75   HIS F CB    1 
ATOM   4309  C  CG    . HIS F 2 75  ? -8.557  -33.692 28.060 1.00 47.18  ? 75   HIS F CG    1 
ATOM   4310  N  ND1   . HIS F 2 75  ? -9.680  -34.314 27.561 1.00 47.05  ? 75   HIS F ND1   1 
ATOM   4311  C  CD2   . HIS F 2 75  ? -8.283  -32.672 27.212 1.00 46.75  ? 75   HIS F CD2   1 
ATOM   4312  C  CE1   . HIS F 2 75  ? -10.084 -33.679 26.474 1.00 47.58  ? 75   HIS F CE1   1 
ATOM   4313  N  NE2   . HIS F 2 75  ? -9.253  -32.679 26.240 1.00 46.61  ? 75   HIS F NE2   1 
ATOM   4314  N  N     . ALA F 2 76  ? -4.712  -33.961 28.478 1.00 47.66  ? 76   ALA F N     1 
ATOM   4315  C  CA    . ALA F 2 76  ? -3.669  -33.345 27.673 1.00 47.73  ? 76   ALA F CA    1 
ATOM   4316  C  C     . ALA F 2 76  ? -2.730  -34.392 27.076 1.00 47.98  ? 76   ALA F C     1 
ATOM   4317  O  O     . ALA F 2 76  ? -1.995  -34.096 26.141 1.00 47.97  ? 76   ALA F O     1 
ATOM   4318  C  CB    . ALA F 2 76  ? -2.891  -32.342 28.505 1.00 47.40  ? 76   ALA F CB    1 
ATOM   4319  N  N     . LYS F 2 77  ? -2.766  -35.607 27.632 1.00 48.46  ? 77   LYS F N     1 
ATOM   4320  C  CA    . LYS F 2 77  ? -1.863  -36.717 27.255 1.00 49.14  ? 77   LYS F CA    1 
ATOM   4321  C  C     . LYS F 2 77  ? -0.421  -36.505 27.724 1.00 48.94  ? 77   LYS F C     1 
ATOM   4322  O  O     . LYS F 2 77  ? 0.535   -36.846 27.017 1.00 49.56  ? 77   LYS F O     1 
ATOM   4323  C  CB    . LYS F 2 77  ? -1.910  -37.008 25.745 1.00 49.28  ? 77   LYS F CB    1 
ATOM   4324  C  CG    . LYS F 2 77  ? -3.129  -37.793 25.320 1.00 51.11  ? 77   LYS F CG    1 
ATOM   4325  C  CD    . LYS F 2 77  ? -3.446  -37.569 23.859 1.00 54.81  ? 77   LYS F CD    1 
ATOM   4326  C  CE    . LYS F 2 77  ? -4.739  -38.277 23.474 1.00 57.06  ? 77   LYS F CE    1 
ATOM   4327  N  NZ    . LYS F 2 77  ? -5.130  -37.977 22.054 1.00 59.66  ? 77   LYS F NZ    1 
ATOM   4328  N  N     . ARG F 2 78  ? -0.278  -35.940 28.915 1.00 48.27  ? 78   ARG F N     1 
ATOM   4329  C  CA    . ARG F 2 78  ? 1.016   -35.746 29.521 1.00 47.99  ? 78   ARG F CA    1 
ATOM   4330  C  C     . ARG F 2 78  ? 1.214   -36.793 30.607 1.00 48.06  ? 78   ARG F C     1 
ATOM   4331  O  O     . ARG F 2 78  ? 0.263   -37.459 31.018 1.00 47.72  ? 78   ARG F O     1 
ATOM   4332  C  CB    . ARG F 2 78  ? 1.131   -34.328 30.092 1.00 47.94  ? 78   ARG F CB    1 
ATOM   4333  C  CG    . ARG F 2 78  ? 1.383   -33.256 29.038 1.00 46.96  ? 78   ARG F CG    1 
ATOM   4334  C  CD    . ARG F 2 78  ? 1.554   -31.876 29.661 1.00 45.69  ? 78   ARG F CD    1 
ATOM   4335  N  NE    . ARG F 2 78  ? 0.278   -31.179 29.853 1.00 43.65  ? 78   ARG F NE    1 
ATOM   4336  C  CZ    . ARG F 2 78  ? -0.355  -31.070 31.021 1.00 43.28  ? 78   ARG F CZ    1 
ATOM   4337  N  NH1   . ARG F 2 78  ? 0.161   -31.612 32.130 1.00 41.36  ? 78   ARG F NH1   1 
ATOM   4338  N  NH2   . ARG F 2 78  ? -1.507  -30.410 31.085 1.00 40.92  ? 78   ARG F NH2   1 
ATOM   4339  N  N     . LYS F 2 79  ? 2.462   -36.952 31.044 1.00 48.36  ? 79   LYS F N     1 
ATOM   4340  C  CA    . LYS F 2 79  ? 2.797   -37.796 32.187 1.00 48.46  ? 79   LYS F CA    1 
ATOM   4341  C  C     . LYS F 2 79  ? 3.165   -36.896 33.367 1.00 47.47  ? 79   LYS F C     1 
ATOM   4342  O  O     . LYS F 2 79  ? 3.374   -37.364 34.494 1.00 47.32  ? 79   LYS F O     1 
ATOM   4343  C  CB    . LYS F 2 79  ? 3.956   -38.742 31.843 1.00 49.11  ? 79   LYS F CB    1 
ATOM   4344  C  CG    . LYS F 2 79  ? 3.660   -39.701 30.684 1.00 52.43  ? 79   LYS F CG    1 
ATOM   4345  C  CD    . LYS F 2 79  ? 4.647   -40.872 30.667 1.00 58.95  ? 79   LYS F CD    1 
ATOM   4346  C  CE    . LYS F 2 79  ? 4.788   -41.453 29.254 1.00 62.45  ? 79   LYS F CE    1 
ATOM   4347  N  NZ    . LYS F 2 79  ? 5.499   -42.777 29.268 1.00 64.38  ? 79   LYS F NZ    1 
ATOM   4348  N  N     . THR F 2 80  ? 3.226   -35.601 33.096 1.00 46.24  ? 80   THR F N     1 
ATOM   4349  C  CA    . THR F 2 80  ? 3.647   -34.625 34.087 1.00 45.64  ? 80   THR F CA    1 
ATOM   4350  C  C     . THR F 2 80  ? 2.475   -33.725 34.495 1.00 44.17  ? 80   THR F C     1 
ATOM   4351  O  O     . THR F 2 80  ? 1.814   -33.121 33.650 1.00 44.26  ? 80   THR F O     1 
ATOM   4352  C  CB    . THR F 2 80  ? 4.849   -33.790 33.567 1.00 45.88  ? 80   THR F CB    1 
ATOM   4353  O  OG1   . THR F 2 80  ? 5.799   -34.671 32.937 1.00 47.08  ? 80   THR F OG1   1 
ATOM   4354  C  CG2   . THR F 2 80  ? 5.531   -33.057 34.717 1.00 45.67  ? 80   THR F CG2   1 
ATOM   4355  N  N     . VAL F 2 81  ? 2.217   -33.663 35.794 1.00 42.70  ? 81   VAL F N     1 
ATOM   4356  C  CA    . VAL F 2 81  ? 1.194   -32.786 36.350 1.00 41.10  ? 81   VAL F CA    1 
ATOM   4357  C  C     . VAL F 2 81  ? 1.804   -31.390 36.442 1.00 40.59  ? 81   VAL F C     1 
ATOM   4358  O  O     . VAL F 2 81  ? 2.816   -31.204 37.118 1.00 39.84  ? 81   VAL F O     1 
ATOM   4359  C  CB    . VAL F 2 81  ? 0.725   -33.271 37.746 1.00 41.32  ? 81   VAL F CB    1 
ATOM   4360  C  CG1   . VAL F 2 81  ? -0.391  -32.380 38.299 1.00 40.65  ? 81   VAL F CG1   1 
ATOM   4361  C  CG2   . VAL F 2 81  ? 0.277   -34.753 37.703 1.00 39.74  ? 81   VAL F CG2   1 
ATOM   4362  N  N     . THR F 2 82  ? 1.199   -30.433 35.727 1.00 40.26  ? 82   THR F N     1 
ATOM   4363  C  CA    . THR F 2 82  ? 1.681   -29.059 35.662 1.00 40.54  ? 82   THR F CA    1 
ATOM   4364  C  C     . THR F 2 82  ? 1.040   -28.170 36.730 1.00 40.44  ? 82   THR F C     1 
ATOM   4365  O  O     . THR F 2 82  ? -0.048  -28.470 37.236 1.00 40.23  ? 82   THR F O     1 
ATOM   4366  C  CB    . THR F 2 82  ? 1.418   -28.411 34.274 1.00 40.72  ? 82   THR F CB    1 
ATOM   4367  O  OG1   . THR F 2 82  ? 0.015   -28.450 33.971 1.00 40.35  ? 82   THR F OG1   1 
ATOM   4368  C  CG2   . THR F 2 82  ? 2.206   -29.111 33.184 1.00 40.57  ? 82   THR F CG2   1 
ATOM   4369  N  N     . ALA F 2 83  ? 1.719   -27.070 37.053 1.00 40.30  ? 83   ALA F N     1 
ATOM   4370  C  CA    . ALA F 2 83  ? 1.142   -26.029 37.894 1.00 40.17  ? 83   ALA F CA    1 
ATOM   4371  C  C     . ALA F 2 83  ? -0.232  -25.649 37.356 1.00 40.41  ? 83   ALA F C     1 
ATOM   4372  O  O     . ALA F 2 83  ? -1.154  -25.402 38.134 1.00 41.08  ? 83   ALA F O     1 
ATOM   4373  C  CB    . ALA F 2 83  ? 2.044   -24.816 37.931 1.00 40.16  ? 83   ALA F CB    1 
ATOM   4374  N  N     . MET F 2 84  ? -0.378  -25.619 36.032 1.00 40.10  ? 84   MET F N     1 
ATOM   4375  C  CA    . MET F 2 84  ? -1.645  -25.221 35.436 1.00 39.99  ? 84   MET F CA    1 
ATOM   4376  C  C     . MET F 2 84  ? -2.735  -26.268 35.667 1.00 39.81  ? 84   MET F C     1 
ATOM   4377  O  O     . MET F 2 84  ? -3.896  -25.914 35.915 1.00 40.60  ? 84   MET F O     1 
ATOM   4378  C  CB    . MET F 2 84  ? -1.499  -24.862 33.950 1.00 40.01  ? 84   MET F CB    1 
ATOM   4379  C  CG    . MET F 2 84  ? -0.775  -23.523 33.696 1.00 41.64  ? 84   MET F CG    1 
ATOM   4380  S  SD    . MET F 2 84  ? -1.335  -22.101 34.697 1.00 44.45  ? 84   MET F SD    1 
ATOM   4381  C  CE    . MET F 2 84  ? -2.994  -21.823 34.065 1.00 42.86  ? 84   MET F CE    1 
ATOM   4382  N  N     . ASP F 2 85  ? -2.380  -27.546 35.624 1.00 39.04  ? 85   ASP F N     1 
ATOM   4383  C  CA    . ASP F 2 85  ? -3.360  -28.593 35.973 1.00 38.70  ? 85   ASP F CA    1 
ATOM   4384  C  C     . ASP F 2 85  ? -3.928  -28.346 37.367 1.00 37.83  ? 85   ASP F C     1 
ATOM   4385  O  O     . ASP F 2 85  ? -5.132  -28.426 37.576 1.00 37.55  ? 85   ASP F O     1 
ATOM   4386  C  CB    . ASP F 2 85  ? -2.755  -30.007 35.908 1.00 38.95  ? 85   ASP F CB    1 
ATOM   4387  C  CG    . ASP F 2 85  ? -2.300  -30.392 34.511 1.00 41.16  ? 85   ASP F CG    1 
ATOM   4388  O  OD1   . ASP F 2 85  ? -2.919  -29.919 33.518 1.00 42.93  ? 85   ASP F OD1   1 
ATOM   4389  O  OD2   . ASP F 2 85  ? -1.314  -31.164 34.407 1.00 41.50  ? 85   ASP F OD2   1 
ATOM   4390  N  N     . VAL F 2 86  ? -3.050  -28.028 38.313 1.00 37.27  ? 86   VAL F N     1 
ATOM   4391  C  CA    . VAL F 2 86  ? -3.467  -27.723 39.682 1.00 37.01  ? 86   VAL F CA    1 
ATOM   4392  C  C     . VAL F 2 86  ? -4.317  -26.464 39.766 1.00 37.11  ? 86   VAL F C     1 
ATOM   4393  O  O     . VAL F 2 86  ? -5.367  -26.462 40.424 1.00 37.37  ? 86   VAL F O     1 
ATOM   4394  C  CB    . VAL F 2 86  ? -2.272  -27.585 40.607 1.00 36.70  ? 86   VAL F CB    1 
ATOM   4395  C  CG1   . VAL F 2 86  ? -2.736  -27.199 41.997 1.00 36.75  ? 86   VAL F CG1   1 
ATOM   4396  C  CG2   . VAL F 2 86  ? -1.499  -28.902 40.642 1.00 36.32  ? 86   VAL F CG2   1 
ATOM   4397  N  N     . VAL F 2 87  ? -3.878  -25.412 39.077 1.00 36.56  ? 87   VAL F N     1 
ATOM   4398  C  CA    . VAL F 2 87  ? -4.592  -24.153 39.097 1.00 36.79  ? 87   VAL F CA    1 
ATOM   4399  C  C     . VAL F 2 87  ? -6.027  -24.307 38.550 1.00 37.46  ? 87   VAL F C     1 
ATOM   4400  O  O     . VAL F 2 87  ? -6.963  -23.753 39.114 1.00 37.75  ? 87   VAL F O     1 
ATOM   4401  C  CB    . VAL F 2 87  ? -3.755  -23.014 38.418 1.00 36.98  ? 87   VAL F CB    1 
ATOM   4402  C  CG1   . VAL F 2 87  ? -4.589  -21.765 38.172 1.00 34.30  ? 87   VAL F CG1   1 
ATOM   4403  C  CG2   . VAL F 2 87  ? -2.504  -22.689 39.280 1.00 36.04  ? 87   VAL F CG2   1 
ATOM   4404  N  N     . TYR F 2 88  ? -6.206  -25.083 37.485 1.00 38.16  ? 88   TYR F N     1 
ATOM   4405  C  CA    . TYR F 2 88  ? -7.547  -25.286 36.914 1.00 38.41  ? 88   TYR F CA    1 
ATOM   4406  C  C     . TYR F 2 88  ? -8.437  -26.131 37.799 1.00 37.81  ? 88   TYR F C     1 
ATOM   4407  O  O     . TYR F 2 88  ? -9.642  -25.891 37.876 1.00 37.31  ? 88   TYR F O     1 
ATOM   4408  C  CB    . TYR F 2 88  ? -7.490  -25.923 35.528 1.00 39.00  ? 88   TYR F CB    1 
ATOM   4409  C  CG    . TYR F 2 88  ? -6.775  -25.105 34.476 1.00 41.66  ? 88   TYR F CG    1 
ATOM   4410  C  CD1   . TYR F 2 88  ? -5.977  -25.731 33.527 1.00 43.13  ? 88   TYR F CD1   1 
ATOM   4411  C  CD2   . TYR F 2 88  ? -6.898  -23.710 34.423 1.00 44.11  ? 88   TYR F CD2   1 
ATOM   4412  C  CE1   . TYR F 2 88  ? -5.317  -25.009 32.554 1.00 44.94  ? 88   TYR F CE1   1 
ATOM   4413  C  CE2   . TYR F 2 88  ? -6.227  -22.967 33.445 1.00 46.05  ? 88   TYR F CE2   1 
ATOM   4414  C  CZ    . TYR F 2 88  ? -5.444  -23.637 32.507 1.00 46.17  ? 88   TYR F CZ    1 
ATOM   4415  O  OH    . TYR F 2 88  ? -4.777  -22.947 31.522 1.00 47.83  ? 88   TYR F OH    1 
ATOM   4416  N  N     . ALA F 2 89  ? -7.829  -27.125 38.451 1.00 37.64  ? 89   ALA F N     1 
ATOM   4417  C  CA    . ALA F 2 89  ? -8.520  -27.995 39.399 1.00 37.29  ? 89   ALA F CA    1 
ATOM   4418  C  C     . ALA F 2 89  ? -9.030  -27.164 40.557 1.00 37.59  ? 89   ALA F C     1 
ATOM   4419  O  O     . ALA F 2 89  ? -10.165 -27.327 40.982 1.00 37.79  ? 89   ALA F O     1 
ATOM   4420  C  CB    . ALA F 2 89  ? -7.588  -29.061 39.900 1.00 37.26  ? 89   ALA F CB    1 
ATOM   4421  N  N     . LEU F 2 90  ? -8.190  -26.262 41.056 1.00 37.84  ? 90   LEU F N     1 
ATOM   4422  C  CA    . LEU F 2 90  ? -8.595  -25.359 42.106 1.00 38.03  ? 90   LEU F CA    1 
ATOM   4423  C  C     . LEU F 2 90  ? -9.737  -24.451 41.662 1.00 38.95  ? 90   LEU F C     1 
ATOM   4424  O  O     . LEU F 2 90  ? -10.748 -24.343 42.363 1.00 39.08  ? 90   LEU F O     1 
ATOM   4425  C  CB    . LEU F 2 90  ? -7.397  -24.562 42.604 1.00 37.88  ? 90   LEU F CB    1 
ATOM   4426  C  CG    . LEU F 2 90  ? -6.356  -25.390 43.371 1.00 36.70  ? 90   LEU F CG    1 
ATOM   4427  C  CD1   . LEU F 2 90  ? -5.088  -24.584 43.485 1.00 33.73  ? 90   LEU F CD1   1 
ATOM   4428  C  CD2   . LEU F 2 90  ? -6.865  -25.862 44.764 1.00 33.46  ? 90   LEU F CD2   1 
ATOM   4429  N  N     . LYS F 2 91  ? -9.614  -23.825 40.497 1.00 39.82  ? 91   LYS F N     1 
ATOM   4430  C  CA    . LYS F 2 91  ? -10.695 -22.964 40.035 1.00 41.46  ? 91   LYS F CA    1 
ATOM   4431  C  C     . LYS F 2 91  ? -12.035 -23.710 39.971 1.00 42.13  ? 91   LYS F C     1 
ATOM   4432  O  O     . LYS F 2 91  ? -13.066 -23.180 40.388 1.00 43.07  ? 91   LYS F O     1 
ATOM   4433  C  CB    . LYS F 2 91  ? -10.354 -22.310 38.700 1.00 41.83  ? 91   LYS F CB    1 
ATOM   4434  C  CG    . LYS F 2 91  ? -11.381 -21.281 38.250 1.00 44.39  ? 91   LYS F CG    1 
ATOM   4435  C  CD    . LYS F 2 91  ? -10.891 -20.489 37.058 1.00 48.88  ? 91   LYS F CD    1 
ATOM   4436  C  CE    . LYS F 2 91  ? -10.433 -19.102 37.477 1.00 52.15  ? 91   LYS F CE    1 
ATOM   4437  N  NZ    . LYS F 2 91  ? -9.819  -18.356 36.329 1.00 55.03  ? 91   LYS F NZ    1 
ATOM   4438  N  N     . ARG F 2 92  ? -12.007 -24.940 39.471 1.00 42.72  ? 92   ARG F N     1 
ATOM   4439  C  CA    . ARG F 2 92  ? -13.194 -25.793 39.339 1.00 43.38  ? 92   ARG F CA    1 
ATOM   4440  C  C     . ARG F 2 92  ? -13.892 -26.020 40.664 1.00 43.05  ? 92   ARG F C     1 
ATOM   4441  O  O     . ARG F 2 92  ? -15.109 -26.200 40.723 1.00 43.28  ? 92   ARG F O     1 
ATOM   4442  C  CB    . ARG F 2 92  ? -12.794 -27.180 38.828 1.00 43.63  ? 92   ARG F CB    1 
ATOM   4443  C  CG    . ARG F 2 92  ? -12.986 -27.402 37.358 1.00 45.70  ? 92   ARG F CG    1 
ATOM   4444  C  CD    . ARG F 2 92  ? -13.247 -28.887 37.096 1.00 48.05  ? 92   ARG F CD    1 
ATOM   4445  N  NE    . ARG F 2 92  ? -14.678 -29.176 37.146 1.00 48.95  ? 92   ARG F NE    1 
ATOM   4446  C  CZ    . ARG F 2 92  ? -15.309 -29.721 38.181 1.00 48.31  ? 92   ARG F CZ    1 
ATOM   4447  N  NH1   . ARG F 2 92  ? -14.647 -30.066 39.272 1.00 47.72  ? 92   ARG F NH1   1 
ATOM   4448  N  NH2   . ARG F 2 92  ? -16.614 -29.926 38.111 1.00 50.14  ? 92   ARG F NH2   1 
ATOM   4449  N  N     . GLN F 2 93  ? -13.097 -26.061 41.719 1.00 42.43  ? 93   GLN F N     1 
ATOM   4450  C  CA    . GLN F 2 93  ? -13.603 -26.351 43.031 1.00 42.14  ? 93   GLN F CA    1 
ATOM   4451  C  C     . GLN F 2 93  ? -13.895 -25.121 43.856 1.00 41.24  ? 93   GLN F C     1 
ATOM   4452  O  O     . GLN F 2 93  ? -14.159 -25.225 45.038 1.00 41.00  ? 93   GLN F O     1 
ATOM   4453  C  CB    . GLN F 2 93  ? -12.624 -27.260 43.736 1.00 42.59  ? 93   GLN F CB    1 
ATOM   4454  C  CG    . GLN F 2 93  ? -13.038 -28.704 43.555 1.00 45.91  ? 93   GLN F CG    1 
ATOM   4455  C  CD    . GLN F 2 93  ? -11.880 -29.638 43.583 1.00 49.41  ? 93   GLN F CD    1 
ATOM   4456  O  OE1   . GLN F 2 93  ? -11.100 -29.648 44.535 1.00 51.73  ? 93   GLN F OE1   1 
ATOM   4457  N  NE2   . GLN F 2 93  ? -11.746 -30.437 42.532 1.00 51.09  ? 93   GLN F NE2   1 
ATOM   4458  N  N     . GLY F 2 94  ? -13.859 -23.956 43.211 1.00 40.76  ? 94   GLY F N     1 
ATOM   4459  C  CA    . GLY F 2 94  ? -14.139 -22.689 43.864 1.00 39.71  ? 94   GLY F CA    1 
ATOM   4460  C  C     . GLY F 2 94  ? -13.095 -22.264 44.887 1.00 39.06  ? 94   GLY F C     1 
ATOM   4461  O  O     . GLY F 2 94  ? -13.427 -21.564 45.844 1.00 38.80  ? 94   GLY F O     1 
ATOM   4462  N  N     . ARG F 2 95  ? -11.847 -22.698 44.684 1.00 38.28  ? 95   ARG F N     1 
ATOM   4463  C  CA    . ARG F 2 95  ? -10.713 -22.331 45.542 1.00 36.99  ? 95   ARG F CA    1 
ATOM   4464  C  C     . ARG F 2 95  ? -9.586  -21.768 44.670 1.00 35.89  ? 95   ARG F C     1 
ATOM   4465  O  O     . ARG F 2 95  ? -8.421  -22.187 44.795 1.00 35.92  ? 95   ARG F O     1 
ATOM   4466  C  CB    . ARG F 2 95  ? -10.170 -23.540 46.318 1.00 37.36  ? 95   ARG F CB    1 
ATOM   4467  C  CG    . ARG F 2 95  ? -11.171 -24.521 46.921 1.00 39.40  ? 95   ARG F CG    1 
ATOM   4468  C  CD    . ARG F 2 95  ? -11.434 -24.279 48.397 1.00 44.49  ? 95   ARG F CD    1 
ATOM   4469  N  NE    . ARG F 2 95  ? -10.360 -23.516 49.046 1.00 47.72  ? 95   ARG F NE    1 
ATOM   4470  C  CZ    . ARG F 2 95  ? -10.483 -22.848 50.194 1.00 48.05  ? 95   ARG F CZ    1 
ATOM   4471  N  NH1   . ARG F 2 95  ? -11.643 -22.840 50.855 1.00 48.49  ? 95   ARG F NH1   1 
ATOM   4472  N  NH2   . ARG F 2 95  ? -9.440  -22.183 50.679 1.00 46.73  ? 95   ARG F NH2   1 
ATOM   4473  N  N     . THR F 2 96  ? -9.949  -20.849 43.772 1.00 34.40  ? 96   THR F N     1 
ATOM   4474  C  CA    . THR F 2 96  ? -9.029  -20.114 42.891 1.00 33.03  ? 96   THR F CA    1 
ATOM   4475  C  C     . THR F 2 96  ? -7.751  -19.658 43.574 1.00 32.19  ? 96   THR F C     1 
ATOM   4476  O  O     . THR F 2 96  ? -7.783  -19.076 44.650 1.00 32.07  ? 96   THR F O     1 
ATOM   4477  C  CB    . THR F 2 96  ? -9.734  -18.871 42.327 1.00 33.14  ? 96   THR F CB    1 
ATOM   4478  O  OG1   . THR F 2 96  ? -10.962 -19.269 41.709 1.00 34.66  ? 96   THR F OG1   1 
ATOM   4479  C  CG2   . THR F 2 96  ? -8.871  -18.162 41.323 1.00 32.10  ? 96   THR F CG2   1 
ATOM   4480  N  N     . LEU F 2 97  ? -6.629  -19.922 42.923 1.00 31.91  ? 97   LEU F N     1 
ATOM   4481  C  CA    . LEU F 2 97  ? -5.309  -19.608 43.453 1.00 32.13  ? 97   LEU F CA    1 
ATOM   4482  C  C     . LEU F 2 97  ? -4.568  -18.661 42.528 1.00 32.37  ? 97   LEU F C     1 
ATOM   4483  O  O     . LEU F 2 97  ? -4.438  -18.954 41.343 1.00 31.72  ? 97   LEU F O     1 
ATOM   4484  C  CB    . LEU F 2 97  ? -4.479  -20.876 43.599 1.00 31.57  ? 97   LEU F CB    1 
ATOM   4485  C  CG    . LEU F 2 97  ? -3.059  -20.737 44.149 1.00 32.23  ? 97   LEU F CG    1 
ATOM   4486  C  CD1   . LEU F 2 97  ? -3.024  -20.192 45.584 1.00 33.13  ? 97   LEU F CD1   1 
ATOM   4487  C  CD2   . LEU F 2 97  ? -2.400  -22.090 44.100 1.00 33.02  ? 97   LEU F CD2   1 
ATOM   4488  N  N     . TYR F 2 98  ? -4.091  -17.537 43.074 1.00 32.52  ? 98   TYR F N     1 
ATOM   4489  C  CA    . TYR F 2 98  ? -3.228  -16.648 42.329 1.00 33.27  ? 98   TYR F CA    1 
ATOM   4490  C  C     . TYR F 2 98  ? -1.774  -16.935 42.698 1.00 33.89  ? 98   TYR F C     1 
ATOM   4491  O  O     . TYR F 2 98  ? -1.465  -17.150 43.870 1.00 34.59  ? 98   TYR F O     1 
ATOM   4492  C  CB    . TYR F 2 98  ? -3.528  -15.191 42.676 1.00 33.42  ? 98   TYR F CB    1 
ATOM   4493  C  CG    . TYR F 2 98  ? -4.846  -14.605 42.206 1.00 33.51  ? 98   TYR F CG    1 
ATOM   4494  C  CD1   . TYR F 2 98  ? -5.667  -15.250 41.266 1.00 34.27  ? 98   TYR F CD1   1 
ATOM   4495  C  CD2   . TYR F 2 98  ? -5.240  -13.364 42.672 1.00 32.85  ? 98   TYR F CD2   1 
ATOM   4496  C  CE1   . TYR F 2 98  ? -6.873  -14.668 40.850 1.00 33.24  ? 98   TYR F CE1   1 
ATOM   4497  C  CE2   . TYR F 2 98  ? -6.415  -12.779 42.263 1.00 33.23  ? 98   TYR F CE2   1 
ATOM   4498  C  CZ    . TYR F 2 98  ? -7.227  -13.420 41.369 1.00 33.80  ? 98   TYR F CZ    1 
ATOM   4499  O  OH    . TYR F 2 98  ? -8.384  -12.761 41.012 1.00 35.21  ? 98   TYR F OH    1 
ATOM   4500  N  N     . GLY F 2 99  ? -0.879  -16.937 41.718 1.00 34.32  ? 99   GLY F N     1 
ATOM   4501  C  CA    . GLY F 2 99  ? 0.553   -16.873 42.027 1.00 35.52  ? 99   GLY F CA    1 
ATOM   4502  C  C     . GLY F 2 99  ? 1.390   -17.940 41.359 1.00 36.05  ? 99   GLY F C     1 
ATOM   4503  O  O     . GLY F 2 99  ? 2.588   -18.091 41.645 1.00 36.33  ? 99   GLY F O     1 
ATOM   4504  N  N     . PHE F 2 100 ? 0.756   -18.686 40.463 1.00 36.53  ? 100  PHE F N     1 
ATOM   4505  C  CA    . PHE F 2 100 ? 1.413   -19.819 39.818 1.00 36.58  ? 100  PHE F CA    1 
ATOM   4506  C  C     . PHE F 2 100 ? 1.109   -19.900 38.342 1.00 37.17  ? 100  PHE F C     1 
ATOM   4507  O  O     . PHE F 2 100 ? 1.348   -20.917 37.741 1.00 37.55  ? 100  PHE F O     1 
ATOM   4508  C  CB    . PHE F 2 100 ? 1.047   -21.151 40.514 1.00 36.15  ? 100  PHE F CB    1 
ATOM   4509  C  CG    . PHE F 2 100 ? 1.655   -21.317 41.894 1.00 34.50  ? 100  PHE F CG    1 
ATOM   4510  C  CD1   . PHE F 2 100 ? 0.959   -20.927 43.024 1.00 33.25  ? 100  PHE F CD1   1 
ATOM   4511  C  CD2   . PHE F 2 100 ? 2.919   -21.879 42.058 1.00 33.30  ? 100  PHE F CD2   1 
ATOM   4512  C  CE1   . PHE F 2 100 ? 1.522   -21.079 44.305 1.00 33.76  ? 100  PHE F CE1   1 
ATOM   4513  C  CE2   . PHE F 2 100 ? 3.480   -22.046 43.328 1.00 32.45  ? 100  PHE F CE2   1 
ATOM   4514  C  CZ    . PHE F 2 100 ? 2.778   -21.634 44.450 1.00 32.86  ? 100  PHE F CZ    1 
ATOM   4515  N  N     . GLY F 2 101 ? 0.602   -18.827 37.747 1.00 38.68  ? 101  GLY F N     1 
ATOM   4516  C  CA    . GLY F 2 101 ? 0.289   -18.820 36.319 1.00 40.15  ? 101  GLY F CA    1 
ATOM   4517  C  C     . GLY F 2 101 ? -1.200  -18.805 36.083 1.00 41.88  ? 101  GLY F C     1 
ATOM   4518  O  O     . GLY F 2 101 ? -1.667  -18.754 34.948 1.00 42.25  ? 101  GLY F O     1 
ATOM   4519  N  N     . GLY F 2 102 ? -1.965  -18.805 37.161 1.00 43.61  ? 102  GLY F N     1 
ATOM   4520  C  CA    . GLY F 2 102 ? -3.409  -18.892 37.018 1.00 46.09  ? 102  GLY F CA    1 
ATOM   4521  C  C     . GLY F 2 102 ? -4.219  -17.852 37.766 1.00 47.06  ? 102  GLY F C     1 
ATOM   4522  O  O     . GLY F 2 102 ? -4.318  -16.726 37.282 1.00 48.41  ? 102  GLY F O     1 
ATOM   4523  O  OXT   . GLY F 2 102 ? -4.823  -18.111 38.821 1.00 47.67  ? 102  GLY F OXT   1 
ATOM   4524  N  N     . ALA G 3 14  ? -34.670 -40.715 4.681  1.00 86.35  ? 14   ALA G N     1 
ATOM   4525  C  CA    . ALA G 3 14  ? -33.978 -39.956 5.767  1.00 86.36  ? 14   ALA G CA    1 
ATOM   4526  C  C     . ALA G 3 14  ? -34.217 -40.576 7.142  1.00 86.24  ? 14   ALA G C     1 
ATOM   4527  O  O     . ALA G 3 14  ? -35.364 -40.831 7.531  1.00 86.39  ? 14   ALA G O     1 
ATOM   4528  C  CB    . ALA G 3 14  ? -34.407 -38.494 5.761  1.00 86.36  ? 14   ALA G CB    1 
ATOM   4529  N  N     . LYS G 3 15  ? -33.127 -40.810 7.874  1.00 85.99  ? 15   LYS G N     1 
ATOM   4530  C  CA    . LYS G 3 15  ? -33.217 -41.329 9.239  1.00 85.67  ? 15   LYS G CA    1 
ATOM   4531  C  C     . LYS G 3 15  ? -32.495 -40.419 10.238 1.00 85.04  ? 15   LYS G C     1 
ATOM   4532  O  O     . LYS G 3 15  ? -31.300 -40.132 10.080 1.00 85.23  ? 15   LYS G O     1 
ATOM   4533  C  CB    . LYS G 3 15  ? -32.667 -42.761 9.316  1.00 85.92  ? 15   LYS G CB    1 
ATOM   4534  C  CG    . LYS G 3 15  ? -33.377 -43.634 10.345 1.00 86.60  ? 15   LYS G CG    1 
ATOM   4535  C  CD    . LYS G 3 15  ? -34.767 -44.041 9.845  1.00 87.84  ? 15   LYS G CD    1 
ATOM   4536  C  CE    . LYS G 3 15  ? -35.806 -44.056 10.971 1.00 88.21  ? 15   LYS G CE    1 
ATOM   4537  N  NZ    . LYS G 3 15  ? -35.561 -45.117 11.992 1.00 88.16  ? 15   LYS G NZ    1 
ATOM   4538  N  N     . THR G 3 16  ? -33.226 -39.978 11.264 1.00 84.06  ? 16   THR G N     1 
ATOM   4539  C  CA    . THR G 3 16  ? -32.684 -39.080 12.296 1.00 83.14  ? 16   THR G CA    1 
ATOM   4540  C  C     . THR G 3 16  ? -31.429 -39.636 12.980 1.00 82.23  ? 16   THR G C     1 
ATOM   4541  O  O     . THR G 3 16  ? -31.255 -40.852 13.100 1.00 82.12  ? 16   THR G O     1 
ATOM   4542  C  CB    . THR G 3 16  ? -33.732 -38.733 13.398 1.00 83.26  ? 16   THR G CB    1 
ATOM   4543  O  OG1   . THR G 3 16  ? -33.961 -39.878 14.231 1.00 83.36  ? 16   THR G OG1   1 
ATOM   4544  C  CG2   . THR G 3 16  ? -35.057 -38.256 12.793 1.00 83.13  ? 16   THR G CG2   1 
ATOM   4545  N  N     . ARG G 3 17  ? -30.567 -38.732 13.433 1.00 81.15  ? 17   ARG G N     1 
ATOM   4546  C  CA    . ARG G 3 17  ? -29.363 -39.113 14.167 1.00 79.94  ? 17   ARG G CA    1 
ATOM   4547  C  C     . ARG G 3 17  ? -29.666 -39.719 15.543 1.00 79.09  ? 17   ARG G C     1 
ATOM   4548  O  O     . ARG G 3 17  ? -28.897 -40.540 16.043 1.00 79.01  ? 17   ARG G O     1 
ATOM   4549  C  CB    . ARG G 3 17  ? -28.412 -37.922 14.284 1.00 79.90  ? 17   ARG G CB    1 
ATOM   4550  C  CG    . ARG G 3 17  ? -27.648 -37.637 13.007 1.00 79.60  ? 17   ARG G CG    1 
ATOM   4551  C  CD    . ARG G 3 17  ? -26.500 -36.681 13.253 1.00 79.10  ? 17   ARG G CD    1 
ATOM   4552  N  NE    . ARG G 3 17  ? -26.940 -35.290 13.264 1.00 78.86  ? 17   ARG G NE    1 
ATOM   4553  C  CZ    . ARG G 3 17  ? -26.167 -34.260 13.599 1.00 78.68  ? 17   ARG G CZ    1 
ATOM   4554  N  NH1   . ARG G 3 17  ? -24.903 -34.459 13.964 1.00 77.75  ? 17   ARG G NH1   1 
ATOM   4555  N  NH2   . ARG G 3 17  ? -26.665 -33.028 13.574 1.00 78.56  ? 17   ARG G NH2   1 
ATOM   4556  N  N     . SER G 3 18  ? -30.789 -39.323 16.141 1.00 78.12  ? 18   SER G N     1 
ATOM   4557  C  CA    . SER G 3 18  ? -31.228 -39.890 17.412 1.00 77.18  ? 18   SER G CA    1 
ATOM   4558  C  C     . SER G 3 18  ? -31.513 -41.376 17.249 1.00 76.53  ? 18   SER G C     1 
ATOM   4559  O  O     . SER G 3 18  ? -30.961 -42.195 17.980 1.00 76.66  ? 18   SER G O     1 
ATOM   4560  C  CB    . SER G 3 18  ? -32.465 -39.166 17.937 1.00 77.17  ? 18   SER G CB    1 
ATOM   4561  O  OG    . SER G 3 18  ? -32.286 -37.763 17.867 1.00 77.66  ? 18   SER G OG    1 
ATOM   4562  N  N     . SER G 3 19  ? -32.355 -41.725 16.279 1.00 75.74  ? 19   SER G N     1 
ATOM   4563  C  CA    . SER G 3 19  ? -32.656 -43.132 15.987 1.00 74.90  ? 19   SER G CA    1 
ATOM   4564  C  C     . SER G 3 19  ? -31.389 -43.917 15.641 1.00 74.23  ? 19   SER G C     1 
ATOM   4565  O  O     . SER G 3 19  ? -31.221 -45.047 16.093 1.00 73.96  ? 19   SER G O     1 
ATOM   4566  C  CB    . SER G 3 19  ? -33.706 -43.256 14.879 1.00 74.87  ? 19   SER G CB    1 
ATOM   4567  O  OG    . SER G 3 19  ? -33.402 -42.407 13.786 1.00 75.11  ? 19   SER G OG    1 
ATOM   4568  N  N     . ARG G 3 20  ? -30.497 -43.299 14.865 1.00 73.56  ? 20   ARG G N     1 
ATOM   4569  C  CA    . ARG G 3 20  ? -29.177 -43.865 14.578 1.00 73.15  ? 20   ARG G CA    1 
ATOM   4570  C  C     . ARG G 3 20  ? -28.385 -44.176 15.848 1.00 72.55  ? 20   ARG G C     1 
ATOM   4571  O  O     . ARG G 3 20  ? -27.781 -45.247 15.965 1.00 72.43  ? 20   ARG G O     1 
ATOM   4572  C  CB    . ARG G 3 20  ? -28.345 -42.909 13.716 1.00 73.51  ? 20   ARG G CB    1 
ATOM   4573  C  CG    . ARG G 3 20  ? -28.746 -42.810 12.263 1.00 74.27  ? 20   ARG G CG    1 
ATOM   4574  C  CD    . ARG G 3 20  ? -27.602 -42.245 11.436 1.00 76.15  ? 20   ARG G CD    1 
ATOM   4575  N  NE    . ARG G 3 20  ? -28.093 -41.473 10.292 1.00 79.09  ? 20   ARG G NE    1 
ATOM   4576  C  CZ    . ARG G 3 20  ? -28.516 -42.000 9.140  1.00 80.75  ? 20   ARG G CZ    1 
ATOM   4577  N  NH1   . ARG G 3 20  ? -28.514 -43.321 8.947  1.00 80.98  ? 20   ARG G NH1   1 
ATOM   4578  N  NH2   . ARG G 3 20  ? -28.942 -41.198 8.170  1.00 81.30  ? 20   ARG G NH2   1 
ATOM   4579  N  N     . ALA G 3 21  ? -28.378 -43.222 16.783 1.00 71.70  ? 21   ALA G N     1 
ATOM   4580  C  CA    . ALA G 3 21  ? -27.610 -43.342 18.023 1.00 70.83  ? 21   ALA G CA    1 
ATOM   4581  C  C     . ALA G 3 21  ? -28.326 -44.199 19.056 1.00 70.13  ? 21   ALA G C     1 
ATOM   4582  O  O     . ALA G 3 21  ? -27.720 -44.646 20.028 1.00 69.96  ? 21   ALA G O     1 
ATOM   4583  C  CB    . ALA G 3 21  ? -27.301 -41.970 18.592 1.00 71.00  ? 21   ALA G CB    1 
ATOM   4584  N  N     . GLY G 3 22  ? -29.619 -44.421 18.836 1.00 69.44  ? 22   GLY G N     1 
ATOM   4585  C  CA    . GLY G 3 22  ? -30.422 -45.294 19.690 1.00 68.55  ? 22   GLY G CA    1 
ATOM   4586  C  C     . GLY G 3 22  ? -30.986 -44.539 20.864 1.00 67.93  ? 22   GLY G C     1 
ATOM   4587  O  O     . GLY G 3 22  ? -31.115 -45.087 21.957 1.00 68.05  ? 22   GLY G O     1 
ATOM   4588  N  N     . LEU G 3 23  ? -31.345 -43.280 20.627 1.00 67.18  ? 23   LEU G N     1 
ATOM   4589  C  CA    . LEU G 3 23  ? -31.667 -42.363 21.704 1.00 66.36  ? 23   LEU G CA    1 
ATOM   4590  C  C     . LEU G 3 23  ? -32.986 -41.666 21.478 1.00 66.00  ? 23   LEU G C     1 
ATOM   4591  O  O     . LEU G 3 23  ? -33.372 -41.413 20.336 1.00 66.29  ? 23   LEU G O     1 
ATOM   4592  C  CB    . LEU G 3 23  ? -30.559 -41.316 21.841 1.00 66.33  ? 23   LEU G CB    1 
ATOM   4593  C  CG    . LEU G 3 23  ? -29.140 -41.769 22.203 1.00 65.96  ? 23   LEU G CG    1 
ATOM   4594  C  CD1   . LEU G 3 23  ? -28.169 -40.601 22.115 1.00 65.51  ? 23   LEU G CD1   1 
ATOM   4595  C  CD2   . LEU G 3 23  ? -29.111 -42.401 23.591 1.00 65.29  ? 23   LEU G CD2   1 
ATOM   4596  N  N     . GLN G 3 24  ? -33.667 -41.346 22.577 1.00 65.39  ? 24   GLN G N     1 
ATOM   4597  C  CA    . GLN G 3 24  ? -34.875 -40.532 22.531 1.00 64.72  ? 24   GLN G CA    1 
ATOM   4598  C  C     . GLN G 3 24  ? -34.516 -39.048 22.455 1.00 64.14  ? 24   GLN G C     1 
ATOM   4599  O  O     . GLN G 3 24  ? -35.244 -38.251 21.857 1.00 64.50  ? 24   GLN G O     1 
ATOM   4600  C  CB    . GLN G 3 24  ? -35.752 -40.798 23.754 1.00 64.90  ? 24   GLN G CB    1 
ATOM   4601  C  CG    . GLN G 3 24  ? -36.045 -42.283 24.032 1.00 65.29  ? 24   GLN G CG    1 
ATOM   4602  C  CD    . GLN G 3 24  ? -36.708 -42.996 22.862 1.00 65.55  ? 24   GLN G CD    1 
ATOM   4603  O  OE1   . GLN G 3 24  ? -37.728 -42.547 22.335 1.00 66.49  ? 24   GLN G OE1   1 
ATOM   4604  N  NE2   . GLN G 3 24  ? -36.128 -44.114 22.455 1.00 65.41  ? 24   GLN G NE2   1 
ATOM   4605  N  N     . PHE G 3 25  ? -33.381 -38.689 23.047 1.00 63.05  ? 25   PHE G N     1 
ATOM   4606  C  CA    . PHE G 3 25  ? -32.933 -37.298 23.105 1.00 61.94  ? 25   PHE G CA    1 
ATOM   4607  C  C     . PHE G 3 25  ? -32.374 -36.805 21.768 1.00 61.42  ? 25   PHE G C     1 
ATOM   4608  O  O     . PHE G 3 25  ? -31.626 -37.523 21.098 1.00 61.26  ? 25   PHE G O     1 
ATOM   4609  C  CB    . PHE G 3 25  ? -31.924 -37.109 24.247 1.00 61.82  ? 25   PHE G CB    1 
ATOM   4610  C  CG    . PHE G 3 25  ? -32.558 -36.716 25.558 1.00 60.51  ? 25   PHE G CG    1 
ATOM   4611  C  CD1   . PHE G 3 25  ? -33.574 -37.482 26.119 1.00 58.80  ? 25   PHE G CD1   1 
ATOM   4612  C  CD2   . PHE G 3 25  ? -32.140 -35.571 26.227 1.00 59.44  ? 25   PHE G CD2   1 
ATOM   4613  C  CE1   . PHE G 3 25  ? -34.159 -37.120 27.318 1.00 58.26  ? 25   PHE G CE1   1 
ATOM   4614  C  CE2   . PHE G 3 25  ? -32.726 -35.199 27.425 1.00 58.86  ? 25   PHE G CE2   1 
ATOM   4615  C  CZ    . PHE G 3 25  ? -33.735 -35.977 27.975 1.00 58.28  ? 25   PHE G CZ    1 
ATOM   4616  N  N     . PRO G 3 26  ? -32.736 -35.568 21.383 1.00 60.81  ? 26   PRO G N     1 
ATOM   4617  C  CA    . PRO G 3 26  ? -32.491 -35.076 20.028 1.00 60.13  ? 26   PRO G CA    1 
ATOM   4618  C  C     . PRO G 3 26  ? -31.039 -34.693 19.776 1.00 59.65  ? 26   PRO G C     1 
ATOM   4619  O  O     . PRO G 3 26  ? -30.577 -33.657 20.254 1.00 60.11  ? 26   PRO G O     1 
ATOM   4620  C  CB    . PRO G 3 26  ? -33.401 -33.849 19.940 1.00 59.91  ? 26   PRO G CB    1 
ATOM   4621  C  CG    . PRO G 3 26  ? -33.510 -33.361 21.330 1.00 60.18  ? 26   PRO G CG    1 
ATOM   4622  C  CD    . PRO G 3 26  ? -33.387 -34.552 22.233 1.00 60.76  ? 26   PRO G CD    1 
ATOM   4623  N  N     . VAL G 3 27  ? -30.336 -35.514 19.009 1.00 58.89  ? 27   VAL G N     1 
ATOM   4624  C  CA    . VAL G 3 27  ? -28.952 -35.227 18.650 1.00 58.25  ? 27   VAL G CA    1 
ATOM   4625  C  C     . VAL G 3 27  ? -28.839 -33.955 17.818 1.00 58.14  ? 27   VAL G C     1 
ATOM   4626  O  O     . VAL G 3 27  ? -27.974 -33.117 18.085 1.00 58.38  ? 27   VAL G O     1 
ATOM   4627  C  CB    . VAL G 3 27  ? -28.297 -36.418 17.927 1.00 58.14  ? 27   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G 3 27  ? -26.819 -36.164 17.684 1.00 57.48  ? 27   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G 3 27  ? -28.466 -37.668 18.761 1.00 58.00  ? 27   VAL G CG2   1 
ATOM   4630  N  N     . GLY G 3 28  ? -29.720 -33.804 16.830 1.00 57.87  ? 28   GLY G N     1 
ATOM   4631  C  CA    . GLY G 3 28  ? -29.738 -32.609 15.993 1.00 57.37  ? 28   GLY G CA    1 
ATOM   4632  C  C     . GLY G 3 28  ? -29.778 -31.354 16.844 1.00 57.25  ? 28   GLY G C     1 
ATOM   4633  O  O     . GLY G 3 28  ? -28.936 -30.468 16.698 1.00 57.43  ? 28   GLY G O     1 
ATOM   4634  N  N     . ARG G 3 29  ? -30.744 -31.299 17.757 1.00 56.82  ? 29   ARG G N     1 
ATOM   4635  C  CA    . ARG G 3 29  ? -30.919 -30.148 18.625 1.00 56.59  ? 29   ARG G CA    1 
ATOM   4636  C  C     . ARG G 3 29  ? -29.692 -29.896 19.501 1.00 56.40  ? 29   ARG G C     1 
ATOM   4637  O  O     . ARG G 3 29  ? -29.229 -28.756 19.603 1.00 56.14  ? 29   ARG G O     1 
ATOM   4638  C  CB    . ARG G 3 29  ? -32.179 -30.315 19.471 1.00 56.44  ? 29   ARG G CB    1 
ATOM   4639  C  CG    . ARG G 3 29  ? -32.470 -29.141 20.358 1.00 57.27  ? 29   ARG G CG    1 
ATOM   4640  C  CD    . ARG G 3 29  ? -33.749 -29.356 21.130 1.00 58.90  ? 29   ARG G CD    1 
ATOM   4641  N  NE    . ARG G 3 29  ? -34.925 -29.009 20.338 1.00 60.49  ? 29   ARG G NE    1 
ATOM   4642  C  CZ    . ARG G 3 29  ? -36.166 -28.962 20.811 1.00 61.84  ? 29   ARG G CZ    1 
ATOM   4643  N  NH1   . ARG G 3 29  ? -36.420 -29.252 22.084 1.00 63.51  ? 29   ARG G NH1   1 
ATOM   4644  N  NH2   . ARG G 3 29  ? -37.165 -28.630 20.007 1.00 62.67  ? 29   ARG G NH2   1 
ATOM   4645  N  N     . VAL G 3 30  ? -29.169 -30.965 20.109 1.00 56.12  ? 30   VAL G N     1 
ATOM   4646  C  CA    . VAL G 3 30  ? -27.991 -30.881 20.967 1.00 55.89  ? 30   VAL G CA    1 
ATOM   4647  C  C     . VAL G 3 30  ? -26.807 -30.353 20.171 1.00 56.31  ? 30   VAL G C     1 
ATOM   4648  O  O     . VAL G 3 30  ? -26.070 -29.505 20.666 1.00 56.64  ? 30   VAL G O     1 
ATOM   4649  C  CB    . VAL G 3 30  ? -27.659 -32.235 21.652 1.00 55.63  ? 30   VAL G CB    1 
ATOM   4650  C  CG1   . VAL G 3 30  ? -26.270 -32.225 22.292 1.00 55.08  ? 30   VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G 3 30  ? -28.693 -32.553 22.697 1.00 55.03  ? 30   VAL G CG2   1 
ATOM   4652  N  N     . HIS G 3 31  ? -26.654 -30.823 18.934 1.00 56.89  ? 31   HIS G N     1 
ATOM   4653  C  CA    . HIS G 3 31  ? -25.580 -30.357 18.047 1.00 57.62  ? 31   HIS G CA    1 
ATOM   4654  C  C     . HIS G 3 31  ? -25.719 -28.863 17.791 1.00 57.77  ? 31   HIS G C     1 
ATOM   4655  O  O     . HIS G 3 31  ? -24.755 -28.100 17.918 1.00 57.77  ? 31   HIS G O     1 
ATOM   4656  C  CB    . HIS G 3 31  ? -25.606 -31.118 16.713 1.00 57.63  ? 31   HIS G CB    1 
ATOM   4657  C  CG    . HIS G 3 31  ? -24.331 -31.029 15.929 1.00 58.37  ? 31   HIS G CG    1 
ATOM   4658  N  ND1   . HIS G 3 31  ? -23.510 -29.920 15.952 1.00 60.05  ? 31   HIS G ND1   1 
ATOM   4659  C  CD2   . HIS G 3 31  ? -23.752 -31.904 15.071 1.00 58.49  ? 31   HIS G CD2   1 
ATOM   4660  C  CE1   . HIS G 3 31  ? -22.472 -30.126 15.160 1.00 59.81  ? 31   HIS G CE1   1 
ATOM   4661  N  NE2   . HIS G 3 31  ? -22.597 -31.321 14.610 1.00 58.92  ? 31   HIS G NE2   1 
ATOM   4662  N  N     . ARG G 3 32  ? -26.935 -28.460 17.442 1.00 58.18  ? 32   ARG G N     1 
ATOM   4663  C  CA    . ARG G 3 32  ? -27.225 -27.081 17.109 1.00 58.92  ? 32   ARG G CA    1 
ATOM   4664  C  C     . ARG G 3 32  ? -26.879 -26.196 18.296 1.00 58.95  ? 32   ARG G C     1 
ATOM   4665  O  O     . ARG G 3 32  ? -26.141 -25.213 18.164 1.00 59.03  ? 32   ARG G O     1 
ATOM   4666  C  CB    . ARG G 3 32  ? -28.696 -26.934 16.737 1.00 59.03  ? 32   ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3 32  ? -29.048 -25.612 16.082 1.00 60.50  ? 32   ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3 32  ? -30.541 -25.393 16.164 1.00 63.10  ? 32   ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3 32  ? -30.945 -24.973 17.507 1.00 64.54  ? 32   ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3 32  ? -32.104 -25.285 18.087 1.00 65.60  ? 32   ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3 32  ? -33.000 -26.050 17.467 1.00 66.54  ? 32   ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3 32  ? -32.364 -24.844 19.308 1.00 65.78  ? 32   ARG G NH2   1 
ATOM   4673  N  N     . LEU G 3 33  ? -27.397 -26.578 19.459 1.00 58.93  ? 33   LEU G N     1 
ATOM   4674  C  CA    . LEU G 3 33  ? -27.200 -25.822 20.677 1.00 58.99  ? 33   LEU G CA    1 
ATOM   4675  C  C     . LEU G 3 33  ? -25.725 -25.688 21.043 1.00 59.45  ? 33   LEU G C     1 
ATOM   4676  O  O     . LEU G 3 33  ? -25.324 -24.684 21.628 1.00 59.59  ? 33   LEU G O     1 
ATOM   4677  C  CB    . LEU G 3 33  ? -27.994 -26.440 21.824 1.00 58.72  ? 33   LEU G CB    1 
ATOM   4678  C  CG    . LEU G 3 33  ? -29.521 -26.297 21.791 1.00 57.67  ? 33   LEU G CG    1 
ATOM   4679  C  CD1   . LEU G 3 33  ? -30.142 -27.031 22.962 1.00 56.76  ? 33   LEU G CD1   1 
ATOM   4680  C  CD2   . LEU G 3 33  ? -29.973 -24.844 21.783 1.00 57.08  ? 33   LEU G CD2   1 
ATOM   4681  N  N     . LEU G 3 34  ? -24.923 -26.686 20.684 1.00 59.78  ? 34   LEU G N     1 
ATOM   4682  C  CA    . LEU G 3 34  ? -23.481 -26.608 20.885 1.00 60.20  ? 34   LEU G CA    1 
ATOM   4683  C  C     . LEU G 3 34  ? -22.824 -25.568 19.974 1.00 60.83  ? 34   LEU G C     1 
ATOM   4684  O  O     . LEU G 3 34  ? -21.955 -24.822 20.420 1.00 61.41  ? 34   LEU G O     1 
ATOM   4685  C  CB    . LEU G 3 34  ? -22.822 -27.986 20.725 1.00 59.76  ? 34   LEU G CB    1 
ATOM   4686  C  CG    . LEU G 3 34  ? -22.988 -28.998 21.870 1.00 59.06  ? 34   LEU G CG    1 
ATOM   4687  C  CD1   . LEU G 3 34  ? -22.688 -30.424 21.400 1.00 57.12  ? 34   LEU G CD1   1 
ATOM   4688  C  CD2   . LEU G 3 34  ? -22.139 -28.651 23.100 1.00 58.11  ? 34   LEU G CD2   1 
ATOM   4689  N  N     . ARG G 3 35  ? -23.245 -25.507 18.713 1.00 61.53  ? 35   ARG G N     1 
ATOM   4690  C  CA    . ARG G 3 35  ? -22.699 -24.540 17.755 1.00 62.48  ? 35   ARG G CA    1 
ATOM   4691  C  C     . ARG G 3 35  ? -22.994 -23.104 18.158 1.00 62.59  ? 35   ARG G C     1 
ATOM   4692  O  O     . ARG G 3 35  ? -22.112 -22.237 18.157 1.00 62.90  ? 35   ARG G O     1 
ATOM   4693  C  CB    . ARG G 3 35  ? -23.295 -24.763 16.370 1.00 62.83  ? 35   ARG G CB    1 
ATOM   4694  C  CG    . ARG G 3 35  ? -23.036 -26.119 15.789 1.00 64.74  ? 35   ARG G CG    1 
ATOM   4695  C  CD    . ARG G 3 35  ? -23.097 -26.041 14.288 1.00 68.04  ? 35   ARG G CD    1 
ATOM   4696  N  NE    . ARG G 3 35  ? -22.517 -27.229 13.669 1.00 71.16  ? 35   ARG G NE    1 
ATOM   4697  C  CZ    . ARG G 3 35  ? -21.209 -27.470 13.568 1.00 72.94  ? 35   ARG G CZ    1 
ATOM   4698  N  NH1   . ARG G 3 35  ? -20.312 -26.611 14.059 1.00 73.90  ? 35   ARG G NH1   1 
ATOM   4699  N  NH2   . ARG G 3 35  ? -20.796 -28.583 12.976 1.00 73.62  ? 35   ARG G NH2   1 
ATOM   4700  N  N     . LYS G 3 36  ? -24.248 -22.860 18.505 1.00 62.69  ? 36   LYS G N     1 
ATOM   4701  C  CA    . LYS G 3 36  ? -24.707 -21.507 18.744 1.00 63.04  ? 36   LYS G CA    1 
ATOM   4702  C  C     . LYS G 3 36  ? -24.491 -21.108 20.201 1.00 62.82  ? 36   LYS G C     1 
ATOM   4703  O  O     . LYS G 3 36  ? -24.885 -20.013 20.618 1.00 63.43  ? 36   LYS G O     1 
ATOM   4704  C  CB    . LYS G 3 36  ? -26.164 -21.346 18.274 1.00 63.43  ? 36   LYS G CB    1 
ATOM   4705  C  CG    . LYS G 3 36  ? -26.408 -22.062 16.936 1.00 64.06  ? 36   LYS G CG    1 
ATOM   4706  C  CD    . LYS G 3 36  ? -27.383 -21.367 15.998 1.00 66.47  ? 36   LYS G CD    1 
ATOM   4707  C  CE    . LYS G 3 36  ? -27.360 -22.074 14.624 1.00 67.32  ? 36   LYS G CE    1 
ATOM   4708  N  NZ    . LYS G 3 36  ? -28.565 -21.830 13.772 1.00 68.15  ? 36   LYS G NZ    1 
ATOM   4709  N  N     . GLY G 3 37  ? -23.814 -21.978 20.950 1.00 62.20  ? 37   GLY G N     1 
ATOM   4710  C  CA    . GLY G 3 37  ? -23.520 -21.740 22.360 1.00 61.39  ? 37   GLY G CA    1 
ATOM   4711  C  C     . GLY G 3 37  ? -22.173 -21.092 22.630 1.00 60.98  ? 37   GLY G C     1 
ATOM   4712  O  O     . GLY G 3 37  ? -21.823 -20.838 23.788 1.00 60.89  ? 37   GLY G O     1 
ATOM   4713  N  N     . ASN G 3 38  ? -21.421 -20.815 21.564 1.00 60.44  ? 38   ASN G N     1 
ATOM   4714  C  CA    . ASN G 3 38  ? -20.083 -20.235 21.680 1.00 59.96  ? 38   ASN G CA    1 
ATOM   4715  C  C     . ASN G 3 38  ? -19.236 -21.047 22.643 1.00 59.51  ? 38   ASN G C     1 
ATOM   4716  O  O     . ASN G 3 38  ? -18.662 -20.516 23.606 1.00 59.85  ? 38   ASN G O     1 
ATOM   4717  C  CB    . ASN G 3 38  ? -20.132 -18.765 22.134 1.00 60.12  ? 38   ASN G CB    1 
ATOM   4718  C  CG    . ASN G 3 38  ? -20.827 -17.857 21.134 1.00 60.18  ? 38   ASN G CG    1 
ATOM   4719  O  OD1   . ASN G 3 38  ? -21.873 -17.280 21.434 1.00 61.53  ? 38   ASN G OD1   1 
ATOM   4720  N  ND2   . ASN G 3 38  ? -20.247 -17.716 19.950 1.00 59.29  ? 38   ASN G ND2   1 
ATOM   4721  N  N     . TYR G 3 39  ? -19.167 -22.344 22.387 1.00 58.82  ? 39   TYR G N     1 
ATOM   4722  C  CA    . TYR G 3 39  ? -18.362 -23.217 23.215 1.00 58.40  ? 39   TYR G CA    1 
ATOM   4723  C  C     . TYR G 3 39  ? -16.972 -23.440 22.609 1.00 58.91  ? 39   TYR G C     1 
ATOM   4724  O  O     . TYR G 3 39  ? -15.980 -23.513 23.340 1.00 58.86  ? 39   TYR G O     1 
ATOM   4725  C  CB    . TYR G 3 39  ? -19.107 -24.521 23.503 1.00 57.68  ? 39   TYR G CB    1 
ATOM   4726  C  CG    . TYR G 3 39  ? -20.349 -24.331 24.348 1.00 55.33  ? 39   TYR G CG    1 
ATOM   4727  C  CD1   . TYR G 3 39  ? -21.610 -24.597 23.834 1.00 53.89  ? 39   TYR G CD1   1 
ATOM   4728  C  CD2   . TYR G 3 39  ? -20.263 -23.867 25.656 1.00 53.94  ? 39   TYR G CD2   1 
ATOM   4729  C  CE1   . TYR G 3 39  ? -22.760 -24.423 24.606 1.00 52.05  ? 39   TYR G CE1   1 
ATOM   4730  C  CE2   . TYR G 3 39  ? -21.399 -23.687 26.432 1.00 52.67  ? 39   TYR G CE2   1 
ATOM   4731  C  CZ    . TYR G 3 39  ? -22.644 -23.971 25.901 1.00 52.02  ? 39   TYR G CZ    1 
ATOM   4732  O  OH    . TYR G 3 39  ? -23.774 -23.796 26.667 1.00 50.38  ? 39   TYR G OH    1 
ATOM   4733  N  N     . ALA G 3 40  ? -16.910 -23.521 21.277 1.00 59.54  ? 40   ALA G N     1 
ATOM   4734  C  CA    . ALA G 3 40  ? -15.643 -23.534 20.522 1.00 60.32  ? 40   ALA G CA    1 
ATOM   4735  C  C     . ALA G 3 40  ? -15.897 -23.147 19.069 1.00 60.84  ? 40   ALA G C     1 
ATOM   4736  O  O     . ALA G 3 40  ? -17.050 -23.095 18.639 1.00 60.93  ? 40   ALA G O     1 
ATOM   4737  C  CB    . ALA G 3 40  ? -14.980 -24.898 20.598 1.00 60.16  ? 40   ALA G CB    1 
ATOM   4738  N  N     . GLU G 3 41  ? -14.837 -22.865 18.314 1.00 61.60  ? 41   GLU G N     1 
ATOM   4739  C  CA    . GLU G 3 41  ? -14.998 -22.595 16.881 1.00 62.59  ? 41   GLU G CA    1 
ATOM   4740  C  C     . GLU G 3 41  ? -15.653 -23.786 16.170 1.00 62.47  ? 41   GLU G C     1 
ATOM   4741  O  O     . GLU G 3 41  ? -16.471 -23.602 15.273 1.00 62.81  ? 41   GLU G O     1 
ATOM   4742  C  CB    . GLU G 3 41  ? -13.665 -22.234 16.201 1.00 62.83  ? 41   GLU G CB    1 
ATOM   4743  C  CG    . GLU G 3 41  ? -13.089 -20.856 16.571 1.00 66.01  ? 41   GLU G CG    1 
ATOM   4744  C  CD    . GLU G 3 41  ? -13.992 -19.681 16.174 1.00 70.96  ? 41   GLU G CD    1 
ATOM   4745  O  OE1   . GLU G 3 41  ? -14.427 -19.613 14.993 1.00 72.47  ? 41   GLU G OE1   1 
ATOM   4746  O  OE2   . GLU G 3 41  ? -14.259 -18.814 17.049 1.00 73.16  ? 41   GLU G OE2   1 
ATOM   4747  N  N     . ARG G 3 42  ? -15.310 -25.002 16.590 1.00 62.28  ? 42   ARG G N     1 
ATOM   4748  C  CA    . ARG G 3 42  ? -15.756 -26.214 15.892 1.00 62.10  ? 42   ARG G CA    1 
ATOM   4749  C  C     . ARG G 3 42  ? -16.370 -27.263 16.808 1.00 61.33  ? 42   ARG G C     1 
ATOM   4750  O  O     . ARG G 3 42  ? -16.020 -27.358 17.982 1.00 61.69  ? 42   ARG G O     1 
ATOM   4751  C  CB    . ARG G 3 42  ? -14.592 -26.846 15.135 1.00 62.53  ? 42   ARG G CB    1 
ATOM   4752  C  CG    . ARG G 3 42  ? -13.974 -25.953 14.088 1.00 64.22  ? 42   ARG G CG    1 
ATOM   4753  C  CD    . ARG G 3 42  ? -12.987 -26.733 13.265 1.00 68.31  ? 42   ARG G CD    1 
ATOM   4754  N  NE    . ARG G 3 42  ? -12.649 -26.009 12.047 1.00 72.32  ? 42   ARG G NE    1 
ATOM   4755  C  CZ    . ARG G 3 42  ? -12.165 -26.573 10.946 1.00 73.81  ? 42   ARG G CZ    1 
ATOM   4756  N  NH1   . ARG G 3 42  ? -11.958 -27.887 10.901 1.00 74.31  ? 42   ARG G NH1   1 
ATOM   4757  N  NH2   . ARG G 3 42  ? -11.883 -25.814 9.894  1.00 74.64  ? 42   ARG G NH2   1 
ATOM   4758  N  N     . VAL G 3 43  ? -17.272 -28.064 16.255 1.00 60.17  ? 43   VAL G N     1 
ATOM   4759  C  CA    . VAL G 3 43  ? -17.951 -29.105 17.015 1.00 59.10  ? 43   VAL G CA    1 
ATOM   4760  C  C     . VAL G 3 43  ? -17.891 -30.443 16.295 1.00 58.48  ? 43   VAL G C     1 
ATOM   4761  O  O     . VAL G 3 43  ? -18.503 -30.616 15.242 1.00 58.24  ? 43   VAL G O     1 
ATOM   4762  C  CB    . VAL G 3 43  ? -19.429 -28.766 17.256 1.00 59.33  ? 43   VAL G CB    1 
ATOM   4763  C  CG1   . VAL G 3 43  ? -20.068 -29.801 18.196 1.00 59.28  ? 43   VAL G CG1   1 
ATOM   4764  C  CG2   . VAL G 3 43  ? -19.590 -27.344 17.808 1.00 59.19  ? 43   VAL G CG2   1 
ATOM   4765  N  N     . GLY G 3 44  ? -17.162 -31.387 16.882 1.00 57.94  ? 44   GLY G N     1 
ATOM   4766  C  CA    . GLY G 3 44  ? -17.018 -32.739 16.337 1.00 57.24  ? 44   GLY G CA    1 
ATOM   4767  C  C     . GLY G 3 44  ? -18.334 -33.485 16.202 1.00 56.89  ? 44   GLY G C     1 
ATOM   4768  O  O     . GLY G 3 44  ? -19.283 -33.223 16.940 1.00 56.80  ? 44   GLY G O     1 
ATOM   4769  N  N     . ALA G 3 45  ? -18.379 -34.422 15.259 1.00 56.47  ? 45   ALA G N     1 
ATOM   4770  C  CA    . ALA G 3 45  ? -19.601 -35.148 14.919 1.00 56.07  ? 45   ALA G CA    1 
ATOM   4771  C  C     . ALA G 3 45  ? -20.154 -35.994 16.060 1.00 55.72  ? 45   ALA G C     1 
ATOM   4772  O  O     . ALA G 3 45  ? -21.369 -36.067 16.249 1.00 55.86  ? 45   ALA G O     1 
ATOM   4773  C  CB    . ALA G 3 45  ? -19.378 -36.016 13.688 1.00 56.15  ? 45   ALA G CB    1 
ATOM   4774  N  N     . GLY G 3 46  ? -19.266 -36.635 16.810 1.00 55.15  ? 46   GLY G N     1 
ATOM   4775  C  CA    . GLY G 3 46  ? -19.677 -37.519 17.902 1.00 54.60  ? 46   GLY G CA    1 
ATOM   4776  C  C     . GLY G 3 46  ? -20.066 -36.811 19.192 1.00 54.59  ? 46   GLY G C     1 
ATOM   4777  O  O     . GLY G 3 46  ? -20.862 -37.340 19.975 1.00 54.79  ? 46   GLY G O     1 
ATOM   4778  N  N     . ALA G 3 47  ? -19.513 -35.618 19.423 1.00 53.66  ? 47   ALA G N     1 
ATOM   4779  C  CA    . ALA G 3 47  ? -19.771 -34.886 20.657 1.00 52.71  ? 47   ALA G CA    1 
ATOM   4780  C  C     . ALA G 3 47  ? -21.255 -34.656 20.986 1.00 52.02  ? 47   ALA G C     1 
ATOM   4781  O  O     . ALA G 3 47  ? -21.652 -34.863 22.123 1.00 51.84  ? 47   ALA G O     1 
ATOM   4782  C  CB    . ALA G 3 47  ? -18.974 -33.562 20.700 1.00 52.87  ? 47   ALA G CB    1 
ATOM   4783  N  N     . PRO G 3 48  ? -22.081 -34.223 20.011 1.00 51.54  ? 48   PRO G N     1 
ATOM   4784  C  CA    . PRO G 3 48  ? -23.494 -34.075 20.377 1.00 51.07  ? 48   PRO G CA    1 
ATOM   4785  C  C     . PRO G 3 48  ? -24.152 -35.409 20.647 1.00 50.81  ? 48   PRO G C     1 
ATOM   4786  O  O     . PRO G 3 48  ? -25.102 -35.472 21.424 1.00 50.46  ? 48   PRO G O     1 
ATOM   4787  C  CB    . PRO G 3 48  ? -24.125 -33.433 19.141 1.00 50.71  ? 48   PRO G CB    1 
ATOM   4788  C  CG    . PRO G 3 48  ? -23.196 -33.701 18.049 1.00 51.22  ? 48   PRO G CG    1 
ATOM   4789  C  CD    . PRO G 3 48  ? -21.830 -33.721 18.650 1.00 51.82  ? 48   PRO G CD    1 
ATOM   4790  N  N     . VAL G 3 49  ? -23.647 -36.462 20.001 1.00 50.75  ? 49   VAL G N     1 
ATOM   4791  C  CA    . VAL G 3 49  ? -24.173 -37.809 20.197 1.00 50.68  ? 49   VAL G CA    1 
ATOM   4792  C  C     . VAL G 3 49  ? -23.902 -38.192 21.645 1.00 50.49  ? 49   VAL G C     1 
ATOM   4793  O  O     . VAL G 3 49  ? -24.821 -38.517 22.410 1.00 50.84  ? 49   VAL G O     1 
ATOM   4794  C  CB    . VAL G 3 49  ? -23.535 -38.859 19.222 1.00 50.94  ? 49   VAL G CB    1 
ATOM   4795  C  CG1   . VAL G 3 49  ? -23.972 -40.268 19.587 1.00 51.29  ? 49   VAL G CG1   1 
ATOM   4796  C  CG2   . VAL G 3 49  ? -23.897 -38.569 17.771 1.00 50.34  ? 49   VAL G CG2   1 
ATOM   4797  N  N     . TYR G 3 50  ? -22.635 -38.123 22.022 1.00 49.83  ? 50   TYR G N     1 
ATOM   4798  C  CA    . TYR G 3 50  ? -22.227 -38.395 23.395 1.00 49.50  ? 50   TYR G CA    1 
ATOM   4799  C  C     . TYR G 3 50  ? -23.051 -37.594 24.408 1.00 49.19  ? 50   TYR G C     1 
ATOM   4800  O  O     . TYR G 3 50  ? -23.610 -38.160 25.356 1.00 49.45  ? 50   TYR G O     1 
ATOM   4801  C  CB    . TYR G 3 50  ? -20.754 -38.047 23.550 1.00 49.48  ? 50   TYR G CB    1 
ATOM   4802  C  CG    . TYR G 3 50  ? -20.025 -38.782 24.645 1.00 49.66  ? 50   TYR G CG    1 
ATOM   4803  C  CD1   . TYR G 3 50  ? -18.961 -39.630 24.336 1.00 48.99  ? 50   TYR G CD1   1 
ATOM   4804  C  CD2   . TYR G 3 50  ? -20.360 -38.601 25.991 1.00 49.94  ? 50   TYR G CD2   1 
ATOM   4805  C  CE1   . TYR G 3 50  ? -18.263 -40.292 25.321 1.00 48.68  ? 50   TYR G CE1   1 
ATOM   4806  C  CE2   . TYR G 3 50  ? -19.654 -39.263 26.996 1.00 49.98  ? 50   TYR G CE2   1 
ATOM   4807  C  CZ    . TYR G 3 50  ? -18.612 -40.113 26.642 1.00 50.39  ? 50   TYR G CZ    1 
ATOM   4808  O  OH    . TYR G 3 50  ? -17.899 -40.781 27.611 1.00 52.86  ? 50   TYR G OH    1 
ATOM   4809  N  N     . LEU G 3 51  ? -23.136 -36.283 24.201 1.00 48.41  ? 51   LEU G N     1 
ATOM   4810  C  CA    . LEU G 3 51  ? -23.781 -35.421 25.168 1.00 48.01  ? 51   LEU G CA    1 
ATOM   4811  C  C     . LEU G 3 51  ? -25.262 -35.712 25.292 1.00 47.94  ? 51   LEU G C     1 
ATOM   4812  O  O     . LEU G 3 51  ? -25.804 -35.694 26.396 1.00 48.37  ? 51   LEU G O     1 
ATOM   4813  C  CB    . LEU G 3 51  ? -23.550 -33.939 24.855 1.00 48.01  ? 51   LEU G CB    1 
ATOM   4814  C  CG    . LEU G 3 51  ? -24.310 -32.950 25.746 1.00 47.25  ? 51   LEU G CG    1 
ATOM   4815  C  CD1   . LEU G 3 51  ? -24.033 -33.146 27.244 1.00 46.59  ? 51   LEU G CD1   1 
ATOM   4816  C  CD2   . LEU G 3 51  ? -24.000 -31.537 25.322 1.00 47.29  ? 51   LEU G CD2   1 
ATOM   4817  N  N     . ALA G 3 52  ? -25.921 -35.986 24.174 1.00 47.59  ? 52   ALA G N     1 
ATOM   4818  C  CA    . ALA G 3 52  ? -27.339 -36.305 24.235 1.00 47.21  ? 52   ALA G CA    1 
ATOM   4819  C  C     . ALA G 3 52  ? -27.547 -37.569 25.065 1.00 47.08  ? 52   ALA G C     1 
ATOM   4820  O  O     . ALA G 3 52  ? -28.458 -37.638 25.882 1.00 46.78  ? 52   ALA G O     1 
ATOM   4821  C  CB    . ALA G 3 52  ? -27.906 -36.458 22.853 1.00 47.46  ? 52   ALA G CB    1 
ATOM   4822  N  N     . ALA G 3 53  ? -26.671 -38.553 24.876 1.00 47.17  ? 53   ALA G N     1 
ATOM   4823  C  CA    . ALA G 3 53  ? -26.730 -39.808 25.633 1.00 46.97  ? 53   ALA G CA    1 
ATOM   4824  C  C     . ALA G 3 53  ? -26.612 -39.569 27.128 1.00 46.93  ? 53   ALA G C     1 
ATOM   4825  O  O     . ALA G 3 53  ? -27.396 -40.113 27.916 1.00 47.25  ? 53   ALA G O     1 
ATOM   4826  C  CB    . ALA G 3 53  ? -25.637 -40.760 25.176 1.00 46.94  ? 53   ALA G CB    1 
ATOM   4827  N  N     . VAL G 3 54  ? -25.629 -38.754 27.513 1.00 46.64  ? 54   VAL G N     1 
ATOM   4828  C  CA    . VAL G 3 54  ? -25.414 -38.406 28.923 1.00 46.06  ? 54   VAL G CA    1 
ATOM   4829  C  C     . VAL G 3 54  ? -26.643 -37.714 29.520 1.00 45.70  ? 54   VAL G C     1 
ATOM   4830  O  O     . VAL G 3 54  ? -27.055 -38.019 30.635 1.00 45.77  ? 54   VAL G O     1 
ATOM   4831  C  CB    . VAL G 3 54  ? -24.151 -37.537 29.101 1.00 46.02  ? 54   VAL G CB    1 
ATOM   4832  C  CG1   . VAL G 3 54  ? -24.036 -37.021 30.530 1.00 46.12  ? 54   VAL G CG1   1 
ATOM   4833  C  CG2   . VAL G 3 54  ? -22.905 -38.326 28.706 1.00 45.46  ? 54   VAL G CG2   1 
ATOM   4834  N  N     . LEU G 3 55  ? -27.246 -36.808 28.764 1.00 45.39  ? 55   LEU G N     1 
ATOM   4835  C  CA    . LEU G 3 55  ? -28.417 -36.098 29.247 1.00 45.41  ? 55   LEU G CA    1 
ATOM   4836  C  C     . LEU G 3 55  ? -29.595 -37.032 29.441 1.00 45.84  ? 55   LEU G C     1 
ATOM   4837  O  O     . LEU G 3 55  ? -30.279 -36.978 30.466 1.00 45.69  ? 55   LEU G O     1 
ATOM   4838  C  CB    . LEU G 3 55  ? -28.776 -34.945 28.310 1.00 45.00  ? 55   LEU G CB    1 
ATOM   4839  C  CG    . LEU G 3 55  ? -27.774 -33.788 28.292 1.00 44.16  ? 55   LEU G CG    1 
ATOM   4840  C  CD1   . LEU G 3 55  ? -28.093 -32.818 27.172 1.00 42.98  ? 55   LEU G CD1   1 
ATOM   4841  C  CD2   . LEU G 3 55  ? -27.765 -33.078 29.633 1.00 43.71  ? 55   LEU G CD2   1 
ATOM   4842  N  N     . GLU G 3 56  ? -29.819 -37.899 28.455 1.00 46.77  ? 56   GLU G N     1 
ATOM   4843  C  CA    . GLU G 3 56  ? -30.910 -38.869 28.499 1.00 47.00  ? 56   GLU G CA    1 
ATOM   4844  C  C     . GLU G 3 56  ? -30.716 -39.791 29.687 1.00 46.82  ? 56   GLU G C     1 
ATOM   4845  O  O     . GLU G 3 56  ? -31.635 -40.011 30.484 1.00 46.64  ? 56   GLU G O     1 
ATOM   4846  C  CB    . GLU G 3 56  ? -30.942 -39.669 27.202 1.00 47.63  ? 56   GLU G CB    1 
ATOM   4847  C  CG    . GLU G 3 56  ? -32.159 -40.575 27.036 1.00 49.21  ? 56   GLU G CG    1 
ATOM   4848  C  CD    . GLU G 3 56  ? -32.199 -41.267 25.679 1.00 52.05  ? 56   GLU G CD    1 
ATOM   4849  O  OE1   . GLU G 3 56  ? -31.884 -40.637 24.639 1.00 52.85  ? 56   GLU G OE1   1 
ATOM   4850  O  OE2   . GLU G 3 56  ? -32.557 -42.458 25.658 1.00 55.03  ? 56   GLU G OE2   1 
ATOM   4851  N  N     . TYR G 3 57  ? -29.504 -40.309 29.824 1.00 46.80  ? 57   TYR G N     1 
ATOM   4852  C  CA    . TYR G 3 57  ? -29.204 -41.182 30.955 1.00 47.32  ? 57   TYR G CA    1 
ATOM   4853  C  C     . TYR G 3 57  ? -29.590 -40.583 32.321 1.00 47.62  ? 57   TYR G C     1 
ATOM   4854  O  O     . TYR G 3 57  ? -30.264 -41.248 33.112 1.00 47.95  ? 57   TYR G O     1 
ATOM   4855  C  CB    . TYR G 3 57  ? -27.734 -41.618 30.954 1.00 47.14  ? 57   TYR G CB    1 
ATOM   4856  C  CG    . TYR G 3 57  ? -27.297 -42.144 32.296 1.00 47.88  ? 57   TYR G CG    1 
ATOM   4857  C  CD1   . TYR G 3 57  ? -27.813 -43.348 32.810 1.00 48.09  ? 57   TYR G CD1   1 
ATOM   4858  C  CD2   . TYR G 3 57  ? -26.389 -41.429 33.075 1.00 48.22  ? 57   TYR G CD2   1 
ATOM   4859  C  CE1   . TYR G 3 57  ? -27.426 -43.814 34.055 1.00 46.80  ? 57   TYR G CE1   1 
ATOM   4860  C  CE2   . TYR G 3 57  ? -25.996 -41.893 34.309 1.00 47.13  ? 57   TYR G CE2   1 
ATOM   4861  C  CZ    . TYR G 3 57  ? -26.520 -43.072 34.792 1.00 47.26  ? 57   TYR G CZ    1 
ATOM   4862  O  OH    . TYR G 3 57  ? -26.109 -43.493 36.021 1.00 49.07  ? 57   TYR G OH    1 
ATOM   4863  N  N     . LEU G 3 58  ? -29.164 -39.345 32.595 1.00 47.49  ? 58   LEU G N     1 
ATOM   4864  C  CA    . LEU G 3 58  ? -29.418 -38.729 33.900 1.00 47.54  ? 58   LEU G CA    1 
ATOM   4865  C  C     . LEU G 3 58  ? -30.899 -38.485 34.081 1.00 47.88  ? 58   LEU G C     1 
ATOM   4866  O  O     . LEU G 3 58  ? -31.437 -38.666 35.174 1.00 47.65  ? 58   LEU G O     1 
ATOM   4867  C  CB    . LEU G 3 58  ? -28.619 -37.431 34.097 1.00 47.26  ? 58   LEU G CB    1 
ATOM   4868  C  CG    . LEU G 3 58  ? -27.088 -37.561 34.119 1.00 47.03  ? 58   LEU G CG    1 
ATOM   4869  C  CD1   . LEU G 3 58  ? -26.409 -36.276 33.711 1.00 46.53  ? 58   LEU G CD1   1 
ATOM   4870  C  CD2   . LEU G 3 58  ? -26.565 -38.040 35.471 1.00 46.13  ? 58   LEU G CD2   1 
ATOM   4871  N  N     . THR G 3 59  ? -31.562 -38.091 33.000 1.00 48.44  ? 59   THR G N     1 
ATOM   4872  C  CA    . THR G 3 59  ? -33.016 -37.955 33.010 1.00 49.03  ? 59   THR G CA    1 
ATOM   4873  C  C     . THR G 3 59  ? -33.686 -39.269 33.438 1.00 49.45  ? 59   THR G C     1 
ATOM   4874  O  O     . THR G 3 59  ? -34.590 -39.276 34.282 1.00 49.36  ? 59   THR G O     1 
ATOM   4875  C  CB    . THR G 3 59  ? -33.538 -37.553 31.632 1.00 49.11  ? 59   THR G CB    1 
ATOM   4876  O  OG1   . THR G 3 59  ? -32.742 -36.469 31.126 1.00 49.31  ? 59   THR G OG1   1 
ATOM   4877  C  CG2   . THR G 3 59  ? -35.004 -37.145 31.711 1.00 48.67  ? 59   THR G CG2   1 
ATOM   4878  N  N     . ALA G 3 60  ? -33.240 -40.378 32.859 1.00 49.80  ? 60   ALA G N     1 
ATOM   4879  C  CA    . ALA G 3 60  ? -33.792 -41.686 33.221 1.00 50.28  ? 60   ALA G CA    1 
ATOM   4880  C  C     . ALA G 3 60  ? -33.535 -41.996 34.694 1.00 50.39  ? 60   ALA G C     1 
ATOM   4881  O  O     . ALA G 3 60  ? -34.423 -42.476 35.406 1.00 50.60  ? 60   ALA G O     1 
ATOM   4882  C  CB    . ALA G 3 60  ? -33.218 -42.798 32.327 1.00 50.26  ? 60   ALA G CB    1 
ATOM   4883  N  N     . GLU G 3 61  ? -32.320 -41.713 35.151 1.00 50.45  ? 61   GLU G N     1 
ATOM   4884  C  CA    . GLU G 3 61  ? -31.960 -41.972 36.544 1.00 50.37  ? 61   GLU G CA    1 
ATOM   4885  C  C     . GLU G 3 61  ? -32.895 -41.257 37.518 1.00 49.83  ? 61   GLU G C     1 
ATOM   4886  O  O     . GLU G 3 61  ? -33.402 -41.874 38.442 1.00 50.36  ? 61   GLU G O     1 
ATOM   4887  C  CB    . GLU G 3 61  ? -30.498 -41.610 36.796 1.00 50.51  ? 61   GLU G CB    1 
ATOM   4888  C  CG    . GLU G 3 61  ? -30.021 -41.838 38.214 1.00 52.65  ? 61   GLU G CG    1 
ATOM   4889  C  CD    . GLU G 3 61  ? -29.644 -43.292 38.535 1.00 56.17  ? 61   GLU G CD    1 
ATOM   4890  O  OE1   . GLU G 3 61  ? -29.854 -44.206 37.700 1.00 55.71  ? 61   GLU G OE1   1 
ATOM   4891  O  OE2   . GLU G 3 61  ? -29.114 -43.505 39.653 1.00 58.62  ? 61   GLU G OE2   1 
ATOM   4892  N  N     . ILE G 3 62  ? -33.140 -39.969 37.296 1.00 49.46  ? 62   ILE G N     1 
ATOM   4893  C  CA    . ILE G 3 62  ? -34.045 -39.192 38.147 1.00 48.74  ? 62   ILE G CA    1 
ATOM   4894  C  C     . ILE G 3 62  ? -35.477 -39.674 38.014 1.00 48.66  ? 62   ILE G C     1 
ATOM   4895  O  O     . ILE G 3 62  ? -36.160 -39.843 39.015 1.00 48.54  ? 62   ILE G O     1 
ATOM   4896  C  CB    . ILE G 3 62  ? -34.003 -37.668 37.840 1.00 48.70  ? 62   ILE G CB    1 
ATOM   4897  C  CG1   . ILE G 3 62  ? -32.614 -37.096 38.120 1.00 49.24  ? 62   ILE G CG1   1 
ATOM   4898  C  CG2   . ILE G 3 62  ? -35.028 -36.928 38.673 1.00 47.83  ? 62   ILE G CG2   1 
ATOM   4899  C  CD1   . ILE G 3 62  ? -32.585 -35.592 38.251 1.00 48.49  ? 62   ILE G CD1   1 
ATOM   4900  N  N     . LEU G 3 63  ? -35.944 -39.877 36.784 1.00 49.01  ? 63   LEU G N     1 
ATOM   4901  C  CA    . LEU G 3 63  ? -37.322 -40.333 36.573 1.00 49.32  ? 63   LEU G CA    1 
ATOM   4902  C  C     . LEU G 3 63  ? -37.564 -41.713 37.194 1.00 49.88  ? 63   LEU G C     1 
ATOM   4903  O  O     . LEU G 3 63  ? -38.588 -41.926 37.849 1.00 49.37  ? 63   LEU G O     1 
ATOM   4904  C  CB    . LEU G 3 63  ? -37.699 -40.306 35.095 1.00 49.15  ? 63   LEU G CB    1 
ATOM   4905  C  CG    . LEU G 3 63  ? -37.833 -38.924 34.449 1.00 48.81  ? 63   LEU G CG    1 
ATOM   4906  C  CD1   . LEU G 3 63  ? -38.194 -39.111 33.019 1.00 49.00  ? 63   LEU G CD1   1 
ATOM   4907  C  CD2   . LEU G 3 63  ? -38.857 -38.016 35.134 1.00 47.81  ? 63   LEU G CD2   1 
ATOM   4908  N  N     . GLU G 3 64  ? -36.599 -42.620 37.034 1.00 50.73  ? 64   GLU G N     1 
ATOM   4909  C  CA    . GLU G 3 64  ? -36.607 -43.888 37.763 1.00 52.34  ? 64   GLU G CA    1 
ATOM   4910  C  C     . GLU G 3 64  ? -36.947 -43.662 39.225 1.00 52.77  ? 64   GLU G C     1 
ATOM   4911  O  O     . GLU G 3 64  ? -37.970 -44.148 39.713 1.00 53.38  ? 64   GLU G O     1 
ATOM   4912  C  CB    . GLU G 3 64  ? -35.247 -44.582 37.656 1.00 52.90  ? 64   GLU G CB    1 
ATOM   4913  C  CG    . GLU G 3 64  ? -35.105 -45.876 38.473 1.00 55.93  ? 64   GLU G CG    1 
ATOM   4914  C  CD    . GLU G 3 64  ? -35.988 -47.014 37.963 1.00 60.79  ? 64   GLU G CD    1 
ATOM   4915  O  OE1   . GLU G 3 64  ? -36.192 -47.109 36.730 1.00 62.69  ? 64   GLU G OE1   1 
ATOM   4916  O  OE2   . GLU G 3 64  ? -36.474 -47.820 38.795 1.00 62.49  ? 64   GLU G OE2   1 
ATOM   4917  N  N     . LEU G 3 65  ? -36.100 -42.897 39.914 1.00 53.13  ? 65   LEU G N     1 
ATOM   4918  C  CA    . LEU G 3 65  ? -36.209 -42.738 41.363 1.00 52.99  ? 65   LEU G CA    1 
ATOM   4919  C  C     . LEU G 3 65  ? -37.425 -41.916 41.775 1.00 53.19  ? 65   LEU G C     1 
ATOM   4920  O  O     . LEU G 3 65  ? -38.014 -42.162 42.826 1.00 53.15  ? 65   LEU G O     1 
ATOM   4921  C  CB    . LEU G 3 65  ? -34.915 -42.151 41.938 1.00 52.99  ? 65   LEU G CB    1 
ATOM   4922  C  CG    . LEU G 3 65  ? -33.631 -42.976 41.723 1.00 53.16  ? 65   LEU G CG    1 
ATOM   4923  C  CD1   . LEU G 3 65  ? -32.379 -42.181 42.093 1.00 53.84  ? 65   LEU G CD1   1 
ATOM   4924  C  CD2   . LEU G 3 65  ? -33.651 -44.304 42.480 1.00 50.98  ? 65   LEU G CD2   1 
ATOM   4925  N  N     . ALA G 3 66  ? -37.801 -40.945 40.945 1.00 53.26  ? 66   ALA G N     1 
ATOM   4926  C  CA    . ALA G 3 66  ? -38.952 -40.097 41.238 1.00 53.59  ? 66   ALA G CA    1 
ATOM   4927  C  C     . ALA G 3 66  ? -40.241 -40.886 41.055 1.00 54.15  ? 66   ALA G C     1 
ATOM   4928  O  O     . ALA G 3 66  ? -41.191 -40.730 41.828 1.00 54.49  ? 66   ALA G O     1 
ATOM   4929  C  CB    . ALA G 3 66  ? -38.946 -38.858 40.355 1.00 53.10  ? 66   ALA G CB    1 
ATOM   4930  N  N     . GLY G 3 67  ? -40.267 -41.726 40.022 1.00 54.55  ? 67   GLY G N     1 
ATOM   4931  C  CA    . GLY G 3 67  ? -41.368 -42.652 39.803 1.00 54.94  ? 67   GLY G CA    1 
ATOM   4932  C  C     . GLY G 3 67  ? -41.605 -43.499 41.035 1.00 55.12  ? 67   GLY G C     1 
ATOM   4933  O  O     . GLY G 3 67  ? -42.740 -43.610 41.509 1.00 55.02  ? 67   GLY G O     1 
ATOM   4934  N  N     . ASN G 3 68  ? -40.529 -44.085 41.558 1.00 55.43  ? 68   ASN G N     1 
ATOM   4935  C  CA    . ASN G 3 68  ? -40.611 -44.896 42.780 1.00 56.12  ? 68   ASN G CA    1 
ATOM   4936  C  C     . ASN G 3 68  ? -41.211 -44.120 43.955 1.00 56.53  ? 68   ASN G C     1 
ATOM   4937  O  O     . ASN G 3 68  ? -42.083 -44.634 44.657 1.00 56.72  ? 68   ASN G O     1 
ATOM   4938  C  CB    . ASN G 3 68  ? -39.235 -45.462 43.171 1.00 55.94  ? 68   ASN G CB    1 
ATOM   4939  C  CG    . ASN G 3 68  ? -38.691 -46.454 42.156 1.00 56.28  ? 68   ASN G CG    1 
ATOM   4940  O  OD1   . ASN G 3 68  ? -39.433 -46.997 41.325 1.00 57.12  ? 68   ASN G OD1   1 
ATOM   4941  N  ND2   . ASN G 3 68  ? -37.383 -46.699 42.219 1.00 55.77  ? 68   ASN G ND2   1 
ATOM   4942  N  N     . ALA G 3 69  ? -40.753 -42.884 44.149 1.00 56.95  ? 69   ALA G N     1 
ATOM   4943  C  CA    . ALA G 3 69  ? -41.253 -42.026 45.225 1.00 57.84  ? 69   ALA G CA    1 
ATOM   4944  C  C     . ALA G 3 69  ? -42.735 -41.725 45.073 1.00 58.59  ? 69   ALA G C     1 
ATOM   4945  O  O     . ALA G 3 69  ? -43.446 -41.612 46.068 1.00 58.68  ? 69   ALA G O     1 
ATOM   4946  C  CB    . ALA G 3 69  ? -40.453 -40.738 45.305 1.00 57.62  ? 69   ALA G CB    1 
ATOM   4947  N  N     . ALA G 3 70  ? -43.195 -41.598 43.831 1.00 59.82  ? 70   ALA G N     1 
ATOM   4948  C  CA    . ALA G 3 70  ? -44.627 -41.527 43.545 1.00 61.34  ? 70   ALA G CA    1 
ATOM   4949  C  C     . ALA G 3 70  ? -45.330 -42.803 43.998 1.00 62.45  ? 70   ALA G C     1 
ATOM   4950  O  O     . ALA G 3 70  ? -46.323 -42.740 44.724 1.00 62.64  ? 70   ALA G O     1 
ATOM   4951  C  CB    . ALA G 3 70  ? -44.875 -41.278 42.068 1.00 61.14  ? 70   ALA G CB    1 
ATOM   4952  N  N     . ARG G 3 71  ? -44.794 -43.954 43.588 1.00 63.99  ? 71   ARG G N     1 
ATOM   4953  C  CA    . ARG G 3 71  ? -45.354 -45.263 43.943 1.00 65.76  ? 71   ARG G CA    1 
ATOM   4954  C  C     . ARG G 3 71  ? -45.474 -45.430 45.460 1.00 66.47  ? 71   ARG G C     1 
ATOM   4955  O  O     . ARG G 3 71  ? -46.517 -45.857 45.958 1.00 66.88  ? 71   ARG G O     1 
ATOM   4956  C  CB    . ARG G 3 71  ? -44.513 -46.397 43.342 1.00 66.07  ? 71   ARG G CB    1 
ATOM   4957  C  CG    . ARG G 3 71  ? -45.183 -47.765 43.328 1.00 67.91  ? 71   ARG G CG    1 
ATOM   4958  C  CD    . ARG G 3 71  ? -44.156 -48.897 43.471 1.00 71.43  ? 71   ARG G CD    1 
ATOM   4959  N  NE    . ARG G 3 71  ? -44.809 -50.189 43.763 1.00 74.58  ? 71   ARG G NE    1 
ATOM   4960  C  CZ    . ARG G 3 71  ? -44.183 -51.303 44.185 1.00 76.00  ? 71   ARG G CZ    1 
ATOM   4961  N  NH1   . ARG G 3 71  ? -42.867 -51.312 44.385 1.00 76.42  ? 71   ARG G NH1   1 
ATOM   4962  N  NH2   . ARG G 3 71  ? -44.879 -52.419 44.421 1.00 76.61  ? 71   ARG G NH2   1 
ATOM   4963  N  N     . ASP G 3 72  ? -44.420 -45.068 46.191 1.00 67.29  ? 72   ASP G N     1 
ATOM   4964  C  CA    . ASP G 3 72  ? -44.413 -45.202 47.649 1.00 68.02  ? 72   ASP G CA    1 
ATOM   4965  C  C     . ASP G 3 72  ? -45.480 -44.342 48.296 1.00 68.34  ? 72   ASP G C     1 
ATOM   4966  O  O     . ASP G 3 72  ? -45.981 -44.673 49.364 1.00 68.58  ? 72   ASP G O     1 
ATOM   4967  C  CB    . ASP G 3 72  ? -43.045 -44.836 48.233 1.00 68.11  ? 72   ASP G CB    1 
ATOM   4968  C  CG    . ASP G 3 72  ? -41.901 -45.593 47.573 1.00 69.51  ? 72   ASP G CG    1 
ATOM   4969  O  OD1   . ASP G 3 72  ? -41.956 -46.842 47.491 1.00 70.52  ? 72   ASP G OD1   1 
ATOM   4970  O  OD2   . ASP G 3 72  ? -40.932 -44.935 47.135 1.00 71.30  ? 72   ASP G OD2   1 
ATOM   4971  N  N     . ASN G 3 73  ? -45.829 -43.235 47.650 1.00 68.78  ? 73   ASN G N     1 
ATOM   4972  C  CA    . ASN G 3 73  ? -46.787 -42.302 48.233 1.00 69.26  ? 73   ASN G CA    1 
ATOM   4973  C  C     . ASN G 3 73  ? -48.212 -42.461 47.676 1.00 69.11  ? 73   ASN G C     1 
ATOM   4974  O  O     . ASN G 3 73  ? -49.056 -41.572 47.838 1.00 69.25  ? 73   ASN G O     1 
ATOM   4975  C  CB    . ASN G 3 73  ? -46.270 -40.859 48.121 1.00 69.59  ? 73   ASN G CB    1 
ATOM   4976  C  CG    . ASN G 3 73  ? -45.042 -40.600 49.015 1.00 71.15  ? 73   ASN G CG    1 
ATOM   4977  O  OD1   . ASN G 3 73  ? -45.156 -39.977 50.079 1.00 72.95  ? 73   ASN G OD1   1 
ATOM   4978  N  ND2   . ASN G 3 73  ? -43.871 -41.082 48.589 1.00 71.07  ? 73   ASN G ND2   1 
ATOM   4979  N  N     . LYS G 3 74  ? -48.461 -43.613 47.043 1.00 68.59  ? 74   LYS G N     1 
ATOM   4980  C  CA    . LYS G 3 74  ? -49.786 -44.018 46.540 1.00 68.38  ? 74   LYS G CA    1 
ATOM   4981  C  C     . LYS G 3 74  ? -50.273 -43.175 45.363 1.00 67.76  ? 74   LYS G C     1 
ATOM   4982  O  O     . LYS G 3 74  ? -51.458 -42.829 45.288 1.00 67.64  ? 74   LYS G O     1 
ATOM   4983  C  CB    . LYS G 3 74  ? -50.859 -44.005 47.651 1.00 68.79  ? 74   LYS G CB    1 
ATOM   4984  C  CG    . LYS G 3 74  ? -50.525 -44.761 48.940 1.00 69.99  ? 74   LYS G CG    1 
ATOM   4985  C  CD    . LYS G 3 74  ? -50.682 -46.276 48.800 1.00 71.20  ? 74   LYS G CD    1 
ATOM   4986  C  CE    . LYS G 3 74  ? -50.416 -46.956 50.150 1.00 72.07  ? 74   LYS G CE    1 
ATOM   4987  N  NZ    . LYS G 3 74  ? -49.689 -48.251 49.992 1.00 71.47  ? 74   LYS G NZ    1 
ATOM   4988  N  N     . LYS G 3 75  ? -49.367 -42.852 44.441 1.00 67.00  ? 75   LYS G N     1 
ATOM   4989  C  CA    . LYS G 3 75  ? -49.687 -41.922 43.351 1.00 65.94  ? 75   LYS G CA    1 
ATOM   4990  C  C     . LYS G 3 75  ? -49.077 -42.298 42.006 1.00 64.88  ? 75   LYS G C     1 
ATOM   4991  O  O     . LYS G 3 75  ? -48.069 -43.006 41.941 1.00 64.73  ? 75   LYS G O     1 
ATOM   4992  C  CB    . LYS G 3 75  ? -49.320 -40.489 43.756 1.00 66.21  ? 75   LYS G CB    1 
ATOM   4993  C  CG    . LYS G 3 75  ? -50.439 -39.778 44.519 1.00 67.32  ? 75   LYS G CG    1 
ATOM   4994  C  CD    . LYS G 3 75  ? -49.902 -38.900 45.624 1.00 69.28  ? 75   LYS G CD    1 
ATOM   4995  C  CE    . LYS G 3 75  ? -50.842 -37.741 45.898 1.00 70.13  ? 75   LYS G CE    1 
ATOM   4996  N  NZ    . LYS G 3 75  ? -50.067 -36.449 45.873 1.00 71.49  ? 75   LYS G NZ    1 
ATOM   4997  N  N     . THR G 3 76  ? -49.706 -41.816 40.936 1.00 63.84  ? 76   THR G N     1 
ATOM   4998  C  CA    . THR G 3 76  ? -49.304 -42.158 39.562 1.00 62.54  ? 76   THR G CA    1 
ATOM   4999  C  C     . THR G 3 76  ? -48.726 -40.962 38.798 1.00 61.33  ? 76   THR G C     1 
ATOM   5000  O  O     . THR G 3 76  ? -48.073 -41.124 37.771 1.00 61.07  ? 76   THR G O     1 
ATOM   5001  C  CB    . THR G 3 76  ? -50.487 -42.769 38.750 1.00 62.64  ? 76   THR G CB    1 
ATOM   5002  O  OG1   . THR G 3 76  ? -51.581 -41.844 38.704 1.00 63.15  ? 76   THR G OG1   1 
ATOM   5003  C  CG2   . THR G 3 76  ? -50.963 -44.080 39.375 1.00 62.84  ? 76   THR G CG2   1 
ATOM   5004  N  N     . ARG G 3 77  ? -48.972 -39.757 39.295 1.00 60.05  ? 77   ARG G N     1 
ATOM   5005  C  CA    . ARG G 3 77  ? -48.435 -38.569 38.644 1.00 58.79  ? 77   ARG G CA    1 
ATOM   5006  C  C     . ARG G 3 77  ? -47.274 -38.001 39.451 1.00 57.10  ? 77   ARG G C     1 
ATOM   5007  O  O     . ARG G 3 77  ? -47.450 -37.647 40.612 1.00 56.84  ? 77   ARG G O     1 
ATOM   5008  C  CB    . ARG G 3 77  ? -49.535 -37.526 38.465 1.00 59.16  ? 77   ARG G CB    1 
ATOM   5009  C  CG    . ARG G 3 77  ? -49.116 -36.274 37.712 1.00 60.77  ? 77   ARG G CG    1 
ATOM   5010  C  CD    . ARG G 3 77  ? -50.286 -35.321 37.645 1.00 63.41  ? 77   ARG G CD    1 
ATOM   5011  N  NE    . ARG G 3 77  ? -51.363 -35.857 36.815 1.00 65.48  ? 77   ARG G NE    1 
ATOM   5012  C  CZ    . ARG G 3 77  ? -52.652 -35.629 37.037 1.00 67.32  ? 77   ARG G CZ    1 
ATOM   5013  N  NH1   . ARG G 3 77  ? -53.039 -34.885 38.071 1.00 68.01  ? 77   ARG G NH1   1 
ATOM   5014  N  NH2   . ARG G 3 77  ? -53.559 -36.157 36.230 1.00 68.56  ? 77   ARG G NH2   1 
ATOM   5015  N  N     . ILE G 3 78  ? -46.098 -37.932 38.827 1.00 55.25  ? 78   ILE G N     1 
ATOM   5016  C  CA    . ILE G 3 78  ? -44.911 -37.334 39.445 1.00 53.78  ? 78   ILE G CA    1 
ATOM   5017  C  C     . ILE G 3 78  ? -45.073 -35.827 39.634 1.00 52.91  ? 78   ILE G C     1 
ATOM   5018  O  O     . ILE G 3 78  ? -45.280 -35.087 38.665 1.00 52.96  ? 78   ILE G O     1 
ATOM   5019  C  CB    . ILE G 3 78  ? -43.626 -37.611 38.627 1.00 53.53  ? 78   ILE G CB    1 
ATOM   5020  C  CG1   . ILE G 3 78  ? -43.217 -39.079 38.764 1.00 53.36  ? 78   ILE G CG1   1 
ATOM   5021  C  CG2   . ILE G 3 78  ? -42.485 -36.704 39.095 1.00 53.18  ? 78   ILE G CG2   1 
ATOM   5022  C  CD1   . ILE G 3 78  ? -42.131 -39.543 37.776 1.00 53.22  ? 78   ILE G CD1   1 
ATOM   5023  N  N     . ILE G 3 79  ? -45.000 -35.389 40.888 1.00 51.75  ? 79   ILE G N     1 
ATOM   5024  C  CA    . ILE G 3 79  ? -44.988 -33.962 41.216 1.00 50.87  ? 79   ILE G CA    1 
ATOM   5025  C  C     . ILE G 3 79  ? -43.602 -33.523 41.754 1.00 50.21  ? 79   ILE G C     1 
ATOM   5026  O  O     . ILE G 3 79  ? -42.724 -34.372 41.988 1.00 50.26  ? 79   ILE G O     1 
ATOM   5027  C  CB    . ILE G 3 79  ? -46.134 -33.587 42.179 1.00 50.67  ? 79   ILE G CB    1 
ATOM   5028  C  CG1   . ILE G 3 79  ? -45.985 -34.312 43.526 1.00 50.66  ? 79   ILE G CG1   1 
ATOM   5029  C  CG2   . ILE G 3 79  ? -47.479 -33.865 41.513 1.00 51.14  ? 79   ILE G CG2   1 
ATOM   5030  C  CD1   . ILE G 3 79  ? -46.878 -33.761 44.653 1.00 49.28  ? 79   ILE G CD1   1 
ATOM   5031  N  N     . PRO G 3 80  ? -43.381 -32.202 41.912 1.00 49.21  ? 80   PRO G N     1 
ATOM   5032  C  CA    . PRO G 3 80  ? -42.093 -31.715 42.408 1.00 48.48  ? 80   PRO G CA    1 
ATOM   5033  C  C     . PRO G 3 80  ? -41.643 -32.347 43.723 1.00 47.87  ? 80   PRO G C     1 
ATOM   5034  O  O     . PRO G 3 80  ? -40.454 -32.640 43.883 1.00 48.10  ? 80   PRO G O     1 
ATOM   5035  C  CB    . PRO G 3 80  ? -42.350 -30.223 42.578 1.00 48.42  ? 80   PRO G CB    1 
ATOM   5036  C  CG    . PRO G 3 80  ? -43.262 -29.925 41.460 1.00 48.41  ? 80   PRO G CG    1 
ATOM   5037  C  CD    . PRO G 3 80  ? -44.220 -31.082 41.447 1.00 49.02  ? 80   PRO G CD    1 
ATOM   5038  N  N     . ARG G 3 81  ? -42.580 -32.579 44.640 1.00 47.02  ? 81   ARG G N     1 
ATOM   5039  C  CA    . ARG G 3 81  ? -42.265 -33.296 45.871 1.00 46.16  ? 81   ARG G CA    1 
ATOM   5040  C  C     . ARG G 3 81  ? -41.502 -34.582 45.571 1.00 45.87  ? 81   ARG G C     1 
ATOM   5041  O  O     . ARG G 3 81  ? -40.468 -34.840 46.185 1.00 46.18  ? 81   ARG G O     1 
ATOM   5042  C  CB    . ARG G 3 81  ? -43.526 -33.588 46.694 1.00 46.04  ? 81   ARG G CB    1 
ATOM   5043  C  CG    . ARG G 3 81  ? -43.294 -34.369 47.985 1.00 45.51  ? 81   ARG G CG    1 
ATOM   5044  C  CD    . ARG G 3 81  ? -42.201 -33.746 48.852 1.00 44.09  ? 81   ARG G CD    1 
ATOM   5045  N  NE    . ARG G 3 81  ? -42.237 -34.247 50.222 1.00 42.99  ? 81   ARG G NE    1 
ATOM   5046  C  CZ    . ARG G 3 81  ? -41.402 -33.865 51.185 1.00 43.60  ? 81   ARG G CZ    1 
ATOM   5047  N  NH1   . ARG G 3 81  ? -40.438 -32.967 50.939 1.00 43.48  ? 81   ARG G NH1   1 
ATOM   5048  N  NH2   . ARG G 3 81  ? -41.527 -34.378 52.403 1.00 42.44  ? 81   ARG G NH2   1 
ATOM   5049  N  N     . HIS G 3 82  ? -41.990 -35.367 44.613 1.00 44.95  ? 82   HIS G N     1 
ATOM   5050  C  CA    . HIS G 3 82  ? -41.343 -36.632 44.274 1.00 44.37  ? 82   HIS G CA    1 
ATOM   5051  C  C     . HIS G 3 82  ? -39.922 -36.481 43.715 1.00 44.01  ? 82   HIS G C     1 
ATOM   5052  O  O     . HIS G 3 82  ? -39.026 -37.260 44.064 1.00 43.93  ? 82   HIS G O     1 
ATOM   5053  C  CB    . HIS G 3 82  ? -42.230 -37.490 43.365 1.00 43.96  ? 82   HIS G CB    1 
ATOM   5054  C  CG    . HIS G 3 82  ? -43.612 -37.681 43.900 1.00 43.79  ? 82   HIS G CG    1 
ATOM   5055  N  ND1   . HIS G 3 82  ? -44.732 -37.635 43.102 1.00 42.89  ? 82   HIS G ND1   1 
ATOM   5056  C  CD2   . HIS G 3 82  ? -44.057 -37.874 45.165 1.00 44.15  ? 82   HIS G CD2   1 
ATOM   5057  C  CE1   . HIS G 3 82  ? -45.806 -37.819 43.847 1.00 44.04  ? 82   HIS G CE1   1 
ATOM   5058  N  NE2   . HIS G 3 82  ? -45.425 -37.959 45.103 1.00 44.58  ? 82   HIS G NE2   1 
ATOM   5059  N  N     . LEU G 3 83  ? -39.711 -35.475 42.876 1.00 43.65  ? 83   LEU G N     1 
ATOM   5060  C  CA    . LEU G 3 83  ? -38.358 -35.173 42.373 1.00 43.33  ? 83   LEU G CA    1 
ATOM   5061  C  C     . LEU G 3 83  ? -37.403 -34.794 43.512 1.00 43.00  ? 83   LEU G C     1 
ATOM   5062  O  O     . LEU G 3 83  ? -36.257 -35.247 43.539 1.00 42.66  ? 83   LEU G O     1 
ATOM   5063  C  CB    . LEU G 3 83  ? -38.394 -34.068 41.322 1.00 43.53  ? 83   LEU G CB    1 
ATOM   5064  C  CG    . LEU G 3 83  ? -39.183 -34.346 40.031 1.00 43.29  ? 83   LEU G CG    1 
ATOM   5065  C  CD1   . LEU G 3 83  ? -39.439 -33.035 39.299 1.00 43.72  ? 83   LEU G CD1   1 
ATOM   5066  C  CD2   . LEU G 3 83  ? -38.462 -35.334 39.129 1.00 42.58  ? 83   LEU G CD2   1 
ATOM   5067  N  N     . GLN G 3 84  ? -37.893 -34.009 44.469 1.00 42.60  ? 84   GLN G N     1 
ATOM   5068  C  CA    . GLN G 3 84  ? -37.113 -33.691 45.671 1.00 42.63  ? 84   GLN G CA    1 
ATOM   5069  C  C     . GLN G 3 84  ? -36.718 -34.932 46.473 1.00 43.13  ? 84   GLN G C     1 
ATOM   5070  O  O     . GLN G 3 84  ? -35.519 -35.172 46.701 1.00 43.69  ? 84   GLN G O     1 
ATOM   5071  C  CB    . GLN G 3 84  ? -37.860 -32.712 46.574 1.00 42.17  ? 84   GLN G CB    1 
ATOM   5072  C  CG    . GLN G 3 84  ? -37.129 -32.363 47.850 1.00 41.07  ? 84   GLN G CG    1 
ATOM   5073  C  CD    . GLN G 3 84  ? -35.916 -31.447 47.639 1.00 40.32  ? 84   GLN G CD    1 
ATOM   5074  O  OE1   . GLN G 3 84  ? -35.319 -31.394 46.552 1.00 39.47  ? 84   GLN G OE1   1 
ATOM   5075  N  NE2   . GLN G 3 84  ? -35.524 -30.758 48.701 1.00 36.80  ? 84   GLN G NE2   1 
ATOM   5076  N  N     . LEU G 3 85  ? -37.707 -35.717 46.901 1.00 43.06  ? 85   LEU G N     1 
ATOM   5077  C  CA    . LEU G 3 85  ? -37.426 -36.946 47.635 1.00 43.16  ? 85   LEU G CA    1 
ATOM   5078  C  C     . LEU G 3 85  ? -36.419 -37.821 46.876 1.00 43.39  ? 85   LEU G C     1 
ATOM   5079  O  O     . LEU G 3 85  ? -35.493 -38.364 47.471 1.00 43.52  ? 85   LEU G O     1 
ATOM   5080  C  CB    . LEU G 3 85  ? -38.707 -37.743 47.919 1.00 43.29  ? 85   LEU G CB    1 
ATOM   5081  C  CG    . LEU G 3 85  ? -39.848 -37.226 48.820 1.00 43.18  ? 85   LEU G CG    1 
ATOM   5082  C  CD1   . LEU G 3 85  ? -40.917 -38.286 48.903 1.00 42.64  ? 85   LEU G CD1   1 
ATOM   5083  C  CD2   . LEU G 3 85  ? -39.405 -36.843 50.214 1.00 42.44  ? 85   LEU G CD2   1 
ATOM   5084  N  N     . ALA G 3 86  ? -36.582 -37.931 45.561 1.00 43.55  ? 86   ALA G N     1 
ATOM   5085  C  CA    . ALA G 3 86  ? -35.692 -38.762 44.753 1.00 43.72  ? 86   ALA G CA    1 
ATOM   5086  C  C     . ALA G 3 86  ? -34.251 -38.284 44.839 1.00 43.90  ? 86   ALA G C     1 
ATOM   5087  O  O     . ALA G 3 86  ? -33.341 -39.074 45.080 1.00 43.91  ? 86   ALA G O     1 
ATOM   5088  C  CB    . ALA G 3 86  ? -36.152 -38.794 43.300 1.00 43.61  ? 86   ALA G CB    1 
ATOM   5089  N  N     . VAL G 3 87  ? -34.066 -36.982 44.635 1.00 44.11  ? 87   VAL G N     1 
ATOM   5090  C  CA    . VAL G 3 87  ? -32.748 -36.355 44.627 1.00 43.93  ? 87   VAL G CA    1 
ATOM   5091  C  C     . VAL G 3 87  ? -32.063 -36.388 46.000 1.00 43.77  ? 87   VAL G C     1 
ATOM   5092  O  O     . VAL G 3 87  ? -30.939 -36.851 46.111 1.00 43.46  ? 87   VAL G O     1 
ATOM   5093  C  CB    . VAL G 3 87  ? -32.819 -34.910 44.029 1.00 44.02  ? 87   VAL G CB    1 
ATOM   5094  C  CG1   . VAL G 3 87  ? -31.582 -34.085 44.358 1.00 43.41  ? 87   VAL G CG1   1 
ATOM   5095  C  CG2   . VAL G 3 87  ? -33.014 -34.982 42.522 1.00 44.10  ? 87   VAL G CG2   1 
ATOM   5096  N  N     . ARG G 3 88  ? -32.728 -35.916 47.044 1.00 44.06  ? 88   ARG G N     1 
ATOM   5097  C  CA    . ARG G 3 88  ? -32.033 -35.777 48.327 1.00 44.47  ? 88   ARG G CA    1 
ATOM   5098  C  C     . ARG G 3 88  ? -31.810 -37.107 49.061 1.00 44.91  ? 88   ARG G C     1 
ATOM   5099  O  O     . ARG G 3 88  ? -30.916 -37.205 49.904 1.00 45.13  ? 88   ARG G O     1 
ATOM   5100  C  CB    . ARG G 3 88  ? -32.707 -34.727 49.218 1.00 44.40  ? 88   ARG G CB    1 
ATOM   5101  C  CG    . ARG G 3 88  ? -33.578 -33.722 48.450 1.00 43.51  ? 88   ARG G CG    1 
ATOM   5102  C  CD    . ARG G 3 88  ? -32.937 -32.351 48.072 1.00 43.04  ? 88   ARG G CD    1 
ATOM   5103  N  NE    . ARG G 3 88  ? -31.557 -32.368 47.599 1.00 42.09  ? 88   ARG G NE    1 
ATOM   5104  C  CZ    . ARG G 3 88  ? -31.021 -31.500 46.739 1.00 40.91  ? 88   ARG G CZ    1 
ATOM   5105  N  NH1   . ARG G 3 88  ? -31.731 -30.539 46.169 1.00 38.95  ? 88   ARG G NH1   1 
ATOM   5106  N  NH2   . ARG G 3 88  ? -29.744 -31.624 46.416 1.00 43.65  ? 88   ARG G NH2   1 
ATOM   5107  N  N     . ASN G 3 89  ? -32.590 -38.137 48.722 1.00 45.40  ? 89   ASN G N     1 
ATOM   5108  C  CA    . ASN G 3 89  ? -32.358 -39.484 49.272 1.00 45.66  ? 89   ASN G CA    1 
ATOM   5109  C  C     . ASN G 3 89  ? -31.278 -40.273 48.541 1.00 45.86  ? 89   ASN G C     1 
ATOM   5110  O  O     . ASN G 3 89  ? -30.966 -41.385 48.941 1.00 46.65  ? 89   ASN G O     1 
ATOM   5111  C  CB    . ASN G 3 89  ? -33.646 -40.313 49.318 1.00 45.38  ? 89   ASN G CB    1 
ATOM   5112  C  CG    . ASN G 3 89  ? -34.548 -39.936 50.471 1.00 45.85  ? 89   ASN G CG    1 
ATOM   5113  O  OD1   . ASN G 3 89  ? -34.118 -39.834 51.627 1.00 46.85  ? 89   ASN G OD1   1 
ATOM   5114  N  ND2   . ASN G 3 89  ? -35.818 -39.729 50.164 1.00 46.27  ? 89   ASN G ND2   1 
ATOM   5115  N  N     . ASP G 3 90  ? -30.727 -39.715 47.467 1.00 46.26  ? 90   ASP G N     1 
ATOM   5116  C  CA    . ASP G 3 90  ? -29.667 -40.373 46.712 1.00 46.84  ? 90   ASP G CA    1 
ATOM   5117  C  C     . ASP G 3 90  ? -28.391 -39.575 46.839 1.00 47.32  ? 90   ASP G C     1 
ATOM   5118  O  O     . ASP G 3 90  ? -28.300 -38.460 46.338 1.00 47.43  ? 90   ASP G O     1 
ATOM   5119  C  CB    . ASP G 3 90  ? -30.024 -40.519 45.231 1.00 47.12  ? 90   ASP G CB    1 
ATOM   5120  C  CG    . ASP G 3 90  ? -28.951 -41.272 44.448 1.00 48.16  ? 90   ASP G CG    1 
ATOM   5121  O  OD1   . ASP G 3 90  ? -28.909 -42.515 44.542 1.00 51.34  ? 90   ASP G OD1   1 
ATOM   5122  O  OD2   . ASP G 3 90  ? -28.144 -40.629 43.742 1.00 48.67  ? 90   ASP G OD2   1 
ATOM   5123  N  N     . GLU G 3 91  ? -27.399 -40.166 47.492 1.00 47.97  ? 91   GLU G N     1 
ATOM   5124  C  CA    . GLU G 3 91  ? -26.148 -39.491 47.796 1.00 48.43  ? 91   GLU G CA    1 
ATOM   5125  C  C     . GLU G 3 91  ? -25.508 -38.804 46.585 1.00 47.98  ? 91   GLU G C     1 
ATOM   5126  O  O     . GLU G 3 91  ? -24.984 -37.708 46.704 1.00 48.04  ? 91   GLU G O     1 
ATOM   5127  C  CB    . GLU G 3 91  ? -25.159 -40.479 48.412 1.00 48.91  ? 91   GLU G CB    1 
ATOM   5128  C  CG    . GLU G 3 91  ? -24.259 -39.852 49.472 1.00 52.56  ? 91   GLU G CG    1 
ATOM   5129  C  CD    . GLU G 3 91  ? -22.926 -40.571 49.616 1.00 56.87  ? 91   GLU G CD    1 
ATOM   5130  O  OE1   . GLU G 3 91  ? -22.154 -40.601 48.635 1.00 59.05  ? 91   GLU G OE1   1 
ATOM   5131  O  OE2   . GLU G 3 91  ? -22.644 -41.101 50.714 1.00 59.37  ? 91   GLU G OE2   1 
ATOM   5132  N  N     . GLU G 3 92  ? -25.553 -39.442 45.421 1.00 47.69  ? 92   GLU G N     1 
ATOM   5133  C  CA    . GLU G 3 92  ? -24.879 -38.887 44.254 1.00 47.25  ? 92   GLU G CA    1 
ATOM   5134  C  C     . GLU G 3 92  ? -25.676 -37.753 43.587 1.00 46.57  ? 92   GLU G C     1 
ATOM   5135  O  O     . GLU G 3 92  ? -25.147 -36.658 43.347 1.00 46.27  ? 92   GLU G O     1 
ATOM   5136  C  CB    . GLU G 3 92  ? -24.462 -39.991 43.281 1.00 46.94  ? 92   GLU G CB    1 
ATOM   5137  C  CG    . GLU G 3 92  ? -23.169 -40.655 43.714 1.00 48.67  ? 92   GLU G CG    1 
ATOM   5138  C  CD    . GLU G 3 92  ? -22.637 -41.736 42.762 1.00 51.56  ? 92   GLU G CD    1 
ATOM   5139  O  OE1   . GLU G 3 92  ? -23.195 -41.945 41.654 1.00 52.20  ? 92   GLU G OE1   1 
ATOM   5140  O  OE2   . GLU G 3 92  ? -21.631 -42.382 43.145 1.00 52.99  ? 92   GLU G OE2   1 
ATOM   5141  N  N     . LEU G 3 93  ? -26.949 -38.015 43.319 1.00 45.76  ? 93   LEU G N     1 
ATOM   5142  C  CA    . LEU G 3 93  ? -27.844 -36.995 42.764 1.00 45.11  ? 93   LEU G CA    1 
ATOM   5143  C  C     . LEU G 3 93  ? -27.910 -35.766 43.675 1.00 44.50  ? 93   LEU G C     1 
ATOM   5144  O  O     . LEU G 3 93  ? -27.994 -34.637 43.196 1.00 43.64  ? 93   LEU G O     1 
ATOM   5145  C  CB    . LEU G 3 93  ? -29.252 -37.568 42.551 1.00 44.90  ? 93   LEU G CB    1 
ATOM   5146  C  CG    . LEU G 3 93  ? -29.486 -38.488 41.363 1.00 44.07  ? 93   LEU G CG    1 
ATOM   5147  C  CD1   . LEU G 3 93  ? -30.930 -38.910 41.349 1.00 44.50  ? 93   LEU G CD1   1 
ATOM   5148  C  CD2   . LEU G 3 93  ? -29.121 -37.790 40.053 1.00 44.65  ? 93   LEU G CD2   1 
ATOM   5149  N  N     . ASN G 3 94  ? -27.860 -36.010 44.985 1.00 44.03  ? 94   ASN G N     1 
ATOM   5150  C  CA    . ASN G 3 94  ? -27.831 -34.946 45.971 1.00 43.72  ? 94   ASN G CA    1 
ATOM   5151  C  C     . ASN G 3 94  ? -26.588 -34.083 45.855 1.00 43.85  ? 94   ASN G C     1 
ATOM   5152  O  O     . ASN G 3 94  ? -26.673 -32.864 45.989 1.00 44.17  ? 94   ASN G O     1 
ATOM   5153  C  CB    . ASN G 3 94  ? -27.934 -35.503 47.388 1.00 43.70  ? 94   ASN G CB    1 
ATOM   5154  C  CG    . ASN G 3 94  ? -28.096 -34.410 48.434 1.00 43.46  ? 94   ASN G CG    1 
ATOM   5155  O  OD1   . ASN G 3 94  ? -29.038 -33.615 48.373 1.00 44.58  ? 94   ASN G OD1   1 
ATOM   5156  N  ND2   . ASN G 3 94  ? -27.183 -34.365 49.392 1.00 39.27  ? 94   ASN G ND2   1 
ATOM   5157  N  N     . LYS G 3 95  ? -25.440 -34.708 45.614 1.00 43.51  ? 95   LYS G N     1 
ATOM   5158  C  CA    . LYS G 3 95  ? -24.191 -33.974 45.497 1.00 43.12  ? 95   LYS G CA    1 
ATOM   5159  C  C     . LYS G 3 95  ? -24.177 -33.164 44.203 1.00 42.55  ? 95   LYS G C     1 
ATOM   5160  O  O     . LYS G 3 95  ? -23.773 -31.999 44.204 1.00 42.19  ? 95   LYS G O     1 
ATOM   5161  C  CB    . LYS G 3 95  ? -22.998 -34.927 45.552 1.00 43.47  ? 95   LYS G CB    1 
ATOM   5162  C  CG    . LYS G 3 95  ? -21.645 -34.230 45.581 1.00 46.88  ? 95   LYS G CG    1 
ATOM   5163  C  CD    . LYS G 3 95  ? -20.514 -35.262 45.697 1.00 53.26  ? 95   LYS G CD    1 
ATOM   5164  C  CE    . LYS G 3 95  ? -19.141 -34.601 45.594 1.00 56.42  ? 95   LYS G CE    1 
ATOM   5165  N  NZ    . LYS G 3 95  ? -18.105 -35.681 45.679 1.00 60.98  ? 95   LYS G NZ    1 
ATOM   5166  N  N     . LEU G 3 96  ? -24.621 -33.778 43.102 1.00 41.71  ? 96   LEU G N     1 
ATOM   5167  C  CA    . LEU G 3 96  ? -24.683 -33.088 41.813 1.00 40.66  ? 96   LEU G CA    1 
ATOM   5168  C  C     . LEU G 3 96  ? -25.616 -31.887 41.861 1.00 40.21  ? 96   LEU G C     1 
ATOM   5169  O  O     . LEU G 3 96  ? -25.372 -30.879 41.195 1.00 40.42  ? 96   LEU G O     1 
ATOM   5170  C  CB    . LEU G 3 96  ? -25.131 -34.032 40.701 1.00 40.30  ? 96   LEU G CB    1 
ATOM   5171  C  CG    . LEU G 3 96  ? -25.144 -33.450 39.288 1.00 39.60  ? 96   LEU G CG    1 
ATOM   5172  C  CD1   . LEU G 3 96  ? -23.724 -33.303 38.704 1.00 37.23  ? 96   LEU G CD1   1 
ATOM   5173  C  CD2   . LEU G 3 96  ? -26.008 -34.342 38.429 1.00 39.30  ? 96   LEU G CD2   1 
ATOM   5174  N  N     . LEU G 3 97  ? -26.679 -32.003 42.647 1.00 39.72  ? 97   LEU G N     1 
ATOM   5175  C  CA    . LEU G 3 97  ? -27.656 -30.925 42.793 1.00 39.51  ? 97   LEU G CA    1 
ATOM   5176  C  C     . LEU G 3 97  ? -27.503 -30.203 44.142 1.00 39.50  ? 97   LEU G C     1 
ATOM   5177  O  O     . LEU G 3 97  ? -28.435 -29.579 44.653 1.00 38.66  ? 97   LEU G O     1 
ATOM   5178  C  CB    . LEU G 3 97  ? -29.083 -31.469 42.582 1.00 39.30  ? 97   LEU G CB    1 
ATOM   5179  C  CG    . LEU G 3 97  ? -29.402 -32.068 41.197 1.00 38.79  ? 97   LEU G CG    1 
ATOM   5180  C  CD1   . LEU G 3 97  ? -30.910 -32.197 41.018 1.00 38.51  ? 97   LEU G CD1   1 
ATOM   5181  C  CD2   . LEU G 3 97  ? -28.804 -31.246 40.037 1.00 37.34  ? 97   LEU G CD2   1 
ATOM   5182  N  N     . GLY G 3 98  ? -26.300 -30.295 44.700 1.00 40.01  ? 98   GLY G N     1 
ATOM   5183  C  CA    . GLY G 3 98  ? -25.973 -29.723 46.008 1.00 40.89  ? 98   GLY G CA    1 
ATOM   5184  C  C     . GLY G 3 98  ? -26.249 -28.240 46.181 1.00 41.45  ? 98   GLY G C     1 
ATOM   5185  O  O     . GLY G 3 98  ? -26.515 -27.784 47.288 1.00 41.49  ? 98   GLY G O     1 
ATOM   5186  N  N     . ARG G 3 99  ? -26.207 -27.493 45.082 1.00 42.02  ? 99   ARG G N     1 
ATOM   5187  C  CA    . ARG G 3 99  ? -26.512 -26.061 45.110 1.00 42.43  ? 99   ARG G CA    1 
ATOM   5188  C  C     . ARG G 3 99  ? -27.748 -25.696 44.262 1.00 41.61  ? 99   ARG G C     1 
ATOM   5189  O  O     . ARG G 3 99  ? -27.841 -24.601 43.718 1.00 41.47  ? 99   ARG G O     1 
ATOM   5190  C  CB    . ARG G 3 99  ? -25.265 -25.245 44.714 1.00 43.08  ? 99   ARG G CB    1 
ATOM   5191  C  CG    . ARG G 3 99  ? -24.203 -25.217 45.823 1.00 47.03  ? 99   ARG G CG    1 
ATOM   5192  C  CD    . ARG G 3 99  ? -22.788 -25.295 45.266 1.00 54.68  ? 99   ARG G CD    1 
ATOM   5193  N  NE    . ARG G 3 99  ? -21.787 -25.496 46.328 1.00 60.98  ? 99   ARG G NE    1 
ATOM   5194  C  CZ    . ARG G 3 99  ? -20.463 -25.568 46.134 1.00 62.34  ? 99   ARG G CZ    1 
ATOM   5195  N  NH1   . ARG G 3 99  ? -19.945 -25.442 44.911 1.00 62.40  ? 99   ARG G NH1   1 
ATOM   5196  N  NH2   . ARG G 3 99  ? -19.652 -25.759 47.173 1.00 62.49  ? 99   ARG G NH2   1 
ATOM   5197  N  N     . VAL G 3 100 ? -28.704 -26.616 44.190 1.00 40.75  ? 100  VAL G N     1 
ATOM   5198  C  CA    . VAL G 3 100 ? -29.916 -26.431 43.411 1.00 40.14  ? 100  VAL G CA    1 
ATOM   5199  C  C     . VAL G 3 100 ? -31.144 -26.496 44.298 1.00 40.27  ? 100  VAL G C     1 
ATOM   5200  O  O     . VAL G 3 100 ? -31.201 -27.275 45.251 1.00 40.77  ? 100  VAL G O     1 
ATOM   5201  C  CB    . VAL G 3 100 ? -30.030 -27.478 42.265 1.00 39.93  ? 100  VAL G CB    1 
ATOM   5202  C  CG1   . VAL G 3 100 ? -31.458 -27.567 41.749 1.00 40.01  ? 100  VAL G CG1   1 
ATOM   5203  C  CG2   . VAL G 3 100 ? -29.104 -27.108 41.122 1.00 39.25  ? 100  VAL G CG2   1 
ATOM   5204  N  N     . THR G 3 101 ? -32.129 -25.667 43.983 1.00 40.53  ? 101  THR G N     1 
ATOM   5205  C  CA    . THR G 3 101 ? -33.387 -25.671 44.701 1.00 40.85  ? 101  THR G CA    1 
ATOM   5206  C  C     . THR G 3 101 ? -34.493 -26.111 43.760 1.00 41.23  ? 101  THR G C     1 
ATOM   5207  O  O     . THR G 3 101 ? -34.673 -25.528 42.693 1.00 41.57  ? 101  THR G O     1 
ATOM   5208  C  CB    . THR G 3 101 ? -33.684 -24.292 45.273 1.00 40.66  ? 101  THR G CB    1 
ATOM   5209  O  OG1   . THR G 3 101 ? -32.714 -23.990 46.286 1.00 41.84  ? 101  THR G OG1   1 
ATOM   5210  C  CG2   . THR G 3 101 ? -35.059 -24.244 45.885 1.00 40.07  ? 101  THR G CG2   1 
ATOM   5211  N  N     . ILE G 3 102 ? -35.208 -27.161 44.147 1.00 41.53  ? 102  ILE G N     1 
ATOM   5212  C  CA    . ILE G 3 102 ? -36.354 -27.638 43.388 1.00 41.64  ? 102  ILE G CA    1 
ATOM   5213  C  C     . ILE G 3 102 ? -37.591 -26.993 43.987 1.00 41.86  ? 102  ILE G C     1 
ATOM   5214  O  O     . ILE G 3 102 ? -37.945 -27.256 45.141 1.00 42.19  ? 102  ILE G O     1 
ATOM   5215  C  CB    . ILE G 3 102 ? -36.455 -29.183 43.454 1.00 41.79  ? 102  ILE G CB    1 
ATOM   5216  C  CG1   . ILE G 3 102 ? -35.270 -29.813 42.730 1.00 41.91  ? 102  ILE G CG1   1 
ATOM   5217  C  CG2   . ILE G 3 102 ? -37.779 -29.684 42.882 1.00 41.24  ? 102  ILE G CG2   1 
ATOM   5218  C  CD1   . ILE G 3 102 ? -35.087 -31.289 42.988 1.00 42.81  ? 102  ILE G CD1   1 
ATOM   5219  N  N     . ALA G 3 103 ? -38.235 -26.132 43.211 1.00 42.36  ? 103  ALA G N     1 
ATOM   5220  C  CA    . ALA G 3 103 ? -39.430 -25.424 43.669 1.00 43.24  ? 103  ALA G CA    1 
ATOM   5221  C  C     . ALA G 3 103 ? -40.529 -26.390 44.109 1.00 43.74  ? 103  ALA G C     1 
ATOM   5222  O  O     . ALA G 3 103 ? -40.731 -27.426 43.491 1.00 43.93  ? 103  ALA G O     1 
ATOM   5223  C  CB    . ALA G 3 103 ? -39.928 -24.504 42.594 1.00 43.11  ? 103  ALA G CB    1 
ATOM   5224  N  N     . GLN G 3 104 ? -41.221 -26.058 45.192 1.00 44.68  ? 104  GLN G N     1 
ATOM   5225  C  CA    . GLN G 3 104 ? -42.298 -26.909 45.715 1.00 45.59  ? 104  GLN G CA    1 
ATOM   5226  C  C     . GLN G 3 104 ? -41.806 -28.310 46.036 1.00 45.42  ? 104  GLN G C     1 
ATOM   5227  O  O     . GLN G 3 104 ? -42.544 -29.269 45.852 1.00 45.93  ? 104  GLN G O     1 
ATOM   5228  C  CB    . GLN G 3 104 ? -43.483 -26.994 44.733 1.00 46.27  ? 104  GLN G CB    1 
ATOM   5229  C  CG    . GLN G 3 104 ? -44.388 -25.759 44.683 1.00 48.38  ? 104  GLN G CG    1 
ATOM   5230  C  CD    . GLN G 3 104 ? -45.112 -25.512 46.006 1.00 53.60  ? 104  GLN G CD    1 
ATOM   5231  O  OE1   . GLN G 3 104 ? -45.975 -26.308 46.432 1.00 54.99  ? 104  GLN G OE1   1 
ATOM   5232  N  NE2   . GLN G 3 104 ? -44.758 -24.407 46.670 1.00 53.60  ? 104  GLN G NE2   1 
ATOM   5233  N  N     . GLY G 3 105 ? -40.570 -28.425 46.517 1.00 45.06  ? 105  GLY G N     1 
ATOM   5234  C  CA    . GLY G 3 105 ? -40.023 -29.718 46.896 1.00 44.84  ? 105  GLY G CA    1 
ATOM   5235  C  C     . GLY G 3 105 ? -40.047 -30.055 48.378 1.00 44.87  ? 105  GLY G C     1 
ATOM   5236  O  O     . GLY G 3 105 ? -40.011 -31.238 48.746 1.00 45.02  ? 105  GLY G O     1 
ATOM   5237  N  N     . GLY G 3 106 ? -40.093 -29.027 49.231 1.00 44.63  ? 106  GLY G N     1 
ATOM   5238  C  CA    . GLY G 3 106 ? -39.983 -29.199 50.675 1.00 44.50  ? 106  GLY G CA    1 
ATOM   5239  C  C     . GLY G 3 106 ? -38.662 -29.832 51.072 1.00 44.97  ? 106  GLY G C     1 
ATOM   5240  O  O     . GLY G 3 106 ? -37.690 -29.805 50.318 1.00 44.82  ? 106  GLY G O     1 
ATOM   5241  N  N     . VAL G 3 107 ? -38.635 -30.422 52.260 1.00 45.45  ? 107  VAL G N     1 
ATOM   5242  C  CA    . VAL G 3 107 ? -37.426 -31.011 52.796 1.00 45.63  ? 107  VAL G CA    1 
ATOM   5243  C  C     . VAL G 3 107 ? -37.683 -32.454 53.203 1.00 46.16  ? 107  VAL G C     1 
ATOM   5244  O  O     . VAL G 3 107 ? -38.832 -32.887 53.270 1.00 46.44  ? 107  VAL G O     1 
ATOM   5245  C  CB    . VAL G 3 107 ? -36.938 -30.210 54.009 1.00 45.67  ? 107  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G 3 107 ? -36.743 -28.752 53.627 1.00 44.07  ? 107  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G 3 107 ? -37.915 -30.355 55.193 1.00 46.06  ? 107  VAL G CG2   1 
ATOM   5248  N  N     . LEU G 3 108 ? -36.611 -33.196 53.455 1.00 46.94  ? 108  LEU G N     1 
ATOM   5249  C  CA    . LEU G 3 108 ? -36.711 -34.525 54.033 1.00 47.68  ? 108  LEU G CA    1 
ATOM   5250  C  C     . LEU G 3 108 ? -37.227 -34.431 55.456 1.00 49.02  ? 108  LEU G C     1 
ATOM   5251  O  O     . LEU G 3 108 ? -36.823 -33.538 56.189 1.00 49.46  ? 108  LEU G O     1 
ATOM   5252  C  CB    . LEU G 3 108 ? -35.342 -35.196 54.044 1.00 47.16  ? 108  LEU G CB    1 
ATOM   5253  C  CG    . LEU G 3 108 ? -34.734 -35.565 52.694 1.00 45.91  ? 108  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G 3 108 ? -33.601 -36.555 52.892 1.00 43.53  ? 108  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G 3 108 ? -35.779 -36.103 51.739 1.00 43.99  ? 108  LEU G CD2   1 
ATOM   5256  N  N     . PRO G 3 109 ? -38.137 -35.338 55.853 1.00 50.57  ? 109  PRO G N     1 
ATOM   5257  C  CA    . PRO G 3 109 ? -38.466 -35.425 57.273 1.00 51.71  ? 109  PRO G CA    1 
ATOM   5258  C  C     . PRO G 3 109 ? -37.211 -35.770 58.062 1.00 52.80  ? 109  PRO G C     1 
ATOM   5259  O  O     . PRO G 3 109 ? -36.605 -36.805 57.819 1.00 53.08  ? 109  PRO G O     1 
ATOM   5260  C  CB    . PRO G 3 109 ? -39.473 -36.579 57.323 1.00 51.57  ? 109  PRO G CB    1 
ATOM   5261  C  CG    . PRO G 3 109 ? -40.139 -36.526 55.980 1.00 51.13  ? 109  PRO G CG    1 
ATOM   5262  C  CD    . PRO G 3 109 ? -38.994 -36.224 55.042 1.00 50.65  ? 109  PRO G CD    1 
ATOM   5263  N  N     . ASN G 3 110 ? -36.814 -34.884 58.969 1.00 54.32  ? 110  ASN G N     1 
ATOM   5264  C  CA    . ASN G 3 110 ? -35.627 -35.087 59.786 1.00 55.86  ? 110  ASN G CA    1 
ATOM   5265  C  C     . ASN G 3 110 ? -35.678 -34.246 61.055 1.00 56.71  ? 110  ASN G C     1 
ATOM   5266  O  O     . ASN G 3 110 ? -35.704 -33.011 60.984 1.00 56.96  ? 110  ASN G O     1 
ATOM   5267  C  CB    . ASN G 3 110 ? -34.362 -34.752 58.981 1.00 56.08  ? 110  ASN G CB    1 
ATOM   5268  C  CG    . ASN G 3 110 ? -33.079 -35.192 59.683 1.00 57.20  ? 110  ASN G CG    1 
ATOM   5269  O  OD1   . ASN G 3 110 ? -33.113 -35.952 60.657 1.00 58.87  ? 110  ASN G OD1   1 
ATOM   5270  N  ND2   . ASN G 3 110 ? -31.936 -34.716 59.182 1.00 57.42  ? 110  ASN G ND2   1 
ATOM   5271  N  N     . ILE G 3 111 ? -35.694 -34.919 62.209 1.00 57.48  ? 111  ILE G N     1 
ATOM   5272  C  CA    . ILE G 3 111 ? -35.626 -34.249 63.510 1.00 58.10  ? 111  ILE G CA    1 
ATOM   5273  C  C     . ILE G 3 111 ? -34.408 -34.740 64.275 1.00 58.85  ? 111  ILE G C     1 
ATOM   5274  O  O     . ILE G 3 111 ? -34.201 -35.947 64.414 1.00 59.32  ? 111  ILE G O     1 
ATOM   5275  C  CB    . ILE G 3 111 ? -36.882 -34.504 64.376 1.00 58.04  ? 111  ILE G CB    1 
ATOM   5276  C  CG1   . ILE G 3 111 ? -38.169 -34.389 63.547 1.00 58.41  ? 111  ILE G CG1   1 
ATOM   5277  C  CG2   . ILE G 3 111 ? -36.922 -33.535 65.551 1.00 58.04  ? 111  ILE G CG2   1 
ATOM   5278  C  CD1   . ILE G 3 111 ? -39.367 -35.121 64.139 1.00 57.75  ? 111  ILE G CD1   1 
ATOM   5279  N  N     . GLN G 3 112 ? -33.608 -33.802 64.772 1.00 59.75  ? 112  GLN G N     1 
ATOM   5280  C  CA    . GLN G 3 112 ? -32.440 -34.121 65.593 1.00 60.63  ? 112  GLN G CA    1 
ATOM   5281  C  C     . GLN G 3 112 ? -32.870 -34.870 66.846 1.00 61.36  ? 112  GLN G C     1 
ATOM   5282  O  O     . GLN G 3 112 ? -33.861 -34.496 67.485 1.00 61.45  ? 112  GLN G O     1 
ATOM   5283  C  CB    . GLN G 3 112 ? -31.708 -32.841 65.987 1.00 60.69  ? 112  GLN G CB    1 
ATOM   5284  C  CG    . GLN G 3 112 ? -31.199 -32.039 64.810 1.00 60.72  ? 112  GLN G CG    1 
ATOM   5285  C  CD    . GLN G 3 112 ? -30.163 -32.791 64.013 1.00 60.61  ? 112  GLN G CD    1 
ATOM   5286  O  OE1   . GLN G 3 112 ? -29.200 -33.329 64.567 1.00 61.42  ? 112  GLN G OE1   1 
ATOM   5287  N  NE2   . GLN G 3 112 ? -30.352 -32.833 62.703 1.00 59.71  ? 112  GLN G NE2   1 
ATOM   5288  N  N     . SER G 3 113 ? -32.125 -35.918 67.194 1.00 62.19  ? 113  SER G N     1 
ATOM   5289  C  CA    . SER G 3 113 ? -32.529 -36.821 68.272 1.00 63.06  ? 113  SER G CA    1 
ATOM   5290  C  C     . SER G 3 113 ? -32.674 -36.135 69.629 1.00 63.59  ? 113  SER G C     1 
ATOM   5291  O  O     . SER G 3 113 ? -33.610 -36.417 70.370 1.00 63.46  ? 113  SER G O     1 
ATOM   5292  C  CB    . SER G 3 113 ? -31.597 -38.032 68.355 1.00 63.07  ? 113  SER G CB    1 
ATOM   5293  O  OG    . SER G 3 113 ? -30.257 -37.641 68.583 1.00 63.55  ? 113  SER G OG    1 
ATOM   5294  N  N     . VAL G 3 114 ? -31.776 -35.201 69.926 1.00 64.74  ? 114  VAL G N     1 
ATOM   5295  C  CA    . VAL G 3 114 ? -31.810 -34.462 71.193 1.00 65.70  ? 114  VAL G CA    1 
ATOM   5296  C  C     . VAL G 3 114 ? -33.096 -33.636 71.372 1.00 66.52  ? 114  VAL G C     1 
ATOM   5297  O  O     . VAL G 3 114 ? -33.406 -33.190 72.473 1.00 66.75  ? 114  VAL G O     1 
ATOM   5298  C  CB    . VAL G 3 114 ? -30.534 -33.592 71.380 1.00 65.65  ? 114  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3 114 ? -30.584 -32.349 70.501 1.00 65.73  ? 114  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3 114 ? -30.329 -33.214 72.850 1.00 65.48  ? 114  VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3 115 ? -33.853 -33.457 70.295 1.00 67.82  ? 115  LEU G N     1 
ATOM   5302  C  CA    . LEU G 3 115 ? -35.135 -32.746 70.360 1.00 69.10  ? 115  LEU G CA    1 
ATOM   5303  C  C     . LEU G 3 115 ? -36.335 -33.666 70.626 1.00 70.25  ? 115  LEU G C     1 
ATOM   5304  O  O     . LEU G 3 115 ? -37.455 -33.189 70.833 1.00 70.15  ? 115  LEU G O     1 
ATOM   5305  C  CB    . LEU G 3 115 ? -35.360 -31.920 69.086 1.00 68.91  ? 115  LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3 115 ? -34.366 -30.783 68.811 1.00 68.62  ? 115  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3 115 ? -34.519 -30.233 67.404 1.00 68.50  ? 115  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3 115 ? -34.514 -29.670 69.827 1.00 68.34  ? 115  LEU G CD2   1 
ATOM   5309  N  N     . LEU G 3 116 ? -36.099 -34.977 70.624 1.00 71.91  ? 116  LEU G N     1 
ATOM   5310  C  CA    . LEU G 3 116 ? -37.151 -35.948 70.911 1.00 73.51  ? 116  LEU G CA    1 
ATOM   5311  C  C     . LEU G 3 116 ? -37.520 -35.957 72.396 1.00 74.78  ? 116  LEU G C     1 
ATOM   5312  O  O     . LEU G 3 116 ? -36.637 -35.865 73.255 1.00 74.85  ? 116  LEU G O     1 
ATOM   5313  C  CB    . LEU G 3 116 ? -36.748 -37.352 70.435 1.00 73.38  ? 116  LEU G CB    1 
ATOM   5314  C  CG    . LEU G 3 116 ? -36.671 -37.561 68.914 1.00 73.66  ? 116  LEU G CG    1 
ATOM   5315  C  CD1   . LEU G 3 116 ? -36.201 -38.975 68.573 1.00 73.66  ? 116  LEU G CD1   1 
ATOM   5316  C  CD2   . LEU G 3 116 ? -38.017 -37.254 68.237 1.00 73.88  ? 116  LEU G CD2   1 
ATOM   5317  N  N     . PRO G 3 117 ? -38.833 -36.052 72.700 1.00 76.23  ? 117  PRO G N     1 
ATOM   5318  C  CA    . PRO G 3 117 ? -39.331 -36.131 74.077 1.00 77.32  ? 117  PRO G CA    1 
ATOM   5319  C  C     . PRO G 3 117 ? -38.742 -37.340 74.783 1.00 78.43  ? 117  PRO G C     1 
ATOM   5320  O  O     . PRO G 3 117 ? -38.623 -38.409 74.173 1.00 78.57  ? 117  PRO G O     1 
ATOM   5321  C  CB    . PRO G 3 117 ? -40.845 -36.324 73.896 1.00 77.31  ? 117  PRO G CB    1 
ATOM   5322  C  CG    . PRO G 3 117 ? -41.011 -36.845 72.501 1.00 76.95  ? 117  PRO G CG    1 
ATOM   5323  C  CD    . PRO G 3 117 ? -39.933 -36.154 71.723 1.00 76.36  ? 117  PRO G CD    1 
ATOM   5324  N  N     . LYS G 3 118 ? -38.376 -37.166 76.050 1.00 79.82  ? 118  LYS G N     1 
ATOM   5325  C  CA    . LYS G 3 118 ? -37.691 -38.220 76.803 1.00 81.31  ? 118  LYS G CA    1 
ATOM   5326  C  C     . LYS G 3 118 ? -38.666 -39.297 77.290 1.00 82.03  ? 118  LYS G C     1 
ATOM   5327  O  O     . LYS G 3 118 ? -39.608 -39.014 78.040 1.00 82.30  ? 118  LYS G O     1 
ATOM   5328  C  CB    . LYS G 3 118 ? -36.841 -37.625 77.939 1.00 81.43  ? 118  LYS G CB    1 
ATOM   5329  C  CG    . LYS G 3 118 ? -35.619 -36.861 77.416 1.00 82.51  ? 118  LYS G CG    1 
ATOM   5330  C  CD    . LYS G 3 118 ? -34.975 -35.963 78.465 1.00 84.03  ? 118  LYS G CD    1 
ATOM   5331  C  CE    . LYS G 3 118 ? -33.901 -35.065 77.819 1.00 84.04  ? 118  LYS G CE    1 
ATOM   5332  N  NZ    . LYS G 3 118 ? -33.362 -34.050 78.769 1.00 84.76  ? 118  LYS G NZ    1 
ATOM   5333  N  N     . LYS G 3 119 ? -38.419 -40.529 76.843 1.00 82.80  ? 119  LYS G N     1 
ATOM   5334  C  CA    . LYS G 3 119 ? -39.335 -41.660 77.038 1.00 83.53  ? 119  LYS G CA    1 
ATOM   5335  C  C     . LYS G 3 119 ? -39.284 -42.241 78.455 1.00 83.65  ? 119  LYS G C     1 
ATOM   5336  O  O     . LYS G 3 119 ? -40.322 -42.505 79.069 1.00 83.71  ? 119  LYS G O     1 
ATOM   5337  C  CB    . LYS G 3 119 ? -39.045 -42.754 76.000 1.00 83.75  ? 119  LYS G CB    1 
ATOM   5338  C  CG    . LYS G 3 119 ? -38.938 -42.228 74.557 1.00 84.75  ? 119  LYS G CG    1 
ATOM   5339  C  CD    . LYS G 3 119 ? -38.433 -43.289 73.577 1.00 86.31  ? 119  LYS G CD    1 
ATOM   5340  C  CE    . LYS G 3 119 ? -39.568 -44.180 73.079 1.00 86.92  ? 119  LYS G CE    1 
ATOM   5341  N  NZ    . LYS G 3 119 ? -39.200 -44.889 71.826 1.00 87.16  ? 119  LYS G NZ    1 
ATOM   5342  N  N     . LYS H 4 31  ? -46.504 -16.409 20.287 1.00 79.43  ? 28   LYS H N     1 
ATOM   5343  C  CA    . LYS H 4 31  ? -46.438 -16.984 18.909 1.00 79.35  ? 28   LYS H CA    1 
ATOM   5344  C  C     . LYS H 4 31  ? -45.079 -17.598 18.603 1.00 79.14  ? 28   LYS H C     1 
ATOM   5345  O  O     . LYS H 4 31  ? -45.012 -18.703 18.057 1.00 79.20  ? 28   LYS H O     1 
ATOM   5346  C  CB    . LYS H 4 31  ? -46.780 -15.928 17.849 1.00 79.42  ? 28   LYS H CB    1 
ATOM   5347  C  CG    . LYS H 4 31  ? -46.652 -16.434 16.410 1.00 79.62  ? 28   LYS H CG    1 
ATOM   5348  C  CD    . LYS H 4 31  ? -46.625 -15.297 15.412 1.00 80.24  ? 28   LYS H CD    1 
ATOM   5349  C  CE    . LYS H 4 31  ? -48.038 -14.830 15.047 1.00 80.55  ? 28   LYS H CE    1 
ATOM   5350  N  NZ    . LYS H 4 31  ? -48.046 -13.434 14.518 1.00 79.98  ? 28   LYS H NZ    1 
ATOM   5351  N  N     . THR H 4 32  ? -44.005 -16.877 18.941 1.00 78.98  ? 29   THR H N     1 
ATOM   5352  C  CA    . THR H 4 32  ? -42.645 -17.332 18.641 1.00 78.83  ? 29   THR H CA    1 
ATOM   5353  C  C     . THR H 4 32  ? -42.383 -18.686 19.308 1.00 78.61  ? 29   THR H C     1 
ATOM   5354  O  O     . THR H 4 32  ? -42.884 -18.954 20.404 1.00 78.58  ? 29   THR H O     1 
ATOM   5355  C  CB    . THR H 4 32  ? -41.557 -16.269 19.004 1.00 78.94  ? 29   THR H CB    1 
ATOM   5356  O  OG1   . THR H 4 32  ? -40.423 -16.414 18.136 1.00 78.89  ? 29   THR H OG1   1 
ATOM   5357  C  CG2   . THR H 4 32  ? -41.102 -16.381 20.467 1.00 78.97  ? 29   THR H CG2   1 
ATOM   5358  N  N     . ARG H 4 33  ? -41.625 -19.538 18.621 1.00 78.31  ? 30   ARG H N     1 
ATOM   5359  C  CA    . ARG H 4 33  ? -41.400 -20.922 19.056 1.00 78.10  ? 30   ARG H CA    1 
ATOM   5360  C  C     . ARG H 4 33  ? -40.702 -21.029 20.411 1.00 77.17  ? 30   ARG H C     1 
ATOM   5361  O  O     . ARG H 4 33  ? -39.602 -20.491 20.597 1.00 77.53  ? 30   ARG H O     1 
ATOM   5362  C  CB    . ARG H 4 33  ? -40.582 -21.683 18.008 1.00 78.62  ? 30   ARG H CB    1 
ATOM   5363  C  CG    . ARG H 4 33  ? -41.418 -22.341 16.915 1.00 80.25  ? 30   ARG H CG    1 
ATOM   5364  C  CD    . ARG H 4 33  ? -40.515 -22.926 15.834 1.00 83.50  ? 30   ARG H CD    1 
ATOM   5365  N  NE    . ARG H 4 33  ? -39.733 -24.078 16.297 1.00 85.63  ? 30   ARG H NE    1 
ATOM   5366  C  CZ    . ARG H 4 33  ? -40.013 -25.354 15.993 1.00 87.39  ? 30   ARG H CZ    1 
ATOM   5367  N  NH1   . ARG H 4 33  ? -41.065 -25.665 15.223 1.00 88.63  ? 30   ARG H NH1   1 
ATOM   5368  N  NH2   . ARG H 4 33  ? -39.239 -26.328 16.459 1.00 88.21  ? 30   ARG H NH2   1 
ATOM   5369  N  N     . LYS H 4 34  ? -41.345 -21.729 21.345 1.00 75.75  ? 31   LYS H N     1 
ATOM   5370  C  CA    . LYS H 4 34  ? -40.754 -21.993 22.653 1.00 74.48  ? 31   LYS H CA    1 
ATOM   5371  C  C     . LYS H 4 34  ? -40.341 -23.465 22.758 1.00 73.02  ? 31   LYS H C     1 
ATOM   5372  O  O     . LYS H 4 34  ? -41.159 -24.318 23.106 1.00 72.74  ? 31   LYS H O     1 
ATOM   5373  C  CB    . LYS H 4 34  ? -41.734 -21.613 23.775 1.00 74.90  ? 31   LYS H CB    1 
ATOM   5374  C  CG    . LYS H 4 34  ? -41.149 -20.705 24.868 1.00 76.07  ? 31   LYS H CG    1 
ATOM   5375  C  CD    . LYS H 4 34  ? -40.155 -21.433 25.790 1.00 78.41  ? 31   LYS H CD    1 
ATOM   5376  C  CE    . LYS H 4 34  ? -39.461 -20.468 26.770 1.00 79.13  ? 31   LYS H CE    1 
ATOM   5377  N  NZ    . LYS H 4 34  ? -38.393 -19.639 26.108 1.00 80.13  ? 31   LYS H NZ    1 
ATOM   5378  N  N     . GLU H 4 35  ? -39.077 -23.750 22.431 1.00 71.33  ? 32   GLU H N     1 
ATOM   5379  C  CA    . GLU H 4 35  ? -38.523 -25.108 22.507 1.00 69.72  ? 32   GLU H CA    1 
ATOM   5380  C  C     . GLU H 4 35  ? -38.335 -25.587 23.944 1.00 68.09  ? 32   GLU H C     1 
ATOM   5381  O  O     . GLU H 4 35  ? -38.142 -24.786 24.861 1.00 67.95  ? 32   GLU H O     1 
ATOM   5382  C  CB    . GLU H 4 35  ? -37.176 -25.187 21.791 1.00 70.06  ? 32   GLU H CB    1 
ATOM   5383  C  CG    . GLU H 4 35  ? -37.243 -25.280 20.280 1.00 71.31  ? 32   GLU H CG    1 
ATOM   5384  C  CD    . GLU H 4 35  ? -35.854 -25.465 19.679 1.00 74.13  ? 32   GLU H CD    1 
ATOM   5385  O  OE1   . GLU H 4 35  ? -35.735 -26.114 18.613 1.00 74.56  ? 32   GLU H OE1   1 
ATOM   5386  O  OE2   . GLU H 4 35  ? -34.872 -24.971 20.292 1.00 75.06  ? 32   GLU H OE2   1 
ATOM   5387  N  N     . SER H 4 36  ? -38.353 -26.905 24.115 1.00 66.18  ? 33   SER H N     1 
ATOM   5388  C  CA    . SER H 4 36  ? -38.338 -27.543 25.424 1.00 64.32  ? 33   SER H CA    1 
ATOM   5389  C  C     . SER H 4 36  ? -37.911 -28.985 25.236 1.00 63.24  ? 33   SER H C     1 
ATOM   5390  O  O     . SER H 4 36  ? -38.047 -29.524 24.138 1.00 62.96  ? 33   SER H O     1 
ATOM   5391  C  CB    . SER H 4 36  ? -39.745 -27.503 26.020 1.00 64.30  ? 33   SER H CB    1 
ATOM   5392  O  OG    . SER H 4 36  ? -39.849 -28.331 27.159 1.00 64.00  ? 33   SER H OG    1 
ATOM   5393  N  N     . TYR H 4 37  ? -37.393 -29.606 26.296 1.00 61.86  ? 34   TYR H N     1 
ATOM   5394  C  CA    . TYR H 4 37  ? -37.069 -31.040 26.266 1.00 60.41  ? 34   TYR H CA    1 
ATOM   5395  C  C     . TYR H 4 37  ? -38.249 -31.907 26.696 1.00 60.37  ? 34   TYR H C     1 
ATOM   5396  O  O     . TYR H 4 37  ? -38.109 -33.120 26.814 1.00 60.36  ? 34   TYR H O     1 
ATOM   5397  C  CB    . TYR H 4 37  ? -35.878 -31.359 27.172 1.00 59.83  ? 34   TYR H CB    1 
ATOM   5398  C  CG    . TYR H 4 37  ? -34.544 -30.851 26.692 1.00 57.29  ? 34   TYR H CG    1 
ATOM   5399  C  CD1   . TYR H 4 37  ? -34.011 -29.669 27.195 1.00 54.89  ? 34   TYR H CD1   1 
ATOM   5400  C  CD2   . TYR H 4 37  ? -33.803 -31.563 25.753 1.00 54.81  ? 34   TYR H CD2   1 
ATOM   5401  C  CE1   . TYR H 4 37  ? -32.789 -29.201 26.766 1.00 53.27  ? 34   TYR H CE1   1 
ATOM   5402  C  CE2   . TYR H 4 37  ? -32.575 -31.101 25.316 1.00 53.55  ? 34   TYR H CE2   1 
ATOM   5403  C  CZ    . TYR H 4 37  ? -32.078 -29.924 25.827 1.00 52.99  ? 34   TYR H CZ    1 
ATOM   5404  O  OH    . TYR H 4 37  ? -30.861 -29.473 25.397 1.00 53.43  ? 34   TYR H OH    1 
ATOM   5405  N  N     . ALA H 4 38  ? -39.405 -31.287 26.923 1.00 60.46  ? 35   ALA H N     1 
ATOM   5406  C  CA    . ALA H 4 38  ? -40.565 -31.982 27.491 1.00 60.70  ? 35   ALA H CA    1 
ATOM   5407  C  C     . ALA H 4 38  ? -40.960 -33.259 26.748 1.00 61.02  ? 35   ALA H C     1 
ATOM   5408  O  O     . ALA H 4 38  ? -41.141 -34.299 27.383 1.00 61.36  ? 35   ALA H O     1 
ATOM   5409  C  CB    . ALA H 4 38  ? -41.760 -31.038 27.631 1.00 60.61  ? 35   ALA H CB    1 
ATOM   5410  N  N     . ILE H 4 39  ? -41.077 -33.210 25.419 1.00 61.04  ? 36   ILE H N     1 
ATOM   5411  C  CA    . ILE H 4 39  ? -41.481 -34.422 24.690 1.00 61.23  ? 36   ILE H CA    1 
ATOM   5412  C  C     . ILE H 4 39  ? -40.498 -35.575 24.871 1.00 61.03  ? 36   ILE H C     1 
ATOM   5413  O  O     . ILE H 4 39  ? -40.907 -36.731 24.997 1.00 61.39  ? 36   ILE H O     1 
ATOM   5414  C  CB    . ILE H 4 39  ? -41.781 -34.204 23.175 1.00 61.19  ? 36   ILE H CB    1 
ATOM   5415  C  CG1   . ILE H 4 39  ? -40.613 -33.527 22.464 1.00 61.47  ? 36   ILE H CG1   1 
ATOM   5416  C  CG2   . ILE H 4 39  ? -43.105 -33.449 22.977 1.00 61.60  ? 36   ILE H CG2   1 
ATOM   5417  C  CD1   . ILE H 4 39  ? -40.616 -33.758 20.965 1.00 62.21  ? 36   ILE H CD1   1 
ATOM   5418  N  N     . TYR H 4 40  ? -39.211 -35.253 24.898 1.00 60.72  ? 37   TYR H N     1 
ATOM   5419  C  CA    . TYR H 4 40  ? -38.165 -36.263 25.025 1.00 60.38  ? 37   TYR H CA    1 
ATOM   5420  C  C     . TYR H 4 40  ? -38.077 -36.782 26.456 1.00 60.04  ? 37   TYR H C     1 
ATOM   5421  O  O     . TYR H 4 40  ? -37.751 -37.948 26.677 1.00 59.86  ? 37   TYR H O     1 
ATOM   5422  C  CB    . TYR H 4 40  ? -36.817 -35.697 24.587 1.00 60.35  ? 37   TYR H CB    1 
ATOM   5423  C  CG    . TYR H 4 40  ? -36.867 -34.995 23.247 1.00 61.23  ? 37   TYR H CG    1 
ATOM   5424  C  CD1   . TYR H 4 40  ? -36.965 -33.607 23.167 1.00 61.52  ? 37   TYR H CD1   1 
ATOM   5425  C  CD2   . TYR H 4 40  ? -36.830 -35.715 22.058 1.00 60.77  ? 37   TYR H CD2   1 
ATOM   5426  C  CE1   . TYR H 4 40  ? -37.017 -32.960 21.934 1.00 61.56  ? 37   TYR H CE1   1 
ATOM   5427  C  CE2   . TYR H 4 40  ? -36.874 -35.078 20.831 1.00 61.04  ? 37   TYR H CE2   1 
ATOM   5428  C  CZ    . TYR H 4 40  ? -36.971 -33.701 20.771 1.00 61.37  ? 37   TYR H CZ    1 
ATOM   5429  O  OH    . TYR H 4 40  ? -37.017 -33.064 19.544 1.00 62.35  ? 37   TYR H OH    1 
ATOM   5430  N  N     . VAL H 4 41  ? -38.373 -35.916 27.422 1.00 59.44  ? 38   VAL H N     1 
ATOM   5431  C  CA    . VAL H 4 41  ? -38.418 -36.328 28.817 1.00 59.14  ? 38   VAL H CA    1 
ATOM   5432  C  C     . VAL H 4 41  ? -39.620 -37.237 29.041 1.00 59.35  ? 38   VAL H C     1 
ATOM   5433  O  O     . VAL H 4 41  ? -39.514 -38.247 29.738 1.00 59.24  ? 38   VAL H O     1 
ATOM   5434  C  CB    . VAL H 4 41  ? -38.442 -35.111 29.770 1.00 59.14  ? 38   VAL H CB    1 
ATOM   5435  C  CG1   . VAL H 4 41  ? -38.877 -35.504 31.169 1.00 58.41  ? 38   VAL H CG1   1 
ATOM   5436  C  CG2   . VAL H 4 41  ? -37.075 -34.460 29.806 1.00 58.65  ? 38   VAL H CG2   1 
ATOM   5437  N  N     . TYR H 4 42  ? -40.749 -36.892 28.424 1.00 59.66  ? 39   TYR H N     1 
ATOM   5438  C  CA    . TYR H 4 42  ? -41.962 -37.702 28.527 1.00 60.18  ? 39   TYR H CA    1 
ATOM   5439  C  C     . TYR H 4 42  ? -41.765 -39.076 27.887 1.00 59.88  ? 39   TYR H C     1 
ATOM   5440  O  O     . TYR H 4 42  ? -42.249 -40.076 28.409 1.00 60.02  ? 39   TYR H O     1 
ATOM   5441  C  CB    . TYR H 4 42  ? -43.173 -36.981 27.923 1.00 60.52  ? 39   TYR H CB    1 
ATOM   5442  C  CG    . TYR H 4 42  ? -44.504 -37.614 28.284 1.00 62.64  ? 39   TYR H CG    1 
ATOM   5443  C  CD1   . TYR H 4 42  ? -45.189 -37.235 29.443 1.00 64.64  ? 39   TYR H CD1   1 
ATOM   5444  C  CD2   . TYR H 4 42  ? -45.084 -38.591 27.463 1.00 64.80  ? 39   TYR H CD2   1 
ATOM   5445  C  CE1   . TYR H 4 42  ? -46.415 -37.819 29.784 1.00 66.07  ? 39   TYR H CE1   1 
ATOM   5446  C  CE2   . TYR H 4 42  ? -46.306 -39.178 27.790 1.00 66.20  ? 39   TYR H CE2   1 
ATOM   5447  C  CZ    . TYR H 4 42  ? -46.966 -38.787 28.950 1.00 66.91  ? 39   TYR H CZ    1 
ATOM   5448  O  OH    . TYR H 4 42  ? -48.177 -39.366 29.268 1.00 68.48  ? 39   TYR H OH    1 
ATOM   5449  N  N     . LYS H 4 43  ? -41.044 -39.123 26.772 1.00 59.77  ? 40   LYS H N     1 
ATOM   5450  C  CA    . LYS H 4 43  ? -40.708 -40.397 26.139 1.00 59.90  ? 40   LYS H CA    1 
ATOM   5451  C  C     . LYS H 4 43  ? -39.918 -41.286 27.078 1.00 59.64  ? 40   LYS H C     1 
ATOM   5452  O  O     . LYS H 4 43  ? -40.260 -42.446 27.255 1.00 59.62  ? 40   LYS H O     1 
ATOM   5453  C  CB    . LYS H 4 43  ? -39.929 -40.192 24.839 1.00 60.00  ? 40   LYS H CB    1 
ATOM   5454  C  CG    . LYS H 4 43  ? -40.792 -39.832 23.660 1.00 60.93  ? 40   LYS H CG    1 
ATOM   5455  C  CD    . LYS H 4 43  ? -39.927 -39.439 22.478 1.00 63.45  ? 40   LYS H CD    1 
ATOM   5456  C  CE    . LYS H 4 43  ? -40.771 -39.081 21.258 1.00 64.50  ? 40   LYS H CE    1 
ATOM   5457  N  NZ    . LYS H 4 43  ? -39.889 -38.694 20.120 1.00 65.34  ? 40   LYS H NZ    1 
ATOM   5458  N  N     . VAL H 4 44  ? -38.872 -40.732 27.690 1.00 59.89  ? 41   VAL H N     1 
ATOM   5459  C  CA    . VAL H 4 44  ? -38.001 -41.505 28.584 1.00 59.89  ? 41   VAL H CA    1 
ATOM   5460  C  C     . VAL H 4 44  ? -38.760 -41.964 29.830 1.00 60.26  ? 41   VAL H C     1 
ATOM   5461  O  O     . VAL H 4 44  ? -38.521 -43.058 30.343 1.00 60.01  ? 41   VAL H O     1 
ATOM   5462  C  CB    . VAL H 4 44  ? -36.722 -40.728 28.970 1.00 59.83  ? 41   VAL H CB    1 
ATOM   5463  C  CG1   . VAL H 4 44  ? -35.761 -41.632 29.731 1.00 59.81  ? 41   VAL H CG1   1 
ATOM   5464  C  CG2   . VAL H 4 44  ? -36.025 -40.182 27.730 1.00 59.21  ? 41   VAL H CG2   1 
ATOM   5465  N  N     . LEU H 4 45  ? -39.688 -41.128 30.297 1.00 60.90  ? 42   LEU H N     1 
ATOM   5466  C  CA    . LEU H 4 45  ? -40.586 -41.498 31.388 1.00 61.32  ? 42   LEU H CA    1 
ATOM   5467  C  C     . LEU H 4 45  ? -41.387 -42.750 31.048 1.00 61.88  ? 42   LEU H C     1 
ATOM   5468  O  O     . LEU H 4 45  ? -41.496 -43.664 31.867 1.00 62.10  ? 42   LEU H O     1 
ATOM   5469  C  CB    . LEU H 4 45  ? -41.533 -40.348 31.725 1.00 60.99  ? 42   LEU H CB    1 
ATOM   5470  C  CG    . LEU H 4 45  ? -42.652 -40.664 32.721 1.00 60.96  ? 42   LEU H CG    1 
ATOM   5471  C  CD1   . LEU H 4 45  ? -42.115 -41.109 34.080 1.00 60.78  ? 42   LEU H CD1   1 
ATOM   5472  C  CD2   . LEU H 4 45  ? -43.570 -39.471 32.882 1.00 61.28  ? 42   LEU H CD2   1 
ATOM   5473  N  N     . LYS H 4 46  ? -41.946 -42.794 29.841 1.00 62.45  ? 43   LYS H N     1 
ATOM   5474  C  CA    . LYS H 4 46  ? -42.761 -43.939 29.442 1.00 63.15  ? 43   LYS H CA    1 
ATOM   5475  C  C     . LYS H 4 46  ? -41.921 -45.199 29.257 1.00 63.47  ? 43   LYS H C     1 
ATOM   5476  O  O     . LYS H 4 46  ? -42.405 -46.301 29.498 1.00 63.75  ? 43   LYS H O     1 
ATOM   5477  C  CB    . LYS H 4 46  ? -43.604 -43.631 28.201 1.00 63.30  ? 43   LYS H CB    1 
ATOM   5478  C  CG    . LYS H 4 46  ? -44.788 -42.695 28.471 1.00 63.59  ? 43   LYS H CG    1 
ATOM   5479  C  CD    . LYS H 4 46  ? -45.572 -43.130 29.704 1.00 64.38  ? 43   LYS H CD    1 
ATOM   5480  C  CE    . LYS H 4 46  ? -46.701 -42.150 30.012 1.00 65.92  ? 43   LYS H CE    1 
ATOM   5481  N  NZ    . LYS H 4 46  ? -47.353 -42.379 31.340 1.00 65.00  ? 43   LYS H NZ    1 
ATOM   5482  N  N     . GLN H 4 47  ? -40.660 -45.026 28.860 1.00 63.76  ? 44   GLN H N     1 
ATOM   5483  C  CA    . GLN H 4 47  ? -39.699 -46.133 28.803 1.00 63.97  ? 44   GLN H CA    1 
ATOM   5484  C  C     . GLN H 4 47  ? -39.364 -46.699 30.180 1.00 63.69  ? 44   GLN H C     1 
ATOM   5485  O  O     . GLN H 4 47  ? -38.985 -47.862 30.303 1.00 64.03  ? 44   GLN H O     1 
ATOM   5486  C  CB    . GLN H 4 47  ? -38.396 -45.682 28.143 1.00 64.14  ? 44   GLN H CB    1 
ATOM   5487  C  CG    . GLN H 4 47  ? -38.418 -45.660 26.630 1.00 65.39  ? 44   GLN H CG    1 
ATOM   5488  C  CD    . GLN H 4 47  ? -37.087 -46.112 26.014 1.00 66.94  ? 44   GLN H CD    1 
ATOM   5489  O  OE1   . GLN H 4 47  ? -36.000 -45.770 26.497 1.00 66.06  ? 44   GLN H OE1   1 
ATOM   5490  N  NE2   . GLN H 4 47  ? -37.177 -46.889 24.938 1.00 67.58  ? 44   GLN H NE2   1 
ATOM   5491  N  N     . VAL H 4 48  ? -39.507 -45.870 31.208 1.00 63.44  ? 45   VAL H N     1 
ATOM   5492  C  CA    . VAL H 4 48  ? -38.976 -46.164 32.542 1.00 62.91  ? 45   VAL H CA    1 
ATOM   5493  C  C     . VAL H 4 48  ? -40.075 -46.411 33.581 1.00 62.63  ? 45   VAL H C     1 
ATOM   5494  O  O     . VAL H 4 48  ? -39.886 -47.185 34.516 1.00 62.63  ? 45   VAL H O     1 
ATOM   5495  C  CB    . VAL H 4 48  ? -37.951 -45.052 32.957 1.00 63.07  ? 45   VAL H CB    1 
ATOM   5496  C  CG1   . VAL H 4 48  ? -38.210 -44.490 34.350 1.00 62.20  ? 45   VAL H CG1   1 
ATOM   5497  C  CG2   . VAL H 4 48  ? -36.513 -45.554 32.795 1.00 63.50  ? 45   VAL H CG2   1 
ATOM   5498  N  N     . HIS H 4 49  ? -41.211 -45.742 33.411 1.00 62.37  ? 46   HIS H N     1 
ATOM   5499  C  CA    . HIS H 4 49  ? -42.425 -46.035 34.154 1.00 62.51  ? 46   HIS H CA    1 
ATOM   5500  C  C     . HIS H 4 49  ? -43.590 -45.755 33.206 1.00 62.65  ? 46   HIS H C     1 
ATOM   5501  O  O     . HIS H 4 49  ? -44.072 -44.610 33.143 1.00 62.64  ? 46   HIS H O     1 
ATOM   5502  C  CB    . HIS H 4 49  ? -42.557 -45.146 35.390 1.00 62.61  ? 46   HIS H CB    1 
ATOM   5503  C  CG    . HIS H 4 49  ? -41.565 -45.433 36.477 1.00 63.22  ? 46   HIS H CG    1 
ATOM   5504  N  ND1   . HIS H 4 49  ? -41.794 -46.358 37.473 1.00 63.71  ? 46   HIS H ND1   1 
ATOM   5505  C  CD2   . HIS H 4 49  ? -40.362 -44.876 36.753 1.00 62.92  ? 46   HIS H CD2   1 
ATOM   5506  C  CE1   . HIS H 4 49  ? -40.764 -46.376 38.301 1.00 63.93  ? 46   HIS H CE1   1 
ATOM   5507  N  NE2   . HIS H 4 49  ? -39.879 -45.489 37.884 1.00 63.53  ? 46   HIS H NE2   1 
ATOM   5508  N  N     . PRO H 4 50  ? -44.047 -46.787 32.457 1.00 62.47  ? 47   PRO H N     1 
ATOM   5509  C  CA    . PRO H 4 50  ? -45.059 -46.577 31.416 1.00 62.21  ? 47   PRO H CA    1 
ATOM   5510  C  C     . PRO H 4 50  ? -46.424 -46.155 31.959 1.00 62.16  ? 47   PRO H C     1 
ATOM   5511  O  O     . PRO H 4 50  ? -47.194 -45.518 31.234 1.00 62.34  ? 47   PRO H O     1 
ATOM   5512  C  CB    . PRO H 4 50  ? -45.158 -47.943 30.725 1.00 62.16  ? 47   PRO H CB    1 
ATOM   5513  C  CG    . PRO H 4 50  ? -43.980 -48.730 31.199 1.00 62.16  ? 47   PRO H CG    1 
ATOM   5514  C  CD    . PRO H 4 50  ? -43.660 -48.204 32.556 1.00 62.52  ? 47   PRO H CD    1 
ATOM   5515  N  N     . ASP H 4 51  ? -46.716 -46.485 33.215 1.00 61.76  ? 48   ASP H N     1 
ATOM   5516  C  CA    . ASP H 4 51  ? -48.017 -46.156 33.796 1.00 61.64  ? 48   ASP H CA    1 
ATOM   5517  C  C     . ASP H 4 51  ? -47.992 -44.893 34.651 1.00 61.45  ? 48   ASP H C     1 
ATOM   5518  O  O     . ASP H 4 51  ? -49.029 -44.475 35.192 1.00 61.50  ? 48   ASP H O     1 
ATOM   5519  C  CB    . ASP H 4 51  ? -48.567 -47.338 34.603 1.00 61.90  ? 48   ASP H CB    1 
ATOM   5520  C  CG    . ASP H 4 51  ? -48.849 -48.551 33.735 1.00 62.81  ? 48   ASP H CG    1 
ATOM   5521  O  OD1   . ASP H 4 51  ? -49.682 -48.439 32.807 1.00 63.31  ? 48   ASP H OD1   1 
ATOM   5522  O  OD2   . ASP H 4 51  ? -48.232 -49.616 33.978 1.00 63.99  ? 48   ASP H OD2   1 
ATOM   5523  N  N     . THR H 4 52  ? -46.814 -44.278 34.761 1.00 61.04  ? 49   THR H N     1 
ATOM   5524  C  CA    . THR H 4 52  ? -46.631 -43.074 35.585 1.00 60.14  ? 49   THR H CA    1 
ATOM   5525  C  C     . THR H 4 52  ? -46.648 -41.820 34.734 1.00 59.58  ? 49   THR H C     1 
ATOM   5526  O  O     . THR H 4 52  ? -46.034 -41.782 33.669 1.00 59.73  ? 49   THR H O     1 
ATOM   5527  C  CB    . THR H 4 52  ? -45.317 -43.130 36.359 1.00 60.04  ? 49   THR H CB    1 
ATOM   5528  O  OG1   . THR H 4 52  ? -45.288 -44.330 37.129 1.00 61.11  ? 49   THR H OG1   1 
ATOM   5529  C  CG2   . THR H 4 52  ? -45.179 -41.951 37.303 1.00 59.72  ? 49   THR H CG2   1 
ATOM   5530  N  N     . GLY H 4 53  ? -47.363 -40.802 35.210 1.00 58.93  ? 50   GLY H N     1 
ATOM   5531  C  CA    . GLY H 4 53  ? -47.442 -39.507 34.534 1.00 58.09  ? 50   GLY H CA    1 
ATOM   5532  C  C     . GLY H 4 53  ? -46.619 -38.460 35.261 1.00 57.73  ? 50   GLY H C     1 
ATOM   5533  O  O     . GLY H 4 53  ? -45.904 -38.772 36.216 1.00 58.11  ? 50   GLY H O     1 
ATOM   5534  N  N     . ILE H 4 54  ? -46.725 -37.216 34.812 1.00 57.06  ? 51   ILE H N     1 
ATOM   5535  C  CA    . ILE H 4 54  ? -45.922 -36.124 35.346 1.00 56.58  ? 51   ILE H CA    1 
ATOM   5536  C  C     . ILE H 4 54  ? -46.664 -34.799 35.245 1.00 56.30  ? 51   ILE H C     1 
ATOM   5537  O  O     . ILE H 4 54  ? -47.204 -34.462 34.186 1.00 55.97  ? 51   ILE H O     1 
ATOM   5538  C  CB    . ILE H 4 54  ? -44.535 -36.033 34.633 1.00 56.89  ? 51   ILE H CB    1 
ATOM   5539  C  CG1   . ILE H 4 54  ? -43.645 -34.971 35.292 1.00 56.48  ? 51   ILE H CG1   1 
ATOM   5540  C  CG2   . ILE H 4 54  ? -44.684 -35.800 33.116 1.00 56.90  ? 51   ILE H CG2   1 
ATOM   5541  C  CD1   . ILE H 4 54  ? -42.164 -35.279 35.180 1.00 55.89  ? 51   ILE H CD1   1 
ATOM   5542  N  N     . SER H 4 55  ? -46.693 -34.061 36.353 1.00 55.73  ? 52   SER H N     1 
ATOM   5543  C  CA    . SER H 4 55  ? -47.356 -32.769 36.392 1.00 55.18  ? 52   SER H CA    1 
ATOM   5544  C  C     . SER H 4 55  ? -46.532 -31.746 35.625 1.00 55.07  ? 52   SER H C     1 
ATOM   5545  O  O     . SER H 4 55  ? -45.363 -31.981 35.332 1.00 55.05  ? 52   SER H O     1 
ATOM   5546  C  CB    . SER H 4 55  ? -47.569 -32.312 37.835 1.00 55.36  ? 52   SER H CB    1 
ATOM   5547  O  OG    . SER H 4 55  ? -46.412 -31.682 38.350 1.00 54.64  ? 52   SER H OG    1 
ATOM   5548  N  N     . SER H 4 56  ? -47.146 -30.616 35.294 1.00 54.98  ? 53   SER H N     1 
ATOM   5549  C  CA    . SER H 4 56  ? -46.460 -29.571 34.546 1.00 55.20  ? 53   SER H CA    1 
ATOM   5550  C  C     . SER H 4 56  ? -45.256 -29.043 35.289 1.00 54.99  ? 53   SER H C     1 
ATOM   5551  O  O     . SER H 4 56  ? -44.154 -28.972 34.732 1.00 55.21  ? 53   SER H O     1 
ATOM   5552  C  CB    . SER H 4 56  ? -47.404 -28.418 34.227 1.00 55.29  ? 53   SER H CB    1 
ATOM   5553  O  OG    . SER H 4 56  ? -48.000 -28.645 32.964 1.00 57.59  ? 53   SER H OG    1 
ATOM   5554  N  N     . LYS H 4 57  ? -45.470 -28.676 36.547 1.00 54.44  ? 54   LYS H N     1 
ATOM   5555  C  CA    . LYS H 4 57  ? -44.408 -28.127 37.365 1.00 54.17  ? 54   LYS H CA    1 
ATOM   5556  C  C     . LYS H 4 57  ? -43.225 -29.086 37.481 1.00 53.65  ? 54   LYS H C     1 
ATOM   5557  O  O     . LYS H 4 57  ? -42.066 -28.656 37.429 1.00 53.56  ? 54   LYS H O     1 
ATOM   5558  C  CB    . LYS H 4 57  ? -44.945 -27.720 38.735 1.00 54.62  ? 54   LYS H CB    1 
ATOM   5559  C  CG    . LYS H 4 57  ? -45.710 -26.399 38.701 1.00 56.05  ? 54   LYS H CG    1 
ATOM   5560  C  CD    . LYS H 4 57  ? -46.726 -26.289 39.850 1.00 59.45  ? 54   LYS H CD    1 
ATOM   5561  C  CE    . LYS H 4 57  ? -47.533 -24.980 39.760 1.00 60.13  ? 54   LYS H CE    1 
ATOM   5562  N  NZ    . LYS H 4 57  ? -48.947 -25.145 40.208 1.00 60.05  ? 54   LYS H NZ    1 
ATOM   5563  N  N     . ALA H 4 58  ? -43.506 -30.382 37.602 1.00 52.79  ? 55   ALA H N     1 
ATOM   5564  C  CA    . ALA H 4 58  ? -42.435 -31.373 37.635 1.00 52.05  ? 55   ALA H CA    1 
ATOM   5565  C  C     . ALA H 4 58  ? -41.717 -31.438 36.287 1.00 51.53  ? 55   ALA H C     1 
ATOM   5566  O  O     . ALA H 4 58  ? -40.485 -31.529 36.222 1.00 51.56  ? 55   ALA H O     1 
ATOM   5567  C  CB    . ALA H 4 58  ? -42.971 -32.732 38.036 1.00 52.23  ? 55   ALA H CB    1 
ATOM   5568  N  N     . MET H 4 59  ? -42.487 -31.374 35.211 1.00 50.58  ? 56   MET H N     1 
ATOM   5569  C  CA    . MET H 4 59  ? -41.900 -31.351 33.879 1.00 50.00  ? 56   MET H CA    1 
ATOM   5570  C  C     . MET H 4 59  ? -41.014 -30.118 33.687 1.00 49.35  ? 56   MET H C     1 
ATOM   5571  O  O     . MET H 4 59  ? -39.945 -30.184 33.069 1.00 48.95  ? 56   MET H O     1 
ATOM   5572  C  CB    . MET H 4 59  ? -42.989 -31.384 32.805 1.00 50.01  ? 56   MET H CB    1 
ATOM   5573  C  CG    . MET H 4 59  ? -42.434 -31.329 31.404 1.00 49.44  ? 56   MET H CG    1 
ATOM   5574  S  SD    . MET H 4 59  ? -41.292 -32.681 31.127 1.00 50.88  ? 56   MET H SD    1 
ATOM   5575  C  CE    . MET H 4 59  ? -42.359 -33.934 30.403 1.00 50.56  ? 56   MET H CE    1 
ATOM   5576  N  N     . SER H 4 60  ? -41.466 -28.994 34.223 1.00 48.50  ? 57   SER H N     1 
ATOM   5577  C  CA    . SER H 4 60  ? -40.708 -27.762 34.096 1.00 47.98  ? 57   SER H CA    1 
ATOM   5578  C  C     . SER H 4 60  ? -39.355 -27.870 34.817 1.00 47.41  ? 57   SER H C     1 
ATOM   5579  O  O     . SER H 4 60  ? -38.335 -27.416 34.297 1.00 47.12  ? 57   SER H O     1 
ATOM   5580  C  CB    . SER H 4 60  ? -41.526 -26.591 34.609 1.00 47.87  ? 57   SER H CB    1 
ATOM   5581  O  OG    . SER H 4 60  ? -40.876 -25.383 34.307 1.00 48.92  ? 57   SER H OG    1 
ATOM   5582  N  N     . ILE H 4 61  ? -39.356 -28.508 35.989 1.00 46.95  ? 58   ILE H N     1 
ATOM   5583  C  CA    . ILE H 4 61  ? -38.130 -28.800 36.745 1.00 46.21  ? 58   ILE H CA    1 
ATOM   5584  C  C     . ILE H 4 61  ? -37.174 -29.714 35.991 1.00 46.21  ? 58   ILE H C     1 
ATOM   5585  O  O     . ILE H 4 61  ? -35.973 -29.454 35.929 1.00 46.49  ? 58   ILE H O     1 
ATOM   5586  C  CB    . ILE H 4 61  ? -38.443 -29.416 38.110 1.00 45.96  ? 58   ILE H CB    1 
ATOM   5587  C  CG1   . ILE H 4 61  ? -39.072 -28.357 39.016 1.00 45.52  ? 58   ILE H CG1   1 
ATOM   5588  C  CG2   . ILE H 4 61  ? -37.176 -29.963 38.742 1.00 45.39  ? 58   ILE H CG2   1 
ATOM   5589  C  CD1   . ILE H 4 61  ? -39.962 -28.913 40.074 1.00 46.42  ? 58   ILE H CD1   1 
ATOM   5590  N  N     . MET H 4 62  ? -37.709 -30.775 35.402 1.00 46.02  ? 59   MET H N     1 
ATOM   5591  C  CA    . MET H 4 62  ? -36.895 -31.686 34.606 1.00 45.67  ? 59   MET H CA    1 
ATOM   5592  C  C     . MET H 4 62  ? -36.222 -30.971 33.446 1.00 45.74  ? 59   MET H C     1 
ATOM   5593  O  O     . MET H 4 62  ? -35.061 -31.255 33.112 1.00 45.41  ? 59   MET H O     1 
ATOM   5594  C  CB    . MET H 4 62  ? -37.742 -32.843 34.076 1.00 45.78  ? 59   MET H CB    1 
ATOM   5595  C  CG    . MET H 4 62  ? -38.164 -33.831 35.132 1.00 44.93  ? 59   MET H CG    1 
ATOM   5596  S  SD    . MET H 4 62  ? -36.759 -34.470 36.073 1.00 46.21  ? 59   MET H SD    1 
ATOM   5597  C  CE    . MET H 4 62  ? -35.782 -35.282 34.811 1.00 41.68  ? 59   MET H CE    1 
ATOM   5598  N  N     . ASN H 4 63  ? -36.958 -30.046 32.831 1.00 45.74  ? 60   ASN H N     1 
ATOM   5599  C  CA    . ASN H 4 63  ? -36.442 -29.289 31.698 1.00 45.72  ? 60   ASN H CA    1 
ATOM   5600  C  C     . ASN H 4 63  ? -35.294 -28.389 32.131 1.00 45.66  ? 60   ASN H C     1 
ATOM   5601  O  O     . ASN H 4 63  ? -34.264 -28.326 31.448 1.00 45.75  ? 60   ASN H O     1 
ATOM   5602  C  CB    . ASN H 4 63  ? -37.557 -28.483 31.032 1.00 46.06  ? 60   ASN H CB    1 
ATOM   5603  C  CG    . ASN H 4 63  ? -37.118 -27.847 29.729 1.00 46.90  ? 60   ASN H CG    1 
ATOM   5604  O  OD1   . ASN H 4 63  ? -36.535 -28.512 28.866 1.00 48.50  ? 60   ASN H OD1   1 
ATOM   5605  N  ND2   . ASN H 4 63  ? -37.401 -26.554 29.573 1.00 45.46  ? 60   ASN H ND2   1 
ATOM   5606  N  N     . SER H 4 64  ? -35.470 -27.706 33.266 1.00 45.13  ? 61   SER H N     1 
ATOM   5607  C  CA    . SER H 4 64  ? -34.390 -26.928 33.873 1.00 44.74  ? 61   SER H CA    1 
ATOM   5608  C  C     . SER H 4 64  ? -33.182 -27.836 34.122 1.00 44.68  ? 61   SER H C     1 
ATOM   5609  O  O     . SER H 4 64  ? -32.060 -27.538 33.689 1.00 44.54  ? 61   SER H O     1 
ATOM   5610  C  CB    . SER H 4 64  ? -34.842 -26.272 35.180 1.00 44.89  ? 61   SER H CB    1 
ATOM   5611  O  OG    . SER H 4 64  ? -35.951 -25.412 34.982 1.00 44.59  ? 61   SER H OG    1 
ATOM   5612  N  N     . PHE H 4 65  ? -33.416 -28.965 34.780 1.00 44.26  ? 62   PHE H N     1 
ATOM   5613  C  CA    . PHE H 4 65  ? -32.333 -29.915 35.014 1.00 43.98  ? 62   PHE H CA    1 
ATOM   5614  C  C     . PHE H 4 65  ? -31.519 -30.235 33.754 1.00 44.07  ? 62   PHE H C     1 
ATOM   5615  O  O     . PHE H 4 65  ? -30.289 -30.183 33.780 1.00 43.69  ? 62   PHE H O     1 
ATOM   5616  C  CB    . PHE H 4 65  ? -32.865 -31.197 35.618 1.00 43.60  ? 62   PHE H CB    1 
ATOM   5617  C  CG    . PHE H 4 65  ? -31.842 -32.279 35.703 1.00 43.93  ? 62   PHE H CG    1 
ATOM   5618  C  CD1   . PHE H 4 65  ? -30.802 -32.194 36.629 1.00 42.82  ? 62   PHE H CD1   1 
ATOM   5619  C  CD2   . PHE H 4 65  ? -31.912 -33.388 34.856 1.00 43.03  ? 62   PHE H CD2   1 
ATOM   5620  C  CE1   . PHE H 4 65  ? -29.851 -33.197 36.716 1.00 44.53  ? 62   PHE H CE1   1 
ATOM   5621  C  CE2   . PHE H 4 65  ? -30.967 -34.398 34.935 1.00 42.91  ? 62   PHE H CE2   1 
ATOM   5622  C  CZ    . PHE H 4 65  ? -29.933 -34.312 35.861 1.00 44.36  ? 62   PHE H CZ    1 
ATOM   5623  N  N     . VAL H 4 66  ? -32.203 -30.563 32.657 1.00 44.44  ? 63   VAL H N     1 
ATOM   5624  C  CA    . VAL H 4 66  ? -31.508 -30.905 31.412 1.00 44.50  ? 63   VAL H CA    1 
ATOM   5625  C  C     . VAL H 4 66  ? -30.728 -29.700 30.873 1.00 44.96  ? 63   VAL H C     1 
ATOM   5626  O  O     . VAL H 4 66  ? -29.559 -29.832 30.484 1.00 45.23  ? 63   VAL H O     1 
ATOM   5627  C  CB    . VAL H 4 66  ? -32.463 -31.482 30.345 1.00 44.52  ? 63   VAL H CB    1 
ATOM   5628  C  CG1   . VAL H 4 66  ? -31.731 -31.704 29.031 1.00 44.77  ? 63   VAL H CG1   1 
ATOM   5629  C  CG2   . VAL H 4 66  ? -33.050 -32.806 30.811 1.00 44.18  ? 63   VAL H CG2   1 
ATOM   5630  N  N     . ASN H 4 67  ? -31.356 -28.525 30.887 1.00 45.11  ? 64   ASN H N     1 
ATOM   5631  C  CA    . ASN H 4 67  ? -30.655 -27.297 30.517 1.00 45.11  ? 64   ASN H CA    1 
ATOM   5632  C  C     . ASN H 4 67  ? -29.429 -27.034 31.378 1.00 44.67  ? 64   ASN H C     1 
ATOM   5633  O  O     . ASN H 4 67  ? -28.355 -26.750 30.846 1.00 44.63  ? 64   ASN H O     1 
ATOM   5634  C  CB    . ASN H 4 67  ? -31.598 -26.097 30.542 1.00 45.45  ? 64   ASN H CB    1 
ATOM   5635  C  CG    . ASN H 4 67  ? -32.494 -26.039 29.321 1.00 46.65  ? 64   ASN H CG    1 
ATOM   5636  O  OD1   . ASN H 4 67  ? -32.052 -26.274 28.192 1.00 46.76  ? 64   ASN H OD1   1 
ATOM   5637  N  ND2   . ASN H 4 67  ? -33.766 -25.733 29.543 1.00 49.02  ? 64   ASN H ND2   1 
ATOM   5638  N  N     . ASP H 4 68  ? -29.592 -27.143 32.696 1.00 44.12  ? 65   ASP H N     1 
ATOM   5639  C  CA    . ASP H 4 68  ? -28.493 -26.943 33.627 1.00 43.79  ? 65   ASP H CA    1 
ATOM   5640  C  C     . ASP H 4 68  ? -27.336 -27.889 33.307 1.00 43.73  ? 65   ASP H C     1 
ATOM   5641  O  O     . ASP H 4 68  ? -26.215 -27.435 33.076 1.00 43.54  ? 65   ASP H O     1 
ATOM   5642  C  CB    . ASP H 4 68  ? -28.981 -27.110 35.070 1.00 44.13  ? 65   ASP H CB    1 
ATOM   5643  C  CG    . ASP H 4 68  ? -27.887 -26.863 36.118 1.00 44.55  ? 65   ASP H CG    1 
ATOM   5644  O  OD1   . ASP H 4 68  ? -26.821 -26.291 35.788 1.00 44.64  ? 65   ASP H OD1   1 
ATOM   5645  O  OD2   . ASP H 4 68  ? -28.108 -27.258 37.291 1.00 44.09  ? 65   ASP H OD2   1 
ATOM   5646  N  N     . VAL H 4 69  ? -27.603 -29.192 33.263 1.00 43.68  ? 66   VAL H N     1 
ATOM   5647  C  CA    . VAL H 4 69  ? -26.525 -30.171 33.047 1.00 43.78  ? 66   VAL H CA    1 
ATOM   5648  C  C     . VAL H 4 69  ? -25.842 -29.967 31.702 1.00 43.77  ? 66   VAL H C     1 
ATOM   5649  O  O     . VAL H 4 69  ? -24.615 -30.039 31.617 1.00 43.76  ? 66   VAL H O     1 
ATOM   5650  C  CB    . VAL H 4 69  ? -27.006 -31.626 33.195 1.00 43.65  ? 66   VAL H CB    1 
ATOM   5651  C  CG1   . VAL H 4 69  ? -25.871 -32.586 32.956 1.00 44.24  ? 66   VAL H CG1   1 
ATOM   5652  C  CG2   . VAL H 4 69  ? -27.534 -31.845 34.587 1.00 44.52  ? 66   VAL H CG2   1 
ATOM   5653  N  N     . PHE H 4 70  ? -26.633 -29.712 30.658 1.00 43.79  ? 67   PHE H N     1 
ATOM   5654  C  CA    . PHE H 4 70  ? -26.086 -29.317 29.365 1.00 43.79  ? 67   PHE H CA    1 
ATOM   5655  C  C     . PHE H 4 70  ? -25.019 -28.224 29.543 1.00 44.04  ? 67   PHE H C     1 
ATOM   5656  O  O     . PHE H 4 70  ? -23.860 -28.419 29.149 1.00 43.67  ? 67   PHE H O     1 
ATOM   5657  C  CB    . PHE H 4 70  ? -27.211 -28.863 28.422 1.00 43.65  ? 67   PHE H CB    1 
ATOM   5658  C  CG    . PHE H 4 70  ? -26.734 -28.418 27.069 1.00 44.38  ? 67   PHE H CG    1 
ATOM   5659  C  CD1   . PHE H 4 70  ? -26.740 -29.290 25.984 1.00 45.76  ? 67   PHE H CD1   1 
ATOM   5660  C  CD2   . PHE H 4 70  ? -26.288 -27.121 26.876 1.00 45.55  ? 67   PHE H CD2   1 
ATOM   5661  C  CE1   . PHE H 4 70  ? -26.291 -28.875 24.728 1.00 46.25  ? 67   PHE H CE1   1 
ATOM   5662  C  CE2   . PHE H 4 70  ? -25.846 -26.698 25.634 1.00 46.89  ? 67   PHE H CE2   1 
ATOM   5663  C  CZ    . PHE H 4 70  ? -25.840 -27.580 24.557 1.00 46.66  ? 67   PHE H CZ    1 
ATOM   5664  N  N     . GLU H 4 71  ? -25.412 -27.096 30.152 1.00 44.50  ? 68   GLU H N     1 
ATOM   5665  C  CA    . GLU H 4 71  ? -24.540 -25.914 30.285 1.00 44.98  ? 68   GLU H CA    1 
ATOM   5666  C  C     . GLU H 4 71  ? -23.273 -26.233 31.067 1.00 44.35  ? 68   GLU H C     1 
ATOM   5667  O  O     . GLU H 4 71  ? -22.170 -25.883 30.650 1.00 44.34  ? 68   GLU H O     1 
ATOM   5668  C  CB    . GLU H 4 71  ? -25.282 -24.721 30.907 1.00 45.44  ? 68   GLU H CB    1 
ATOM   5669  C  CG    . GLU H 4 71  ? -26.015 -23.835 29.887 1.00 49.17  ? 68   GLU H CG    1 
ATOM   5670  C  CD    . GLU H 4 71  ? -27.105 -22.925 30.497 1.00 55.20  ? 68   GLU H CD    1 
ATOM   5671  O  OE1   . GLU H 4 71  ? -27.490 -23.115 31.685 1.00 57.02  ? 68   GLU H OE1   1 
ATOM   5672  O  OE2   . GLU H 4 71  ? -27.588 -22.012 29.776 1.00 57.50  ? 68   GLU H OE2   1 
ATOM   5673  N  N     . ARG H 4 72  ? -23.436 -26.929 32.183 1.00 43.67  ? 69   ARG H N     1 
ATOM   5674  C  CA    . ARG H 4 72  ? -22.297 -27.411 32.949 1.00 43.43  ? 69   ARG H CA    1 
ATOM   5675  C  C     . ARG H 4 72  ? -21.306 -28.251 32.125 1.00 42.88  ? 69   ARG H C     1 
ATOM   5676  O  O     . ARG H 4 72  ? -20.111 -27.971 32.121 1.00 42.88  ? 69   ARG H O     1 
ATOM   5677  C  CB    . ARG H 4 72  ? -22.779 -28.184 34.174 1.00 43.46  ? 69   ARG H CB    1 
ATOM   5678  C  CG    . ARG H 4 72  ? -23.449 -27.322 35.203 1.00 45.80  ? 69   ARG H CG    1 
ATOM   5679  C  CD    . ARG H 4 72  ? -23.432 -28.026 36.538 1.00 49.35  ? 69   ARG H CD    1 
ATOM   5680  N  NE    . ARG H 4 72  ? -24.761 -28.225 37.112 1.00 50.08  ? 69   ARG H NE    1 
ATOM   5681  C  CZ    . ARG H 4 72  ? -24.975 -28.811 38.289 1.00 51.55  ? 69   ARG H CZ    1 
ATOM   5682  N  NH1   . ARG H 4 72  ? -23.958 -29.275 39.006 1.00 51.27  ? 69   ARG H NH1   1 
ATOM   5683  N  NH2   . ARG H 4 72  ? -26.210 -28.945 38.755 1.00 53.62  ? 69   ARG H NH2   1 
ATOM   5684  N  N     . ILE H 4 73  ? -21.800 -29.277 31.435 1.00 42.68  ? 70   ILE H N     1 
ATOM   5685  C  CA    . ILE H 4 73  ? -20.945 -30.157 30.636 1.00 42.21  ? 70   ILE H CA    1 
ATOM   5686  C  C     . ILE H 4 73  ? -20.305 -29.430 29.453 1.00 42.02  ? 70   ILE H C     1 
ATOM   5687  O  O     . ILE H 4 73  ? -19.101 -29.505 29.278 1.00 42.12  ? 70   ILE H O     1 
ATOM   5688  C  CB    . ILE H 4 73  ? -21.700 -31.431 30.178 1.00 42.30  ? 70   ILE H CB    1 
ATOM   5689  C  CG1   . ILE H 4 73  ? -22.088 -32.270 31.395 1.00 41.93  ? 70   ILE H CG1   1 
ATOM   5690  C  CG2   . ILE H 4 73  ? -20.851 -32.267 29.223 1.00 42.30  ? 70   ILE H CG2   1 
ATOM   5691  C  CD1   . ILE H 4 73  ? -22.807 -33.533 31.060 1.00 41.21  ? 70   ILE H CD1   1 
ATOM   5692  N  N     . ALA H 4 74  ? -21.096 -28.723 28.652 1.00 42.01  ? 71   ALA H N     1 
ATOM   5693  C  CA    . ALA H 4 74  ? -20.542 -27.960 27.536 1.00 42.35  ? 71   ALA H CA    1 
ATOM   5694  C  C     . ALA H 4 74  ? -19.549 -26.912 28.021 1.00 42.91  ? 71   ALA H C     1 
ATOM   5695  O  O     . ALA H 4 74  ? -18.483 -26.727 27.418 1.00 42.95  ? 71   ALA H O     1 
ATOM   5696  C  CB    . ALA H 4 74  ? -21.647 -27.304 26.740 1.00 42.37  ? 71   ALA H CB    1 
ATOM   5697  N  N     . GLY H 4 75  ? -19.902 -26.224 29.109 1.00 43.27  ? 72   GLY H N     1 
ATOM   5698  C  CA    . GLY H 4 75  ? -19.029 -25.213 29.684 1.00 43.97  ? 72   GLY H CA    1 
ATOM   5699  C  C     . GLY H 4 75  ? -17.660 -25.793 29.969 1.00 44.70  ? 72   GLY H C     1 
ATOM   5700  O  O     . GLY H 4 75  ? -16.642 -25.259 29.523 1.00 44.62  ? 72   GLY H O     1 
ATOM   5701  N  N     . GLU H 4 76  ? -17.637 -26.901 30.704 1.00 45.30  ? 73   GLU H N     1 
ATOM   5702  C  CA    . GLU H 4 76  ? -16.384 -27.544 31.039 1.00 46.36  ? 73   GLU H CA    1 
ATOM   5703  C  C     . GLU H 4 76  ? -15.630 -28.019 29.799 1.00 46.41  ? 73   GLU H C     1 
ATOM   5704  O  O     . GLU H 4 76  ? -14.403 -27.852 29.710 1.00 47.18  ? 73   GLU H O     1 
ATOM   5705  C  CB    . GLU H 4 76  ? -16.604 -28.698 31.998 1.00 46.77  ? 73   GLU H CB    1 
ATOM   5706  C  CG    . GLU H 4 76  ? -15.303 -29.301 32.448 1.00 48.86  ? 73   GLU H CG    1 
ATOM   5707  C  CD    . GLU H 4 76  ? -14.571 -28.397 33.414 1.00 52.15  ? 73   GLU H CD    1 
ATOM   5708  O  OE1   . GLU H 4 76  ? -13.458 -27.924 33.059 1.00 51.68  ? 73   GLU H OE1   1 
ATOM   5709  O  OE2   . GLU H 4 76  ? -15.123 -28.168 34.529 1.00 53.58  ? 73   GLU H OE2   1 
ATOM   5710  N  N     . ALA H 4 77  ? -16.353 -28.589 28.842 1.00 45.96  ? 74   ALA H N     1 
ATOM   5711  C  CA    . ALA H 4 77  ? -15.729 -29.045 27.610 1.00 46.30  ? 74   ALA H CA    1 
ATOM   5712  C  C     . ALA H 4 77  ? -15.067 -27.873 26.911 1.00 46.60  ? 74   ALA H C     1 
ATOM   5713  O  O     . ALA H 4 77  ? -13.950 -27.999 26.403 1.00 46.55  ? 74   ALA H O     1 
ATOM   5714  C  CB    . ALA H 4 77  ? -16.748 -29.693 26.708 1.00 46.39  ? 74   ALA H CB    1 
ATOM   5715  N  N     . SER H 4 78  ? -15.760 -26.733 26.898 1.00 46.88  ? 75   SER H N     1 
ATOM   5716  C  CA    . SER H 4 78  ? -15.207 -25.497 26.359 1.00 47.47  ? 75   SER H CA    1 
ATOM   5717  C  C     . SER H 4 78  ? -13.859 -25.173 26.988 1.00 47.69  ? 75   SER H C     1 
ATOM   5718  O  O     . SER H 4 78  ? -12.873 -24.993 26.278 1.00 47.83  ? 75   SER H O     1 
ATOM   5719  C  CB    . SER H 4 78  ? -16.176 -24.333 26.567 1.00 47.56  ? 75   SER H CB    1 
ATOM   5720  O  OG    . SER H 4 78  ? -15.663 -23.138 25.999 1.00 48.35  ? 75   SER H OG    1 
ATOM   5721  N  N     . ARG H 4 79  ? -13.809 -25.120 28.314 1.00 48.18  ? 76   ARG H N     1 
ATOM   5722  C  CA    . ARG H 4 79  ? -12.560 -24.823 28.996 1.00 49.04  ? 76   ARG H CA    1 
ATOM   5723  C  C     . ARG H 4 79  ? -11.453 -25.822 28.623 1.00 49.21  ? 76   ARG H C     1 
ATOM   5724  O  O     . ARG H 4 79  ? -10.352 -25.418 28.263 1.00 49.32  ? 76   ARG H O     1 
ATOM   5725  C  CB    . ARG H 4 79  ? -12.766 -24.733 30.516 1.00 49.19  ? 76   ARG H CB    1 
ATOM   5726  C  CG    . ARG H 4 79  ? -13.539 -23.498 30.944 1.00 49.70  ? 76   ARG H CG    1 
ATOM   5727  C  CD    . ARG H 4 79  ? -13.932 -23.535 32.420 1.00 50.63  ? 76   ARG H CD    1 
ATOM   5728  N  NE    . ARG H 4 79  ? -15.327 -23.126 32.576 1.00 51.05  ? 76   ARG H NE    1 
ATOM   5729  C  CZ    . ARG H 4 79  ? -16.310 -23.923 32.992 1.00 51.98  ? 76   ARG H CZ    1 
ATOM   5730  N  NH1   . ARG H 4 79  ? -16.053 -25.179 33.346 1.00 53.01  ? 76   ARG H NH1   1 
ATOM   5731  N  NH2   . ARG H 4 79  ? -17.552 -23.455 33.086 1.00 51.69  ? 76   ARG H NH2   1 
ATOM   5732  N  N     . LEU H 4 80  ? -11.751 -27.113 28.695 1.00 49.71  ? 77   LEU H N     1 
ATOM   5733  C  CA    . LEU H 4 80  ? -10.783 -28.138 28.297 1.00 50.93  ? 77   LEU H CA    1 
ATOM   5734  C  C     . LEU H 4 80  ? -10.156 -27.875 26.939 1.00 51.39  ? 77   LEU H C     1 
ATOM   5735  O  O     . LEU H 4 80  ? -8.928  -27.845 26.812 1.00 51.74  ? 77   LEU H O     1 
ATOM   5736  C  CB    . LEU H 4 80  ? -11.429 -29.518 28.266 1.00 50.76  ? 77   LEU H CB    1 
ATOM   5737  C  CG    . LEU H 4 80  ? -11.385 -30.278 29.577 1.00 51.18  ? 77   LEU H CG    1 
ATOM   5738  C  CD1   . LEU H 4 80  ? -12.435 -31.367 29.531 1.00 51.10  ? 77   LEU H CD1   1 
ATOM   5739  C  CD2   . LEU H 4 80  ? -9.980  -30.840 29.833 1.00 51.42  ? 77   LEU H CD2   1 
ATOM   5740  N  N     . ALA H 4 81  ? -11.005 -27.701 25.930 1.00 52.15  ? 78   ALA H N     1 
ATOM   5741  C  CA    . ALA H 4 81  ? -10.544 -27.412 24.578 1.00 53.28  ? 78   ALA H CA    1 
ATOM   5742  C  C     . ALA H 4 81  ? -9.590  -26.240 24.575 1.00 54.10  ? 78   ALA H C     1 
ATOM   5743  O  O     . ALA H 4 81  ? -8.484  -26.357 24.065 1.00 54.71  ? 78   ALA H O     1 
ATOM   5744  C  CB    . ALA H 4 81  ? -11.703 -27.149 23.657 1.00 53.14  ? 78   ALA H CB    1 
ATOM   5745  N  N     . HIS H 4 82  ? -10.006 -25.122 25.162 1.00 55.14  ? 79   HIS H N     1 
ATOM   5746  C  CA    . HIS H 4 82  ? -9.154  -23.946 25.232 1.00 56.39  ? 79   HIS H CA    1 
ATOM   5747  C  C     . HIS H 4 82  ? -7.808  -24.230 25.920 1.00 56.56  ? 79   HIS H C     1 
ATOM   5748  O  O     . HIS H 4 82  ? -6.754  -23.919 25.355 1.00 56.39  ? 79   HIS H O     1 
ATOM   5749  C  CB    . HIS H 4 82  ? -9.881  -22.779 25.901 1.00 56.96  ? 79   HIS H CB    1 
ATOM   5750  C  CG    . HIS H 4 82  ? -9.036  -21.552 26.026 1.00 60.39  ? 79   HIS H CG    1 
ATOM   5751  N  ND1   . HIS H 4 82  ? -8.563  -20.861 24.929 1.00 62.28  ? 79   HIS H ND1   1 
ATOM   5752  C  CD2   . HIS H 4 82  ? -8.554  -20.907 27.115 1.00 63.55  ? 79   HIS H CD2   1 
ATOM   5753  C  CE1   . HIS H 4 82  ? -7.827  -19.843 25.336 1.00 64.30  ? 79   HIS H CE1   1 
ATOM   5754  N  NE2   . HIS H 4 82  ? -7.802  -19.849 26.658 1.00 65.87  ? 79   HIS H NE2   1 
ATOM   5755  N  N     . TYR H 4 83  ? -7.849  -24.839 27.111 1.00 56.81  ? 80   TYR H N     1 
ATOM   5756  C  CA    . TYR H 4 83  ? -6.637  -25.163 27.877 1.00 57.27  ? 80   TYR H CA    1 
ATOM   5757  C  C     . TYR H 4 83  ? -5.592  -25.847 27.025 1.00 57.30  ? 80   TYR H C     1 
ATOM   5758  O  O     . TYR H 4 83  ? -4.400  -25.616 27.195 1.00 57.30  ? 80   TYR H O     1 
ATOM   5759  C  CB    . TYR H 4 83  ? -6.948  -26.065 29.076 1.00 57.43  ? 80   TYR H CB    1 
ATOM   5760  C  CG    . TYR H 4 83  ? -7.839  -25.452 30.140 1.00 59.29  ? 80   TYR H CG    1 
ATOM   5761  C  CD1   . TYR H 4 83  ? -7.959  -24.062 30.279 1.00 60.73  ? 80   TYR H CD1   1 
ATOM   5762  C  CD2   . TYR H 4 83  ? -8.541  -26.265 31.034 1.00 60.28  ? 80   TYR H CD2   1 
ATOM   5763  C  CE1   . TYR H 4 83  ? -8.769  -23.511 31.256 1.00 61.30  ? 80   TYR H CE1   1 
ATOM   5764  C  CE2   . TYR H 4 83  ? -9.348  -25.716 32.019 1.00 60.86  ? 80   TYR H CE2   1 
ATOM   5765  C  CZ    . TYR H 4 83  ? -9.457  -24.343 32.121 1.00 61.64  ? 80   TYR H CZ    1 
ATOM   5766  O  OH    . TYR H 4 83  ? -10.260 -23.796 33.095 1.00 64.66  ? 80   TYR H OH    1 
ATOM   5767  N  N     . ASN H 4 84  ? -6.058  -26.689 26.107 1.00 57.72  ? 81   ASN H N     1 
ATOM   5768  C  CA    . ASN H 4 84  ? -5.187  -27.479 25.245 1.00 57.93  ? 81   ASN H CA    1 
ATOM   5769  C  C     . ASN H 4 84  ? -4.969  -26.910 23.859 1.00 58.17  ? 81   ASN H C     1 
ATOM   5770  O  O     . ASN H 4 84  ? -4.502  -27.625 22.970 1.00 58.38  ? 81   ASN H O     1 
ATOM   5771  C  CB    . ASN H 4 84  ? -5.734  -28.891 25.125 1.00 57.86  ? 81   ASN H CB    1 
ATOM   5772  C  CG    . ASN H 4 84  ? -5.631  -29.646 26.417 1.00 58.43  ? 81   ASN H CG    1 
ATOM   5773  O  OD1   . ASN H 4 84  ? -4.546  -30.110 26.803 1.00 58.95  ? 81   ASN H OD1   1 
ATOM   5774  N  ND2   . ASN H 4 84  ? -6.754  -29.754 27.120 1.00 57.42  ? 81   ASN H ND2   1 
ATOM   5775  N  N     . LYS H 4 85  ? -5.304  -25.634 23.675 1.00 58.32  ? 82   LYS H N     1 
ATOM   5776  C  CA    . LYS H 4 85  ? -5.147  -24.971 22.386 1.00 58.76  ? 82   LYS H CA    1 
ATOM   5777  C  C     . LYS H 4 85  ? -5.753  -25.819 21.261 1.00 58.67  ? 82   LYS H C     1 
ATOM   5778  O  O     . LYS H 4 85  ? -5.075  -26.153 20.290 1.00 58.61  ? 82   LYS H O     1 
ATOM   5779  C  CB    . LYS H 4 85  ? -3.668  -24.663 22.111 1.00 58.91  ? 82   LYS H CB    1 
ATOM   5780  C  CG    . LYS H 4 85  ? -3.047  -23.663 23.090 1.00 60.65  ? 82   LYS H CG    1 
ATOM   5781  C  CD    . LYS H 4 85  ? -1.578  -23.368 22.777 1.00 62.06  ? 82   LYS H CD    1 
ATOM   5782  C  CE    . LYS H 4 85  ? -0.629  -24.255 23.580 1.00 62.72  ? 82   LYS H CE    1 
ATOM   5783  N  NZ    . LYS H 4 85  ? 0.779   -23.766 23.443 1.00 63.86  ? 82   LYS H NZ    1 
ATOM   5784  N  N     . ARG H 4 86  ? -7.025  -26.182 21.426 1.00 58.53  ? 83   ARG H N     1 
ATOM   5785  C  CA    . ARG H 4 86  ? -7.787  -26.901 20.407 1.00 58.62  ? 83   ARG H CA    1 
ATOM   5786  C  C     . ARG H 4 86  ? -9.013  -26.097 19.974 1.00 58.40  ? 83   ARG H C     1 
ATOM   5787  O  O     . ARG H 4 86  ? -9.595  -25.339 20.758 1.00 58.38  ? 83   ARG H O     1 
ATOM   5788  C  CB    . ARG H 4 86  ? -8.224  -28.279 20.907 1.00 58.89  ? 83   ARG H CB    1 
ATOM   5789  C  CG    . ARG H 4 86  ? -7.091  -29.231 21.270 1.00 60.57  ? 83   ARG H CG    1 
ATOM   5790  C  CD    . ARG H 4 86  ? -6.573  -29.985 20.059 1.00 63.70  ? 83   ARG H CD    1 
ATOM   5791  N  NE    . ARG H 4 86  ? -5.368  -30.754 20.368 1.00 66.83  ? 83   ARG H NE    1 
ATOM   5792  C  CZ    . ARG H 4 86  ? -4.124  -30.273 20.323 1.00 68.94  ? 83   ARG H CZ    1 
ATOM   5793  N  NH1   . ARG H 4 86  ? -3.899  -29.005 19.985 1.00 70.38  ? 83   ARG H NH1   1 
ATOM   5794  N  NH2   . ARG H 4 86  ? -3.096  -31.062 20.620 1.00 68.99  ? 83   ARG H NH2   1 
ATOM   5795  N  N     . SER H 4 87  ? -9.401  -26.273 18.718 1.00 58.07  ? 84   SER H N     1 
ATOM   5796  C  CA    . SER H 4 87  ? -10.463 -25.483 18.114 1.00 57.73  ? 84   SER H CA    1 
ATOM   5797  C  C     . SER H 4 87  ? -11.789 -26.236 18.130 1.00 57.54  ? 84   SER H C     1 
ATOM   5798  O  O     . SER H 4 87  ? -12.849 -25.661 17.854 1.00 57.40  ? 84   SER H O     1 
ATOM   5799  C  CB    . SER H 4 87  ? -10.081 -25.109 16.679 1.00 57.80  ? 84   SER H CB    1 
ATOM   5800  O  OG    . SER H 4 87  ? -8.704  -24.768 16.582 1.00 57.45  ? 84   SER H OG    1 
ATOM   5801  N  N     . THR H 4 88  ? -11.722 -27.521 18.473 1.00 57.20  ? 85   THR H N     1 
ATOM   5802  C  CA    . THR H 4 88  ? -12.882 -28.403 18.395 1.00 56.81  ? 85   THR H CA    1 
ATOM   5803  C  C     . THR H 4 88  ? -13.269 -28.997 19.744 1.00 56.36  ? 85   THR H C     1 
ATOM   5804  O  O     . THR H 4 88  ? -12.417 -29.455 20.504 1.00 56.38  ? 85   THR H O     1 
ATOM   5805  C  CB    . THR H 4 88  ? -12.632 -29.595 17.432 1.00 56.85  ? 85   THR H CB    1 
ATOM   5806  O  OG1   . THR H 4 88  ? -11.778 -29.193 16.357 1.00 57.35  ? 85   THR H OG1   1 
ATOM   5807  C  CG2   . THR H 4 88  ? -13.943 -30.115 16.867 1.00 56.78  ? 85   THR H CG2   1 
ATOM   5808  N  N     . ILE H 4 89  ? -14.566 -28.995 20.022 1.00 55.89  ? 86   ILE H N     1 
ATOM   5809  C  CA    . ILE H 4 89  ? -15.117 -29.798 21.100 1.00 55.52  ? 86   ILE H CA    1 
ATOM   5810  C  C     . ILE H 4 89  ? -15.506 -31.177 20.548 1.00 55.63  ? 86   ILE H C     1 
ATOM   5811  O  O     . ILE H 4 89  ? -16.476 -31.326 19.796 1.00 55.16  ? 86   ILE H O     1 
ATOM   5812  C  CB    . ILE H 4 89  ? -16.317 -29.107 21.771 1.00 55.42  ? 86   ILE H CB    1 
ATOM   5813  C  CG1   . ILE H 4 89  ? -15.817 -27.958 22.656 1.00 55.22  ? 86   ILE H CG1   1 
ATOM   5814  C  CG2   . ILE H 4 89  ? -17.130 -30.108 22.598 1.00 54.37  ? 86   ILE H CG2   1 
ATOM   5815  C  CD1   . ILE H 4 89  ? -16.906 -27.006 23.106 1.00 53.95  ? 86   ILE H CD1   1 
ATOM   5816  N  N     . THR H 4 90  ? -14.718 -32.179 20.917 1.00 55.59  ? 87   THR H N     1 
ATOM   5817  C  CA    . THR H 4 90  ? -14.962 -33.543 20.479 1.00 55.48  ? 87   THR H CA    1 
ATOM   5818  C  C     . THR H 4 90  ? -15.494 -34.295 21.676 1.00 55.29  ? 87   THR H C     1 
ATOM   5819  O  O     . THR H 4 90  ? -15.392 -33.805 22.802 1.00 55.60  ? 87   THR H O     1 
ATOM   5820  C  CB    . THR H 4 90  ? -13.669 -34.250 19.987 1.00 55.40  ? 87   THR H CB    1 
ATOM   5821  O  OG1   . THR H 4 90  ? -12.847 -34.587 21.112 1.00 56.22  ? 87   THR H OG1   1 
ATOM   5822  C  CG2   . THR H 4 90  ? -12.881 -33.373 19.021 1.00 55.42  ? 87   THR H CG2   1 
ATOM   5823  N  N     . SER H 4 91  ? -16.039 -35.485 21.431 1.00 54.78  ? 88   SER H N     1 
ATOM   5824  C  CA    . SER H 4 91  ? -16.585 -36.339 22.479 1.00 54.39  ? 88   SER H CA    1 
ATOM   5825  C  C     . SER H 4 91  ? -15.535 -36.643 23.539 1.00 54.07  ? 88   SER H C     1 
ATOM   5826  O  O     . SER H 4 91  ? -15.862 -36.941 24.683 1.00 54.12  ? 88   SER H O     1 
ATOM   5827  C  CB    . SER H 4 91  ? -17.136 -37.633 21.885 1.00 54.23  ? 88   SER H CB    1 
ATOM   5828  O  OG    . SER H 4 91  ? -16.139 -38.298 21.134 1.00 55.80  ? 88   SER H OG    1 
ATOM   5829  N  N     . ARG H 4 92  ? -14.266 -36.545 23.174 1.00 53.75  ? 89   ARG H N     1 
ATOM   5830  C  CA    . ARG H 4 92  ? -13.223 -36.703 24.165 1.00 53.30  ? 89   ARG H CA    1 
ATOM   5831  C  C     . ARG H 4 92  ? -13.367 -35.632 25.258 1.00 52.49  ? 89   ARG H C     1 
ATOM   5832  O  O     . ARG H 4 92  ? -13.261 -35.927 26.456 1.00 52.50  ? 89   ARG H O     1 
ATOM   5833  C  CB    . ARG H 4 92  ? -11.850 -36.639 23.511 1.00 53.61  ? 89   ARG H CB    1 
ATOM   5834  C  CG    . ARG H 4 92  ? -10.834 -37.437 24.273 1.00 55.30  ? 89   ARG H CG    1 
ATOM   5835  C  CD    . ARG H 4 92  ? -9.483  -37.360 23.636 1.00 58.02  ? 89   ARG H CD    1 
ATOM   5836  N  NE    . ARG H 4 92  ? -8.483  -37.855 24.573 1.00 60.52  ? 89   ARG H NE    1 
ATOM   5837  C  CZ    . ARG H 4 92  ? -7.731  -37.075 25.340 1.00 62.20  ? 89   ARG H CZ    1 
ATOM   5838  N  NH1   . ARG H 4 92  ? -7.856  -35.750 25.272 1.00 63.52  ? 89   ARG H NH1   1 
ATOM   5839  N  NH2   . ARG H 4 92  ? -6.851  -37.619 26.169 1.00 63.23  ? 89   ARG H NH2   1 
ATOM   5840  N  N     . GLU H 4 93  ? -13.627 -34.397 24.836 1.00 51.21  ? 90   GLU H N     1 
ATOM   5841  C  CA    . GLU H 4 93  ? -13.828 -33.294 25.767 1.00 49.89  ? 90   GLU H CA    1 
ATOM   5842  C  C     . GLU H 4 93  ? -15.111 -33.461 26.575 1.00 49.22  ? 90   GLU H C     1 
ATOM   5843  O  O     . GLU H 4 93  ? -15.122 -33.164 27.764 1.00 49.23  ? 90   GLU H O     1 
ATOM   5844  C  CB    . GLU H 4 93  ? -13.820 -31.945 25.038 1.00 49.60  ? 90   GLU H CB    1 
ATOM   5845  C  CG    . GLU H 4 93  ? -12.443 -31.421 24.711 1.00 49.09  ? 90   GLU H CG    1 
ATOM   5846  C  CD    . GLU H 4 93  ? -11.742 -32.197 23.606 1.00 50.99  ? 90   GLU H CD    1 
ATOM   5847  O  OE1   . GLU H 4 93  ? -12.418 -32.617 22.633 1.00 51.55  ? 90   GLU H OE1   1 
ATOM   5848  O  OE2   . GLU H 4 93  ? -10.507 -32.379 23.707 1.00 50.51  ? 90   GLU H OE2   1 
ATOM   5849  N  N     . ILE H 4 94  ? -16.187 -33.919 25.936 1.00 48.47  ? 91   ILE H N     1 
ATOM   5850  C  CA    . ILE H 4 94  ? -17.437 -34.210 26.647 1.00 47.94  ? 91   ILE H CA    1 
ATOM   5851  C  C     . ILE H 4 94  ? -17.192 -35.272 27.700 1.00 47.65  ? 91   ILE H C     1 
ATOM   5852  O  O     . ILE H 4 94  ? -17.669 -35.154 28.823 1.00 47.86  ? 91   ILE H O     1 
ATOM   5853  C  CB    . ILE H 4 94  ? -18.586 -34.678 25.702 1.00 48.19  ? 91   ILE H CB    1 
ATOM   5854  C  CG1   . ILE H 4 94  ? -18.796 -33.688 24.542 1.00 48.63  ? 91   ILE H CG1   1 
ATOM   5855  C  CG2   . ILE H 4 94  ? -19.895 -34.919 26.474 1.00 46.92  ? 91   ILE H CG2   1 
ATOM   5856  C  CD1   . ILE H 4 94  ? -19.274 -32.283 24.952 1.00 47.95  ? 91   ILE H CD1   1 
ATOM   5857  N  N     . GLN H 4 95  ? -16.425 -36.297 27.345 1.00 47.40  ? 92   GLN H N     1 
ATOM   5858  C  CA    . GLN H 4 95  ? -16.096 -37.371 28.292 1.00 46.91  ? 92   GLN H CA    1 
ATOM   5859  C  C     . GLN H 4 95  ? -15.319 -36.861 29.522 1.00 46.06  ? 92   GLN H C     1 
ATOM   5860  O  O     . GLN H 4 95  ? -15.751 -37.083 30.658 1.00 45.15  ? 92   GLN H O     1 
ATOM   5861  C  CB    . GLN H 4 95  ? -15.366 -38.527 27.587 1.00 47.00  ? 92   GLN H CB    1 
ATOM   5862  C  CG    . GLN H 4 95  ? -14.916 -39.646 28.522 1.00 48.23  ? 92   GLN H CG    1 
ATOM   5863  C  CD    . GLN H 4 95  ? -14.531 -40.907 27.771 1.00 50.80  ? 92   GLN H CD    1 
ATOM   5864  O  OE1   . GLN H 4 95  ? -13.337 -41.194 27.576 1.00 51.47  ? 92   GLN H OE1   1 
ATOM   5865  N  NE2   . GLN H 4 95  ? -15.542 -41.659 27.330 1.00 49.78  ? 92   GLN H NE2   1 
ATOM   5866  N  N     . THR H 4 96  ? -14.194 -36.177 29.300 1.00 45.22  ? 93   THR H N     1 
ATOM   5867  C  CA    . THR H 4 96  ? -13.454 -35.597 30.419 1.00 45.19  ? 93   THR H CA    1 
ATOM   5868  C  C     . THR H 4 96  ? -14.326 -34.639 31.255 1.00 45.31  ? 93   THR H C     1 
ATOM   5869  O  O     . THR H 4 96  ? -14.269 -34.666 32.491 1.00 45.26  ? 93   THR H O     1 
ATOM   5870  C  CB    . THR H 4 96  ? -12.207 -34.873 29.969 1.00 44.95  ? 93   THR H CB    1 
ATOM   5871  O  OG1   . THR H 4 96  ? -11.425 -35.733 29.142 1.00 46.15  ? 93   THR H OG1   1 
ATOM   5872  C  CG2   . THR H 4 96  ? -11.385 -34.484 31.168 1.00 45.19  ? 93   THR H CG2   1 
ATOM   5873  N  N     . ALA H 4 97  ? -15.141 -33.820 30.591 1.00 45.01  ? 94   ALA H N     1 
ATOM   5874  C  CA    . ALA H 4 97  ? -16.082 -32.956 31.295 1.00 45.48  ? 94   ALA H CA    1 
ATOM   5875  C  C     . ALA H 4 97  ? -16.983 -33.764 32.223 1.00 45.88  ? 94   ALA H C     1 
ATOM   5876  O  O     . ALA H 4 97  ? -17.179 -33.392 33.391 1.00 46.52  ? 94   ALA H O     1 
ATOM   5877  C  CB    . ALA H 4 97  ? -16.920 -32.137 30.318 1.00 45.50  ? 94   ALA H CB    1 
ATOM   5878  N  N     . VAL H 4 98  ? -17.532 -34.865 31.710 1.00 45.81  ? 95   VAL H N     1 
ATOM   5879  C  CA    . VAL H 4 98  ? -18.410 -35.723 32.503 1.00 45.47  ? 95   VAL H CA    1 
ATOM   5880  C  C     . VAL H 4 98  ? -17.662 -36.258 33.729 1.00 45.98  ? 95   VAL H C     1 
ATOM   5881  O  O     . VAL H 4 98  ? -18.205 -36.254 34.836 1.00 45.97  ? 95   VAL H O     1 
ATOM   5882  C  CB    . VAL H 4 98  ? -19.022 -36.861 31.636 1.00 45.49  ? 95   VAL H CB    1 
ATOM   5883  C  CG1   . VAL H 4 98  ? -19.502 -38.028 32.490 1.00 45.25  ? 95   VAL H CG1   1 
ATOM   5884  C  CG2   . VAL H 4 98  ? -20.170 -36.328 30.767 1.00 44.98  ? 95   VAL H CG2   1 
ATOM   5885  N  N     . ARG H 4 99  ? -16.410 -36.684 33.542 1.00 46.51  ? 96   ARG H N     1 
ATOM   5886  C  CA    . ARG H 4 99  ? -15.606 -37.192 34.659 1.00 46.92  ? 96   ARG H CA    1 
ATOM   5887  C  C     . ARG H 4 99  ? -15.315 -36.105 35.688 1.00 46.54  ? 96   ARG H C     1 
ATOM   5888  O  O     . ARG H 4 99  ? -15.188 -36.389 36.869 1.00 47.03  ? 96   ARG H O     1 
ATOM   5889  C  CB    . ARG H 4 99  ? -14.294 -37.825 34.180 1.00 47.17  ? 96   ARG H CB    1 
ATOM   5890  C  CG    . ARG H 4 99  ? -14.436 -39.239 33.630 1.00 49.85  ? 96   ARG H CG    1 
ATOM   5891  C  CD    . ARG H 4 99  ? -13.081 -39.891 33.375 1.00 53.61  ? 96   ARG H CD    1 
ATOM   5892  N  NE    . ARG H 4 99  ? -13.258 -41.277 32.932 1.00 57.82  ? 96   ARG H NE    1 
ATOM   5893  C  CZ    . ARG H 4 99  ? -12.847 -41.774 31.758 1.00 59.45  ? 96   ARG H CZ    1 
ATOM   5894  N  NH1   . ARG H 4 99  ? -12.194 -41.007 30.876 1.00 58.91  ? 96   ARG H NH1   1 
ATOM   5895  N  NH2   . ARG H 4 99  ? -13.078 -43.060 31.472 1.00 59.35  ? 96   ARG H NH2   1 
ATOM   5896  N  N     . LEU H 4 100 ? -15.192 -34.862 35.241 1.00 45.98  ? 97   LEU H N     1 
ATOM   5897  C  CA    . LEU H 4 100 ? -14.903 -33.766 36.162 1.00 45.17  ? 97   LEU H CA    1 
ATOM   5898  C  C     . LEU H 4 100 ? -16.140 -33.337 36.948 1.00 45.43  ? 97   LEU H C     1 
ATOM   5899  O  O     . LEU H 4 100 ? -16.036 -32.908 38.092 1.00 44.95  ? 97   LEU H O     1 
ATOM   5900  C  CB    . LEU H 4 100 ? -14.312 -32.574 35.413 1.00 44.53  ? 97   LEU H CB    1 
ATOM   5901  C  CG    . LEU H 4 100 ? -12.888 -32.691 34.864 1.00 43.46  ? 97   LEU H CG    1 
ATOM   5902  C  CD1   . LEU H 4 100 ? -12.574 -31.483 33.993 1.00 42.59  ? 97   LEU H CD1   1 
ATOM   5903  C  CD2   . LEU H 4 100 ? -11.873 -32.826 35.966 1.00 41.05  ? 97   LEU H CD2   1 
ATOM   5904  N  N     . LEU H 4 101 ? -17.310 -33.475 36.334 1.00 45.93  ? 98   LEU H N     1 
ATOM   5905  C  CA    . LEU H 4 101 ? -18.548 -32.968 36.914 1.00 46.25  ? 98   LEU H CA    1 
ATOM   5906  C  C     . LEU H 4 101 ? -19.399 -33.977 37.663 1.00 46.22  ? 98   LEU H C     1 
ATOM   5907  O  O     . LEU H 4 101 ? -19.976 -33.643 38.684 1.00 46.33  ? 98   LEU H O     1 
ATOM   5908  C  CB    . LEU H 4 101 ? -19.395 -32.294 35.839 1.00 46.37  ? 98   LEU H CB    1 
ATOM   5909  C  CG    . LEU H 4 101 ? -18.902 -30.921 35.408 1.00 46.70  ? 98   LEU H CG    1 
ATOM   5910  C  CD1   . LEU H 4 101 ? -19.365 -30.677 33.997 1.00 47.14  ? 98   LEU H CD1   1 
ATOM   5911  C  CD2   . LEU H 4 101 ? -19.395 -29.815 36.343 1.00 45.79  ? 98   LEU H CD2   1 
ATOM   5912  N  N     . LEU H 4 102 ? -19.505 -35.200 37.161 1.00 46.72  ? 99   LEU H N     1 
ATOM   5913  C  CA    . LEU H 4 102 ? -20.335 -36.199 37.846 1.00 47.09  ? 99   LEU H CA    1 
ATOM   5914  C  C     . LEU H 4 102 ? -19.591 -36.979 38.940 1.00 47.35  ? 99   LEU H C     1 
ATOM   5915  O  O     . LEU H 4 102 ? -18.416 -37.312 38.792 1.00 47.58  ? 99   LEU H O     1 
ATOM   5916  C  CB    . LEU H 4 102 ? -21.012 -37.147 36.847 1.00 47.02  ? 99   LEU H CB    1 
ATOM   5917  C  CG    . LEU H 4 102 ? -21.805 -36.576 35.656 1.00 46.66  ? 99   LEU H CG    1 
ATOM   5918  C  CD1   . LEU H 4 102 ? -22.728 -37.635 35.099 1.00 46.09  ? 99   LEU H CD1   1 
ATOM   5919  C  CD2   . LEU H 4 102 ? -22.614 -35.348 35.994 1.00 45.60  ? 99   LEU H CD2   1 
ATOM   5920  N  N     . PRO H 4 103 ? -20.277 -37.243 40.061 1.00 47.97  ? 100  PRO H N     1 
ATOM   5921  C  CA    . PRO H 4 103 ? -19.757 -38.129 41.106 1.00 48.59  ? 100  PRO H CA    1 
ATOM   5922  C  C     . PRO H 4 103 ? -19.542 -39.558 40.603 1.00 49.50  ? 100  PRO H C     1 
ATOM   5923  O  O     . PRO H 4 103 ? -20.275 -40.021 39.724 1.00 49.50  ? 100  PRO H O     1 
ATOM   5924  C  CB    . PRO H 4 103 ? -20.862 -38.107 42.166 1.00 48.63  ? 100  PRO H CB    1 
ATOM   5925  C  CG    . PRO H 4 103 ? -21.589 -36.831 41.946 1.00 47.50  ? 100  PRO H CG    1 
ATOM   5926  C  CD    . PRO H 4 103 ? -21.521 -36.563 40.479 1.00 47.78  ? 100  PRO H CD    1 
ATOM   5927  N  N     . GLY H 4 104 ? -18.538 -40.226 41.176 1.00 50.40  ? 101  GLY H N     1 
ATOM   5928  C  CA    . GLY H 4 104 ? -18.096 -41.568 40.791 1.00 51.30  ? 101  GLY H CA    1 
ATOM   5929  C  C     . GLY H 4 104 ? -19.032 -42.432 39.973 1.00 51.72  ? 101  GLY H C     1 
ATOM   5930  O  O     . GLY H 4 104 ? -18.855 -42.567 38.759 1.00 51.96  ? 101  GLY H O     1 
ATOM   5931  N  N     . GLU H 4 105 ? -20.023 -43.019 40.633 1.00 52.09  ? 102  GLU H N     1 
ATOM   5932  C  CA    . GLU H 4 105 ? -20.888 -44.000 39.981 1.00 52.96  ? 102  GLU H CA    1 
ATOM   5933  C  C     . GLU H 4 105 ? -21.750 -43.384 38.865 1.00 52.67  ? 102  GLU H C     1 
ATOM   5934  O  O     . GLU H 4 105 ? -21.978 -44.008 37.816 1.00 53.13  ? 102  GLU H O     1 
ATOM   5935  C  CB    . GLU H 4 105 ? -21.726 -44.747 41.021 1.00 53.21  ? 102  GLU H CB    1 
ATOM   5936  C  CG    . GLU H 4 105 ? -22.275 -46.095 40.560 1.00 56.32  ? 102  GLU H CG    1 
ATOM   5937  C  CD    . GLU H 4 105 ? -21.247 -47.243 40.556 1.00 59.67  ? 102  GLU H CD    1 
ATOM   5938  O  OE1   . GLU H 4 105 ? -21.680 -48.390 40.271 1.00 61.28  ? 102  GLU H OE1   1 
ATOM   5939  O  OE2   . GLU H 4 105 ? -20.038 -47.016 40.831 1.00 59.15  ? 102  GLU H OE2   1 
ATOM   5940  N  N     . LEU H 4 106 ? -22.190 -42.151 39.077 1.00 52.29  ? 103  LEU H N     1 
ATOM   5941  C  CA    . LEU H 4 106 ? -22.955 -41.417 38.077 1.00 52.21  ? 103  LEU H CA    1 
ATOM   5942  C  C     . LEU H 4 106 ? -22.085 -41.125 36.847 1.00 52.28  ? 103  LEU H C     1 
ATOM   5943  O  O     . LEU H 4 106 ? -22.547 -41.226 35.704 1.00 52.21  ? 103  LEU H O     1 
ATOM   5944  C  CB    . LEU H 4 106 ? -23.484 -40.124 38.696 1.00 52.27  ? 103  LEU H CB    1 
ATOM   5945  C  CG    . LEU H 4 106 ? -24.967 -39.751 38.577 1.00 52.65  ? 103  LEU H CG    1 
ATOM   5946  C  CD1   . LEU H 4 106 ? -25.909 -40.946 38.678 1.00 52.56  ? 103  LEU H CD1   1 
ATOM   5947  C  CD2   . LEU H 4 106 ? -25.337 -38.723 39.633 1.00 52.59  ? 103  LEU H CD2   1 
ATOM   5948  N  N     . ALA H 4 107 ? -20.821 -40.787 37.085 1.00 52.29  ? 104  ALA H N     1 
ATOM   5949  C  CA    . ALA H 4 107 ? -19.868 -40.590 36.003 1.00 52.61  ? 104  ALA H CA    1 
ATOM   5950  C  C     . ALA H 4 107 ? -19.699 -41.863 35.184 1.00 53.03  ? 104  ALA H C     1 
ATOM   5951  O  O     . ALA H 4 107 ? -19.770 -41.821 33.945 1.00 53.02  ? 104  ALA H O     1 
ATOM   5952  C  CB    . ALA H 4 107 ? -18.524 -40.123 36.546 1.00 52.51  ? 104  ALA H CB    1 
ATOM   5953  N  N     . LYS H 4 108 ? -19.491 -42.985 35.883 1.00 53.49  ? 105  LYS H N     1 
ATOM   5954  C  CA    . LYS H 4 108 ? -19.193 -44.265 35.246 1.00 54.06  ? 105  LYS H CA    1 
ATOM   5955  C  C     . LYS H 4 108 ? -20.265 -44.654 34.220 1.00 53.85  ? 105  LYS H C     1 
ATOM   5956  O  O     . LYS H 4 108 ? -19.945 -44.962 33.065 1.00 53.52  ? 105  LYS H O     1 
ATOM   5957  C  CB    . LYS H 4 108 ? -19.012 -45.369 36.295 1.00 54.43  ? 105  LYS H CB    1 
ATOM   5958  C  CG    . LYS H 4 108 ? -18.694 -46.743 35.691 1.00 56.83  ? 105  LYS H CG    1 
ATOM   5959  C  CD    . LYS H 4 108 ? -18.601 -47.836 36.740 1.00 61.70  ? 105  LYS H CD    1 
ATOM   5960  C  CE    . LYS H 4 108 ? -18.447 -49.216 36.081 1.00 64.56  ? 105  LYS H CE    1 
ATOM   5961  N  NZ    . LYS H 4 108 ? -18.876 -50.298 37.025 1.00 66.57  ? 105  LYS H NZ    1 
ATOM   5962  N  N     . HIS H 4 109 ? -21.528 -44.614 34.640 1.00 54.03  ? 106  HIS H N     1 
ATOM   5963  C  CA    . HIS H 4 109 ? -22.636 -44.996 33.769 1.00 54.55  ? 106  HIS H CA    1 
ATOM   5964  C  C     . HIS H 4 109 ? -22.838 -43.995 32.642 1.00 54.29  ? 106  HIS H C     1 
ATOM   5965  O  O     . HIS H 4 109 ? -23.124 -44.386 31.506 1.00 54.52  ? 106  HIS H O     1 
ATOM   5966  C  CB    . HIS H 4 109 ? -23.918 -45.166 34.566 1.00 54.74  ? 106  HIS H CB    1 
ATOM   5967  C  CG    . HIS H 4 109 ? -23.909 -46.355 35.472 1.00 56.84  ? 106  HIS H CG    1 
ATOM   5968  N  ND1   . HIS H 4 109 ? -24.707 -47.461 35.257 1.00 59.33  ? 106  HIS H ND1   1 
ATOM   5969  C  CD2   . HIS H 4 109 ? -23.200 -46.615 36.597 1.00 57.76  ? 106  HIS H CD2   1 
ATOM   5970  C  CE1   . HIS H 4 109 ? -24.492 -48.349 36.212 1.00 59.07  ? 106  HIS H CE1   1 
ATOM   5971  N  NE2   . HIS H 4 109 ? -23.584 -47.858 37.040 1.00 58.54  ? 106  HIS H NE2   1 
ATOM   5972  N  N     . ALA H 4 110 ? -22.657 -42.713 32.955 1.00 53.94  ? 107  ALA H N     1 
ATOM   5973  C  CA    . ALA H 4 110 ? -22.758 -41.654 31.959 1.00 53.73  ? 107  ALA H CA    1 
ATOM   5974  C  C     . ALA H 4 110 ? -21.749 -41.866 30.854 1.00 53.44  ? 107  ALA H C     1 
ATOM   5975  O  O     . ALA H 4 110 ? -22.087 -41.715 29.672 1.00 53.29  ? 107  ALA H O     1 
ATOM   5976  C  CB    . ALA H 4 110 ? -22.573 -40.287 32.599 1.00 53.68  ? 107  ALA H CB    1 
ATOM   5977  N  N     . VAL H 4 111 ? -20.527 -42.242 31.250 1.00 53.54  ? 108  VAL H N     1 
ATOM   5978  C  CA    . VAL H 4 111 ? -19.410 -42.478 30.321 1.00 53.64  ? 108  VAL H CA    1 
ATOM   5979  C  C     . VAL H 4 111 ? -19.728 -43.632 29.387 1.00 54.28  ? 108  VAL H C     1 
ATOM   5980  O  O     . VAL H 4 111 ? -19.499 -43.549 28.175 1.00 54.46  ? 108  VAL H O     1 
ATOM   5981  C  CB    . VAL H 4 111 ? -18.080 -42.731 31.081 1.00 53.48  ? 108  VAL H CB    1 
ATOM   5982  C  CG1   . VAL H 4 111 ? -17.013 -43.340 30.182 1.00 52.63  ? 108  VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H 4 111 ? -17.575 -41.443 31.680 1.00 52.78  ? 108  VAL H CG2   1 
ATOM   5984  N  N     . SER H 4 112 ? -20.286 -44.697 29.949 1.00 54.91  ? 109  SER H N     1 
ATOM   5985  C  CA    . SER H 4 112 ? -20.537 -45.885 29.170 1.00 55.76  ? 109  SER H CA    1 
ATOM   5986  C  C     . SER H 4 112 ? -21.764 -45.692 28.290 1.00 56.29  ? 109  SER H C     1 
ATOM   5987  O  O     . SER H 4 112 ? -21.750 -46.101 27.129 1.00 56.56  ? 109  SER H O     1 
ATOM   5988  C  CB    . SER H 4 112 ? -20.647 -47.108 30.066 1.00 55.89  ? 109  SER H CB    1 
ATOM   5989  O  OG    . SER H 4 112 ? -21.891 -47.131 30.739 1.00 56.96  ? 109  SER H OG    1 
ATOM   5990  N  N     . GLU H 4 113 ? -22.799 -45.030 28.807 1.00 56.92  ? 110  GLU H N     1 
ATOM   5991  C  CA    . GLU H 4 113 ? -23.941 -44.646 27.956 1.00 57.62  ? 110  GLU H CA    1 
ATOM   5992  C  C     . GLU H 4 113 ? -23.516 -43.787 26.777 1.00 58.23  ? 110  GLU H C     1 
ATOM   5993  O  O     . GLU H 4 113 ? -24.088 -43.890 25.693 1.00 58.57  ? 110  GLU H O     1 
ATOM   5994  C  CB    . GLU H 4 113 ? -25.027 -43.910 28.732 1.00 57.25  ? 110  GLU H CB    1 
ATOM   5995  C  CG    . GLU H 4 113 ? -25.891 -44.779 29.639 1.00 57.97  ? 110  GLU H CG    1 
ATOM   5996  C  CD    . GLU H 4 113 ? -26.634 -45.903 28.921 1.00 59.09  ? 110  GLU H CD    1 
ATOM   5997  O  OE1   . GLU H 4 113 ? -26.918 -45.800 27.698 1.00 60.09  ? 110  GLU H OE1   1 
ATOM   5998  O  OE2   . GLU H 4 113 ? -26.944 -46.900 29.602 1.00 58.60  ? 110  GLU H OE2   1 
ATOM   5999  N  N     . GLY H 4 114 ? -22.511 -42.945 27.000 1.00 58.98  ? 111  GLY H N     1 
ATOM   6000  C  CA    . GLY H 4 114 ? -22.031 -42.024 25.981 1.00 60.15  ? 111  GLY H CA    1 
ATOM   6001  C  C     . GLY H 4 114 ? -21.206 -42.730 24.933 1.00 60.91  ? 111  GLY H C     1 
ATOM   6002  O  O     . GLY H 4 114 ? -21.441 -42.564 23.737 1.00 60.94  ? 111  GLY H O     1 
ATOM   6003  N  N     . THR H 4 115 ? -20.237 -43.516 25.394 1.00 61.79  ? 112  THR H N     1 
ATOM   6004  C  CA    . THR H 4 115 ? -19.406 -44.353 24.530 1.00 62.82  ? 112  THR H CA    1 
ATOM   6005  C  C     . THR H 4 115 ? -20.267 -45.328 23.721 1.00 63.76  ? 112  THR H C     1 
ATOM   6006  O  O     . THR H 4 115 ? -20.022 -45.549 22.528 1.00 63.83  ? 112  THR H O     1 
ATOM   6007  C  CB    . THR H 4 115 ? -18.368 -45.138 25.360 1.00 62.73  ? 112  THR H CB    1 
ATOM   6008  O  OG1   . THR H 4 115 ? -17.607 -44.221 26.159 1.00 62.59  ? 112  THR H OG1   1 
ATOM   6009  C  CG2   . THR H 4 115 ? -17.421 -45.915 24.458 1.00 62.36  ? 112  THR H CG2   1 
ATOM   6010  N  N     . LYS H 4 116 ? -21.284 -45.886 24.375 1.00 64.81  ? 113  LYS H N     1 
ATOM   6011  C  CA    . LYS H 4 116 ? -22.209 -46.811 23.736 1.00 66.00  ? 113  LYS H CA    1 
ATOM   6012  C  C     . LYS H 4 116 ? -22.930 -46.150 22.572 1.00 66.67  ? 113  LYS H C     1 
ATOM   6013  O  O     . LYS H 4 116 ? -23.003 -46.720 21.478 1.00 66.99  ? 113  LYS H O     1 
ATOM   6014  C  CB    . LYS H 4 116 ? -23.226 -47.343 24.747 1.00 66.13  ? 113  LYS H CB    1 
ATOM   6015  C  CG    . LYS H 4 116 ? -24.002 -48.561 24.269 1.00 67.13  ? 113  LYS H CG    1 
ATOM   6016  C  CD    . LYS H 4 116 ? -24.997 -49.038 25.322 1.00 68.68  ? 113  LYS H CD    1 
ATOM   6017  C  CE    . LYS H 4 116 ? -26.404 -48.518 25.035 1.00 69.78  ? 113  LYS H CE    1 
ATOM   6018  N  NZ    . LYS H 4 116 ? -27.437 -49.181 25.889 1.00 70.33  ? 113  LYS H NZ    1 
ATOM   6019  N  N     . ALA H 4 117 ? -23.444 -44.946 22.811 1.00 67.50  ? 114  ALA H N     1 
ATOM   6020  C  CA    . ALA H 4 117 ? -24.192 -44.205 21.804 1.00 68.42  ? 114  ALA H CA    1 
ATOM   6021  C  C     . ALA H 4 117 ? -23.339 -43.770 20.614 1.00 69.28  ? 114  ALA H C     1 
ATOM   6022  O  O     . ALA H 4 117 ? -23.832 -43.736 19.485 1.00 69.46  ? 114  ALA H O     1 
ATOM   6023  C  CB    . ALA H 4 117 ? -24.892 -43.016 22.428 1.00 68.20  ? 114  ALA H CB    1 
ATOM   6024  N  N     . VAL H 4 118 ? -22.068 -43.449 20.858 1.00 70.39  ? 115  VAL H N     1 
ATOM   6025  C  CA    . VAL H 4 118 ? -21.173 -43.011 19.781 1.00 71.69  ? 115  VAL H CA    1 
ATOM   6026  C  C     . VAL H 4 118 ? -20.759 -44.198 18.904 1.00 72.69  ? 115  VAL H C     1 
ATOM   6027  O  O     . VAL H 4 118 ? -20.496 -44.042 17.705 1.00 72.93  ? 115  VAL H O     1 
ATOM   6028  C  CB    . VAL H 4 118 ? -19.958 -42.206 20.323 1.00 71.53  ? 115  VAL H CB    1 
ATOM   6029  C  CG1   . VAL H 4 118 ? -18.882 -42.013 19.261 1.00 71.41  ? 115  VAL H CG1   1 
ATOM   6030  C  CG2   . VAL H 4 118 ? -20.422 -40.849 20.839 1.00 71.80  ? 115  VAL H CG2   1 
ATOM   6031  N  N     . THR H 4 119 ? -20.727 -45.384 19.503 1.00 73.86  ? 116  THR H N     1 
ATOM   6032  C  CA    . THR H 4 119 ? -20.473 -46.605 18.758 1.00 75.06  ? 116  THR H CA    1 
ATOM   6033  C  C     . THR H 4 119 ? -21.654 -46.899 17.826 1.00 76.01  ? 116  THR H C     1 
ATOM   6034  O  O     . THR H 4 119 ? -21.488 -46.895 16.603 1.00 76.32  ? 116  THR H O     1 
ATOM   6035  C  CB    . THR H 4 119 ? -20.137 -47.780 19.699 1.00 74.96  ? 116  THR H CB    1 
ATOM   6036  O  OG1   . THR H 4 119 ? -18.851 -47.548 20.289 1.00 74.98  ? 116  THR H OG1   1 
ATOM   6037  C  CG2   . THR H 4 119 ? -20.088 -49.096 18.937 1.00 75.44  ? 116  THR H CG2   1 
ATOM   6038  N  N     . LYS H 4 120 ? -22.842 -47.100 18.398 1.00 77.06  ? 117  LYS H N     1 
ATOM   6039  C  CA    . LYS H 4 120 ? -24.065 -47.357 17.625 1.00 78.07  ? 117  LYS H CA    1 
ATOM   6040  C  C     . LYS H 4 120 ? -24.254 -46.399 16.446 1.00 78.61  ? 117  LYS H C     1 
ATOM   6041  O  O     . LYS H 4 120 ? -24.721 -46.801 15.382 1.00 78.95  ? 117  LYS H O     1 
ATOM   6042  C  CB    . LYS H 4 120 ? -25.294 -47.304 18.535 1.00 78.15  ? 117  LYS H CB    1 
ATOM   6043  C  CG    . LYS H 4 120 ? -26.413 -48.255 18.123 1.00 79.19  ? 117  LYS H CG    1 
ATOM   6044  C  CD    . LYS H 4 120 ? -27.572 -48.215 19.114 1.00 80.83  ? 117  LYS H CD    1 
ATOM   6045  C  CE    . LYS H 4 120 ? -28.146 -49.617 19.382 1.00 81.77  ? 117  LYS H CE    1 
ATOM   6046  N  NZ    . LYS H 4 120 ? -28.780 -50.241 18.170 1.00 81.82  ? 117  LYS H NZ    1 
ATOM   6047  N  N     . TYR H 4 121 ? -23.880 -45.140 16.647 1.00 79.37  ? 118  TYR H N     1 
ATOM   6048  C  CA    . TYR H 4 121 ? -24.019 -44.105 15.631 1.00 80.09  ? 118  TYR H CA    1 
ATOM   6049  C  C     . TYR H 4 121 ? -22.990 -44.265 14.506 1.00 81.10  ? 118  TYR H C     1 
ATOM   6050  O  O     . TYR H 4 121 ? -23.311 -44.037 13.334 1.00 81.20  ? 118  TYR H O     1 
ATOM   6051  C  CB    . TYR H 4 121 ? -23.923 -42.713 16.281 1.00 79.67  ? 118  TYR H CB    1 
ATOM   6052  C  CG    . TYR H 4 121 ? -23.914 -41.543 15.312 1.00 78.36  ? 118  TYR H CG    1 
ATOM   6053  C  CD1   . TYR H 4 121 ? -25.105 -41.018 14.810 1.00 77.27  ? 118  TYR H CD1   1 
ATOM   6054  C  CD2   . TYR H 4 121 ? -22.711 -40.958 14.908 1.00 77.09  ? 118  TYR H CD2   1 
ATOM   6055  C  CE1   . TYR H 4 121 ? -25.097 -39.944 13.920 1.00 77.16  ? 118  TYR H CE1   1 
ATOM   6056  C  CE2   . TYR H 4 121 ? -22.691 -39.886 14.024 1.00 76.93  ? 118  TYR H CE2   1 
ATOM   6057  C  CZ    . TYR H 4 121 ? -23.887 -39.382 13.534 1.00 77.23  ? 118  TYR H CZ    1 
ATOM   6058  O  OH    . TYR H 4 121 ? -23.867 -38.319 12.658 1.00 77.74  ? 118  TYR H OH    1 
ATOM   6059  N  N     . THR H 4 122 ? -21.761 -44.637 14.866 1.00 82.38  ? 119  THR H N     1 
ATOM   6060  C  CA    . THR H 4 122 ? -20.699 -44.889 13.889 1.00 83.74  ? 119  THR H CA    1 
ATOM   6061  C  C     . THR H 4 122 ? -21.064 -46.097 13.026 1.00 84.87  ? 119  THR H C     1 
ATOM   6062  O  O     . THR H 4 122 ? -21.183 -45.991 11.801 1.00 85.00  ? 119  THR H O     1 
ATOM   6063  C  CB    . THR H 4 122 ? -19.325 -45.106 14.583 1.00 83.60  ? 119  THR H CB    1 
ATOM   6064  O  OG1   . THR H 4 122 ? -18.855 -43.855 15.100 1.00 83.47  ? 119  THR H OG1   1 
ATOM   6065  C  CG2   . THR H 4 122 ? -18.279 -45.656 13.608 1.00 83.74  ? 119  THR H CG2   1 
ATOM   6066  N  N     . SER H 4 123 ? -21.286 -47.229 13.688 1.00 86.27  ? 120  SER H N     1 
ATOM   6067  C  CA    . SER H 4 123 ? -21.540 -48.499 13.025 1.00 87.62  ? 120  SER H CA    1 
ATOM   6068  C  C     . SER H 4 123 ? -22.978 -48.602 12.504 1.00 88.66  ? 120  SER H C     1 
ATOM   6069  O  O     . SER H 4 123 ? -23.639 -49.639 12.648 1.00 89.02  ? 120  SER H O     1 
ATOM   6070  C  CB    . SER H 4 123 ? -21.203 -49.649 13.981 1.00 87.55  ? 120  SER H CB    1 
ATOM   6071  O  OG    . SER H 4 123 ? -19.950 -49.417 14.613 1.00 87.56  ? 120  SER H OG    1 
ATOM   6072  N  N     . ALA H 4 124 ? -23.455 -47.518 11.896 1.00 89.76  ? 121  ALA H N     1 
ATOM   6073  C  CA    . ALA H 4 124 ? -24.775 -47.491 11.277 1.00 90.85  ? 121  ALA H CA    1 
ATOM   6074  C  C     . ALA H 4 124 ? -24.746 -46.656 10.001 1.00 91.64  ? 121  ALA H C     1 
ATOM   6075  O  O     . ALA H 4 124 ? -24.434 -45.459 10.038 1.00 91.73  ? 121  ALA H O     1 
ATOM   6076  C  CB    . ALA H 4 124 ? -25.823 -46.958 12.255 1.00 90.78  ? 121  ALA H CB    1 
ATOM   6077  N  N     . LYS H 4 125 ? -25.057 -47.306 8.877  1.00 92.56  ? 122  LYS H N     1 
ATOM   6078  C  CA    . LYS H 4 125 ? -25.128 -46.646 7.568  1.00 93.41  ? 122  LYS H CA    1 
ATOM   6079  C  C     . LYS H 4 125 ? -26.154 -45.506 7.571  1.00 93.66  ? 122  LYS H C     1 
ATOM   6080  O  O     . LYS H 4 125 ? -25.799 -44.336 7.762  1.00 93.85  ? 122  LYS H O     1 
ATOM   6081  C  CB    . LYS H 4 125 ? -25.432 -47.662 6.448  1.00 93.60  ? 122  LYS H CB    1 
ATOM   6082  C  CG    . LYS H 4 125 ? -26.486 -48.721 6.804  1.00 94.56  ? 122  LYS H CG    1 
ATOM   6083  C  CD    . LYS H 4 125 ? -27.138 -49.336 5.561  1.00 95.77  ? 122  LYS H CD    1 
ATOM   6084  C  CE    . LYS H 4 125 ? -28.179 -50.386 5.957  1.00 96.18  ? 122  LYS H CE    1 
ATOM   6085  N  NZ    . LYS H 4 125 ? -29.003 -50.852 4.805  1.00 96.73  ? 122  LYS H NZ    1 
ATOM   6086  O  OXT   . LYS H 4 125 ? -27.358 -45.723 7.404  1.00 93.96  ? 122  LYS H OXT   1 
ATOM   6087  O  "O5'" . DA  I 5 1   ? 2.100   -0.047  94.617 1.00 135.24 ? -72  DA  I "O5'" 1 
ATOM   6088  C  "C5'" . DA  I 5 1   ? 3.167   -0.276  93.700 1.00 135.04 ? -72  DA  I "C5'" 1 
ATOM   6089  C  "C4'" . DA  I 5 1   ? 4.329   -1.000  94.388 1.00 134.94 ? -72  DA  I "C4'" 1 
ATOM   6090  O  "O4'" . DA  I 5 1   ? 3.956   -2.391  94.698 1.00 135.22 ? -72  DA  I "O4'" 1 
ATOM   6091  C  "C3'" . DA  I 5 1   ? 5.610   -1.060  93.556 1.00 134.65 ? -72  DA  I "C3'" 1 
ATOM   6092  O  "O3'" . DA  I 5 1   ? 6.735   -0.675  94.358 1.00 133.95 ? -72  DA  I "O3'" 1 
ATOM   6093  C  "C2'" . DA  I 5 1   ? 5.663   -2.530  93.096 1.00 135.06 ? -72  DA  I "C2'" 1 
ATOM   6094  C  "C1'" . DA  I 5 1   ? 4.933   -3.286  94.201 1.00 135.35 ? -72  DA  I "C1'" 1 
ATOM   6095  N  N9    . DA  I 5 1   ? 4.304   -4.510  93.697 1.00 135.53 ? -72  DA  I N9    1 
ATOM   6096  C  C8    . DA  I 5 1   ? 3.136   -4.605  92.988 1.00 135.65 ? -72  DA  I C8    1 
ATOM   6097  N  N7    . DA  I 5 1   ? 2.812   -5.832  92.651 1.00 135.75 ? -72  DA  I N7    1 
ATOM   6098  C  C5    . DA  I 5 1   ? 3.842   -6.601  93.170 1.00 135.71 ? -72  DA  I C5    1 
ATOM   6099  C  C6    . DA  I 5 1   ? 4.094   -7.994  93.155 1.00 135.75 ? -72  DA  I C6    1 
ATOM   6100  N  N6    . DA  I 5 1   ? 3.281   -8.882  92.571 1.00 135.56 ? -72  DA  I N6    1 
ATOM   6101  N  N1    . DA  I 5 1   ? 5.218   -8.440  93.768 1.00 135.78 ? -72  DA  I N1    1 
ATOM   6102  C  C2    . DA  I 5 1   ? 6.031   -7.547  94.358 1.00 135.74 ? -72  DA  I C2    1 
ATOM   6103  N  N3    . DA  I 5 1   ? 5.900   -6.219  94.433 1.00 135.65 ? -72  DA  I N3    1 
ATOM   6104  C  C4    . DA  I 5 1   ? 4.775   -5.802  93.817 1.00 135.60 ? -72  DA  I C4    1 
ATOM   6105  P  P     . DT  I 5 2   ? 8.273   -1.035  94.018 1.00 133.70 ? -71  DT  I P     1 
ATOM   6106  O  OP1   . DT  I 5 2   ? 9.108   0.022   94.635 1.00 133.97 ? -71  DT  I OP1   1 
ATOM   6107  O  OP2   . DT  I 5 2   ? 8.423   -1.302  92.567 1.00 133.66 ? -71  DT  I OP2   1 
ATOM   6108  O  "O5'" . DT  I 5 2   ? 8.482   -2.413  94.813 1.00 132.92 ? -71  DT  I "O5'" 1 
ATOM   6109  C  "C5'" . DT  I 5 2   ? 9.651   -2.648  95.602 1.00 131.69 ? -71  DT  I "C5'" 1 
ATOM   6110  C  "C4'" . DT  I 5 2   ? 10.520  -3.732  94.981 1.00 130.70 ? -71  DT  I "C4'" 1 
ATOM   6111  O  "O4'" . DT  I 5 2   ? 9.671   -4.795  94.474 1.00 130.58 ? -71  DT  I "O4'" 1 
ATOM   6112  C  "C3'" . DT  I 5 2   ? 11.391  -3.262  93.815 1.00 129.89 ? -71  DT  I "C3'" 1 
ATOM   6113  O  "O3'" . DT  I 5 2   ? 12.795  -3.329  94.163 1.00 128.64 ? -71  DT  I "O3'" 1 
ATOM   6114  C  "C2'" . DT  I 5 2   ? 10.919  -4.065  92.596 1.00 130.14 ? -71  DT  I "C2'" 1 
ATOM   6115  C  "C1'" . DT  I 5 2   ? 10.160  -5.242  93.221 1.00 130.43 ? -71  DT  I "C1'" 1 
ATOM   6116  N  N1    . DT  I 5 2   ? 9.005   -5.801  92.420 1.00 130.44 ? -71  DT  I N1    1 
ATOM   6117  C  C2    . DT  I 5 2   ? 8.801   -7.173  92.386 1.00 130.40 ? -71  DT  I C2    1 
ATOM   6118  O  O2    . DT  I 5 2   ? 9.498   -7.989  92.970 1.00 130.31 ? -71  DT  I O2    1 
ATOM   6119  N  N3    . DT  I 5 2   ? 7.723   -7.575  91.633 1.00 130.47 ? -71  DT  I N3    1 
ATOM   6120  C  C4    . DT  I 5 2   ? 6.845   -6.771  90.924 1.00 130.52 ? -71  DT  I C4    1 
ATOM   6121  O  O4    . DT  I 5 2   ? 5.912   -7.241  90.280 1.00 130.55 ? -71  DT  I O4    1 
ATOM   6122  C  C5    . DT  I 5 2   ? 7.110   -5.351  90.996 1.00 130.59 ? -71  DT  I C5    1 
ATOM   6123  C  C7    . DT  I 5 2   ? 6.230   -4.377  90.264 1.00 130.54 ? -71  DT  I C7    1 
ATOM   6124  C  C6    . DT  I 5 2   ? 8.159   -4.942  91.730 1.00 130.60 ? -71  DT  I C6    1 
ATOM   6125  P  P     . DC  I 5 3   ? 13.888  -4.409  93.680 1.00 127.90 ? -70  DC  I P     1 
ATOM   6126  O  OP1   . DC  I 5 3   ? 15.115  -4.150  94.469 1.00 128.08 ? -70  DC  I OP1   1 
ATOM   6127  O  OP2   . DC  I 5 3   ? 13.975  -4.358  92.201 1.00 127.97 ? -70  DC  I OP2   1 
ATOM   6128  O  "O5'" . DC  I 5 3   ? 13.299  -5.840  94.117 1.00 126.78 ? -70  DC  I "O5'" 1 
ATOM   6129  C  "C5'" . DC  I 5 3   ? 14.180  -6.923  94.498 1.00 124.74 ? -70  DC  I "C5'" 1 
ATOM   6130  C  "C4'" . DC  I 5 3   ? 14.193  -8.091  93.506 1.00 123.07 ? -70  DC  I "C4'" 1 
ATOM   6131  O  "O4'" . DC  I 5 3   ? 12.920  -8.220  92.802 1.00 122.92 ? -70  DC  I "O4'" 1 
ATOM   6132  C  "C3'" . DC  I 5 3   ? 15.269  -8.033  92.422 1.00 121.56 ? -70  DC  I "C3'" 1 
ATOM   6133  O  "O3'" . DC  I 5 3   ? 15.852  -9.334  92.246 1.00 119.28 ? -70  DC  I "O3'" 1 
ATOM   6134  C  "C2'" . DC  I 5 3   ? 14.474  -7.587  91.194 1.00 121.83 ? -70  DC  I "C2'" 1 
ATOM   6135  C  "C1'" . DC  I 5 3   ? 13.185  -8.378  91.415 1.00 122.18 ? -70  DC  I "C1'" 1 
ATOM   6136  N  N1    . DC  I 5 3   ? 11.987  -7.950  90.595 1.00 121.70 ? -70  DC  I N1    1 
ATOM   6137  C  C2    . DC  I 5 3   ? 11.035  -8.902  90.178 1.00 121.13 ? -70  DC  I C2    1 
ATOM   6138  O  O2    . DC  I 5 3   ? 11.175  -10.097 90.479 1.00 120.68 ? -70  DC  I O2    1 
ATOM   6139  N  N3    . DC  I 5 3   ? 9.969   -8.480  89.444 1.00 120.91 ? -70  DC  I N3    1 
ATOM   6140  C  C4    . DC  I 5 3   ? 9.830   -7.186  89.123 1.00 120.86 ? -70  DC  I C4    1 
ATOM   6141  N  N4    . DC  I 5 3   ? 8.767   -6.821  88.399 1.00 120.41 ? -70  DC  I N4    1 
ATOM   6142  C  C5    . DC  I 5 3   ? 10.782  -6.205  89.537 1.00 121.10 ? -70  DC  I C5    1 
ATOM   6143  C  C6    . DC  I 5 3   ? 11.829  -6.630  90.257 1.00 121.44 ? -70  DC  I C6    1 
ATOM   6144  P  P     . DA  I 5 4   ? 17.041  -9.581  91.195 1.00 117.59 ? -69  DA  I P     1 
ATOM   6145  O  OP1   . DA  I 5 4   ? 18.278  -9.149  91.878 1.00 117.96 ? -69  DA  I OP1   1 
ATOM   6146  O  OP2   . DA  I 5 4   ? 16.679  -8.981  89.890 1.00 117.66 ? -69  DA  I OP2   1 
ATOM   6147  O  "O5'" . DA  I 5 4   ? 17.109  -11.167 90.976 1.00 115.48 ? -69  DA  I "O5'" 1 
ATOM   6148  C  "C5'" . DA  I 5 4   ? 15.934  -11.979 90.879 1.00 112.14 ? -69  DA  I "C5'" 1 
ATOM   6149  C  "C4'" . DA  I 5 4   ? 15.578  -12.424 89.461 1.00 109.36 ? -69  DA  I "C4'" 1 
ATOM   6150  O  "O4'" . DA  I 5 4   ? 14.535  -11.574 88.923 1.00 108.52 ? -69  DA  I "O4'" 1 
ATOM   6151  C  "C3'" . DA  I 5 4   ? 16.667  -12.470 88.387 1.00 107.78 ? -69  DA  I "C3'" 1 
ATOM   6152  O  "O3'" . DA  I 5 4   ? 16.473  -13.663 87.643 1.00 105.74 ? -69  DA  I "O3'" 1 
ATOM   6153  C  "C2'" . DA  I 5 4   ? 16.356  -11.253 87.517 1.00 107.75 ? -69  DA  I "C2'" 1 
ATOM   6154  C  "C1'" . DA  I 5 4   ? 14.833  -11.311 87.568 1.00 107.73 ? -69  DA  I "C1'" 1 
ATOM   6155  N  N9    . DA  I 5 4   ? 14.092  -10.105 87.227 1.00 107.16 ? -69  DA  I N9    1 
ATOM   6156  C  C8    . DA  I 5 4   ? 14.457  -8.799  87.393 1.00 107.05 ? -69  DA  I C8    1 
ATOM   6157  N  N7    . DA  I 5 4   ? 13.543  -7.945  86.996 1.00 106.82 ? -69  DA  I N7    1 
ATOM   6158  C  C5    . DA  I 5 4   ? 12.506  -8.746  86.547 1.00 106.68 ? -69  DA  I C5    1 
ATOM   6159  C  C6    . DA  I 5 4   ? 11.235  -8.463  85.993 1.00 106.54 ? -69  DA  I C6    1 
ATOM   6160  N  N6    . DA  I 5 4   ? 10.773  -7.225  85.793 1.00 106.42 ? -69  DA  I N6    1 
ATOM   6161  N  N1    . DA  I 5 4   ? 10.444  -9.504  85.652 1.00 106.18 ? -69  DA  I N1    1 
ATOM   6162  C  C2    . DA  I 5 4   ? 10.896  -10.749 85.849 1.00 106.23 ? -69  DA  I C2    1 
ATOM   6163  N  N3    . DA  I 5 4   ? 12.065  -11.140 86.357 1.00 106.46 ? -69  DA  I N3    1 
ATOM   6164  C  C4    . DA  I 5 4   ? 12.830  -10.082 86.688 1.00 106.78 ? -69  DA  I C4    1 
ATOM   6165  P  P     . DA  I 5 5   ? 17.692  -14.513 87.061 1.00 104.45 ? -68  DA  I P     1 
ATOM   6166  O  OP1   . DA  I 5 5   ? 18.127  -15.442 88.130 1.00 104.59 ? -68  DA  I OP1   1 
ATOM   6167  O  OP2   . DA  I 5 5   ? 18.643  -13.571 86.426 1.00 104.27 ? -68  DA  I OP2   1 
ATOM   6168  O  "O5'" . DA  I 5 5   ? 17.009  -15.355 85.880 1.00 103.56 ? -68  DA  I "O5'" 1 
ATOM   6169  C  "C5'" . DA  I 5 5   ? 15.891  -16.231 86.101 1.00 101.02 ? -68  DA  I "C5'" 1 
ATOM   6170  C  "C4'" . DA  I 5 5   ? 14.950  -16.268 84.895 1.00 99.19  ? -68  DA  I "C4'" 1 
ATOM   6171  O  "O4'" . DA  I 5 5   ? 14.235  -15.016 84.752 1.00 98.32  ? -68  DA  I "O4'" 1 
ATOM   6172  C  "C3'" . DA  I 5 5   ? 15.580  -16.536 83.528 1.00 98.03  ? -68  DA  I "C3'" 1 
ATOM   6173  O  "O3'" . DA  I 5 5   ? 14.730  -17.408 82.801 1.00 97.00  ? -68  DA  I "O3'" 1 
ATOM   6174  C  "C2'" . DA  I 5 5   ? 15.653  -15.165 82.862 1.00 97.39  ? -68  DA  I "C2'" 1 
ATOM   6175  C  "C1'" . DA  I 5 5   ? 14.411  -14.506 83.447 1.00 97.67  ? -68  DA  I "C1'" 1 
ATOM   6176  N  N9    . DA  I 5 5   ? 14.526  -13.067 83.585 1.00 97.36  ? -68  DA  I N9    1 
ATOM   6177  C  C8    . DA  I 5 5   ? 15.592  -12.381 84.101 1.00 97.70  ? -68  DA  I C8    1 
ATOM   6178  N  N7    . DA  I 5 5   ? 15.418  -11.082 84.112 1.00 97.97  ? -68  DA  I N7    1 
ATOM   6179  C  C5    . DA  I 5 5   ? 14.148  -10.908 83.574 1.00 97.33  ? -68  DA  I C5    1 
ATOM   6180  C  C6    . DA  I 5 5   ? 13.371  -9.757  83.311 1.00 96.98  ? -68  DA  I C6    1 
ATOM   6181  N  N6    . DA  I 5 5   ? 13.793  -8.520  83.580 1.00 96.71  ? -68  DA  I N6    1 
ATOM   6182  N  N1    . DA  I 5 5   ? 12.140  -9.926  82.766 1.00 96.80  ? -68  DA  I N1    1 
ATOM   6183  C  C2    . DA  I 5 5   ? 11.716  -11.173 82.499 1.00 96.86  ? -68  DA  I C2    1 
ATOM   6184  N  N3    . DA  I 5 5   ? 12.360  -12.329 82.699 1.00 97.10  ? -68  DA  I N3    1 
ATOM   6185  C  C4    . DA  I 5 5   ? 13.581  -12.126 83.244 1.00 97.29  ? -68  DA  I C4    1 
ATOM   6186  P  P     . DT  I 5 6   ? 15.299  -18.331 81.622 1.00 96.15  ? -67  DT  I P     1 
ATOM   6187  O  OP1   . DT  I 5 6   ? 14.836  -19.713 81.886 1.00 95.62  ? -67  DT  I OP1   1 
ATOM   6188  O  OP2   . DT  I 5 6   ? 16.742  -18.040 81.440 1.00 95.97  ? -67  DT  I OP2   1 
ATOM   6189  O  "O5'" . DT  I 5 6   ? 14.546  -17.765 80.325 1.00 94.89  ? -67  DT  I "O5'" 1 
ATOM   6190  C  "C5'" . DT  I 5 6   ? 13.178  -17.328 80.343 1.00 92.26  ? -67  DT  I "C5'" 1 
ATOM   6191  C  "C4'" . DT  I 5 6   ? 12.882  -16.314 79.242 1.00 90.37  ? -67  DT  I "C4'" 1 
ATOM   6192  O  "O4'" . DT  I 5 6   ? 12.946  -14.965 79.782 1.00 89.73  ? -67  DT  I "O4'" 1 
ATOM   6193  C  "C3'" . DT  I 5 6   ? 13.821  -16.307 78.030 1.00 89.74  ? -67  DT  I "C3'" 1 
ATOM   6194  O  "O3'" . DT  I 5 6   ? 13.130  -15.958 76.848 1.00 88.61  ? -67  DT  I "O3'" 1 
ATOM   6195  C  "C2'" . DT  I 5 6   ? 14.756  -15.155 78.346 1.00 89.83  ? -67  DT  I "C2'" 1 
ATOM   6196  C  "C1'" . DT  I 5 6   ? 13.677  -14.199 78.840 1.00 89.55  ? -67  DT  I "C1'" 1 
ATOM   6197  N  N1    . DT  I 5 6   ? 14.194  -12.920 79.407 1.00 89.30  ? -67  DT  I N1    1 
ATOM   6198  C  C2    . DT  I 5 6   ? 13.368  -11.810 79.410 1.00 88.91  ? -67  DT  I C2    1 
ATOM   6199  O  O2    . DT  I 5 6   ? 12.224  -11.810 78.992 1.00 88.57  ? -67  DT  I O2    1 
ATOM   6200  N  N3    . DT  I 5 6   ? 13.941  -10.681 79.933 1.00 88.73  ? -67  DT  I N3    1 
ATOM   6201  C  C4    . DT  I 5 6   ? 15.224  -10.555 80.436 1.00 88.89  ? -67  DT  I C4    1 
ATOM   6202  O  O4    . DT  I 5 6   ? 15.627  -9.490  80.883 1.00 89.27  ? -67  DT  I O4    1 
ATOM   6203  C  C5    . DT  I 5 6   ? 16.041  -11.748 80.400 1.00 89.17  ? -67  DT  I C5    1 
ATOM   6204  C  C7    . DT  I 5 6   ? 17.451  -11.742 80.914 1.00 89.29  ? -67  DT  I C7    1 
ATOM   6205  C  C6    . DT  I 5 6   ? 15.493  -12.859 79.891 1.00 89.34  ? -67  DT  I C6    1 
ATOM   6206  P  P     . DA  I 5 7   ? 12.750  -17.041 75.741 1.00 87.21  ? -66  DA  I P     1 
ATOM   6207  O  OP1   . DA  I 5 7   ? 12.058  -18.156 76.424 1.00 87.20  ? -66  DA  I OP1   1 
ATOM   6208  O  OP2   . DA  I 5 7   ? 13.925  -17.301 74.878 1.00 86.95  ? -66  DA  I OP2   1 
ATOM   6209  O  "O5'" . DA  I 5 7   ? 11.675  -16.213 74.908 1.00 86.25  ? -66  DA  I "O5'" 1 
ATOM   6210  C  "C5'" . DA  I 5 7   ? 10.497  -15.769 75.578 1.00 85.66  ? -66  DA  I "C5'" 1 
ATOM   6211  C  "C4'" . DA  I 5 7   ? 10.045  -14.384 75.134 1.00 85.46  ? -66  DA  I "C4'" 1 
ATOM   6212  O  "O4'" . DA  I 5 7   ? 10.825  -13.352 75.788 1.00 85.44  ? -66  DA  I "O4'" 1 
ATOM   6213  C  "C3'" . DA  I 5 7   ? 10.125  -14.090 73.640 1.00 85.38  ? -66  DA  I "C3'" 1 
ATOM   6214  O  "O3'" . DA  I 5 7   ? 8.905   -13.442 73.266 1.00 85.06  ? -66  DA  I "O3'" 1 
ATOM   6215  C  "C2'" . DA  I 5 7   ? 11.361  -13.197 73.527 1.00 85.38  ? -66  DA  I "C2'" 1 
ATOM   6216  C  "C1'" . DA  I 5 7   ? 11.274  -12.417 74.831 1.00 85.47  ? -66  DA  I "C1'" 1 
ATOM   6217  N  N9    . DA  I 5 7   ? 12.547  -11.882 75.304 1.00 85.70  ? -66  DA  I N9    1 
ATOM   6218  C  C8    . DA  I 5 7   ? 13.701  -12.581 75.523 1.00 86.04  ? -66  DA  I C8    1 
ATOM   6219  N  N7    . DA  I 5 7   ? 14.693  -11.838 75.957 1.00 86.51  ? -66  DA  I N7    1 
ATOM   6220  C  C5    . DA  I 5 7   ? 14.153  -10.563 76.028 1.00 86.14  ? -66  DA  I C5    1 
ATOM   6221  C  C6    . DA  I 5 7   ? 14.692  -9.312  76.421 1.00 85.85  ? -66  DA  I C6    1 
ATOM   6222  N  N6    . DA  I 5 7   ? 15.954  -9.150  76.829 1.00 85.57  ? -66  DA  I N6    1 
ATOM   6223  N  N1    . DA  I 5 7   ? 13.880  -8.230  76.379 1.00 85.77  ? -66  DA  I N1    1 
ATOM   6224  C  C2    . DA  I 5 7   ? 12.617  -8.392  75.962 1.00 85.85  ? -66  DA  I C2    1 
ATOM   6225  N  N3    . DA  I 5 7   ? 11.998  -9.515  75.578 1.00 86.01  ? -66  DA  I N3    1 
ATOM   6226  C  C4    . DA  I 5 7   ? 12.826  -10.575 75.631 1.00 85.76  ? -66  DA  I C4    1 
ATOM   6227  P  P     . DT  I 5 8   ? 8.617   -12.884 71.792 1.00 84.49  ? -65  DT  I P     1 
ATOM   6228  O  OP1   . DT  I 5 8   ? 7.160   -12.674 71.684 1.00 83.69  ? -65  DT  I OP1   1 
ATOM   6229  O  OP2   . DT  I 5 8   ? 9.350   -13.713 70.804 1.00 83.85  ? -65  DT  I OP2   1 
ATOM   6230  O  "O5'" . DT  I 5 8   ? 9.259   -11.434 71.836 1.00 85.47  ? -65  DT  I "O5'" 1 
ATOM   6231  C  "C5'" . DT  I 5 8   ? 8.631   -10.468 72.667 1.00 87.76  ? -65  DT  I "C5'" 1 
ATOM   6232  C  "C4'" . DT  I 5 8   ? 9.150   -9.081  72.363 1.00 89.33  ? -65  DT  I "C4'" 1 
ATOM   6233  O  "O4'" . DT  I 5 8   ? 10.481  -8.939  72.918 1.00 89.55  ? -65  DT  I "O4'" 1 
ATOM   6234  C  "C3'" . DT  I 5 8   ? 9.254   -8.756  70.878 1.00 90.60  ? -65  DT  I "C3'" 1 
ATOM   6235  O  "O3'" . DT  I 5 8   ? 8.549   -7.541  70.661 1.00 92.80  ? -65  DT  I "O3'" 1 
ATOM   6236  C  "C2'" . DT  I 5 8   ? 10.762  -8.656  70.623 1.00 90.16  ? -65  DT  I "C2'" 1 
ATOM   6237  C  "C1'" . DT  I 5 8   ? 11.295  -8.255  71.995 1.00 89.43  ? -65  DT  I "C1'" 1 
ATOM   6238  N  N1    . DT  I 5 8   ? 12.710  -8.629  72.298 1.00 89.38  ? -65  DT  I N1    1 
ATOM   6239  C  C2    . DT  I 5 8   ? 13.551  -7.669  72.835 1.00 89.83  ? -65  DT  I C2    1 
ATOM   6240  O  O2    . DT  I 5 8   ? 13.208  -6.520  73.073 1.00 89.94  ? -65  DT  I O2    1 
ATOM   6241  N  N3    . DT  I 5 8   ? 14.832  -8.108  73.088 1.00 90.06  ? -65  DT  I N3    1 
ATOM   6242  C  C4    . DT  I 5 8   ? 15.345  -9.381  72.865 1.00 89.77  ? -65  DT  I C4    1 
ATOM   6243  O  O4    . DT  I 5 8   ? 16.513  -9.664  73.126 1.00 89.62  ? -65  DT  I O4    1 
ATOM   6244  C  C5    . DT  I 5 8   ? 14.412  -10.337 72.304 1.00 89.79  ? -65  DT  I C5    1 
ATOM   6245  C  C7    . DT  I 5 8   ? 14.837  -11.752 72.014 1.00 89.84  ? -65  DT  I C7    1 
ATOM   6246  C  C6    . DT  I 5 8   ? 13.158  -9.920  72.056 1.00 89.47  ? -65  DT  I C6    1 
ATOM   6247  P  P     . DC  I 5 9   ? 8.190   -6.964  69.204 1.00 94.81  ? -64  DC  I P     1 
ATOM   6248  O  OP1   . DC  I 5 9   ? 6.788   -6.484  69.254 1.00 94.39  ? -64  DC  I OP1   1 
ATOM   6249  O  OP2   . DC  I 5 9   ? 8.627   -7.902  68.143 1.00 93.97  ? -64  DC  I OP2   1 
ATOM   6250  O  "O5'" . DC  I 5 9   ? 9.158   -5.700  69.124 1.00 96.58  ? -64  DC  I "O5'" 1 
ATOM   6251  C  "C5'" . DC  I 5 9   ? 9.151   -4.716  70.159 1.00 99.47  ? -64  DC  I "C5'" 1 
ATOM   6252  C  "C4'" . DC  I 5 9   ? 10.390  -3.853  70.031 1.00 101.69 ? -64  DC  I "C4'" 1 
ATOM   6253  O  "O4'" . DC  I 5 9   ? 11.535  -4.599  70.522 1.00 101.91 ? -64  DC  I "O4'" 1 
ATOM   6254  C  "C3'" . DC  I 5 9   ? 10.703  -3.445  68.593 1.00 103.27 ? -64  DC  I "C3'" 1 
ATOM   6255  O  "O3'" . DC  I 5 9   ? 10.715  -2.023  68.452 1.00 106.24 ? -64  DC  I "O3'" 1 
ATOM   6256  C  "C2'" . DC  I 5 9   ? 12.072  -4.057  68.301 1.00 102.69 ? -64  DC  I "C2'" 1 
ATOM   6257  C  "C1'" . DC  I 5 9   ? 12.644  -4.309  69.696 1.00 101.90 ? -64  DC  I "C1'" 1 
ATOM   6258  N  N1    . DC  I 5 9   ? 13.596  -5.458  69.750 1.00 101.49 ? -64  DC  I N1    1 
ATOM   6259  C  C2    . DC  I 5 9   ? 14.851  -5.309  70.368 1.00 101.61 ? -64  DC  I C2    1 
ATOM   6260  O  O2    . DC  I 5 9   ? 15.171  -4.224  70.875 1.00 102.01 ? -64  DC  I O2    1 
ATOM   6261  N  N3    . DC  I 5 9   ? 15.697  -6.374  70.395 1.00 101.43 ? -64  DC  I N3    1 
ATOM   6262  C  C4    . DC  I 5 9   ? 15.333  -7.537  69.842 1.00 101.06 ? -64  DC  I C4    1 
ATOM   6263  N  N4    . DC  I 5 9   ? 16.201  -8.553  69.894 1.00 100.77 ? -64  DC  I N4    1 
ATOM   6264  C  C5    . DC  I 5 9   ? 14.064  -7.705  69.205 1.00 100.94 ? -64  DC  I C5    1 
ATOM   6265  C  C6    . DC  I 5 9   ? 13.239  -6.653  69.185 1.00 100.97 ? -64  DC  I C6    1 
ATOM   6266  P  P     . DC  I 5 10  ? 9.990   -1.292  67.213 1.00 108.11 ? -63  DC  I P     1 
ATOM   6267  O  OP1   . DC  I 5 10  ? 9.186   -0.177  67.770 1.00 107.77 ? -63  DC  I OP1   1 
ATOM   6268  O  OP2   . DC  I 5 10  ? 9.349   -2.317  66.352 1.00 107.95 ? -63  DC  I OP2   1 
ATOM   6269  O  "O5'" . DC  I 5 10  ? 11.196  -0.657  66.374 1.00 109.29 ? -63  DC  I "O5'" 1 
ATOM   6270  C  "C5'" . DC  I 5 10  ? 12.379  -1.465  66.097 1.00 111.63 ? -63  DC  I "C5'" 1 
ATOM   6271  C  "C4'" . DC  I 5 10  ? 13.569  -0.623  66.518 1.00 113.59 ? -63  DC  I "C4'" 1 
ATOM   6272  O  "O4'" . DC  I 5 10  ? 14.409  -1.369  67.440 1.00 113.79 ? -63  DC  I "O4'" 1 
ATOM   6273  C  "C3'" . DC  I 5 10  ? 14.437  -0.180  65.346 1.00 115.20 ? -63  DC  I "C3'" 1 
ATOM   6274  O  "O3'" . DC  I 5 10  ? 14.819  1.186   65.512 1.00 117.50 ? -63  DC  I "O3'" 1 
ATOM   6275  C  "C2'" . DC  I 5 10  ? 15.631  -1.127  65.415 1.00 114.88 ? -63  DC  I "C2'" 1 
ATOM   6276  C  "C1'" . DC  I 5 10  ? 15.692  -1.571  66.878 1.00 114.39 ? -63  DC  I "C1'" 1 
ATOM   6277  N  N1    . DC  I 5 10  ? 16.075  -3.013  66.997 1.00 114.63 ? -63  DC  I N1    1 
ATOM   6278  C  C2    . DC  I 5 10  ? 17.299  -3.374  67.606 1.00 114.69 ? -63  DC  I C2    1 
ATOM   6279  O  O2    . DC  I 5 10  ? 18.061  -2.502  68.060 1.00 114.62 ? -63  DC  I O2    1 
ATOM   6280  N  N3    . DC  I 5 10  ? 17.616  -4.695  67.687 1.00 114.67 ? -63  DC  I N3    1 
ATOM   6281  C  C4    . DC  I 5 10  ? 16.779  -5.621  67.191 1.00 114.73 ? -63  DC  I C4    1 
ATOM   6282  N  N4    . DC  I 5 10  ? 17.143  -6.903  67.294 1.00 114.82 ? -63  DC  I N4    1 
ATOM   6283  C  C5    . DC  I 5 10  ? 15.534  -5.276  66.565 1.00 114.57 ? -63  DC  I C5    1 
ATOM   6284  C  C6    . DC  I 5 10  ? 15.229  -3.975  66.490 1.00 114.50 ? -63  DC  I C6    1 
ATOM   6285  P  P     . DA  I 5 11  ? 15.471  2.070   64.337 1.00 118.69 ? -62  DA  I P     1 
ATOM   6286  O  OP1   . DA  I 5 11  ? 14.465  3.086   63.959 1.00 118.39 ? -62  DA  I OP1   1 
ATOM   6287  O  OP2   . DA  I 5 11  ? 16.046  1.194   63.289 1.00 118.39 ? -62  DA  I OP2   1 
ATOM   6288  O  "O5'" . DA  I 5 11  ? 16.687  2.780   65.106 1.00 119.88 ? -62  DA  I "O5'" 1 
ATOM   6289  C  "C5'" . DA  I 5 11  ? 17.410  2.096   66.154 1.00 121.61 ? -62  DA  I "C5'" 1 
ATOM   6290  C  "C4'" . DA  I 5 11  ? 18.824  1.707   65.738 1.00 122.85 ? -62  DA  I "C4'" 1 
ATOM   6291  O  "O4'" . DA  I 5 11  ? 19.012  0.274   65.888 1.00 123.14 ? -62  DA  I "O4'" 1 
ATOM   6292  C  "C3'" . DA  I 5 11  ? 19.242  2.068   64.313 1.00 123.93 ? -62  DA  I "C3'" 1 
ATOM   6293  O  "O3'" . DA  I 5 11  ? 20.503  2.744   64.313 1.00 125.46 ? -62  DA  I "O3'" 1 
ATOM   6294  C  "C2'" . DA  I 5 11  ? 19.319  0.722   63.598 1.00 123.79 ? -62  DA  I "C2'" 1 
ATOM   6295  C  "C1'" . DA  I 5 11  ? 19.654  -0.244  64.733 1.00 123.42 ? -62  DA  I "C1'" 1 
ATOM   6296  N  N9    . DA  I 5 11  ? 19.202  -1.615  64.479 1.00 123.29 ? -62  DA  I N9    1 
ATOM   6297  C  C8    . DA  I 5 11  ? 17.986  -2.007  63.991 1.00 123.07 ? -62  DA  I C8    1 
ATOM   6298  N  N7    . DA  I 5 11  ? 17.846  -3.303  63.860 1.00 123.19 ? -62  DA  I N7    1 
ATOM   6299  C  C5    . DA  I 5 11  ? 19.064  -3.804  64.284 1.00 123.43 ? -62  DA  I C5    1 
ATOM   6300  C  C6    . DA  I 5 11  ? 19.571  -5.122  64.383 1.00 123.55 ? -62  DA  I C6    1 
ATOM   6301  N  N6    . DA  I 5 11  ? 18.863  -6.213  64.047 1.00 123.36 ? -62  DA  I N6    1 
ATOM   6302  N  N1    . DA  I 5 11  ? 20.837  -5.281  64.843 1.00 123.63 ? -62  DA  I N1    1 
ATOM   6303  C  C2    . DA  I 5 11  ? 21.549  -4.194  65.180 1.00 123.46 ? -62  DA  I C2    1 
ATOM   6304  N  N3    . DA  I 5 11  ? 21.177  -2.912  65.128 1.00 123.44 ? -62  DA  I N3    1 
ATOM   6305  C  C4    . DA  I 5 11  ? 19.916  -2.779  64.666 1.00 123.35 ? -62  DA  I C4    1 
ATOM   6306  P  P     . DC  I 5 12  ? 21.022  3.541   63.016 1.00 126.72 ? -61  DC  I P     1 
ATOM   6307  O  OP1   . DC  I 5 12  ? 21.665  4.787   63.508 1.00 126.84 ? -61  DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I 5 12  ? 19.926  3.634   62.012 1.00 126.43 ? -61  DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I 5 12  ? 22.157  2.551   62.466 1.00 127.02 ? -61  DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I 5 12  ? 23.358  2.369   63.223 1.00 127.81 ? -61  DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I 5 12  ? 24.041  1.051   62.904 1.00 128.36 ? -61  DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I 5 12  ? 23.098  -0.047  63.042 1.00 128.32 ? -61  DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I 5 12  ? 24.640  0.950   61.497 1.00 128.83 ? -61  DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I 5 12  ? 26.056  0.677   61.609 1.00 129.61 ? -61  DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I 5 12  ? 23.815  -0.160  60.839 1.00 128.51 ? -61  DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I 5 12  ? 23.409  -1.000  62.046 1.00 128.03 ? -61  DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I 5 12  ? 22.253  -1.943  61.788 1.00 127.48 ? -61  DC  I N1    1 
ATOM   6318  C  C2    . DC  I 5 12  ? 22.425  -3.330  61.993 1.00 127.33 ? -61  DC  I C2    1 
ATOM   6319  O  O2    . DC  I 5 12  ? 23.515  -3.769  62.394 1.00 127.63 ? -61  DC  I O2    1 
ATOM   6320  N  N3    . DC  I 5 12  ? 21.379  -4.169  61.750 1.00 127.07 ? -61  DC  I N3    1 
ATOM   6321  C  C4    . DC  I 5 12  ? 20.208  -3.681  61.317 1.00 126.90 ? -61  DC  I C4    1 
ATOM   6322  N  N4    . DC  I 5 12  ? 19.211  -4.550  61.094 1.00 126.60 ? -61  DC  I N4    1 
ATOM   6323  C  C5    . DC  I 5 12  ? 20.007  -2.279  61.099 1.00 126.88 ? -61  DC  I C5    1 
ATOM   6324  C  C6    . DC  I 5 12  ? 21.046  -1.460  61.340 1.00 127.13 ? -61  DC  I C6    1 
ATOM   6325  P  P     . DC  I 5 13  ? 26.936  -0.213  60.594 1.00 130.08 ? -60  DC  I P     1 
ATOM   6326  O  OP1   . DC  I 5 13  ? 28.357  0.056   60.913 1.00 129.98 ? -60  DC  I OP1   1 
ATOM   6327  O  OP2   . DC  I 5 13  ? 26.459  0.013   59.209 1.00 129.81 ? -60  DC  I OP2   1 
ATOM   6328  O  "O5'" . DC  I 5 13  ? 26.589  -1.721  61.027 1.00 130.59 ? -60  DC  I "O5'" 1 
ATOM   6329  C  "C5'" . DC  I 5 13  ? 27.609  -2.722  61.174 1.00 131.16 ? -60  DC  I "C5'" 1 
ATOM   6330  C  "C4'" . DC  I 5 13  ? 27.569  -3.747  60.047 1.00 131.63 ? -60  DC  I "C4'" 1 
ATOM   6331  O  "O4'" . DC  I 5 13  ? 26.224  -4.282  59.926 1.00 131.58 ? -60  DC  I "O4'" 1 
ATOM   6332  C  "C3'" . DC  I 5 13  ? 27.956  -3.220  58.662 1.00 132.01 ? -60  DC  I "C3'" 1 
ATOM   6333  O  "O3'" . DC  I 5 13  ? 28.925  -4.066  58.029 1.00 132.57 ? -60  DC  I "O3'" 1 
ATOM   6334  C  "C2'" . DC  I 5 13  ? 26.640  -3.203  57.886 1.00 131.78 ? -60  DC  I "C2'" 1 
ATOM   6335  C  "C1'" . DC  I 5 13  ? 25.858  -4.326  58.560 1.00 131.45 ? -60  DC  I "C1'" 1 
ATOM   6336  N  N1    . DC  I 5 13  ? 24.360  -4.221  58.432 1.00 131.03 ? -60  DC  I N1    1 
ATOM   6337  C  C2    . DC  I 5 13  ? 23.580  -5.391  58.402 1.00 130.80 ? -60  DC  I C2    1 
ATOM   6338  O  O2    . DC  I 5 13  ? 24.132  -6.494  58.488 1.00 130.68 ? -60  DC  I O2    1 
ATOM   6339  N  N3    . DC  I 5 13  ? 22.229  -5.280  58.288 1.00 130.66 ? -60  DC  I N3    1 
ATOM   6340  C  C4    . DC  I 5 13  ? 21.656  -4.074  58.200 1.00 130.39 ? -60  DC  I C4    1 
ATOM   6341  N  N4    . DC  I 5 13  ? 20.327  -4.016  58.087 1.00 130.07 ? -60  DC  I N4    1 
ATOM   6342  C  C5    . DC  I 5 13  ? 22.426  -2.871  58.226 1.00 130.50 ? -60  DC  I C5    1 
ATOM   6343  C  C6    . DC  I 5 13  ? 23.757  -2.992  58.342 1.00 130.74 ? -60  DC  I C6    1 
ATOM   6344  P  P     . DT  I 5 14  ? 29.939  -3.489  56.921 1.00 133.15 ? -59  DT  I P     1 
ATOM   6345  O  OP1   . DT  I 5 14  ? 31.212  -3.161  57.598 1.00 133.34 ? -59  DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I 5 14  ? 29.245  -2.450  56.123 1.00 133.05 ? -59  DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I 5 14  ? 30.204  -4.747  55.969 1.00 133.05 ? -59  DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I 5 14  ? 30.659  -5.989  56.529 1.00 133.04 ? -59  DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I 5 14  ? 29.920  -7.163  55.899 1.00 133.10 ? -59  DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I 5 14  ? 28.483  -7.056  56.125 1.00 133.29 ? -59  DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I 5 14  ? 30.133  -7.301  54.394 1.00 132.93 ? -59  DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I 5 14  ? 30.648  -8.595  54.075 1.00 132.26 ? -59  DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I 5 14  ? 28.749  -7.060  53.788 1.00 133.14 ? -59  DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I 5 14  ? 27.799  -7.404  54.931 1.00 133.24 ? -59  DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I 5 14  ? 26.465  -6.685  54.845 1.00 133.28 ? -59  DT  I N1    1 
ATOM   6356  C  C2    . DT  I 5 14  ? 25.283  -7.413  54.925 1.00 133.26 ? -59  DT  I C2    1 
ATOM   6357  O  O2    . DT  I 5 14  ? 25.240  -8.625  55.072 1.00 133.24 ? -59  DT  I O2    1 
ATOM   6358  N  N3    . DT  I 5 14  ? 24.130  -6.658  54.830 1.00 133.15 ? -59  DT  I N3    1 
ATOM   6359  C  C4    . DT  I 5 14  ? 24.035  -5.283  54.666 1.00 132.97 ? -59  DT  I C4    1 
ATOM   6360  O  O4    . DT  I 5 14  ? 22.946  -4.714  54.592 1.00 132.73 ? -59  DT  I O4    1 
ATOM   6361  C  C5    . DT  I 5 14  ? 25.302  -4.580  54.584 1.00 132.99 ? -59  DT  I C5    1 
ATOM   6362  C  C7    . DT  I 5 14  ? 25.343  -3.089  54.401 1.00 132.83 ? -59  DT  I C7    1 
ATOM   6363  C  C6    . DT  I 5 14  ? 26.435  -5.305  54.676 1.00 133.14 ? -59  DT  I C6    1 
ATOM   6364  P  P     . DG  I 5 15  ? 31.093  -8.968  52.577 1.00 131.66 ? -58  DG  I P     1 
ATOM   6365  O  OP1   . DG  I 5 15  ? 32.338  -9.769  52.656 1.00 131.64 ? -58  DG  I OP1   1 
ATOM   6366  O  OP2   . DG  I 5 15  ? 31.057  -7.749  51.731 1.00 131.70 ? -58  DG  I OP2   1 
ATOM   6367  O  "O5'" . DG  I 5 15  ? 29.887  -9.901  52.098 1.00 130.10 ? -58  DG  I "O5'" 1 
ATOM   6368  C  "C5'" . DG  I 5 15  ? 29.590  -11.121 52.762 1.00 127.92 ? -58  DG  I "C5'" 1 
ATOM   6369  C  "C4'" . DG  I 5 15  ? 28.331  -11.722 52.168 1.00 126.31 ? -58  DG  I "C4'" 1 
ATOM   6370  O  "O4'" . DG  I 5 15  ? 27.223  -10.794 52.288 1.00 126.09 ? -58  DG  I "O4'" 1 
ATOM   6371  C  "C3'" . DG  I 5 15  ? 28.421  -12.097 50.694 1.00 125.10 ? -58  DG  I "C3'" 1 
ATOM   6372  O  "O3'" . DG  I 5 15  ? 27.821  -13.371 50.545 1.00 123.46 ? -58  DG  I "O3'" 1 
ATOM   6373  C  "C2'" . DG  I 5 15  ? 27.644  -10.995 49.972 1.00 125.28 ? -58  DG  I "C2'" 1 
ATOM   6374  C  "C1'" . DG  I 5 15  ? 26.623  -10.567 51.026 1.00 125.62 ? -58  DG  I "C1'" 1 
ATOM   6375  N  N9    . DG  I 5 15  ? 26.233  -9.156  50.975 1.00 125.40 ? -58  DG  I N9    1 
ATOM   6376  C  C8    . DG  I 5 15  ? 27.070  -8.071  50.837 1.00 125.36 ? -58  DG  I C8    1 
ATOM   6377  N  N7    . DG  I 5 15  ? 26.448  -6.925  50.830 1.00 125.06 ? -58  DG  I N7    1 
ATOM   6378  C  C5    . DG  I 5 15  ? 25.109  -7.264  50.976 1.00 124.71 ? -58  DG  I C5    1 
ATOM   6379  C  C6    . DG  I 5 15  ? 23.962  -6.435  51.036 1.00 124.27 ? -58  DG  I C6    1 
ATOM   6380  O  O6    . DG  I 5 15  ? 23.908  -5.202  50.972 1.00 124.03 ? -58  DG  I O6    1 
ATOM   6381  N  N1    . DG  I 5 15  ? 22.789  -7.170  51.190 1.00 124.10 ? -58  DG  I N1    1 
ATOM   6382  C  C2    . DG  I 5 15  ? 22.737  -8.542  51.272 1.00 124.28 ? -58  DG  I C2    1 
ATOM   6383  N  N2    . DG  I 5 15  ? 21.519  -9.077  51.415 1.00 124.21 ? -58  DG  I N2    1 
ATOM   6384  N  N3    . DG  I 5 15  ? 23.803  -9.334  51.217 1.00 124.60 ? -58  DG  I N3    1 
ATOM   6385  C  C4    . DG  I 5 15  ? 24.957  -8.633  51.069 1.00 124.96 ? -58  DG  I C4    1 
ATOM   6386  P  P     . DC  I 5 16  ? 27.898  -14.166 49.162 1.00 122.30 ? -57  DC  I P     1 
ATOM   6387  O  OP1   . DC  I 5 16  ? 27.951  -15.613 49.481 1.00 122.14 ? -57  DC  I OP1   1 
ATOM   6388  O  OP2   . DC  I 5 16  ? 28.939  -13.543 48.305 1.00 122.17 ? -57  DC  I OP2   1 
ATOM   6389  O  "O5'" . DC  I 5 16  ? 26.485  -13.836 48.491 1.00 120.57 ? -57  DC  I "O5'" 1 
ATOM   6390  C  "C5'" . DC  I 5 16  ? 25.268  -13.945 49.226 1.00 117.89 ? -57  DC  I "C5'" 1 
ATOM   6391  C  "C4'" . DC  I 5 16  ? 24.112  -13.362 48.424 1.00 115.87 ? -57  DC  I "C4'" 1 
ATOM   6392  O  "O4'" . DC  I 5 16  ? 24.053  -11.923 48.609 1.00 115.26 ? -57  DC  I "O4'" 1 
ATOM   6393  C  "C3'" . DC  I 5 16  ? 24.220  -13.594 46.917 1.00 114.67 ? -57  DC  I "C3'" 1 
ATOM   6394  O  "O3'" . DC  I 5 16  ? 23.003  -14.133 46.442 1.00 113.17 ? -57  DC  I "O3'" 1 
ATOM   6395  C  "C2'" . DC  I 5 16  ? 24.499  -12.214 46.327 1.00 114.75 ? -57  DC  I "C2'" 1 
ATOM   6396  C  "C1'" . DC  I 5 16  ? 23.825  -11.311 47.354 1.00 114.73 ? -57  DC  I "C1'" 1 
ATOM   6397  N  N1    . DC  I 5 16  ? 24.330  -9.897  47.409 1.00 114.30 ? -57  DC  I N1    1 
ATOM   6398  C  C2    . DC  I 5 16  ? 23.448  -8.877  47.798 1.00 113.95 ? -57  DC  I C2    1 
ATOM   6399  O  O2    . DC  I 5 16  ? 22.282  -9.164  48.079 1.00 113.77 ? -57  DC  I O2    1 
ATOM   6400  N  N3    . DC  I 5 16  ? 23.897  -7.595  47.854 1.00 114.00 ? -57  DC  I N3    1 
ATOM   6401  C  C4    . DC  I 5 16  ? 25.167  -7.315  47.542 1.00 113.99 ? -57  DC  I C4    1 
ATOM   6402  N  N4    . DC  I 5 16  ? 25.559  -6.038  47.614 1.00 113.85 ? -57  DC  I N4    1 
ATOM   6403  C  C5    . DC  I 5 16  ? 26.089  -8.336  47.146 1.00 114.02 ? -57  DC  I C5    1 
ATOM   6404  C  C6    . DC  I 5 16  ? 25.632  -9.597  47.095 1.00 114.26 ? -57  DC  I C6    1 
ATOM   6405  P  P     . DA  I 5 17  ? 22.938  -15.681 46.061 1.00 111.62 ? -56  DA  I P     1 
ATOM   6406  O  OP1   . DA  I 5 17  ? 23.447  -16.454 47.215 1.00 111.67 ? -56  DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I 5 17  ? 23.557  -15.832 44.725 1.00 111.49 ? -56  DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I 5 17  ? 21.375  -15.973 45.909 1.00 110.86 ? -56  DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I 5 17  ? 20.460  -15.769 46.988 1.00 109.49 ? -56  DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I 5 17  ? 19.357  -14.799 46.579 1.00 108.43 ? -56  DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I 5 17  ? 19.928  -13.492 46.314 1.00 108.12 ? -56  DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I 5 17  ? 18.572  -15.167 45.323 1.00 107.62 ? -56  DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I 5 17  ? 17.213  -14.779 45.470 1.00 106.64 ? -56  DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I 5 17  ? 19.260  -14.358 44.226 1.00 107.79 ? -56  DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I 5 17  ? 19.642  -13.091 44.986 1.00 107.95 ? -56  DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I 5 17  ? 20.813  -12.380 44.472 1.00 107.86 ? -56  DA  I N9    1 
ATOM   6417  C  C8    . DA  I 5 17  ? 21.879  -12.909 43.790 1.00 108.10 ? -56  DA  I C8    1 
ATOM   6418  N  N7    . DA  I 5 17  ? 22.790  -12.025 43.457 1.00 107.98 ? -56  DA  I N7    1 
ATOM   6419  C  C5    . DA  I 5 17  ? 22.290  -10.834 43.959 1.00 107.43 ? -56  DA  I C5    1 
ATOM   6420  C  C6    . DA  I 5 17  ? 22.784  -9.515  43.942 1.00 107.06 ? -56  DA  I C6    1 
ATOM   6421  N  N6    . DA  I 5 17  ? 23.943  -9.191  43.368 1.00 107.20 ? -56  DA  I N6    1 
ATOM   6422  N  N1    . DA  I 5 17  ? 22.045  -8.546  44.529 1.00 106.51 ? -56  DA  I N1    1 
ATOM   6423  C  C2    . DA  I 5 17  ? 20.883  -8.884  45.102 1.00 106.53 ? -56  DA  I C2    1 
ATOM   6424  N  N3    . DA  I 5 17  ? 20.317  -10.089 45.182 1.00 107.05 ? -56  DA  I N3    1 
ATOM   6425  C  C4    . DA  I 5 17  ? 21.074  -11.032 44.589 1.00 107.47 ? -56  DA  I C4    1 
ATOM   6426  P  P     . DG  I 5 18  ? 16.050  -15.568 44.700 1.00 106.13 ? -55  DG  I P     1 
ATOM   6427  O  OP1   . DG  I 5 18  ? 15.356  -16.403 45.706 1.00 106.28 ? -55  DG  I OP1   1 
ATOM   6428  O  OP2   . DG  I 5 18  ? 16.626  -16.180 43.478 1.00 105.83 ? -55  DG  I OP2   1 
ATOM   6429  O  "O5'" . DG  I 5 18  ? 15.024  -14.439 44.222 1.00 104.50 ? -55  DG  I "O5'" 1 
ATOM   6430  C  "C5'" . DG  I 5 18  ? 14.885  -13.223 44.933 1.00 102.45 ? -55  DG  I "C5'" 1 
ATOM   6431  C  "C4'" . DG  I 5 18  ? 15.339  -12.067 44.064 1.00 101.03 ? -55  DG  I "C4'" 1 
ATOM   6432  O  "O4'" . DG  I 5 18  ? 16.714  -12.224 43.638 1.00 100.78 ? -55  DG  I "O4'" 1 
ATOM   6433  C  "C3'" . DG  I 5 18  ? 14.561  -11.875 42.763 1.00 100.32 ? -55  DG  I "C3'" 1 
ATOM   6434  O  "O3'" . DG  I 5 18  ? 13.751  -10.724 42.917 1.00 98.89  ? -55  DG  I "O3'" 1 
ATOM   6435  C  "C2'" . DG  I 5 18  ? 15.642  -11.662 41.695 1.00 100.38 ? -55  DG  I "C2'" 1 
ATOM   6436  C  "C1'" . DG  I 5 18  ? 16.826  -11.297 42.580 1.00 100.72 ? -55  DG  I "C1'" 1 
ATOM   6437  N  N9    . DG  I 5 18  ? 18.153  -11.349 41.964 1.00 100.90 ? -55  DG  I N9    1 
ATOM   6438  C  C8    . DG  I 5 18  ? 18.785  -12.440 41.421 1.00 101.02 ? -55  DG  I C8    1 
ATOM   6439  N  N7    . DG  I 5 18  ? 19.972  -12.174 40.954 1.00 101.08 ? -55  DG  I N7    1 
ATOM   6440  C  C5    . DG  I 5 18  ? 20.140  -10.818 41.201 1.00 101.21 ? -55  DG  I C5    1 
ATOM   6441  C  C6    . DG  I 5 18  ? 21.236  -9.961  40.913 1.00 101.57 ? -55  DG  I C6    1 
ATOM   6442  O  O6    . DG  I 5 18  ? 22.307  -10.257 40.363 1.00 101.97 ? -55  DG  I O6    1 
ATOM   6443  N  N1    . DG  I 5 18  ? 21.009  -8.645  41.329 1.00 101.23 ? -55  DG  I N1    1 
ATOM   6444  C  C2    . DG  I 5 18  ? 19.857  -8.215  41.949 1.00 100.93 ? -55  DG  I C2    1 
ATOM   6445  N  N2    . DG  I 5 18  ? 19.810  -6.919  42.282 1.00 100.72 ? -55  DG  I N2    1 
ATOM   6446  N  N3    . DG  I 5 18  ? 18.824  -9.007  42.224 1.00 100.87 ? -55  DG  I N3    1 
ATOM   6447  C  C4    . DG  I 5 18  ? 19.029  -10.293 41.824 1.00 100.97 ? -55  DG  I C4    1 
ATOM   6448  P  P     . DA  I 5 19  ? 12.413  -10.497 42.080 1.00 97.39  ? -54  DA  I P     1 
ATOM   6449  O  OP1   . DA  I 5 19  ? 11.289  -10.574 43.036 1.00 97.23  ? -54  DA  I OP1   1 
ATOM   6450  O  OP2   . DA  I 5 19  ? 12.440  -11.342 40.865 1.00 97.43  ? -54  DA  I OP2   1 
ATOM   6451  O  "O5'" . DA  I 5 19  ? 12.572  -8.990  41.589 1.00 98.24  ? -54  DA  I "O5'" 1 
ATOM   6452  C  "C5'" . DA  I 5 19  ? 13.093  -8.000  42.468 1.00 99.54  ? -54  DA  I "C5'" 1 
ATOM   6453  C  "C4'" . DA  I 5 19  ? 13.976  -7.007  41.733 1.00 100.32 ? -54  DA  I "C4'" 1 
ATOM   6454  O  "O4'" . DA  I 5 19  ? 15.245  -7.632  41.411 1.00 100.60 ? -54  DA  I "O4'" 1 
ATOM   6455  C  "C3'" . DA  I 5 19  ? 13.401  -6.481  40.418 1.00 100.92 ? -54  DA  I "C3'" 1 
ATOM   6456  O  "O3'" . DA  I 5 19  ? 13.390  -5.059  40.417 1.00 101.86 ? -54  DA  I "O3'" 1 
ATOM   6457  C  "C2'" . DA  I 5 19  ? 14.344  -7.051  39.357 1.00 101.01 ? -54  DA  I "C2'" 1 
ATOM   6458  C  "C1'" . DA  I 5 19  ? 15.643  -7.153  40.145 1.00 101.05 ? -54  DA  I "C1'" 1 
ATOM   6459  N  N9    . DA  I 5 19  ? 16.654  -8.030  39.549 1.00 101.45 ? -54  DA  I N9    1 
ATOM   6460  C  C8    . DA  I 5 19  ? 16.559  -9.367  39.268 1.00 101.49 ? -54  DA  I C8    1 
ATOM   6461  N  N7    . DA  I 5 19  ? 17.640  -9.878  38.727 1.00 101.62 ? -54  DA  I N7    1 
ATOM   6462  C  C5    . DA  I 5 19  ? 18.505  -8.798  38.643 1.00 102.15 ? -54  DA  I C5    1 
ATOM   6463  C  C6    . DA  I 5 19  ? 19.827  -8.660  38.157 1.00 102.59 ? -54  DA  I C6    1 
ATOM   6464  N  N6    . DA  I 5 19  ? 20.535  -9.674  37.643 1.00 102.71 ? -54  DA  I N6    1 
ATOM   6465  N  N1    . DA  I 5 19  ? 20.402  -7.434  38.221 1.00 102.72 ? -54  DA  I N1    1 
ATOM   6466  C  C2    . DA  I 5 19  ? 19.701  -6.411  38.737 1.00 102.25 ? -54  DA  I C2    1 
ATOM   6467  N  N3    . DA  I 5 19  ? 18.458  -6.420  39.221 1.00 101.90 ? -54  DA  I N3    1 
ATOM   6468  C  C4    . DA  I 5 19  ? 17.912  -7.651  39.146 1.00 101.83 ? -54  DA  I C4    1 
ATOM   6469  P  P     . DT  I 5 20  ? 12.326  -4.257  39.524 1.00 102.98 ? -53  DT  I P     1 
ATOM   6470  O  OP1   . DT  I 5 20  ? 11.189  -3.924  40.409 1.00 103.02 ? -53  DT  I OP1   1 
ATOM   6471  O  OP2   . DT  I 5 20  ? 12.076  -5.032  38.288 1.00 103.10 ? -53  DT  I OP2   1 
ATOM   6472  O  "O5'" . DT  I 5 20  ? 13.064  -2.899  39.086 1.00 104.92 ? -53  DT  I "O5'" 1 
ATOM   6473  C  "C5'" . DT  I 5 20  ? 14.367  -2.545  39.558 1.00 108.19 ? -53  DT  I "C5'" 1 
ATOM   6474  C  "C4'" . DT  I 5 20  ? 15.422  -2.530  38.455 1.00 110.71 ? -53  DT  I "C4'" 1 
ATOM   6475  O  "O4'" . DT  I 5 20  ? 15.934  -3.857  38.165 1.00 111.51 ? -53  DT  I "O4'" 1 
ATOM   6476  C  "C3'" . DT  I 5 20  ? 15.018  -1.935  37.100 1.00 112.16 ? -53  DT  I "C3'" 1 
ATOM   6477  O  "O3'" . DT  I 5 20  ? 15.662  -0.655  36.955 1.00 114.22 ? -53  DT  I "O3'" 1 
ATOM   6478  C  "C2'" . DT  I 5 20  ? 15.503  -2.977  36.076 1.00 112.22 ? -53  DT  I "C2'" 1 
ATOM   6479  C  "C1'" . DT  I 5 20  ? 16.548  -3.729  36.898 1.00 112.29 ? -53  DT  I "C1'" 1 
ATOM   6480  N  N1    . DT  I 5 20  ? 16.984  -5.064  36.340 1.00 112.89 ? -53  DT  I N1    1 
ATOM   6481  C  C2    . DT  I 5 20  ? 18.264  -5.196  35.815 1.00 113.21 ? -53  DT  I C2    1 
ATOM   6482  O  O2    . DT  I 5 20  ? 19.082  -4.291  35.767 1.00 113.44 ? -53  DT  I O2    1 
ATOM   6483  N  N3    . DT  I 5 20  ? 18.565  -6.449  35.332 1.00 113.32 ? -53  DT  I N3    1 
ATOM   6484  C  C4    . DT  I 5 20  ? 17.740  -7.563  35.321 1.00 113.35 ? -53  DT  I C4    1 
ATOM   6485  O  O4    . DT  I 5 20  ? 18.125  -8.636  34.859 1.00 113.61 ? -53  DT  I O4    1 
ATOM   6486  C  C5    . DT  I 5 20  ? 16.416  -7.365  35.883 1.00 113.29 ? -53  DT  I C5    1 
ATOM   6487  C  C7    . DT  I 5 20  ? 15.415  -8.488  35.936 1.00 112.99 ? -53  DT  I C7    1 
ATOM   6488  C  C6    . DT  I 5 20  ? 16.110  -6.142  36.355 1.00 113.15 ? -53  DT  I C6    1 
ATOM   6489  P  P     . DA  I 5 21  ? 15.614  0.245   35.622 1.00 115.72 ? -52  DA  I P     1 
ATOM   6490  O  OP1   . DA  I 5 21  ? 15.939  1.630   36.035 1.00 115.63 ? -52  DA  I OP1   1 
ATOM   6491  O  OP2   . DA  I 5 21  ? 14.350  -0.020  34.896 1.00 115.68 ? -52  DA  I OP2   1 
ATOM   6492  O  "O5'" . DA  I 5 21  ? 16.813  -0.350  34.744 1.00 117.16 ? -52  DA  I "O5'" 1 
ATOM   6493  C  "C5'" . DA  I 5 21  ? 18.165  -0.299  35.208 1.00 119.79 ? -52  DA  I "C5'" 1 
ATOM   6494  C  "C4'" . DA  I 5 21  ? 19.140  -0.486  34.055 1.00 121.84 ? -52  DA  I "C4'" 1 
ATOM   6495  O  "O4'" . DA  I 5 21  ? 19.435  -1.896  33.862 1.00 122.06 ? -52  DA  I "O4'" 1 
ATOM   6496  C  "C3'" . DA  I 5 21  ? 18.647  0.040   32.707 1.00 123.19 ? -52  DA  I "C3'" 1 
ATOM   6497  O  "O3'" . DA  I 5 21  ? 19.688  0.819   32.111 1.00 125.44 ? -52  DA  I "O3'" 1 
ATOM   6498  C  "C2'" . DA  I 5 21  ? 18.318  -1.234  31.923 1.00 122.85 ? -52  DA  I "C2'" 1 
ATOM   6499  C  "C1'" . DA  I 5 21  ? 19.343  -2.212  32.486 1.00 122.32 ? -52  DA  I "C1'" 1 
ATOM   6500  N  N9    . DA  I 5 21  ? 19.001  -3.633  32.358 1.00 122.10 ? -52  DA  I N9    1 
ATOM   6501  C  C8    . DA  I 5 21  ? 17.845  -4.253  32.756 1.00 121.88 ? -52  DA  I C8    1 
ATOM   6502  N  N7    . DA  I 5 21  ? 17.821  -5.545  32.521 1.00 121.67 ? -52  DA  I N7    1 
ATOM   6503  C  C5    . DA  I 5 21  ? 19.047  -5.796  31.925 1.00 121.79 ? -52  DA  I C5    1 
ATOM   6504  C  C6    . DA  I 5 21  ? 19.650  -6.978  31.430 1.00 121.71 ? -52  DA  I C6    1 
ATOM   6505  N  N6    . DA  I 5 21  ? 19.062  -8.178  31.461 1.00 121.37 ? -52  DA  I N6    1 
ATOM   6506  N  N1    . DA  I 5 21  ? 20.888  -6.881  30.892 1.00 121.86 ? -52  DA  I N1    1 
ATOM   6507  C  C2    . DA  I 5 21  ? 21.486  -5.678  30.851 1.00 121.90 ? -52  DA  I C2    1 
ATOM   6508  N  N3    . DA  I 5 21  ? 21.023  -4.503  31.288 1.00 121.81 ? -52  DA  I N3    1 
ATOM   6509  C  C4    . DA  I 5 21  ? 19.788  -4.627  31.818 1.00 121.85 ? -52  DA  I C4    1 
ATOM   6510  P  P     . DC  I 5 22  ? 19.423  1.883   30.937 1.00 127.27 ? -51  DC  I P     1 
ATOM   6511  O  OP1   . DC  I 5 22  ? 19.830  3.226   31.421 1.00 127.02 ? -51  DC  I OP1   1 
ATOM   6512  O  OP2   . DC  I 5 22  ? 18.060  1.689   30.371 1.00 126.95 ? -51  DC  I OP2   1 
ATOM   6513  O  "O5'" . DC  I 5 22  ? 20.486  1.402   29.840 1.00 128.98 ? -51  DC  I "O5'" 1 
ATOM   6514  C  "C5'" . DC  I 5 22  ? 20.610  0.002   29.569 1.00 131.72 ? -51  DC  I "C5'" 1 
ATOM   6515  C  "C4'" . DC  I 5 22  ? 21.414  -0.218  28.296 1.00 133.95 ? -51  DC  I "C4'" 1 
ATOM   6516  O  "O4'" . DC  I 5 22  ? 21.632  -1.643  28.142 1.00 134.56 ? -51  DC  I "O4'" 1 
ATOM   6517  C  "C3'" . DC  I 5 22  ? 20.710  0.266   27.023 1.00 135.33 ? -51  DC  I "C3'" 1 
ATOM   6518  O  "O3'" . DC  I 5 22  ? 21.684  0.916   26.165 1.00 136.90 ? -51  DC  I "O3'" 1 
ATOM   6519  C  "C2'" . DC  I 5 22  ? 20.035  -0.997  26.477 1.00 135.32 ? -51  DC  I "C2'" 1 
ATOM   6520  C  "C1'" . DC  I 5 22  ? 20.857  -2.148  27.065 1.00 135.28 ? -51  DC  I "C1'" 1 
ATOM   6521  N  N1    . DC  I 5 22  ? 20.038  -3.309  27.559 1.00 135.85 ? -51  DC  I N1    1 
ATOM   6522  C  C2    . DC  I 5 22  ? 20.548  -4.627  27.454 1.00 136.13 ? -51  DC  I C2    1 
ATOM   6523  O  O2    . DC  I 5 22  ? 21.670  -4.829  26.958 1.00 136.14 ? -51  DC  I O2    1 
ATOM   6524  N  N3    . DC  I 5 22  ? 19.786  -5.663  27.906 1.00 136.23 ? -51  DC  I N3    1 
ATOM   6525  C  C4    . DC  I 5 22  ? 18.576  -5.425  28.438 1.00 136.28 ? -51  DC  I C4    1 
ATOM   6526  N  N4    . DC  I 5 22  ? 17.871  -6.477  28.869 1.00 136.22 ? -51  DC  I N4    1 
ATOM   6527  C  C5    . DC  I 5 22  ? 18.038  -4.097  28.552 1.00 136.07 ? -51  DC  I C5    1 
ATOM   6528  C  C6    . DC  I 5 22  ? 18.796  -3.082  28.107 1.00 135.91 ? -51  DC  I C6    1 
ATOM   6529  P  P     . DT  I 5 23  ? 22.100  0.468   24.680 1.00 138.24 ? -50  DT  I P     1 
ATOM   6530  O  OP1   . DT  I 5 23  ? 23.140  1.427   24.244 1.00 138.46 ? -50  DT  I OP1   1 
ATOM   6531  O  OP2   . DT  I 5 23  ? 20.872  0.312   23.862 1.00 138.28 ? -50  DT  I OP2   1 
ATOM   6532  O  "O5'" . DT  I 5 23  ? 22.763  -0.979  24.893 1.00 138.95 ? -50  DT  I "O5'" 1 
ATOM   6533  C  "C5'" . DT  I 5 23  ? 23.979  -1.371  24.263 1.00 140.00 ? -50  DT  I "C5'" 1 
ATOM   6534  C  "C4'" . DT  I 5 23  ? 23.729  -2.455  23.226 1.00 140.93 ? -50  DT  I "C4'" 1 
ATOM   6535  O  "O4'" . DT  I 5 23  ? 22.688  -3.364  23.676 1.00 140.97 ? -50  DT  I "O4'" 1 
ATOM   6536  C  "C3'" . DT  I 5 23  ? 23.294  -1.941  21.856 1.00 141.66 ? -50  DT  I "C3'" 1 
ATOM   6537  O  "O3'" . DT  I 5 23  ? 24.087  -2.598  20.860 1.00 142.96 ? -50  DT  I "O3'" 1 
ATOM   6538  C  "C2'" . DT  I 5 23  ? 21.806  -2.298  21.788 1.00 141.45 ? -50  DT  I "C2'" 1 
ATOM   6539  C  "C1'" . DT  I 5 23  ? 21.738  -3.559  22.645 1.00 141.10 ? -50  DT  I "C1'" 1 
ATOM   6540  N  N1    . DT  I 5 23  ? 20.397  -3.848  23.271 1.00 140.99 ? -50  DT  I N1    1 
ATOM   6541  C  C2    . DT  I 5 23  ? 20.120  -5.124  23.742 1.00 140.92 ? -50  DT  I C2    1 
ATOM   6542  O  O2    . DT  I 5 23  ? 20.904  -6.057  23.683 1.00 140.85 ? -50  DT  I O2    1 
ATOM   6543  N  N3    . DT  I 5 23  ? 18.869  -5.276  24.297 1.00 140.81 ? -50  DT  I N3    1 
ATOM   6544  C  C4    . DT  I 5 23  ? 17.886  -4.307  24.433 1.00 140.84 ? -50  DT  I C4    1 
ATOM   6545  O  O4    . DT  I 5 23  ? 16.800  -4.565  24.950 1.00 140.58 ? -50  DT  I O4    1 
ATOM   6546  C  C5    . DT  I 5 23  ? 18.235  -2.995  23.920 1.00 140.94 ? -50  DT  I C5    1 
ATOM   6547  C  C7    . DT  I 5 23  ? 17.269  -1.847  23.994 1.00 140.95 ? -50  DT  I C7    1 
ATOM   6548  C  C6    . DT  I 5 23  ? 19.453  -2.836  23.375 1.00 141.00 ? -50  DT  I C6    1 
ATOM   6549  P  P     . DA  I 5 24  ? 23.841  -2.453  19.275 1.00 143.96 ? -49  DA  I P     1 
ATOM   6550  O  OP1   . DA  I 5 24  ? 25.163  -2.627  18.617 1.00 143.96 ? -49  DA  I OP1   1 
ATOM   6551  O  OP2   . DA  I 5 24  ? 23.049  -1.222  19.005 1.00 143.88 ? -49  DA  I OP2   1 
ATOM   6552  O  "O5'" . DA  I 5 24  ? 22.922  -3.730  18.948 1.00 144.21 ? -49  DA  I "O5'" 1 
ATOM   6553  C  "C5'" . DA  I 5 24  ? 23.433  -5.064  19.106 1.00 144.59 ? -49  DA  I "C5'" 1 
ATOM   6554  C  "C4'" . DA  I 5 24  ? 22.390  -6.113  18.746 1.00 144.92 ? -49  DA  I "C4'" 1 
ATOM   6555  O  "O4'" . DA  I 5 24  ? 21.352  -6.154  19.769 1.00 145.23 ? -49  DA  I "O4'" 1 
ATOM   6556  C  "C3'" . DA  I 5 24  ? 21.681  -5.905  17.405 1.00 144.90 ? -49  DA  I "C3'" 1 
ATOM   6557  O  "O3'" . DA  I 5 24  ? 21.758  -7.100  16.614 1.00 144.47 ? -49  DA  I "O3'" 1 
ATOM   6558  C  "C2'" . DA  I 5 24  ? 20.242  -5.561  17.797 1.00 145.14 ? -49  DA  I "C2'" 1 
ATOM   6559  C  "C1'" . DA  I 5 24  ? 20.098  -6.301  19.126 1.00 145.33 ? -49  DA  I "C1'" 1 
ATOM   6560  N  N9    . DA  I 5 24  ? 19.010  -5.824  19.993 1.00 145.45 ? -49  DA  I N9    1 
ATOM   6561  C  C8    . DA  I 5 24  ? 18.620  -4.529  20.218 1.00 145.48 ? -49  DA  I C8    1 
ATOM   6562  N  N7    . DA  I 5 24  ? 17.603  -4.411  21.044 1.00 145.57 ? -49  DA  I N7    1 
ATOM   6563  C  C5    . DA  I 5 24  ? 17.296  -5.718  21.389 1.00 145.58 ? -49  DA  I C5    1 
ATOM   6564  C  C6    . DA  I 5 24  ? 16.311  -6.285  22.238 1.00 145.59 ? -49  DA  I C6    1 
ATOM   6565  N  N6    . DA  I 5 24  ? 15.413  -5.565  22.922 1.00 145.58 ? -49  DA  I N6    1 
ATOM   6566  N  N1    . DA  I 5 24  ? 16.279  -7.631  22.362 1.00 145.57 ? -49  DA  I N1    1 
ATOM   6567  C  C2    . DA  I 5 24  ? 17.173  -8.363  21.677 1.00 145.64 ? -49  DA  I C2    1 
ATOM   6568  N  N3    . DA  I 5 24  ? 18.141  -7.945  20.854 1.00 145.60 ? -49  DA  I N3    1 
ATOM   6569  C  C4    . DA  I 5 24  ? 18.154  -6.602  20.749 1.00 145.53 ? -49  DA  I C4    1 
ATOM   6570  P  P     . DC  I 5 25  ? 21.424  -7.102  15.044 1.00 143.83 ? -48  DC  I P     1 
ATOM   6571  O  OP1   . DC  I 5 25  ? 22.402  -8.009  14.396 1.00 143.81 ? -48  DC  I OP1   1 
ATOM   6572  O  OP2   . DC  I 5 25  ? 21.295  -5.697  14.582 1.00 143.78 ? -48  DC  I OP2   1 
ATOM   6573  O  "O5'" . DC  I 5 25  ? 19.966  -7.767  14.980 1.00 142.96 ? -48  DC  I "O5'" 1 
ATOM   6574  C  "C5'" . DC  I 5 25  ? 19.800  -9.161  15.241 1.00 141.64 ? -48  DC  I "C5'" 1 
ATOM   6575  C  "C4'" . DC  I 5 25  ? 18.381  -9.478  15.682 1.00 140.56 ? -48  DC  I "C4'" 1 
ATOM   6576  O  "O4'" . DC  I 5 25  ? 17.942  -8.553  16.717 1.00 140.39 ? -48  DC  I "O4'" 1 
ATOM   6577  C  "C3'" . DC  I 5 25  ? 17.312  -9.426  14.589 1.00 139.84 ? -48  DC  I "C3'" 1 
ATOM   6578  O  "O3'" . DC  I 5 25  ? 16.649  -10.694 14.511 1.00 138.89 ? -48  DC  I "O3'" 1 
ATOM   6579  C  "C2'" . DC  I 5 25  ? 16.358  -8.334  15.077 1.00 139.97 ? -48  DC  I "C2'" 1 
ATOM   6580  C  "C1'" . DC  I 5 25  ? 16.537  -8.491  16.587 1.00 140.11 ? -48  DC  I "C1'" 1 
ATOM   6581  N  N1    . DC  I 5 25  ? 15.913  -7.438  17.484 1.00 139.80 ? -48  DC  I N1    1 
ATOM   6582  C  C2    . DC  I 5 25  ? 14.999  -7.823  18.491 1.00 139.50 ? -48  DC  I C2    1 
ATOM   6583  O  O2    . DC  I 5 25  ? 14.707  -9.016  18.647 1.00 139.21 ? -48  DC  I O2    1 
ATOM   6584  N  N3    . DC  I 5 25  ? 14.448  -6.865  19.284 1.00 139.51 ? -48  DC  I N3    1 
ATOM   6585  C  C4    . DC  I 5 25  ? 14.768  -5.577  19.113 1.00 139.61 ? -48  DC  I C4    1 
ATOM   6586  N  N4    . DC  I 5 25  ? 14.197  -4.675  19.921 1.00 139.39 ? -48  DC  I N4    1 
ATOM   6587  C  C5    . DC  I 5 25  ? 15.689  -5.163  18.100 1.00 139.75 ? -48  DC  I C5    1 
ATOM   6588  C  C6    . DC  I 5 25  ? 16.229  -6.114  17.321 1.00 139.84 ? -48  DC  I C6    1 
ATOM   6589  P  P     . DC  I 5 26  ? 15.984  -11.203 13.143 1.00 137.87 ? -47  DC  I P     1 
ATOM   6590  O  OP1   . DC  I 5 26  ? 17.108  -11.635 12.267 1.00 137.86 ? -47  DC  I OP1   1 
ATOM   6591  O  OP2   . DC  I 5 26  ? 15.056  -10.154 12.666 1.00 137.93 ? -47  DC  I OP2   1 
ATOM   6592  O  "O5'" . DC  I 5 26  ? 15.114  -12.501 13.528 1.00 136.57 ? -47  DC  I "O5'" 1 
ATOM   6593  C  "C5'" . DC  I 5 26  ? 14.552  -12.714 14.831 1.00 134.40 ? -47  DC  I "C5'" 1 
ATOM   6594  C  "C4'" . DC  I 5 26  ? 13.082  -12.320 14.915 1.00 132.75 ? -47  DC  I "C4'" 1 
ATOM   6595  O  "O4'" . DC  I 5 26  ? 12.970  -11.079 15.656 1.00 132.29 ? -47  DC  I "O4'" 1 
ATOM   6596  C  "C3'" . DC  I 5 26  ? 12.359  -12.089 13.582 1.00 131.78 ? -47  DC  I "C3'" 1 
ATOM   6597  O  "O3'" . DC  I 5 26  ? 11.207  -12.934 13.508 1.00 130.55 ? -47  DC  I "O3'" 1 
ATOM   6598  C  "C2'" . DC  I 5 26  ? 11.982  -10.601 13.581 1.00 131.69 ? -47  DC  I "C2'" 1 
ATOM   6599  C  "C1'" . DC  I 5 26  ? 11.920  -10.312 15.083 1.00 131.80 ? -47  DC  I "C1'" 1 
ATOM   6600  N  N1    . DC  I 5 26  ? 12.126  -8.885  15.503 1.00 131.53 ? -47  DC  I N1    1 
ATOM   6601  C  C2    . DC  I 5 26  ? 11.688  -8.494  16.779 1.00 131.35 ? -47  DC  I C2    1 
ATOM   6602  O  O2    . DC  I 5 26  ? 11.143  -9.327  17.515 1.00 131.50 ? -47  DC  I O2    1 
ATOM   6603  N  N3    . DC  I 5 26  ? 11.869  -7.209  17.182 1.00 131.19 ? -47  DC  I N3    1 
ATOM   6604  C  C4    . DC  I 5 26  ? 12.464  -6.332  16.365 1.00 131.23 ? -47  DC  I C4    1 
ATOM   6605  N  N4    . DC  I 5 26  ? 12.616  -5.080  16.806 1.00 131.11 ? -47  DC  I N4    1 
ATOM   6606  C  C5    . DC  I 5 26  ? 12.922  -6.703  15.059 1.00 131.39 ? -47  DC  I C5    1 
ATOM   6607  C  C6    . DC  I 5 26  ? 12.737  -7.976  14.674 1.00 131.49 ? -47  DC  I C6    1 
ATOM   6608  P  P     . DA  I 5 27  ? 11.165  -14.138 12.446 1.00 129.35 ? -46  DA  I P     1 
ATOM   6609  O  OP1   . DA  I 5 27  ? 12.521  -14.726 12.369 1.00 129.36 ? -46  DA  I OP1   1 
ATOM   6610  O  OP2   . DA  I 5 27  ? 10.500  -13.625 11.227 1.00 129.20 ? -46  DA  I OP2   1 
ATOM   6611  O  "O5'" . DA  I 5 27  ? 10.193  -15.227 13.106 1.00 128.10 ? -46  DA  I "O5'" 1 
ATOM   6612  C  "C5'" . DA  I 5 27  ? 10.127  -15.423 14.520 1.00 125.67 ? -46  DA  I "C5'" 1 
ATOM   6613  C  "C4'" . DA  I 5 27  ? 8.799   -14.930 15.071 1.00 123.71 ? -46  DA  I "C4'" 1 
ATOM   6614  O  "O4'" . DA  I 5 27  ? 8.838   -13.492 15.250 1.00 123.31 ? -46  DA  I "O4'" 1 
ATOM   6615  C  "C3'" . DA  I 5 27  ? 7.575   -15.222 14.211 1.00 122.57 ? -46  DA  I "C3'" 1 
ATOM   6616  O  "O3'" . DA  I 5 27  ? 6.557   -15.675 15.072 1.00 121.10 ? -46  DA  I "O3'" 1 
ATOM   6617  C  "C2'" . DA  I 5 27  ? 7.228   -13.873 13.580 1.00 122.65 ? -46  DA  I "C2'" 1 
ATOM   6618  C  "C1'" . DA  I 5 27  ? 7.711   -12.891 14.641 1.00 122.98 ? -46  DA  I "C1'" 1 
ATOM   6619  N  N9    . DA  I 5 27  ? 8.133   -11.584 14.136 1.00 123.15 ? -46  DA  I N9    1 
ATOM   6620  C  C8    . DA  I 5 27  ? 8.533   -11.261 12.867 1.00 123.21 ? -46  DA  I C8    1 
ATOM   6621  N  N7    . DA  I 5 27  ? 8.860   -10.000 12.715 1.00 123.18 ? -46  DA  I N7    1 
ATOM   6622  C  C5    . DA  I 5 27  ? 8.668   -9.455  13.970 1.00 123.04 ? -46  DA  I C5    1 
ATOM   6623  C  C6    . DA  I 5 27  ? 8.842   -8.153  14.478 1.00 123.19 ? -46  DA  I C6    1 
ATOM   6624  N  N6    . DA  I 5 27  ? 9.264   -7.125  13.739 1.00 123.28 ? -46  DA  I N6    1 
ATOM   6625  N  N1    . DA  I 5 27  ? 8.557   -7.939  15.780 1.00 123.44 ? -46  DA  I N1    1 
ATOM   6626  C  C2    . DA  I 5 27  ? 8.128   -8.968  16.524 1.00 123.39 ? -46  DA  I C2    1 
ATOM   6627  N  N3    . DA  I 5 27  ? 7.930   -10.234 16.158 1.00 123.23 ? -46  DA  I N3    1 
ATOM   6628  C  C4    . DA  I 5 27  ? 8.221   -10.416 14.858 1.00 123.08 ? -46  DA  I C4    1 
ATOM   6629  P  P     . DA  I 5 28  ? 5.208   -16.343 14.531 1.00 120.30 ? -45  DA  I P     1 
ATOM   6630  O  OP1   . DA  I 5 28  ? 5.169   -17.724 15.065 1.00 120.16 ? -45  DA  I OP1   1 
ATOM   6631  O  OP2   . DA  I 5 28  ? 5.055   -16.097 13.074 1.00 120.15 ? -45  DA  I OP2   1 
ATOM   6632  O  "O5'" . DA  I 5 28  ? 4.084   -15.485 15.282 1.00 118.90 ? -45  DA  I "O5'" 1 
ATOM   6633  C  "C5'" . DA  I 5 28  ? 4.336   -14.949 16.582 1.00 116.43 ? -45  DA  I "C5'" 1 
ATOM   6634  C  "C4'" . DA  I 5 28  ? 3.798   -13.535 16.711 1.00 114.40 ? -45  DA  I "C4'" 1 
ATOM   6635  O  "O4'" . DA  I 5 28  ? 4.591   -12.602 15.925 1.00 114.10 ? -45  DA  I "O4'" 1 
ATOM   6636  C  "C3'" . DA  I 5 28  ? 2.355   -13.361 16.240 1.00 113.07 ? -45  DA  I "C3'" 1 
ATOM   6637  O  "O3'" . DA  I 5 28  ? 1.630   -12.676 17.232 1.00 110.87 ? -45  DA  I "O3'" 1 
ATOM   6638  C  "C2'" . DA  I 5 28  ? 2.483   -12.503 14.988 1.00 113.40 ? -45  DA  I "C2'" 1 
ATOM   6639  C  "C1'" . DA  I 5 28  ? 3.686   -11.658 15.388 1.00 113.72 ? -45  DA  I "C1'" 1 
ATOM   6640  N  N9    . DA  I 5 28  ? 4.263   -10.881 14.288 1.00 113.53 ? -45  DA  I N9    1 
ATOM   6641  C  C8    . DA  I 5 28  ? 4.374   -11.257 12.975 1.00 113.61 ? -45  DA  I C8    1 
ATOM   6642  N  N7    . DA  I 5 28  ? 4.922   -10.345 12.206 1.00 113.82 ? -45  DA  I N7    1 
ATOM   6643  C  C5    . DA  I 5 28  ? 5.185   -9.294  13.070 1.00 113.55 ? -45  DA  I C5    1 
ATOM   6644  C  C6    . DA  I 5 28  ? 5.765   -8.019  12.876 1.00 113.38 ? -45  DA  I C6    1 
ATOM   6645  N  N6    . DA  I 5 28  ? 6.200   -7.576  11.691 1.00 113.47 ? -45  DA  I N6    1 
ATOM   6646  N  N1    . DA  I 5 28  ? 5.884   -7.208  13.951 1.00 113.25 ? -45  DA  I N1    1 
ATOM   6647  C  C2    . DA  I 5 28  ? 5.446   -7.644  15.141 1.00 113.23 ? -45  DA  I C2    1 
ATOM   6648  N  N3    . DA  I 5 28  ? 4.887   -8.817  15.445 1.00 113.36 ? -45  DA  I N3    1 
ATOM   6649  C  C4    . DA  I 5 28  ? 4.781   -9.606  14.358 1.00 113.48 ? -45  DA  I C4    1 
ATOM   6650  P  P     . DA  I 5 29  ? 0.474   -13.437 18.006 1.00 109.10 ? -44  DA  I P     1 
ATOM   6651  O  OP1   . DA  I 5 29  ? 1.121   -14.374 18.950 1.00 109.19 ? -44  DA  I OP1   1 
ATOM   6652  O  OP2   . DA  I 5 29  ? -0.507  -13.921 17.008 1.00 109.44 ? -44  DA  I OP2   1 
ATOM   6653  O  "O5'" . DA  I 5 29  ? -0.203  -12.253 18.828 1.00 108.80 ? -44  DA  I "O5'" 1 
ATOM   6654  C  "C5'" . DA  I 5 29  ? -0.816  -11.205 18.108 1.00 108.17 ? -44  DA  I "C5'" 1 
ATOM   6655  C  "C4'" . DA  I 5 29  ? -0.069  -9.912  18.347 1.00 107.41 ? -44  DA  I "C4'" 1 
ATOM   6656  O  "O4'" . DA  I 5 29  ? 0.975   -9.744  17.356 1.00 107.56 ? -44  DA  I "O4'" 1 
ATOM   6657  C  "C3'" . DA  I 5 29  ? -0.987  -8.710  18.246 1.00 107.27 ? -44  DA  I "C3'" 1 
ATOM   6658  O  "O3'" . DA  I 5 29  ? -0.859  -7.957  19.428 1.00 106.86 ? -44  DA  I "O3'" 1 
ATOM   6659  C  "C2'" . DA  I 5 29  ? -0.509  -7.934  17.021 1.00 107.75 ? -44  DA  I "C2'" 1 
ATOM   6660  C  "C1'" . DA  I 5 29  ? 0.886   -8.475  16.734 1.00 107.75 ? -44  DA  I "C1'" 1 
ATOM   6661  N  N9    . DA  I 5 29  ? 1.156   -8.598  15.295 1.00 107.96 ? -44  DA  I N9    1 
ATOM   6662  C  C8    . DA  I 5 29  ? 0.802   -9.637  14.478 1.00 107.79 ? -44  DA  I C8    1 
ATOM   6663  N  N7    . DA  I 5 29  ? 1.170   -9.492  13.228 1.00 107.63 ? -44  DA  I N7    1 
ATOM   6664  C  C5    . DA  I 5 29  ? 1.803   -8.264  13.215 1.00 107.83 ? -44  DA  I C5    1 
ATOM   6665  C  C6    . DA  I 5 29  ? 2.422   -7.529  12.183 1.00 107.88 ? -44  DA  I C6    1 
ATOM   6666  N  N6    . DA  I 5 29  ? 2.488   -7.962  10.922 1.00 107.98 ? -44  DA  I N6    1 
ATOM   6667  N  N1    . DA  I 5 29  ? 2.965   -6.329  12.493 1.00 107.94 ? -44  DA  I N1    1 
ATOM   6668  C  C2    . DA  I 5 29  ? 2.891   -5.898  13.761 1.00 107.78 ? -44  DA  I C2    1 
ATOM   6669  N  N3    . DA  I 5 29  ? 2.339   -6.506  14.815 1.00 107.83 ? -44  DA  I N3    1 
ATOM   6670  C  C4    . DA  I 5 29  ? 1.806   -7.695  14.478 1.00 107.83 ? -44  DA  I C4    1 
ATOM   6671  P  P     . DA  I 5 30  ? -2.125  -7.181  20.005 1.00 106.47 ? -43  DA  I P     1 
ATOM   6672  O  OP1   . DA  I 5 30  ? -1.791  -6.813  21.400 1.00 106.49 ? -43  DA  I OP1   1 
ATOM   6673  O  OP2   . DA  I 5 30  ? -3.337  -7.971  19.690 1.00 106.61 ? -43  DA  I OP2   1 
ATOM   6674  O  "O5'" . DA  I 5 30  ? -2.212  -5.869  19.104 1.00 106.16 ? -43  DA  I "O5'" 1 
ATOM   6675  C  "C5'" . DA  I 5 30  ? -1.204  -4.876  19.178 1.00 105.80 ? -43  DA  I "C5'" 1 
ATOM   6676  C  "C4'" . DA  I 5 30  ? -1.368  -3.919  18.019 1.00 105.39 ? -43  DA  I "C4'" 1 
ATOM   6677  O  "O4'" . DA  I 5 30  ? -0.900  -4.573  16.820 1.00 105.08 ? -43  DA  I "O4'" 1 
ATOM   6678  C  "C3'" . DA  I 5 30  ? -2.809  -3.500  17.754 1.00 105.29 ? -43  DA  I "C3'" 1 
ATOM   6679  O  "O3'" . DA  I 5 30  ? -2.928  -2.131  18.129 1.00 106.01 ? -43  DA  I "O3'" 1 
ATOM   6680  C  "C2'" . DA  I 5 30  ? -3.027  -3.787  16.264 1.00 105.02 ? -43  DA  I "C2'" 1 
ATOM   6681  C  "C1'" . DA  I 5 30  ? -1.624  -4.071  15.725 1.00 104.67 ? -43  DA  I "C1'" 1 
ATOM   6682  N  N9    . DA  I 5 30  ? -1.551  -5.067  14.650 1.00 104.09 ? -43  DA  I N9    1 
ATOM   6683  C  C8    . DA  I 5 30  ? -2.163  -6.291  14.617 1.00 103.91 ? -43  DA  I C8    1 
ATOM   6684  N  N7    . DA  I 5 30  ? -1.916  -6.982  13.532 1.00 103.76 ? -43  DA  I N7    1 
ATOM   6685  C  C5    . DA  I 5 30  ? -1.086  -6.156  12.791 1.00 103.31 ? -43  DA  I C5    1 
ATOM   6686  C  C6    . DA  I 5 30  ? -0.473  -6.303  11.528 1.00 102.78 ? -43  DA  I C6    1 
ATOM   6687  N  N6    . DA  I 5 30  ? -0.608  -7.387  10.764 1.00 102.76 ? -43  DA  I N6    1 
ATOM   6688  N  N1    . DA  I 5 30  ? 0.301   -5.294  11.075 1.00 102.73 ? -43  DA  I N1    1 
ATOM   6689  C  C2    . DA  I 5 30  ? 0.446   -4.200  11.834 1.00 103.03 ? -43  DA  I C2    1 
ATOM   6690  N  N3    . DA  I 5 30  ? -0.081  -3.944  13.032 1.00 103.33 ? -43  DA  I N3    1 
ATOM   6691  C  C4    . DA  I 5 30  ? -0.845  -4.971  13.465 1.00 103.65 ? -43  DA  I C4    1 
ATOM   6692  P  P     . DG  I 5 31  ? -4.185  -1.204  17.783 1.00 106.98 ? -42  DG  I P     1 
ATOM   6693  O  OP1   . DG  I 5 31  ? -4.255  -0.158  18.824 1.00 107.53 ? -42  DG  I OP1   1 
ATOM   6694  O  OP2   . DG  I 5 31  ? -5.372  -2.052  17.523 1.00 107.32 ? -42  DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  I 5 31  ? -3.721  -0.543  16.402 1.00 108.55 ? -42  DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  I 5 31  ? -2.381  -0.035  16.219 1.00 110.15 ? -42  DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  I 5 31  ? -2.086  0.273   14.751 1.00 111.21 ? -42  DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  I 5 31  ? -1.867  -0.965  14.021 1.00 111.33 ? -42  DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  I 5 31  ? -3.215  1.015   14.030 1.00 111.98 ? -42  DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  I 5 31  ? -2.765  2.291   13.579 1.00 112.99 ? -42  DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  I 5 31  ? -3.627  0.106   12.869 1.00 111.88 ? -42  DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  I 5 31  ? -2.449  -0.859  12.730 1.00 111.82 ? -42  DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  I 5 31  ? -2.874  -2.186  12.284 1.00 112.31 ? -42  DG  I N9    1 
ATOM   6704  C  C8    . DG  I 5 31  ? -3.570  -3.115  13.018 1.00 112.41 ? -42  DG  I C8    1 
ATOM   6705  N  N7    . DG  I 5 31  ? -3.820  -4.222  12.379 1.00 112.62 ? -42  DG  I N7    1 
ATOM   6706  C  C5    . DG  I 5 31  ? -3.267  -4.013  11.125 1.00 112.86 ? -42  DG  I C5    1 
ATOM   6707  C  C6    . DG  I 5 31  ? -3.232  -4.866  9.993  1.00 113.05 ? -42  DG  I C6    1 
ATOM   6708  O  O6    . DG  I 5 31  ? -3.702  -6.007  9.884  1.00 113.04 ? -42  DG  I O6    1 
ATOM   6709  N  N1    . DG  I 5 31  ? -2.572  -4.282  8.910  1.00 113.28 ? -42  DG  I N1    1 
ATOM   6710  C  C2    . DG  I 5 31  ? -2.013  -3.021  8.921  1.00 113.46 ? -42  DG  I C2    1 
ATOM   6711  N  N2    . DG  I 5 31  ? -1.416  -2.622  7.784  1.00 113.63 ? -42  DG  I N2    1 
ATOM   6712  N  N3    . DG  I 5 31  ? -2.041  -2.210  9.979  1.00 113.32 ? -42  DG  I N3    1 
ATOM   6713  C  C4    . DG  I 5 31  ? -2.680  -2.765  11.046 1.00 112.81 ? -42  DG  I C4    1 
ATOM   6714  P  P     . DT  I 5 32  ? -3.827  3.388   13.098 1.00 113.64 ? -41  DT  I P     1 
ATOM   6715  O  OP1   . DT  I 5 32  ? -3.269  4.718   13.410 1.00 113.56 ? -41  DT  I OP1   1 
ATOM   6716  O  OP2   . DT  I 5 32  ? -5.158  3.009   13.623 1.00 113.51 ? -41  DT  I OP2   1 
ATOM   6717  O  "O5'" . DT  I 5 32  ? -3.867  3.176   11.512 1.00 115.17 ? -41  DT  I "O5'" 1 
ATOM   6718  C  "C5'" . DT  I 5 32  ? -2.689  3.261   10.701 1.00 117.27 ? -41  DT  I "C5'" 1 
ATOM   6719  C  "C4'" . DT  I 5 32  ? -2.982  2.823   9.270  1.00 118.82 ? -41  DT  I "C4'" 1 
ATOM   6720  O  "O4'" . DT  I 5 32  ? -3.169  1.386   9.237  1.00 119.03 ? -41  DT  I "O4'" 1 
ATOM   6721  C  "C3'" . DT  I 5 32  ? -4.245  3.433   8.659  1.00 119.89 ? -41  DT  I "C3'" 1 
ATOM   6722  O  "O3'" . DT  I 5 32  ? -3.894  4.266   7.553  1.00 121.51 ? -41  DT  I "O3'" 1 
ATOM   6723  C  "C2'" . DT  I 5 32  ? -5.121  2.246   8.231  1.00 119.52 ? -41  DT  I "C2'" 1 
ATOM   6724  C  "C1'" . DT  I 5 32  ? -4.140  1.073   8.255  1.00 119.29 ? -41  DT  I "C1'" 1 
ATOM   6725  N  N1    . DT  I 5 32  ? -4.765  -0.237  8.619  1.00 119.49 ? -41  DT  I N1    1 
ATOM   6726  C  C2    . DT  I 5 32  ? -4.611  -1.321  7.774  1.00 119.61 ? -41  DT  I C2    1 
ATOM   6727  O  O2    . DT  I 5 32  ? -3.990  -1.280  6.728  1.00 119.97 ? -41  DT  I O2    1 
ATOM   6728  N  N3    . DT  I 5 32  ? -5.218  -2.477  8.203  1.00 119.60 ? -41  DT  I N3    1 
ATOM   6729  C  C4    . DT  I 5 32  ? -5.950  -2.659  9.365  1.00 119.66 ? -41  DT  I C4    1 
ATOM   6730  O  O4    . DT  I 5 32  ? -6.451  -3.745  9.651  1.00 119.60 ? -41  DT  I O4    1 
ATOM   6731  C  C5    . DT  I 5 32  ? -6.074  -1.487  10.206 1.00 119.64 ? -41  DT  I C5    1 
ATOM   6732  C  C7    . DT  I 5 32  ? -6.841  -1.541  11.496 1.00 119.60 ? -41  DT  I C7    1 
ATOM   6733  C  C6    . DT  I 5 32  ? -5.484  -0.352  9.797  1.00 119.60 ? -41  DT  I C6    1 
ATOM   6734  P  P     . DG  I 5 33  ? -4.997  5.211   6.875  1.00 123.07 ? -40  DG  I P     1 
ATOM   6735  O  OP1   . DG  I 5 33  ? -4.268  6.306   6.193  1.00 123.07 ? -40  DG  I OP1   1 
ATOM   6736  O  OP2   . DG  I 5 33  ? -6.043  5.536   7.878  1.00 122.90 ? -40  DG  I OP2   1 
ATOM   6737  O  "O5'" . DG  I 5 33  ? -5.656  4.233   5.787  1.00 124.06 ? -40  DG  I "O5'" 1 
ATOM   6738  C  "C5'" . DG  I 5 33  ? -4.910  3.752   4.663  1.00 125.34 ? -40  DG  I "C5'" 1 
ATOM   6739  C  "C4'" . DG  I 5 33  ? -5.779  2.881   3.765  1.00 126.39 ? -40  DG  I "C4'" 1 
ATOM   6740  O  "O4'" . DG  I 5 33  ? -5.874  1.555   4.349  1.00 126.38 ? -40  DG  I "O4'" 1 
ATOM   6741  C  "C3'" . DG  I 5 33  ? -7.215  3.377   3.558  1.00 127.18 ? -40  DG  I "C3'" 1 
ATOM   6742  O  "O3'" . DG  I 5 33  ? -7.530  3.459   2.165  1.00 128.51 ? -40  DG  I "O3'" 1 
ATOM   6743  C  "C2'" . DG  I 5 33  ? -8.075  2.334   4.269  1.00 126.91 ? -40  DG  I "C2'" 1 
ATOM   6744  C  "C1'" . DG  I 5 33  ? -7.199  1.088   4.209  1.00 126.49 ? -40  DG  I "C1'" 1 
ATOM   6745  N  N9    . DG  I 5 33  ? -7.513  0.125   5.267  1.00 126.13 ? -40  DG  I N9    1 
ATOM   6746  C  C8    . DG  I 5 33  ? -7.661  0.379   6.611  1.00 125.94 ? -40  DG  I C8    1 
ATOM   6747  N  N7    . DG  I 5 33  ? -7.950  -0.678  7.315  1.00 125.83 ? -40  DG  I N7    1 
ATOM   6748  C  C5    . DG  I 5 33  ? -8.002  -1.703  6.379  1.00 125.82 ? -40  DG  I C5    1 
ATOM   6749  C  C6    . DG  I 5 33  ? -8.274  -3.084  6.545  1.00 125.71 ? -40  DG  I C6    1 
ATOM   6750  O  O6    . DG  I 5 33  ? -8.531  -3.689  7.591  1.00 125.68 ? -40  DG  I O6    1 
ATOM   6751  N  N1    . DG  I 5 33  ? -8.229  -3.785  5.341  1.00 125.69 ? -40  DG  I N1    1 
ATOM   6752  C  C2    . DG  I 5 33  ? -7.954  -3.214  4.121  1.00 125.75 ? -40  DG  I C2    1 
ATOM   6753  N  N2    . DG  I 5 33  ? -7.953  -4.037  3.065  1.00 125.91 ? -40  DG  I N2    1 
ATOM   6754  N  N3    . DG  I 5 33  ? -7.699  -1.922  3.948  1.00 125.89 ? -40  DG  I N3    1 
ATOM   6755  C  C4    . DG  I 5 33  ? -7.738  -1.225  5.114  1.00 125.92 ? -40  DG  I C4    1 
ATOM   6756  P  P     . DT  I 5 34  ? -8.910  4.103   1.628  1.00 129.66 ? -39  DT  I P     1 
ATOM   6757  O  OP1   . DT  I 5 34  ? -8.558  5.169   0.648  1.00 129.71 ? -39  DT  I OP1   1 
ATOM   6758  O  OP2   . DT  I 5 34  ? -9.805  4.451   2.764  1.00 129.60 ? -39  DT  I OP2   1 
ATOM   6759  O  "O5'" . DT  I 5 34  ? -9.575  2.864   0.852  1.00 130.05 ? -39  DT  I "O5'" 1 
ATOM   6760  C  "C5'" . DT  I 5 34  ? -8.798  2.070   -0.109 1.00 130.64 ? -39  DT  I "C5'" 1 
ATOM   6761  C  "C4'" . DT  I 5 34  ? -9.527  0.734   -0.337 1.00 130.99 ? -39  DT  I "C4'" 1 
ATOM   6762  O  "O4'" . DT  I 5 34  ? -9.442  -0.059  0.881  1.00 131.12 ? -39  DT  I "O4'" 1 
ATOM   6763  C  "C3'" . DT  I 5 34  ? -11.018 0.873   -0.679 1.00 131.18 ? -39  DT  I "C3'" 1 
ATOM   6764  O  "O3'" . DT  I 5 34  ? -11.387 0.125   -1.841 1.00 130.84 ? -39  DT  I "O3'" 1 
ATOM   6765  C  "C2'" . DT  I 5 34  ? -11.740 0.348   0.560  1.00 131.46 ? -39  DT  I "C2'" 1 
ATOM   6766  C  "C1'" . DT  I 5 34  ? -10.717 -0.619  1.155  1.00 131.59 ? -39  DT  I "C1'" 1 
ATOM   6767  N  N1    . DT  I 5 34  ? -10.902 -0.826  2.637  1.00 131.97 ? -39  DT  I N1    1 
ATOM   6768  C  C2    . DT  I 5 34  ? -10.903 -2.111  3.154  1.00 131.95 ? -39  DT  I C2    1 
ATOM   6769  O  O2    . DT  I 5 34  ? -10.748 -3.119  2.486  1.00 131.94 ? -39  DT  I O2    1 
ATOM   6770  N  N3    . DT  I 5 34  ? -11.086 -2.182  4.513  1.00 132.07 ? -39  DT  I N3    1 
ATOM   6771  C  C4    . DT  I 5 34  ? -11.272 -1.126  5.389  1.00 132.35 ? -39  DT  I C4    1 
ATOM   6772  O  O4    . DT  I 5 34  ? -11.428 -1.310  6.592  1.00 132.67 ? -39  DT  I O4    1 
ATOM   6773  C  C5    . DT  I 5 34  ? -11.269 0.191   4.791  1.00 132.43 ? -39  DT  I C5    1 
ATOM   6774  C  C7    . DT  I 5 34  ? -11.460 1.421   5.634  1.00 132.48 ? -39  DT  I C7    1 
ATOM   6775  C  C6    . DT  I 5 34  ? -11.087 0.273   3.463  1.00 132.32 ? -39  DT  I C6    1 
ATOM   6776  P  P     . DA  I 5 35  ? -12.710 0.496   -2.677 1.00 130.46 ? -38  DA  I P     1 
ATOM   6777  O  OP1   . DA  I 5 35  ? -12.250 1.063   -3.961 1.00 130.51 ? -38  DA  I OP1   1 
ATOM   6778  O  OP2   . DA  I 5 35  ? -13.635 1.287   -1.828 1.00 130.34 ? -38  DA  I OP2   1 
ATOM   6779  O  "O5'" . DA  I 5 35  ? -13.397 -0.929  -2.951 1.00 130.18 ? -38  DA  I "O5'" 1 
ATOM   6780  C  "C5'" . DA  I 5 35  ? -12.631 -2.139  -2.985 1.00 129.57 ? -38  DA  I "C5'" 1 
ATOM   6781  C  "C4'" . DA  I 5 35  ? -13.349 -3.266  -2.256 1.00 129.20 ? -38  DA  I "C4'" 1 
ATOM   6782  O  "O4'" . DA  I 5 35  ? -13.240 -3.083  -0.814 1.00 129.16 ? -38  DA  I "O4'" 1 
ATOM   6783  C  "C3'" . DA  I 5 35  ? -14.846 -3.410  -2.558 1.00 128.78 ? -38  DA  I "C3'" 1 
ATOM   6784  O  "O3'" . DA  I 5 35  ? -15.137 -4.768  -2.934 1.00 128.01 ? -38  DA  I "O3'" 1 
ATOM   6785  C  "C2'" . DA  I 5 35  ? -15.501 -2.995  -1.240 1.00 128.92 ? -38  DA  I "C2'" 1 
ATOM   6786  C  "C1'" . DA  I 5 35  ? -14.463 -3.524  -0.256 1.00 129.06 ? -38  DA  I "C1'" 1 
ATOM   6787  N  N9    . DA  I 5 35  ? -14.639 -3.085  1.136  1.00 128.88 ? -38  DA  I N9    1 
ATOM   6788  C  C8    . DA  I 5 35  ? -14.461 -1.829  1.657  1.00 128.82 ? -38  DA  I C8    1 
ATOM   6789  N  N7    . DA  I 5 35  ? -14.701 -1.743  2.946  1.00 128.48 ? -38  DA  I N7    1 
ATOM   6790  C  C5    . DA  I 5 35  ? -15.064 -3.033  3.300  1.00 128.40 ? -38  DA  I C5    1 
ATOM   6791  C  C6    . DA  I 5 35  ? -15.442 -3.619  4.529  1.00 128.13 ? -38  DA  I C6    1 
ATOM   6792  N  N6    . DA  I 5 35  ? -15.516 -2.935  5.672  1.00 128.09 ? -38  DA  I N6    1 
ATOM   6793  N  N1    . DA  I 5 35  ? -15.743 -4.938  4.544  1.00 128.05 ? -38  DA  I N1    1 
ATOM   6794  C  C2    . DA  I 5 35  ? -15.670 -5.629  3.398  1.00 128.14 ? -38  DA  I C2    1 
ATOM   6795  N  N3    . DA  I 5 35  ? -15.327 -5.190  2.184  1.00 128.29 ? -38  DA  I N3    1 
ATOM   6796  C  C4    . DA  I 5 35  ? -15.032 -3.874  2.199  1.00 128.51 ? -38  DA  I C4    1 
ATOM   6797  P  P     . DT  I 5 36  ? -16.633 -5.341  -3.093 1.00 127.41 ? -37  DT  I P     1 
ATOM   6798  O  OP1   . DT  I 5 36  ? -16.544 -6.518  -3.988 1.00 127.40 ? -37  DT  I OP1   1 
ATOM   6799  O  OP2   . DT  I 5 36  ? -17.562 -4.224  -3.427 1.00 127.22 ? -37  DT  I OP2   1 
ATOM   6800  O  "O5'" . DT  I 5 36  ? -17.008 -5.847  -1.609 1.00 126.82 ? -37  DT  I "O5'" 1 
ATOM   6801  C  "C5'" . DT  I 5 36  ? -16.740 -7.201  -1.188 1.00 125.55 ? -37  DT  I "C5'" 1 
ATOM   6802  C  "C4'" . DT  I 5 36  ? -17.753 -7.674  -0.152 1.00 124.53 ? -37  DT  I "C4'" 1 
ATOM   6803  O  "O4'" . DT  I 5 36  ? -17.620 -6.893  1.069  1.00 124.72 ? -37  DT  I "O4'" 1 
ATOM   6804  C  "C3'" . DT  I 5 36  ? -19.223 -7.587  -0.575 1.00 123.49 ? -37  DT  I "C3'" 1 
ATOM   6805  O  "O3'" . DT  I 5 36  ? -19.879 -8.833  -0.289 1.00 121.43 ? -37  DT  I "O3'" 1 
ATOM   6806  C  "C2'" . DT  I 5 36  ? -19.760 -6.408  0.239  1.00 124.14 ? -37  DT  I "C2'" 1 
ATOM   6807  C  "C1'" . DT  I 5 36  ? -18.895 -6.444  1.495  1.00 124.71 ? -37  DT  I "C1'" 1 
ATOM   6808  N  N1    . DT  I 5 36  ? -18.777 -5.114  2.203  1.00 124.90 ? -37  DT  I N1    1 
ATOM   6809  C  C2    . DT  I 5 36  ? -19.008 -5.030  3.572  1.00 124.92 ? -37  DT  I C2    1 
ATOM   6810  O  O2    . DT  I 5 36  ? -19.304 -5.980  4.282  1.00 124.81 ? -37  DT  I O2    1 
ATOM   6811  N  N3    . DT  I 5 36  ? -18.872 -3.764  4.095  1.00 125.04 ? -37  DT  I N3    1 
ATOM   6812  C  C4    . DT  I 5 36  ? -18.540 -2.600  3.413  1.00 125.09 ? -37  DT  I C4    1 
ATOM   6813  O  O4    . DT  I 5 36  ? -18.444 -1.516  3.984  1.00 124.95 ? -37  DT  I O4    1 
ATOM   6814  C  C5    . DT  I 5 36  ? -18.317 -2.755  1.990  1.00 125.10 ? -37  DT  I C5    1 
ATOM   6815  C  C7    . DT  I 5 36  ? -17.955 -1.573  1.133  1.00 125.10 ? -37  DT  I C7    1 
ATOM   6816  C  C6    . DT  I 5 36  ? -18.445 -3.984  1.465  1.00 124.99 ? -37  DT  I C6    1 
ATOM   6817  P  P     . DT  I 5 37  ? -21.470 -9.021  -0.100 1.00 119.94 ? -36  DT  I P     1 
ATOM   6818  O  OP1   . DT  I 5 37  ? -21.796 -10.392 -0.554 1.00 119.86 ? -36  DT  I OP1   1 
ATOM   6819  O  OP2   . DT  I 5 37  ? -22.208 -7.876  -0.683 1.00 120.06 ? -36  DT  I OP2   1 
ATOM   6820  O  "O5'" . DT  I 5 37  ? -21.640 -8.946  1.493  1.00 118.02 ? -36  DT  I "O5'" 1 
ATOM   6821  C  "C5'" . DT  I 5 37  ? -21.013 -9.922  2.333  1.00 114.64 ? -36  DT  I "C5'" 1 
ATOM   6822  C  "C4'" . DT  I 5 37  ? -21.481 -9.787  3.771  1.00 111.96 ? -36  DT  I "C4'" 1 
ATOM   6823  O  "O4'" . DT  I 5 37  ? -21.236 -8.438  4.240  1.00 111.52 ? -36  DT  I "O4'" 1 
ATOM   6824  C  "C3'" . DT  I 5 37  ? -22.963 -10.058 4.001  1.00 110.23 ? -36  DT  I "C3'" 1 
ATOM   6825  O  "O3'" . DT  I 5 37  ? -23.077 -10.861 5.162  1.00 107.51 ? -36  DT  I "O3'" 1 
ATOM   6826  C  "C2'" . DT  I 5 37  ? -23.583 -8.672  4.187  1.00 110.61 ? -36  DT  I "C2'" 1 
ATOM   6827  C  "C1'" . DT  I 5 37  ? -22.417 -7.907  4.808  1.00 111.33 ? -36  DT  I "C1'" 1 
ATOM   6828  N  N1    . DT  I 5 37  ? -22.392 -6.430  4.577  1.00 111.59 ? -36  DT  I N1    1 
ATOM   6829  C  C2    . DT  I 5 37  ? -22.339 -5.590  5.674  1.00 111.98 ? -36  DT  I C2    1 
ATOM   6830  O  O2    . DT  I 5 37  ? -22.330 -5.979  6.830  1.00 112.31 ? -36  DT  I O2    1 
ATOM   6831  N  N3    . DT  I 5 37  ? -22.304 -4.253  5.365  1.00 112.27 ? -36  DT  I N3    1 
ATOM   6832  C  C4    . DT  I 5 37  ? -22.310 -3.681  4.105  1.00 112.30 ? -36  DT  I C4    1 
ATOM   6833  O  O4    . DT  I 5 37  ? -22.276 -2.462  3.955  1.00 112.45 ? -36  DT  I O4    1 
ATOM   6834  C  C5    . DT  I 5 37  ? -22.362 -4.614  2.998  1.00 112.10 ? -36  DT  I C5    1 
ATOM   6835  C  C7    . DT  I 5 37  ? -22.377 -4.120  1.577  1.00 112.03 ? -36  DT  I C7    1 
ATOM   6836  C  C6    . DT  I 5 37  ? -22.397 -5.926  3.285  1.00 111.81 ? -36  DT  I C6    1 
ATOM   6837  P  P     . DT  I 5 38  ? -24.401 -11.695 5.491  1.00 105.68 ? -35  DT  I P     1 
ATOM   6838  O  OP1   . DT  I 5 38  ? -23.969 -13.053 5.890  1.00 105.07 ? -35  DT  I OP1   1 
ATOM   6839  O  OP2   . DT  I 5 38  ? -25.376 -11.530 4.387  1.00 105.74 ? -35  DT  I OP2   1 
ATOM   6840  O  "O5'" . DT  I 5 38  ? -24.999 -10.932 6.767  1.00 103.76 ? -35  DT  I "O5'" 1 
ATOM   6841  C  "C5'" . DT  I 5 38  ? -24.179 -10.616 7.899  1.00 100.40 ? -35  DT  I "C5'" 1 
ATOM   6842  C  "C4'" . DT  I 5 38  ? -24.810 -9.522  8.745  1.00 97.70  ? -35  DT  I "C4'" 1 
ATOM   6843  O  "O4'" . DT  I 5 38  ? -24.629 -8.232  8.107  1.00 97.26  ? -35  DT  I "O4'" 1 
ATOM   6844  C  "C3'" . DT  I 5 38  ? -26.311 -9.670  8.995  1.00 95.98  ? -35  DT  I "C3'" 1 
ATOM   6845  O  "O3'" . DT  I 5 38  ? -26.553 -9.684  10.394 1.00 93.10  ? -35  DT  I "O3'" 1 
ATOM   6846  C  "C2'" . DT  I 5 38  ? -26.926 -8.429  8.349  1.00 96.65  ? -35  DT  I "C2'" 1 
ATOM   6847  C  "C1'" . DT  I 5 38  ? -25.761 -7.451  8.416  1.00 97.46  ? -35  DT  I "C1'" 1 
ATOM   6848  N  N1    . DT  I 5 38  ? -25.853 -6.287  7.479  1.00 98.32  ? -35  DT  I N1    1 
ATOM   6849  C  C2    . DT  I 5 38  ? -25.933 -5.006  8.004  1.00 98.72  ? -35  DT  I C2    1 
ATOM   6850  O  O2    . DT  I 5 38  ? -25.935 -4.759  9.199  1.00 98.79  ? -35  DT  I O2    1 
ATOM   6851  N  N3    . DT  I 5 38  ? -26.014 -4.005  7.066  1.00 99.06  ? -35  DT  I N3    1 
ATOM   6852  C  C4    . DT  I 5 38  ? -26.021 -4.150  5.685  1.00 99.31  ? -35  DT  I C4    1 
ATOM   6853  O  O4    . DT  I 5 38  ? -26.099 -3.174  4.941  1.00 99.58  ? -35  DT  I O4    1 
ATOM   6854  C  C5    . DT  I 5 38  ? -25.934 -5.518  5.200  1.00 99.34  ? -35  DT  I C5    1 
ATOM   6855  C  C7    . DT  I 5 38  ? -25.933 -5.833  3.723  1.00 99.57  ? -35  DT  I C7    1 
ATOM   6856  C  C6    . DT  I 5 38  ? -25.855 -6.503  6.108  1.00 98.88  ? -35  DT  I C6    1 
ATOM   6857  P  P     . DG  I 5 39  ? -26.763 -11.039 11.223 1.00 90.40  ? -34  DG  I P     1 
ATOM   6858  O  OP1   . DG  I 5 39  ? -25.685 -11.999 10.899 1.00 89.52  ? -34  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I 5 39  ? -28.187 -11.444 11.116 1.00 89.92  ? -34  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I 5 39  ? -26.515 -10.525 12.714 1.00 88.61  ? -34  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I 5 39  ? -25.348 -9.777  13.020 1.00 86.40  ? -34  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I 5 39  ? -25.655 -8.593  13.927 1.00 85.09  ? -34  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I 5 39  ? -26.132 -7.462  13.157 1.00 85.23  ? -34  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I 5 39  ? -26.687 -8.807  15.025 1.00 83.94  ? -34  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I 5 39  ? -26.216 -8.142  16.191 1.00 81.54  ? -34  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I 5 39  ? -27.967 -8.188  14.461 1.00 85.02  ? -34  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I 5 39  ? -27.443 -7.096  13.536 1.00 86.26  ? -34  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I 5 39  ? -28.176 -6.919  12.283 1.00 88.46  ? -34  DG  I N9    1 
ATOM   6869  C  C8    . DG  I 5 39  ? -28.867 -7.865  11.557 1.00 89.00  ? -34  DG  I C8    1 
ATOM   6870  N  N7    . DG  I 5 39  ? -29.404 -7.399  10.461 1.00 89.51  ? -34  DG  I N7    1 
ATOM   6871  C  C5    . DG  I 5 39  ? -29.039 -6.058  10.452 1.00 89.66  ? -34  DG  I C5    1 
ATOM   6872  C  C6    . DG  I 5 39  ? -29.330 -5.038  9.511  1.00 90.05  ? -34  DG  I C6    1 
ATOM   6873  O  O6    . DG  I 5 39  ? -29.992 -5.135  8.466  1.00 90.51  ? -34  DG  I O6    1 
ATOM   6874  N  N1    . DG  I 5 39  ? -28.771 -3.809  9.882  1.00 89.93  ? -34  DG  I N1    1 
ATOM   6875  C  C2    . DG  I 5 39  ? -28.022 -3.597  11.023 1.00 89.59  ? -34  DG  I C2    1 
ATOM   6876  N  N2    . DG  I 5 39  ? -27.556 -2.358  11.229 1.00 89.38  ? -34  DG  I N2    1 
ATOM   6877  N  N3    . DG  I 5 39  ? -27.742 -4.545  11.910 1.00 89.53  ? -34  DG  I N3    1 
ATOM   6878  C  C4    . DG  I 5 39  ? -28.282 -5.746  11.565 1.00 89.41  ? -34  DG  I C4    1 
ATOM   6879  P  P     . DG  I 5 40  ? -27.001 -8.190  17.579 1.00 79.86  ? -33  DG  I P     1 
ATOM   6880  O  OP1   . DG  I 5 40  ? -25.981 -8.054  18.636 1.00 80.66  ? -33  DG  I OP1   1 
ATOM   6881  O  OP2   . DG  I 5 40  ? -27.922 -9.345  17.599 1.00 79.45  ? -33  DG  I OP2   1 
ATOM   6882  O  "O5'" . DG  I 5 40  ? -27.898 -6.870  17.540 1.00 81.23  ? -33  DG  I "O5'" 1 
ATOM   6883  C  "C5'" . DG  I 5 40  ? -27.321 -5.563  17.565 1.00 82.77  ? -33  DG  I "C5'" 1 
ATOM   6884  C  "C4'" . DG  I 5 40  ? -28.389 -4.527  17.260 1.00 84.41  ? -33  DG  I "C4'" 1 
ATOM   6885  O  "O4'" . DG  I 5 40  ? -28.897 -4.763  15.926 1.00 85.51  ? -33  DG  I "O4'" 1 
ATOM   6886  C  "C3'" . DG  I 5 40  ? -29.610 -4.561  18.174 1.00 85.44  ? -33  DG  I "C3'" 1 
ATOM   6887  O  "O3'" . DG  I 5 40  ? -30.016 -3.241  18.457 1.00 86.66  ? -33  DG  I "O3'" 1 
ATOM   6888  C  "C2'" . DG  I 5 40  ? -30.663 -5.282  17.342 1.00 86.21  ? -33  DG  I "C2'" 1 
ATOM   6889  C  "C1'" . DG  I 5 40  ? -30.305 -4.729  15.969 1.00 86.77  ? -33  DG  I "C1'" 1 
ATOM   6890  N  N9    . DG  I 5 40  ? -30.876 -5.419  14.807 1.00 88.32  ? -33  DG  I N9    1 
ATOM   6891  C  C8    . DG  I 5 40  ? -31.233 -6.741  14.661 1.00 89.01  ? -33  DG  I C8    1 
ATOM   6892  N  N7    . DG  I 5 40  ? -31.724 -7.028  13.484 1.00 89.29  ? -33  DG  I N7    1 
ATOM   6893  C  C5    . DG  I 5 40  ? -31.697 -5.816  12.804 1.00 89.57  ? -33  DG  I C5    1 
ATOM   6894  C  C6    . DG  I 5 40  ? -32.105 -5.487  11.481 1.00 89.84  ? -33  DG  I C6    1 
ATOM   6895  O  O6    . DG  I 5 40  ? -32.586 -6.234  10.613 1.00 90.00  ? -33  DG  I O6    1 
ATOM   6896  N  N1    . DG  I 5 40  ? -31.898 -4.132  11.198 1.00 89.83  ? -33  DG  I N1    1 
ATOM   6897  C  C2    . DG  I 5 40  ? -31.366 -3.214  12.081 1.00 89.65  ? -33  DG  I C2    1 
ATOM   6898  N  N2    . DG  I 5 40  ? -31.239 -1.954  11.650 1.00 89.76  ? -33  DG  I N2    1 
ATOM   6899  N  N3    . DG  I 5 40  ? -30.986 -3.507  13.317 1.00 89.60  ? -33  DG  I N3    1 
ATOM   6900  C  C4    . DG  I 5 40  ? -31.178 -4.820  13.609 1.00 89.23  ? -33  DG  I C4    1 
ATOM   6901  P  P     . DA  I 5 41  ? -30.031 -2.693  19.959 1.00 88.04  ? -32  DA  I P     1 
ATOM   6902  O  OP1   . DA  I 5 41  ? -28.697 -2.933  20.552 1.00 87.03  ? -32  DA  I OP1   1 
ATOM   6903  O  OP2   . DA  I 5 41  ? -31.258 -3.220  20.609 1.00 87.58  ? -32  DA  I OP2   1 
ATOM   6904  O  "O5'" . DA  I 5 41  ? -30.195 -1.110  19.767 1.00 89.52  ? -32  DA  I "O5'" 1 
ATOM   6905  C  "C5'" . DA  I 5 41  ? -29.517 -0.393  18.728 1.00 91.29  ? -32  DA  I "C5'" 1 
ATOM   6906  C  "C4'" . DA  I 5 41  ? -30.485 0.513   17.983 1.00 93.12  ? -32  DA  I "C4'" 1 
ATOM   6907  O  "O4'" . DA  I 5 41  ? -31.013 -0.193  16.831 1.00 93.23  ? -32  DA  I "O4'" 1 
ATOM   6908  C  "C3'" . DA  I 5 41  ? -31.676 0.984   18.818 1.00 94.33  ? -32  DA  I "C3'" 1 
ATOM   6909  O  "O3'" . DA  I 5 41  ? -31.654 2.426   18.957 1.00 96.25  ? -32  DA  I "O3'" 1 
ATOM   6910  C  "C2'" . DA  I 5 41  ? -32.906 0.356   18.150 1.00 93.87  ? -32  DA  I "C2'" 1 
ATOM   6911  C  "C1'" . DA  I 5 41  ? -32.423 -0.110  16.778 1.00 93.49  ? -32  DA  I "C1'" 1 
ATOM   6912  N  N9    . DA  I 5 41  ? -32.938 -1.419  16.362 1.00 93.48  ? -32  DA  I N9    1 
ATOM   6913  C  C8    . DA  I 5 41  ? -32.991 -2.567  17.110 1.00 93.51  ? -32  DA  I C8    1 
ATOM   6914  N  N7    . DA  I 5 41  ? -33.499 -3.602  16.482 1.00 93.28  ? -32  DA  I N7    1 
ATOM   6915  C  C5    . DA  I 5 41  ? -33.802 -3.103  15.228 1.00 93.50  ? -32  DA  I C5    1 
ATOM   6916  C  C6    . DA  I 5 41  ? -34.370 -3.701  14.082 1.00 93.42  ? -32  DA  I C6    1 
ATOM   6917  N  N6    . DA  I 5 41  ? -34.739 -4.985  14.037 1.00 93.63  ? -32  DA  I N6    1 
ATOM   6918  N  N1    . DA  I 5 41  ? -34.543 -2.926  12.986 1.00 93.39  ? -32  DA  I N1    1 
ATOM   6919  C  C2    . DA  I 5 41  ? -34.167 -1.637  13.039 1.00 93.56  ? -32  DA  I C2    1 
ATOM   6920  N  N3    . DA  I 5 41  ? -33.620 -0.964  14.055 1.00 93.57  ? -32  DA  I N3    1 
ATOM   6921  C  C4    . DA  I 5 41  ? -33.463 -1.759  15.133 1.00 93.60  ? -32  DA  I C4    1 
ATOM   6922  P  P     . DA  I 5 42  ? -32.838 3.439   18.584 1.00 98.34  ? -31  DA  I P     1 
ATOM   6923  O  OP1   . DA  I 5 42  ? -32.310 4.791   18.866 1.00 98.31  ? -31  DA  I OP1   1 
ATOM   6924  O  OP2   . DA  I 5 42  ? -34.107 3.007   19.221 1.00 98.17  ? -31  DA  I OP2   1 
ATOM   6925  O  "O5'" . DA  I 5 42  ? -32.953 3.240   16.995 1.00 100.04 ? -31  DA  I "O5'" 1 
ATOM   6926  C  "C5'" . DA  I 5 42  ? -33.468 4.263   16.152 1.00 102.48 ? -31  DA  I "C5'" 1 
ATOM   6927  C  "C4'" . DA  I 5 42  ? -34.838 3.907   15.592 1.00 104.28 ? -31  DA  I "C4'" 1 
ATOM   6928  O  "O4'" . DA  I 5 42  ? -34.981 2.472   15.403 1.00 104.58 ? -31  DA  I "O4'" 1 
ATOM   6929  C  "C3'" . DA  I 5 42  ? -36.024 4.355   16.446 1.00 105.42 ? -31  DA  I "C3'" 1 
ATOM   6930  O  "O3'" . DA  I 5 42  ? -36.819 5.246   15.662 1.00 107.24 ? -31  DA  I "O3'" 1 
ATOM   6931  C  "C2'" . DA  I 5 42  ? -36.759 3.052   16.775 1.00 105.46 ? -31  DA  I "C2'" 1 
ATOM   6932  C  "C1'" . DA  I 5 42  ? -36.340 2.148   15.622 1.00 105.20 ? -31  DA  I "C1'" 1 
ATOM   6933  N  N9    . DA  I 5 42  ? -36.475 0.714   15.885 1.00 105.45 ? -31  DA  I N9    1 
ATOM   6934  C  C8    . DA  I 5 42  ? -36.181 0.045   17.042 1.00 105.54 ? -31  DA  I C8    1 
ATOM   6935  N  N7    . DA  I 5 42  ? -36.400 -1.249  16.984 1.00 105.77 ? -31  DA  I N7    1 
ATOM   6936  C  C5    . DA  I 5 42  ? -36.877 -1.449  15.699 1.00 105.66 ? -31  DA  I C5    1 
ATOM   6937  C  C6    . DA  I 5 42  ? -37.299 -2.604  15.001 1.00 105.71 ? -31  DA  I C6    1 
ATOM   6938  N  N6    . DA  I 5 42  ? -37.306 -3.831  15.529 1.00 105.68 ? -31  DA  I N6    1 
ATOM   6939  N  N1    . DA  I 5 42  ? -37.716 -2.459  13.725 1.00 105.85 ? -31  DA  I N1    1 
ATOM   6940  C  C2    . DA  I 5 42  ? -37.713 -1.230  13.187 1.00 105.97 ? -31  DA  I C2    1 
ATOM   6941  N  N3    . DA  I 5 42  ? -37.340 -0.074  13.741 1.00 105.73 ? -31  DA  I N3    1 
ATOM   6942  C  C4    . DA  I 5 42  ? -36.928 -0.249  15.009 1.00 105.55 ? -31  DA  I C4    1 
ATOM   6943  P  P     . DA  I 5 43  ? -38.068 6.079   16.233 1.00 108.90 ? -30  DA  I P     1 
ATOM   6944  O  OP1   . DA  I 5 43  ? -37.591 7.464   16.450 1.00 109.09 ? -30  DA  I OP1   1 
ATOM   6945  O  OP2   . DA  I 5 43  ? -38.716 5.329   17.340 1.00 108.78 ? -30  DA  I OP2   1 
ATOM   6946  O  "O5'" . DA  I 5 43  ? -39.076 6.088   14.988 1.00 109.09 ? -30  DA  I "O5'" 1 
ATOM   6947  C  "C5'" . DA  I 5 43  ? -39.033 5.054   14.004 1.00 109.37 ? -30  DA  I "C5'" 1 
ATOM   6948  C  "C4'" . DA  I 5 43  ? -40.389 4.397   13.797 1.00 109.83 ? -30  DA  I "C4'" 1 
ATOM   6949  O  "O4'" . DA  I 5 43  ? -40.246 2.970   14.012 1.00 110.01 ? -30  DA  I "O4'" 1 
ATOM   6950  C  "C3'" . DA  I 5 43  ? -41.530 4.842   14.710 1.00 110.10 ? -30  DA  I "C3'" 1 
ATOM   6951  O  "O3'" . DA  I 5 43  ? -42.721 4.888   13.931 1.00 110.42 ? -30  DA  I "O3'" 1 
ATOM   6952  C  "C2'" . DA  I 5 43  ? -41.581 3.738   15.766 1.00 110.15 ? -30  DA  I "C2'" 1 
ATOM   6953  C  "C1'" . DA  I 5 43  ? -41.246 2.525   14.905 1.00 110.45 ? -30  DA  I "C1'" 1 
ATOM   6954  N  N9    . DA  I 5 43  ? -40.742 1.354   15.631 1.00 111.25 ? -30  DA  I N9    1 
ATOM   6955  C  C8    . DA  I 5 43  ? -39.922 1.328   16.730 1.00 111.26 ? -30  DA  I C8    1 
ATOM   6956  N  N7    . DA  I 5 43  ? -39.639 0.118   17.157 1.00 111.35 ? -30  DA  I N7    1 
ATOM   6957  C  C5    . DA  I 5 43  ? -40.316 -0.713  16.277 1.00 111.51 ? -30  DA  I C5    1 
ATOM   6958  C  C6    . DA  I 5 43  ? -40.432 -2.120  16.179 1.00 111.68 ? -30  DA  I C6    1 
ATOM   6959  N  N6    . DA  I 5 43  ? -39.830 -2.965  17.022 1.00 111.71 ? -30  DA  I N6    1 
ATOM   6960  N  N1    . DA  I 5 43  ? -41.189 -2.632  15.180 1.00 111.70 ? -30  DA  I N1    1 
ATOM   6961  C  C2    . DA  I 5 43  ? -41.795 -1.788  14.330 1.00 111.66 ? -30  DA  I C2    1 
ATOM   6962  N  N3    . DA  I 5 43  ? -41.765 -0.452  14.324 1.00 111.66 ? -30  DA  I N3    1 
ATOM   6963  C  C4    . DA  I 5 43  ? -41.001 0.031   15.328 1.00 111.49 ? -30  DA  I C4    1 
ATOM   6964  P  P     . DC  I 5 44  ? -44.070 5.580   14.446 1.00 110.81 ? -29  DC  I P     1 
ATOM   6965  O  OP1   . DC  I 5 44  ? -44.331 6.734   13.561 1.00 111.05 ? -29  DC  I OP1   1 
ATOM   6966  O  OP2   . DC  I 5 44  ? -44.021 5.781   15.913 1.00 110.76 ? -29  DC  I OP2   1 
ATOM   6967  O  "O5'" . DC  I 5 44  ? -45.154 4.443   14.159 1.00 111.22 ? -29  DC  I "O5'" 1 
ATOM   6968  C  "C5'" . DC  I 5 44  ? -45.206 3.744   12.916 1.00 111.97 ? -29  DC  I "C5'" 1 
ATOM   6969  C  "C4'" . DC  I 5 44  ? -45.947 2.427   13.093 1.00 112.85 ? -29  DC  I "C4'" 1 
ATOM   6970  O  "O4'" . DC  I 5 44  ? -45.054 1.485   13.744 1.00 112.78 ? -29  DC  I "O4'" 1 
ATOM   6971  C  "C3'" . DC  I 5 44  ? -47.213 2.484   13.963 1.00 113.51 ? -29  DC  I "C3'" 1 
ATOM   6972  O  "O3'" . DC  I 5 44  ? -48.299 1.746   13.361 1.00 114.47 ? -29  DC  I "O3'" 1 
ATOM   6973  C  "C2'" . DC  I 5 44  ? -46.749 1.855   15.277 1.00 113.25 ? -29  DC  I "C2'" 1 
ATOM   6974  C  "C1'" . DC  I 5 44  ? -45.799 0.803   14.727 1.00 112.80 ? -29  DC  I "C1'" 1 
ATOM   6975  N  N1    . DC  I 5 44  ? -44.919 0.210   15.769 1.00 112.54 ? -29  DC  I N1    1 
ATOM   6976  C  C2    . DC  I 5 44  ? -44.825 -1.189  15.852 1.00 112.48 ? -29  DC  I C2    1 
ATOM   6977  O  O2    . DC  I 5 44  ? -45.459 -1.895  15.054 1.00 112.42 ? -29  DC  I O2    1 
ATOM   6978  N  N3    . DC  I 5 44  ? -44.031 -1.735  16.809 1.00 112.37 ? -29  DC  I N3    1 
ATOM   6979  C  C4    . DC  I 5 44  ? -43.364 -0.944  17.655 1.00 112.46 ? -29  DC  I C4    1 
ATOM   6980  N  N4    . DC  I 5 44  ? -42.597 -1.538  18.574 1.00 112.69 ? -29  DC  I N4    1 
ATOM   6981  C  C5    . DC  I 5 44  ? -43.450 0.483   17.593 1.00 112.47 ? -29  DC  I C5    1 
ATOM   6982  C  C6    . DC  I 5 44  ? -44.233 1.013   16.644 1.00 112.44 ? -29  DC  I C6    1 
ATOM   6983  P  P     . DT  I 5 45  ? -49.580 1.220   14.182 1.00 115.43 ? -28  DT  I P     1 
ATOM   6984  O  OP1   . DT  I 5 45  ? -50.745 1.304   13.267 1.00 115.31 ? -28  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I 5 45  ? -49.656 1.890   15.507 1.00 115.28 ? -28  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I 5 45  ? -49.193 -0.321  14.426 1.00 115.04 ? -28  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I 5 45  ? -50.001 -1.393  13.901 1.00 114.76 ? -28  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I 5 45  ? -50.262 -2.437  14.986 1.00 114.36 ? -28  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I 5 45  ? -49.081 -2.599  15.831 1.00 114.42 ? -28  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I 5 45  ? -51.414 -2.126  15.940 1.00 113.91 ? -28  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I 5 45  ? -52.046 -3.337  16.276 1.00 113.50 ? -28  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I 5 45  ? -50.707 -1.565  17.167 1.00 114.02 ? -28  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I 5 45  ? -49.501 -2.512  17.191 1.00 113.98 ? -28  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I 5 45  ? -48.357 -2.101  18.078 1.00 113.59 ? -28  DT  I N1    1 
ATOM   6995  C  C2    . DT  I 5 45  ? -47.557 -3.087  18.631 1.00 113.10 ? -28  DT  I C2    1 
ATOM   6996  O  O2    . DT  I 5 45  ? -47.717 -4.282  18.440 1.00 112.77 ? -28  DT  I O2    1 
ATOM   6997  N  N3    . DT  I 5 45  ? -46.544 -2.614  19.428 1.00 112.98 ? -28  DT  I N3    1 
ATOM   6998  C  C4    . DT  I 5 45  ? -46.248 -1.293  19.726 1.00 113.27 ? -28  DT  I C4    1 
ATOM   6999  O  O4    . DT  I 5 45  ? -45.309 -0.986  20.456 1.00 113.10 ? -28  DT  I O4    1 
ATOM   7000  C  C5    . DT  I 5 45  ? -47.124 -0.312  19.118 1.00 113.50 ? -28  DT  I C5    1 
ATOM   7001  C  C7    . DT  I 5 45  ? -46.917 1.159   19.358 1.00 113.56 ? -28  DT  I C7    1 
ATOM   7002  C  C6    . DT  I 5 45  ? -48.120 -0.759  18.336 1.00 113.49 ? -28  DT  I C6    1 
ATOM   7003  P  P     . DG  I 5 46  ? -53.478 -3.694  15.679 1.00 113.21 ? -27  DG  I P     1 
ATOM   7004  O  OP1   . DG  I 5 46  ? -53.512 -3.229  14.272 1.00 113.17 ? -27  DG  I OP1   1 
ATOM   7005  O  OP2   . DG  I 5 46  ? -54.488 -3.221  16.656 1.00 112.88 ? -27  DG  I OP2   1 
ATOM   7006  O  "O5'" . DG  I 5 46  ? -53.492 -5.297  15.684 1.00 112.19 ? -27  DG  I "O5'" 1 
ATOM   7007  C  "C5'" . DG  I 5 46  ? -52.294 -6.079  15.574 1.00 110.48 ? -27  DG  I "C5'" 1 
ATOM   7008  C  "C4'" . DG  I 5 46  ? -52.186 -7.132  16.678 1.00 109.33 ? -27  DG  I "C4'" 1 
ATOM   7009  O  "O4'" . DG  I 5 46  ? -51.233 -6.695  17.682 1.00 109.02 ? -27  DG  I "O4'" 1 
ATOM   7010  C  "C3'" . DG  I 5 46  ? -53.452 -7.481  17.465 1.00 108.69 ? -27  DG  I "C3'" 1 
ATOM   7011  O  "O3'" . DG  I 5 46  ? -53.408 -8.858  17.836 1.00 107.75 ? -27  DG  I "O3'" 1 
ATOM   7012  C  "C2'" . DG  I 5 46  ? -53.359 -6.576  18.695 1.00 108.48 ? -27  DG  I "C2'" 1 
ATOM   7013  C  "C1'" . DG  I 5 46  ? -51.857 -6.629  18.953 1.00 108.60 ? -27  DG  I "C1'" 1 
ATOM   7014  N  N9    . DG  I 5 46  ? -51.286 -5.487  19.664 1.00 108.19 ? -27  DG  I N9    1 
ATOM   7015  C  C8    . DG  I 5 46  ? -51.638 -4.160  19.566 1.00 108.07 ? -27  DG  I C8    1 
ATOM   7016  N  N7    . DG  I 5 46  ? -50.929 -3.372  20.327 1.00 107.75 ? -27  DG  I N7    1 
ATOM   7017  C  C5    . DG  I 5 46  ? -50.046 -4.229  20.965 1.00 107.56 ? -27  DG  I C5    1 
ATOM   7018  C  C6    . DG  I 5 46  ? -49.032 -3.950  21.909 1.00 107.24 ? -27  DG  I C6    1 
ATOM   7019  O  O6    . DG  I 5 46  ? -48.712 -2.848  22.375 1.00 106.83 ? -27  DG  I O6    1 
ATOM   7020  N  N1    . DG  I 5 46  ? -48.368 -5.113  22.308 1.00 107.51 ? -27  DG  I N1    1 
ATOM   7021  C  C2    . DG  I 5 46  ? -48.647 -6.384  21.849 1.00 107.66 ? -27  DG  I C2    1 
ATOM   7022  N  N2    . DG  I 5 46  ? -47.908 -7.387  22.341 1.00 108.00 ? -27  DG  I N2    1 
ATOM   7023  N  N3    . DG  I 5 46  ? -49.594 -6.656  20.965 1.00 107.70 ? -27  DG  I N3    1 
ATOM   7024  C  C4    . DG  I 5 46  ? -50.251 -5.535  20.568 1.00 107.90 ? -27  DG  I C4    1 
ATOM   7025  P  P     . DC  I 5 47  ? -54.729 -9.688  18.206 1.00 107.34 ? -26  DC  I P     1 
ATOM   7026  O  OP1   . DC  I 5 47  ? -54.909 -10.665 17.109 1.00 107.21 ? -26  DC  I OP1   1 
ATOM   7027  O  OP2   . DC  I 5 47  ? -55.828 -8.756  18.576 1.00 107.22 ? -26  DC  I OP2   1 
ATOM   7028  O  "O5'" . DC  I 5 47  ? -54.329 -10.503 19.533 1.00 106.53 ? -26  DC  I "O5'" 1 
ATOM   7029  C  "C5'" . DC  I 5 47  ? -52.969 -10.822 19.866 1.00 104.67 ? -26  DC  I "C5'" 1 
ATOM   7030  C  "C4'" . DC  I 5 47  ? -52.743 -10.724 21.366 1.00 103.15 ? -26  DC  I "C4'" 1 
ATOM   7031  O  "O4'" . DC  I 5 47  ? -52.447 -9.350  21.717 1.00 102.98 ? -26  DC  I "O4'" 1 
ATOM   7032  C  "C3'" . DC  I 5 47  ? -53.936 -11.142 22.227 1.00 102.32 ? -26  DC  I "C3'" 1 
ATOM   7033  O  "O3'" . DC  I 5 47  ? -53.529 -12.064 23.221 1.00 100.55 ? -26  DC  I "O3'" 1 
ATOM   7034  C  "C2'" . DC  I 5 47  ? -54.431 -9.844  22.858 1.00 102.86 ? -26  DC  I "C2'" 1 
ATOM   7035  C  "C1'" . DC  I 5 47  ? -53.161 -9.000  22.884 1.00 103.15 ? -26  DC  I "C1'" 1 
ATOM   7036  N  N1    . DC  I 5 47  ? -53.384 -7.513  22.893 1.00 103.46 ? -26  DC  I N1    1 
ATOM   7037  C  C2    . DC  I 5 47  ? -52.328 -6.649  23.235 1.00 103.57 ? -26  DC  I C2    1 
ATOM   7038  O  O2    . DC  I 5 47  ? -51.218 -7.118  23.527 1.00 103.28 ? -26  DC  I O2    1 
ATOM   7039  N  N3    . DC  I 5 47  ? -52.555 -5.306  23.236 1.00 103.77 ? -26  DC  I N3    1 
ATOM   7040  C  C4    . DC  I 5 47  ? -53.763 -4.822  22.919 1.00 104.00 ? -26  DC  I C4    1 
ATOM   7041  N  N4    . DC  I 5 47  ? -53.939 -3.496  22.938 1.00 104.08 ? -26  DC  I N4    1 
ATOM   7042  C  C5    . DC  I 5 47  ? -54.849 -5.683  22.571 1.00 104.23 ? -26  DC  I C5    1 
ATOM   7043  C  C6    . DC  I 5 47  ? -54.615 -7.003  22.571 1.00 103.83 ? -26  DC  I C6    1 
ATOM   7044  P  P     . DT  I 5 48  ? -53.724 -13.634 22.980 1.00 99.16  ? -25  DT  I P     1 
ATOM   7045  O  OP1   . DT  I 5 48  ? -52.830 -14.054 21.872 1.00 98.82  ? -25  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I 5 48  ? -55.181 -13.904 22.915 1.00 99.68  ? -25  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I 5 48  ? -53.179 -14.289 24.334 1.00 97.16  ? -25  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I 5 48  ? -53.098 -13.519 25.519 1.00 93.45  ? -25  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I 5 48  ? -51.654 -13.148 25.831 1.00 90.36  ? -25  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I 5 48  ? -51.444 -11.745 25.523 1.00 90.17  ? -25  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I 5 48  ? -51.298 -13.298 27.308 1.00 88.35  ? -25  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I 5 48  ? -49.930 -13.667 27.511 1.00 84.29  ? -25  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I 5 48  ? -51.599 -11.923 27.894 1.00 88.73  ? -25  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I 5 48  ? -51.381 -10.979 26.716 1.00 89.90  ? -25  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I 5 48  ? -52.399 -9.878  26.705 1.00 90.79  ? -25  DT  I N1    1 
ATOM   7056  C  C2    . DT  I 5 48  ? -51.990 -8.591  26.985 1.00 91.16  ? -25  DT  I C2    1 
ATOM   7057  O  O2    . DT  I 5 48  ? -50.839 -8.287  27.229 1.00 91.36  ? -25  DT  I O2    1 
ATOM   7058  N  N3    . DT  I 5 48  ? -52.988 -7.651  26.964 1.00 91.65  ? -25  DT  I N3    1 
ATOM   7059  C  C4    . DT  I 5 48  ? -54.330 -7.859  26.706 1.00 92.29  ? -25  DT  I C4    1 
ATOM   7060  O  O4    . DT  I 5 48  ? -55.125 -6.922  26.722 1.00 92.92  ? -25  DT  I O4    1 
ATOM   7061  C  C5    . DT  I 5 48  ? -54.706 -9.234  26.424 1.00 92.46  ? -25  DT  I C5    1 
ATOM   7062  C  C7    . DT  I 5 48  ? -56.131 -9.622  26.122 1.00 92.58  ? -25  DT  I C7    1 
ATOM   7063  C  C6    . DT  I 5 48  ? -53.732 -10.159 26.442 1.00 91.80  ? -25  DT  I C6    1 
ATOM   7064  P  P     . DC  I 5 49  ? -49.525 -14.568 28.776 1.00 80.80  ? -24  DC  I P     1 
ATOM   7065  O  OP1   . DC  I 5 49  ? -48.169 -15.091 28.523 1.00 79.64  ? -24  DC  I OP1   1 
ATOM   7066  O  OP2   . DC  I 5 49  ? -50.650 -15.490 29.054 1.00 80.28  ? -24  DC  I OP2   1 
ATOM   7067  O  "O5'" . DC  I 5 49  ? -49.447 -13.541 29.996 1.00 79.66  ? -24  DC  I "O5'" 1 
ATOM   7068  C  "C5'" . DC  I 5 49  ? -48.644 -12.366 29.945 1.00 78.26  ? -24  DC  I "C5'" 1 
ATOM   7069  C  "C4'" . DC  I 5 49  ? -49.127 -11.382 30.996 1.00 77.62  ? -24  DC  I "C4'" 1 
ATOM   7070  O  "O4'" . DC  I 5 49  ? -50.280 -10.635 30.513 1.00 78.73  ? -24  DC  I "O4'" 1 
ATOM   7071  C  "C3'" . DC  I 5 49  ? -49.577 -12.017 32.311 1.00 76.35  ? -24  DC  I "C3'" 1 
ATOM   7072  O  "O3'" . DC  I 5 49  ? -49.278 -11.145 33.379 1.00 73.43  ? -24  DC  I "O3'" 1 
ATOM   7073  C  "C2'" . DC  I 5 49  ? -51.085 -12.088 32.134 1.00 78.20  ? -24  DC  I "C2'" 1 
ATOM   7074  C  "C1'" . DC  I 5 49  ? -51.268 -10.700 31.522 1.00 79.83  ? -24  DC  I "C1'" 1 
ATOM   7075  N  N1    . DC  I 5 49  ? -52.651 -10.373 31.022 1.00 81.79  ? -24  DC  I N1    1 
ATOM   7076  C  C2    . DC  I 5 49  ? -53.071 -9.031  30.969 1.00 82.82  ? -24  DC  I C2    1 
ATOM   7077  O  O2    . DC  I 5 49  ? -52.303 -8.127  31.322 1.00 82.99  ? -24  DC  I O2    1 
ATOM   7078  N  N3    . DC  I 5 49  ? -54.331 -8.760  30.533 1.00 83.85  ? -24  DC  I N3    1 
ATOM   7079  C  C4    . DC  I 5 49  ? -55.151 -9.752  30.161 1.00 84.14  ? -24  DC  I C4    1 
ATOM   7080  N  N4    . DC  I 5 49  ? -56.378 -9.431  29.740 1.00 84.89  ? -24  DC  I N4    1 
ATOM   7081  C  C5    . DC  I 5 49  ? -54.747 -11.122 30.211 1.00 83.71  ? -24  DC  I C5    1 
ATOM   7082  C  C6    . DC  I 5 49  ? -53.507 -11.380 30.647 1.00 82.82  ? -24  DC  I C6    1 
ATOM   7083  P  P     . DC  I 5 50  ? -47.955 -11.325 34.242 1.00 70.86  ? -23  DC  I P     1 
ATOM   7084  O  OP1   . DC  I 5 50  ? -46.813 -11.292 33.308 1.00 71.01  ? -23  DC  I OP1   1 
ATOM   7085  O  OP2   . DC  I 5 50  ? -48.150 -12.471 35.155 1.00 71.69  ? -23  DC  I OP2   1 
ATOM   7086  O  "O5'" . DC  I 5 50  ? -47.934 -9.994  35.119 1.00 70.88  ? -23  DC  I "O5'" 1 
ATOM   7087  C  "C5'" . DC  I 5 50  ? -47.438 -8.784  34.546 1.00 70.34  ? -23  DC  I "C5'" 1 
ATOM   7088  C  "C4'" . DC  I 5 50  ? -48.309 -7.617  34.948 1.00 70.46  ? -23  DC  I "C4'" 1 
ATOM   7089  O  "O4'" . DC  I 5 50  ? -49.592 -7.772  34.309 1.00 71.43  ? -23  DC  I "O4'" 1 
ATOM   7090  C  "C3'" . DC  I 5 50  ? -48.581 -7.533  36.442 1.00 70.77  ? -23  DC  I "C3'" 1 
ATOM   7091  O  "O3'" . DC  I 5 50  ? -48.058 -6.305  36.904 1.00 70.88  ? -23  DC  I "O3'" 1 
ATOM   7092  C  "C2'" . DC  I 5 50  ? -50.103 -7.654  36.588 1.00 71.40  ? -23  DC  I "C2'" 1 
ATOM   7093  C  "C1'" . DC  I 5 50  ? -50.605 -7.341  35.184 1.00 72.23  ? -23  DC  I "C1'" 1 
ATOM   7094  N  N1    . DC  I 5 50  ? -51.844 -8.041  34.737 1.00 73.17  ? -23  DC  I N1    1 
ATOM   7095  C  C2    . DC  I 5 50  ? -52.937 -7.297  34.249 1.00 73.33  ? -23  DC  I C2    1 
ATOM   7096  O  O2    . DC  I 5 50  ? -52.871 -6.062  34.214 1.00 73.48  ? -23  DC  I O2    1 
ATOM   7097  N  N3    . DC  I 5 50  ? -54.050 -7.958  33.834 1.00 73.42  ? -23  DC  I N3    1 
ATOM   7098  C  C4    . DC  I 5 50  ? -54.095 -9.296  33.884 1.00 74.32  ? -23  DC  I C4    1 
ATOM   7099  N  N4    . DC  I 5 50  ? -55.209 -9.912  33.461 1.00 74.69  ? -23  DC  I N4    1 
ATOM   7100  C  C5    . DC  I 5 50  ? -52.991 -10.069 34.371 1.00 74.59  ? -23  DC  I C5    1 
ATOM   7101  C  C6    . DC  I 5 50  ? -51.895 -9.408  34.775 1.00 73.95  ? -23  DC  I C6    1 
ATOM   7102  P  P     . DA  I 5 51  ? -47.887 -6.018  38.461 1.00 71.65  ? -22  DA  I P     1 
ATOM   7103  O  OP1   . DA  I 5 51  ? -46.624 -5.292  38.658 1.00 70.88  ? -22  DA  I OP1   1 
ATOM   7104  O  OP2   . DA  I 5 51  ? -48.134 -7.283  39.185 1.00 73.40  ? -22  DA  I OP2   1 
ATOM   7105  O  "O5'" . DA  I 5 51  ? -49.103 -5.024  38.778 1.00 75.58  ? -22  DA  I "O5'" 1 
ATOM   7106  C  "C5'" . DA  I 5 51  ? -49.285 -3.827  37.989 1.00 78.78  ? -22  DA  I "C5'" 1 
ATOM   7107  C  "C4'" . DA  I 5 51  ? -50.398 -2.916  38.498 1.00 80.90  ? -22  DA  I "C4'" 1 
ATOM   7108  O  "O4'" . DA  I 5 51  ? -51.678 -3.366  37.991 1.00 81.48  ? -22  DA  I "O4'" 1 
ATOM   7109  C  "C3'" . DA  I 5 51  ? -50.568 -2.773  40.005 1.00 82.34  ? -22  DA  I "C3'" 1 
ATOM   7110  O  "O3'" . DA  I 5 51  ? -50.912 -1.407  40.267 1.00 85.08  ? -22  DA  I "O3'" 1 
ATOM   7111  C  "C2'" . DA  I 5 51  ? -51.682 -3.775  40.318 1.00 82.66  ? -22  DA  I "C2'" 1 
ATOM   7112  C  "C1'" . DA  I 5 51  ? -52.526 -3.762  39.045 1.00 83.06  ? -22  DA  I "C1'" 1 
ATOM   7113  N  N9    . DA  I 5 51  ? -53.061 -5.059  38.640 1.00 84.66  ? -22  DA  I N9    1 
ATOM   7114  C  C8    . DA  I 5 51  ? -52.442 -6.272  38.763 1.00 85.40  ? -22  DA  I C8    1 
ATOM   7115  N  N7    . DA  I 5 51  ? -53.143 -7.277  38.300 1.00 85.98  ? -22  DA  I N7    1 
ATOM   7116  C  C5    . DA  I 5 51  ? -54.301 -6.688  37.829 1.00 85.95  ? -22  DA  I C5    1 
ATOM   7117  C  C6    . DA  I 5 51  ? -55.457 -7.223  37.216 1.00 86.57  ? -22  DA  I C6    1 
ATOM   7118  N  N6    . DA  I 5 51  ? -55.618 -8.530  36.970 1.00 86.53  ? -22  DA  I N6    1 
ATOM   7119  N  N1    . DA  I 5 51  ? -56.443 -6.362  36.865 1.00 86.79  ? -22  DA  I N1    1 
ATOM   7120  C  C2    . DA  I 5 51  ? -56.277 -5.051  37.111 1.00 86.73  ? -22  DA  I C2    1 
ATOM   7121  N  N3    . DA  I 5 51  ? -55.238 -4.433  37.687 1.00 86.42  ? -22  DA  I N3    1 
ATOM   7122  C  C4    . DA  I 5 51  ? -54.271 -5.315  38.026 1.00 85.85  ? -22  DA  I C4    1 
ATOM   7123  P  P     . DT  I 5 52  ? -51.485 -0.870  41.668 1.00 87.63  ? -21  DT  I P     1 
ATOM   7124  O  OP1   . DT  I 5 52  ? -51.133 0.560   41.775 1.00 87.35  ? -21  DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I 5 52  ? -51.085 -1.796  42.753 1.00 87.00  ? -21  DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I 5 52  ? -53.070 -1.012  41.479 1.00 90.28  ? -21  DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I 5 52  ? -53.790 -0.348  40.445 1.00 93.47  ? -21  DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I 5 52  ? -55.242 -0.779  40.527 1.00 96.22  ? -21  DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I 5 52  ? -55.341 -2.158  40.098 1.00 96.34  ? -21  DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I 5 52  ? -55.849 -0.728  41.931 1.00 98.00  ? -21  DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I 5 52  ? -56.850 0.302   42.024 1.00 100.90 ? -21  DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I 5 52  ? -56.435 -2.124  42.164 1.00 97.41  ? -21  DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I 5 52  ? -56.433 -2.740  40.770 1.00 96.64  ? -21  DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I 5 52  ? -56.274 -4.224  40.770 1.00 96.64  ? -21  DT  I N1    1 
ATOM   7135  C  C2    . DT  I 5 52  ? -57.233 -5.010  40.154 1.00 96.64  ? -21  DT  I C2    1 
ATOM   7136  O  O2    . DT  I 5 52  ? -58.219 -4.570  39.586 1.00 96.69  ? -21  DT  I O2    1 
ATOM   7137  N  N3    . DT  I 5 52  ? -56.987 -6.361  40.216 1.00 96.72  ? -21  DT  I N3    1 
ATOM   7138  C  C4    . DT  I 5 52  ? -55.911 -6.994  40.822 1.00 96.54  ? -21  DT  I C4    1 
ATOM   7139  O  O4    . DT  I 5 52  ? -55.800 -8.218  40.813 1.00 96.43  ? -21  DT  I O4    1 
ATOM   7140  C  C5    . DT  I 5 52  ? -54.948 -6.113  41.454 1.00 96.49  ? -21  DT  I C5    1 
ATOM   7141  C  C7    . DT  I 5 52  ? -53.733 -6.661  42.150 1.00 96.49  ? -21  DT  I C7    1 
ATOM   7142  C  C6    . DT  I 5 52  ? -55.175 -4.791  41.398 1.00 96.55  ? -21  DT  I C6    1 
ATOM   7143  P  P     . DC  I 5 53  ? -57.476 0.775   43.432 1.00 102.82 ? -20  DC  I P     1 
ATOM   7144  O  OP1   . DC  I 5 53  ? -57.752 2.223   43.300 1.00 103.15 ? -20  DC  I OP1   1 
ATOM   7145  O  OP2   . DC  I 5 53  ? -56.628 0.308   44.556 1.00 102.78 ? -20  DC  I OP2   1 
ATOM   7146  O  "O5'" . DC  I 5 53  ? -58.850 -0.046  43.506 1.00 104.36 ? -20  DC  I "O5'" 1 
ATOM   7147  C  "C5'" . DC  I 5 53  ? -59.730 -0.192  42.386 1.00 106.65 ? -20  DC  I "C5'" 1 
ATOM   7148  C  "C4'" . DC  I 5 53  ? -60.747 -1.290  42.660 1.00 108.49 ? -20  DC  I "C4'" 1 
ATOM   7149  O  "O4'" . DC  I 5 53  ? -60.119 -2.585  42.467 1.00 108.56 ? -20  DC  I "O4'" 1 
ATOM   7150  C  "C3'" . DC  I 5 53  ? -61.314 -1.310  44.083 1.00 110.06 ? -20  DC  I "C3'" 1 
ATOM   7151  O  "O3'" . DC  I 5 53  ? -62.703 -1.612  44.068 1.00 112.61 ? -20  DC  I "O3'" 1 
ATOM   7152  C  "C2'" . DC  I 5 53  ? -60.525 -2.426  44.762 1.00 109.52 ? -20  DC  I "C2'" 1 
ATOM   7153  C  "C1'" . DC  I 5 53  ? -60.430 -3.391  43.588 1.00 109.03 ? -20  DC  I "C1'" 1 
ATOM   7154  N  N1    . DC  I 5 53  ? -59.435 -4.498  43.744 1.00 108.63 ? -20  DC  I N1    1 
ATOM   7155  C  C2    . DC  I 5 53  ? -59.706 -5.725  43.123 1.00 108.29 ? -20  DC  I C2    1 
ATOM   7156  O  O2    . DC  I 5 53  ? -60.745 -5.855  42.462 1.00 107.88 ? -20  DC  I O2    1 
ATOM   7157  N  N3    . DC  I 5 53  ? -58.815 -6.739  43.264 1.00 108.35 ? -20  DC  I N3    1 
ATOM   7158  C  C4    . DC  I 5 53  ? -57.703 -6.557  43.988 1.00 108.35 ? -20  DC  I C4    1 
ATOM   7159  N  N4    . DC  I 5 53  ? -56.861 -7.587  44.095 1.00 108.19 ? -20  DC  I N4    1 
ATOM   7160  C  C5    . DC  I 5 53  ? -57.404 -5.315  44.633 1.00 108.29 ? -20  DC  I C5    1 
ATOM   7161  C  C6    . DC  I 5 53  ? -58.292 -4.322  44.485 1.00 108.52 ? -20  DC  I C6    1 
ATOM   7162  P  P     . DA  I 5 54  ? -63.598 -1.301  45.358 1.00 114.69 ? -19  DA  I P     1 
ATOM   7163  O  OP1   . DA  I 5 54  ? -63.572 0.174   45.515 1.00 114.49 ? -19  DA  I OP1   1 
ATOM   7164  O  OP2   . DA  I 5 54  ? -63.156 -2.157  46.485 1.00 114.73 ? -19  DA  I OP2   1 
ATOM   7165  O  "O5'" . DA  I 5 54  ? -65.062 -1.801  44.923 1.00 115.82 ? -19  DA  I "O5'" 1 
ATOM   7166  C  "C5'" . DA  I 5 54  ? -65.245 -2.776  43.887 1.00 117.97 ? -19  DA  I "C5'" 1 
ATOM   7167  C  "C4'" . DA  I 5 54  ? -66.168 -3.923  44.289 1.00 119.61 ? -19  DA  I "C4'" 1 
ATOM   7168  O  "O4'" . DA  I 5 54  ? -65.402 -5.160  44.312 1.00 120.28 ? -19  DA  I "O4'" 1 
ATOM   7169  C  "C3'" . DA  I 5 54  ? -66.857 -3.855  45.653 1.00 120.27 ? -19  DA  I "C3'" 1 
ATOM   7170  O  "O3'" . DA  I 5 54  ? -68.118 -4.539  45.572 1.00 120.99 ? -19  DA  I "O3'" 1 
ATOM   7171  C  "C2'" . DA  I 5 54  ? -65.850 -4.560  46.562 1.00 120.71 ? -19  DA  I "C2'" 1 
ATOM   7172  C  "C1'" . DA  I 5 54  ? -65.283 -5.640  45.640 1.00 121.01 ? -19  DA  I "C1'" 1 
ATOM   7173  N  N9    . DA  I 5 54  ? -63.879 -5.965  45.909 1.00 121.72 ? -19  DA  I N9    1 
ATOM   7174  C  C8    . DA  I 5 54  ? -62.944 -5.171  46.525 1.00 121.60 ? -19  DA  I C8    1 
ATOM   7175  N  N7    . DA  I 5 54  ? -61.760 -5.719  46.638 1.00 121.54 ? -19  DA  I N7    1 
ATOM   7176  C  C5    . DA  I 5 54  ? -61.927 -6.965  46.056 1.00 121.82 ? -19  DA  I C5    1 
ATOM   7177  C  C6    . DA  I 5 54  ? -61.038 -8.041  45.857 1.00 121.88 ? -19  DA  I C6    1 
ATOM   7178  N  N6    . DA  I 5 54  ? -59.761 -7.997  46.250 1.00 121.78 ? -19  DA  I N6    1 
ATOM   7179  N  N1    . DA  I 5 54  ? -61.513 -9.153  45.241 1.00 122.00 ? -19  DA  I N1    1 
ATOM   7180  C  C2    . DA  I 5 54  ? -62.799 -9.188  44.850 1.00 121.97 ? -19  DA  I C2    1 
ATOM   7181  N  N3    . DA  I 5 54  ? -63.730 -8.239  44.984 1.00 122.00 ? -19  DA  I N3    1 
ATOM   7182  C  C4    . DA  I 5 54  ? -63.226 -7.142  45.599 1.00 121.99 ? -19  DA  I C4    1 
ATOM   7183  P  P     . DA  I 5 55  ? -68.958 -5.065  46.841 1.00 121.60 ? -18  DA  I P     1 
ATOM   7184  O  OP1   . DA  I 5 55  ? -70.394 -5.051  46.458 1.00 121.72 ? -18  DA  I OP1   1 
ATOM   7185  O  OP2   . DA  I 5 55  ? -68.522 -4.335  48.056 1.00 121.23 ? -18  DA  I OP2   1 
ATOM   7186  O  "O5'" . DA  I 5 55  ? -68.476 -6.589  46.984 1.00 121.82 ? -18  DA  I "O5'" 1 
ATOM   7187  C  "C5'" . DA  I 5 55  ? -68.743 -7.561  45.947 1.00 122.11 ? -18  DA  I "C5'" 1 
ATOM   7188  C  "C4'" . DA  I 5 55  ? -68.377 -8.966  46.414 1.00 122.33 ? -18  DA  I "C4'" 1 
ATOM   7189  O  "O4'" . DA  I 5 55  ? -66.951 -9.055  46.680 1.00 122.43 ? -18  DA  I "O4'" 1 
ATOM   7190  C  "C3'" . DA  I 5 55  ? -69.071 -9.453  47.686 1.00 122.54 ? -18  DA  I "C3'" 1 
ATOM   7191  O  "O3'" . DA  I 5 55  ? -69.402 -10.838 47.551 1.00 122.85 ? -18  DA  I "O3'" 1 
ATOM   7192  C  "C2'" . DA  I 5 55  ? -68.029 -9.215  48.779 1.00 122.34 ? -18  DA  I "C2'" 1 
ATOM   7193  C  "C1'" . DA  I 5 55  ? -66.723 -9.447  48.024 1.00 122.23 ? -18  DA  I "C1'" 1 
ATOM   7194  N  N9    . DA  I 5 55  ? -65.578 -8.702  48.559 1.00 121.88 ? -18  DA  I N9    1 
ATOM   7195  C  C8    . DA  I 5 55  ? -65.581 -7.463  49.146 1.00 121.62 ? -18  DA  I C8    1 
ATOM   7196  N  N7    . DA  I 5 55  ? -64.395 -7.049  49.531 1.00 121.25 ? -18  DA  I N7    1 
ATOM   7197  C  C5    . DA  I 5 55  ? -63.550 -8.087  49.174 1.00 120.99 ? -18  DA  I C5    1 
ATOM   7198  C  C6    . DA  I 5 55  ? -62.154 -8.275  49.304 1.00 120.46 ? -18  DA  I C6    1 
ATOM   7199  N  N6    . DA  I 5 55  ? -61.333 -7.381  49.858 1.00 119.99 ? -18  DA  I N6    1 
ATOM   7200  N  N1    . DA  I 5 55  ? -61.627 -9.429  48.845 1.00 120.26 ? -18  DA  I N1    1 
ATOM   7201  C  C2    . DA  I 5 55  ? -62.442 -10.336 48.287 1.00 120.69 ? -18  DA  I C2    1 
ATOM   7202  N  N3    . DA  I 5 55  ? -63.763 -10.274 48.105 1.00 121.08 ? -18  DA  I N3    1 
ATOM   7203  C  C4    . DA  I 5 55  ? -64.263 -9.114  48.574 1.00 121.35 ? -18  DA  I C4    1 
ATOM   7204  P  P     . DA  I 5 56  ? -70.321 -11.618 48.619 1.00 123.27 ? -17  DA  I P     1 
ATOM   7205  O  OP1   . DA  I 5 56  ? -71.451 -12.218 47.871 1.00 123.38 ? -17  DA  I OP1   1 
ATOM   7206  O  OP2   . DA  I 5 56  ? -70.599 -10.732 49.779 1.00 123.09 ? -17  DA  I OP2   1 
ATOM   7207  O  "O5'" . DA  I 5 56  ? -69.355 -12.800 49.116 1.00 122.56 ? -17  DA  I "O5'" 1 
ATOM   7208  C  "C5'" . DA  I 5 56  ? -68.642 -13.615 48.176 1.00 121.58 ? -17  DA  I "C5'" 1 
ATOM   7209  C  "C4'" . DA  I 5 56  ? -67.349 -14.157 48.773 1.00 120.83 ? -17  DA  I "C4'" 1 
ATOM   7210  O  "O4'" . DA  I 5 56  ? -66.417 -13.068 49.018 1.00 120.91 ? -17  DA  I "O4'" 1 
ATOM   7211  C  "C3'" . DA  I 5 56  ? -67.508 -14.901 50.103 1.00 120.11 ? -17  DA  I "C3'" 1 
ATOM   7212  O  "O3'" . DA  I 5 56  ? -67.171 -16.286 49.931 1.00 118.43 ? -17  DA  I "O3'" 1 
ATOM   7213  C  "C2'" . DA  I 5 56  ? -66.585 -14.170 51.083 1.00 120.43 ? -17  DA  I "C2'" 1 
ATOM   7214  C  "C1'" . DA  I 5 56  ? -65.656 -13.374 50.171 1.00 120.85 ? -17  DA  I "C1'" 1 
ATOM   7215  N  N9    . DA  I 5 56  ? -65.178 -12.137 50.792 1.00 121.08 ? -17  DA  I N9    1 
ATOM   7216  C  C8    . DA  I 5 56  ? -65.936 -11.058 51.157 1.00 121.34 ? -17  DA  I C8    1 
ATOM   7217  N  N7    . DA  I 5 56  ? -65.252 -10.078 51.697 1.00 121.30 ? -17  DA  I N7    1 
ATOM   7218  C  C5    . DA  I 5 56  ? -63.951 -10.543 51.691 1.00 121.22 ? -17  DA  I C5    1 
ATOM   7219  C  C6    . DA  I 5 56  ? -62.737 -9.971  52.134 1.00 121.28 ? -17  DA  I C6    1 
ATOM   7220  N  N6    . DA  I 5 56  ? -62.660 -8.756  52.685 1.00 121.32 ? -17  DA  I N6    1 
ATOM   7221  N  N1    . DA  I 5 56  ? -61.605 -10.696 51.985 1.00 121.21 ? -17  DA  I N1    1 
ATOM   7222  C  C2    . DA  I 5 56  ? -61.689 -11.913 51.429 1.00 121.16 ? -17  DA  I C2    1 
ATOM   7223  N  N3    . DA  I 5 56  ? -62.771 -12.556 50.980 1.00 121.18 ? -17  DA  I N3    1 
ATOM   7224  C  C4    . DA  I 5 56  ? -63.883 -11.812 51.139 1.00 121.16 ? -17  DA  I C4    1 
ATOM   7225  P  P     . DA  I 5 57  ? -67.162 -17.353 51.136 1.00 117.12 ? -16  DA  I P     1 
ATOM   7226  O  OP1   . DA  I 5 57  ? -67.377 -18.696 50.546 1.00 117.22 ? -16  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I 5 57  ? -68.043 -16.887 52.234 1.00 117.18 ? -16  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I 5 57  ? -65.647 -17.257 51.648 1.00 115.76 ? -16  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I 5 57  ? -64.574 -17.624 50.762 1.00 113.08 ? -16  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I 5 57  ? -63.220 -17.512 51.442 1.00 110.77 ? -16  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I 5 57  ? -62.972 -16.121 51.777 1.00 110.45 ? -16  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I 5 57  ? -63.069 -18.317 52.732 1.00 109.24 ? -16  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I 5 57  ? -61.888 -19.111 52.651 1.00 107.04 ? -16  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I 5 57  ? -62.990 -17.255 53.831 1.00 109.56 ? -16  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I 5 57  ? -62.453 -16.033 53.089 1.00 110.15 ? -16  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I 5 57  ? -62.834 -14.729 53.642 1.00 110.26 ? -16  DA  I N9    1 
ATOM   7237  C  C8    . DA  I 5 57  ? -64.094 -14.201 53.736 1.00 110.34 ? -16  DA  I C8    1 
ATOM   7238  N  N7    . DA  I 5 57  ? -64.131 -13.002 54.272 1.00 110.60 ? -16  DA  I N7    1 
ATOM   7239  C  C5    . DA  I 5 57  ? -62.803 -12.715 54.547 1.00 110.37 ? -16  DA  I C5    1 
ATOM   7240  C  C6    . DA  I 5 57  ? -62.158 -11.591 55.118 1.00 110.24 ? -16  DA  I C6    1 
ATOM   7241  N  N6    . DA  I 5 57  ? -62.806 -10.503 55.540 1.00 110.31 ? -16  DA  I N6    1 
ATOM   7242  N  N1    . DA  I 5 57  ? -60.815 -11.627 55.253 1.00 110.12 ? -16  DA  I N1    1 
ATOM   7243  C  C2    . DA  I 5 57  ? -60.155 -12.714 54.833 1.00 110.04 ? -16  DA  I C2    1 
ATOM   7244  N  N3    . DA  I 5 57  ? -60.648 -13.825 54.282 1.00 110.24 ? -16  DA  I N3    1 
ATOM   7245  C  C4    . DA  I 5 57  ? -61.990 -13.769 54.165 1.00 110.34 ? -16  DA  I C4    1 
ATOM   7246  P  P     . DG  I 5 58  ? -61.676 -20.467 53.485 1.00 105.29 ? -15  DG  I P     1 
ATOM   7247  O  OP1   . DG  I 5 58  ? -61.665 -21.583 52.513 1.00 104.78 ? -15  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I 5 58  ? -62.610 -20.485 54.637 1.00 105.05 ? -15  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I 5 58  ? -60.196 -20.313 54.074 1.00 103.19 ? -15  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I 5 58  ? -59.552 -19.038 54.109 1.00 100.46 ? -15  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I 5 58  ? -59.008 -18.662 55.484 1.00 98.47  ? -15  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I 5 58  ? -59.586 -17.394 55.895 1.00 98.18  ? -15  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I 5 58  ? -59.244 -19.610 56.661 1.00 97.07  ? -15  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I 5 58  ? -58.153 -19.477 57.580 1.00 94.58  ? -15  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I 5 58  ? -60.528 -19.044 57.265 1.00 97.72  ? -15  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I 5 58  ? -60.198 -17.555 57.163 1.00 98.24  ? -15  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I 5 58  ? -61.317 -16.614 57.258 1.00 98.62  ? -15  DG  I N9    1 
ATOM   7258  C  C8    . DG  I 5 58  ? -62.667 -16.844 57.078 1.00 98.48  ? -15  DG  I C8    1 
ATOM   7259  N  N7    . DG  I 5 58  ? -63.403 -15.776 57.232 1.00 98.23  ? -15  DG  I N7    1 
ATOM   7260  C  C5    . DG  I 5 58  ? -62.485 -14.777 57.536 1.00 98.40  ? -15  DG  I C5    1 
ATOM   7261  C  C6    . DG  I 5 58  ? -62.682 -13.401 57.815 1.00 98.93  ? -15  DG  I C6    1 
ATOM   7262  O  O6    . DG  I 5 58  ? -63.752 -12.774 57.844 1.00 99.92  ? -15  DG  I O6    1 
ATOM   7263  N  N1    . DG  I 5 58  ? -61.478 -12.734 58.074 1.00 98.57  ? -15  DG  I N1    1 
ATOM   7264  C  C2    . DG  I 5 58  ? -60.234 -13.330 58.071 1.00 97.90  ? -15  DG  I C2    1 
ATOM   7265  N  N2    . DG  I 5 58  ? -59.186 -12.540 58.337 1.00 97.50  ? -15  DG  I N2    1 
ATOM   7266  N  N3    . DG  I 5 58  ? -60.034 -14.616 57.812 1.00 97.70  ? -15  DG  I N3    1 
ATOM   7267  C  C4    . DG  I 5 58  ? -61.198 -15.275 57.556 1.00 98.30  ? -15  DG  I C4    1 
ATOM   7268  P  P     . DG  I 5 59  ? -56.927 -20.514 57.647 1.00 92.30  ? -14  DG  I P     1 
ATOM   7269  O  OP1   . DG  I 5 59  ? -56.709 -21.085 56.297 1.00 92.86  ? -14  DG  I OP1   1 
ATOM   7270  O  OP2   . DG  I 5 59  ? -57.140 -21.416 58.805 1.00 91.35  ? -14  DG  I OP2   1 
ATOM   7271  O  "O5'" . DG  I 5 59  ? -55.694 -19.558 57.977 1.00 90.53  ? -14  DG  I "O5'" 1 
ATOM   7272  C  "C5'" . DG  I 5 59  ? -55.242 -18.606 57.018 1.00 88.35  ? -14  DG  I "C5'" 1 
ATOM   7273  C  "C4'" . DG  I 5 59  ? -54.451 -17.484 57.681 1.00 87.26  ? -14  DG  I "C4'" 1 
ATOM   7274  O  "O4'" . DG  I 5 59  ? -55.345 -16.557 58.351 1.00 88.22  ? -14  DG  I "O4'" 1 
ATOM   7275  C  "C3'" . DG  I 5 59  ? -53.448 -17.844 58.772 1.00 85.70  ? -14  DG  I "C3'" 1 
ATOM   7276  O  "O3'" . DG  I 5 59  ? -52.526 -16.755 58.864 1.00 82.03  ? -14  DG  I "O3'" 1 
ATOM   7277  C  "C2'" . DG  I 5 59  ? -54.359 -17.915 59.995 1.00 87.17  ? -14  DG  I "C2'" 1 
ATOM   7278  C  "C1'" . DG  I 5 59  ? -55.247 -16.696 59.760 1.00 88.92  ? -14  DG  I "C1'" 1 
ATOM   7279  N  N9    . DG  I 5 59  ? -56.634 -16.779 60.202 1.00 90.71  ? -14  DG  I N9    1 
ATOM   7280  C  C8    . DG  I 5 59  ? -57.434 -17.897 60.230 1.00 91.49  ? -14  DG  I C8    1 
ATOM   7281  N  N7    . DG  I 5 59  ? -58.645 -17.649 60.646 1.00 92.60  ? -14  DG  I N7    1 
ATOM   7282  C  C5    . DG  I 5 59  ? -58.652 -16.276 60.899 1.00 92.47  ? -14  DG  I C5    1 
ATOM   7283  C  C6    . DG  I 5 59  ? -59.694 -15.428 61.368 1.00 92.72  ? -14  DG  I C6    1 
ATOM   7284  O  O6    . DG  I 5 59  ? -60.860 -15.745 61.656 1.00 92.80  ? -14  DG  I O6    1 
ATOM   7285  N  N1    . DG  I 5 59  ? -59.282 -14.095 61.488 1.00 92.65  ? -14  DG  I N1    1 
ATOM   7286  C  C2    . DG  I 5 59  ? -58.013 -13.640 61.184 1.00 92.54  ? -14  DG  I C2    1 
ATOM   7287  N  N2    . DG  I 5 59  ? -57.779 -12.328 61.348 1.00 92.34  ? -14  DG  I N2    1 
ATOM   7288  N  N3    . DG  I 5 59  ? -57.035 -14.425 60.741 1.00 92.09  ? -14  DG  I N3    1 
ATOM   7289  C  C4    . DG  I 5 59  ? -57.419 -15.725 60.623 1.00 91.63  ? -14  DG  I C4    1 
ATOM   7290  P  P     . DC  I 5 60  ? -51.128 -16.807 59.637 1.00 78.59  ? -13  DC  I P     1 
ATOM   7291  O  OP1   . DC  I 5 60  ? -50.107 -16.498 58.621 1.00 77.79  ? -13  DC  I OP1   1 
ATOM   7292  O  OP2   . DC  I 5 60  ? -51.048 -18.045 60.443 1.00 78.74  ? -13  DC  I OP2   1 
ATOM   7293  O  "O5'" . DC  I 5 60  ? -51.210 -15.586 60.670 1.00 78.77  ? -13  DC  I "O5'" 1 
ATOM   7294  C  "C5'" . DC  I 5 60  ? -51.528 -14.255 60.243 1.00 78.56  ? -13  DC  I "C5'" 1 
ATOM   7295  C  "C4'" . DC  I 5 60  ? -52.041 -13.400 61.397 1.00 78.95  ? -13  DC  I "C4'" 1 
ATOM   7296  O  "O4'" . DC  I 5 60  ? -53.360 -13.839 61.830 1.00 79.21  ? -13  DC  I "O4'" 1 
ATOM   7297  C  "C3'" . DC  I 5 60  ? -51.185 -13.389 62.660 1.00 78.93  ? -13  DC  I "C3'" 1 
ATOM   7298  O  "O3'" . DC  I 5 60  ? -51.197 -12.092 63.209 1.00 77.79  ? -13  DC  I "O3'" 1 
ATOM   7299  C  "C2'" . DC  I 5 60  ? -51.903 -14.367 63.591 1.00 79.50  ? -13  DC  I "C2'" 1 
ATOM   7300  C  "C1'" . DC  I 5 60  ? -53.362 -14.101 63.225 1.00 79.83  ? -13  DC  I "C1'" 1 
ATOM   7301  N  N1    . DC  I 5 60  ? -54.325 -15.227 63.481 1.00 80.96  ? -13  DC  I N1    1 
ATOM   7302  C  C2    . DC  I 5 60  ? -55.600 -14.969 64.026 1.00 81.45  ? -13  DC  I C2    1 
ATOM   7303  O  O2    . DC  I 5 60  ? -55.921 -13.806 64.302 1.00 82.14  ? -13  DC  I O2    1 
ATOM   7304  N  N3    . DC  I 5 60  ? -56.456 -16.008 64.232 1.00 81.63  ? -13  DC  I N3    1 
ATOM   7305  C  C4    . DC  I 5 60  ? -56.089 -17.258 63.919 1.00 81.97  ? -13  DC  I C4    1 
ATOM   7306  N  N4    . DC  I 5 60  ? -56.947 -18.265 64.136 1.00 82.18  ? -13  DC  I N4    1 
ATOM   7307  C  C5    . DC  I 5 60  ? -54.800 -17.538 63.368 1.00 81.92  ? -13  DC  I C5    1 
ATOM   7308  C  C6    . DC  I 5 60  ? -53.966 -16.508 63.165 1.00 81.40  ? -13  DC  I C6    1 
ATOM   7309  P  P     . DA  I 5 61  ? -49.832 -11.349 63.537 1.00 77.64  ? -12  DA  I P     1 
ATOM   7310  O  OP1   . DA  I 5 61  ? -49.429 -10.615 62.322 1.00 77.40  ? -12  DA  I OP1   1 
ATOM   7311  O  OP2   . DA  I 5 61  ? -48.914 -12.314 64.161 1.00 77.61  ? -12  DA  I OP2   1 
ATOM   7312  O  "O5'" . DA  I 5 61  ? -50.236 -10.306 64.683 1.00 79.39  ? -12  DA  I "O5'" 1 
ATOM   7313  C  "C5'" . DA  I 5 61  ? -51.115 -9.211  64.428 1.00 81.83  ? -12  DA  I "C5'" 1 
ATOM   7314  C  "C4'" . DA  I 5 61  ? -52.010 -8.966  65.629 1.00 83.59  ? -12  DA  I "C4'" 1 
ATOM   7315  O  "O4'" . DA  I 5 61  ? -52.869 -10.115 65.841 1.00 84.03  ? -12  DA  I "O4'" 1 
ATOM   7316  C  "C3'" . DA  I 5 61  ? -51.277 -8.718  66.944 1.00 84.79  ? -12  DA  I "C3'" 1 
ATOM   7317  O  "O3'" . DA  I 5 61  ? -51.840 -7.553  67.522 1.00 87.10  ? -12  DA  I "O3'" 1 
ATOM   7318  C  "C2'" . DA  I 5 61  ? -51.534 -9.976  67.777 1.00 84.50  ? -12  DA  I "C2'" 1 
ATOM   7319  C  "C1'" . DA  I 5 61  ? -52.845 -10.498 67.197 1.00 84.64  ? -12  DA  I "C1'" 1 
ATOM   7320  N  N9    . DA  I 5 61  ? -53.022 -11.945 67.200 1.00 85.47  ? -12  DA  I N9    1 
ATOM   7321  C  C8    . DA  I 5 61  ? -52.097 -12.911 66.909 1.00 85.46  ? -12  DA  I C8    1 
ATOM   7322  N  N7    . DA  I 5 61  ? -52.563 -14.136 66.984 1.00 85.74  ? -12  DA  I N7    1 
ATOM   7323  C  C5    . DA  I 5 61  ? -53.888 -13.960 67.341 1.00 86.66  ? -12  DA  I C5    1 
ATOM   7324  C  C6    . DA  I 5 61  ? -54.940 -14.867 67.582 1.00 87.57  ? -12  DA  I C6    1 
ATOM   7325  N  N6    . DA  I 5 61  ? -54.798 -16.193 67.493 1.00 88.21  ? -12  DA  I N6    1 
ATOM   7326  N  N1    . DA  I 5 61  ? -56.151 -14.360 67.922 1.00 88.24  ? -12  DA  I N1    1 
ATOM   7327  C  C2    . DA  I 5 61  ? -56.302 -13.029 68.013 1.00 87.75  ? -12  DA  I C2    1 
ATOM   7328  N  N3    . DA  I 5 61  ? -55.387 -12.079 67.811 1.00 87.26  ? -12  DA  I N3    1 
ATOM   7329  C  C4    . DA  I 5 61  ? -54.192 -12.614 67.476 1.00 86.72  ? -12  DA  I C4    1 
ATOM   7330  P  P     . DT  I 5 62  ? -51.130 -6.707  68.682 1.00 88.85  ? -11  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5 62  ? -51.596 -5.310  68.537 1.00 88.33  ? -11  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5 62  ? -49.673 -6.991  68.698 1.00 88.34  ? -11  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5 62  ? -51.765 -7.343  70.016 1.00 90.69  ? -11  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5 62  ? -53.187 -7.450  70.181 1.00 93.16  ? -11  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5 62  ? -53.591 -8.438  71.268 1.00 94.89  ? -11  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5 62  ? -53.757 -9.758  70.698 1.00 95.17  ? -11  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5 62  ? -52.622 -8.629  72.430 1.00 95.92  ? -11  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5 62  ? -52.939 -7.691  73.464 1.00 97.88  ? -11  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5 62  ? -52.892 -10.070 72.868 1.00 96.06  ? -11  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5 62  ? -53.734 -10.691 71.753 1.00 95.95  ? -11  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5 62  ? -53.196 -11.995 71.241 1.00 96.79  ? -11  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5 62  ? -54.062 -13.045 70.972 1.00 97.26  ? -11  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5 62  ? -55.271 -12.998 71.119 1.00 97.94  ? -11  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5 62  ? -53.452 -14.187 70.514 1.00 97.41  ? -11  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5 62  ? -52.096 -14.384 70.300 1.00 97.31  ? -11  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5 62  ? -51.656 -15.451 69.885 1.00 97.70  ? -11  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5 62  ? -51.245 -13.252 70.599 1.00 97.06  ? -11  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5 62  ? -49.758 -13.342 70.408 1.00 96.97  ? -11  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5 62  ? -51.829 -12.130 71.046 1.00 96.82  ? -11  DT  I C6    1 
ATOM   7350  P  P     . DG  I 5 63  ? -52.036 -7.420  74.772 1.00 99.59  ? -10  DG  I P     1 
ATOM   7351  O  OP1   . DG  I 5 63  ? -51.757 -5.971  74.772 1.00 99.20  ? -10  DG  I OP1   1 
ATOM   7352  O  OP2   . DG  I 5 63  ? -50.898 -8.361  74.842 1.00 99.65  ? -10  DG  I OP2   1 
ATOM   7353  O  "O5'" . DG  I 5 63  ? -53.004 -7.746  76.010 1.00 100.52 ? -10  DG  I "O5'" 1 
ATOM   7354  C  "C5'" . DG  I 5 63  ? -53.936 -8.836  75.986 1.00 102.40 ? -10  DG  I "C5'" 1 
ATOM   7355  C  "C4'" . DG  I 5 63  ? -54.020 -9.598  77.307 1.00 103.94 ? -10  DG  I "C4'" 1 
ATOM   7356  O  "O4'" . DG  I 5 63  ? -53.836 -11.023 77.074 1.00 104.23 ? -10  DG  I "O4'" 1 
ATOM   7357  C  "C3'" . DG  I 5 63  ? -53.014 -9.253  78.408 1.00 104.70 ? -10  DG  I "C3'" 1 
ATOM   7358  O  "O3'" . DG  I 5 63  ? -53.657 -9.469  79.686 1.00 105.23 ? -10  DG  I "O3'" 1 
ATOM   7359  C  "C2'" . DG  I 5 63  ? -51.847 -10.194 78.094 1.00 104.60 ? -10  DG  I "C2'" 1 
ATOM   7360  C  "C1'" . DG  I 5 63  ? -52.558 -11.429 77.541 1.00 104.53 ? -10  DG  I "C1'" 1 
ATOM   7361  N  N9    . DG  I 5 63  ? -51.851 -12.118 76.456 1.00 104.63 ? -10  DG  I N9    1 
ATOM   7362  C  C8    . DG  I 5 63  ? -50.856 -11.633 75.637 1.00 104.41 ? -10  DG  I C8    1 
ATOM   7363  N  N7    . DG  I 5 63  ? -50.429 -12.500 74.759 1.00 104.29 ? -10  DG  I N7    1 
ATOM   7364  C  C5    . DG  I 5 63  ? -51.187 -13.634 75.010 1.00 104.65 ? -10  DG  I C5    1 
ATOM   7365  C  C6    . DG  I 5 63  ? -51.176 -14.906 74.381 1.00 104.95 ? -10  DG  I C6    1 
ATOM   7366  O  O6    . DG  I 5 63  ? -50.468 -15.289 73.441 1.00 104.87 ? -10  DG  I O6    1 
ATOM   7367  N  N1    . DG  I 5 63  ? -52.109 -15.781 74.944 1.00 105.45 ? -10  DG  I N1    1 
ATOM   7368  C  C2    . DG  I 5 63  ? -52.950 -15.459 75.991 1.00 105.25 ? -10  DG  I C2    1 
ATOM   7369  N  N2    . DG  I 5 63  ? -53.786 -16.418 76.410 1.00 105.26 ? -10  DG  I N2    1 
ATOM   7370  N  N3    . DG  I 5 63  ? -52.969 -14.273 76.588 1.00 104.95 ? -10  DG  I N3    1 
ATOM   7371  C  C4    . DG  I 5 63  ? -52.066 -13.413 76.050 1.00 104.69 ? -10  DG  I C4    1 
ATOM   7372  P  P     . DT  I 5 64  ? -52.926 -9.901  81.053 1.00 105.35 ? -9   DT  I P     1 
ATOM   7373  O  OP1   . DT  I 5 64  ? -53.795 -9.447  82.162 1.00 105.52 ? -9   DT  I OP1   1 
ATOM   7374  O  OP2   . DT  I 5 64  ? -51.503 -9.478  81.027 1.00 105.14 ? -9   DT  I OP2   1 
ATOM   7375  O  "O5'" . DT  I 5 64  ? -52.985 -11.500 80.980 1.00 104.60 ? -9   DT  I "O5'" 1 
ATOM   7376  C  "C5'" . DT  I 5 64  ? -54.237 -12.180 80.821 1.00 103.85 ? -9   DT  I "C5'" 1 
ATOM   7377  C  "C4'" . DT  I 5 64  ? -54.124 -13.625 81.283 1.00 103.50 ? -9   DT  I "C4'" 1 
ATOM   7378  O  "O4'" . DT  I 5 64  ? -53.471 -14.421 80.253 1.00 103.29 ? -9   DT  I "O4'" 1 
ATOM   7379  C  "C3'" . DT  I 5 64  ? -53.321 -13.817 82.570 1.00 103.36 ? -9   DT  I "C3'" 1 
ATOM   7380  O  "O3'" . DT  I 5 64  ? -54.017 -14.685 83.474 1.00 102.48 ? -9   DT  I "O3'" 1 
ATOM   7381  C  "C2'" . DT  I 5 64  ? -51.979 -14.388 82.101 1.00 103.61 ? -9   DT  I "C2'" 1 
ATOM   7382  C  "C1'" . DT  I 5 64  ? -52.304 -15.046 80.763 1.00 103.38 ? -9   DT  I "C1'" 1 
ATOM   7383  N  N1    . DT  I 5 64  ? -51.184 -14.987 79.737 1.00 103.31 ? -9   DT  I N1    1 
ATOM   7384  C  C2    . DT  I 5 64  ? -50.908 -16.111 78.977 1.00 103.14 ? -9   DT  I C2    1 
ATOM   7385  O  O2    . DT  I 5 64  ? -51.520 -17.162 79.082 1.00 103.08 ? -9   DT  I O2    1 
ATOM   7386  N  N3    . DT  I 5 64  ? -49.877 -15.964 78.077 1.00 102.93 ? -9   DT  I N3    1 
ATOM   7387  C  C4    . DT  I 5 64  ? -49.103 -14.836 77.859 1.00 102.81 ? -9   DT  I C4    1 
ATOM   7388  O  O4    . DT  I 5 64  ? -48.204 -14.825 77.023 1.00 102.56 ? -9   DT  I O4    1 
ATOM   7389  C  C5    . DT  I 5 64  ? -49.435 -13.693 78.682 1.00 102.75 ? -9   DT  I C5    1 
ATOM   7390  C  C7    . DT  I 5 64  ? -48.675 -12.406 78.546 1.00 102.19 ? -9   DT  I C7    1 
ATOM   7391  C  C6    . DT  I 5 64  ? -50.441 -13.824 79.566 1.00 103.07 ? -9   DT  I C6    1 
ATOM   7392  P  P     . DT  I 5 65  ? -53.367 -15.138 84.871 1.00 102.19 ? -8   DT  I P     1 
ATOM   7393  O  OP1   . DT  I 5 65  ? -54.479 -15.460 85.797 1.00 102.29 ? -8   DT  I OP1   1 
ATOM   7394  O  OP2   . DT  I 5 65  ? -52.313 -14.169 85.271 1.00 102.03 ? -8   DT  I OP2   1 
ATOM   7395  O  "O5'" . DT  I 5 65  ? -52.633 -16.500 84.480 1.00 100.81 ? -8   DT  I "O5'" 1 
ATOM   7396  C  "C5'" . DT  I 5 65  ? -53.370 -17.601 83.961 1.00 98.98  ? -8   DT  I "C5'" 1 
ATOM   7397  C  "C4'" . DT  I 5 65  ? -52.402 -18.729 83.673 1.00 97.71  ? -8   DT  I "C4'" 1 
ATOM   7398  O  "O4'" . DT  I 5 65  ? -51.551 -18.349 82.560 1.00 97.23  ? -8   DT  I "O4'" 1 
ATOM   7399  C  "C3'" . DT  I 5 65  ? -51.474 -19.056 84.845 1.00 96.88  ? -8   DT  I "C3'" 1 
ATOM   7400  O  "O3'" . DT  I 5 65  ? -51.615 -20.430 85.214 1.00 95.32  ? -8   DT  I "O3'" 1 
ATOM   7401  C  "C2'" . DT  I 5 65  ? -50.067 -18.718 84.336 1.00 97.01  ? -8   DT  I "C2'" 1 
ATOM   7402  C  "C1'" . DT  I 5 65  ? -50.235 -18.794 82.821 1.00 96.69  ? -8   DT  I "C1'" 1 
ATOM   7403  N  N1    . DT  I 5 65  ? -49.266 -17.974 82.006 1.00 96.05  ? -8   DT  I N1    1 
ATOM   7404  C  C2    . DT  I 5 65  ? -48.753 -18.514 80.835 1.00 95.53  ? -8   DT  I C2    1 
ATOM   7405  O  O2    . DT  I 5 65  ? -49.033 -19.624 80.415 1.00 95.81  ? -8   DT  I O2    1 
ATOM   7406  N  N3    . DT  I 5 65  ? -47.883 -17.698 80.154 1.00 94.76  ? -8   DT  I N3    1 
ATOM   7407  C  C4    . DT  I 5 65  ? -47.477 -16.426 80.509 1.00 94.35  ? -8   DT  I C4    1 
ATOM   7408  O  O4    . DT  I 5 65  ? -46.693 -15.789 79.816 1.00 93.56  ? -8   DT  I O4    1 
ATOM   7409  C  C5    . DT  I 5 65  ? -48.045 -15.915 81.740 1.00 94.88  ? -8   DT  I C5    1 
ATOM   7410  C  C7    . DT  I 5 65  ? -47.684 -14.542 82.231 1.00 94.61  ? -8   DT  I C7    1 
ATOM   7411  C  C6    . DT  I 5 65  ? -48.902 -16.700 82.420 1.00 95.19  ? -8   DT  I C6    1 
ATOM   7412  P  P     . DC  I 5 66  ? -50.968 -20.980 86.571 1.00 94.29  ? -7   DC  I P     1 
ATOM   7413  O  OP1   . DC  I 5 66  ? -51.898 -21.966 87.168 1.00 94.59  ? -7   DC  I OP1   1 
ATOM   7414  O  OP2   . DC  I 5 66  ? -50.502 -19.814 87.357 1.00 94.54  ? -7   DC  I OP2   1 
ATOM   7415  O  "O5'" . DC  I 5 66  ? -49.661 -21.755 86.073 1.00 93.13  ? -7   DC  I "O5'" 1 
ATOM   7416  C  "C5'" . DC  I 5 66  ? -49.729 -22.831 85.127 1.00 90.77  ? -7   DC  I "C5'" 1 
ATOM   7417  C  "C4'" . DC  I 5 66  ? -48.351 -23.097 84.539 1.00 88.51  ? -7   DC  I "C4'" 1 
ATOM   7418  O  "O4'" . DC  I 5 66  ? -47.864 -21.909 83.859 1.00 88.39  ? -7   DC  I "O4'" 1 
ATOM   7419  C  "C3'" . DC  I 5 66  ? -47.280 -23.463 85.565 1.00 86.99  ? -7   DC  I "C3'" 1 
ATOM   7420  O  "O3'" . DC  I 5 66  ? -46.497 -24.519 85.074 1.00 84.66  ? -7   DC  I "O3'" 1 
ATOM   7421  C  "C2'" . DC  I 5 66  ? -46.436 -22.204 85.682 1.00 87.36  ? -7   DC  I "C2'" 1 
ATOM   7422  C  "C1'" . DC  I 5 66  ? -46.523 -21.690 84.248 1.00 88.01  ? -7   DC  I "C1'" 1 
ATOM   7423  N  N1    . DC  I 5 66  ? -46.142 -20.248 84.079 1.00 88.22  ? -7   DC  I N1    1 
ATOM   7424  C  C2    . DC  I 5 66  ? -45.827 -19.752 82.803 1.00 88.21  ? -7   DC  I C2    1 
ATOM   7425  O  O2    . DC  I 5 66  ? -45.877 -20.504 81.821 1.00 88.09  ? -7   DC  I O2    1 
ATOM   7426  N  N3    . DC  I 5 66  ? -45.476 -18.446 82.677 1.00 88.06  ? -7   DC  I N3    1 
ATOM   7427  C  C4    . DC  I 5 66  ? -45.429 -17.655 83.753 1.00 88.14  ? -7   DC  I C4    1 
ATOM   7428  N  N4    . DC  I 5 66  ? -45.077 -16.380 83.578 1.00 88.53  ? -7   DC  I N4    1 
ATOM   7429  C  C5    . DC  I 5 66  ? -45.738 -18.134 85.060 1.00 88.32  ? -7   DC  I C5    1 
ATOM   7430  C  C6    . DC  I 5 66  ? -46.084 -19.423 85.171 1.00 88.46  ? -7   DC  I C6    1 
ATOM   7431  P  P     . DA  I 5 67  ? -46.679 -25.974 85.695 1.00 83.24  ? -6   DA  I P     1 
ATOM   7432  O  OP1   . DA  I 5 67  ? -48.136 -26.193 85.871 1.00 83.47  ? -6   DA  I OP1   1 
ATOM   7433  O  OP2   . DA  I 5 67  ? -45.753 -26.070 86.849 1.00 83.22  ? -6   DA  I OP2   1 
ATOM   7434  O  "O5'" . DA  I 5 67  ? -46.133 -26.948 84.538 1.00 81.17  ? -6   DA  I "O5'" 1 
ATOM   7435  C  "C5'" . DA  I 5 67  ? -46.572 -26.791 83.183 1.00 77.86  ? -6   DA  I "C5'" 1 
ATOM   7436  C  "C4'" . DA  I 5 67  ? -45.461 -26.971 82.148 1.00 75.21  ? -6   DA  I "C4'" 1 
ATOM   7437  O  "O4'" . DA  I 5 67  ? -44.779 -25.719 81.898 1.00 73.79  ? -6   DA  I "O4'" 1 
ATOM   7438  C  "C3'" . DA  I 5 67  ? -44.361 -27.975 82.460 1.00 73.78  ? -6   DA  I "C3'" 1 
ATOM   7439  O  "O3'" . DA  I 5 67  ? -43.998 -28.603 81.259 1.00 73.15  ? -6   DA  I "O3'" 1 
ATOM   7440  C  "C2'" . DA  I 5 67  ? -43.208 -27.131 82.984 1.00 73.20  ? -6   DA  I "C2'" 1 
ATOM   7441  C  "C1'" . DA  I 5 67  ? -43.415 -25.801 82.271 1.00 73.71  ? -6   DA  I "C1'" 1 
ATOM   7442  N  N9    . DA  I 5 67  ? -43.177 -24.649 83.128 1.00 73.66  ? -6   DA  I N9    1 
ATOM   7443  C  C8    . DA  I 5 67  ? -43.463 -24.563 84.459 1.00 74.29  ? -6   DA  I C8    1 
ATOM   7444  N  N7    . DA  I 5 67  ? -43.166 -23.406 84.995 1.00 74.28  ? -6   DA  I N7    1 
ATOM   7445  C  C5    . DA  I 5 67  ? -42.658 -22.686 83.943 1.00 73.31  ? -6   DA  I C5    1 
ATOM   7446  C  C6    . DA  I 5 67  ? -42.162 -21.376 83.865 1.00 73.71  ? -6   DA  I C6    1 
ATOM   7447  N  N6    . DA  I 5 67  ? -42.114 -20.571 84.925 1.00 74.08  ? -6   DA  I N6    1 
ATOM   7448  N  N1    . DA  I 5 67  ? -41.719 -20.932 82.667 1.00 73.62  ? -6   DA  I N1    1 
ATOM   7449  C  C2    . DA  I 5 67  ? -41.774 -21.761 81.615 1.00 73.24  ? -6   DA  I C2    1 
ATOM   7450  N  N3    . DA  I 5 67  ? -42.223 -23.020 81.576 1.00 73.84  ? -6   DA  I N3    1 
ATOM   7451  C  C4    . DA  I 5 67  ? -42.654 -23.428 82.782 1.00 73.41  ? -6   DA  I C4    1 
ATOM   7452  P  P     . DG  I 5 68  ? -42.986 -29.846 81.256 1.00 73.67  ? -5   DG  I P     1 
ATOM   7453  O  OP1   . DG  I 5 68  ? -43.362 -30.733 80.134 1.00 74.13  ? -5   DG  I OP1   1 
ATOM   7454  O  OP2   . DG  I 5 68  ? -42.863 -30.412 82.618 1.00 73.59  ? -5   DG  I OP2   1 
ATOM   7455  O  "O5'" . DG  I 5 68  ? -41.606 -29.145 80.913 1.00 72.49  ? -5   DG  I "O5'" 1 
ATOM   7456  C  "C5'" . DG  I 5 68  ? -41.495 -28.268 79.798 1.00 71.61  ? -5   DG  I "C5'" 1 
ATOM   7457  C  "C4'" . DG  I 5 68  ? -40.164 -27.536 79.837 1.00 70.89  ? -5   DG  I "C4'" 1 
ATOM   7458  O  "O4'" . DG  I 5 68  ? -40.283 -26.365 80.682 1.00 70.65  ? -5   DG  I "O4'" 1 
ATOM   7459  C  "C3'" . DG  I 5 68  ? -38.981 -28.338 80.393 1.00 70.71  ? -5   DG  I "C3'" 1 
ATOM   7460  O  "O3'" . DG  I 5 68  ? -37.764 -28.011 79.732 1.00 70.10  ? -5   DG  I "O3'" 1 
ATOM   7461  C  "C2'" . DG  I 5 68  ? -38.881 -27.834 81.823 1.00 70.22  ? -5   DG  I "C2'" 1 
ATOM   7462  C  "C1'" . DG  I 5 68  ? -39.173 -26.367 81.558 1.00 70.35  ? -5   DG  I "C1'" 1 
ATOM   7463  N  N9    . DG  I 5 68  ? -39.444 -25.617 82.779 1.00 70.48  ? -5   DG  I N9    1 
ATOM   7464  C  C8    . DG  I 5 68  ? -39.972 -26.098 83.954 1.00 70.85  ? -5   DG  I C8    1 
ATOM   7465  N  N7    . DG  I 5 68  ? -40.083 -25.196 84.883 1.00 70.92  ? -5   DG  I N7    1 
ATOM   7466  C  C5    . DG  I 5 68  ? -39.588 -24.047 84.288 1.00 70.61  ? -5   DG  I C5    1 
ATOM   7467  C  C6    . DG  I 5 68  ? -39.459 -22.743 84.817 1.00 70.35  ? -5   DG  I C6    1 
ATOM   7468  O  O6    . DG  I 5 68  ? -39.775 -22.364 85.948 1.00 70.29  ? -5   DG  I O6    1 
ATOM   7469  N  N1    . DG  I 5 68  ? -38.912 -21.849 83.894 1.00 69.88  ? -5   DG  I N1    1 
ATOM   7470  C  C2    . DG  I 5 68  ? -38.537 -22.198 82.615 1.00 69.93  ? -5   DG  I C2    1 
ATOM   7471  N  N2    . DG  I 5 68  ? -38.031 -21.218 81.863 1.00 70.16  ? -5   DG  I N2    1 
ATOM   7472  N  N3    . DG  I 5 68  ? -38.653 -23.418 82.105 1.00 69.83  ? -5   DG  I N3    1 
ATOM   7473  C  C4    . DG  I 5 68  ? -39.188 -24.288 82.994 1.00 70.24  ? -5   DG  I C4    1 
ATOM   7474  P  P     . DC  I 5 69  ? -37.186 -28.840 78.496 1.00 69.16  ? -4   DC  I P     1 
ATOM   7475  O  OP1   . DC  I 5 69  ? -38.296 -29.082 77.537 1.00 68.71  ? -4   DC  I OP1   1 
ATOM   7476  O  OP2   . DC  I 5 69  ? -36.372 -29.975 79.002 1.00 68.76  ? -4   DC  I OP2   1 
ATOM   7477  O  "O5'" . DC  I 5 69  ? -36.178 -27.742 77.915 1.00 65.98  ? -4   DC  I "O5'" 1 
ATOM   7478  C  "C5'" . DC  I 5 69  ? -36.725 -26.608 77.271 1.00 63.03  ? -4   DC  I "C5'" 1 
ATOM   7479  C  "C4'" . DC  I 5 69  ? -35.972 -25.356 77.658 1.00 60.58  ? -4   DC  I "C4'" 1 
ATOM   7480  O  "O4'" . DC  I 5 69  ? -36.317 -24.946 79.004 1.00 60.48  ? -4   DC  I "O4'" 1 
ATOM   7481  C  "C3'" . DC  I 5 69  ? -34.463 -25.519 77.618 1.00 58.67  ? -4   DC  I "C3'" 1 
ATOM   7482  O  "O3'" . DC  I 5 69  ? -33.919 -24.541 76.730 1.00 56.74  ? -4   DC  I "O3'" 1 
ATOM   7483  C  "C2'" . DC  I 5 69  ? -34.019 -25.299 79.059 1.00 58.88  ? -4   DC  I "C2'" 1 
ATOM   7484  C  "C1'" . DC  I 5 69  ? -35.156 -24.491 79.658 1.00 60.13  ? -4   DC  I "C1'" 1 
ATOM   7485  N  N1    . DC  I 5 69  ? -35.340 -24.720 81.128 1.00 61.65  ? -4   DC  I N1    1 
ATOM   7486  C  C2    . DC  I 5 69  ? -35.319 -23.634 82.015 1.00 61.91  ? -4   DC  I C2    1 
ATOM   7487  O  O2    . DC  I 5 69  ? -35.142 -22.495 81.580 1.00 62.37  ? -4   DC  I O2    1 
ATOM   7488  N  N3    . DC  I 5 69  ? -35.490 -23.860 83.338 1.00 62.28  ? -4   DC  I N3    1 
ATOM   7489  C  C4    . DC  I 5 69  ? -35.675 -25.107 83.784 1.00 62.98  ? -4   DC  I C4    1 
ATOM   7490  N  N4    . DC  I 5 69  ? -35.848 -25.293 85.102 1.00 63.31  ? -4   DC  I N4    1 
ATOM   7491  C  C5    . DC  I 5 69  ? -35.695 -26.230 82.899 1.00 62.55  ? -4   DC  I C5    1 
ATOM   7492  C  C6    . DC  I 5 69  ? -35.525 -25.993 81.596 1.00 61.60  ? -4   DC  I C6    1 
ATOM   7493  P  P     . DT  I 5 70  ? -32.352 -24.517 76.389 1.00 53.64  ? -3   DT  I P     1 
ATOM   7494  O  OP1   . DT  I 5 70  ? -32.230 -24.205 74.951 1.00 54.43  ? -3   DT  I OP1   1 
ATOM   7495  O  OP2   . DT  I 5 70  ? -31.707 -25.725 76.956 1.00 53.55  ? -3   DT  I OP2   1 
ATOM   7496  O  "O5'" . DT  I 5 70  ? -31.809 -23.286 77.211 1.00 53.61  ? -3   DT  I "O5'" 1 
ATOM   7497  C  "C5'" . DT  I 5 70  ? -32.292 -21.987 76.918 1.00 56.20  ? -3   DT  I "C5'" 1 
ATOM   7498  C  "C4'" . DT  I 5 70  ? -31.748 -21.000 77.931 1.00 57.16  ? -3   DT  I "C4'" 1 
ATOM   7499  O  "O4'" . DT  I 5 70  ? -32.117 -21.418 79.269 1.00 59.16  ? -3   DT  I "O4'" 1 
ATOM   7500  C  "C3'" . DT  I 5 70  ? -30.235 -20.888 77.947 1.00 58.00  ? -3   DT  I "C3'" 1 
ATOM   7501  O  "O3'" . DT  I 5 70  ? -29.932 -19.529 78.106 1.00 58.41  ? -3   DT  I "O3'" 1 
ATOM   7502  C  "C2'" . DT  I 5 70  ? -29.785 -21.718 79.151 1.00 58.12  ? -3   DT  I "C2'" 1 
ATOM   7503  C  "C1'" . DT  I 5 70  ? -30.967 -21.525 80.091 1.00 59.38  ? -3   DT  I "C1'" 1 
ATOM   7504  N  N1    . DT  I 5 70  ? -31.233 -22.596 81.102 1.00 60.04  ? -3   DT  I N1    1 
ATOM   7505  C  C2    . DT  I 5 70  ? -31.552 -22.202 82.385 1.00 60.90  ? -3   DT  I C2    1 
ATOM   7506  O  O2    . DT  I 5 70  ? -31.605 -21.026 82.723 1.00 61.32  ? -3   DT  I O2    1 
ATOM   7507  N  N3    . DT  I 5 70  ? -31.801 -23.238 83.259 1.00 60.74  ? -3   DT  I N3    1 
ATOM   7508  C  C4    . DT  I 5 70  ? -31.761 -24.590 82.984 1.00 61.07  ? -3   DT  I C4    1 
ATOM   7509  O  O4    . DT  I 5 70  ? -31.997 -25.439 83.843 1.00 61.84  ? -3   DT  I O4    1 
ATOM   7510  C  C5    . DT  I 5 70  ? -31.426 -24.933 81.617 1.00 61.32  ? -3   DT  I C5    1 
ATOM   7511  C  C7    . DT  I 5 70  ? -31.354 -26.373 81.194 1.00 60.67  ? -3   DT  I C7    1 
ATOM   7512  C  C6    . DT  I 5 70  ? -31.184 -23.934 80.749 1.00 60.64  ? -3   DT  I C6    1 
ATOM   7513  P  P     . DG  I 5 71  ? -28.497 -18.946 77.697 1.00 58.43  ? -2   DG  I P     1 
ATOM   7514  O  OP1   . DG  I 5 71  ? -28.770 -17.679 77.000 1.00 58.22  ? -2   DG  I OP1   1 
ATOM   7515  O  OP2   . DG  I 5 71  ? -27.651 -20.003 77.122 1.00 57.33  ? -2   DG  I OP2   1 
ATOM   7516  O  "O5'" . DG  I 5 71  ? -27.795 -18.601 79.083 1.00 61.45  ? -2   DG  I "O5'" 1 
ATOM   7517  C  "C5'" . DG  I 5 71  ? -28.327 -17.626 79.969 1.00 63.94  ? -2   DG  I "C5'" 1 
ATOM   7518  C  "C4'" . DG  I 5 71  ? -27.760 -17.874 81.353 1.00 65.68  ? -2   DG  I "C4'" 1 
ATOM   7519  O  "O4'" . DG  I 5 71  ? -28.190 -19.171 81.829 1.00 65.77  ? -2   DG  I "O4'" 1 
ATOM   7520  C  "C3'" . DG  I 5 71  ? -26.238 -17.900 81.416 1.00 67.41  ? -2   DG  I "C3'" 1 
ATOM   7521  O  "O3'" . DG  I 5 71  ? -25.868 -17.042 82.472 1.00 70.22  ? -2   DG  I "O3'" 1 
ATOM   7522  C  "C2'" . DG  I 5 71  ? -25.892 -19.367 81.684 1.00 66.39  ? -2   DG  I "C2'" 1 
ATOM   7523  C  "C1'" . DG  I 5 71  ? -27.111 -19.792 82.488 1.00 65.98  ? -2   DG  I "C1'" 1 
ATOM   7524  N  N9    . DG  I 5 71  ? -27.415 -21.217 82.527 1.00 65.61  ? -2   DG  I N9    1 
ATOM   7525  C  C8    . DG  I 5 71  ? -27.308 -22.134 81.514 1.00 65.66  ? -2   DG  I C8    1 
ATOM   7526  N  N7    . DG  I 5 71  ? -27.670 -23.337 81.849 1.00 65.58  ? -2   DG  I N7    1 
ATOM   7527  C  C5    . DG  I 5 71  ? -28.042 -23.207 83.176 1.00 66.29  ? -2   DG  I C5    1 
ATOM   7528  C  C6    . DG  I 5 71  ? -28.522 -24.176 84.087 1.00 66.74  ? -2   DG  I C6    1 
ATOM   7529  O  O6    . DG  I 5 71  ? -28.716 -25.380 83.876 1.00 67.71  ? -2   DG  I O6    1 
ATOM   7530  N  N1    . DG  I 5 71  ? -28.777 -23.636 85.348 1.00 66.01  ? -2   DG  I N1    1 
ATOM   7531  C  C2    . DG  I 5 71  ? -28.596 -22.314 85.680 1.00 65.91  ? -2   DG  I C2    1 
ATOM   7532  N  N2    . DG  I 5 71  ? -28.898 -21.953 86.934 1.00 65.74  ? -2   DG  I N2    1 
ATOM   7533  N  N3    . DG  I 5 71  ? -28.150 -21.397 84.831 1.00 66.23  ? -2   DG  I N3    1 
ATOM   7534  C  C4    . DG  I 5 71  ? -27.894 -21.910 83.605 1.00 65.74  ? -2   DG  I C4    1 
ATOM   7535  P  P     . DA  I 5 72  ? -24.374 -16.504 82.669 1.00 72.20  ? -1   DA  I P     1 
ATOM   7536  O  OP1   . DA  I 5 72  ? -24.296 -15.209 81.968 1.00 72.27  ? -1   DA  I OP1   1 
ATOM   7537  O  OP2   . DA  I 5 72  ? -23.410 -17.583 82.379 1.00 70.24  ? -1   DA  I OP2   1 
ATOM   7538  O  "O5'" . DA  I 5 72  ? -24.310 -16.214 84.246 1.00 73.48  ? -1   DA  I "O5'" 1 
ATOM   7539  C  "C5'" . DA  I 5 72  ? -25.507 -16.107 85.026 1.00 75.82  ? -1   DA  I "C5'" 1 
ATOM   7540  C  "C4'" . DA  I 5 72  ? -25.335 -16.765 86.385 1.00 77.27  ? -1   DA  I "C4'" 1 
ATOM   7541  O  "O4'" . DA  I 5 72  ? -25.751 -18.154 86.319 1.00 77.47  ? -1   DA  I "O4'" 1 
ATOM   7542  C  "C3'" . DA  I 5 72  ? -23.912 -16.769 86.942 1.00 78.39  ? -1   DA  I "C3'" 1 
ATOM   7543  O  "O3'" . DA  I 5 72  ? -23.952 -16.316 88.307 1.00 80.59  ? -1   DA  I "O3'" 1 
ATOM   7544  C  "C2'" . DA  I 5 72  ? -23.449 -18.220 86.786 1.00 76.95  ? -1   DA  I "C2'" 1 
ATOM   7545  C  "C1'" . DA  I 5 72  ? -24.763 -18.982 86.904 1.00 76.66  ? -1   DA  I "C1'" 1 
ATOM   7546  N  N9    . DA  I 5 72  ? -24.822 -20.253 86.191 1.00 75.84  ? -1   DA  I N9    1 
ATOM   7547  C  C8    . DA  I 5 72  ? -24.485 -20.475 84.886 1.00 75.30  ? -1   DA  I C8    1 
ATOM   7548  N  N7    . DA  I 5 72  ? -24.652 -21.713 84.503 1.00 74.94  ? -1   DA  I N7    1 
ATOM   7549  C  C5    . DA  I 5 72  ? -25.136 -22.349 85.629 1.00 74.86  ? -1   DA  I C5    1 
ATOM   7550  C  C6    . DA  I 5 72  ? -25.518 -23.683 85.873 1.00 74.59  ? -1   DA  I C6    1 
ATOM   7551  N  N6    . DA  I 5 72  ? -25.453 -24.635 84.941 1.00 73.88  ? -1   DA  I N6    1 
ATOM   7552  N  N1    . DA  I 5 72  ? -25.962 -24.000 87.111 1.00 74.99  ? -1   DA  I N1    1 
ATOM   7553  C  C2    . DA  I 5 72  ? -26.022 -23.036 88.043 1.00 75.52  ? -1   DA  I C2    1 
ATOM   7554  N  N3    . DA  I 5 72  ? -25.698 -21.742 87.926 1.00 75.55  ? -1   DA  I N3    1 
ATOM   7555  C  C4    . DA  I 5 72  ? -25.255 -21.462 86.684 1.00 75.36  ? -1   DA  I C4    1 
ATOM   7556  P  P     . DA  I 5 73  ? -22.609 -16.002 89.120 1.00 81.96  ? 0    DA  I P     1 
ATOM   7557  O  OP1   . DA  I 5 73  ? -22.895 -14.942 90.112 1.00 82.10  ? 0    DA  I OP1   1 
ATOM   7558  O  OP2   . DA  I 5 73  ? -21.512 -15.788 88.150 1.00 82.49  ? 0    DA  I OP2   1 
ATOM   7559  O  "O5'" . DA  I 5 73  ? -22.336 -17.380 89.880 1.00 81.59  ? 0    DA  I "O5'" 1 
ATOM   7560  C  "C5'" . DA  I 5 73  ? -23.282 -17.843 90.812 1.00 82.33  ? 0    DA  I "C5'" 1 
ATOM   7561  C  "C4'" . DA  I 5 73  ? -22.799 -19.125 91.449 1.00 83.17  ? 0    DA  I "C4'" 1 
ATOM   7562  O  "O4'" . DA  I 5 73  ? -23.090 -20.233 90.573 1.00 83.57  ? 0    DA  I "O4'" 1 
ATOM   7563  C  "C3'" . DA  I 5 73  ? -21.311 -19.199 91.766 1.00 83.88  ? 0    DA  I "C3'" 1 
ATOM   7564  O  "O3'" . DA  I 5 73  ? -21.237 -19.559 93.136 1.00 85.19  ? 0    DA  I "O3'" 1 
ATOM   7565  C  "C2'" . DA  I 5 73  ? -20.761 -20.278 90.832 1.00 83.86  ? 0    DA  I "C2'" 1 
ATOM   7566  C  "C1'" . DA  I 5 73  ? -21.998 -21.126 90.556 1.00 84.13  ? 0    DA  I "C1'" 1 
ATOM   7567  N  N9    . DA  I 5 73  ? -22.042 -21.777 89.248 1.00 84.67  ? 0    DA  I N9    1 
ATOM   7568  C  C8    . DA  I 5 73  ? -21.790 -21.207 88.026 1.00 84.70  ? 0    DA  I C8    1 
ATOM   7569  N  N7    . DA  I 5 73  ? -21.922 -22.036 87.018 1.00 85.14  ? 0    DA  I N7    1 
ATOM   7570  C  C5    . DA  I 5 73  ? -22.300 -23.227 87.618 1.00 85.39  ? 0    DA  I C5    1 
ATOM   7571  C  C6    . DA  I 5 73  ? -22.598 -24.510 87.102 1.00 85.84  ? 0    DA  I C6    1 
ATOM   7572  N  N6    . DA  I 5 73  ? -22.558 -24.798 85.800 1.00 86.01  ? 0    DA  I N6    1 
ATOM   7573  N  N1    . DA  I 5 73  ? -22.943 -25.489 87.973 1.00 85.96  ? 0    DA  I N1    1 
ATOM   7574  C  C2    . DA  I 5 73  ? -22.984 -25.203 89.284 1.00 85.71  ? 0    DA  I C2    1 
ATOM   7575  N  N3    . DA  I 5 73  ? -22.721 -24.038 89.883 1.00 85.34  ? 0    DA  I N3    1 
ATOM   7576  C  C4    . DA  I 5 73  ? -22.383 -23.084 88.992 1.00 84.95  ? 0    DA  I C4    1 
ATOM   7577  P  P     . DT  I 5 74  ? -19.866 -19.715 93.940 1.00 85.84  ? 1    DT  I P     1 
ATOM   7578  O  OP1   . DT  I 5 74  ? -20.158 -19.337 95.345 1.00 85.60  ? 1    DT  I OP1   1 
ATOM   7579  O  OP2   . DT  I 5 74  ? -18.767 -19.045 93.199 1.00 85.54  ? 1    DT  I OP2   1 
ATOM   7580  O  "O5'" . DT  I 5 74  ? -19.636 -21.289 93.855 1.00 85.02  ? 1    DT  I "O5'" 1 
ATOM   7581  C  "C5'" . DT  I 5 74  ? -20.614 -22.162 94.385 1.00 85.06  ? 1    DT  I "C5'" 1 
ATOM   7582  C  "C4'" . DT  I 5 74  ? -20.170 -23.580 94.125 1.00 85.13  ? 1    DT  I "C4'" 1 
ATOM   7583  O  "O4'" . DT  I 5 74  ? -20.387 -23.887 92.729 1.00 84.88  ? 1    DT  I "O4'" 1 
ATOM   7584  C  "C3'" . DT  I 5 74  ? -18.687 -23.810 94.391 1.00 85.60  ? 1    DT  I "C3'" 1 
ATOM   7585  O  "O3'" . DT  I 5 74  ? -18.562 -24.903 95.282 1.00 87.06  ? 1    DT  I "O3'" 1 
ATOM   7586  C  "C2'" . DT  I 5 74  ? -18.069 -24.082 93.017 1.00 84.89  ? 1    DT  I "C2'" 1 
ATOM   7587  C  "C1'" . DT  I 5 74  ? -19.277 -24.618 92.258 1.00 84.15  ? 1    DT  I "C1'" 1 
ATOM   7588  N  N1    . DT  I 5 74  ? -19.227 -24.530 90.765 1.00 82.50  ? 1    DT  I N1    1 
ATOM   7589  C  C2    . DT  I 5 74  ? -19.555 -25.651 90.028 1.00 81.65  ? 1    DT  I C2    1 
ATOM   7590  O  O2    . DT  I 5 74  ? -19.879 -26.716 90.525 1.00 81.39  ? 1    DT  I O2    1 
ATOM   7591  N  N3    . DT  I 5 74  ? -19.484 -25.482 88.669 1.00 81.31  ? 1    DT  I N3    1 
ATOM   7592  C  C4    . DT  I 5 74  ? -19.127 -24.330 87.987 1.00 81.60  ? 1    DT  I C4    1 
ATOM   7593  O  O4    . DT  I 5 74  ? -19.098 -24.295 86.758 1.00 81.52  ? 1    DT  I O4    1 
ATOM   7594  C  C5    . DT  I 5 74  ? -18.797 -23.190 88.820 1.00 81.78  ? 1    DT  I C5    1 
ATOM   7595  C  C7    . DT  I 5 74  ? -18.388 -21.876 88.214 1.00 81.44  ? 1    DT  I C7    1 
ATOM   7596  C  C6    . DT  I 5 74  ? -18.866 -23.345 90.151 1.00 81.88  ? 1    DT  I C6    1 
ATOM   7597  P  P     . DC  I 5 75  ? -17.167 -25.220 95.998 1.00 88.29  ? 2    DC  I P     1 
ATOM   7598  O  OP1   . DC  I 5 75  ? -17.458 -25.760 97.347 1.00 87.69  ? 2    DC  I OP1   1 
ATOM   7599  O  OP2   . DC  I 5 75  ? -16.272 -24.045 95.841 1.00 87.89  ? 2    DC  I OP2   1 
ATOM   7600  O  "O5'" . DC  I 5 75  ? -16.618 -26.407 95.077 1.00 89.27  ? 2    DC  I "O5'" 1 
ATOM   7601  C  "C5'" . DC  I 5 75  ? -17.407 -27.580 94.875 1.00 90.56  ? 2    DC  I "C5'" 1 
ATOM   7602  C  "C4'" . DC  I 5 75  ? -16.761 -28.464 93.831 1.00 91.40  ? 2    DC  I "C4'" 1 
ATOM   7603  O  "O4'" . DC  I 5 75  ? -16.963 -27.903 92.513 1.00 91.58  ? 2    DC  I "O4'" 1 
ATOM   7604  C  "C3'" . DC  I 5 75  ? -15.254 -28.592 93.983 1.00 91.96  ? 2    DC  I "C3'" 1 
ATOM   7605  O  "O3'" . DC  I 5 75  ? -14.931 -29.949 94.011 1.00 92.93  ? 2    DC  I "O3'" 1 
ATOM   7606  C  "C2'" . DC  I 5 75  ? -14.660 -27.903 92.757 1.00 91.73  ? 2    DC  I "C2'" 1 
ATOM   7607  C  "C1'" . DC  I 5 75  ? -15.788 -28.121 91.760 1.00 91.33  ? 2    DC  I "C1'" 1 
ATOM   7608  N  N1    . DC  I 5 75  ? -15.810 -27.216 90.569 1.00 91.11  ? 2    DC  I N1    1 
ATOM   7609  C  C2    . DC  I 5 75  ? -16.038 -27.760 89.290 1.00 90.72  ? 2    DC  I C2    1 
ATOM   7610  O  O2    . DC  I 5 75  ? -16.201 -28.982 89.157 1.00 90.37  ? 2    DC  I O2    1 
ATOM   7611  N  N3    . DC  I 5 75  ? -16.065 -26.921 88.222 1.00 90.46  ? 2    DC  I N3    1 
ATOM   7612  C  C4    . DC  I 5 75  ? -15.884 -25.606 88.392 1.00 90.58  ? 2    DC  I C4    1 
ATOM   7613  N  N4    . DC  I 5 75  ? -15.920 -24.822 87.309 1.00 90.60  ? 2    DC  I N4    1 
ATOM   7614  C  C5    . DC  I 5 75  ? -15.656 -25.034 89.681 1.00 90.53  ? 2    DC  I C5    1 
ATOM   7615  C  C6    . DC  I 5 75  ? -15.631 -25.866 90.730 1.00 90.79  ? 2    DC  I C6    1 
ATOM   7616  P  P     . DA  I 5 76  ? -13.917 -30.441 95.136 1.00 94.05  ? 3    DA  I P     1 
ATOM   7617  O  OP1   . DA  I 5 76  ? -14.689 -30.546 96.394 1.00 94.29  ? 3    DA  I OP1   1 
ATOM   7618  O  OP2   . DA  I 5 76  ? -12.705 -29.580 95.063 1.00 93.90  ? 3    DA  I OP2   1 
ATOM   7619  O  "O5'" . DA  I 5 76  ? -13.552 -31.923 94.648 1.00 94.40  ? 3    DA  I "O5'" 1 
ATOM   7620  C  "C5'" . DA  I 5 76  ? -14.588 -32.833 94.245 1.00 94.83  ? 3    DA  I "C5'" 1 
ATOM   7621  C  "C4'" . DA  I 5 76  ? -14.235 -33.537 92.938 1.00 95.07  ? 3    DA  I "C4'" 1 
ATOM   7622  O  "O4'" . DA  I 5 76  ? -14.260 -32.605 91.823 1.00 95.41  ? 3    DA  I "O4'" 1 
ATOM   7623  C  "C3'" . DA  I 5 76  ? -12.861 -34.206 92.894 1.00 95.13  ? 3    DA  I "C3'" 1 
ATOM   7624  O  "O3'" . DA  I 5 76  ? -13.051 -35.509 92.341 1.00 94.75  ? 3    DA  I "O3'" 1 
ATOM   7625  C  "C2'" . DA  I 5 76  ? -12.007 -33.272 92.027 1.00 94.84  ? 3    DA  I "C2'" 1 
ATOM   7626  C  "C1'" . DA  I 5 76  ? -13.060 -32.708 91.080 1.00 95.19  ? 3    DA  I "C1'" 1 
ATOM   7627  N  N9    . DA  I 5 76  ? -12.787 -31.384 90.537 1.00 95.24  ? 3    DA  I N9    1 
ATOM   7628  C  C8    . DA  I 5 76  ? -12.274 -30.295 91.185 1.00 95.45  ? 3    DA  I C8    1 
ATOM   7629  N  N7    . DA  I 5 76  ? -12.155 -29.231 90.423 1.00 95.45  ? 3    DA  I N7    1 
ATOM   7630  C  C5    . DA  I 5 76  ? -12.628 -29.647 89.188 1.00 95.62  ? 3    DA  I C5    1 
ATOM   7631  C  C6    . DA  I 5 76  ? -12.772 -28.995 87.940 1.00 95.52  ? 3    DA  I C6    1 
ATOM   7632  N  N6    . DA  I 5 76  ? -12.439 -27.720 87.718 1.00 95.34  ? 3    DA  I N6    1 
ATOM   7633  N  N1    . DA  I 5 76  ? -13.282 -29.705 86.911 1.00 95.57  ? 3    DA  I N1    1 
ATOM   7634  C  C2    . DA  I 5 76  ? -13.624 -30.989 87.115 1.00 96.05  ? 3    DA  I C2    1 
ATOM   7635  N  N3    . DA  I 5 76  ? -13.536 -31.710 88.235 1.00 96.12  ? 3    DA  I N3    1 
ATOM   7636  C  C4    . DA  I 5 76  ? -13.025 -30.975 89.245 1.00 95.77  ? 3    DA  I C4    1 
ATOM   7637  P  P     . DG  I 5 77  ? -11.856 -36.559 92.130 1.00 94.66  ? 4    DG  I P     1 
ATOM   7638  O  OP1   . DG  I 5 77  ? -12.359 -37.905 92.527 1.00 94.96  ? 4    DG  I OP1   1 
ATOM   7639  O  OP2   . DG  I 5 77  ? -10.586 -36.006 92.677 1.00 94.09  ? 4    DG  I OP2   1 
ATOM   7640  O  "O5'" . DG  I 5 77  ? -11.684 -36.570 90.542 1.00 92.20  ? 4    DG  I "O5'" 1 
ATOM   7641  C  "C5'" . DG  I 5 77  ? -12.779 -36.714 89.643 1.00 88.12  ? 4    DG  I "C5'" 1 
ATOM   7642  C  "C4'" . DG  I 5 77  ? -12.236 -36.424 88.260 1.00 84.96  ? 4    DG  I "C4'" 1 
ATOM   7643  O  "O4'" . DG  I 5 77  ? -11.914 -35.013 88.132 1.00 83.79  ? 4    DG  I "O4'" 1 
ATOM   7644  C  "C3'" . DG  I 5 77  ? -10.943 -37.162 87.952 1.00 83.02  ? 4    DG  I "C3'" 1 
ATOM   7645  O  "O3'" . DG  I 5 77  ? -11.051 -37.572 86.631 1.00 81.91  ? 4    DG  I "O3'" 1 
ATOM   7646  C  "C2'" . DG  I 5 77  ? -9.845  -36.111 88.130 1.00 82.65  ? 4    DG  I "C2'" 1 
ATOM   7647  C  "C1'" . DG  I 5 77  ? -10.587 -34.874 87.653 1.00 82.75  ? 4    DG  I "C1'" 1 
ATOM   7648  N  N9    . DG  I 5 77  ? -10.055 -33.582 88.088 1.00 82.02  ? 4    DG  I N9    1 
ATOM   7649  C  C8    . DG  I 5 77  ? -9.445  -33.255 89.275 1.00 81.90  ? 4    DG  I C8    1 
ATOM   7650  N  N7    . DG  I 5 77  ? -9.094  -31.999 89.348 1.00 81.81  ? 4    DG  I N7    1 
ATOM   7651  C  C5    . DG  I 5 77  ? -9.495  -31.454 88.133 1.00 81.61  ? 4    DG  I C5    1 
ATOM   7652  C  C6    . DG  I 5 77  ? -9.383  -30.130 87.624 1.00 81.40  ? 4    DG  I C6    1 
ATOM   7653  O  O6    . DG  I 5 77  ? -8.891  -29.130 88.161 1.00 81.31  ? 4    DG  I O6    1 
ATOM   7654  N  N1    . DG  I 5 77  ? -9.921  -30.009 86.346 1.00 81.10  ? 4    DG  I N1    1 
ATOM   7655  C  C2    . DG  I 5 77  ? -10.498 -31.042 85.644 1.00 80.97  ? 4    DG  I C2    1 
ATOM   7656  N  N2    . DG  I 5 77  ? -10.966 -30.738 84.425 1.00 80.85  ? 4    DG  I N2    1 
ATOM   7657  N  N3    . DG  I 5 77  ? -10.614 -32.281 86.106 1.00 80.66  ? 4    DG  I N3    1 
ATOM   7658  C  C4    . DG  I 5 77  ? -10.091 -32.418 87.351 1.00 81.51  ? 4    DG  I C4    1 
ATOM   7659  P  P     . DC  I 5 78  ? -10.214 -38.810 86.095 1.00 81.03  ? 5    DC  I P     1 
ATOM   7660  O  OP1   . DC  I 5 78  ? -11.206 -39.875 85.839 1.00 81.50  ? 5    DC  I OP1   1 
ATOM   7661  O  OP2   . DC  I 5 78  ? -9.050  -39.041 86.980 1.00 80.97  ? 5    DC  I OP2   1 
ATOM   7662  O  "O5'" . DC  I 5 78  ? -9.649  -38.298 84.687 1.00 80.25  ? 5    DC  I "O5'" 1 
ATOM   7663  C  "C5'" . DC  I 5 78  ? -10.275 -37.227 83.965 1.00 78.83  ? 5    DC  I "C5'" 1 
ATOM   7664  C  "C4'" . DC  I 5 78  ? -9.247  -36.320 83.295 1.00 78.00  ? 5    DC  I "C4'" 1 
ATOM   7665  O  "O4'" . DC  I 5 78  ? -8.895  -35.227 84.186 1.00 77.95  ? 5    DC  I "O4'" 1 
ATOM   7666  C  "C3'" . DC  I 5 78  ? -7.915  -36.956 82.886 1.00 77.01  ? 5    DC  I "C3'" 1 
ATOM   7667  O  "O3'" . DC  I 5 78  ? -7.564  -36.510 81.592 1.00 75.68  ? 5    DC  I "O3'" 1 
ATOM   7668  C  "C2'" . DC  I 5 78  ? -6.914  -36.400 83.894 1.00 77.25  ? 5    DC  I "C2'" 1 
ATOM   7669  C  "C1'" . DC  I 5 78  ? -7.500  -35.011 84.089 1.00 77.82  ? 5    DC  I "C1'" 1 
ATOM   7670  N  N1    . DC  I 5 78  ? -7.074  -34.263 85.309 1.00 78.33  ? 5    DC  I N1    1 
ATOM   7671  C  C2    . DC  I 5 78  ? -7.202  -32.864 85.319 1.00 78.16  ? 5    DC  I C2    1 
ATOM   7672  O  O2    . DC  I 5 78  ? -7.654  -32.280 84.321 1.00 78.27  ? 5    DC  I O2    1 
ATOM   7673  N  N3    . DC  I 5 78  ? -6.823  -32.186 86.433 1.00 78.06  ? 5    DC  I N3    1 
ATOM   7674  C  C4    . DC  I 5 78  ? -6.342  -32.843 87.492 1.00 78.22  ? 5    DC  I C4    1 
ATOM   7675  N  N4    . DC  I 5 78  ? -5.986  -32.125 88.557 1.00 78.17  ? 5    DC  I N4    1 
ATOM   7676  C  C5    . DC  I 5 78  ? -6.202  -34.266 87.505 1.00 78.32  ? 5    DC  I C5    1 
ATOM   7677  C  C6    . DC  I 5 78  ? -6.580  -34.927 86.404 1.00 78.44  ? 5    DC  I C6    1 
ATOM   7678  P  P     . DT  I 5 79  ? -7.527  -37.489 80.329 1.00 74.52  ? 6    DT  I P     1 
ATOM   7679  O  OP1   . DT  I 5 79  ? -8.512  -38.582 80.542 1.00 74.77  ? 6    DT  I OP1   1 
ATOM   7680  O  OP2   . DT  I 5 79  ? -6.097  -37.785 80.057 1.00 72.99  ? 6    DT  I OP2   1 
ATOM   7681  O  "O5'" . DT  I 5 79  ? -8.118  -36.561 79.158 1.00 72.20  ? 6    DT  I "O5'" 1 
ATOM   7682  C  "C5'" . DT  I 5 79  ? -8.856  -35.364 79.420 1.00 68.01  ? 6    DT  I "C5'" 1 
ATOM   7683  C  "C4'" . DT  I 5 79  ? -8.132  -34.138 78.870 1.00 65.46  ? 6    DT  I "C4'" 1 
ATOM   7684  O  "O4'" . DT  I 5 79  ? -7.439  -33.438 79.938 1.00 65.55  ? 6    DT  I "O4'" 1 
ATOM   7685  C  "C3'" . DT  I 5 79  ? -7.055  -34.358 77.812 1.00 63.22  ? 6    DT  I "C3'" 1 
ATOM   7686  O  "O3'" . DT  I 5 79  ? -6.911  -33.163 77.088 1.00 59.91  ? 6    DT  I "O3'" 1 
ATOM   7687  C  "C2'" . DT  I 5 79  ? -5.812  -34.498 78.674 1.00 64.43  ? 6    DT  I "C2'" 1 
ATOM   7688  C  "C1'" . DT  I 5 79  ? -6.070  -33.325 79.609 1.00 65.69  ? 6    DT  I "C1'" 1 
ATOM   7689  N  N1    . DT  I 5 79  ? -5.260  -33.265 80.866 1.00 67.36  ? 6    DT  I N1    1 
ATOM   7690  C  C2    . DT  I 5 79  ? -5.074  -32.041 81.479 1.00 68.00  ? 6    DT  I C2    1 
ATOM   7691  O  O2    . DT  I 5 79  ? -5.529  -30.988 81.064 1.00 66.75  ? 6    DT  I O2    1 
ATOM   7692  N  N3    . DT  I 5 79  ? -4.314  -32.086 82.618 1.00 68.80  ? 6    DT  I N3    1 
ATOM   7693  C  C4    . DT  I 5 79  ? -3.740  -33.196 83.201 1.00 70.19  ? 6    DT  I C4    1 
ATOM   7694  O  O4    . DT  I 5 79  ? -3.084  -33.095 84.237 1.00 71.87  ? 6    DT  I O4    1 
ATOM   7695  C  C5    . DT  I 5 79  ? -3.974  -34.450 82.509 1.00 69.89  ? 6    DT  I C5    1 
ATOM   7696  C  C7    . DT  I 5 79  ? -3.420  -35.751 83.019 1.00 69.66  ? 6    DT  I C7    1 
ATOM   7697  C  C6    . DT  I 5 79  ? -4.712  -34.418 81.393 1.00 68.57  ? 6    DT  I C6    1 
ATOM   7698  P  P     . DG  I 5 80  ? -7.091  -32.973 75.515 1.00 55.33  ? 7    DG  I P     1 
ATOM   7699  O  OP1   . DG  I 5 80  ? -8.499  -32.603 75.338 1.00 54.27  ? 7    DG  I OP1   1 
ATOM   7700  O  OP2   . DG  I 5 80  ? -6.465  -34.061 74.728 1.00 55.99  ? 7    DG  I OP2   1 
ATOM   7701  O  "O5'" . DG  I 5 80  ? -6.158  -31.696 75.289 1.00 54.32  ? 7    DG  I "O5'" 1 
ATOM   7702  C  "C5'" . DG  I 5 80  ? -6.314  -30.514 76.083 1.00 52.37  ? 7    DG  I "C5'" 1 
ATOM   7703  C  "C4'" . DG  I 5 80  ? -5.002  -29.793 76.379 1.00 49.99  ? 7    DG  I "C4'" 1 
ATOM   7704  O  "O4'" . DG  I 5 80  ? -4.389  -30.399 77.532 1.00 50.52  ? 7    DG  I "O4'" 1 
ATOM   7705  C  "C3'" . DG  I 5 80  ? -3.931  -29.757 75.290 1.00 49.17  ? 7    DG  I "C3'" 1 
ATOM   7706  O  "O3'" . DG  I 5 80  ? -3.481  -28.408 75.192 1.00 46.25  ? 7    DG  I "O3'" 1 
ATOM   7707  C  "C2'" . DG  I 5 80  ? -2.852  -30.713 75.787 1.00 49.80  ? 7    DG  I "C2'" 1 
ATOM   7708  C  "C1'" . DG  I 5 80  ? -3.019  -30.574 77.297 1.00 52.81  ? 7    DG  I "C1'" 1 
ATOM   7709  N  N9    . DG  I 5 80  ? -2.624  -31.714 78.130 1.00 54.63  ? 7    DG  I N9    1 
ATOM   7710  C  C8    . DG  I 5 80  ? -2.763  -33.059 77.895 1.00 55.55  ? 7    DG  I C8    1 
ATOM   7711  N  N7    . DG  I 5 80  ? -2.306  -33.801 78.866 1.00 57.81  ? 7    DG  I N7    1 
ATOM   7712  C  C5    . DG  I 5 80  ? -1.843  -32.874 79.801 1.00 58.21  ? 7    DG  I C5    1 
ATOM   7713  C  C6    . DG  I 5 80  ? -1.236  -33.055 81.072 1.00 58.90  ? 7    DG  I C6    1 
ATOM   7714  O  O6    . DG  I 5 80  ? -0.976  -34.128 81.642 1.00 60.30  ? 7    DG  I O6    1 
ATOM   7715  N  N1    . DG  I 5 80  ? -0.921  -31.829 81.680 1.00 58.07  ? 7    DG  I N1    1 
ATOM   7716  C  C2    . DG  I 5 80  ? -1.175  -30.589 81.125 1.00 57.40  ? 7    DG  I C2    1 
ATOM   7717  N  N2    . DG  I 5 80  ? -0.833  -29.497 81.820 1.00 57.27  ? 7    DG  I N2    1 
ATOM   7718  N  N3    . DG  I 5 80  ? -1.741  -30.415 79.948 1.00 56.30  ? 7    DG  I N3    1 
ATOM   7719  C  C4    . DG  I 5 80  ? -2.043  -31.590 79.354 1.00 56.31  ? 7    DG  I C4    1 
ATOM   7720  P  P     . DA  I 5 81  ? -2.411  -27.847 74.150 1.00 42.72  ? 8    DA  I P     1 
ATOM   7721  O  OP1   . DA  I 5 81  ? -3.217  -27.069 73.207 1.00 43.99  ? 8    DA  I OP1   1 
ATOM   7722  O  OP2   . DA  I 5 81  ? -1.452  -28.867 73.667 1.00 45.48  ? 8    DA  I OP2   1 
ATOM   7723  O  "O5'" . DA  I 5 81  ? -1.537  -26.860 75.040 1.00 44.65  ? 8    DA  I "O5'" 1 
ATOM   7724  C  "C5'" . DA  I 5 81  ? -2.132  -26.101 76.123 1.00 45.37  ? 8    DA  I "C5'" 1 
ATOM   7725  C  "C4'" . DA  I 5 81  ? -1.018  -25.442 76.923 1.00 46.16  ? 8    DA  I "C4'" 1 
ATOM   7726  O  "O4'" . DA  I 5 81  ? -0.505  -26.366 77.917 1.00 46.75  ? 8    DA  I "O4'" 1 
ATOM   7727  C  "C3'" . DA  I 5 81  ? 0.187   -25.013 76.090 1.00 47.05  ? 8    DA  I "C3'" 1 
ATOM   7728  O  "O3'" . DA  I 5 81  ? 0.655   -23.778 76.614 1.00 48.41  ? 8    DA  I "O3'" 1 
ATOM   7729  C  "C2'" . DA  I 5 81  ? 1.193   -26.154 76.250 1.00 46.45  ? 8    DA  I "C2'" 1 
ATOM   7730  C  "C1'" . DA  I 5 81  ? 0.816   -26.761 77.597 1.00 48.26  ? 8    DA  I "C1'" 1 
ATOM   7731  N  N9    . DA  I 5 81  ? 0.877   -28.221 77.621 1.00 49.36  ? 8    DA  I N9    1 
ATOM   7732  C  C8    . DA  I 5 81  ? 0.502   -29.074 76.629 1.00 49.77  ? 8    DA  I C8    1 
ATOM   7733  N  N7    . DA  I 5 81  ? 0.677   -30.334 76.907 1.00 50.22  ? 8    DA  I N7    1 
ATOM   7734  C  C5    . DA  I 5 81  ? 1.204   -30.305 78.181 1.00 51.08  ? 8    DA  I C5    1 
ATOM   7735  C  C6    . DA  I 5 81  ? 1.611   -31.334 79.053 1.00 49.97  ? 8    DA  I C6    1 
ATOM   7736  N  N6    . DA  I 5 81  ? 1.534   -32.624 78.756 1.00 50.26  ? 8    DA  I N6    1 
ATOM   7737  N  N1    . DA  I 5 81  ? 2.096   -30.968 80.251 1.00 50.96  ? 8    DA  I N1    1 
ATOM   7738  C  C2    . DA  I 5 81  ? 2.177   -29.661 80.579 1.00 50.29  ? 8    DA  I C2    1 
ATOM   7739  N  N3    . DA  I 5 81  ? 1.827   -28.598 79.848 1.00 50.22  ? 8    DA  I N3    1 
ATOM   7740  C  C4    . DA  I 5 81  ? 1.342   -29.001 78.645 1.00 50.86  ? 8    DA  I C4    1 
ATOM   7741  P  P     . DA  I 5 82  ? 1.905   -22.968 76.032 1.00 48.91  ? 9    DA  I P     1 
ATOM   7742  O  OP1   . DA  I 5 82  ? 1.527   -21.579 76.332 1.00 46.65  ? 9    DA  I OP1   1 
ATOM   7743  O  OP2   . DA  I 5 82  ? 2.127   -23.442 74.648 1.00 48.27  ? 9    DA  I OP2   1 
ATOM   7744  O  "O5'" . DA  I 5 82  ? 3.206   -23.349 76.911 1.00 49.54  ? 9    DA  I "O5'" 1 
ATOM   7745  C  "C5'" . DA  I 5 82  ? 3.220   -23.271 78.337 1.00 50.25  ? 9    DA  I "C5'" 1 
ATOM   7746  C  "C4'" . DA  I 5 82  ? 4.432   -23.997 78.902 1.00 52.26  ? 9    DA  I "C4'" 1 
ATOM   7747  O  "O4'" . DA  I 5 82  ? 4.209   -25.427 78.844 1.00 53.50  ? 9    DA  I "O4'" 1 
ATOM   7748  C  "C3'" . DA  I 5 82  ? 5.762   -23.728 78.199 1.00 52.41  ? 9    DA  I "C3'" 1 
ATOM   7749  O  "O3'" . DA  I 5 82  ? 6.643   -23.154 79.171 1.00 54.21  ? 9    DA  I "O3'" 1 
ATOM   7750  C  "C2'" . DA  I 5 82  ? 6.199   -25.096 77.673 1.00 52.49  ? 9    DA  I "C2'" 1 
ATOM   7751  C  "C1'" . DA  I 5 82  ? 5.425   -26.067 78.555 1.00 54.63  ? 9    DA  I "C1'" 1 
ATOM   7752  N  N9    . DA  I 5 82  ? 5.073   -27.378 78.004 1.00 57.39  ? 9    DA  I N9    1 
ATOM   7753  C  C8    . DA  I 5 82  ? 4.488   -27.656 76.800 1.00 58.48  ? 9    DA  I C8    1 
ATOM   7754  N  N7    . DA  I 5 82  ? 4.284   -28.938 76.593 1.00 59.65  ? 9    DA  I N7    1 
ATOM   7755  C  C5    . DA  I 5 82  ? 4.762   -29.547 77.739 1.00 59.95  ? 9    DA  I C5    1 
ATOM   7756  C  C6    . DA  I 5 82  ? 4.841   -30.895 78.149 1.00 60.63  ? 9    DA  I C6    1 
ATOM   7757  N  N6    . DA  I 5 82  ? 4.411   -31.913 77.408 1.00 61.33  ? 9    DA  I N6    1 
ATOM   7758  N  N1    . DA  I 5 82  ? 5.377   -31.166 79.358 1.00 60.52  ? 9    DA  I N1    1 
ATOM   7759  C  C2    . DA  I 5 82  ? 5.813   -30.147 80.107 1.00 59.97  ? 9    DA  I C2    1 
ATOM   7760  N  N3    . DA  I 5 82  ? 5.794   -28.842 79.828 1.00 59.70  ? 9    DA  I N3    1 
ATOM   7761  C  C4    . DA  I 5 82  ? 5.253   -28.600 78.620 1.00 59.18  ? 9    DA  I C4    1 
ATOM   7762  P  P     . DC  I 5 83  ? 8.100   -22.555 78.860 1.00 54.39  ? 10   DC  I P     1 
ATOM   7763  O  OP1   . DC  I 5 83  ? 8.318   -21.493 79.871 1.00 54.11  ? 10   DC  I OP1   1 
ATOM   7764  O  OP2   . DC  I 5 83  ? 8.166   -22.256 77.418 1.00 53.07  ? 10   DC  I OP2   1 
ATOM   7765  O  "O5'" . DC  I 5 83  ? 9.127   -23.763 79.106 1.00 56.78  ? 10   DC  I "O5'" 1 
ATOM   7766  C  "C5'" . DC  I 5 83  ? 9.130   -24.498 80.306 1.00 59.54  ? 10   DC  I "C5'" 1 
ATOM   7767  C  "C4'" . DC  I 5 83  ? 9.980   -25.726 80.080 1.00 63.25  ? 10   DC  I "C4'" 1 
ATOM   7768  O  "O4'" . DC  I 5 83  ? 9.167   -26.718 79.416 1.00 63.32  ? 10   DC  I "O4'" 1 
ATOM   7769  C  "C3'" . DC  I 5 83  ? 11.205  -25.526 79.190 1.00 64.76  ? 10   DC  I "C3'" 1 
ATOM   7770  O  "O3'" . DC  I 5 83  ? 12.323  -26.106 79.832 1.00 67.71  ? 10   DC  I "O3'" 1 
ATOM   7771  C  "C2'" . DC  I 5 83  ? 10.821  -26.265 77.911 1.00 64.32  ? 10   DC  I "C2'" 1 
ATOM   7772  C  "C1'" . DC  I 5 83  ? 10.025  -27.394 78.541 1.00 64.11  ? 10   DC  I "C1'" 1 
ATOM   7773  N  N1    . DC  I 5 83  ? 9.167   -28.199 77.652 1.00 64.89  ? 10   DC  I N1    1 
ATOM   7774  C  C2    . DC  I 5 83  ? 8.887   -29.523 78.020 1.00 64.92  ? 10   DC  I C2    1 
ATOM   7775  O  O2    . DC  I 5 83  ? 9.366   -29.985 79.056 1.00 65.18  ? 10   DC  I O2    1 
ATOM   7776  N  N3    . DC  I 5 83  ? 8.098   -30.269 77.220 1.00 64.96  ? 10   DC  I N3    1 
ATOM   7777  C  C4    . DC  I 5 83  ? 7.611   -29.726 76.104 1.00 64.72  ? 10   DC  I C4    1 
ATOM   7778  N  N4    . DC  I 5 83  ? 6.844   -30.499 75.343 1.00 64.19  ? 10   DC  I N4    1 
ATOM   7779  C  C5    . DC  I 5 83  ? 7.874   -28.379 75.713 1.00 64.08  ? 10   DC  I C5    1 
ATOM   7780  C  C6    . DC  I 5 83  ? 8.650   -27.652 76.513 1.00 64.16  ? 10   DC  I C6    1 
ATOM   7781  P  P     . DA  I 5 84  ? 13.805  -25.671 79.449 1.00 70.73  ? 11   DA  I P     1 
ATOM   7782  O  OP1   . DA  I 5 84  ? 13.978  -24.320 80.019 1.00 70.15  ? 11   DA  I OP1   1 
ATOM   7783  O  OP2   . DA  I 5 84  ? 14.028  -25.903 78.007 1.00 70.90  ? 11   DA  I OP2   1 
ATOM   7784  O  "O5'" . DA  I 5 84  ? 14.707  -26.734 80.236 1.00 74.18  ? 11   DA  I "O5'" 1 
ATOM   7785  C  "C5'" . DA  I 5 84  ? 14.115  -27.669 81.135 1.00 79.32  ? 11   DA  I "C5'" 1 
ATOM   7786  C  "C4'" . DA  I 5 84  ? 14.537  -29.089 80.801 1.00 83.25  ? 11   DA  I "C4'" 1 
ATOM   7787  O  "O4'" . DA  I 5 84  ? 13.519  -29.716 79.982 1.00 84.11  ? 11   DA  I "O4'" 1 
ATOM   7788  C  "C3'" . DA  I 5 84  ? 15.860  -29.232 80.048 1.00 85.83  ? 11   DA  I "C3'" 1 
ATOM   7789  O  "O3'" . DA  I 5 84  ? 16.624  -30.283 80.636 1.00 89.41  ? 11   DA  I "O3'" 1 
ATOM   7790  C  "C2'" . DA  I 5 84  ? 15.434  -29.570 78.622 1.00 85.77  ? 11   DA  I "C2'" 1 
ATOM   7791  C  "C1'" . DA  I 5 84  ? 14.100  -30.288 78.827 1.00 85.53  ? 11   DA  I "C1'" 1 
ATOM   7792  N  N9    . DA  I 5 84  ? 13.181  -30.128 77.692 1.00 86.28  ? 11   DA  I N9    1 
ATOM   7793  C  C8    . DA  I 5 84  ? 12.866  -28.961 77.044 1.00 86.44  ? 11   DA  I C8    1 
ATOM   7794  N  N7    . DA  I 5 84  ? 12.015  -29.098 76.056 1.00 86.24  ? 11   DA  I N7    1 
ATOM   7795  C  C5    . DA  I 5 84  ? 11.751  -30.457 76.051 1.00 86.54  ? 11   DA  I C5    1 
ATOM   7796  C  C6    . DA  I 5 84  ? 10.923  -31.258 75.233 1.00 86.40  ? 11   DA  I C6    1 
ATOM   7797  N  N6    . DA  I 5 84  ? 10.188  -30.761 74.235 1.00 85.89  ? 11   DA  I N6    1 
ATOM   7798  N  N1    . DA  I 5 84  ? 10.881  -32.589 75.486 1.00 86.29  ? 11   DA  I N1    1 
ATOM   7799  C  C2    . DA  I 5 84  ? 11.622  -33.087 76.490 1.00 86.16  ? 11   DA  I C2    1 
ATOM   7800  N  N3    . DA  I 5 84  ? 12.440  -32.435 77.322 1.00 86.12  ? 11   DA  I N3    1 
ATOM   7801  C  C4    . DA  I 5 84  ? 12.462  -31.113 77.050 1.00 86.33  ? 11   DA  I C4    1 
ATOM   7802  P  P     . DT  I 5 85  ? 18.173  -30.504 80.292 1.00 91.81  ? 12   DT  I P     1 
ATOM   7803  O  OP1   . DT  I 5 85  ? 18.841  -30.887 81.560 1.00 92.34  ? 12   DT  I OP1   1 
ATOM   7804  O  OP2   . DT  I 5 85  ? 18.687  -29.355 79.506 1.00 91.69  ? 12   DT  I OP2   1 
ATOM   7805  O  "O5'" . DT  I 5 85  ? 18.105  -31.778 79.333 1.00 92.73  ? 12   DT  I "O5'" 1 
ATOM   7806  C  "C5'" . DT  I 5 85  ? 17.465  -32.973 79.770 1.00 95.05  ? 12   DT  I "C5'" 1 
ATOM   7807  C  "C4'" . DT  I 5 85  ? 17.316  -33.917 78.595 1.00 96.85  ? 12   DT  I "C4'" 1 
ATOM   7808  O  "O4'" . DT  I 5 85  ? 16.195  -33.477 77.783 1.00 97.50  ? 12   DT  I "O4'" 1 
ATOM   7809  C  "C3'" . DT  I 5 85  ? 18.540  -33.963 77.678 1.00 97.75  ? 12   DT  I "C3'" 1 
ATOM   7810  O  "O3'" . DT  I 5 85  ? 18.948  -35.304 77.428 1.00 98.66  ? 12   DT  I "O3'" 1 
ATOM   7811  C  "C2'" . DT  I 5 85  ? 18.064  -33.265 76.404 1.00 97.89  ? 12   DT  I "C2'" 1 
ATOM   7812  C  "C1'" . DT  I 5 85  ? 16.568  -33.576 76.425 1.00 97.88  ? 12   DT  I "C1'" 1 
ATOM   7813  N  N1    . DT  I 5 85  ? 15.722  -32.677 75.560 1.00 98.16  ? 12   DT  I N1    1 
ATOM   7814  C  C2    . DT  I 5 85  ? 14.692  -33.228 74.814 1.00 98.23  ? 12   DT  I C2    1 
ATOM   7815  O  O2    . DT  I 5 85  ? 14.407  -34.414 74.816 1.00 98.26  ? 12   DT  I O2    1 
ATOM   7816  N  N3    . DT  I 5 85  ? 13.991  -32.325 74.051 1.00 98.38  ? 12   DT  I N3    1 
ATOM   7817  C  C4    . DT  I 5 85  ? 14.206  -30.959 73.951 1.00 98.38  ? 12   DT  I C4    1 
ATOM   7818  O  O4    . DT  I 5 85  ? 13.508  -30.251 73.231 1.00 98.26  ? 12   DT  I O4    1 
ATOM   7819  C  C5    . DT  I 5 85  ? 15.297  -30.446 74.754 1.00 98.26  ? 12   DT  I C5    1 
ATOM   7820  C  C7    . DT  I 5 85  ? 15.644  -28.984 74.746 1.00 98.27  ? 12   DT  I C7    1 
ATOM   7821  C  C6    . DT  I 5 85  ? 15.991  -31.317 75.503 1.00 98.16  ? 12   DT  I C6    1 
ATOM   7822  P  P     . DG  I 5 86  ? 20.452  -35.635 76.977 1.00 99.32  ? 13   DG  I P     1 
ATOM   7823  O  OP1   . DG  I 5 86  ? 21.193  -35.929 78.226 1.00 99.70  ? 13   DG  I OP1   1 
ATOM   7824  O  OP2   . DG  I 5 86  ? 20.962  -34.571 76.070 1.00 99.06  ? 13   DG  I OP2   1 
ATOM   7825  O  "O5'" . DG  I 5 86  ? 20.300  -36.988 76.122 1.00 99.11  ? 13   DG  I "O5'" 1 
ATOM   7826  C  "C5'" . DG  I 5 86  ? 19.031  -37.616 75.882 1.00 98.73  ? 13   DG  I "C5'" 1 
ATOM   7827  C  "C4'" . DG  I 5 86  ? 18.866  -38.115 74.448 1.00 98.58  ? 13   DG  I "C4'" 1 
ATOM   7828  O  "O4'" . DG  I 5 86  ? 17.973  -37.236 73.712 1.00 99.40  ? 13   DG  I "O4'" 1 
ATOM   7829  C  "C3'" . DG  I 5 86  ? 20.119  -38.260 73.583 1.00 97.88  ? 13   DG  I "C3'" 1 
ATOM   7830  O  "O3'" . DG  I 5 86  ? 20.003  -39.481 72.823 1.00 95.76  ? 13   DG  I "O3'" 1 
ATOM   7831  C  "C2'" . DG  I 5 86  ? 20.117  -36.972 72.748 1.00 98.68  ? 13   DG  I "C2'" 1 
ATOM   7832  C  "C1'" . DG  I 5 86  ? 18.623  -36.700 72.571 1.00 99.89  ? 13   DG  I "C1'" 1 
ATOM   7833  N  N9    . DG  I 5 86  ? 18.233  -35.290 72.476 1.00 101.06 ? 13   DG  I N9    1 
ATOM   7834  C  C8    . DG  I 5 86  ? 18.751  -34.223 73.176 1.00 101.67 ? 13   DG  I C8    1 
ATOM   7835  N  N7    . DG  I 5 86  ? 18.193  -33.075 72.891 1.00 101.62 ? 13   DG  I N7    1 
ATOM   7836  C  C5    . DG  I 5 86  ? 17.236  -33.395 71.939 1.00 101.50 ? 13   DG  I C5    1 
ATOM   7837  C  C6    . DG  I 5 86  ? 16.319  -32.559 71.251 1.00 101.55 ? 13   DG  I C6    1 
ATOM   7838  O  O6    . DG  I 5 86  ? 16.169  -31.334 71.361 1.00 101.71 ? 13   DG  I O6    1 
ATOM   7839  N  N1    . DG  I 5 86  ? 15.522  -33.281 70.362 1.00 101.43 ? 13   DG  I N1    1 
ATOM   7840  C  C2    . DG  I 5 86  ? 15.607  -34.643 70.164 1.00 101.39 ? 13   DG  I C2    1 
ATOM   7841  N  N2    . DG  I 5 86  ? 14.762  -35.171 69.271 1.00 101.31 ? 13   DG  I N2    1 
ATOM   7842  N  N3    . DG  I 5 86  ? 16.458  -35.439 70.803 1.00 101.59 ? 13   DG  I N3    1 
ATOM   7843  C  C4    . DG  I 5 86  ? 17.243  -34.753 71.674 1.00 101.52 ? 13   DG  I C4    1 
ATOM   7844  P  P     . DC  I 5 87  ? 20.917  -39.846 71.552 1.00 94.44  ? 14   DC  I P     1 
ATOM   7845  O  OP1   . DC  I 5 87  ? 20.899  -41.319 71.415 1.00 94.09  ? 14   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I 5 87  ? 22.203  -39.113 71.640 1.00 94.40  ? 14   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I 5 87  ? 20.103  -39.196 70.335 1.00 92.89  ? 14   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I 5 87  ? 19.143  -39.944 69.591 1.00 90.49  ? 14   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I 5 87  ? 18.868  -39.267 68.260 1.00 88.31  ? 14   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I 5 87  ? 18.415  -37.921 68.532 1.00 87.22  ? 14   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I 5 87  ? 20.065  -39.162 67.303 1.00 86.89  ? 14   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I 5 87  ? 19.713  -39.491 65.960 1.00 84.58  ? 14   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I 5 87  ? 20.445  -37.691 67.378 1.00 87.18  ? 14   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I 5 87  ? 19.072  -37.073 67.623 1.00 87.28  ? 14   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I 5 87  ? 19.116  -35.709 68.195 1.00 87.64  ? 14   DC  I N1    1 
ATOM   7856  C  C2    . DC  I 5 87  ? 18.381  -34.692 67.567 1.00 87.79  ? 14   DC  I C2    1 
ATOM   7857  O  O2    . DC  I 5 87  ? 17.710  -34.955 66.556 1.00 87.83  ? 14   DC  I O2    1 
ATOM   7858  N  N3    . DC  I 5 87  ? 18.432  -33.441 68.095 1.00 87.39  ? 14   DC  I N3    1 
ATOM   7859  C  C4    . DC  I 5 87  ? 19.168  -33.200 69.186 1.00 87.29  ? 14   DC  I C4    1 
ATOM   7860  N  N4    . DC  I 5 87  ? 19.182  -31.956 69.665 1.00 86.90  ? 14   DC  I N4    1 
ATOM   7861  C  C5    . DC  I 5 87  ? 19.924  -34.223 69.836 1.00 87.37  ? 14   DC  I C5    1 
ATOM   7862  C  C6    . DC  I 5 87  ? 19.865  -35.452 69.312 1.00 87.47  ? 14   DC  I C6    1 
ATOM   7863  P  P     . DC  I 5 88  ? 19.519  -41.006 65.498 1.00 83.45  ? 15   DC  I P     1 
ATOM   7864  O  OP1   . DC  I 5 88  ? 19.153  -41.792 66.703 1.00 83.20  ? 15   DC  I OP1   1 
ATOM   7865  O  OP2   . DC  I 5 88  ? 20.680  -41.396 64.665 1.00 82.92  ? 15   DC  I OP2   1 
ATOM   7866  O  "O5'" . DC  I 5 88  ? 18.233  -40.911 64.544 1.00 82.52  ? 15   DC  I "O5'" 1 
ATOM   7867  C  "C5'" . DC  I 5 88  ? 16.919  -40.671 65.089 1.00 79.66  ? 15   DC  I "C5'" 1 
ATOM   7868  C  "C4'" . DC  I 5 88  ? 16.043  -39.834 64.162 1.00 77.68  ? 15   DC  I "C4'" 1 
ATOM   7869  O  "O4'" . DC  I 5 88  ? 16.565  -38.483 64.121 1.00 77.30  ? 15   DC  I "O4'" 1 
ATOM   7870  C  "C3'" . DC  I 5 88  ? 15.917  -40.312 62.712 1.00 76.49  ? 15   DC  I "C3'" 1 
ATOM   7871  O  "O3'" . DC  I 5 88  ? 14.567  -40.169 62.249 1.00 74.79  ? 15   DC  I "O3'" 1 
ATOM   7872  C  "C2'" . DC  I 5 88  ? 16.877  -39.405 61.955 1.00 76.60  ? 15   DC  I "C2'" 1 
ATOM   7873  C  "C1'" . DC  I 5 88  ? 16.863  -38.128 62.790 1.00 77.75  ? 15   DC  I "C1'" 1 
ATOM   7874  N  N1    . DC  I 5 88  ? 18.149  -37.343 62.734 1.00 78.96  ? 15   DC  I N1    1 
ATOM   7875  C  C2    . DC  I 5 88  ? 18.087  -35.944 62.713 1.00 79.22  ? 15   DC  I C2    1 
ATOM   7876  O  O2    . DC  I 5 88  ? 16.980  -35.395 62.756 1.00 78.82  ? 15   DC  I O2    1 
ATOM   7877  N  N3    . DC  I 5 88  ? 19.247  -35.232 62.648 1.00 80.03  ? 15   DC  I N3    1 
ATOM   7878  C  C4    . DC  I 5 88  ? 20.426  -35.859 62.601 1.00 80.31  ? 15   DC  I C4    1 
ATOM   7879  N  N4    . DC  I 5 88  ? 21.530  -35.104 62.541 1.00 80.11  ? 15   DC  I N4    1 
ATOM   7880  C  C5    . DC  I 5 88  ? 20.516  -37.287 62.618 1.00 79.96  ? 15   DC  I C5    1 
ATOM   7881  C  C6    . DC  I 5 88  ? 19.367  -37.977 62.686 1.00 79.55  ? 15   DC  I C6    1 
ATOM   7882  P  P     . DT  I 5 89  ? 14.028  -40.660 60.810 1.00 73.99  ? 16   DT  I P     1 
ATOM   7883  O  OP1   . DT  I 5 89  ? 12.729  -41.330 61.044 1.00 72.94  ? 16   DT  I OP1   1 
ATOM   7884  O  OP2   . DT  I 5 89  ? 15.112  -41.334 60.055 1.00 73.94  ? 16   DT  I OP2   1 
ATOM   7885  O  "O5'" . DT  I 5 89  ? 13.718  -39.307 60.021 1.00 72.32  ? 16   DT  I "O5'" 1 
ATOM   7886  C  "C5'" . DT  I 5 89  ? 13.094  -38.218 60.680 1.00 69.22  ? 16   DT  I "C5'" 1 
ATOM   7887  C  "C4'" . DT  I 5 89  ? 13.313  -36.977 59.846 1.00 67.15  ? 16   DT  I "C4'" 1 
ATOM   7888  O  "O4'" . DT  I 5 89  ? 14.663  -36.478 60.009 1.00 66.87  ? 16   DT  I "O4'" 1 
ATOM   7889  C  "C3'" . DT  I 5 89  ? 13.110  -37.212 58.357 1.00 66.03  ? 16   DT  I "C3'" 1 
ATOM   7890  O  "O3'" . DT  I 5 89  ? 12.108  -36.281 57.977 1.00 63.03  ? 16   DT  I "O3'" 1 
ATOM   7891  C  "C2'" . DT  I 5 89  ? 14.498  -36.989 57.744 1.00 66.60  ? 16   DT  I "C2'" 1 
ATOM   7892  C  "C1'" . DT  I 5 89  ? 15.138  -36.045 58.756 1.00 68.17  ? 16   DT  I "C1'" 1 
ATOM   7893  N  N1    . DT  I 5 89  ? 16.633  -36.037 58.833 1.00 70.24  ? 16   DT  I N1    1 
ATOM   7894  C  C2    . DT  I 5 89  ? 17.322  -34.839 58.727 1.00 71.23  ? 16   DT  I C2    1 
ATOM   7895  O  O2    . DT  I 5 89  ? 16.811  -33.753 58.551 1.00 71.71  ? 16   DT  I O2    1 
ATOM   7896  N  N3    . DT  I 5 89  ? 18.683  -34.952 58.823 1.00 72.66  ? 16   DT  I N3    1 
ATOM   7897  C  C4    . DT  I 5 89  ? 19.420  -36.107 59.023 1.00 72.14  ? 16   DT  I C4    1 
ATOM   7898  O  O4    . DT  I 5 89  ? 20.646  -36.071 59.096 1.00 73.02  ? 16   DT  I O4    1 
ATOM   7899  C  C5    . DT  I 5 89  ? 18.645  -37.323 59.128 1.00 71.25  ? 16   DT  I C5    1 
ATOM   7900  C  C7    . DT  I 5 89  ? 19.315  -38.646 59.334 1.00 71.72  ? 16   DT  I C7    1 
ATOM   7901  C  C6    . DT  I 5 89  ? 17.312  -37.230 59.034 1.00 71.00  ? 16   DT  I C6    1 
ATOM   7902  P  P     . DT  I 5 90  ? 11.528  -36.143 56.500 1.00 62.36  ? 17   DT  I P     1 
ATOM   7903  O  OP1   . DT  I 5 90  ? 10.064  -36.312 56.665 1.00 60.84  ? 17   DT  I OP1   1 
ATOM   7904  O  OP2   . DT  I 5 90  ? 12.302  -36.975 55.542 1.00 60.76  ? 17   DT  I OP2   1 
ATOM   7905  O  "O5'" . DT  I 5 90  ? 11.843  -34.613 56.147 1.00 62.70  ? 17   DT  I "O5'" 1 
ATOM   7906  C  "C5'" . DT  I 5 90  ? 11.754  -33.597 57.146 1.00 62.80  ? 17   DT  I "C5'" 1 
ATOM   7907  C  "C4'" . DT  I 5 90  ? 12.732  -32.488 56.824 1.00 63.46  ? 17   DT  I "C4'" 1 
ATOM   7908  O  "O4'" . DT  I 5 90  ? 14.094  -32.980 56.935 1.00 64.63  ? 17   DT  I "O4'" 1 
ATOM   7909  C  "C3'" . DT  I 5 90  ? 12.578  -31.907 55.424 1.00 62.72  ? 17   DT  I "C3'" 1 
ATOM   7910  O  "O3'" . DT  I 5 90  ? 12.337  -30.511 55.540 1.00 60.60  ? 17   DT  I "O3'" 1 
ATOM   7911  C  "C2'" . DT  I 5 90  ? 13.896  -32.265 54.731 1.00 64.10  ? 17   DT  I "C2'" 1 
ATOM   7912  C  "C1'" . DT  I 5 90  ? 14.867  -32.419 55.899 1.00 66.08  ? 17   DT  I "C1'" 1 
ATOM   7913  N  N1    . DT  I 5 90  ? 16.066  -33.309 55.667 1.00 68.84  ? 17   DT  I N1    1 
ATOM   7914  C  C2    . DT  I 5 90  ? 17.337  -32.771 55.765 1.00 69.91  ? 17   DT  I C2    1 
ATOM   7915  O  O2    . DT  I 5 90  ? 17.571  -31.602 56.028 1.00 70.46  ? 17   DT  I O2    1 
ATOM   7916  N  N3    . DT  I 5 90  ? 18.351  -33.670 55.543 1.00 71.05  ? 17   DT  I N3    1 
ATOM   7917  C  C4    . DT  I 5 90  ? 18.250  -35.017 55.246 1.00 71.01  ? 17   DT  I C4    1 
ATOM   7918  O  O4    . DT  I 5 90  ? 19.242  -35.719 55.067 1.00 71.76  ? 17   DT  I O4    1 
ATOM   7919  C  C5    . DT  I 5 90  ? 16.902  -35.525 55.159 1.00 70.96  ? 17   DT  I C5    1 
ATOM   7920  C  C7    . DT  I 5 90  ? 16.670  -36.974 54.828 1.00 70.63  ? 17   DT  I C7    1 
ATOM   7921  C  C6    . DT  I 5 90  ? 15.890  -34.659 55.375 1.00 70.01  ? 17   DT  I C6    1 
ATOM   7922  P  P     . DT  I 5 91  ? 12.045  -29.576 54.280 1.00 59.38  ? 18   DT  I P     1 
ATOM   7923  O  OP1   . DT  I 5 91  ? 10.992  -28.675 54.739 1.00 61.02  ? 18   DT  I OP1   1 
ATOM   7924  O  OP2   . DT  I 5 91  ? 11.816  -30.385 53.064 1.00 59.29  ? 18   DT  I OP2   1 
ATOM   7925  O  "O5'" . DT  I 5 91  ? 13.394  -28.737 54.068 1.00 62.43  ? 18   DT  I "O5'" 1 
ATOM   7926  C  "C5'" . DT  I 5 91  ? 14.062  -28.029 55.102 1.00 65.71  ? 18   DT  I "C5'" 1 
ATOM   7927  C  "C4'" . DT  I 5 91  ? 15.471  -27.674 54.649 1.00 70.07  ? 18   DT  I "C4'" 1 
ATOM   7928  O  "O4'" . DT  I 5 91  ? 16.317  -28.855 54.578 1.00 71.45  ? 18   DT  I "O4'" 1 
ATOM   7929  C  "C3'" . DT  I 5 91  ? 15.585  -26.982 53.295 1.00 72.16  ? 18   DT  I "C3'" 1 
ATOM   7930  O  "O3'" . DT  I 5 91  ? 16.489  -25.910 53.447 1.00 75.65  ? 18   DT  I "O3'" 1 
ATOM   7931  C  "C2'" . DT  I 5 91  ? 16.155  -28.061 52.378 1.00 72.60  ? 18   DT  I "C2'" 1 
ATOM   7932  C  "C1'" . DT  I 5 91  ? 17.023  -28.857 53.353 1.00 74.00  ? 18   DT  I "C1'" 1 
ATOM   7933  N  N1    . DT  I 5 91  ? 17.330  -30.294 52.983 1.00 76.62  ? 18   DT  I N1    1 
ATOM   7934  C  C2    . DT  I 5 91  ? 18.601  -30.806 53.193 1.00 77.93  ? 18   DT  I C2    1 
ATOM   7935  O  O2    . DT  I 5 91  ? 19.527  -30.169 53.660 1.00 78.09  ? 18   DT  I O2    1 
ATOM   7936  N  N3    . DT  I 5 91  ? 18.767  -32.121 52.829 1.00 79.37  ? 18   DT  I N3    1 
ATOM   7937  C  C4    . DT  I 5 91  ? 17.817  -32.971 52.295 1.00 79.93  ? 18   DT  I C4    1 
ATOM   7938  O  O4    . DT  I 5 91  ? 18.077  -34.137 52.006 1.00 81.57  ? 18   DT  I O4    1 
ATOM   7939  C  C5    . DT  I 5 91  ? 16.510  -32.387 52.102 1.00 79.33  ? 18   DT  I C5    1 
ATOM   7940  C  C7    . DT  I 5 91  ? 15.393  -33.203 51.522 1.00 78.66  ? 18   DT  I C7    1 
ATOM   7941  C  C6    . DT  I 5 91  ? 16.335  -31.099 52.451 1.00 78.44  ? 18   DT  I C6    1 
ATOM   7942  P  P     . DT  I 5 92  ? 16.555  -24.671 52.437 1.00 78.11  ? 19   DT  I P     1 
ATOM   7943  O  OP1   . DT  I 5 92  ? 16.607  -23.488 53.322 1.00 78.43  ? 19   DT  I OP1   1 
ATOM   7944  O  OP2   . DT  I 5 92  ? 15.516  -24.785 51.390 1.00 76.76  ? 19   DT  I OP2   1 
ATOM   7945  O  "O5'" . DT  I 5 92  ? 17.970  -24.845 51.708 1.00 82.16  ? 19   DT  I "O5'" 1 
ATOM   7946  C  "C5'" . DT  I 5 92  ? 19.165  -25.045 52.462 1.00 88.07  ? 19   DT  I "C5'" 1 
ATOM   7947  C  "C4'" . DT  I 5 92  ? 20.219  -25.708 51.597 1.00 92.64  ? 19   DT  I "C4'" 1 
ATOM   7948  O  "O4'" . DT  I 5 92  ? 19.932  -27.124 51.472 1.00 93.96  ? 19   DT  I "O4'" 1 
ATOM   7949  C  "C3'" . DT  I 5 92  ? 20.307  -25.154 50.176 1.00 95.54  ? 19   DT  I "C3'" 1 
ATOM   7950  O  "O3'" . DT  I 5 92  ? 21.645  -24.750 49.920 1.00 99.26  ? 19   DT  I "O3'" 1 
ATOM   7951  C  "C2'" . DT  I 5 92  ? 19.866  -26.313 49.282 1.00 95.35  ? 19   DT  I "C2'" 1 
ATOM   7952  C  "C1'" . DT  I 5 92  ? 20.250  -27.510 50.151 1.00 95.63  ? 19   DT  I "C1'" 1 
ATOM   7953  N  N1    . DT  I 5 92  ? 19.577  -28.819 49.834 1.00 96.69  ? 19   DT  I N1    1 
ATOM   7954  C  C2    . DT  I 5 92  ? 20.343  -29.974 49.780 1.00 97.58  ? 19   DT  I C2    1 
ATOM   7955  O  O2    . DT  I 5 92  ? 21.546  -30.008 49.972 1.00 98.44  ? 19   DT  I O2    1 
ATOM   7956  N  N3    . DT  I 5 92  ? 19.645  -31.117 49.484 1.00 98.26  ? 19   DT  I N3    1 
ATOM   7957  C  C4    . DT  I 5 92  ? 18.284  -31.229 49.244 1.00 98.66  ? 19   DT  I C4    1 
ATOM   7958  O  O4    . DT  I 5 92  ? 17.767  -32.315 48.983 1.00 98.96  ? 19   DT  I O4    1 
ATOM   7959  C  C5    . DT  I 5 92  ? 17.537  -29.985 49.314 1.00 98.28  ? 19   DT  I C5    1 
ATOM   7960  C  C7    . DT  I 5 92  ? 16.052  -29.960 49.069 1.00 98.43  ? 19   DT  I C7    1 
ATOM   7961  C  C6    . DT  I 5 92  ? 18.212  -28.859 49.603 1.00 97.45  ? 19   DT  I C6    1 
ATOM   7962  P  P     . DG  I 5 93  ? 21.985  -23.628 48.837 1.00 102.20 ? 20   DG  I P     1 
ATOM   7963  O  OP1   . DG  I 5 93  ? 22.795  -22.611 49.545 1.00 102.04 ? 20   DG  I OP1   1 
ATOM   7964  O  OP2   . DG  I 5 93  ? 20.752  -23.229 48.108 1.00 101.60 ? 20   DG  I OP2   1 
ATOM   7965  O  "O5'" . DG  I 5 93  ? 22.906  -24.447 47.816 1.00 104.93 ? 20   DG  I "O5'" 1 
ATOM   7966  C  "C5'" . DG  I 5 93  ? 24.252  -24.794 48.159 1.00 109.27 ? 20   DG  I "C5'" 1 
ATOM   7967  C  "C4'" . DG  I 5 93  ? 24.800  -25.853 47.212 1.00 112.43 ? 20   DG  I "C4'" 1 
ATOM   7968  O  "O4'" . DG  I 5 93  ? 24.069  -27.096 47.414 1.00 113.19 ? 20   DG  I "O4'" 1 
ATOM   7969  C  "C3'" . DG  I 5 93  ? 24.721  -25.526 45.716 1.00 114.07 ? 20   DG  I "C3'" 1 
ATOM   7970  O  "O3'" . DG  I 5 93  ? 25.962  -25.865 45.082 1.00 116.54 ? 20   DG  I "O3'" 1 
ATOM   7971  C  "C2'" . DG  I 5 93  ? 23.545  -26.388 45.250 1.00 114.29 ? 20   DG  I "C2'" 1 
ATOM   7972  C  "C1'" . DG  I 5 93  ? 23.684  -27.611 46.153 1.00 114.31 ? 20   DG  I "C1'" 1 
ATOM   7973  N  N9    . DG  I 5 93  ? 22.449  -28.388 46.282 1.00 115.21 ? 20   DG  I N9    1 
ATOM   7974  C  C8    . DG  I 5 93  ? 21.208  -27.910 46.642 1.00 115.68 ? 20   DG  I C8    1 
ATOM   7975  N  N7    . DG  I 5 93  ? 20.280  -28.827 46.668 1.00 116.09 ? 20   DG  I N7    1 
ATOM   7976  C  C5    . DG  I 5 93  ? 20.943  -29.994 46.298 1.00 116.14 ? 20   DG  I C5    1 
ATOM   7977  C  C6    . DG  I 5 93  ? 20.454  -31.322 46.149 1.00 116.41 ? 20   DG  I C6    1 
ATOM   7978  O  O6    . DG  I 5 93  ? 19.298  -31.736 46.320 1.00 116.26 ? 20   DG  I O6    1 
ATOM   7979  N  N1    . DG  I 5 93  ? 21.457  -32.217 45.754 1.00 116.45 ? 20   DG  I N1    1 
ATOM   7980  C  C2    . DG  I 5 93  ? 22.772  -31.866 45.528 1.00 116.49 ? 20   DG  I C2    1 
ATOM   7981  N  N2    . DG  I 5 93  ? 23.603  -32.853 45.158 1.00 116.76 ? 20   DG  I N2    1 
ATOM   7982  N  N3    . DG  I 5 93  ? 23.241  -30.630 45.672 1.00 116.29 ? 20   DG  I N3    1 
ATOM   7983  C  C4    . DG  I 5 93  ? 22.279  -29.741 46.054 1.00 115.85 ? 20   DG  I C4    1 
ATOM   7984  P  P     . DA  I 5 94  ? 26.210  -25.918 43.485 1.00 119.01 ? 21   DA  I P     1 
ATOM   7985  O  OP1   . DA  I 5 94  ? 26.834  -24.633 43.089 1.00 118.54 ? 21   DA  I OP1   1 
ATOM   7986  O  OP2   . DA  I 5 94  ? 24.999  -26.371 42.755 1.00 118.57 ? 21   DA  I OP2   1 
ATOM   7987  O  "O5'" . DA  I 5 94  ? 27.291  -27.107 43.378 1.00 120.42 ? 21   DA  I "O5'" 1 
ATOM   7988  C  "C5'" . DA  I 5 94  ? 27.189  -28.294 44.189 1.00 122.60 ? 21   DA  I "C5'" 1 
ATOM   7989  C  "C4'" . DA  I 5 94  ? 27.155  -29.579 43.370 1.00 124.52 ? 21   DA  I "C4'" 1 
ATOM   7990  O  "O4'" . DA  I 5 94  ? 25.883  -30.259 43.582 1.00 124.89 ? 21   DA  I "O4'" 1 
ATOM   7991  C  "C3'" . DA  I 5 94  ? 27.303  -29.428 41.852 1.00 125.94 ? 21   DA  I "C3'" 1 
ATOM   7992  O  "O3'" . DA  I 5 94  ? 28.155  -30.454 41.309 1.00 127.75 ? 21   DA  I "O3'" 1 
ATOM   7993  C  "C2'" . DA  I 5 94  ? 25.861  -29.562 41.368 1.00 125.90 ? 21   DA  I "C2'" 1 
ATOM   7994  C  "C1'" . DA  I 5 94  ? 25.343  -30.628 42.325 1.00 125.70 ? 21   DA  I "C1'" 1 
ATOM   7995  N  N9    . DA  I 5 94  ? 23.881  -30.687 42.372 1.00 126.04 ? 21   DA  I N9    1 
ATOM   7996  C  C8    . DA  I 5 94  ? 23.039  -29.686 42.769 1.00 126.19 ? 21   DA  I C8    1 
ATOM   7997  N  N7    . DA  I 5 94  ? 21.767  -29.999 42.710 1.00 126.22 ? 21   DA  I N7    1 
ATOM   7998  C  C5    . DA  I 5 94  ? 21.771  -31.296 42.228 1.00 126.29 ? 21   DA  I C5    1 
ATOM   7999  C  C6    . DA  I 5 94  ? 20.726  -32.200 41.938 1.00 126.40 ? 21   DA  I C6    1 
ATOM   8000  N  N6    . DA  I 5 94  ? 19.439  -31.886 42.110 1.00 126.34 ? 21   DA  I N6    1 
ATOM   8001  N  N1    . DA  I 5 94  ? 21.053  -33.430 41.468 1.00 126.50 ? 21   DA  I N1    1 
ATOM   8002  C  C2    . DA  I 5 94  ? 22.352  -33.726 41.302 1.00 126.58 ? 21   DA  I C2    1 
ATOM   8003  N  N3    . DA  I 5 94  ? 23.422  -32.956 41.542 1.00 126.50 ? 21   DA  I N3    1 
ATOM   8004  C  C4    . DA  I 5 94  ? 23.064  -31.741 42.009 1.00 126.28 ? 21   DA  I C4    1 
ATOM   8005  P  P     . DT  I 5 95  ? 28.420  -30.617 39.727 1.00 129.12 ? 22   DT  I P     1 
ATOM   8006  O  OP1   . DT  I 5 95  ? 29.790  -31.168 39.595 1.00 129.25 ? 22   DT  I OP1   1 
ATOM   8007  O  OP2   . DT  I 5 95  ? 28.075  -29.346 39.041 1.00 128.87 ? 22   DT  I OP2   1 
ATOM   8008  O  "O5'" . DT  I 5 95  ? 27.354  -31.728 39.263 1.00 130.38 ? 22   DT  I "O5'" 1 
ATOM   8009  C  "C5'" . DT  I 5 95  ? 27.571  -33.128 39.486 1.00 132.72 ? 22   DT  I "C5'" 1 
ATOM   8010  C  "C4'" . DT  I 5 95  ? 26.585  -33.965 38.679 1.00 134.64 ? 22   DT  I "C4'" 1 
ATOM   8011  O  "O4'" . DT  I 5 95  ? 25.211  -33.602 39.011 1.00 135.56 ? 22   DT  I "O4'" 1 
ATOM   8012  C  "C3'" . DT  I 5 95  ? 26.700  -33.842 37.153 1.00 135.51 ? 22   DT  I "C3'" 1 
ATOM   8013  O  "O3'" . DT  I 5 95  ? 26.705  -35.155 36.567 1.00 135.82 ? 22   DT  I "O3'" 1 
ATOM   8014  C  "C2'" . DT  I 5 95  ? 25.443  -33.051 36.778 1.00 136.00 ? 22   DT  I "C2'" 1 
ATOM   8015  C  "C1'" . DT  I 5 95  ? 24.462  -33.617 37.805 1.00 136.31 ? 22   DT  I "C1'" 1 
ATOM   8016  N  N1    . DT  I 5 95  ? 23.144  -32.880 37.953 1.00 136.75 ? 22   DT  I N1    1 
ATOM   8017  C  C2    . DT  I 5 95  ? 21.960  -33.599 38.100 1.00 136.74 ? 22   DT  I C2    1 
ATOM   8018  O  O2    . DT  I 5 95  ? 21.891  -34.820 38.122 1.00 136.40 ? 22   DT  I O2    1 
ATOM   8019  N  N3    . DT  I 5 95  ? 20.833  -32.817 38.225 1.00 136.81 ? 22   DT  I N3    1 
ATOM   8020  C  C4    . DT  I 5 95  ? 20.764  -31.428 38.217 1.00 137.04 ? 22   DT  I C4    1 
ATOM   8021  O  O4    . DT  I 5 95  ? 19.694  -30.835 38.338 1.00 137.17 ? 22   DT  I O4    1 
ATOM   8022  C  C5    . DT  I 5 95  ? 22.031  -30.738 38.058 1.00 137.02 ? 22   DT  I C5    1 
ATOM   8023  C  C7    . DT  I 5 95  ? 22.108  -29.235 38.030 1.00 136.73 ? 22   DT  I C7    1 
ATOM   8024  C  C6    . DT  I 5 95  ? 23.137  -31.490 37.936 1.00 136.98 ? 22   DT  I C6    1 
ATOM   8025  P  P     . DG  I 5 96  ? 27.073  -35.421 35.022 1.00 135.75 ? 23   DG  I P     1 
ATOM   8026  O  OP1   . DG  I 5 96  ? 28.534  -35.158 34.897 1.00 135.81 ? 23   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I 5 96  ? 26.111  -34.685 34.154 1.00 135.59 ? 23   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I 5 96  ? 26.788  -37.010 34.878 1.00 134.76 ? 23   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I 5 96  ? 26.352  -37.626 33.647 1.00 132.96 ? 23   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I 5 96  ? 25.039  -38.379 33.840 1.00 131.73 ? 23   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I 5 96  ? 24.113  -37.545 34.602 1.00 131.77 ? 23   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I 5 96  ? 24.302  -38.747 32.546 1.00 130.73 ? 23   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I 5 96  ? 23.666  -40.039 32.671 1.00 128.84 ? 23   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I 5 96  ? 23.291  -37.608 32.422 1.00 131.14 ? 23   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I 5 96  ? 22.898  -37.422 33.886 1.00 131.63 ? 23   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I 5 96  ? 22.295  -36.116 34.148 1.00 131.77 ? 23   DG  I N9    1 
ATOM   8037  C  C8    . DG  I 5 96  ? 22.912  -34.881 34.026 1.00 131.92 ? 23   DG  I C8    1 
ATOM   8038  N  N7    . DG  I 5 96  ? 22.135  -33.875 34.317 1.00 131.94 ? 23   DG  I N7    1 
ATOM   8039  C  C5    . DG  I 5 96  ? 20.921  -34.476 34.653 1.00 131.68 ? 23   DG  I C5    1 
ATOM   8040  C  C6    . DG  I 5 96  ? 19.698  -33.883 35.058 1.00 131.07 ? 23   DG  I C6    1 
ATOM   8041  O  O6    . DG  I 5 96  ? 19.451  -32.675 35.201 1.00 130.69 ? 23   DG  I O6    1 
ATOM   8042  N  N1    . DG  I 5 96  ? 18.706  -34.840 35.305 1.00 130.74 ? 23   DG  I N1    1 
ATOM   8043  C  C2    . DG  I 5 96  ? 18.879  -36.203 35.176 1.00 131.13 ? 23   DG  I C2    1 
ATOM   8044  N  N2    . DG  I 5 96  ? 17.809  -36.968 35.460 1.00 130.91 ? 23   DG  I N2    1 
ATOM   8045  N  N3    . DG  I 5 96  ? 20.020  -36.777 34.800 1.00 131.46 ? 23   DG  I N3    1 
ATOM   8046  C  C4    . DG  I 5 96  ? 20.999  -35.857 34.553 1.00 131.73 ? 23   DG  I C4    1 
ATOM   8047  P  P     . DG  I 5 97  ? 22.454  -40.558 31.726 1.00 127.48 ? 24   DG  I P     1 
ATOM   8048  O  OP1   . DG  I 5 97  ? 22.247  -41.994 32.039 1.00 127.14 ? 24   DG  I OP1   1 
ATOM   8049  O  OP2   . DG  I 5 97  ? 22.737  -40.151 30.323 1.00 127.36 ? 24   DG  I OP2   1 
ATOM   8050  O  "O5'" . DG  I 5 97  ? 21.156  -39.744 32.225 1.00 125.81 ? 24   DG  I "O5'" 1 
ATOM   8051  C  "C5'" . DG  I 5 97  ? 20.003  -40.455 32.741 1.00 123.03 ? 24   DG  I "C5'" 1 
ATOM   8052  C  "C4'" . DG  I 5 97  ? 18.677  -39.859 32.268 1.00 120.77 ? 24   DG  I "C4'" 1 
ATOM   8053  O  "O4'" . DG  I 5 97  ? 18.714  -38.407 32.297 1.00 120.69 ? 24   DG  I "O4'" 1 
ATOM   8054  C  "C3'" . DG  I 5 97  ? 18.206  -40.234 30.861 1.00 118.98 ? 24   DG  I "C3'" 1 
ATOM   8055  O  "O3'" . DG  I 5 97  ? 16.791  -40.426 30.873 1.00 115.98 ? 24   DG  I "O3'" 1 
ATOM   8056  C  "C2'" . DG  I 5 97  ? 18.565  -39.003 30.031 1.00 119.52 ? 24   DG  I "C2'" 1 
ATOM   8057  C  "C1'" . DG  I 5 97  ? 18.260  -37.910 31.051 1.00 120.11 ? 24   DG  I "C1'" 1 
ATOM   8058  N  N9    . DG  I 5 97  ? 18.935  -36.635 30.859 1.00 119.90 ? 24   DG  I N9    1 
ATOM   8059  C  C8    . DG  I 5 97  ? 20.162  -36.389 30.289 1.00 120.03 ? 24   DG  I C8    1 
ATOM   8060  N  N7    . DG  I 5 97  ? 20.485  -35.125 30.290 1.00 120.23 ? 24   DG  I N7    1 
ATOM   8061  C  C5    . DG  I 5 97  ? 19.407  -34.499 30.909 1.00 120.29 ? 24   DG  I C5    1 
ATOM   8062  C  C6    . DG  I 5 97  ? 19.176  -33.128 31.202 1.00 120.20 ? 24   DG  I C6    1 
ATOM   8063  O  O6    . DG  I 5 97  ? 19.908  -32.155 30.964 1.00 120.51 ? 24   DG  I O6    1 
ATOM   8064  N  N1    . DG  I 5 97  ? 17.948  -32.930 31.838 1.00 119.93 ? 24   DG  I N1    1 
ATOM   8065  C  C2    . DG  I 5 97  ? 17.059  -33.933 32.154 1.00 119.79 ? 24   DG  I C2    1 
ATOM   8066  N  N2    . DG  I 5 97  ? 15.929  -33.561 32.768 1.00 119.80 ? 24   DG  I N2    1 
ATOM   8067  N  N3    . DG  I 5 97  ? 17.262  -35.217 31.887 1.00 119.79 ? 24   DG  I N3    1 
ATOM   8068  C  C4    . DG  I 5 97  ? 18.449  -35.422 31.267 1.00 119.99 ? 24   DG  I C4    1 
ATOM   8069  P  P     . DA  I 5 98  ? 16.109  -41.564 29.978 1.00 113.44 ? 25   DA  I P     1 
ATOM   8070  O  OP1   . DA  I 5 98  ? 16.527  -42.862 30.551 1.00 112.99 ? 25   DA  I OP1   1 
ATOM   8071  O  OP2   . DA  I 5 98  ? 16.360  -41.232 28.557 1.00 113.38 ? 25   DA  I OP2   1 
ATOM   8072  O  "O5'" . DA  I 5 98  ? 14.534  -41.399 30.203 1.00 111.93 ? 25   DA  I "O5'" 1 
ATOM   8073  C  "C5'" . DA  I 5 98  ? 13.972  -41.275 31.512 1.00 109.30 ? 25   DA  I "C5'" 1 
ATOM   8074  C  "C4'" . DA  I 5 98  ? 12.916  -40.176 31.531 1.00 107.04 ? 25   DA  I "C4'" 1 
ATOM   8075  O  "O4'" . DA  I 5 98  ? 13.538  -38.882 31.290 1.00 107.11 ? 25   DA  I "O4'" 1 
ATOM   8076  C  "C3'" . DA  I 5 98  ? 11.783  -40.335 30.516 1.00 105.10 ? 25   DA  I "C3'" 1 
ATOM   8077  O  "O3'" . DA  I 5 98  ? 10.510  -40.182 31.175 1.00 101.85 ? 25   DA  I "O3'" 1 
ATOM   8078  C  "C2'" . DA  I 5 98  ? 12.066  -39.259 29.464 1.00 106.09 ? 25   DA  I "C2'" 1 
ATOM   8079  C  "C1'" . DA  I 5 98  ? 12.902  -38.220 30.213 1.00 107.20 ? 25   DA  I "C1'" 1 
ATOM   8080  N  N9    . DA  I 5 98  ? 13.944  -37.573 29.415 1.00 108.11 ? 25   DA  I N9    1 
ATOM   8081  C  C8    . DA  I 5 98  ? 14.784  -38.160 28.505 1.00 108.55 ? 25   DA  I C8    1 
ATOM   8082  N  N7    . DA  I 5 98  ? 15.632  -37.330 27.942 1.00 108.83 ? 25   DA  I N7    1 
ATOM   8083  C  C5    . DA  I 5 98  ? 15.335  -36.109 28.523 1.00 109.02 ? 25   DA  I C5    1 
ATOM   8084  C  C6    . DA  I 5 98  ? 15.880  -34.814 28.357 1.00 109.40 ? 25   DA  I C6    1 
ATOM   8085  N  N6    . DA  I 5 98  ? 16.880  -34.537 27.513 1.00 109.82 ? 25   DA  I N6    1 
ATOM   8086  N  N1    . DA  I 5 98  ? 15.353  -33.805 29.090 1.00 109.49 ? 25   DA  I N1    1 
ATOM   8087  C  C2    . DA  I 5 98  ? 14.348  -34.084 29.937 1.00 109.47 ? 25   DA  I C2    1 
ATOM   8088  N  N3    . DA  I 5 98  ? 13.756  -35.259 30.180 1.00 108.87 ? 25   DA  I N3    1 
ATOM   8089  C  C4    . DA  I 5 98  ? 14.298  -36.241 29.436 1.00 108.76 ? 25   DA  I C4    1 
ATOM   8090  P  P     . DG  I 5 99  ? 9.087   -40.407 30.450 1.00 99.57  ? 26   DG  I P     1 
ATOM   8091  O  OP1   . DG  I 5 99  ? 8.103   -40.838 31.470 1.00 98.21  ? 26   DG  I OP1   1 
ATOM   8092  O  OP2   . DG  I 5 99  ? 9.305   -41.252 29.253 1.00 99.53  ? 26   DG  I OP2   1 
ATOM   8093  O  "O5'" . DG  I 5 99  ? 8.673   -38.951 29.922 1.00 96.97  ? 26   DG  I "O5'" 1 
ATOM   8094  C  "C5'" . DG  I 5 99  ? 8.608   -37.817 30.785 1.00 93.52  ? 26   DG  I "C5'" 1 
ATOM   8095  C  "C4'" . DG  I 5 99  ? 8.491   -36.528 29.989 1.00 90.95  ? 26   DG  I "C4'" 1 
ATOM   8096  O  "O4'" . DG  I 5 99  ? 9.732   -36.254 29.275 1.00 91.57  ? 26   DG  I "O4'" 1 
ATOM   8097  C  "C3'" . DG  I 5 99  ? 7.383   -36.511 28.945 1.00 89.13  ? 26   DG  I "C3'" 1 
ATOM   8098  O  "O3'" . DG  I 5 99  ? 6.734   -35.250 29.057 1.00 86.17  ? 26   DG  I "O3'" 1 
ATOM   8099  C  "C2'" . DG  I 5 99  ? 8.157   -36.636 27.632 1.00 90.48  ? 26   DG  I "C2'" 1 
ATOM   8100  C  "C1'" . DG  I 5 99  ? 9.419   -35.836 27.960 1.00 92.15  ? 26   DG  I "C1'" 1 
ATOM   8101  N  N9    . DG  I 5 99  ? 10.584  -35.997 27.066 1.00 94.18  ? 26   DG  I N9    1 
ATOM   8102  C  C8    . DG  I 5 99  ? 10.892  -37.079 26.269 1.00 94.77  ? 26   DG  I C8    1 
ATOM   8103  N  N7    . DG  I 5 99  ? 11.995  -36.941 25.580 1.00 95.51  ? 26   DG  I N7    1 
ATOM   8104  C  C5    . DG  I 5 99  ? 12.467  -35.681 25.933 1.00 96.25  ? 26   DG  I C5    1 
ATOM   8105  C  C6    . DG  I 5 99  ? 13.634  -34.977 25.502 1.00 97.02  ? 26   DG  I C6    1 
ATOM   8106  O  O6    . DG  I 5 99  ? 14.509  -35.345 24.696 1.00 96.93  ? 26   DG  I O6    1 
ATOM   8107  N  N1    . DG  I 5 99  ? 13.744  -33.715 26.103 1.00 97.23  ? 26   DG  I N1    1 
ATOM   8108  C  C2    . DG  I 5 99  ? 12.839  -33.198 27.007 1.00 97.13  ? 26   DG  I C2    1 
ATOM   8109  N  N2    . DG  I 5 99  ? 13.109  -31.970 27.486 1.00 97.22  ? 26   DG  I N2    1 
ATOM   8110  N  N3    . DG  I 5 99  ? 11.747  -33.851 27.417 1.00 96.67  ? 26   DG  I N3    1 
ATOM   8111  C  C4    . DG  I 5 99  ? 11.611  -35.085 26.846 1.00 95.73  ? 26   DG  I C4    1 
ATOM   8112  P  P     . DC  I 5 100 ? 5.160   -35.037 29.276 1.00 82.23  ? 27   DC  I P     1 
ATOM   8113  O  OP1   . DC  I 5 100 ? 4.796   -35.545 30.607 1.00 83.00  ? 27   DC  I OP1   1 
ATOM   8114  O  OP2   . DC  I 5 100 ? 4.410   -35.503 28.098 1.00 82.83  ? 27   DC  I OP2   1 
ATOM   8115  O  "O5'" . DC  I 5 100 ? 5.039   -33.454 29.264 1.00 84.92  ? 27   DC  I "O5'" 1 
ATOM   8116  C  "C5'" . DC  I 5 100 ? 5.981   -32.654 29.975 1.00 86.78  ? 27   DC  I "C5'" 1 
ATOM   8117  C  "C4'" . DC  I 5 100 ? 6.664   -31.657 29.054 1.00 87.75  ? 27   DC  I "C4'" 1 
ATOM   8118  O  "O4'" . DC  I 5 100 ? 7.595   -32.329 28.169 1.00 87.51  ? 27   DC  I "O4'" 1 
ATOM   8119  C  "C3'" . DC  I 5 100 ? 5.726   -30.838 28.174 1.00 88.67  ? 27   DC  I "C3'" 1 
ATOM   8120  O  "O3'" . DC  I 5 100 ? 5.920   -29.461 28.522 1.00 90.84  ? 27   DC  I "O3'" 1 
ATOM   8121  C  "C2'" . DC  I 5 100 ? 6.150   -31.185 26.744 1.00 87.91  ? 27   DC  I "C2'" 1 
ATOM   8122  C  "C1'" . DC  I 5 100 ? 7.591   -31.659 26.929 1.00 87.40  ? 27   DC  I "C1'" 1 
ATOM   8123  N  N1    . DC  I 5 100 ? 8.150   -32.610 25.901 1.00 87.01  ? 27   DC  I N1    1 
ATOM   8124  C  C2    . DC  I 5 100 ? 9.390   -32.339 25.263 1.00 87.04  ? 27   DC  I C2    1 
ATOM   8125  O  O2    . DC  I 5 100 ? 10.049  -31.316 25.516 1.00 87.27  ? 27   DC  I O2    1 
ATOM   8126  N  N3    . DC  I 5 100 ? 9.865   -33.226 24.353 1.00 86.98  ? 27   DC  I N3    1 
ATOM   8127  C  C4    . DC  I 5 100 ? 9.173   -34.334 24.069 1.00 87.00  ? 27   DC  I C4    1 
ATOM   8128  N  N4    . DC  I 5 100 ? 9.700   -35.159 23.161 1.00 86.91  ? 27   DC  I N4    1 
ATOM   8129  C  C5    . DC  I 5 100 ? 7.919   -34.634 24.697 1.00 86.70  ? 27   DC  I C5    1 
ATOM   8130  C  C6    . DC  I 5 100 ? 7.455   -33.756 25.598 1.00 86.63  ? 27   DC  I C6    1 
ATOM   8131  P  P     . DA  I 5 101 ? 4.867   -28.300 28.183 1.00 91.61  ? 28   DA  I P     1 
ATOM   8132  O  OP1   . DA  I 5 101 ? 4.992   -27.264 29.238 1.00 91.36  ? 28   DA  I OP1   1 
ATOM   8133  O  OP2   . DA  I 5 101 ? 3.552   -28.911 27.882 1.00 91.58  ? 28   DA  I OP2   1 
ATOM   8134  O  "O5'" . DA  I 5 101 ? 5.445   -27.744 26.798 1.00 94.23  ? 28   DA  I "O5'" 1 
ATOM   8135  C  "C5'" . DA  I 5 101 ? 6.800   -27.309 26.710 1.00 97.26  ? 28   DA  I "C5'" 1 
ATOM   8136  C  "C4'" . DA  I 5 101 ? 7.276   -27.266 25.269 1.00 99.49  ? 28   DA  I "C4'" 1 
ATOM   8137  O  "O4'" . DA  I 5 101 ? 7.485   -28.606 24.766 1.00 99.22  ? 28   DA  I "O4'" 1 
ATOM   8138  C  "C3'" . DA  I 5 101 ? 6.350   -26.587 24.264 1.00 101.37 ? 28   DA  I "C3'" 1 
ATOM   8139  O  "O3'" . DA  I 5 101 ? 7.164   -25.766 23.447 1.00 105.75 ? 28   DA  I "O3'" 1 
ATOM   8140  C  "C2'" . DA  I 5 101 ? 5.788   -27.753 23.453 1.00 100.25 ? 28   DA  I "C2'" 1 
ATOM   8141  C  "C1'" . DA  I 5 101 ? 7.048   -28.609 23.424 1.00 99.19  ? 28   DA  I "C1'" 1 
ATOM   8142  N  N9    . DA  I 5 101 ? 6.896   -29.998 23.021 1.00 98.46  ? 28   DA  I N9    1 
ATOM   8143  C  C8    . DA  I 5 101 ? 5.898   -30.871 23.360 1.00 98.36  ? 28   DA  I C8    1 
ATOM   8144  N  N7    . DA  I 5 101 ? 6.051   -32.071 22.847 1.00 98.04  ? 28   DA  I N7    1 
ATOM   8145  C  C5    . DA  I 5 101 ? 7.232   -31.975 22.126 1.00 97.81  ? 28   DA  I C5    1 
ATOM   8146  C  C6    . DA  I 5 101 ? 7.957   -32.899 21.340 1.00 97.50  ? 28   DA  I C6    1 
ATOM   8147  N  N6    . DA  I 5 101 ? 7.565   -34.163 21.150 1.00 97.31  ? 28   DA  I N6    1 
ATOM   8148  N  N1    . DA  I 5 101 ? 9.104   -32.478 20.754 1.00 97.28  ? 28   DA  I N1    1 
ATOM   8149  C  C2    . DA  I 5 101 ? 9.505   -31.212 20.938 1.00 97.13  ? 28   DA  I C2    1 
ATOM   8150  N  N3    . DA  I 5 101 ? 8.907   -30.255 21.653 1.00 97.57  ? 28   DA  I N3    1 
ATOM   8151  C  C4    . DA  I 5 101 ? 7.769   -30.702 22.225 1.00 97.89  ? 28   DA  I C4    1 
ATOM   8152  P  P     . DG  I 5 102 ? 6.754   -24.268 23.053 1.00 108.86 ? 29   DG  I P     1 
ATOM   8153  O  OP1   . DG  I 5 102 ? 7.240   -23.355 24.118 1.00 108.71 ? 29   DG  I OP1   1 
ATOM   8154  O  OP2   . DG  I 5 102 ? 5.328   -24.268 22.645 1.00 108.05 ? 29   DG  I OP2   1 
ATOM   8155  O  "O5'" . DG  I 5 102 ? 7.635   -24.028 21.735 1.00 111.97 ? 29   DG  I "O5'" 1 
ATOM   8156  C  "C5'" . DG  I 5 102 ? 9.045   -24.343 21.702 1.00 116.12 ? 29   DG  I "C5'" 1 
ATOM   8157  C  "C4'" . DG  I 5 102 ? 9.484   -24.726 20.291 1.00 118.99 ? 29   DG  I "C4'" 1 
ATOM   8158  O  "O4'" . DG  I 5 102 ? 9.303   -26.151 20.082 1.00 119.43 ? 29   DG  I "O4'" 1 
ATOM   8159  C  "C3'" . DG  I 5 102 ? 8.762   -24.025 19.141 1.00 120.88 ? 29   DG  I "C3'" 1 
ATOM   8160  O  "O3'" . DG  I 5 102 ? 9.715   -23.589 18.169 1.00 123.88 ? 29   DG  I "O3'" 1 
ATOM   8161  C  "C2'" . DG  I 5 102 ? 7.806   -25.087 18.590 1.00 120.44 ? 29   DG  I "C2'" 1 
ATOM   8162  C  "C1'" . DG  I 5 102 ? 8.582   -26.374 18.882 1.00 119.96 ? 29   DG  I "C1'" 1 
ATOM   8163  N  N9    . DG  I 5 102 ? 7.759   -27.563 19.091 1.00 120.14 ? 29   DG  I N9    1 
ATOM   8164  C  C8    . DG  I 5 102 ? 6.632   -27.678 19.874 1.00 120.33 ? 29   DG  I C8    1 
ATOM   8165  N  N7    . DG  I 5 102 ? 6.114   -28.876 19.865 1.00 120.39 ? 29   DG  I N7    1 
ATOM   8166  C  C5    . DG  I 5 102 ? 6.954   -29.608 19.032 1.00 120.46 ? 29   DG  I C5    1 
ATOM   8167  C  C6    . DG  I 5 102 ? 6.904   -30.974 18.641 1.00 120.68 ? 29   DG  I C6    1 
ATOM   8168  O  O6    . DG  I 5 102 ? 6.073   -31.835 18.968 1.00 120.38 ? 29   DG  I O6    1 
ATOM   8169  N  N1    . DG  I 5 102 ? 7.956   -31.317 17.783 1.00 120.97 ? 29   DG  I N1    1 
ATOM   8170  C  C2    . DG  I 5 102 ? 8.938   -30.445 17.357 1.00 120.85 ? 29   DG  I C2    1 
ATOM   8171  N  N2    . DG  I 5 102 ? 9.873   -30.944 16.533 1.00 120.66 ? 29   DG  I N2    1 
ATOM   8172  N  N3    . DG  I 5 102 ? 8.993   -29.165 17.720 1.00 120.68 ? 29   DG  I N3    1 
ATOM   8173  C  C4    . DG  I 5 102 ? 7.975   -28.813 18.553 1.00 120.35 ? 29   DG  I C4    1 
ATOM   8174  P  P     . DT  I 5 103 ? 9.349   -22.434 17.118 1.00 126.30 ? 30   DT  I P     1 
ATOM   8175  O  OP1   . DT  I 5 103 ? 10.551  -21.571 16.988 1.00 126.28 ? 30   DT  I OP1   1 
ATOM   8176  O  OP2   . DT  I 5 103 ? 8.046   -21.827 17.494 1.00 126.15 ? 30   DT  I OP2   1 
ATOM   8177  O  "O5'" . DT  I 5 103 ? 9.112   -23.263 15.763 1.00 127.64 ? 30   DT  I "O5'" 1 
ATOM   8178  C  "C5'" . DT  I 5 103 ? 10.222  -23.807 15.047 1.00 130.20 ? 30   DT  I "C5'" 1 
ATOM   8179  C  "C4'" . DT  I 5 103 ? 9.819   -25.007 14.202 1.00 132.07 ? 30   DT  I "C4'" 1 
ATOM   8180  O  "O4'" . DT  I 5 103 ? 9.035   -25.944 14.984 1.00 132.45 ? 30   DT  I "O4'" 1 
ATOM   8181  C  "C3'" . DT  I 5 103 ? 8.970   -24.702 12.964 1.00 133.26 ? 30   DT  I "C3'" 1 
ATOM   8182  O  "O3'" . DT  I 5 103 ? 9.737   -24.978 11.785 1.00 134.93 ? 30   DT  I "O3'" 1 
ATOM   8183  C  "C2'" . DT  I 5 103 ? 7.759   -25.633 13.083 1.00 132.89 ? 30   DT  I "C2'" 1 
ATOM   8184  C  "C1'" . DT  I 5 103 ? 8.283   -26.690 14.050 1.00 132.59 ? 30   DT  I "C1'" 1 
ATOM   8185  N  N1    . DT  I 5 103 ? 7.230   -27.515 14.744 1.00 132.68 ? 30   DT  I N1    1 
ATOM   8186  C  C2    . DT  I 5 103 ? 7.099   -28.874 14.425 1.00 132.50 ? 30   DT  I C2    1 
ATOM   8187  O  O2    . DT  I 5 103 ? 7.789   -29.469 13.602 1.00 132.42 ? 30   DT  I O2    1 
ATOM   8188  N  N3    . DT  I 5 103 ? 6.109   -29.538 15.117 1.00 132.25 ? 30   DT  I N3    1 
ATOM   8189  C  C4    . DT  I 5 103 ? 5.256   -28.992 16.075 1.00 132.43 ? 30   DT  I C4    1 
ATOM   8190  O  O4    . DT  I 5 103 ? 4.405   -29.677 16.635 1.00 132.21 ? 30   DT  I O4    1 
ATOM   8191  C  C5    . DT  I 5 103 ? 5.439   -27.571 16.370 1.00 132.69 ? 30   DT  I C5    1 
ATOM   8192  C  C7    . DT  I 5 103 ? 4.575   -26.859 17.391 1.00 132.57 ? 30   DT  I C7    1 
ATOM   8193  C  C6    . DT  I 5 103 ? 6.404   -26.911 15.699 1.00 132.81 ? 30   DT  I C6    1 
ATOM   8194  P  P     . DT  I 5 104 ? 9.240   -24.580 10.309 1.00 136.09 ? 31   DT  I P     1 
ATOM   8195  O  OP1   . DT  I 5 104 ? 10.451  -24.246 9.521  1.00 136.15 ? 31   DT  I OP1   1 
ATOM   8196  O  OP2   . DT  I 5 104 ? 8.110   -23.620 10.388 1.00 135.94 ? 31   DT  I OP2   1 
ATOM   8197  O  "O5'" . DT  I 5 104 ? 8.635   -25.958 9.785  1.00 136.22 ? 31   DT  I "O5'" 1 
ATOM   8198  C  "C5'" . DT  I 5 104 ? 9.493   -27.008 9.358  1.00 137.19 ? 31   DT  I "C5'" 1 
ATOM   8199  C  "C4'" . DT  I 5 104 ? 8.633   -28.148 8.853  1.00 137.91 ? 31   DT  I "C4'" 1 
ATOM   8200  O  "O4'" . DT  I 5 104 ? 7.833   -28.648 9.959  1.00 138.09 ? 31   DT  I "O4'" 1 
ATOM   8201  C  "C3'" . DT  I 5 104 ? 7.645   -27.759 7.751  1.00 138.23 ? 31   DT  I "C3'" 1 
ATOM   8202  O  "O3'" . DT  I 5 104 ? 7.610   -28.761 6.730  1.00 138.49 ? 31   DT  I "O3'" 1 
ATOM   8203  C  "C2'" . DT  I 5 104 ? 6.313   -27.672 8.494  1.00 138.24 ? 31   DT  I "C2'" 1 
ATOM   8204  C  "C1'" . DT  I 5 104 ? 6.504   -28.800 9.502  1.00 138.34 ? 31   DT  I "C1'" 1 
ATOM   8205  N  N1    . DT  I 5 104 ? 5.541   -28.814 10.656 1.00 138.49 ? 31   DT  I N1    1 
ATOM   8206  C  C2    . DT  I 5 104 ? 5.014   -30.025 11.085 1.00 138.39 ? 31   DT  I C2    1 
ATOM   8207  O  O2    . DT  I 5 104 ? 5.283   -31.105 10.584 1.00 138.17 ? 31   DT  I O2    1 
ATOM   8208  N  N3    . DT  I 5 104 ? 4.146   -29.927 12.147 1.00 138.44 ? 31   DT  I N3    1 
ATOM   8209  C  C4    . DT  I 5 104 ? 3.754   -28.772 12.807 1.00 138.59 ? 31   DT  I C4    1 
ATOM   8210  O  O4    . DT  I 5 104 ? 2.966   -28.810 13.750 1.00 138.53 ? 31   DT  I O4    1 
ATOM   8211  C  C5    . DT  I 5 104 ? 4.339   -27.538 12.311 1.00 138.65 ? 31   DT  I C5    1 
ATOM   8212  C  C7    . DT  I 5 104 ? 4.005   -26.209 12.932 1.00 138.69 ? 31   DT  I C7    1 
ATOM   8213  C  C6    . DT  I 5 104 ? 5.192   -27.622 11.276 1.00 138.70 ? 31   DT  I C6    1 
ATOM   8214  P  P     . DT  I 5 105 ? 6.949   -28.457 5.300  1.00 138.54 ? 32   DT  I P     1 
ATOM   8215  O  OP1   . DT  I 5 105 ? 7.705   -27.340 4.686  1.00 138.44 ? 32   DT  I OP1   1 
ATOM   8216  O  OP2   . DT  I 5 105 ? 5.488   -28.324 5.489  1.00 138.34 ? 32   DT  I OP2   1 
ATOM   8217  O  "O5'" . DT  I 5 105 ? 7.196   -29.803 4.461  1.00 138.82 ? 32   DT  I "O5'" 1 
ATOM   8218  C  "C5'" . DT  I 5 105 ? 7.556   -31.037 5.091  1.00 139.52 ? 32   DT  I "C5'" 1 
ATOM   8219  C  "C4'" . DT  I 5 105 ? 6.353   -31.848 5.565  1.00 140.15 ? 32   DT  I "C4'" 1 
ATOM   8220  O  "O4'" . DT  I 5 105 ? 5.735   -31.256 6.742  1.00 140.84 ? 32   DT  I "O4'" 1 
ATOM   8221  C  "C3'" . DT  I 5 105 ? 5.208   -32.043 4.562  1.00 140.09 ? 32   DT  I "C3'" 1 
ATOM   8222  O  "O3'" . DT  I 5 105 ? 5.222   -33.397 4.087  1.00 139.15 ? 32   DT  I "O3'" 1 
ATOM   8223  C  "C2'" . DT  I 5 105 ? 3.941   -31.745 5.372  1.00 140.70 ? 32   DT  I "C2'" 1 
ATOM   8224  C  "C1'" . DT  I 5 105 ? 4.443   -31.831 6.811  1.00 141.41 ? 32   DT  I "C1'" 1 
ATOM   8225  N  N1    . DT  I 5 105 ? 3.557   -31.152 7.845  1.00 142.34 ? 32   DT  I N1    1 
ATOM   8226  C  C2    . DT  I 5 105 ? 2.858   -31.916 8.775  1.00 142.60 ? 32   DT  I C2    1 
ATOM   8227  O  O2    . DT  I 5 105 ? 2.904   -33.133 8.839  1.00 142.38 ? 32   DT  I O2    1 
ATOM   8228  N  N3    . DT  I 5 105 ? 2.088   -31.192 9.659  1.00 142.91 ? 32   DT  I N3    1 
ATOM   8229  C  C4    . DT  I 5 105 ? 1.937   -29.812 9.707  1.00 143.15 ? 32   DT  I C4    1 
ATOM   8230  O  O4    . DT  I 5 105 ? 1.218   -29.272 10.546 1.00 143.18 ? 32   DT  I O4    1 
ATOM   8231  C  C5    . DT  I 5 105 ? 2.689   -29.068 8.712  1.00 143.19 ? 32   DT  I C5    1 
ATOM   8232  C  C7    . DT  I 5 105 ? 2.623   -27.564 8.643  1.00 143.26 ? 32   DT  I C7    1 
ATOM   8233  C  C6    . DT  I 5 105 ? 3.443   -29.767 7.844  1.00 142.91 ? 32   DT  I C6    1 
ATOM   8234  P  P     . DC  I 5 106 ? 4.315   -33.911 2.859  1.00 138.15 ? 33   DC  I P     1 
ATOM   8235  O  OP1   . DC  I 5 106 ? 4.933   -35.166 2.361  1.00 137.80 ? 33   DC  I OP1   1 
ATOM   8236  O  OP2   . DC  I 5 106 ? 4.080   -32.774 1.935  1.00 138.14 ? 33   DC  I OP2   1 
ATOM   8237  O  "O5'" . DC  I 5 106 ? 2.901   -34.239 3.544  1.00 137.08 ? 33   DC  I "O5'" 1 
ATOM   8238  C  "C5'" . DC  I 5 106 ? 2.499   -35.575 3.859  1.00 135.20 ? 33   DC  I "C5'" 1 
ATOM   8239  C  "C4'" . DC  I 5 106 ? 1.071   -35.578 4.386  1.00 133.89 ? 33   DC  I "C4'" 1 
ATOM   8240  O  "O4'" . DC  I 5 106 ? 0.873   -34.449 5.285  1.00 134.02 ? 33   DC  I "O4'" 1 
ATOM   8241  C  "C3'" . DC  I 5 106 ? -0.016  -35.468 3.316  1.00 132.53 ? 33   DC  I "C3'" 1 
ATOM   8242  O  "O3'" . DC  I 5 106 ? -1.080  -36.390 3.570  1.00 129.91 ? 33   DC  I "O3'" 1 
ATOM   8243  C  "C2'" . DC  I 5 106 ? -0.498  -34.026 3.443  1.00 133.13 ? 33   DC  I "C2'" 1 
ATOM   8244  C  "C1'" . DC  I 5 106 ? -0.350  -33.822 4.951  1.00 133.87 ? 33   DC  I "C1'" 1 
ATOM   8245  N  N1    . DC  I 5 106 ? -0.338  -32.393 5.416  1.00 134.22 ? 33   DC  I N1    1 
ATOM   8246  C  C2    . DC  I 5 106 ? -1.086  -32.026 6.555  1.00 134.25 ? 33   DC  I C2    1 
ATOM   8247  O  O2    . DC  I 5 106 ? -1.749  -32.881 7.170  1.00 133.92 ? 33   DC  I O2    1 
ATOM   8248  N  N3    . DC  I 5 106 ? -1.061  -30.724 6.956  1.00 134.31 ? 33   DC  I N3    1 
ATOM   8249  C  C4    . DC  I 5 106 ? -0.339  -29.819 6.274  1.00 134.43 ? 33   DC  I C4    1 
ATOM   8250  N  N4    . DC  I 5 106 ? -0.348  -28.553 6.706  1.00 134.12 ? 33   DC  I N4    1 
ATOM   8251  C  C5    . DC  I 5 106 ? 0.426   -30.172 5.115  1.00 134.53 ? 33   DC  I C5    1 
ATOM   8252  C  C6    . DC  I 5 106 ? 0.397   -31.455 4.728  1.00 134.41 ? 33   DC  I C6    1 
ATOM   8253  P  P     . DC  I 5 107 ? -1.747  -37.165 2.339  1.00 127.81 ? 34   DC  I P     1 
ATOM   8254  O  OP1   . DC  I 5 107 ? -0.716  -38.087 1.811  1.00 127.75 ? 34   DC  I OP1   1 
ATOM   8255  O  OP2   . DC  I 5 107 ? -2.363  -36.145 1.456  1.00 127.65 ? 34   DC  I OP2   1 
ATOM   8256  O  "O5'" . DC  I 5 107 ? -2.943  -38.035 2.960  1.00 126.02 ? 34   DC  I "O5'" 1 
ATOM   8257  C  "C5'" . DC  I 5 107 ? -2.966  -38.449 4.330  1.00 123.54 ? 34   DC  I "C5'" 1 
ATOM   8258  C  "C4'" . DC  I 5 107 ? -4.194  -37.916 5.065  1.00 121.51 ? 34   DC  I "C4'" 1 
ATOM   8259  O  "O4'" . DC  I 5 107 ? -3.970  -36.539 5.472  1.00 121.61 ? 34   DC  I "O4'" 1 
ATOM   8260  C  "C3'" . DC  I 5 107 ? -5.505  -37.916 4.273  1.00 119.93 ? 34   DC  I "C3'" 1 
ATOM   8261  O  "O3'" . DC  I 5 107 ? -6.560  -38.434 5.076  1.00 117.70 ? 34   DC  I "O3'" 1 
ATOM   8262  C  "C2'" . DC  I 5 107 ? -5.738  -36.440 3.964  1.00 120.46 ? 34   DC  I "C2'" 1 
ATOM   8263  C  "C1'" . DC  I 5 107 ? -5.158  -35.816 5.226  1.00 121.55 ? 34   DC  I "C1'" 1 
ATOM   8264  N  N1    . DC  I 5 107 ? -4.864  -34.347 5.147  1.00 122.32 ? 34   DC  I N1    1 
ATOM   8265  C  C2    . DC  I 5 107 ? -5.508  -33.478 6.040  1.00 122.67 ? 34   DC  I C2    1 
ATOM   8266  O  O2    . DC  I 5 107 ? -6.301  -33.943 6.868  1.00 122.52 ? 34   DC  I O2    1 
ATOM   8267  N  N3    . DC  I 5 107 ? -5.243  -32.145 5.971  1.00 123.04 ? 34   DC  I N3    1 
ATOM   8268  C  C4    . DC  I 5 107 ? -4.377  -31.674 5.065  1.00 123.20 ? 34   DC  I C4    1 
ATOM   8269  N  N4    . DC  I 5 107 ? -4.148  -30.356 5.035  1.00 122.97 ? 34   DC  I N4    1 
ATOM   8270  C  C5    . DC  I 5 107 ? -3.709  -32.544 4.147  1.00 123.01 ? 34   DC  I C5    1 
ATOM   8271  C  C6    . DC  I 5 107 ? -3.979  -33.856 4.224  1.00 122.68 ? 34   DC  I C6    1 
ATOM   8272  P  P     . DA  I 5 108 ? -7.005  -39.976 5.021  1.00 115.84 ? 35   DA  I P     1 
ATOM   8273  O  OP1   . DA  I 5 108 ? -5.838  -40.822 5.369  1.00 115.71 ? 35   DA  I OP1   1 
ATOM   8274  O  OP2   . DA  I 5 108 ? -7.736  -40.204 3.757  1.00 115.70 ? 35   DA  I OP2   1 
ATOM   8275  O  "O5'" . DA  I 5 108 ? -8.079  -40.086 6.206  1.00 114.27 ? 35   DA  I "O5'" 1 
ATOM   8276  C  "C5'" . DA  I 5 108 ? -7.674  -39.902 7.564  1.00 111.75 ? 35   DA  I "C5'" 1 
ATOM   8277  C  "C4'" . DA  I 5 108 ? -8.566  -38.924 8.315  1.00 109.80 ? 35   DA  I "C4'" 1 
ATOM   8278  O  "O4'" . DA  I 5 108 ? -8.428  -37.567 7.816  1.00 109.56 ? 35   DA  I "O4'" 1 
ATOM   8279  C  "C3'" . DA  I 5 108 ? -10.061 -39.215 8.285  1.00 108.57 ? 35   DA  I "C3'" 1 
ATOM   8280  O  "O3'" . DA  I 5 108 ? -10.528 -38.974 9.599  1.00 106.68 ? 35   DA  I "O3'" 1 
ATOM   8281  C  "C2'" . DA  I 5 108 ? -10.609 -38.200 7.281  1.00 108.80 ? 35   DA  I "C2'" 1 
ATOM   8282  C  "C1'" . DA  I 5 108 ? -9.704  -37.012 7.564  1.00 109.38 ? 35   DA  I "C1'" 1 
ATOM   8283  N  N9    . DA  I 5 108 ? -9.502  -36.107 6.451  1.00 110.14 ? 35   DA  I N9    1 
ATOM   8284  C  C8    . DA  I 5 108 ? -9.404  -36.440 5.131  1.00 110.73 ? 35   DA  I C8    1 
ATOM   8285  N  N7    . DA  I 5 108 ? -9.195  -35.412 4.345  1.00 111.32 ? 35   DA  I N7    1 
ATOM   8286  C  C5    . DA  I 5 108 ? -9.140  -34.330 5.208  1.00 111.14 ? 35   DA  I C5    1 
ATOM   8287  C  C6    . DA  I 5 108 ? -8.939  -32.946 4.997  1.00 111.36 ? 35   DA  I C6    1 
ATOM   8288  N  N6    . DA  I 5 108 ? -8.752  -32.398 3.790  1.00 111.40 ? 35   DA  I N6    1 
ATOM   8289  N  N1    . DA  I 5 108 ? -8.943  -32.137 6.081  1.00 111.44 ? 35   DA  I N1    1 
ATOM   8290  C  C2    . DA  I 5 108 ? -9.132  -32.683 7.292  1.00 111.29 ? 35   DA  I C2    1 
ATOM   8291  N  N3    . DA  I 5 108 ? -9.329  -33.965 7.612  1.00 111.06 ? 35   DA  I N3    1 
ATOM   8292  C  C4    . DA  I 5 108 ? -9.324  -34.745 6.516  1.00 110.79 ? 35   DA  I C4    1 
ATOM   8293  P  P     . DA  I 5 109 ? -12.030 -39.262 10.076 1.00 105.01 ? 36   DA  I P     1 
ATOM   8294  O  OP1   . DA  I 5 109 ? -11.924 -40.137 11.263 1.00 104.38 ? 36   DA  I OP1   1 
ATOM   8295  O  OP2   . DA  I 5 109 ? -12.847 -39.698 8.918  1.00 104.82 ? 36   DA  I OP2   1 
ATOM   8296  O  "O5'" . DA  I 5 109 ? -12.557 -37.813 10.523 1.00 103.51 ? 36   DA  I "O5'" 1 
ATOM   8297  C  "C5'" . DA  I 5 109 ? -11.672 -36.826 11.070 1.00 101.57 ? 36   DA  I "C5'" 1 
ATOM   8298  C  "C4'" . DA  I 5 109 ? -12.308 -35.451 10.996 1.00 100.75 ? 36   DA  I "C4'" 1 
ATOM   8299  O  "O4'" . DA  I 5 109 ? -11.922 -34.807 9.752  1.00 100.93 ? 36   DA  I "O4'" 1 
ATOM   8300  C  "C3'" . DA  I 5 109 ? -13.838 -35.435 11.048 1.00 100.21 ? 36   DA  I "C3'" 1 
ATOM   8301  O  "O3'" . DA  I 5 109 ? -14.259 -34.452 11.994 1.00 99.09  ? 36   DA  I "O3'" 1 
ATOM   8302  C  "C2'" . DA  I 5 109 ? -14.226 -35.098 9.610  1.00 100.76 ? 36   DA  I "C2'" 1 
ATOM   8303  C  "C1'" . DA  I 5 109 ? -13.071 -34.188 9.210  1.00 101.18 ? 36   DA  I "C1'" 1 
ATOM   8304  N  N9    . DA  I 5 109 ? -12.916 -34.010 7.771  1.00 101.38 ? 36   DA  I N9    1 
ATOM   8305  C  C8    . DA  I 5 109 ? -13.113 -34.952 6.804  1.00 101.27 ? 36   DA  I C8    1 
ATOM   8306  N  N7    . DA  I 5 109 ? -12.901 -34.508 5.591  1.00 101.98 ? 36   DA  I N7    1 
ATOM   8307  C  C5    . DA  I 5 109 ? -12.538 -33.184 5.772  1.00 102.10 ? 36   DA  I C5    1 
ATOM   8308  C  C6    . DA  I 5 109 ? -12.179 -32.156 4.868  1.00 102.37 ? 36   DA  I C6    1 
ATOM   8309  N  N6    . DA  I 5 109 ? -12.131 -32.325 3.540  1.00 102.85 ? 36   DA  I N6    1 
ATOM   8310  N  N1    . DA  I 5 109 ? -11.872 -30.941 5.380  1.00 102.36 ? 36   DA  I N1    1 
ATOM   8311  C  C2    . DA  I 5 109 ? -11.923 -30.769 6.708  1.00 102.12 ? 36   DA  I C2    1 
ATOM   8312  N  N3    . DA  I 5 109 ? -12.242 -31.658 7.652  1.00 101.93 ? 36   DA  I N3    1 
ATOM   8313  C  C4    . DA  I 5 109 ? -12.543 -32.858 7.116  1.00 101.87 ? 36   DA  I C4    1 
ATOM   8314  P  P     . DA  I 5 110 ? -15.783 -34.127 12.402 1.00 98.47  ? 37   DA  I P     1 
ATOM   8315  O  OP1   . DA  I 5 110 ? -15.995 -34.703 13.747 1.00 97.25  ? 37   DA  I OP1   1 
ATOM   8316  O  OP2   . DA  I 5 110 ? -16.713 -34.478 11.301 1.00 98.08  ? 37   DA  I OP2   1 
ATOM   8317  O  "O5'" . DA  I 5 110 ? -15.765 -32.531 12.528 1.00 98.04  ? 37   DA  I "O5'" 1 
ATOM   8318  C  "C5'" . DA  I 5 110 ? -14.557 -31.782 12.367 1.00 98.55  ? 37   DA  I "C5'" 1 
ATOM   8319  C  "C4'" . DA  I 5 110 ? -14.842 -30.407 11.774 1.00 99.45  ? 37   DA  I "C4'" 1 
ATOM   8320  O  "O4'" . DA  I 5 110 ? -14.438 -30.371 10.371 1.00 100.42 ? 37   DA  I "O4'" 1 
ATOM   8321  C  "C3'" . DA  I 5 110 ? -16.309 -29.979 11.822 1.00 99.05  ? 37   DA  I "C3'" 1 
ATOM   8322  O  "O3'" . DA  I 5 110 ? -16.433 -28.620 12.208 1.00 97.96  ? 37   DA  I "O3'" 1 
ATOM   8323  C  "C2'" . DA  I 5 110 ? -16.788 -30.186 10.389 1.00 100.18 ? 37   DA  I "C2'" 1 
ATOM   8324  C  "C1'" . DA  I 5 110 ? -15.529 -29.983 9.557  1.00 101.20 ? 37   DA  I "C1'" 1 
ATOM   8325  N  N9    . DA  I 5 110 ? -15.569 -30.781 8.332  1.00 102.47 ? 37   DA  I N9    1 
ATOM   8326  C  C8    . DA  I 5 110 ? -15.897 -32.107 8.216  1.00 102.81 ? 37   DA  I C8    1 
ATOM   8327  N  N7    . DA  I 5 110 ? -15.859 -32.568 6.990  1.00 103.46 ? 37   DA  I N7    1 
ATOM   8328  C  C5    . DA  I 5 110 ? -15.485 -31.465 6.244  1.00 103.89 ? 37   DA  I C5    1 
ATOM   8329  C  C6    . DA  I 5 110 ? -15.265 -31.286 4.860  1.00 104.60 ? 37   DA  I C6    1 
ATOM   8330  N  N6    . DA  I 5 110 ? -15.400 -32.268 3.965  1.00 104.52 ? 37   DA  I N6    1 
ATOM   8331  N  N1    . DA  I 5 110 ? -14.893 -30.057 4.429  1.00 105.00 ? 37   DA  I N1    1 
ATOM   8332  C  C2    . DA  I 5 110 ? -14.759 -29.075 5.336  1.00 105.43 ? 37   DA  I C2    1 
ATOM   8333  N  N3    . DA  I 5 110 ? -14.937 -29.122 6.663  1.00 104.80 ? 37   DA  I N3    1 
ATOM   8334  C  C4    . DA  I 5 110 ? -15.305 -30.356 7.055  1.00 103.50 ? 37   DA  I C4    1 
ATOM   8335  P  P     . DT  I 5 111 ? -17.877 -27.956 12.367 1.00 96.52  ? 38   DT  I P     1 
ATOM   8336  O  OP1   . DT  I 5 111 ? -17.989 -27.423 13.740 1.00 96.26  ? 38   DT  I OP1   1 
ATOM   8337  O  OP2   . DT  I 5 111 ? -18.876 -28.925 11.890 1.00 95.93  ? 38   DT  I OP2   1 
ATOM   8338  O  "O5'" . DT  I 5 111 ? -17.847 -26.734 11.338 1.00 98.35  ? 38   DT  I "O5'" 1 
ATOM   8339  C  "C5'" . DT  I 5 111 ? -16.676 -25.916 11.221 1.00 100.82 ? 38   DT  I "C5'" 1 
ATOM   8340  C  "C4'" . DT  I 5 111 ? -16.678 -25.202 9.879  1.00 102.74 ? 38   DT  I "C4'" 1 
ATOM   8341  O  "O4'" . DT  I 5 111 ? -16.569 -26.175 8.803  1.00 102.62 ? 38   DT  I "O4'" 1 
ATOM   8342  C  "C3'" . DT  I 5 111 ? -17.929 -24.373 9.588  1.00 103.93 ? 38   DT  I "C3'" 1 
ATOM   8343  O  "O3'" . DT  I 5 111 ? -17.530 -23.115 9.043  1.00 106.34 ? 38   DT  I "O3'" 1 
ATOM   8344  C  "C2'" . DT  I 5 111 ? -18.705 -25.238 8.593  1.00 103.35 ? 38   DT  I "C2'" 1 
ATOM   8345  C  "C1'" . DT  I 5 111 ? -17.541 -25.854 7.822  1.00 102.85 ? 38   DT  I "C1'" 1 
ATOM   8346  N  N1    . DT  I 5 111 ? -17.850 -27.076 7.007  1.00 102.62 ? 38   DT  I N1    1 
ATOM   8347  C  C2    . DT  I 5 111 ? -17.629 -27.040 5.634  1.00 102.40 ? 38   DT  I C2    1 
ATOM   8348  O  O2    . DT  I 5 111 ? -17.198 -26.062 5.034  1.00 102.04 ? 38   DT  I O2    1 
ATOM   8349  N  N3    . DT  I 5 111 ? -17.938 -28.210 4.973  1.00 102.01 ? 38   DT  I N3    1 
ATOM   8350  C  C4    . DT  I 5 111 ? -18.425 -29.381 5.533  1.00 101.93 ? 38   DT  I C4    1 
ATOM   8351  O  O4    . DT  I 5 111 ? -18.663 -30.370 4.844  1.00 101.61 ? 38   DT  I O4    1 
ATOM   8352  C  C5    . DT  I 5 111 ? -18.631 -29.352 6.968  1.00 101.95 ? 38   DT  I C5    1 
ATOM   8353  C  C7    . DT  I 5 111 ? -19.162 -30.560 7.687  1.00 101.96 ? 38   DT  I C7    1 
ATOM   8354  C  C6    . DT  I 5 111 ? -18.337 -28.218 7.628  1.00 102.13 ? 38   DT  I C6    1 
ATOM   8355  P  P     . DA  I 5 112 ? -18.593 -21.958 8.743  1.00 108.56 ? 39   DA  I P     1 
ATOM   8356  O  OP1   . DA  I 5 112 ? -17.861 -20.667 8.751  1.00 108.47 ? 39   DA  I OP1   1 
ATOM   8357  O  OP2   . DA  I 5 112 ? -19.754 -22.175 9.642  1.00 107.68 ? 39   DA  I OP2   1 
ATOM   8358  O  "O5'" . DA  I 5 112 ? -19.054 -22.283 7.239  1.00 111.09 ? 39   DA  I "O5'" 1 
ATOM   8359  C  "C5'" . DA  I 5 112 ? -18.179 -22.112 6.110  1.00 114.41 ? 39   DA  I "C5'" 1 
ATOM   8360  C  "C4'" . DA  I 5 112 ? -18.918 -22.226 4.778  1.00 116.90 ? 39   DA  I "C4'" 1 
ATOM   8361  O  "O4'" . DA  I 5 112 ? -19.065 -23.620 4.396  1.00 117.24 ? 39   DA  I "O4'" 1 
ATOM   8362  C  "C3'" . DA  I 5 112 ? -20.328 -21.631 4.731  1.00 118.44 ? 39   DA  I "C3'" 1 
ATOM   8363  O  "O3'" . DA  I 5 112 ? -20.494 -20.859 3.544  1.00 120.69 ? 39   DA  I "O3'" 1 
ATOM   8364  C  "C2'" . DA  I 5 112 ? -21.249 -22.848 4.736  1.00 117.97 ? 39   DA  I "C2'" 1 
ATOM   8365  C  "C1'" . DA  I 5 112 ? -20.390 -23.829 3.949  1.00 117.81 ? 39   DA  I "C1'" 1 
ATOM   8366  N  N9    . DA  I 5 112 ? -20.738 -25.232 4.143  1.00 118.17 ? 39   DA  I N9    1 
ATOM   8367  C  C8    . DA  I 5 112 ? -21.063 -25.866 5.314  1.00 118.31 ? 39   DA  I C8    1 
ATOM   8368  N  N7    . DA  I 5 112 ? -21.327 -27.144 5.172  1.00 118.52 ? 39   DA  I N7    1 
ATOM   8369  C  C5    . DA  I 5 112 ? -21.162 -27.362 3.814  1.00 118.88 ? 39   DA  I C5    1 
ATOM   8370  C  C6    . DA  I 5 112 ? -21.294 -28.516 3.010  1.00 119.30 ? 39   DA  I C6    1 
ATOM   8371  N  N6    . DA  I 5 112 ? -21.640 -29.715 3.496  1.00 119.36 ? 39   DA  I N6    1 
ATOM   8372  N  N1    . DA  I 5 112 ? -21.057 -28.388 1.681  1.00 119.57 ? 39   DA  I N1    1 
ATOM   8373  C  C2    . DA  I 5 112 ? -20.712 -27.185 1.188  1.00 119.37 ? 39   DA  I C2    1 
ATOM   8374  N  N3    . DA  I 5 112 ? -20.555 -26.032 1.844  1.00 118.96 ? 39   DA  I N3    1 
ATOM   8375  C  C4    . DA  I 5 112 ? -20.798 -26.192 3.163  1.00 118.67 ? 39   DA  I C4    1 
ATOM   8376  P  P     . DC  I 5 113 ? -21.447 -19.573 3.543  1.00 122.61 ? 40   DC  I P     1 
ATOM   8377  O  OP1   . DC  I 5 113 ? -21.062 -18.756 2.360  1.00 122.82 ? 40   DC  I OP1   1 
ATOM   8378  O  OP2   . DC  I 5 113 ? -21.429 -18.950 4.895  1.00 122.58 ? 40   DC  I OP2   1 
ATOM   8379  O  "O5'" . DC  I 5 113 ? -22.900 -20.222 3.336  1.00 123.86 ? 40   DC  I "O5'" 1 
ATOM   8380  C  "C5'" . DC  I 5 113 ? -23.648 -19.959 2.147  1.00 126.07 ? 40   DC  I "C5'" 1 
ATOM   8381  C  "C4'" . DC  I 5 113 ? -23.588 -21.159 1.215  1.00 127.70 ? 40   DC  I "C4'" 1 
ATOM   8382  O  "O4'" . DC  I 5 113 ? -23.350 -22.367 1.978  1.00 127.78 ? 40   DC  I "O4'" 1 
ATOM   8383  C  "C3'" . DC  I 5 113 ? -24.903 -21.436 0.503  1.00 128.90 ? 40   DC  I "C3'" 1 
ATOM   8384  O  "O3'" . DC  I 5 113 ? -24.929 -20.732 -0.738 1.00 130.76 ? 40   DC  I "O3'" 1 
ATOM   8385  C  "C2'" . DC  I 5 113 ? -24.897 -22.955 0.296  1.00 128.36 ? 40   DC  I "C2'" 1 
ATOM   8386  C  "C1'" . DC  I 5 113 ? -23.752 -23.454 1.172  1.00 127.80 ? 40   DC  I "C1'" 1 
ATOM   8387  N  N1    . DC  I 5 113 ? -24.089 -24.636 2.037  1.00 127.47 ? 40   DC  I N1    1 
ATOM   8388  C  C2    . DC  I 5 113 ? -23.956 -25.935 1.511  1.00 127.34 ? 40   DC  I C2    1 
ATOM   8389  O  O2    . DC  I 5 113 ? -23.577 -26.095 0.342  1.00 127.39 ? 40   DC  I O2    1 
ATOM   8390  N  N3    . DC  I 5 113 ? -24.255 -26.999 2.300  1.00 127.07 ? 40   DC  I N3    1 
ATOM   8391  C  C4    . DC  I 5 113 ? -24.663 -26.809 3.557  1.00 126.79 ? 40   DC  I C4    1 
ATOM   8392  N  N4    . DC  I 5 113 ? -24.940 -27.896 4.282  1.00 126.51 ? 40   DC  I N4    1 
ATOM   8393  C  C5    . DC  I 5 113 ? -24.804 -25.501 4.117  1.00 126.84 ? 40   DC  I C5    1 
ATOM   8394  C  C6    . DC  I 5 113 ? -24.507 -24.454 3.331  1.00 127.09 ? 40   DC  I C6    1 
ATOM   8395  P  P     . DA  I 5 114 ? -26.308 -20.150 -1.317 1.00 132.25 ? 41   DA  I P     1 
ATOM   8396  O  OP1   . DA  I 5 114 ? -25.972 -19.288 -2.477 1.00 132.31 ? 41   DA  I OP1   1 
ATOM   8397  O  OP2   . DA  I 5 114 ? -27.116 -19.613 -0.195 1.00 131.59 ? 41   DA  I OP2   1 
ATOM   8398  O  "O5'" . DA  I 5 114 ? -27.052 -21.460 -1.843 1.00 133.21 ? 41   DA  I "O5'" 1 
ATOM   8399  C  "C5'" . DA  I 5 114 ? -26.512 -22.217 -2.926 1.00 135.18 ? 41   DA  I "C5'" 1 
ATOM   8400  C  "C4'" . DA  I 5 114 ? -27.173 -23.582 -2.965 1.00 136.51 ? 41   DA  I "C4'" 1 
ATOM   8401  O  "O4'" . DA  I 5 114 ? -26.772 -24.329 -1.787 1.00 136.54 ? 41   DA  I "O4'" 1 
ATOM   8402  C  "C3'" . DA  I 5 114 ? -28.705 -23.529 -2.963 1.00 137.45 ? 41   DA  I "C3'" 1 
ATOM   8403  O  "O3'" . DA  I 5 114 ? -29.264 -24.364 -3.980 1.00 138.76 ? 41   DA  I "O3'" 1 
ATOM   8404  C  "C2'" . DA  I 5 114 ? -29.078 -24.025 -1.570 1.00 137.14 ? 41   DA  I "C2'" 1 
ATOM   8405  C  "C1'" . DA  I 5 114 ? -27.919 -24.966 -1.273 1.00 136.87 ? 41   DA  I "C1'" 1 
ATOM   8406  N  N9    . DA  I 5 114 ? -27.812 -25.247 0.154  1.00 136.95 ? 41   DA  I N9    1 
ATOM   8407  C  C8    . DA  I 5 114 ? -27.580 -24.369 1.181  1.00 136.93 ? 41   DA  I C8    1 
ATOM   8408  N  N7    . DA  I 5 114 ? -27.569 -24.938 2.363  1.00 136.95 ? 41   DA  I N7    1 
ATOM   8409  C  C5    . DA  I 5 114 ? -27.811 -26.276 2.092  1.00 136.98 ? 41   DA  I C5    1 
ATOM   8410  C  C6    . DA  I 5 114 ? -27.923 -27.419 2.915  1.00 137.00 ? 41   DA  I C6    1 
ATOM   8411  N  N6    . DA  I 5 114 ? -27.793 -27.368 4.243  1.00 136.74 ? 41   DA  I N6    1 
ATOM   8412  N  N1    . DA  I 5 114 ? -28.174 -28.615 2.318  1.00 137.06 ? 41   DA  I N1    1 
ATOM   8413  C  C2    . DA  I 5 114 ? -28.304 -28.670 0.985  1.00 136.91 ? 41   DA  I C2    1 
ATOM   8414  N  N3    . DA  I 5 114 ? -28.222 -27.663 0.113  1.00 136.94 ? 41   DA  I N3    1 
ATOM   8415  C  C4    . DA  I 5 114 ? -27.971 -26.487 0.734  1.00 136.96 ? 41   DA  I C4    1 
ATOM   8416  P  P     . DC  I 5 115 ? -30.742 -24.100 -4.553 1.00 139.70 ? 42   DC  I P     1 
ATOM   8417  O  OP1   . DC  I 5 115 ? -30.640 -22.970 -5.504 1.00 139.61 ? 42   DC  I OP1   1 
ATOM   8418  O  OP2   . DC  I 5 115 ? -31.709 -24.028 -3.428 1.00 139.07 ? 42   DC  I OP2   1 
ATOM   8419  O  "O5'" . DC  I 5 115 ? -31.054 -25.440 -5.380 1.00 140.26 ? 42   DC  I "O5'" 1 
ATOM   8420  C  "C5'" . DC  I 5 115 ? -30.490 -26.707 -5.007 1.00 140.90 ? 42   DC  I "C5'" 1 
ATOM   8421  C  "C4'" . DC  I 5 115 ? -31.339 -27.499 -4.011 1.00 141.41 ? 42   DC  I "C4'" 1 
ATOM   8422  O  "O4'" . DC  I 5 115 ? -30.913 -27.216 -2.652 1.00 141.82 ? 42   DC  I "O4'" 1 
ATOM   8423  C  "C3'" . DC  I 5 115 ? -32.862 -27.276 -4.016 1.00 141.27 ? 42   DC  I "C3'" 1 
ATOM   8424  O  "O3'" . DC  I 5 115 ? -33.514 -28.369 -4.732 1.00 140.41 ? 42   DC  I "O3'" 1 
ATOM   8425  C  "C2'" . DC  I 5 115 ? -33.233 -27.128 -2.529 1.00 141.62 ? 42   DC  I "C2'" 1 
ATOM   8426  C  "C1'" . DC  I 5 115 ? -31.975 -27.643 -1.824 1.00 142.16 ? 42   DC  I "C1'" 1 
ATOM   8427  N  N1    . DC  I 5 115 ? -31.781 -27.194 -0.388 1.00 142.71 ? 42   DC  I N1    1 
ATOM   8428  C  C2    . DC  I 5 115 ? -31.566 -28.147 0.635  1.00 142.84 ? 42   DC  I C2    1 
ATOM   8429  O  O2    . DC  I 5 115 ? -31.525 -29.359 0.365  1.00 142.84 ? 42   DC  I O2    1 
ATOM   8430  N  N3    . DC  I 5 115 ? -31.400 -27.711 1.917  1.00 142.72 ? 42   DC  I N3    1 
ATOM   8431  C  C4    . DC  I 5 115 ? -31.442 -26.403 2.201  1.00 142.59 ? 42   DC  I C4    1 
ATOM   8432  N  N4    . DC  I 5 115 ? -31.272 -26.029 3.472  1.00 142.19 ? 42   DC  I N4    1 
ATOM   8433  C  C5    . DC  I 5 115 ? -31.659 -25.421 1.184  1.00 142.70 ? 42   DC  I C5    1 
ATOM   8434  C  C6    . DC  I 5 115 ? -31.821 -25.855 -0.077 1.00 142.86 ? 42   DC  I C6    1 
ATOM   8435  P  P     . DT  I 5 116 ? -34.680 -29.347 -4.194 1.00 139.55 ? 43   DT  I P     1 
ATOM   8436  O  OP1   . DT  I 5 116 ? -35.051 -30.224 -5.333 1.00 139.59 ? 43   DT  I OP1   1 
ATOM   8437  O  OP2   . DT  I 5 116 ? -35.737 -28.545 -3.536 1.00 139.43 ? 43   DT  I OP2   1 
ATOM   8438  O  "O5'" . DT  I 5 116 ? -33.945 -30.224 -3.069 1.00 138.73 ? 43   DT  I "O5'" 1 
ATOM   8439  C  "C5'" . DT  I 5 116 ? -33.960 -31.654 -3.114 1.00 137.20 ? 43   DT  I "C5'" 1 
ATOM   8440  C  "C4'" . DT  I 5 116 ? -34.764 -32.251 -1.960 1.00 135.93 ? 43   DT  I "C4'" 1 
ATOM   8441  O  "O4'" . DT  I 5 116 ? -34.464 -31.556 -0.717 1.00 135.77 ? 43   DT  I "O4'" 1 
ATOM   8442  C  "C3'" . DT  I 5 116 ? -36.290 -32.228 -2.123 1.00 134.99 ? 43   DT  I "C3'" 1 
ATOM   8443  O  "O3'" . DT  I 5 116 ? -36.785 -33.562 -1.846 1.00 133.78 ? 43   DT  I "O3'" 1 
ATOM   8444  C  "C2'" . DT  I 5 116 ? -36.735 -31.159 -1.122 1.00 135.08 ? 43   DT  I "C2'" 1 
ATOM   8445  C  "C1'" . DT  I 5 116 ? -35.670 -31.283 -0.030 1.00 135.25 ? 43   DT  I "C1'" 1 
ATOM   8446  N  N1    . DT  I 5 116 ? -35.481 -30.075 0.857  1.00 134.82 ? 43   DT  I N1    1 
ATOM   8447  C  C2    . DT  I 5 116 ? -35.259 -30.241 2.220  1.00 134.34 ? 43   DT  I C2    1 
ATOM   8448  O  O2    . DT  I 5 116 ? -35.205 -31.323 2.783  1.00 133.66 ? 43   DT  I O2    1 
ATOM   8449  N  N3    . DT  I 5 116 ? -35.100 -29.068 2.921  1.00 134.32 ? 43   DT  I N3    1 
ATOM   8450  C  C4    . DT  I 5 116 ? -35.135 -27.776 2.418  1.00 134.47 ? 43   DT  I C4    1 
ATOM   8451  O  O4    . DT  I 5 116 ? -34.977 -26.795 3.140  1.00 134.37 ? 43   DT  I O4    1 
ATOM   8452  C  C5    . DT  I 5 116 ? -35.369 -27.669 0.993  1.00 134.67 ? 43   DT  I C5    1 
ATOM   8453  C  C7    . DT  I 5 116 ? -35.433 -26.326 0.320  1.00 134.68 ? 43   DT  I C7    1 
ATOM   8454  C  C6    . DT  I 5 116 ? -35.525 -28.806 0.295  1.00 134.78 ? 43   DT  I C6    1 
ATOM   8455  P  P     . DT  I 5 117 ? -38.236 -33.945 -1.257 1.00 132.84 ? 44   DT  I P     1 
ATOM   8456  O  OP1   . DT  I 5 117 ? -38.531 -35.345 -1.650 1.00 132.64 ? 44   DT  I OP1   1 
ATOM   8457  O  OP2   . DT  I 5 117 ? -39.223 -32.881 -1.570 1.00 132.97 ? 44   DT  I OP2   1 
ATOM   8458  O  "O5'" . DT  I 5 117 ? -37.988 -33.932 0.322  1.00 131.65 ? 44   DT  I "O5'" 1 
ATOM   8459  C  "C5'" . DT  I 5 117 ? -37.248 -34.981 0.950  1.00 129.74 ? 44   DT  I "C5'" 1 
ATOM   8460  C  "C4'" . DT  I 5 117 ? -37.416 -34.923 2.462  1.00 127.99 ? 44   DT  I "C4'" 1 
ATOM   8461  O  "O4'" . DT  I 5 117 ? -37.190 -33.559 2.917  1.00 127.74 ? 44   DT  I "O4'" 1 
ATOM   8462  C  "C3'" . DT  I 5 117 ? -38.797 -35.329 2.976  1.00 126.84 ? 44   DT  I "C3'" 1 
ATOM   8463  O  "O3'" . DT  I 5 117 ? -38.647 -36.256 4.062  1.00 125.05 ? 44   DT  I "O3'" 1 
ATOM   8464  C  "C2'" . DT  I 5 117 ? -39.442 -34.008 3.404  1.00 126.94 ? 44   DT  I "C2'" 1 
ATOM   8465  C  "C1'" . DT  I 5 117 ? -38.227 -33.170 3.796  1.00 127.24 ? 44   DT  I "C1'" 1 
ATOM   8466  N  N1    . DT  I 5 117 ? -38.418 -31.675 3.724  1.00 127.14 ? 44   DT  I N1    1 
ATOM   8467  C  C2    . DT  I 5 117 ? -38.340 -30.928 4.890  1.00 127.02 ? 44   DT  I C2    1 
ATOM   8468  O  O2    . DT  I 5 117 ? -38.127 -31.404 5.992  1.00 126.72 ? 44   DT  I O2    1 
ATOM   8469  N  N3    . DT  I 5 117 ? -38.523 -29.575 4.725  1.00 127.09 ? 44   DT  I N3    1 
ATOM   8470  C  C4    . DT  I 5 117 ? -38.769 -28.903 3.541  1.00 127.21 ? 44   DT  I C4    1 
ATOM   8471  O  O4    . DT  I 5 117 ? -38.917 -27.684 3.513  1.00 127.17 ? 44   DT  I O4    1 
ATOM   8472  C  C5    . DT  I 5 117 ? -38.838 -29.737 2.357  1.00 127.39 ? 44   DT  I C5    1 
ATOM   8473  C  C7    . DT  I 5 117 ? -39.101 -29.128 1.008  1.00 127.61 ? 44   DT  I C7    1 
ATOM   8474  C  C6    . DT  I 5 117 ? -38.662 -31.062 2.503  1.00 127.27 ? 44   DT  I C6    1 
ATOM   8475  P  P     . DT  I 5 118 ? -39.866 -37.158 4.613  1.00 123.69 ? 45   DT  I P     1 
ATOM   8476  O  OP1   . DT  I 5 118 ? -39.399 -38.566 4.719  1.00 123.28 ? 45   DT  I OP1   1 
ATOM   8477  O  OP2   . DT  I 5 118 ? -41.114 -36.837 3.876  1.00 123.76 ? 45   DT  I OP2   1 
ATOM   8478  O  "O5'" . DT  I 5 118 ? -40.072 -36.595 6.093  1.00 122.67 ? 45   DT  I "O5'" 1 
ATOM   8479  C  "C5'" . DT  I 5 118 ? -39.006 -36.642 7.042  1.00 121.11 ? 45   DT  I "C5'" 1 
ATOM   8480  C  "C4'" . DT  I 5 118 ? -39.279 -35.658 8.167  1.00 119.63 ? 45   DT  I "C4'" 1 
ATOM   8481  O  "O4'" . DT  I 5 118 ? -39.147 -34.302 7.673  1.00 119.69 ? 45   DT  I "O4'" 1 
ATOM   8482  C  "C3'" . DT  I 5 118 ? -40.704 -35.709 8.710  1.00 118.38 ? 45   DT  I "C3'" 1 
ATOM   8483  O  "O3'" . DT  I 5 118 ? -40.951 -36.795 9.652  1.00 116.03 ? 45   DT  I "O3'" 1 
ATOM   8484  C  "C2'" . DT  I 5 118 ? -40.884 -34.309 9.297  1.00 119.09 ? 45   DT  I "C2'" 1 
ATOM   8485  C  "C1'" . DT  I 5 118 ? -39.938 -33.438 8.469  1.00 119.94 ? 45   DT  I "C1'" 1 
ATOM   8486  N  N1    . DT  I 5 118 ? -40.641 -32.426 7.597  1.00 121.05 ? 45   DT  I N1    1 
ATOM   8487  C  C2    . DT  I 5 118 ? -40.561 -31.082 7.923  1.00 121.53 ? 45   DT  I C2    1 
ATOM   8488  O  O2    . DT  I 5 118 ? -39.946 -30.660 8.885  1.00 121.88 ? 45   DT  I O2    1 
ATOM   8489  N  N3    . DT  I 5 118 ? -41.232 -30.234 7.072  1.00 121.86 ? 45   DT  I N3    1 
ATOM   8490  C  C4    . DT  I 5 118 ? -41.966 -30.584 5.948  1.00 121.95 ? 45   DT  I C4    1 
ATOM   8491  O  O4    . DT  I 5 118 ? -42.530 -29.740 5.253  1.00 121.93 ? 45   DT  I O4    1 
ATOM   8492  C  C5    . DT  I 5 118 ? -42.013 -32.004 5.662  1.00 121.95 ? 45   DT  I C5    1 
ATOM   8493  C  C7    . DT  I 5 118 ? -42.773 -32.525 4.475  1.00 122.12 ? 45   DT  I C7    1 
ATOM   8494  C  C6    . DT  I 5 118 ? -41.360 -32.842 6.486  1.00 121.54 ? 45   DT  I C6    1 
ATOM   8495  P  P     . DT  I 5 119 ? -39.986 -37.353 10.814 1.00 113.92 ? 46   DT  I P     1 
ATOM   8496  O  OP1   . DT  I 5 119 ? -38.620 -37.562 10.283 1.00 113.54 ? 46   DT  I OP1   1 
ATOM   8497  O  OP2   . DT  I 5 119 ? -40.678 -38.504 11.431 1.00 113.24 ? 46   DT  I OP2   1 
ATOM   8498  O  "O5'" . DT  I 5 119 ? -40.012 -36.191 11.914 1.00 113.28 ? 46   DT  I "O5'" 1 
ATOM   8499  C  "C5'" . DT  I 5 119 ? -38.930 -35.262 12.057 1.00 112.03 ? 46   DT  I "C5'" 1 
ATOM   8500  C  "C4'" . DT  I 5 119 ? -39.302 -34.097 12.961 1.00 110.76 ? 46   DT  I "C4'" 1 
ATOM   8501  O  "O4'" . DT  I 5 119 ? -39.966 -33.022 12.237 1.00 111.21 ? 46   DT  I "O4'" 1 
ATOM   8502  C  "C3'" . DT  I 5 119 ? -40.211 -34.457 14.128 1.00 109.83 ? 46   DT  I "C3'" 1 
ATOM   8503  O  "O3'" . DT  I 5 119 ? -39.526 -33.923 15.272 1.00 108.02 ? 46   DT  I "O3'" 1 
ATOM   8504  C  "C2'" . DT  I 5 119 ? -41.553 -33.775 13.779 1.00 110.57 ? 46   DT  I "C2'" 1 
ATOM   8505  C  "C1'" . DT  I 5 119 ? -41.115 -32.575 12.941 1.00 111.27 ? 46   DT  I "C1'" 1 
ATOM   8506  N  N1    . DT  I 5 119 ? -42.088 -32.010 11.914 1.00 111.84 ? 46   DT  I N1    1 
ATOM   8507  C  C2    . DT  I 5 119 ? -42.169 -30.630 11.736 1.00 112.21 ? 46   DT  I C2    1 
ATOM   8508  O  O2    . DT  I 5 119 ? -41.524 -29.804 12.368 1.00 111.92 ? 46   DT  I O2    1 
ATOM   8509  N  N3    . DT  I 5 119 ? -43.061 -30.225 10.770 1.00 112.76 ? 46   DT  I N3    1 
ATOM   8510  C  C4    . DT  I 5 119 ? -43.864 -31.031 9.968  1.00 112.93 ? 46   DT  I C4    1 
ATOM   8511  O  O4    . DT  I 5 119 ? -44.628 -30.550 9.129  1.00 113.36 ? 46   DT  I O4    1 
ATOM   8512  C  C5    . DT  I 5 119 ? -43.731 -32.458 10.194 1.00 112.62 ? 46   DT  I C5    1 
ATOM   8513  C  C7    . DT  I 5 119 ? -44.544 -33.445 9.393  1.00 112.67 ? 46   DT  I C7    1 
ATOM   8514  C  C6    . DT  I 5 119 ? -42.866 -32.868 11.139 1.00 112.11 ? 46   DT  I C6    1 
ATOM   8515  P  P     . DG  I 5 120 ? -39.844 -34.416 16.784 1.00 106.45 ? 47   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 5 120 ? -38.613 -35.042 17.365 1.00 105.33 ? 47   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 5 120 ? -41.156 -35.122 16.822 1.00 106.58 ? 47   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 5 120 ? -40.060 -33.020 17.541 1.00 104.72 ? 47   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 5 120 ? -39.044 -31.995 17.398 1.00 101.99 ? 47   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 5 120 ? -39.726 -30.648 17.581 1.00 100.13 ? 47   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 5 120 ? -40.697 -30.455 16.514 1.00 100.45 ? 47   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 5 120 ? -40.493 -30.507 18.888 1.00 98.97  ? 47   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 5 120 ? -40.231 -29.220 19.429 1.00 96.49  ? 47   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 5 120 ? -41.966 -30.706 18.501 1.00 99.29  ? 47   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 5 120 ? -41.992 -30.227 17.052 1.00 100.40 ? 47   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 5 120 ? -42.997 -30.851 16.182 1.00 100.73 ? 47   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 5 120 ? -43.385 -32.169 16.150 1.00 100.52 ? 47   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 5 120 ? -44.302 -32.426 15.261 1.00 100.70 ? 47   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 5 120 ? -44.543 -31.201 14.658 1.00 101.39 ? 47   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 5 120 ? -45.442 -30.852 13.616 1.00 101.73 ? 47   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 5 120 ? -46.228 -31.594 13.006 1.00 101.68 ? 47   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 5 120 ? -45.376 -29.491 13.297 1.00 101.96 ? 47   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 5 120 ? -44.544 -28.575 13.909 1.00 102.23 ? 47   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 5 120 ? -44.614 -27.303 13.475 1.00 102.50 ? 47   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 5 120 ? -43.698 -28.895 14.887 1.00 102.09 ? 47   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 5 120 ? -43.747 -30.219 15.211 1.00 101.44 ? 47   DG  I C4    1 
ATOM   8537  P  P     . DG  I 5 121 ? -40.604 -28.891 20.949 1.00 94.85  ? 48   DG  I P     1 
ATOM   8538  O  OP1   . DG  I 5 121 ? -39.376 -28.367 21.588 1.00 95.28  ? 48   DG  I OP1   1 
ATOM   8539  O  OP2   . DG  I 5 121 ? -41.320 -30.029 21.560 1.00 94.26  ? 48   DG  I OP2   1 
ATOM   8540  O  "O5'" . DG  I 5 121 ? -41.681 -27.720 20.795 1.00 96.84  ? 48   DG  I "O5'" 1 
ATOM   8541  C  "C5'" . DG  I 5 121 ? -41.366 -26.530 20.076 1.00 98.78  ? 48   DG  I "C5'" 1 
ATOM   8542  C  "C4'" . DG  I 5 121 ? -42.637 -25.862 19.593 1.00 100.12 ? 48   DG  I "C4'" 1 
ATOM   8543  O  "O4'" . DG  I 5 121 ? -43.332 -26.735 18.669 1.00 100.50 ? 48   DG  I "O4'" 1 
ATOM   8544  C  "C3'" . DG  I 5 121 ? -43.640 -25.527 20.693 1.00 101.14 ? 48   DG  I "C3'" 1 
ATOM   8545  O  "O3'" . DG  I 5 121 ? -43.956 -24.150 20.576 1.00 102.73 ? 48   DG  I "O3'" 1 
ATOM   8546  C  "C2'" . DG  I 5 121 ? -44.839 -26.431 20.402 1.00 101.14 ? 48   DG  I "C2'" 1 
ATOM   8547  C  "C1'" . DG  I 5 121 ? -44.714 -26.553 18.889 1.00 101.37 ? 48   DG  I "C1'" 1 
ATOM   8548  N  N9    . DG  I 5 121 ? -45.468 -27.622 18.226 1.00 102.11 ? 48   DG  I N9    1 
ATOM   8549  C  C8    . DG  I 5 121 ? -45.574 -28.958 18.557 1.00 102.18 ? 48   DG  I C8    1 
ATOM   8550  N  N7    . DG  I 5 121 ? -46.331 -29.644 17.740 1.00 102.20 ? 48   DG  I N7    1 
ATOM   8551  C  C5    . DG  I 5 121 ? -46.753 -28.703 16.803 1.00 103.00 ? 48   DG  I C5    1 
ATOM   8552  C  C6    . DG  I 5 121 ? -47.593 -28.836 15.660 1.00 103.86 ? 48   DG  I C6    1 
ATOM   8553  O  O6    . DG  I 5 121 ? -48.158 -29.863 15.234 1.00 104.37 ? 48   DG  I O6    1 
ATOM   8554  N  N1    . DG  I 5 121 ? -47.760 -27.612 14.979 1.00 104.07 ? 48   DG  I N1    1 
ATOM   8555  C  C2    . DG  I 5 121 ? -47.190 -26.407 15.346 1.00 103.47 ? 48   DG  I C2    1 
ATOM   8556  N  N2    . DG  I 5 121 ? -47.454 -25.334 14.576 1.00 103.07 ? 48   DG  I N2    1 
ATOM   8557  N  N3    . DG  I 5 121 ? -46.405 -26.277 16.411 1.00 103.33 ? 48   DG  I N3    1 
ATOM   8558  C  C4    . DG  I 5 121 ? -46.229 -27.455 17.088 1.00 102.92 ? 48   DG  I C4    1 
ATOM   8559  P  P     . DT  I 5 122 ? -44.928 -23.430 21.620 1.00 104.18 ? 49   DT  I P     1 
ATOM   8560  O  OP1   . DT  I 5 122 ? -44.344 -22.103 21.926 1.00 104.39 ? 49   DT  I OP1   1 
ATOM   8561  O  OP2   . DT  I 5 122 ? -45.285 -24.368 22.708 1.00 103.65 ? 49   DT  I OP2   1 
ATOM   8562  O  "O5'" . DT  I 5 122 ? -46.255 -23.259 20.753 1.00 106.44 ? 49   DT  I "O5'" 1 
ATOM   8563  C  "C5'" . DT  I 5 122 ? -46.325 -22.278 19.729 1.00 109.61 ? 49   DT  I "C5'" 1 
ATOM   8564  C  "C4'" . DT  I 5 122 ? -47.700 -22.321 19.098 1.00 111.92 ? 49   DT  I "C4'" 1 
ATOM   8565  O  "O4'" . DT  I 5 122 ? -47.946 -23.661 18.621 1.00 112.14 ? 49   DT  I "O4'" 1 
ATOM   8566  C  "C3'" . DT  I 5 122 ? -48.852 -21.949 20.027 1.00 113.82 ? 49   DT  I "C3'" 1 
ATOM   8567  O  "O3'" . DT  I 5 122 ? -49.520 -20.849 19.408 1.00 117.51 ? 49   DT  I "O3'" 1 
ATOM   8568  C  "C2'" . DT  I 5 122 ? -49.712 -23.215 20.122 1.00 112.96 ? 49   DT  I "C2'" 1 
ATOM   8569  C  "C1'" . DT  I 5 122 ? -49.268 -24.047 18.921 1.00 112.58 ? 49   DT  I "C1'" 1 
ATOM   8570  N  N1    . DT  I 5 122 ? -49.260 -25.540 19.122 1.00 112.53 ? 49   DT  I N1    1 
ATOM   8571  C  C2    . DT  I 5 122 ? -49.599 -26.373 18.066 1.00 112.57 ? 49   DT  I C2    1 
ATOM   8572  O  O2    . DT  I 5 122 ? -49.917 -25.973 16.959 1.00 113.07 ? 49   DT  I O2    1 
ATOM   8573  N  N3    . DT  I 5 122 ? -49.559 -27.717 18.345 1.00 112.07 ? 49   DT  I N3    1 
ATOM   8574  C  C4    . DT  I 5 122 ? -49.218 -28.309 19.547 1.00 111.95 ? 49   DT  I C4    1 
ATOM   8575  O  O4    . DT  I 5 122 ? -49.221 -29.531 19.672 1.00 111.15 ? 49   DT  I O4    1 
ATOM   8576  C  C5    . DT  I 5 122 ? -48.867 -27.386 20.613 1.00 112.26 ? 49   DT  I C5    1 
ATOM   8577  C  C7    . DT  I 5 122 ? -48.474 -27.880 21.978 1.00 112.49 ? 49   DT  I C7    1 
ATOM   8578  C  C6    . DT  I 5 122 ? -48.903 -26.069 20.350 1.00 112.34 ? 49   DT  I C6    1 
ATOM   8579  P  P     . DA  I 5 123 ? -50.689 -19.966 20.069 1.00 120.00 ? 50   DA  I P     1 
ATOM   8580  O  OP1   . DA  I 5 123 ? -50.129 -18.628 20.376 1.00 119.99 ? 50   DA  I OP1   1 
ATOM   8581  O  OP2   . DA  I 5 123 ? -51.381 -20.743 21.125 1.00 119.42 ? 50   DA  I OP2   1 
ATOM   8582  O  "O5'" . DA  I 5 123 ? -51.691 -19.804 18.829 1.00 122.56 ? 50   DA  I "O5'" 1 
ATOM   8583  C  "C5'" . DA  I 5 123 ? -51.748 -20.787 17.786 1.00 126.23 ? 50   DA  I "C5'" 1 
ATOM   8584  C  "C4'" . DA  I 5 123 ? -53.049 -21.580 17.810 1.00 129.11 ? 50   DA  I "C4'" 1 
ATOM   8585  O  "O4'" . DA  I 5 123 ? -52.738 -22.990 17.973 1.00 129.47 ? 50   DA  I "O4'" 1 
ATOM   8586  C  "C3'" . DA  I 5 123 ? -54.024 -21.242 18.942 1.00 131.11 ? 50   DA  I "C3'" 1 
ATOM   8587  O  "O3'" . DA  I 5 123 ? -55.340 -21.056 18.417 1.00 134.17 ? 50   DA  I "O3'" 1 
ATOM   8588  C  "C2'" . DA  I 5 123 ? -53.938 -22.455 19.868 1.00 130.57 ? 50   DA  I "C2'" 1 
ATOM   8589  C  "C1'" . DA  I 5 123 ? -53.717 -23.542 18.826 1.00 129.99 ? 50   DA  I "C1'" 1 
ATOM   8590  N  N9    . DA  I 5 123 ? -53.265 -24.843 19.319 1.00 130.26 ? 50   DA  I N9    1 
ATOM   8591  C  C8    . DA  I 5 123 ? -52.744 -25.161 20.551 1.00 130.32 ? 50   DA  I C8    1 
ATOM   8592  N  N7    . DA  I 5 123 ? -52.439 -26.434 20.693 1.00 130.42 ? 50   DA  I N7    1 
ATOM   8593  C  C5    . DA  I 5 123 ? -52.779 -26.991 19.468 1.00 130.56 ? 50   DA  I C5    1 
ATOM   8594  C  C6    . DA  I 5 123 ? -52.704 -28.312 18.965 1.00 130.66 ? 50   DA  I C6    1 
ATOM   8595  N  N6    . DA  I 5 123 ? -52.232 -29.340 19.686 1.00 130.80 ? 50   DA  I N6    1 
ATOM   8596  N  N1    . DA  I 5 123 ? -53.138 -28.544 17.695 1.00 130.67 ? 50   DA  I N1    1 
ATOM   8597  C  C2    . DA  I 5 123 ? -53.616 -27.511 16.974 1.00 130.70 ? 50   DA  I C2    1 
ATOM   8598  N  N3    . DA  I 5 123 ? -53.735 -26.226 17.340 1.00 130.62 ? 50   DA  I N3    1 
ATOM   8599  C  C4    . DA  I 5 123 ? -53.296 -26.028 18.609 1.00 130.59 ? 50   DA  I C4    1 
ATOM   8600  P  P     . DG  I 5 124 ? -56.373 -20.040 19.135 1.00 136.63 ? 51   DG  I P     1 
ATOM   8601  O  OP1   . DG  I 5 124 ? -56.128 -18.676 18.571 1.00 136.47 ? 51   DG  I OP1   1 
ATOM   8602  O  OP2   . DG  I 5 124 ? -56.331 -20.270 20.601 1.00 136.49 ? 51   DG  I OP2   1 
ATOM   8603  O  "O5'" . DG  I 5 124 ? -57.814 -20.562 18.650 1.00 137.63 ? 51   DG  I "O5'" 1 
ATOM   8604  C  "C5'" . DG  I 5 124 ? -58.002 -20.983 17.303 1.00 139.62 ? 51   DG  I "C5'" 1 
ATOM   8605  C  "C4'" . DG  I 5 124 ? -58.680 -22.336 17.332 1.00 141.11 ? 51   DG  I "C4'" 1 
ATOM   8606  O  "O4'" . DG  I 5 124 ? -57.699 -23.322 17.740 1.00 141.37 ? 51   DG  I "O4'" 1 
ATOM   8607  C  "C3'" . DG  I 5 124 ? -59.816 -22.405 18.356 1.00 142.06 ? 51   DG  I "C3'" 1 
ATOM   8608  O  "O3'" . DG  I 5 124 ? -61.093 -22.508 17.698 1.00 143.02 ? 51   DG  I "O3'" 1 
ATOM   8609  C  "C2'" . DG  I 5 124 ? -59.475 -23.613 19.236 1.00 142.18 ? 51   DG  I "C2'" 1 
ATOM   8610  C  "C1'" . DG  I 5 124 ? -58.385 -24.333 18.445 1.00 142.02 ? 51   DG  I "C1'" 1 
ATOM   8611  N  N9    . DG  I 5 124 ? -57.447 -25.059 19.297 1.00 142.33 ? 51   DG  I N9    1 
ATOM   8612  C  C8    . DG  I 5 124 ? -56.675 -24.542 20.312 1.00 142.57 ? 51   DG  I C8    1 
ATOM   8613  N  N7    . DG  I 5 124 ? -55.928 -25.431 20.910 1.00 142.69 ? 51   DG  I N7    1 
ATOM   8614  C  C5    . DG  I 5 124 ? -56.221 -26.623 20.253 1.00 142.64 ? 51   DG  I C5    1 
ATOM   8615  C  C6    . DG  I 5 124 ? -55.721 -27.943 20.461 1.00 142.50 ? 51   DG  I C6    1 
ATOM   8616  O  O6    . DG  I 5 124 ? -54.886 -28.331 21.297 1.00 142.01 ? 51   DG  I O6    1 
ATOM   8617  N  N1    . DG  I 5 124 ? -56.289 -28.861 19.570 1.00 142.57 ? 51   DG  I N1    1 
ATOM   8618  C  C2    . DG  I 5 124 ? -57.225 -28.542 18.602 1.00 142.67 ? 51   DG  I C2    1 
ATOM   8619  N  N2    . DG  I 5 124 ? -57.664 -29.551 17.834 1.00 142.61 ? 51   DG  I N2    1 
ATOM   8620  N  N3    . DG  I 5 124 ? -57.700 -27.315 18.400 1.00 142.54 ? 51   DG  I N3    1 
ATOM   8621  C  C4    . DG  I 5 124 ? -57.160 -26.407 19.257 1.00 142.52 ? 51   DG  I C4    1 
ATOM   8622  P  P     . DT  I 5 125 ? -62.487 -22.380 18.495 1.00 143.66 ? 52   DT  I P     1 
ATOM   8623  O  OP1   . DT  I 5 125 ? -63.525 -21.977 17.512 1.00 143.69 ? 52   DT  I OP1   1 
ATOM   8624  O  OP2   . DT  I 5 125 ? -62.277 -21.571 19.723 1.00 143.45 ? 52   DT  I OP2   1 
ATOM   8625  O  "O5'" . DT  I 5 125 ? -62.763 -23.893 18.942 1.00 143.71 ? 52   DT  I "O5'" 1 
ATOM   8626  C  "C5'" . DT  I 5 125 ? -62.703 -24.956 17.982 1.00 144.03 ? 52   DT  I "C5'" 1 
ATOM   8627  C  "C4'" . DT  I 5 125 ? -62.626 -26.306 18.668 1.00 144.13 ? 52   DT  I "C4'" 1 
ATOM   8628  O  "O4'" . DT  I 5 125 ? -61.276 -26.579 19.112 1.00 144.16 ? 52   DT  I "O4'" 1 
ATOM   8629  C  "C3'" . DT  I 5 125 ? -63.468 -26.419 19.932 1.00 144.30 ? 52   DT  I "C3'" 1 
ATOM   8630  O  "O3'" . DT  I 5 125 ? -64.777 -26.889 19.582 1.00 144.58 ? 52   DT  I "O3'" 1 
ATOM   8631  C  "C2'" . DT  I 5 125 ? -62.685 -27.404 20.800 1.00 144.23 ? 52   DT  I "C2'" 1 
ATOM   8632  C  "C1'" . DT  I 5 125 ? -61.379 -27.635 20.043 1.00 144.34 ? 52   DT  I "C1'" 1 
ATOM   8633  N  N1    . DT  I 5 125 ? -60.186 -27.668 20.959 1.00 144.70 ? 52   DT  I N1    1 
ATOM   8634  C  C2    . DT  I 5 125 ? -59.500 -28.874 21.119 1.00 144.68 ? 52   DT  I C2    1 
ATOM   8635  O  O2    . DT  I 5 125 ? -59.802 -29.923 20.544 1.00 144.15 ? 52   DT  I O2    1 
ATOM   8636  N  N3    . DT  I 5 125 ? -58.428 -28.801 21.989 1.00 144.85 ? 52   DT  I N3    1 
ATOM   8637  C  C4    . DT  I 5 125 ? -57.987 -27.679 22.707 1.00 144.91 ? 52   DT  I C4    1 
ATOM   8638  O  O4    . DT  I 5 125 ? -57.008 -27.734 23.454 1.00 144.77 ? 52   DT  I O4    1 
ATOM   8639  C  C5    . DT  I 5 125 ? -58.749 -26.450 22.494 1.00 144.87 ? 52   DT  I C5    1 
ATOM   8640  C  C7    . DT  I 5 125 ? -58.384 -25.158 23.203 1.00 144.62 ? 52   DT  I C7    1 
ATOM   8641  C  C6    . DT  I 5 125 ? -59.796 -26.507 21.647 1.00 144.84 ? 52   DT  I C6    1 
ATOM   8642  P  P     . DA  I 5 126 ? -65.943 -27.176 20.657 1.00 144.67 ? 53   DA  I P     1 
ATOM   8643  O  OP1   . DA  I 5 126 ? -67.241 -27.036 19.953 1.00 144.65 ? 53   DA  I OP1   1 
ATOM   8644  O  OP2   . DA  I 5 126 ? -65.690 -26.351 21.864 1.00 144.67 ? 53   DA  I OP2   1 
ATOM   8645  O  "O5'" . DA  I 5 126 ? -65.721 -28.723 21.038 1.00 144.16 ? 53   DA  I "O5'" 1 
ATOM   8646  C  "C5'" . DA  I 5 126 ? -65.255 -29.684 20.070 1.00 143.27 ? 53   DA  I "C5'" 1 
ATOM   8647  C  "C4'" . DA  I 5 126 ? -64.601 -30.882 20.751 1.00 142.42 ? 53   DA  I "C4'" 1 
ATOM   8648  O  "O4'" . DA  I 5 126 ? -63.242 -30.574 21.194 1.00 142.36 ? 53   DA  I "O4'" 1 
ATOM   8649  C  "C3'" . DA  I 5 126 ? -65.380 -31.379 21.965 1.00 141.79 ? 53   DA  I "C3'" 1 
ATOM   8650  O  "O3'" . DA  I 5 126 ? -65.700 -32.761 21.752 1.00 140.77 ? 53   DA  I "O3'" 1 
ATOM   8651  C  "C2'" . DA  I 5 126 ? -64.421 -31.118 23.129 1.00 142.03 ? 53   DA  I "C2'" 1 
ATOM   8652  C  "C1'" . DA  I 5 126 ? -63.049 -31.178 22.461 1.00 142.47 ? 53   DA  I "C1'" 1 
ATOM   8653  N  N9    . DA  I 5 126 ? -62.045 -30.449 23.243 1.00 142.93 ? 53   DA  I N9    1 
ATOM   8654  C  C8    . DA  I 5 126 ? -62.059 -29.108 23.526 1.00 143.07 ? 53   DA  I C8    1 
ATOM   8655  N  N7    . DA  I 5 126 ? -61.051 -28.699 24.261 1.00 143.14 ? 53   DA  I N7    1 
ATOM   8656  C  C5    . DA  I 5 126 ? -60.317 -29.854 24.492 1.00 142.98 ? 53   DA  I C5    1 
ATOM   8657  C  C6    . DA  I 5 126 ? -59.120 -30.091 25.210 1.00 142.65 ? 53   DA  I C6    1 
ATOM   8658  N  N6    . DA  I 5 126 ? -58.446 -29.126 25.846 1.00 142.29 ? 53   DA  I N6    1 
ATOM   8659  N  N1    . DA  I 5 126 ? -58.646 -31.358 25.251 1.00 142.46 ? 53   DA  I N1    1 
ATOM   8660  C  C2    . DA  I 5 126 ? -59.328 -32.320 24.610 1.00 142.60 ? 53   DA  I C2    1 
ATOM   8661  N  N3    . DA  I 5 126 ? -60.459 -32.223 23.901 1.00 142.85 ? 53   DA  I N3    1 
ATOM   8662  C  C4    . DA  I 5 126 ? -60.915 -30.949 23.875 1.00 143.02 ? 53   DA  I C4    1 
ATOM   8663  P  P     . DT  I 5 127 ? -65.813 -33.833 22.940 1.00 140.07 ? 54   DT  I P     1 
ATOM   8664  O  OP1   . DT  I 5 127 ? -66.366 -35.085 22.362 1.00 139.98 ? 54   DT  I OP1   1 
ATOM   8665  O  OP2   . DT  I 5 127 ? -66.508 -33.203 24.092 1.00 140.12 ? 54   DT  I OP2   1 
ATOM   8666  O  "O5'" . DT  I 5 127 ? -64.270 -34.056 23.332 1.00 137.92 ? 54   DT  I "O5'" 1 
ATOM   8667  C  "C5'" . DT  I 5 127 ? -63.456 -35.065 22.720 1.00 134.43 ? 54   DT  I "C5'" 1 
ATOM   8668  C  "C4'" . DT  I 5 127 ? -62.869 -35.983 23.783 1.00 131.67 ? 54   DT  I "C4'" 1 
ATOM   8669  O  "O4'" . DT  I 5 127 ? -61.844 -35.258 24.508 1.00 131.17 ? 54   DT  I "O4'" 1 
ATOM   8670  C  "C3'" . DT  I 5 127 ? -63.865 -36.496 24.826 1.00 129.94 ? 54   DT  I "C3'" 1 
ATOM   8671  O  "O3'" . DT  I 5 127 ? -63.656 -37.904 25.011 1.00 127.45 ? 54   DT  I "O3'" 1 
ATOM   8672  C  "C2'" . DT  I 5 127 ? -63.573 -35.659 26.075 1.00 130.17 ? 54   DT  I "C2'" 1 
ATOM   8673  C  "C1'" . DT  I 5 127 ? -62.109 -35.264 25.899 1.00 130.66 ? 54   DT  I "C1'" 1 
ATOM   8674  N  N1    . DT  I 5 127 ? -61.746 -33.914 26.480 1.00 130.45 ? 54   DT  I N1    1 
ATOM   8675  C  C2    . DT  I 5 127 ? -60.497 -33.720 27.060 1.00 130.28 ? 54   DT  I C2    1 
ATOM   8676  O  O2    . DT  I 5 127 ? -59.633 -34.579 27.139 1.00 130.10 ? 54   DT  I O2    1 
ATOM   8677  N  N3    . DT  I 5 127 ? -60.282 -32.453 27.551 1.00 129.94 ? 54   DT  I N3    1 
ATOM   8678  C  C4    . DT  I 5 127 ? -61.161 -31.384 27.527 1.00 129.92 ? 54   DT  I C4    1 
ATOM   8679  O  O4    . DT  I 5 127 ? -60.850 -30.296 27.999 1.00 129.73 ? 54   DT  I O4    1 
ATOM   8680  C  C5    . DT  I 5 127 ? -62.448 -31.646 26.915 1.00 130.18 ? 54   DT  I C5    1 
ATOM   8681  C  C7    . DT  I 5 127 ? -63.501 -30.575 26.822 1.00 130.13 ? 54   DT  I C7    1 
ATOM   8682  C  C6    . DT  I 5 127 ? -62.670 -32.879 26.430 1.00 130.39 ? 54   DT  I C6    1 
ATOM   8683  P  P     . DC  I 5 128 ? -64.203 -38.739 26.274 1.00 125.56 ? 55   DC  I P     1 
ATOM   8684  O  OP1   . DC  I 5 128 ? -64.383 -40.144 25.830 1.00 125.40 ? 55   DC  I OP1   1 
ATOM   8685  O  OP2   . DC  I 5 128 ? -65.343 -38.018 26.899 1.00 125.64 ? 55   DC  I OP2   1 
ATOM   8686  O  "O5'" . DC  I 5 128 ? -62.955 -38.684 27.282 1.00 123.21 ? 55   DC  I "O5'" 1 
ATOM   8687  C  "C5'" . DC  I 5 128 ? -61.616 -38.952 26.826 1.00 119.37 ? 55   DC  I "C5'" 1 
ATOM   8688  C  "C4'" . DC  I 5 128 ? -60.578 -38.807 27.938 1.00 116.48 ? 55   DC  I "C4'" 1 
ATOM   8689  O  "O4'" . DC  I 5 128 ? -60.383 -37.405 28.263 1.00 116.29 ? 55   DC  I "O4'" 1 
ATOM   8690  C  "C3'" . DC  I 5 128 ? -60.893 -39.523 29.254 1.00 114.25 ? 55   DC  I "C3'" 1 
ATOM   8691  O  "O3'" . DC  I 5 128 ? -59.778 -40.303 29.673 1.00 110.47 ? 55   DC  I "O3'" 1 
ATOM   8692  C  "C2'" . DC  I 5 128 ? -61.186 -38.404 30.249 1.00 114.93 ? 55   DC  I "C2'" 1 
ATOM   8693  C  "C1'" . DC  I 5 128 ? -60.381 -37.241 29.672 1.00 116.09 ? 55   DC  I "C1'" 1 
ATOM   8694  N  N1    . DC  I 5 128 ? -60.921 -35.878 30.030 1.00 116.75 ? 55   DC  I N1    1 
ATOM   8695  C  C2    . DC  I 5 128 ? -60.195 -35.048 30.903 1.00 116.88 ? 55   DC  I C2    1 
ATOM   8696  O  O2    . DC  I 5 128 ? -59.122 -35.442 31.374 1.00 116.74 ? 55   DC  I O2    1 
ATOM   8697  N  N3    . DC  I 5 128 ? -60.695 -33.821 31.213 1.00 117.37 ? 55   DC  I N3    1 
ATOM   8698  C  C4    . DC  I 5 128 ? -61.861 -33.413 30.695 1.00 117.71 ? 55   DC  I C4    1 
ATOM   8699  N  N4    . DC  I 5 128 ? -62.309 -32.198 31.034 1.00 117.96 ? 55   DC  I N4    1 
ATOM   8700  C  C5    . DC  I 5 128 ? -62.618 -34.239 29.806 1.00 117.64 ? 55   DC  I C5    1 
ATOM   8701  C  C6    . DC  I 5 128 ? -62.115 -35.448 29.508 1.00 117.09 ? 55   DC  I C6    1 
ATOM   8702  P  P     . DT  I 5 129 ? -59.940 -41.449 30.783 1.00 107.63 ? 56   DT  I P     1 
ATOM   8703  O  OP1   . DT  I 5 129 ? -58.977 -42.525 30.449 1.00 107.15 ? 56   DT  I OP1   1 
ATOM   8704  O  OP2   . DT  I 5 129 ? -61.374 -41.775 30.945 1.00 107.80 ? 56   DT  I OP2   1 
ATOM   8705  O  "O5'" . DT  I 5 129 ? -59.495 -40.719 32.135 1.00 105.42 ? 56   DT  I "O5'" 1 
ATOM   8706  C  "C5'" . DT  I 5 129 ? -58.117 -40.453 32.406 1.00 101.24 ? 56   DT  I "C5'" 1 
ATOM   8707  C  "C4'" . DT  I 5 129 ? -57.925 -39.789 33.761 1.00 97.92  ? 56   DT  I "C4'" 1 
ATOM   8708  O  "O4'" . DT  I 5 129 ? -58.551 -38.477 33.749 1.00 97.57  ? 56   DT  I "O4'" 1 
ATOM   8709  C  "C3'" . DT  I 5 129 ? -58.511 -40.542 34.957 1.00 95.53  ? 56   DT  I "C3'" 1 
ATOM   8710  O  "O3'" . DT  I 5 129 ? -57.527 -40.647 35.985 1.00 91.51  ? 56   DT  I "O3'" 1 
ATOM   8711  C  "C2'" . DT  I 5 129 ? -59.690 -39.668 35.392 1.00 96.48  ? 56   DT  I "C2'" 1 
ATOM   8712  C  "C1'" . DT  I 5 129 ? -59.216 -38.277 34.977 1.00 97.47  ? 56   DT  I "C1'" 1 
ATOM   8713  N  N1    . DT  I 5 129 ? -60.277 -37.236 34.761 1.00 98.41  ? 56   DT  I N1    1 
ATOM   8714  C  C2    . DT  I 5 129 ? -60.155 -36.011 35.393 1.00 98.91  ? 56   DT  I C2    1 
ATOM   8715  O  O2    . DT  I 5 129 ? -59.236 -35.719 36.134 1.00 98.82  ? 56   DT  I O2    1 
ATOM   8716  N  N3    . DT  I 5 129 ? -61.169 -35.121 35.130 1.00 99.37  ? 56   DT  I N3    1 
ATOM   8717  C  C4    . DT  I 5 129 ? -62.268 -35.320 34.311 1.00 99.54  ? 56   DT  I C4    1 
ATOM   8718  O  O4    . DT  I 5 129 ? -63.119 -34.449 34.149 1.00 99.92  ? 56   DT  I O4    1 
ATOM   8719  C  C5    . DT  I 5 129 ? -62.337 -36.617 33.674 1.00 99.34  ? 56   DT  I C5    1 
ATOM   8720  C  C7    . DT  I 5 129 ? -63.480 -36.960 32.765 1.00 99.69  ? 56   DT  I C7    1 
ATOM   8721  C  C6    . DT  I 5 129 ? -61.352 -37.496 33.923 1.00 99.09  ? 56   DT  I C6    1 
ATOM   8722  P  P     . DG  I 5 130 ? -56.420 -41.811 36.017 1.00 88.00  ? 57   DG  I P     1 
ATOM   8723  O  OP1   . DG  I 5 130 ? -55.792 -41.949 34.688 1.00 87.62  ? 57   DG  I OP1   1 
ATOM   8724  O  OP2   . DG  I 5 130 ? -57.020 -42.990 36.674 1.00 88.50  ? 57   DG  I OP2   1 
ATOM   8725  O  "O5'" . DG  I 5 130 ? -55.340 -41.231 37.039 1.00 86.79  ? 57   DG  I "O5'" 1 
ATOM   8726  C  "C5'" . DG  I 5 130 ? -54.564 -40.070 36.718 1.00 84.06  ? 57   DG  I "C5'" 1 
ATOM   8727  C  "C4'" . DG  I 5 130 ? -54.352 -39.141 37.908 1.00 82.02  ? 57   DG  I "C4'" 1 
ATOM   8728  O  "O4'" . DG  I 5 130 ? -55.476 -38.242 38.073 1.00 81.18  ? 57   DG  I "O4'" 1 
ATOM   8729  C  "C3'" . DG  I 5 130 ? -54.086 -39.751 39.277 1.00 81.07  ? 57   DG  I "C3'" 1 
ATOM   8730  O  "O3'" . DG  I 5 130 ? -53.006 -38.992 39.846 1.00 80.02  ? 57   DG  I "O3'" 1 
ATOM   8731  C  "C2'" . DG  I 5 130 ? -55.428 -39.600 40.004 1.00 81.46  ? 57   DG  I "C2'" 1 
ATOM   8732  C  "C1'" . DG  I 5 130 ? -56.076 -38.377 39.349 1.00 81.73  ? 57   DG  I "C1'" 1 
ATOM   8733  N  N9    . DG  I 5 130 ? -57.521 -38.449 39.086 1.00 82.31  ? 57   DG  I N9    1 
ATOM   8734  C  C8    . DG  I 5 130 ? -58.248 -39.573 38.774 1.00 82.17  ? 57   DG  I C8    1 
ATOM   8735  N  N7    . DG  I 5 130 ? -59.510 -39.338 38.564 1.00 82.57  ? 57   DG  I N7    1 
ATOM   8736  C  C5    . DG  I 5 130 ? -59.642 -37.969 38.729 1.00 82.67  ? 57   DG  I C5    1 
ATOM   8737  C  C6    . DG  I 5 130 ? -60.793 -37.143 38.625 1.00 83.07  ? 57   DG  I C6    1 
ATOM   8738  O  O6    . DG  I 5 130 ? -61.952 -37.475 38.343 1.00 83.05  ? 57   DG  I O6    1 
ATOM   8739  N  N1    . DG  I 5 130 ? -60.501 -35.801 38.874 1.00 83.18  ? 57   DG  I N1    1 
ATOM   8740  C  C2    . DG  I 5 130 ? -59.246 -35.324 39.185 1.00 82.99  ? 57   DG  I C2    1 
ATOM   8741  N  N2    . DG  I 5 130 ? -59.146 -34.001 39.389 1.00 82.86  ? 57   DG  I N2    1 
ATOM   8742  N  N3    . DG  I 5 130 ? -58.163 -36.092 39.285 1.00 82.74  ? 57   DG  I N3    1 
ATOM   8743  C  C4    . DG  I 5 130 ? -58.426 -37.404 39.051 1.00 82.43  ? 57   DG  I C4    1 
ATOM   8744  P  P     . DC  I 5 131 ? -52.340 -39.222 41.295 1.00 79.48  ? 58   DC  I P     1 
ATOM   8745  O  OP1   . DC  I 5 131 ? -50.966 -38.684 41.221 1.00 79.74  ? 58   DC  I OP1   1 
ATOM   8746  O  OP2   . DC  I 5 131 ? -52.538 -40.627 41.729 1.00 79.45  ? 58   DC  I OP2   1 
ATOM   8747  O  "O5'" . DC  I 5 131 ? -53.205 -38.286 42.257 1.00 78.32  ? 58   DC  I "O5'" 1 
ATOM   8748  C  "C5'" . DC  I 5 131 ? -53.475 -36.943 41.887 1.00 78.67  ? 58   DC  I "C5'" 1 
ATOM   8749  C  "C4'" . DC  I 5 131 ? -54.468 -36.281 42.828 1.00 79.46  ? 58   DC  I "C4'" 1 
ATOM   8750  O  "O4'" . DC  I 5 131 ? -55.826 -36.452 42.336 1.00 80.13  ? 58   DC  I "O4'" 1 
ATOM   8751  C  "C3'" . DC  I 5 131 ? -54.477 -36.789 44.265 1.00 80.10  ? 58   DC  I "C3'" 1 
ATOM   8752  O  "O3'" . DC  I 5 131 ? -54.695 -35.683 45.133 1.00 80.22  ? 58   DC  I "O3'" 1 
ATOM   8753  C  "C2'" . DC  I 5 131 ? -55.669 -37.743 44.265 1.00 80.49  ? 58   DC  I "C2'" 1 
ATOM   8754  C  "C1'" . DC  I 5 131 ? -56.630 -36.932 43.397 1.00 80.99  ? 58   DC  I "C1'" 1 
ATOM   8755  N  N1    . DC  I 5 131 ? -57.844 -37.652 42.853 1.00 81.82  ? 58   DC  I N1    1 
ATOM   8756  C  C2    . DC  I 5 131 ? -58.974 -36.908 42.453 1.00 82.35  ? 58   DC  I C2    1 
ATOM   8757  O  O2    . DC  I 5 131 ? -58.971 -35.670 42.543 1.00 83.11  ? 58   DC  I O2    1 
ATOM   8758  N  N3    . DC  I 5 131 ? -60.061 -37.565 41.969 1.00 82.33  ? 58   DC  I N3    1 
ATOM   8759  C  C4    . DC  I 5 131 ? -60.054 -38.900 41.878 1.00 82.20  ? 58   DC  I C4    1 
ATOM   8760  N  N4    . DC  I 5 131 ? -61.148 -39.500 41.391 1.00 81.85  ? 58   DC  I N4    1 
ATOM   8761  C  C5    . DC  I 5 131 ? -58.922 -39.676 42.278 1.00 82.11  ? 58   DC  I C5    1 
ATOM   8762  C  C6    . DC  I 5 131 ? -57.853 -39.019 42.753 1.00 81.89  ? 58   DC  I C6    1 
ATOM   8763  P  P     . DA  I 5 132 ? -53.501 -35.011 45.965 1.00 80.05  ? 59   DA  I P     1 
ATOM   8764  O  OP1   . DA  I 5 132 ? -52.376 -34.792 45.029 1.00 79.70  ? 59   DA  I OP1   1 
ATOM   8765  O  OP2   . DA  I 5 132 ? -53.302 -35.782 47.214 1.00 79.46  ? 59   DA  I OP2   1 
ATOM   8766  O  "O5'" . DA  I 5 132 ? -54.111 -33.601 46.405 1.00 81.04  ? 59   DA  I "O5'" 1 
ATOM   8767  C  "C5'" . DA  I 5 132 ? -54.493 -32.621 45.448 1.00 82.96  ? 59   DA  I "C5'" 1 
ATOM   8768  C  "C4'" . DA  I 5 132 ? -55.735 -31.858 45.901 1.00 84.83  ? 59   DA  I "C4'" 1 
ATOM   8769  O  "O4'" . DA  I 5 132 ? -56.934 -32.663 45.740 1.00 85.26  ? 59   DA  I "O4'" 1 
ATOM   8770  C  "C3'" . DA  I 5 132 ? -55.800 -31.371 47.346 1.00 85.72  ? 59   DA  I "C3'" 1 
ATOM   8771  O  "O3'" . DA  I 5 132 ? -56.602 -30.178 47.367 1.00 86.75  ? 59   DA  I "O3'" 1 
ATOM   8772  C  "C2'" . DA  I 5 132 ? -56.466 -32.548 48.062 1.00 85.32  ? 59   DA  I "C2'" 1 
ATOM   8773  C  "C1'" . DA  I 5 132 ? -57.470 -33.014 47.006 1.00 85.73  ? 59   DA  I "C1'" 1 
ATOM   8774  N  N9    . DA  I 5 132 ? -57.712 -34.446 46.884 1.00 86.04  ? 59   DA  I N9    1 
ATOM   8775  C  C8    . DA  I 5 132 ? -56.910 -35.492 47.256 1.00 86.09  ? 59   DA  I C8    1 
ATOM   8776  N  N7    . DA  I 5 132 ? -57.413 -36.674 46.981 1.00 85.65  ? 59   DA  I N7    1 
ATOM   8777  C  C5    . DA  I 5 132 ? -58.622 -36.378 46.370 1.00 85.95  ? 59   DA  I C5    1 
ATOM   8778  C  C6    . DA  I 5 132 ? -59.646 -37.185 45.837 1.00 85.59  ? 59   DA  I C6    1 
ATOM   8779  N  N6    . DA  I 5 132 ? -59.587 -38.515 45.842 1.00 86.00  ? 59   DA  I N6    1 
ATOM   8780  N  N1    . DA  I 5 132 ? -60.729 -36.581 45.301 1.00 85.76  ? 59   DA  I N1    1 
ATOM   8781  C  C2    . DA  I 5 132 ? -60.791 -35.242 45.299 1.00 85.98  ? 59   DA  I C2    1 
ATOM   8782  N  N3    . DA  I 5 132 ? -59.894 -34.376 45.773 1.00 86.45  ? 59   DA  I N3    1 
ATOM   8783  C  C4    . DA  I 5 132 ? -58.823 -35.012 46.299 1.00 86.36  ? 59   DA  I C4    1 
ATOM   8784  P  P     . DG  I 5 133 ? -56.546 -29.100 48.552 1.00 87.69  ? 60   DG  I P     1 
ATOM   8785  O  OP1   . DG  I 5 133 ? -56.071 -27.815 48.000 1.00 87.86  ? 60   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I 5 133 ? -55.898 -29.684 49.752 1.00 86.53  ? 60   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I 5 133 ? -58.098 -28.950 48.862 1.00 89.08  ? 60   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I 5 133 ? -58.558 -29.680 49.960 1.00 91.48  ? 60   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I 5 133 ? -59.991 -30.116 49.800 1.00 92.96  ? 60   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I 5 133 ? -60.058 -31.440 49.213 1.00 92.93  ? 60   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I 5 133 ? -60.636 -30.223 51.165 1.00 94.20  ? 60   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I 5 133 ? -61.927 -29.690 51.099 1.00 96.85  ? 60   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I 5 133 ? -60.637 -31.713 51.482 1.00 93.51  ? 60   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I 5 133 ? -60.715 -32.331 50.094 1.00 92.87  ? 60   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I 5 133 ? -60.068 -33.636 50.002 1.00 92.68  ? 60   DG  I N9    1 
ATOM   8796  C  C8    . DG  I 5 133 ? -58.779 -33.971 50.355 1.00 92.90  ? 60   DG  I C8    1 
ATOM   8797  N  N7    . DG  I 5 133 ? -58.485 -35.228 50.156 1.00 92.33  ? 60   DG  I N7    1 
ATOM   8798  C  C5    . DG  I 5 133 ? -59.656 -35.763 49.636 1.00 92.27  ? 60   DG  I C5    1 
ATOM   8799  C  C6    . DG  I 5 133 ? -59.952 -37.088 49.225 1.00 91.92  ? 60   DG  I C6    1 
ATOM   8800  O  O6    . DG  I 5 133 ? -59.203 -38.074 49.241 1.00 91.86  ? 60   DG  I O6    1 
ATOM   8801  N  N1    . DG  I 5 133 ? -61.263 -37.208 48.758 1.00 91.87  ? 60   DG  I N1    1 
ATOM   8802  C  C2    . DG  I 5 133 ? -62.173 -36.168 48.703 1.00 92.35  ? 60   DG  I C2    1 
ATOM   8803  N  N2    . DG  I 5 133 ? -63.392 -36.449 48.226 1.00 92.23  ? 60   DG  I N2    1 
ATOM   8804  N  N3    . DG  I 5 133 ? -61.911 -34.925 49.087 1.00 92.34  ? 60   DG  I N3    1 
ATOM   8805  C  C4    . DG  I 5 133 ? -60.638 -34.795 49.538 1.00 92.50  ? 60   DG  I C4    1 
ATOM   8806  P  P     . DG  I 5 134 ? -62.529 -29.035 52.424 1.00 99.63  ? 61   DG  I P     1 
ATOM   8807  O  OP1   . DG  I 5 134 ? -62.983 -27.672 52.064 1.00 99.20  ? 61   DG  I OP1   1 
ATOM   8808  O  OP2   . DG  I 5 134 ? -61.567 -29.226 53.541 1.00 99.39  ? 61   DG  I OP2   1 
ATOM   8809  O  "O5'" . DG  I 5 134 ? -63.797 -29.969 52.723 1.00 101.12 ? 61   DG  I "O5'" 1 
ATOM   8810  C  "C5'" . DG  I 5 134 ? -64.702 -30.357 51.686 1.00 103.19 ? 61   DG  I "C5'" 1 
ATOM   8811  C  "C4'" . DG  I 5 134 ? -65.416 -31.646 52.055 1.00 104.99 ? 61   DG  I "C4'" 1 
ATOM   8812  O  "O4'" . DG  I 5 134 ? -64.633 -32.774 51.592 1.00 105.18 ? 61   DG  I "O4'" 1 
ATOM   8813  C  "C3'" . DG  I 5 134 ? -65.648 -31.864 53.552 1.00 105.90 ? 61   DG  I "C3'" 1 
ATOM   8814  O  "O3'" . DG  I 5 134 ? -67.047 -31.858 53.824 1.00 107.97 ? 61   DG  I "O3'" 1 
ATOM   8815  C  "C2'" . DG  I 5 134 ? -65.021 -33.223 53.858 1.00 105.56 ? 61   DG  I "C2'" 1 
ATOM   8816  C  "C1'" . DG  I 5 134 ? -64.829 -33.848 52.483 1.00 105.21 ? 61   DG  I "C1'" 1 
ATOM   8817  N  N9    . DG  I 5 134 ? -63.651 -34.705 52.458 1.00 105.04 ? 61   DG  I N9    1 
ATOM   8818  C  C8    . DG  I 5 134 ? -62.378 -34.347 52.830 1.00 105.04 ? 61   DG  I C8    1 
ATOM   8819  N  N7    . DG  I 5 134 ? -61.509 -35.311 52.724 1.00 104.92 ? 61   DG  I N7    1 
ATOM   8820  C  C5    . DG  I 5 134 ? -62.255 -36.382 52.250 1.00 104.81 ? 61   DG  I C5    1 
ATOM   8821  C  C6    . DG  I 5 134 ? -61.849 -37.704 51.942 1.00 104.83 ? 61   DG  I C6    1 
ATOM   8822  O  O6    . DG  I 5 134 ? -60.715 -38.195 52.030 1.00 104.91 ? 61   DG  I O6    1 
ATOM   8823  N  N1    . DG  I 5 134 ? -62.910 -38.487 51.487 1.00 104.88 ? 61   DG  I N1    1 
ATOM   8824  C  C2    . DG  I 5 134 ? -64.208 -38.047 51.353 1.00 104.96 ? 61   DG  I C2    1 
ATOM   8825  N  N2    . DG  I 5 134 ? -65.094 -38.949 50.904 1.00 104.87 ? 61   DG  I N2    1 
ATOM   8826  N  N3    . DG  I 5 134 ? -64.603 -36.807 51.642 1.00 105.00 ? 61   DG  I N3    1 
ATOM   8827  C  C4    . DG  I 5 134 ? -63.578 -36.029 52.084 1.00 104.98 ? 61   DG  I C4    1 
ATOM   8828  P  P     . DT  I 5 135 ? -67.641 -32.097 55.298 1.00 109.75 ? 62   DT  I P     1 
ATOM   8829  O  OP1   . DT  I 5 135 ? -68.984 -31.473 55.354 1.00 109.69 ? 62   DT  I OP1   1 
ATOM   8830  O  OP2   . DT  I 5 135 ? -66.624 -31.727 56.309 1.00 109.77 ? 62   DT  I OP2   1 
ATOM   8831  O  "O5'" . DT  I 5 135 ? -67.797 -33.684 55.346 1.00 110.10 ? 62   DT  I "O5'" 1 
ATOM   8832  C  "C5'" . DT  I 5 135 ? -68.563 -34.389 54.375 1.00 111.33 ? 62   DT  I "C5'" 1 
ATOM   8833  C  "C4'" . DT  I 5 135 ? -68.675 -35.831 54.826 1.00 112.21 ? 62   DT  I "C4'" 1 
ATOM   8834  O  "O4'" . DT  I 5 135 ? -67.496 -36.546 54.386 1.00 112.16 ? 62   DT  I "O4'" 1 
ATOM   8835  C  "C3'" . DT  I 5 135 ? -68.743 -35.967 56.348 1.00 112.82 ? 62   DT  I "C3'" 1 
ATOM   8836  O  "O3'" . DT  I 5 135 ? -70.031 -36.483 56.742 1.00 113.78 ? 62   DT  I "O3'" 1 
ATOM   8837  C  "C2'" . DT  I 5 135 ? -67.542 -36.833 56.728 1.00 112.75 ? 62   DT  I "C2'" 1 
ATOM   8838  C  "C1'" . DT  I 5 135 ? -67.076 -37.427 55.405 1.00 112.57 ? 62   DT  I "C1'" 1 
ATOM   8839  N  N1    . DT  I 5 135 ? -65.589 -37.590 55.339 1.00 112.72 ? 62   DT  I N1    1 
ATOM   8840  C  C2    . DT  I 5 135 ? -65.050 -38.781 54.885 1.00 112.86 ? 62   DT  I C2    1 
ATOM   8841  O  O2    . DT  I 5 135 ? -65.713 -39.736 54.519 1.00 112.86 ? 62   DT  I O2    1 
ATOM   8842  N  N3    . DT  I 5 135 ? -63.676 -38.818 54.872 1.00 113.08 ? 62   DT  I N3    1 
ATOM   8843  C  C4    . DT  I 5 135 ? -62.803 -37.812 55.259 1.00 113.32 ? 62   DT  I C4    1 
ATOM   8844  O  O4    . DT  I 5 135 ? -61.584 -37.959 55.200 1.00 113.41 ? 62   DT  I O4    1 
ATOM   8845  C  C5    . DT  I 5 135 ? -63.430 -36.591 55.726 1.00 113.26 ? 62   DT  I C5    1 
ATOM   8846  C  C7    . DT  I 5 135 ? -62.606 -35.420 56.178 1.00 113.13 ? 62   DT  I C7    1 
ATOM   8847  C  C6    . DT  I 5 135 ? -64.772 -36.544 55.742 1.00 113.10 ? 62   DT  I C6    1 
ATOM   8848  P  P     . DG  I 5 136 ? -70.261 -37.646 57.825 1.00 114.30 ? 63   DG  I P     1 
ATOM   8849  O  OP1   . DG  I 5 136 ? -71.727 -37.816 57.981 1.00 114.29 ? 63   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I 5 136 ? -69.439 -37.370 59.030 1.00 114.00 ? 63   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I 5 136 ? -69.666 -38.913 57.046 1.00 114.34 ? 63   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I 5 136 ? -70.347 -40.163 57.029 1.00 114.74 ? 63   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I 5 136 ? -69.714 -41.091 58.048 1.00 114.92 ? 63   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I 5 136 ? -68.278 -41.062 57.854 1.00 114.73 ? 63   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I 5 136 ? -69.988 -40.693 59.500 1.00 115.24 ? 63   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I 5 136 ? -70.710 -41.753 60.190 1.00 115.90 ? 63   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I 5 136 ? -68.616 -40.294 60.061 1.00 114.94 ? 63   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I 5 136 ? -67.633 -40.974 59.107 1.00 114.76 ? 63   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I 5 136 ? -66.328 -40.311 58.960 1.00 114.50 ? 63   DG  I N9    1 
ATOM   8860  C  C8    . DG  I 5 136 ? -66.034 -38.975 59.133 1.00 114.37 ? 63   DG  I C8    1 
ATOM   8861  N  N7    . DG  I 5 136 ? -64.776 -38.684 58.941 1.00 114.12 ? 63   DG  I N7    1 
ATOM   8862  C  C5    . DG  I 5 136 ? -64.191 -39.906 58.622 1.00 113.92 ? 63   DG  I C5    1 
ATOM   8863  C  C6    . DG  I 5 136 ? -62.843 -40.225 58.309 1.00 113.79 ? 63   DG  I C6    1 
ATOM   8864  O  O6    . DG  I 5 136 ? -61.874 -39.455 58.253 1.00 114.13 ? 63   DG  I O6    1 
ATOM   8865  N  N1    . DG  I 5 136 ? -62.660 -41.585 58.045 1.00 113.17 ? 63   DG  I N1    1 
ATOM   8866  C  C2    . DG  I 5 136 ? -63.666 -42.523 58.081 1.00 113.19 ? 63   DG  I C2    1 
ATOM   8867  N  N2    . DG  I 5 136 ? -63.314 -43.784 57.800 1.00 113.01 ? 63   DG  I N2    1 
ATOM   8868  N  N3    . DG  I 5 136 ? -64.934 -42.241 58.370 1.00 113.62 ? 63   DG  I N3    1 
ATOM   8869  C  C4    . DG  I 5 136 ? -65.130 -40.918 58.631 1.00 114.06 ? 63   DG  I C4    1 
ATOM   8870  P  P     . DG  I 5 137 ? -70.078 -42.791 61.272 1.00 116.23 ? 64   DG  I P     1 
ATOM   8871  O  OP1   . DG  I 5 137 ? -71.058 -43.888 61.462 1.00 116.05 ? 64   DG  I OP1   1 
ATOM   8872  O  OP2   . DG  I 5 137 ? -69.582 -42.026 62.460 1.00 116.01 ? 64   DG  I OP2   1 
ATOM   8873  O  "O5'" . DG  I 5 137 ? -68.819 -43.389 60.471 1.00 115.41 ? 64   DG  I "O5'" 1 
ATOM   8874  C  "C5'" . DG  I 5 137 ? -68.727 -44.784 60.162 1.00 114.18 ? 64   DG  I "C5'" 1 
ATOM   8875  C  "C4'" . DG  I 5 137 ? -67.571 -45.366 60.960 1.00 113.26 ? 64   DG  I "C4'" 1 
ATOM   8876  O  "O4'" . DG  I 5 137 ? -66.392 -44.512 60.839 1.00 113.20 ? 64   DG  I "O4'" 1 
ATOM   8877  C  "C3'" . DG  I 5 137 ? -67.849 -45.487 62.453 1.00 112.43 ? 64   DG  I "C3'" 1 
ATOM   8878  O  "O3'" . DG  I 5 137 ? -67.287 -46.706 62.927 1.00 111.24 ? 64   DG  I "O3'" 1 
ATOM   8879  C  "C2'" . DG  I 5 137 ? -67.154 -44.245 63.019 1.00 112.60 ? 64   DG  I "C2'" 1 
ATOM   8880  C  "C1'" . DG  I 5 137 ? -65.909 -44.193 62.136 1.00 112.52 ? 64   DG  I "C1'" 1 
ATOM   8881  N  N9    . DG  I 5 137 ? -65.198 -42.906 62.150 1.00 111.43 ? 64   DG  I N9    1 
ATOM   8882  C  C8    . DG  I 5 137 ? -65.704 -41.683 62.531 1.00 111.24 ? 64   DG  I C8    1 
ATOM   8883  N  N7    . DG  I 5 137 ? -64.844 -40.706 62.452 1.00 110.89 ? 64   DG  I N7    1 
ATOM   8884  C  C5    . DG  I 5 137 ? -63.682 -41.314 61.993 1.00 110.47 ? 64   DG  I C5    1 
ATOM   8885  C  C6    . DG  I 5 137 ? -62.407 -40.751 61.713 1.00 110.10 ? 64   DG  I C6    1 
ATOM   8886  O  O6    . DG  I 5 137 ? -62.050 -39.565 61.820 1.00 109.98 ? 64   DG  I O6    1 
ATOM   8887  N  N1    . DG  I 5 137 ? -61.500 -41.714 61.264 1.00 109.44 ? 64   DG  I N1    1 
ATOM   8888  C  C2    . DG  I 5 137 ? -61.791 -43.050 61.106 1.00 109.34 ? 64   DG  I C2    1 
ATOM   8889  N  N2    . DG  I 5 137 ? -60.794 -43.826 60.665 1.00 108.73 ? 64   DG  I N2    1 
ATOM   8890  N  N3    . DG  I 5 137 ? -62.980 -43.589 61.364 1.00 109.84 ? 64   DG  I N3    1 
ATOM   8891  C  C4    . DG  I 5 137 ? -63.881 -42.669 61.803 1.00 110.61 ? 64   DG  I C4    1 
ATOM   8892  P  P     . DA  I 5 138 ? -67.137 -47.053 64.491 1.00 110.49 ? 65   DA  I P     1 
ATOM   8893  O  OP1   . DA  I 5 138 ? -68.021 -48.209 64.765 1.00 110.82 ? 65   DA  I OP1   1 
ATOM   8894  O  OP2   . DA  I 5 138 ? -67.257 -45.823 65.311 1.00 110.26 ? 65   DA  I OP2   1 
ATOM   8895  O  "O5'" . DA  I 5 138 ? -65.623 -47.558 64.595 1.00 108.19 ? 65   DA  I "O5'" 1 
ATOM   8896  C  "C5'" . DA  I 5 138 ? -65.158 -48.619 63.765 1.00 105.20 ? 65   DA  I "C5'" 1 
ATOM   8897  C  "C4'" . DA  I 5 138 ? -63.642 -48.634 63.776 1.00 103.26 ? 65   DA  I "C4'" 1 
ATOM   8898  O  "O4'" . DA  I 5 138 ? -63.138 -47.326 63.385 1.00 102.60 ? 65   DA  I "O4'" 1 
ATOM   8899  C  "C3'" . DA  I 5 138 ? -63.033 -48.954 65.141 1.00 102.24 ? 65   DA  I "C3'" 1 
ATOM   8900  O  "O3'" . DA  I 5 138 ? -62.011 -49.956 64.991 1.00 101.21 ? 65   DA  I "O3'" 1 
ATOM   8901  C  "C2'" . DA  I 5 138 ? -62.520 -47.599 65.629 1.00 101.98 ? 65   DA  I "C2'" 1 
ATOM   8902  C  "C1'" . DA  I 5 138 ? -62.175 -46.888 64.326 1.00 101.69 ? 65   DA  I "C1'" 1 
ATOM   8903  N  N9    . DA  I 5 138 ? -62.219 -45.434 64.491 1.00 100.92 ? 65   DA  I N9    1 
ATOM   8904  C  C8    . DA  I 5 138 ? -63.320 -44.671 64.788 1.00 100.65 ? 65   DA  I C8    1 
ATOM   8905  N  N7    . DA  I 5 138 ? -63.071 -43.387 64.894 1.00 99.96  ? 65   DA  I N7    1 
ATOM   8906  C  C5    . DA  I 5 138 ? -61.708 -43.295 64.652 1.00 99.64  ? 65   DA  I C5    1 
ATOM   8907  C  C6    . DA  I 5 138 ? -60.818 -42.195 64.616 1.00 98.91  ? 65   DA  I C6    1 
ATOM   8908  N  N6    . DA  I 5 138 ? -61.201 -40.933 64.834 1.00 98.11  ? 65   DA  I N6    1 
ATOM   8909  N  N1    . DA  I 5 138 ? -59.515 -42.445 64.346 1.00 98.61  ? 65   DA  I N1    1 
ATOM   8910  C  C2    . DA  I 5 138 ? -59.128 -43.712 64.121 1.00 98.82  ? 65   DA  I C2    1 
ATOM   8911  N  N3    . DA  I 5 138 ? -59.869 -44.825 64.130 1.00 99.30  ? 65   DA  I N3    1 
ATOM   8912  C  C4    . DA  I 5 138 ? -61.162 -44.549 64.405 1.00 99.97  ? 65   DA  I C4    1 
ATOM   8913  P  P     . DT  I 5 139 ? -60.743 -50.120 65.970 1.00 100.58 ? 66   DT  I P     1 
ATOM   8914  O  OP1   . DT  I 5 139 ? -60.004 -51.348 65.587 1.00 99.79  ? 66   DT  I OP1   1 
ATOM   8915  O  OP2   . DT  I 5 139 ? -61.186 -49.934 67.373 1.00 99.93  ? 66   DT  I OP2   1 
ATOM   8916  O  "O5'" . DT  I 5 139 ? -59.866 -48.839 65.579 1.00 100.29 ? 66   DT  I "O5'" 1 
ATOM   8917  C  "C5'" . DT  I 5 139 ? -58.627 -48.936 64.890 1.00 98.50  ? 66   DT  I "C5'" 1 
ATOM   8918  C  "C4'" . DT  I 5 139 ? -57.574 -48.107 65.607 1.00 96.76  ? 66   DT  I "C4'" 1 
ATOM   8919  O  "O4'" . DT  I 5 139 ? -58.048 -46.745 65.786 1.00 96.31  ? 66   DT  I "O4'" 1 
ATOM   8920  C  "C3'" . DT  I 5 139 ? -57.143 -48.597 66.989 1.00 95.48  ? 66   DT  I "C3'" 1 
ATOM   8921  O  "O3'" . DT  I 5 139 ? -55.725 -48.530 66.955 1.00 94.66  ? 66   DT  I "O3'" 1 
ATOM   8922  C  "C2'" . DT  I 5 139 ? -57.789 -47.595 67.950 1.00 95.23  ? 66   DT  I "C2'" 1 
ATOM   8923  C  "C1'" . DT  I 5 139 ? -57.773 -46.321 67.110 1.00 95.34  ? 66   DT  I "C1'" 1 
ATOM   8924  N  N1    . DT  I 5 139 ? -58.767 -45.239 67.456 1.00 94.59  ? 66   DT  I N1    1 
ATOM   8925  C  C2    . DT  I 5 139 ? -58.353 -43.915 67.414 1.00 94.16  ? 66   DT  I C2    1 
ATOM   8926  O  O2    . DT  I 5 139 ? -57.220 -43.565 67.126 1.00 93.47  ? 66   DT  I O2    1 
ATOM   8927  N  N3    . DT  I 5 139 ? -59.326 -42.994 67.724 1.00 94.18  ? 66   DT  I N3    1 
ATOM   8928  C  C4    . DT  I 5 139 ? -60.645 -43.245 68.063 1.00 94.08  ? 66   DT  I C4    1 
ATOM   8929  O  O4    . DT  I 5 139 ? -61.426 -42.329 68.326 1.00 93.84  ? 66   DT  I O4    1 
ATOM   8930  C  C5    . DT  I 5 139 ? -61.017 -44.647 68.083 1.00 94.28  ? 66   DT  I C5    1 
ATOM   8931  C  C7    . DT  I 5 139 ? -62.417 -45.067 68.438 1.00 94.58  ? 66   DT  I C7    1 
ATOM   8932  C  C6    . DT  I 5 139 ? -60.077 -45.561 67.778 1.00 94.29  ? 66   DT  I C6    1 
ATOM   8933  P  P     . DA  I 5 140 ? -54.707 -48.887 68.146 1.00 93.79  ? 67   DA  I P     1 
ATOM   8934  O  OP1   . DA  I 5 140 ? -54.262 -50.287 67.974 1.00 93.45  ? 67   DA  I OP1   1 
ATOM   8935  O  OP2   . DA  I 5 140 ? -55.297 -48.445 69.430 1.00 93.83  ? 67   DA  I OP2   1 
ATOM   8936  O  "O5'" . DA  I 5 140 ? -53.456 -47.930 67.823 1.00 92.32  ? 67   DA  I "O5'" 1 
ATOM   8937  C  "C5'" . DA  I 5 140 ? -53.547 -46.910 66.813 1.00 89.96  ? 67   DA  I "C5'" 1 
ATOM   8938  C  "C4'" . DA  I 5 140 ? -52.894 -45.594 67.212 1.00 88.28  ? 67   DA  I "C4'" 1 
ATOM   8939  O  "O4'" . DA  I 5 140 ? -53.902 -44.598 67.550 1.00 87.57  ? 67   DA  I "O4'" 1 
ATOM   8940  C  "C3'" . DA  I 5 140 ? -51.928 -45.633 68.393 1.00 87.15  ? 67   DA  I "C3'" 1 
ATOM   8941  O  "O3'" . DA  I 5 140 ? -50.777 -44.885 68.036 1.00 86.16  ? 67   DA  I "O3'" 1 
ATOM   8942  C  "C2'" . DA  I 5 140 ? -52.705 -44.982 69.537 1.00 86.54  ? 67   DA  I "C2'" 1 
ATOM   8943  C  "C1'" . DA  I 5 140 ? -53.618 -44.007 68.804 1.00 85.88  ? 67   DA  I "C1'" 1 
ATOM   8944  N  N9    . DA  I 5 140 ? -54.901 -43.758 69.459 1.00 84.70  ? 67   DA  I N9    1 
ATOM   8945  C  C8    . DA  I 5 140 ? -55.842 -44.689 69.798 1.00 83.85  ? 67   DA  I C8    1 
ATOM   8946  N  N7    . DA  I 5 140 ? -56.909 -44.176 70.360 1.00 83.46  ? 67   DA  I N7    1 
ATOM   8947  C  C5    . DA  I 5 140 ? -56.659 -42.817 70.392 1.00 83.25  ? 67   DA  I C5    1 
ATOM   8948  C  C6    . DA  I 5 140 ? -57.403 -41.714 70.869 1.00 83.27  ? 67   DA  I C6    1 
ATOM   8949  N  N6    . DA  I 5 140 ? -58.610 -41.825 71.424 1.00 83.01  ? 67   DA  I N6    1 
ATOM   8950  N  N1    . DA  I 5 140 ? -56.866 -40.479 70.749 1.00 83.45  ? 67   DA  I N1    1 
ATOM   8951  C  C2    . DA  I 5 140 ? -55.657 -40.361 70.186 1.00 83.40  ? 67   DA  I C2    1 
ATOM   8952  N  N3    . DA  I 5 140 ? -54.866 -41.322 69.704 1.00 83.28  ? 67   DA  I N3    1 
ATOM   8953  C  C4    . DA  I 5 140 ? -55.425 -42.539 69.836 1.00 83.71  ? 67   DA  I C4    1 
ATOM   8954  P  P     . DT  I 5 141 ? -49.471 -44.868 68.957 1.00 84.96  ? 68   DT  I P     1 
ATOM   8955  O  OP1   . DT  I 5 141 ? -48.283 -44.819 68.077 1.00 85.65  ? 68   DT  I OP1   1 
ATOM   8956  O  OP2   . DT  I 5 141 ? -49.590 -45.934 69.974 1.00 84.70  ? 68   DT  I OP2   1 
ATOM   8957  O  "O5'" . DT  I 5 141 ? -49.597 -43.457 69.681 1.00 83.69  ? 68   DT  I "O5'" 1 
ATOM   8958  C  "C5'" . DT  I 5 141 ? -49.698 -42.296 68.865 1.00 82.62  ? 68   DT  I "C5'" 1 
ATOM   8959  C  "C4'" . DT  I 5 141 ? -49.961 -41.063 69.705 1.00 81.51  ? 68   DT  I "C4'" 1 
ATOM   8960  O  "O4'" . DT  I 5 141 ? -51.309 -41.106 70.231 1.00 81.43  ? 68   DT  I "O4'" 1 
ATOM   8961  C  "C3'" . DT  I 5 141 ? -49.033 -40.877 70.904 1.00 80.98  ? 68   DT  I "C3'" 1 
ATOM   8962  O  "O3'" . DT  I 5 141 ? -48.425 -39.593 70.752 1.00 80.16  ? 68   DT  I "O3'" 1 
ATOM   8963  C  "C2'" . DT  I 5 141 ? -49.948 -40.971 72.133 1.00 80.96  ? 68   DT  I "C2'" 1 
ATOM   8964  C  "C1'" . DT  I 5 141 ? -51.313 -40.599 71.555 1.00 81.29  ? 68   DT  I "C1'" 1 
ATOM   8965  N  N1    . DT  I 5 141 ? -52.540 -41.161 72.240 1.00 81.10  ? 68   DT  I N1    1 
ATOM   8966  C  C2    . DT  I 5 141 ? -53.526 -40.296 72.689 1.00 80.92  ? 68   DT  I C2    1 
ATOM   8967  O  O2    . DT  I 5 141 ? -53.480 -39.082 72.591 1.00 80.48  ? 68   DT  I O2    1 
ATOM   8968  N  N3    . DT  I 5 141 ? -54.604 -40.910 73.276 1.00 81.19  ? 68   DT  I N3    1 
ATOM   8969  C  C4    . DT  I 5 141 ? -54.798 -42.268 73.455 1.00 81.33  ? 68   DT  I C4    1 
ATOM   8970  O  O4    . DT  I 5 141 ? -55.809 -42.697 73.995 1.00 82.09  ? 68   DT  I O4    1 
ATOM   8971  C  C5    . DT  I 5 141 ? -53.740 -43.122 72.962 1.00 81.04  ? 68   DT  I C5    1 
ATOM   8972  C  C7    . DT  I 5 141 ? -53.835 -44.614 73.093 1.00 80.93  ? 68   DT  I C7    1 
ATOM   8973  C  C6    . DT  I 5 141 ? -52.680 -42.536 72.384 1.00 81.06  ? 68   DT  I C6    1 
ATOM   8974  P  P     . DT  I 5 142 ? -47.307 -39.026 71.749 1.00 79.08  ? 69   DT  I P     1 
ATOM   8975  O  OP1   . DT  I 5 142 ? -46.508 -38.037 71.000 1.00 79.23  ? 69   DT  I OP1   1 
ATOM   8976  O  OP2   . DT  I 5 142 ? -46.636 -40.171 72.403 1.00 79.39  ? 69   DT  I OP2   1 
ATOM   8977  O  "O5'" . DT  I 5 142 ? -48.160 -38.215 72.832 1.00 78.54  ? 69   DT  I "O5'" 1 
ATOM   8978  C  "C5'" . DT  I 5 142 ? -48.960 -37.117 72.397 1.00 77.14  ? 69   DT  I "C5'" 1 
ATOM   8979  C  "C4'" . DT  I 5 142 ? -49.800 -36.564 73.529 1.00 76.38  ? 69   DT  I "C4'" 1 
ATOM   8980  O  "O4'" . DT  I 5 142 ? -50.865 -37.486 73.876 1.00 76.00  ? 69   DT  I "O4'" 1 
ATOM   8981  C  "C3'" . DT  I 5 142 ? -49.019 -36.317 74.810 1.00 76.51  ? 69   DT  I "C3'" 1 
ATOM   8982  O  "O3'" . DT  I 5 142 ? -49.271 -34.974 75.186 1.00 76.86  ? 69   DT  I "O3'" 1 
ATOM   8983  C  "C2'" . DT  I 5 142 ? -49.577 -37.338 75.806 1.00 75.90  ? 69   DT  I "C2'" 1 
ATOM   8984  C  "C1'" . DT  I 5 142 ? -50.993 -37.548 75.281 1.00 75.54  ? 69   DT  I "C1'" 1 
ATOM   8985  N  N1    . DT  I 5 142 ? -51.659 -38.852 75.615 1.00 74.55  ? 69   DT  I N1    1 
ATOM   8986  C  C2    . DT  I 5 142 ? -52.988 -38.851 76.004 1.00 74.28  ? 69   DT  I C2    1 
ATOM   8987  O  O2    . DT  I 5 142 ? -53.664 -37.841 76.114 1.00 73.47  ? 69   DT  I O2    1 
ATOM   8988  N  N3    . DT  I 5 142 ? -53.507 -40.094 76.274 1.00 74.47  ? 69   DT  I N3    1 
ATOM   8989  C  C4    . DT  I 5 142 ? -52.850 -41.311 76.194 1.00 75.21  ? 69   DT  I C4    1 
ATOM   8990  O  O4    . DT  I 5 142 ? -53.427 -42.365 76.460 1.00 76.23  ? 69   DT  I O4    1 
ATOM   8991  C  C5    . DT  I 5 142 ? -51.460 -41.241 75.777 1.00 75.04  ? 69   DT  I C5    1 
ATOM   8992  C  C7    . DT  I 5 142 ? -50.615 -42.478 75.641 1.00 74.66  ? 69   DT  I C7    1 
ATOM   8993  C  C6    . DT  I 5 142 ? -50.947 -40.031 75.509 1.00 74.54  ? 69   DT  I C6    1 
ATOM   8994  P  P     . DG  I 5 143 ? -48.393 -34.235 76.295 1.00 77.30  ? 70   DG  I P     1 
ATOM   8995  O  OP1   . DG  I 5 143 ? -48.250 -32.826 75.864 1.00 76.91  ? 70   DG  I OP1   1 
ATOM   8996  O  OP2   . DG  I 5 143 ? -47.208 -35.061 76.610 1.00 76.15  ? 70   DG  I OP2   1 
ATOM   8997  O  "O5'" . DG  I 5 143 ? -49.374 -34.243 77.551 1.00 79.60  ? 70   DG  I "O5'" 1 
ATOM   8998  C  "C5'" . DG  I 5 143 ? -50.629 -33.553 77.445 1.00 82.88  ? 70   DG  I "C5'" 1 
ATOM   8999  C  "C4'" . DG  I 5 143 ? -51.561 -33.893 78.598 1.00 84.94  ? 70   DG  I "C4'" 1 
ATOM   9000  O  "O4'" . DG  I 5 143 ? -52.017 -35.270 78.491 1.00 85.37  ? 70   DG  I "O4'" 1 
ATOM   9001  C  "C3'" . DG  I 5 143 ? -50.914 -33.764 79.970 1.00 86.49  ? 70   DG  I "C3'" 1 
ATOM   9002  O  "O3'" . DG  I 5 143 ? -51.832 -33.115 80.828 1.00 89.20  ? 70   DG  I "O3'" 1 
ATOM   9003  C  "C2'" . DG  I 5 143 ? -50.632 -35.212 80.372 1.00 86.11  ? 70   DG  I "C2'" 1 
ATOM   9004  C  "C1'" . DG  I 5 143 ? -51.827 -35.914 79.735 1.00 85.80  ? 70   DG  I "C1'" 1 
ATOM   9005  N  N9    . DG  I 5 143 ? -51.695 -37.363 79.540 1.00 86.00  ? 70   DG  I N9    1 
ATOM   9006  C  C8    . DG  I 5 143 ? -50.593 -38.090 79.135 1.00 85.86  ? 70   DG  I C8    1 
ATOM   9007  N  N7    . DG  I 5 143 ? -50.810 -39.376 79.067 1.00 85.77  ? 70   DG  I N7    1 
ATOM   9008  C  C5    . DG  I 5 143 ? -52.141 -39.513 79.454 1.00 85.78  ? 70   DG  I C5    1 
ATOM   9009  C  C6    . DG  I 5 143 ? -52.948 -40.674 79.578 1.00 85.96  ? 70   DG  I C6    1 
ATOM   9010  O  O6    . DG  I 5 143 ? -52.624 -41.854 79.354 1.00 85.57  ? 70   DG  I O6    1 
ATOM   9011  N  N1    . DG  I 5 143 ? -54.248 -40.361 80.003 1.00 86.25  ? 70   DG  I N1    1 
ATOM   9012  C  C2    . DG  I 5 143 ? -54.702 -39.084 80.275 1.00 86.80  ? 70   DG  I C2    1 
ATOM   9013  N  N2    . DG  I 5 143 ? -55.976 -38.953 80.673 1.00 87.51  ? 70   DG  I N2    1 
ATOM   9014  N  N3    . DG  I 5 143 ? -53.953 -37.994 80.162 1.00 86.34  ? 70   DG  I N3    1 
ATOM   9015  C  C4    . DG  I 5 143 ? -52.694 -38.284 79.747 1.00 85.85  ? 70   DG  I C4    1 
ATOM   9016  P  P     . DA  I 5 144 ? -51.358 -32.400 82.186 1.00 92.17  ? 71   DA  I P     1 
ATOM   9017  O  OP1   . DA  I 5 144 ? -51.512 -30.939 81.988 1.00 91.84  ? 71   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I 5 144 ? -50.049 -32.952 82.617 1.00 90.92  ? 71   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I 5 144 ? -52.487 -32.872 83.216 1.00 92.43  ? 71   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I 5 144 ? -53.867 -32.645 82.920 1.00 93.68  ? 71   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I 5 144 ? -54.668 -33.743 83.582 1.00 94.58  ? 71   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I 5 144 ? -54.298 -34.999 82.963 1.00 93.78  ? 71   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I 5 144 ? -54.334 -33.874 85.068 1.00 95.45  ? 71   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I 5 144 ? -55.489 -33.640 85.882 1.00 97.70  ? 71   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I 5 144 ? -53.779 -35.287 85.221 1.00 94.43  ? 71   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I 5 144 ? -54.285 -35.981 83.964 1.00 93.37  ? 71   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I 5 144 ? -53.414 -37.064 83.547 1.00 92.46  ? 71   DA  I N9    1 
ATOM   9028  C  C8    . DA  I 5 144 ? -52.128 -36.962 83.104 1.00 92.21  ? 71   DA  I C8    1 
ATOM   9029  N  N7    . DA  I 5 144 ? -51.582 -38.119 82.808 1.00 91.99  ? 71   DA  I N7    1 
ATOM   9030  C  C5    . DA  I 5 144 ? -52.579 -39.038 83.081 1.00 91.53  ? 71   DA  I C5    1 
ATOM   9031  C  C6    . DA  I 5 144 ? -52.633 -40.443 82.976 1.00 91.42  ? 71   DA  I C6    1 
ATOM   9032  N  N6    . DA  I 5 144 ? -51.608 -41.185 82.547 1.00 90.93  ? 71   DA  I N6    1 
ATOM   9033  N  N1    . DA  I 5 144 ? -53.787 -41.056 83.332 1.00 91.71  ? 71   DA  I N1    1 
ATOM   9034  C  C2    . DA  I 5 144 ? -54.812 -40.306 83.763 1.00 91.87  ? 71   DA  I C2    1 
ATOM   9035  N  N3    . DA  I 5 144 ? -54.877 -38.980 83.900 1.00 91.44  ? 71   DA  I N3    1 
ATOM   9036  C  C4    . DA  I 5 144 ? -53.718 -38.403 83.540 1.00 91.79  ? 71   DA  I C4    1 
ATOM   9037  P  P     . DT  I 5 145 ? -55.349 -33.288 87.449 1.00 99.24  ? 72   DT  I P     1 
ATOM   9038  O  OP1   . DT  I 5 145 ? -56.424 -32.322 87.782 1.00 98.81  ? 72   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I 5 145 ? -53.936 -32.939 87.766 1.00 99.04  ? 72   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I 5 145 ? -55.661 -34.697 88.151 1.00 99.79  ? 72   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I 5 145 ? -56.889 -35.392 87.919 1.00 100.25 ? 72   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I 5 145 ? -56.745 -36.829 88.386 1.00 100.69 ? 72   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I 5 145 ? -55.842 -37.529 87.492 1.00 100.67 ? 72   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I 5 145 ? -56.165 -36.983 89.797 1.00 100.93 ? 72   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I 5 145 ? -57.065 -37.715 90.632 1.00 100.83 ? 72   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I 5 145 ? -54.841 -37.722 89.583 1.00 100.77 ? 72   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I 5 145 ? -55.131 -38.458 88.279 1.00 100.49 ? 72   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I 5 145 ? -53.931 -38.991 87.547 1.00 99.77  ? 72   DT  I N1    1 
ATOM   9049  C  C2    . DT  I 5 145 ? -53.904 -40.339 87.238 1.00 99.83  ? 72   DT  I C2    1 
ATOM   9050  O  O2    . DT  I 5 145 ? -54.802 -41.118 87.523 1.00 100.55 ? 72   DT  I O2    1 
ATOM   9051  N  N3    . DT  I 5 145 ? -52.778 -40.753 86.573 1.00 99.40  ? 72   DT  I N3    1 
ATOM   9052  C  C4    . DT  I 5 145 ? -51.698 -39.975 86.195 1.00 99.45  ? 72   DT  I C4    1 
ATOM   9053  O  O4    . DT  I 5 145 ? -50.738 -40.458 85.601 1.00 100.15 ? 72   DT  I O4    1 
ATOM   9054  C  C5    . DT  I 5 145 ? -51.788 -38.574 86.545 1.00 99.01  ? 72   DT  I C5    1 
ATOM   9055  C  C7    . DT  I 5 145 ? -50.679 -37.622 86.196 1.00 98.59  ? 72   DT  I C7    1 
ATOM   9056  C  C6    . DT  I 5 145 ? -52.884 -38.156 87.199 1.00 99.20  ? 72   DT  I C6    1 
ATOM   9057  O  "O5'" . DA  J 6 1   ? -49.957 -51.006 84.401 1.00 110.78 ? -72  DA  J "O5'" 1 
ATOM   9058  C  "C5'" . DA  J 6 1   ? -51.171 -50.348 84.032 1.00 110.38 ? -72  DA  J "C5'" 1 
ATOM   9059  C  "C4'" . DA  J 6 1   ? -52.155 -50.304 85.191 1.00 109.91 ? -72  DA  J "C4'" 1 
ATOM   9060  O  "O4'" . DA  J 6 1   ? -51.529 -49.665 86.334 1.00 109.38 ? -72  DA  J "O4'" 1 
ATOM   9061  C  "C3'" . DA  J 6 1   ? -53.426 -49.514 84.896 1.00 109.79 ? -72  DA  J "C3'" 1 
ATOM   9062  O  "O3'" . DA  J 6 1   ? -54.517 -50.404 84.680 1.00 110.39 ? -72  DA  J "O3'" 1 
ATOM   9063  C  "C2'" . DA  J 6 1   ? -53.647 -48.643 86.133 1.00 109.14 ? -72  DA  J "C2'" 1 
ATOM   9064  C  "C1'" . DA  J 6 1   ? -52.249 -48.503 86.718 1.00 108.56 ? -72  DA  J "C1'" 1 
ATOM   9065  N  N9    . DA  J 6 1   ? -51.521 -47.300 86.286 1.00 107.53 ? -72  DA  J N9    1 
ATOM   9066  C  C8    . DA  J 6 1   ? -50.284 -47.265 85.700 1.00 107.03 ? -72  DA  J C8    1 
ATOM   9067  N  N7    . DA  J 6 1   ? -49.855 -46.057 85.423 1.00 106.51 ? -72  DA  J N7    1 
ATOM   9068  C  C5    . DA  J 6 1   ? -50.877 -45.230 85.859 1.00 106.21 ? -72  DA  J C5    1 
ATOM   9069  C  C6    . DA  J 6 1   ? -51.035 -43.823 85.850 1.00 105.35 ? -72  DA  J C6    1 
ATOM   9070  N  N6    . DA  J 6 1   ? -50.116 -42.984 85.365 1.00 104.84 ? -72  DA  J N6    1 
ATOM   9071  N  N1    . DA  J 6 1   ? -52.174 -43.309 86.358 1.00 105.02 ? -72  DA  J N1    1 
ATOM   9072  C  C2    . DA  J 6 1   ? -53.097 -44.150 86.849 1.00 105.52 ? -72  DA  J C2    1 
ATOM   9073  N  N3    . DA  J 6 1   ? -53.061 -45.487 86.911 1.00 106.24 ? -72  DA  J N3    1 
ATOM   9074  C  C4    . DA  J 6 1   ? -51.914 -45.977 86.397 1.00 106.66 ? -72  DA  J C4    1 
ATOM   9075  P  P     . DT  J 6 2   ? -55.906 -49.856 84.092 1.00 111.00 ? -71  DT  J P     1 
ATOM   9076  O  OP1   . DT  J 6 2   ? -56.813 -51.017 83.932 1.00 111.42 ? -71  DT  J OP1   1 
ATOM   9077  O  OP2   . DT  J 6 2   ? -55.605 -49.014 82.914 1.00 111.07 ? -71  DT  J OP2   1 
ATOM   9078  O  "O5'" . DT  J 6 2   ? -56.440 -48.907 85.266 1.00 110.83 ? -71  DT  J "O5'" 1 
ATOM   9079  C  "C5'" . DT  J 6 2   ? -57.733 -49.080 85.824 1.00 111.12 ? -71  DT  J "C5'" 1 
ATOM   9080  C  "C4'" . DT  J 6 2   ? -58.581 -47.871 85.483 1.00 111.12 ? -71  DT  J "C4'" 1 
ATOM   9081  O  "O4'" . DT  J 6 2   ? -57.754 -46.686 85.621 1.00 110.58 ? -71  DT  J "O4'" 1 
ATOM   9082  C  "C3'" . DT  J 6 2   ? -59.142 -47.878 84.058 1.00 111.49 ? -71  DT  J "C3'" 1 
ATOM   9083  O  "O3'" . DT  J 6 2   ? -60.579 -47.682 83.970 1.00 112.14 ? -71  DT  J "O3'" 1 
ATOM   9084  C  "C2'" . DT  J 6 2   ? -58.335 -46.817 83.311 1.00 111.28 ? -71  DT  J "C2'" 1 
ATOM   9085  C  "C1'" . DT  J 6 2   ? -57.804 -45.919 84.432 1.00 110.88 ? -71  DT  J "C1'" 1 
ATOM   9086  N  N1    . DT  J 6 2   ? -56.452 -45.317 84.128 1.00 110.76 ? -71  DT  J N1    1 
ATOM   9087  C  C2    . DT  J 6 2   ? -56.271 -43.944 84.239 1.00 110.47 ? -71  DT  J C2    1 
ATOM   9088  O  O2    . DT  J 6 2   ? -57.145 -43.166 84.590 1.00 110.44 ? -71  DT  J O2    1 
ATOM   9089  N  N3    . DT  J 6 2   ? -55.003 -43.506 83.924 1.00 110.02 ? -71  DT  J N3    1 
ATOM   9090  C  C4    . DT  J 6 2   ? -53.925 -44.272 83.513 1.00 109.94 ? -71  DT  J C4    1 
ATOM   9091  O  O4    . DT  J 6 2   ? -52.830 -43.780 83.257 1.00 109.49 ? -71  DT  J O4    1 
ATOM   9092  C  C5    . DT  J 6 2   ? -54.176 -45.691 83.413 1.00 110.29 ? -71  DT  J C5    1 
ATOM   9093  C  C7    . DT  J 6 2   ? -53.075 -46.615 82.976 1.00 110.39 ? -71  DT  J C7    1 
ATOM   9094  C  C6    . DT  J 6 2   ? -55.409 -46.136 83.719 1.00 110.66 ? -71  DT  J C6    1 
ATOM   9095  P  P     . DC  J 6 3   ? -61.437 -46.512 84.677 1.00 112.84 ? -70  DC  J P     1 
ATOM   9096  O  OP1   . DC  J 6 3   ? -61.124 -46.484 86.126 1.00 112.67 ? -70  DC  J OP1   1 
ATOM   9097  O  OP2   . DC  J 6 3   ? -62.842 -46.692 84.246 1.00 112.82 ? -70  DC  J OP2   1 
ATOM   9098  O  "O5'" . DC  J 6 3   ? -60.914 -45.159 83.996 1.00 112.20 ? -70  DC  J "O5'" 1 
ATOM   9099  C  "C5'" . DC  J 6 3   ? -61.315 -43.875 84.485 1.00 111.18 ? -70  DC  J "C5'" 1 
ATOM   9100  C  "C4'" . DC  J 6 3   ? -61.074 -42.782 83.451 1.00 110.53 ? -70  DC  J "C4'" 1 
ATOM   9101  O  "O4'" . DC  J 6 3   ? -59.673 -42.720 83.064 1.00 110.16 ? -70  DC  J "O4'" 1 
ATOM   9102  C  "C3'" . DC  J 6 3   ? -61.852 -42.919 82.143 1.00 110.12 ? -70  DC  J "C3'" 1 
ATOM   9103  O  "O3'" . DC  J 6 3   ? -62.315 -41.644 81.748 1.00 109.76 ? -70  DC  J "O3'" 1 
ATOM   9104  C  "C2'" . DC  J 6 3   ? -60.805 -43.405 81.152 1.00 110.05 ? -70  DC  J "C2'" 1 
ATOM   9105  C  "C1'" . DC  J 6 3   ? -59.624 -42.580 81.655 1.00 109.80 ? -70  DC  J "C1'" 1 
ATOM   9106  N  N1    . DC  J 6 3   ? -58.281 -42.984 81.122 1.00 109.16 ? -70  DC  J N1    1 
ATOM   9107  C  C2    . DC  J 6 3   ? -57.250 -42.032 81.066 1.00 108.51 ? -70  DC  J C2    1 
ATOM   9108  O  O2    . DC  J 6 3   ? -57.466 -40.879 81.464 1.00 107.56 ? -70  DC  J O2    1 
ATOM   9109  N  N3    . DC  J 6 3   ? -56.040 -42.414 80.576 1.00 108.44 ? -70  DC  J N3    1 
ATOM   9110  C  C4    . DC  J 6 3   ? -55.845 -43.672 80.155 1.00 108.66 ? -70  DC  J C4    1 
ATOM   9111  N  N4    . DC  J 6 3   ? -54.641 -44.003 79.682 1.00 108.40 ? -70  DC  J N4    1 
ATOM   9112  C  C5    . DC  J 6 3   ? -56.881 -44.655 80.200 1.00 108.98 ? -70  DC  J C5    1 
ATOM   9113  C  C6    . DC  J 6 3   ? -58.068 -44.268 80.685 1.00 109.19 ? -70  DC  J C6    1 
ATOM   9114  P  P     . DA  J 6 4   ? -63.888 -41.407 81.682 1.00 109.75 ? -69  DA  J P     1 
ATOM   9115  O  OP1   . DA  J 6 4   ? -64.374 -41.358 83.081 1.00 109.70 ? -69  DA  J OP1   1 
ATOM   9116  O  OP2   . DA  J 6 4   ? -64.435 -42.407 80.732 1.00 110.05 ? -69  DA  J OP2   1 
ATOM   9117  O  "O5'" . DA  J 6 4   ? -64.056 -39.955 81.024 1.00 108.03 ? -69  DA  J "O5'" 1 
ATOM   9118  C  "C5'" . DA  J 6 4   ? -63.291 -38.841 81.479 1.00 105.65 ? -69  DA  J "C5'" 1 
ATOM   9119  C  "C4'" . DA  J 6 4   ? -62.456 -38.243 80.353 1.00 103.87 ? -69  DA  J "C4'" 1 
ATOM   9120  O  "O4'" . DA  J 6 4   ? -61.245 -39.019 80.141 1.00 102.36 ? -69  DA  J "O4'" 1 
ATOM   9121  C  "C3'" . DA  J 6 4   ? -63.125 -38.135 78.980 1.00 103.31 ? -69  DA  J "C3'" 1 
ATOM   9122  O  "O3'" . DA  J 6 4   ? -62.836 -36.869 78.405 1.00 103.33 ? -69  DA  J "O3'" 1 
ATOM   9123  C  "C2'" . DA  J 6 4   ? -62.434 -39.232 78.177 1.00 102.43 ? -69  DA  J "C2'" 1 
ATOM   9124  C  "C1'" . DA  J 6 4   ? -61.031 -39.040 78.743 1.00 101.19 ? -69  DA  J "C1'" 1 
ATOM   9125  N  N9    . DA  J 6 4   ? -60.031 -40.039 78.358 1.00 99.02  ? -69  DA  J N9    1 
ATOM   9126  C  C8    . DA  J 6 4   ? -60.189 -41.393 78.236 1.00 98.51  ? -69  DA  J C8    1 
ATOM   9127  N  N7    . DA  J 6 4   ? -59.101 -42.025 77.866 1.00 97.65  ? -69  DA  J N7    1 
ATOM   9128  C  C5    . DA  J 6 4   ? -58.163 -41.015 77.730 1.00 96.95  ? -69  DA  J C5    1 
ATOM   9129  C  C6    . DA  J 6 4   ? -56.803 -41.020 77.357 1.00 95.85  ? -69  DA  J C6    1 
ATOM   9130  N  N6    . DA  J 6 4   ? -56.138 -42.133 77.047 1.00 94.93  ? -69  DA  J N6    1 
ATOM   9131  N  N1    . DA  J 6 4   ? -56.151 -39.837 77.320 1.00 95.28  ? -69  DA  J N1    1 
ATOM   9132  C  C2    . DA  J 6 4   ? -56.818 -38.718 77.632 1.00 95.90  ? -69  DA  J C2    1 
ATOM   9133  N  N3    . DA  J 6 4   ? -58.093 -38.587 77.995 1.00 96.85  ? -69  DA  J N3    1 
ATOM   9134  C  C4    . DA  J 6 4   ? -58.718 -39.784 78.027 1.00 97.67  ? -69  DA  J C4    1 
ATOM   9135  P  P     . DA  J 6 5   ? -63.923 -35.697 78.405 1.00 103.78 ? -68  DA  J P     1 
ATOM   9136  O  OP1   . DA  J 6 5   ? -63.991 -35.155 79.788 1.00 103.43 ? -68  DA  J OP1   1 
ATOM   9137  O  OP2   . DA  J 6 5   ? -65.144 -36.203 77.729 1.00 103.67 ? -68  DA  J OP2   1 
ATOM   9138  O  "O5'" . DA  J 6 5   ? -63.250 -34.611 77.434 1.00 102.61 ? -68  DA  J "O5'" 1 
ATOM   9139  C  "C5'" . DA  J 6 5   ? -62.069 -33.909 77.840 1.00 101.03 ? -68  DA  J "C5'" 1 
ATOM   9140  C  "C4'" . DA  J 6 5   ? -60.907 -34.063 76.861 1.00 99.69  ? -68  DA  J "C4'" 1 
ATOM   9141  O  "O4'" . DA  J 6 5   ? -60.451 -35.432 76.712 1.00 99.60  ? -68  DA  J "O4'" 1 
ATOM   9142  C  "C3'" . DA  J 6 5   ? -61.147 -33.554 75.445 1.00 98.55  ? -68  DA  J "C3'" 1 
ATOM   9143  O  "O3'" . DA  J 6 5   ? -60.292 -32.437 75.286 1.00 96.99  ? -68  DA  J "O3'" 1 
ATOM   9144  C  "C2'" . DA  J 6 5   ? -60.772 -34.727 74.532 1.00 98.27  ? -68  DA  J "C2'" 1 
ATOM   9145  C  "C1'" . DA  J 6 5   ? -59.853 -35.538 75.436 1.00 98.48  ? -68  DA  J "C1'" 1 
ATOM   9146  N  N9    . DA  J 6 5   ? -59.724 -36.967 75.154 1.00 98.01  ? -68  DA  J N9    1 
ATOM   9147  C  C8    . DA  J 6 5   ? -60.704 -37.917 75.253 1.00 98.23  ? -68  DA  J C8    1 
ATOM   9148  N  N7    . DA  J 6 5   ? -60.308 -39.134 74.958 1.00 98.05  ? -68  DA  J N7    1 
ATOM   9149  C  C5    . DA  J 6 5   ? -58.968 -38.973 74.652 1.00 97.56  ? -68  DA  J C5    1 
ATOM   9150  C  C6    . DA  J 6 5   ? -57.968 -39.890 74.259 1.00 97.32  ? -68  DA  J C6    1 
ATOM   9151  N  N6    . DA  J 6 5   ? -58.188 -41.197 74.110 1.00 97.12  ? -68  DA  J N6    1 
ATOM   9152  N  N1    . DA  J 6 5   ? -56.728 -39.411 74.025 1.00 97.25  ? -68  DA  J N1    1 
ATOM   9153  C  C2    . DA  J 6 5   ? -56.503 -38.096 74.176 1.00 97.22  ? -68  DA  J C2    1 
ATOM   9154  N  N3    . DA  J 6 5   ? -57.360 -37.138 74.544 1.00 97.37  ? -68  DA  J N3    1 
ATOM   9155  C  C4    . DA  J 6 5   ? -58.588 -37.645 74.771 1.00 97.69  ? -68  DA  J C4    1 
ATOM   9156  P  P     . DT  J 6 6   ? -60.528 -31.348 74.138 1.00 95.85  ? -67  DT  J P     1 
ATOM   9157  O  OP1   . DT  J 6 6   ? -59.911 -30.080 74.602 1.00 94.96  ? -67  DT  J OP1   1 
ATOM   9158  O  OP2   . DT  J 6 6   ? -61.955 -31.376 73.736 1.00 95.64  ? -67  DT  J OP2   1 
ATOM   9159  O  "O5'" . DT  J 6 6   ? -59.662 -31.967 72.935 1.00 94.19  ? -67  DT  J "O5'" 1 
ATOM   9160  C  "C5'" . DT  J 6 6   ? -58.243 -32.162 73.071 1.00 91.78  ? -67  DT  J "C5'" 1 
ATOM   9161  C  "C4'" . DT  J 6 6   ? -57.610 -32.911 71.898 1.00 89.63  ? -67  DT  J "C4'" 1 
ATOM   9162  O  "O4'" . DT  J 6 6   ? -57.760 -34.355 72.023 1.00 89.59  ? -67  DT  J "O4'" 1 
ATOM   9163  C  "C3'" . DT  J 6 6   ? -58.154 -32.578 70.511 1.00 88.45  ? -67  DT  J "C3'" 1 
ATOM   9164  O  "O3'" . DT  J 6 6   ? -57.083 -32.668 69.588 1.00 86.23  ? -67  DT  J "O3'" 1 
ATOM   9165  C  "C2'" . DT  J 6 6   ? -59.141 -33.718 70.271 1.00 88.83  ? -67  DT  J "C2'" 1 
ATOM   9166  C  "C1'" . DT  J 6 6   ? -58.271 -34.854 70.798 1.00 89.21  ? -67  DT  J "C1'" 1 
ATOM   9167  N  N1    . DT  J 6 6   ? -58.942 -36.192 70.987 1.00 89.19  ? -67  DT  J N1    1 
ATOM   9168  C  C2    . DT  J 6 6   ? -58.161 -37.332 70.890 1.00 89.27  ? -67  DT  J C2    1 
ATOM   9169  O  O2    . DT  J 6 6   ? -56.961 -37.312 70.664 1.00 88.85  ? -67  DT  J O2    1 
ATOM   9170  N  N3    . DT  J 6 6   ? -58.841 -38.515 71.070 1.00 89.52  ? -67  DT  J N3    1 
ATOM   9171  C  C4    . DT  J 6 6   ? -60.194 -38.675 71.334 1.00 89.70  ? -67  DT  J C4    1 
ATOM   9172  O  O4    . DT  J 6 6   ? -60.682 -39.795 71.479 1.00 89.69  ? -67  DT  J O4    1 
ATOM   9173  C  C5    . DT  J 6 6   ? -60.962 -37.442 71.422 1.00 89.76  ? -67  DT  J C5    1 
ATOM   9174  C  C7    . DT  J 6 6   ? -62.443 -37.460 71.702 1.00 89.89  ? -67  DT  J C7    1 
ATOM   9175  C  C6    . DT  J 6 6   ? -60.305 -36.279 71.245 1.00 89.37  ? -67  DT  J C6    1 
ATOM   9176  P  P     . DA  J 6 7   ? -56.738 -31.531 68.514 1.00 83.84  ? -66  DA  J P     1 
ATOM   9177  O  OP1   . DA  J 6 7   ? -56.258 -30.340 69.259 1.00 83.81  ? -66  DA  J OP1   1 
ATOM   9178  O  OP2   . DA  J 6 7   ? -57.827 -31.433 67.512 1.00 83.17  ? -66  DA  J OP2   1 
ATOM   9179  O  "O5'" . DA  J 6 7   ? -55.489 -32.209 67.795 1.00 82.04  ? -66  DA  J "O5'" 1 
ATOM   9180  C  "C5'" . DA  J 6 7   ? -54.467 -32.784 68.613 1.00 80.10  ? -66  DA  J "C5'" 1 
ATOM   9181  C  "C4'" . DA  J 6 7   ? -53.993 -34.129 68.095 1.00 78.78  ? -66  DA  J "C4'" 1 
ATOM   9182  O  "O4'" . DA  J 6 7   ? -54.948 -35.181 68.404 1.00 78.12  ? -66  DA  J "O4'" 1 
ATOM   9183  C  "C3'" . DA  J 6 7   ? -53.788 -34.156 66.589 1.00 78.74  ? -66  DA  J "C3'" 1 
ATOM   9184  O  "O3'" . DA  J 6 7   ? -52.469 -34.636 66.309 1.00 78.81  ? -66  DA  J "O3'" 1 
ATOM   9185  C  "C2'" . DA  J 6 7   ? -54.921 -35.056 66.081 1.00 78.12  ? -66  DA  J "C2'" 1 
ATOM   9186  C  "C1'" . DA  J 6 7   ? -55.155 -35.990 67.263 1.00 77.42  ? -66  DA  J "C1'" 1 
ATOM   9187  N  N9    . DA  J 6 7   ? -56.503 -36.568 67.322 1.00 76.65  ? -66  DA  J N9    1 
ATOM   9188  C  C8    . DA  J 6 7   ? -57.686 -35.881 67.440 1.00 76.58  ? -66  DA  J C8    1 
ATOM   9189  N  N7    . DA  J 6 7   ? -58.751 -36.650 67.473 1.00 76.37  ? -66  DA  J N7    1 
ATOM   9190  C  C5    . DA  J 6 7   ? -58.237 -37.935 67.368 1.00 76.07  ? -66  DA  J C5    1 
ATOM   9191  C  C6    . DA  J 6 7   ? -58.853 -39.212 67.344 1.00 76.02  ? -66  DA  J C6    1 
ATOM   9192  N  N6    . DA  J 6 7   ? -60.176 -39.394 67.426 1.00 76.28  ? -66  DA  J N6    1 
ATOM   9193  N  N1    . DA  J 6 7   ? -58.054 -40.299 67.234 1.00 75.39  ? -66  DA  J N1    1 
ATOM   9194  C  C2    . DA  J 6 7   ? -56.728 -40.115 67.147 1.00 75.03  ? -66  DA  J C2    1 
ATOM   9195  N  N3    . DA  J 6 7   ? -56.038 -38.971 67.160 1.00 74.95  ? -66  DA  J N3    1 
ATOM   9196  C  C4    . DA  J 6 7   ? -56.852 -37.904 67.273 1.00 75.86  ? -66  DA  J C4    1 
ATOM   9197  P  P     . DT  J 6 8   ? -51.882 -34.721 64.814 1.00 78.66  ? -65  DT  J P     1 
ATOM   9198  O  OP1   . DT  J 6 8   ? -50.415 -34.778 64.939 1.00 78.31  ? -65  DT  J OP1   1 
ATOM   9199  O  OP2   . DT  J 6 8   ? -52.542 -33.718 63.945 1.00 78.00  ? -65  DT  J OP2   1 
ATOM   9200  O  "O5'" . DT  J 6 8   ? -52.310 -36.182 64.349 1.00 78.93  ? -65  DT  J "O5'" 1 
ATOM   9201  C  "C5'" . DT  J 6 8   ? -51.768 -37.319 65.016 1.00 78.88  ? -65  DT  J "C5'" 1 
ATOM   9202  C  "C4'" . DT  J 6 8   ? -52.339 -38.581 64.401 1.00 79.54  ? -65  DT  J "C4'" 1 
ATOM   9203  O  "O4'" . DT  J 6 8   ? -53.750 -38.671 64.725 1.00 79.39  ? -65  DT  J "O4'" 1 
ATOM   9204  C  "C3'" . DT  J 6 8   ? -52.248 -38.638 62.881 1.00 80.03  ? -65  DT  J "C3'" 1 
ATOM   9205  O  "O3'" . DT  J 6 8   ? -51.648 -39.873 62.515 1.00 81.16  ? -65  DT  J "O3'" 1 
ATOM   9206  C  "C2'" . DT  J 6 8   ? -53.702 -38.517 62.423 1.00 79.94  ? -65  DT  J "C2'" 1 
ATOM   9207  C  "C1'" . DT  J 6 8   ? -54.446 -39.145 63.596 1.00 79.74  ? -65  DT  J "C1'" 1 
ATOM   9208  N  N1    . DT  J 6 8   ? -55.926 -38.824 63.731 1.00 80.43  ? -65  DT  J N1    1 
ATOM   9209  C  C2    . DT  J 6 8   ? -56.830 -39.872 63.878 1.00 80.39  ? -65  DT  J C2    1 
ATOM   9210  O  O2    . DT  J 6 8   ? -56.518 -41.051 63.902 1.00 80.00  ? -65  DT  J O2    1 
ATOM   9211  N  N3    . DT  J 6 8   ? -58.144 -39.492 63.995 1.00 80.58  ? -65  DT  J N3    1 
ATOM   9212  C  C4    . DT  J 6 8   ? -58.648 -38.199 63.986 1.00 81.27  ? -65  DT  J C4    1 
ATOM   9213  O  O4    . DT  J 6 8   ? -59.852 -37.966 64.097 1.00 82.05  ? -65  DT  J O4    1 
ATOM   9214  C  C5    . DT  J 6 8   ? -57.664 -37.149 63.833 1.00 80.84  ? -65  DT  J C5    1 
ATOM   9215  C  C7    . DT  J 6 8   ? -58.108 -35.712 63.813 1.00 80.66  ? -65  DT  J C7    1 
ATOM   9216  C  C6    . DT  J 6 8   ? -56.369 -37.506 63.715 1.00 80.43  ? -65  DT  J C6    1 
ATOM   9217  P  P     . DC  J 6 9   ? -51.057 -40.179 61.051 1.00 82.01  ? -64  DC  J P     1 
ATOM   9218  O  OP1   . DC  J 6 9   ? -49.648 -40.588 61.251 1.00 81.61  ? -64  DC  J OP1   1 
ATOM   9219  O  OP2   . DC  J 6 9   ? -51.414 -39.077 60.122 1.00 81.07  ? -64  DC  J OP2   1 
ATOM   9220  O  "O5'" . DC  J 6 9   ? -51.868 -41.477 60.578 1.00 82.01  ? -64  DC  J "O5'" 1 
ATOM   9221  C  "C5'" . DC  J 6 9   ? -52.020 -42.606 61.436 1.00 82.89  ? -64  DC  J "C5'" 1 
ATOM   9222  C  "C4'" . DC  J 6 9   ? -53.180 -43.458 60.960 1.00 83.93  ? -64  DC  J "C4'" 1 
ATOM   9223  O  "O4'" . DC  J 6 9   ? -54.443 -42.878 61.382 1.00 84.55  ? -64  DC  J "O4'" 1 
ATOM   9224  C  "C3'" . DC  J 6 9   ? -53.248 -43.592 59.445 1.00 84.60  ? -64  DC  J "C3'" 1 
ATOM   9225  O  "O3'" . DC  J 6 9   ? -53.128 -44.958 59.087 1.00 85.25  ? -64  DC  J "O3'" 1 
ATOM   9226  C  "C2'" . DC  J 6 9   ? -54.602 -43.009 59.040 1.00 84.66  ? -64  DC  J "C2'" 1 
ATOM   9227  C  "C1'" . DC  J 6 9   ? -55.393 -42.984 60.343 1.00 84.45  ? -64  DC  J "C1'" 1 
ATOM   9228  N  N1    . DC  J 6 9   ? -56.355 -41.837 60.452 1.00 84.61  ? -64  DC  J N1    1 
ATOM   9229  C  C2    . DC  J 6 9   ? -57.738 -42.071 60.554 1.00 85.29  ? -64  DC  J C2    1 
ATOM   9230  O  O2    . DC  J 6 9   ? -58.176 -43.233 60.551 1.00 86.30  ? -64  DC  J O2    1 
ATOM   9231  N  N3    . DC  J 6 9   ? -58.575 -41.003 60.655 1.00 85.19  ? -64  DC  J N3    1 
ATOM   9232  C  C4    . DC  J 6 9   ? -58.094 -39.756 60.655 1.00 85.01  ? -64  DC  J C4    1 
ATOM   9233  N  N4    . DC  J 6 9   ? -58.963 -38.744 60.750 1.00 85.15  ? -64  DC  J N4    1 
ATOM   9234  C  C5    . DC  J 6 9   ? -56.696 -39.497 60.546 1.00 84.93  ? -64  DC  J C5    1 
ATOM   9235  C  C6    . DC  J 6 9   ? -55.880 -40.555 60.451 1.00 84.83  ? -64  DC  J C6    1 
ATOM   9236  P  P     . DC  J 6 10  ? -52.783 -45.370 57.579 1.00 85.54  ? -63  DC  J P     1 
ATOM   9237  O  OP1   . DC  J 6 10  ? -51.908 -46.566 57.618 1.00 84.87  ? -63  DC  J OP1   1 
ATOM   9238  O  OP2   . DC  J 6 10  ? -52.340 -44.156 56.849 1.00 85.27  ? -63  DC  J OP2   1 
ATOM   9239  O  "O5'" . DC  J 6 10  ? -54.223 -45.799 57.025 1.00 85.62  ? -63  DC  J "O5'" 1 
ATOM   9240  C  "C5'" . DC  J 6 10  ? -55.055 -46.708 57.765 1.00 85.89  ? -63  DC  J "C5'" 1 
ATOM   9241  C  "C4'" . DC  J 6 10  ? -56.484 -46.675 57.244 1.00 86.77  ? -63  DC  J "C4'" 1 
ATOM   9242  O  "O4'" . DC  J 6 10  ? -57.195 -45.508 57.749 1.00 86.76  ? -63  DC  J "O4'" 1 
ATOM   9243  C  "C3'" . DC  J 6 10  ? -56.618 -46.640 55.718 1.00 86.93  ? -63  DC  J "C3'" 1 
ATOM   9244  O  "O3'" . DC  J 6 10  ? -57.618 -47.555 55.293 1.00 87.41  ? -63  DC  J "O3'" 1 
ATOM   9245  C  "C2'" . DC  J 6 10  ? -57.059 -45.210 55.431 1.00 86.54  ? -63  DC  J "C2'" 1 
ATOM   9246  C  "C1'" . DC  J 6 10  ? -57.904 -44.933 56.671 1.00 86.41  ? -63  DC  J "C1'" 1 
ATOM   9247  N  N1    . DC  J 6 10  ? -58.166 -43.485 56.933 1.00 86.28  ? -63  DC  J N1    1 
ATOM   9248  C  C2    . DC  J 6 10  ? -59.439 -43.092 57.378 1.00 86.65  ? -63  DC  J C2    1 
ATOM   9249  O  O2    . DC  J 6 10  ? -60.318 -43.949 57.558 1.00 87.39  ? -63  DC  J O2    1 
ATOM   9250  N  N3    . DC  J 6 10  ? -59.673 -41.772 57.604 1.00 86.03  ? -63  DC  J N3    1 
ATOM   9251  C  C4    . DC  J 6 10  ? -58.704 -40.874 57.402 1.00 85.60  ? -63  DC  J C4    1 
ATOM   9252  N  N4    . DC  J 6 10  ? -58.993 -39.595 57.642 1.00 85.46  ? -63  DC  J N4    1 
ATOM   9253  C  C5    . DC  J 6 10  ? -57.403 -41.247 56.943 1.00 85.82  ? -63  DC  J C5    1 
ATOM   9254  C  C6    . DC  J 6 10  ? -57.185 -42.550 56.722 1.00 86.07  ? -63  DC  J C6    1 
ATOM   9255  P  P     . DA  J 6 11  ? -57.371 -48.535 54.053 1.00 87.17  ? -62  DA  J P     1 
ATOM   9256  O  OP1   . DA  J 6 11  ? -56.780 -49.789 54.585 1.00 87.31  ? -62  DA  J OP1   1 
ATOM   9257  O  OP2   . DA  J 6 11  ? -56.692 -47.769 52.975 1.00 86.71  ? -62  DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  J 6 11  ? -58.861 -48.846 53.558 1.00 86.29  ? -62  DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  J 6 11  ? -59.920 -49.012 54.498 1.00 85.24  ? -62  DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  J 6 11  ? -61.215 -48.491 53.907 1.00 84.22  ? -62  DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  J 6 11  ? -61.406 -47.129 54.353 1.00 83.35  ? -62  DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  J 6 11  ? -61.274 -48.498 52.381 1.00 83.70  ? -62  DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  J 6 11  ? -62.429 -49.249 51.969 1.00 84.43  ? -62  DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  J 6 11  ? -61.297 -47.016 52.000 1.00 83.70  ? -62  DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  J 6 11  ? -61.783 -46.315 53.269 1.00 83.47  ? -62  DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  J 6 11  ? -61.204 -44.993 53.527 1.00 83.25  ? -62  DA  J N9    1 
ATOM   9267  C  C8    . DA  J 6 11  ? -59.894 -44.603 53.401 1.00 82.56  ? -62  DA  J C8    1 
ATOM   9268  N  N7    . DA  J 6 11  ? -59.683 -43.346 53.722 1.00 82.40  ? -62  DA  J N7    1 
ATOM   9269  C  C5    . DA  J 6 11  ? -60.935 -42.876 54.089 1.00 82.61  ? -62  DA  J C5    1 
ATOM   9270  C  C6    . DA  J 6 11  ? -61.401 -41.613 54.532 1.00 82.73  ? -62  DA  J C6    1 
ATOM   9271  N  N6    . DA  J 6 11  ? -60.613 -40.546 54.688 1.00 82.95  ? -62  DA  J N6    1 
ATOM   9272  N  N1    . DA  J 6 11  ? -62.717 -41.479 54.812 1.00 82.68  ? -62  DA  J N1    1 
ATOM   9273  C  C2    . DA  J 6 11  ? -63.516 -42.546 54.653 1.00 83.27  ? -62  DA  J C2    1 
ATOM   9274  N  N3    . DA  J 6 11  ? -63.198 -43.781 54.249 1.00 82.98  ? -62  DA  J N3    1 
ATOM   9275  C  C4    . DA  J 6 11  ? -61.883 -43.880 53.976 1.00 82.94  ? -62  DA  J C4    1 
ATOM   9276  P  P     . DC  J 6 12  ? -62.914 -49.407 50.440 1.00 84.54  ? -61  DC  J P     1 
ATOM   9277  O  OP1   . DC  J 6 12  ? -63.789 -50.593 50.321 1.00 84.99  ? -61  DC  J OP1   1 
ATOM   9278  O  OP2   . DC  J 6 12  ? -61.740 -49.306 49.542 1.00 84.42  ? -61  DC  J OP2   1 
ATOM   9279  O  "O5'" . DC  J 6 12  ? -63.843 -48.117 50.281 1.00 85.04  ? -61  DC  J "O5'" 1 
ATOM   9280  C  "C5'" . DC  J 6 12  ? -64.871 -47.851 51.235 1.00 85.48  ? -61  DC  J "C5'" 1 
ATOM   9281  C  "C4'" . DC  J 6 12  ? -65.551 -46.551 50.873 1.00 86.40  ? -61  DC  J "C4'" 1 
ATOM   9282  O  "O4'" . DC  J 6 12  ? -64.720 -45.461 51.347 1.00 87.05  ? -61  DC  J "O4'" 1 
ATOM   9283  C  "C3'" . DC  J 6 12  ? -65.739 -46.327 49.372 1.00 87.05  ? -61  DC  J "C3'" 1 
ATOM   9284  O  "O3'" . DC  J 6 12  ? -67.092 -45.928 49.096 1.00 88.47  ? -61  DC  J "O3'" 1 
ATOM   9285  C  "C2'" . DC  J 6 12  ? -64.721 -45.230 49.050 1.00 87.04  ? -61  DC  J "C2'" 1 
ATOM   9286  C  "C1'" . DC  J 6 12  ? -64.730 -44.451 50.360 1.00 86.80  ? -61  DC  J "C1'" 1 
ATOM   9287  N  N1    . DC  J 6 12  ? -63.583 -43.501 50.558 1.00 86.40  ? -61  DC  J N1    1 
ATOM   9288  C  C2    . DC  J 6 12  ? -63.828 -42.214 51.076 1.00 86.17  ? -61  DC  J C2    1 
ATOM   9289  O  O2    . DC  J 6 12  ? -64.984 -41.876 51.371 1.00 85.86  ? -61  DC  J O2    1 
ATOM   9290  N  N3    . DC  J 6 12  ? -62.775 -41.364 51.241 1.00 86.00  ? -61  DC  J N3    1 
ATOM   9291  C  C4    . DC  J 6 12  ? -61.535 -41.754 50.915 1.00 85.82  ? -61  DC  J C4    1 
ATOM   9292  N  N4    . DC  J 6 12  ? -60.537 -40.885 51.102 1.00 85.43  ? -61  DC  J N4    1 
ATOM   9293  C  C5    . DC  J 6 12  ? -61.265 -43.055 50.385 1.00 85.93  ? -61  DC  J C5    1 
ATOM   9294  C  C6    . DC  J 6 12  ? -62.307 -43.886 50.226 1.00 86.25  ? -61  DC  J C6    1 
ATOM   9295  P  P     . DC  J 6 13  ? -67.607 -45.570 47.614 1.00 89.93  ? -60  DC  J P     1 
ATOM   9296  O  OP1   . DC  J 6 13  ? -68.979 -46.119 47.481 1.00 89.69  ? -60  DC  J OP1   1 
ATOM   9297  O  OP2   . DC  J 6 13  ? -66.563 -45.950 46.630 1.00 88.73  ? -60  DC  J OP2   1 
ATOM   9298  O  "O5'" . DC  J 6 13  ? -67.699 -43.969 47.653 1.00 90.38  ? -60  DC  J "O5'" 1 
ATOM   9299  C  "C5'" . DC  J 6 13  ? -68.549 -43.295 48.592 1.00 92.08  ? -60  DC  J "C5'" 1 
ATOM   9300  C  "C4'" . DC  J 6 13  ? -68.713 -41.830 48.216 1.00 93.26  ? -60  DC  J "C4'" 1 
ATOM   9301  O  "O4'" . DC  J 6 13  ? -67.512 -41.093 48.567 1.00 93.12  ? -60  DC  J "O4'" 1 
ATOM   9302  C  "C3'" . DC  J 6 13  ? -68.947 -41.572 46.729 1.00 94.55  ? -60  DC  J "C3'" 1 
ATOM   9303  O  "O3'" . DC  J 6 13  ? -69.934 -40.552 46.543 1.00 96.66  ? -60  DC  J "O3'" 1 
ATOM   9304  C  "C2'" . DC  J 6 13  ? -67.578 -41.133 46.208 1.00 94.06  ? -60  DC  J "C2'" 1 
ATOM   9305  C  "C1'" . DC  J 6 13  ? -66.985 -40.433 47.427 1.00 93.34  ? -60  DC  J "C1'" 1 
ATOM   9306  N  N1    . DC  J 6 13  ? -65.474 -40.443 47.484 1.00 92.77  ? -60  DC  J N1    1 
ATOM   9307  C  C2    . DC  J 6 13  ? -64.771 -39.258 47.779 1.00 92.20  ? -60  DC  J C2    1 
ATOM   9308  O  O2    . DC  J 6 13  ? -65.393 -38.209 47.994 1.00 91.91  ? -60  DC  J O2    1 
ATOM   9309  N  N3    . DC  J 6 13  ? -63.414 -39.288 47.830 1.00 91.72  ? -60  DC  J N3    1 
ATOM   9310  C  C4    . DC  J 6 13  ? -62.760 -40.431 47.600 1.00 91.72  ? -60  DC  J C4    1 
ATOM   9311  N  N4    . DC  J 6 13  ? -61.424 -40.418 47.658 1.00 91.45  ? -60  DC  J N4    1 
ATOM   9312  C  C5    . DC  J 6 13  ? -63.452 -41.642 47.294 1.00 92.08  ? -60  DC  J C5    1 
ATOM   9313  C  C6    . DC  J 6 13  ? -64.790 -41.605 47.249 1.00 92.22  ? -60  DC  J C6    1 
ATOM   9314  P  P     . DT  J 6 14  ? -70.568 -40.299 45.086 1.00 98.06  ? -59  DT  J P     1 
ATOM   9315  O  OP1   . DT  J 6 14  ? -72.008 -39.982 45.270 1.00 98.09  ? -59  DT  J OP1   1 
ATOM   9316  O  OP2   . DT  J 6 14  ? -70.154 -41.411 44.193 1.00 97.03  ? -59  DT  J OP2   1 
ATOM   9317  O  "O5'" . DT  J 6 14  ? -69.815 -38.983 44.566 1.00 98.94  ? -59  DT  J "O5'" 1 
ATOM   9318  C  "C5'" . DT  J 6 14  ? -69.752 -37.768 45.312 1.00 100.32 ? -59  DT  J "C5'" 1 
ATOM   9319  C  "C4'" . DT  J 6 14  ? -68.777 -36.814 44.634 1.00 101.61 ? -59  DT  J "C4'" 1 
ATOM   9320  O  "O4'" . DT  J 6 14  ? -67.406 -37.188 44.935 1.00 101.77 ? -59  DT  J "O4'" 1 
ATOM   9321  C  "C3'" . DT  J 6 14  ? -68.853 -36.761 43.104 1.00 102.16 ? -59  DT  J "C3'" 1 
ATOM   9322  O  "O3'" . DT  J 6 14  ? -68.741 -35.415 42.673 1.00 102.87 ? -59  DT  J "O3'" 1 
ATOM   9323  C  "C2'" . DT  J 6 14  ? -67.643 -37.559 42.638 1.00 102.03 ? -59  DT  J "C2'" 1 
ATOM   9324  C  "C1'" . DT  J 6 14  ? -66.675 -37.099 43.723 1.00 102.07 ? -59  DT  J "C1'" 1 
ATOM   9325  N  N1    . DT  J 6 14  ? -65.417 -37.883 43.817 1.00 101.94 ? -59  DT  J N1    1 
ATOM   9326  C  C2    . DT  J 6 14  ? -64.249 -37.235 44.191 1.00 101.65 ? -59  DT  J C2    1 
ATOM   9327  O  O2    . DT  J 6 14  ? -64.181 -36.044 44.460 1.00 101.03 ? -59  DT  J O2    1 
ATOM   9328  N  N3    . DT  J 6 14  ? -63.147 -38.050 44.241 1.00 101.26 ? -59  DT  J N3    1 
ATOM   9329  C  C4    . DT  J 6 14  ? -63.102 -39.405 43.964 1.00 101.53 ? -59  DT  J C4    1 
ATOM   9330  O  O4    . DT  J 6 14  ? -62.052 -40.034 44.045 1.00 101.54 ? -59  DT  J O4    1 
ATOM   9331  C  C5    . DT  J 6 14  ? -64.359 -40.017 43.575 1.00 101.81 ? -59  DT  J C5    1 
ATOM   9332  C  C7    . DT  J 6 14  ? -64.453 -41.481 43.247 1.00 101.82 ? -59  DT  J C7    1 
ATOM   9333  C  C6    . DT  J 6 14  ? -65.442 -39.234 43.521 1.00 101.74 ? -59  DT  J C6    1 
ATOM   9334  P  P     . DG  J 6 15  ? -70.007 -34.738 41.983 1.00 103.06 ? -58  DG  J P     1 
ATOM   9335  O  OP1   . DG  J 6 15  ? -71.093 -34.709 42.999 1.00 103.00 ? -58  DG  J OP1   1 
ATOM   9336  O  OP2   . DG  J 6 15  ? -70.183 -35.430 40.678 1.00 102.65 ? -58  DG  J OP2   1 
ATOM   9337  O  "O5'" . DG  J 6 15  ? -69.532 -33.236 41.687 1.00 102.54 ? -58  DG  J "O5'" 1 
ATOM   9338  C  "C5'" . DG  J 6 15  ? -69.031 -32.385 42.719 1.00 101.58 ? -58  DG  J "C5'" 1 
ATOM   9339  C  "C4'" . DG  J 6 15  ? -67.924 -31.506 42.163 1.00 100.66 ? -58  DG  J "C4'" 1 
ATOM   9340  O  "O4'" . DG  J 6 15  ? -66.688 -32.255 42.089 1.00 99.91  ? -58  DG  J "O4'" 1 
ATOM   9341  C  "C3'" . DG  J 6 15  ? -68.205 -30.960 40.762 1.00 100.42 ? -58  DG  J "C3'" 1 
ATOM   9342  O  "O3'" . DG  J 6 15  ? -68.158 -29.515 40.818 1.00 100.31 ? -58  DG  J "O3'" 1 
ATOM   9343  C  "C2'" . DG  J 6 15  ? -67.221 -31.685 39.830 1.00 99.76  ? -58  DG  J "C2'" 1 
ATOM   9344  C  "C1'" . DG  J 6 15  ? -66.174 -32.286 40.771 1.00 99.53  ? -58  DG  J "C1'" 1 
ATOM   9345  N  N9    . DG  J 6 15  ? -65.806 -33.685 40.544 1.00 98.92  ? -58  DG  J N9    1 
ATOM   9346  C  C8    . DG  J 6 15  ? -66.595 -34.685 40.022 1.00 98.90  ? -58  DG  J C8    1 
ATOM   9347  N  N7    . DG  J 6 15  ? -65.994 -35.842 39.961 1.00 98.67  ? -58  DG  J N7    1 
ATOM   9348  C  C5    . DG  J 6 15  ? -64.730 -35.601 40.483 1.00 98.19  ? -58  DG  J C5    1 
ATOM   9349  C  C6    . DG  J 6 15  ? -63.636 -36.483 40.674 1.00 97.85  ? -58  DG  J C6    1 
ATOM   9350  O  O6    . DG  J 6 15  ? -63.580 -37.688 40.405 1.00 97.56  ? -58  DG  J O6    1 
ATOM   9351  N  N1    . DG  J 6 15  ? -62.525 -35.849 41.234 1.00 97.54  ? -58  DG  J N1    1 
ATOM   9352  C  C2    . DG  J 6 15  ? -62.488 -34.515 41.574 1.00 97.56  ? -58  DG  J C2    1 
ATOM   9353  N  N2    . DG  J 6 15  ? -61.343 -34.069 42.106 1.00 97.08  ? -58  DG  J N2    1 
ATOM   9354  N  N3    . DG  J 6 15  ? -63.507 -33.676 41.402 1.00 98.04  ? -58  DG  J N3    1 
ATOM   9355  C  C4    . DG  J 6 15  ? -64.597 -34.280 40.852 1.00 98.46  ? -58  DG  J C4    1 
ATOM   9356  P  P     . DC  J 6 16  ? -67.109 -28.565 40.065 1.00 100.23 ? -57  DC  J P     1 
ATOM   9357  O  OP1   . DC  J 6 16  ? -67.392 -27.181 40.524 1.00 100.05 ? -57  DC  J OP1   1 
ATOM   9358  O  OP2   . DC  J 6 16  ? -67.148 -28.894 38.617 1.00 99.81  ? -57  DC  J OP2   1 
ATOM   9359  O  "O5'" . DC  J 6 16  ? -65.688 -29.016 40.657 1.00 99.52  ? -57  DC  J "O5'" 1 
ATOM   9360  C  "C5'" . DC  J 6 16  ? -64.582 -28.113 40.689 1.00 98.42  ? -57  DC  J "C5'" 1 
ATOM   9361  C  "C4'" . DC  J 6 16  ? -63.452 -28.558 39.772 1.00 97.71  ? -57  DC  J "C4'" 1 
ATOM   9362  O  "O4'" . DC  J 6 16  ? -63.390 -29.999 39.625 1.00 97.15  ? -57  DC  J "O4'" 1 
ATOM   9363  C  "C3'" . DC  J 6 16  ? -63.511 -27.996 38.354 1.00 97.44  ? -57  DC  J "C3'" 1 
ATOM   9364  O  "O3'" . DC  J 6 16  ? -62.273 -27.392 38.070 1.00 97.70  ? -57  DC  J "O3'" 1 
ATOM   9365  C  "C2'" . DC  J 6 16  ? -63.707 -29.223 37.474 1.00 96.85  ? -57  DC  J "C2'" 1 
ATOM   9366  C  "C1'" . DC  J 6 16  ? -62.943 -30.237 38.311 1.00 96.65  ? -57  DC  J "C1'" 1 
ATOM   9367  N  N1    . DC  J 6 16  ? -63.162 -31.671 37.982 1.00 96.63  ? -57  DC  J N1    1 
ATOM   9368  C  C2    . DC  J 6 16  ? -62.151 -32.586 38.309 1.00 96.43  ? -57  DC  J C2    1 
ATOM   9369  O  O2    . DC  J 6 16  ? -61.117 -32.181 38.852 1.00 96.72  ? -57  DC  J O2    1 
ATOM   9370  N  N3    . DC  J 6 16  ? -62.331 -33.897 38.014 1.00 96.24  ? -57  DC  J N3    1 
ATOM   9371  C  C4    . DC  J 6 16  ? -63.458 -34.303 37.424 1.00 96.22  ? -57  DC  J C4    1 
ATOM   9372  N  N4    . DC  J 6 16  ? -63.579 -35.608 37.163 1.00 95.85  ? -57  DC  J N4    1 
ATOM   9373  C  C5    . DC  J 6 16  ? -64.506 -33.388 37.084 1.00 96.29  ? -57  DC  J C5    1 
ATOM   9374  C  C6    . DC  J 6 16  ? -64.318 -32.094 37.378 1.00 96.55  ? -57  DC  J C6    1 
ATOM   9375  P  P     . DA  J 6 17  ? -62.036 -25.839 38.351 1.00 98.28  ? -56  DA  J P     1 
ATOM   9376  O  OP1   . DA  J 6 17  ? -62.852 -25.402 39.512 1.00 97.92  ? -56  DA  J OP1   1 
ATOM   9377  O  OP2   . DA  J 6 17  ? -62.170 -25.165 37.039 1.00 98.10  ? -56  DA  J OP2   1 
ATOM   9378  O  "O5'" . DA  J 6 17  ? -60.492 -25.792 38.771 1.00 98.63  ? -56  DA  J "O5'" 1 
ATOM   9379  C  "C5'" . DA  J 6 17  ? -59.997 -26.533 39.896 1.00 99.43  ? -56  DA  J "C5'" 1 
ATOM   9380  C  "C4'" . DA  J 6 17  ? -58.666 -27.225 39.599 1.00 99.86  ? -56  DA  J "C4'" 1 
ATOM   9381  O  "O4'" . DA  J 6 17  ? -58.889 -28.469 38.887 1.00 99.78  ? -56  DA  J "O4'" 1 
ATOM   9382  C  "C3'" . DA  J 6 17  ? -57.657 -26.458 38.741 1.00 100.27 ? -56  DA  J "C3'" 1 
ATOM   9383  O  "O3'" . DA  J 6 17  ? -56.336 -26.862 39.121 1.00 100.90 ? -56  DA  J "O3'" 1 
ATOM   9384  C  "C2'" . DA  J 6 17  ? -58.004 -26.913 37.322 1.00 99.97  ? -56  DA  J "C2'" 1 
ATOM   9385  C  "C1'" . DA  J 6 17  ? -58.389 -28.371 37.563 1.00 99.73  ? -56  DA  J "C1'" 1 
ATOM   9386  N  N9    . DA  J 6 17  ? -59.422 -28.893 36.675 1.00 99.62  ? -56  DA  J N9    1 
ATOM   9387  C  C8    . DA  J 6 17  ? -60.382 -28.200 35.985 1.00 99.48  ? -56  DA  J C8    1 
ATOM   9388  N  N7    . DA  J 6 17  ? -61.170 -28.966 35.271 1.00 99.66  ? -56  DA  J N7    1 
ATOM   9389  C  C5    . DA  J 6 17  ? -60.695 -30.248 35.513 1.00 99.51  ? -56  DA  J C5    1 
ATOM   9390  C  C6    . DA  J 6 17  ? -61.094 -31.525 35.057 1.00 99.40  ? -56  DA  J C6    1 
ATOM   9391  N  N6    . DA  J 6 17  ? -62.116 -31.722 34.217 1.00 98.99  ? -56  DA  J N6    1 
ATOM   9392  N  N1    . DA  J 6 17  ? -60.393 -32.599 35.495 1.00 99.51  ? -56  DA  J N1    1 
ATOM   9393  C  C2    . DA  J 6 17  ? -59.362 -32.418 36.335 1.00 99.23  ? -56  DA  J C2    1 
ATOM   9394  N  N3    . DA  J 6 17  ? -58.901 -31.270 36.833 1.00 99.40  ? -56  DA  J N3    1 
ATOM   9395  C  C4    . DA  J 6 17  ? -59.615 -30.219 36.378 1.00 99.58  ? -56  DA  J C4    1 
ATOM   9396  P  P     . DG  J 6 18  ? -55.002 -26.179 38.543 1.00 101.35 ? -55  DG  J P     1 
ATOM   9397  O  OP1   . DG  J 6 18  ? -54.157 -25.881 39.719 1.00 101.00 ? -55  DG  J OP1   1 
ATOM   9398  O  OP2   . DG  J 6 18  ? -55.347 -25.103 37.579 1.00 101.31 ? -55  DG  J OP2   1 
ATOM   9399  O  "O5'" . DG  J 6 18  ? -54.323 -27.363 37.720 1.00 100.83 ? -55  DG  J "O5'" 1 
ATOM   9400  C  "C5'" . DG  J 6 18  ? -54.174 -28.646 38.304 1.00 101.44 ? -55  DG  J "C5'" 1 
ATOM   9401  C  "C4'" . DG  J 6 18  ? -54.146 -29.702 37.213 1.00 102.16 ? -55  DG  J "C4'" 1 
ATOM   9402  O  "O4'" . DG  J 6 18  ? -55.444 -29.762 36.565 1.00 103.00 ? -55  DG  J "O4'" 1 
ATOM   9403  C  "C3'" . DG  J 6 18  ? -53.132 -29.463 36.093 1.00 102.50 ? -55  DG  J "C3'" 1 
ATOM   9404  O  "O3'" . DG  J 6 18  ? -52.468 -30.679 35.810 1.00 102.64 ? -55  DG  J "O3'" 1 
ATOM   9405  C  "C2'" . DG  J 6 18  ? -53.997 -29.069 34.896 1.00 103.01 ? -55  DG  J "C2'" 1 
ATOM   9406  C  "C1'" . DG  J 6 18  ? -55.215 -29.945 35.182 1.00 103.26 ? -55  DG  J "C1'" 1 
ATOM   9407  N  N9    . DG  J 6 18  ? -56.420 -29.634 34.414 1.00 103.48 ? -55  DG  J N9    1 
ATOM   9408  C  C8    . DG  J 6 18  ? -56.961 -28.400 34.132 1.00 103.74 ? -55  DG  J C8    1 
ATOM   9409  N  N7    . DG  J 6 18  ? -58.050 -28.463 33.416 1.00 103.99 ? -55  DG  J N7    1 
ATOM   9410  C  C5    . DG  J 6 18  ? -58.243 -29.824 33.213 1.00 103.86 ? -55  DG  J C5    1 
ATOM   9411  C  C6    . DG  J 6 18  ? -59.262 -30.511 32.508 1.00 104.07 ? -55  DG  J C6    1 
ATOM   9412  O  O6    . DG  J 6 18  ? -60.231 -30.021 31.908 1.00 104.74 ? -55  DG  J O6    1 
ATOM   9413  N  N1    . DG  J 6 18  ? -59.084 -31.899 32.546 1.00 103.71 ? -55  DG  J N1    1 
ATOM   9414  C  C2    . DG  J 6 18  ? -58.044 -32.538 33.190 1.00 103.28 ? -55  DG  J C2    1 
ATOM   9415  N  N2    . DG  J 6 18  ? -58.015 -33.873 33.133 1.00 102.60 ? -55  DG  J N2    1 
ATOM   9416  N  N3    . DG  J 6 18  ? -57.085 -31.904 33.853 1.00 103.30 ? -55  DG  J N3    1 
ATOM   9417  C  C4    . DG  J 6 18  ? -57.248 -30.557 33.824 1.00 103.55 ? -55  DG  J C4    1 
ATOM   9418  P  P     . DA  J 6 19  ? -50.932 -30.656 35.394 1.00 102.65 ? -54  DA  J P     1 
ATOM   9419  O  OP1   . DA  J 6 19  ? -50.177 -30.936 36.630 1.00 102.47 ? -54  DA  J OP1   1 
ATOM   9420  O  OP2   . DA  J 6 19  ? -50.662 -29.426 34.619 1.00 102.58 ? -54  DA  J OP2   1 
ATOM   9421  O  "O5'" . DA  J 6 19  ? -50.788 -31.882 34.381 1.00 103.12 ? -54  DA  J "O5'" 1 
ATOM   9422  C  "C5'" . DA  J 6 19  ? -51.142 -33.182 34.794 1.00 104.31 ? -54  DA  J "C5'" 1 
ATOM   9423  C  "C4'" . DA  J 6 19  ? -52.078 -33.841 33.802 1.00 105.32 ? -54  DA  J "C4'" 1 
ATOM   9424  O  "O4'" . DA  J 6 19  ? -53.215 -32.998 33.506 1.00 105.20 ? -54  DA  J "O4'" 1 
ATOM   9425  C  "C3'" . DA  J 6 19  ? -51.436 -34.163 32.463 1.00 106.46 ? -54  DA  J "C3'" 1 
ATOM   9426  O  "O3'" . DA  J 6 19  ? -51.311 -35.566 32.392 1.00 109.38 ? -54  DA  J "O3'" 1 
ATOM   9427  C  "C2'" . DA  J 6 19  ? -52.421 -33.623 31.423 1.00 106.02 ? -54  DA  J "C2'" 1 
ATOM   9428  C  "C1'" . DA  J 6 19  ? -53.687 -33.384 32.236 1.00 105.04 ? -54  DA  J "C1'" 1 
ATOM   9429  N  N9    . DA  J 6 19  ? -54.555 -32.337 31.695 1.00 104.35 ? -54  DA  J N9    1 
ATOM   9430  C  C8    . DA  J 6 19  ? -54.420 -30.990 31.878 1.00 104.17 ? -54  DA  J C8    1 
ATOM   9431  N  N7    . DA  J 6 19  ? -55.340 -30.275 31.278 1.00 104.18 ? -54  DA  J N7    1 
ATOM   9432  C  C5    . DA  J 6 19  ? -56.137 -31.219 30.657 1.00 103.98 ? -54  DA  J C5    1 
ATOM   9433  C  C6    . DA  J 6 19  ? -57.291 -31.107 29.855 1.00 103.85 ? -54  DA  J C6    1 
ATOM   9434  N  N6    . DA  J 6 19  ? -57.848 -29.936 29.539 1.00 104.12 ? -54  DA  J N6    1 
ATOM   9435  N  N1    . DA  J 6 19  ? -57.852 -32.243 29.384 1.00 103.91 ? -54  DA  J N1    1 
ATOM   9436  C  C2    . DA  J 6 19  ? -57.289 -33.415 29.700 1.00 103.60 ? -54  DA  J C2    1 
ATOM   9437  N  N3    . DA  J 6 19  ? -56.208 -33.644 30.445 1.00 103.63 ? -54  DA  J N3    1 
ATOM   9438  C  C4    . DA  J 6 19  ? -55.669 -32.497 30.899 1.00 103.92 ? -54  DA  J C4    1 
ATOM   9439  P  P     . DT  J 6 20  ? -50.305 -36.270 31.356 1.00 111.93 ? -53  DT  J P     1 
ATOM   9440  O  OP1   . DT  J 6 20  ? -49.990 -37.623 31.872 1.00 112.17 ? -53  DT  J OP1   1 
ATOM   9441  O  OP2   . DT  J 6 20  ? -49.179 -35.342 31.108 1.00 111.17 ? -53  DT  J OP2   1 
ATOM   9442  O  "O5'" . DT  J 6 20  ? -51.253 -36.457 29.995 1.00 114.38 ? -53  DT  J "O5'" 1 
ATOM   9443  C  "C5'" . DT  J 6 20  ? -52.392 -37.299 30.011 1.00 117.99 ? -53  DT  J "C5'" 1 
ATOM   9444  C  "C4'" . DT  J 6 20  ? -53.316 -37.091 28.790 1.00 121.10 ? -53  DT  J "C4'" 1 
ATOM   9445  O  "O4'" . DT  J 6 20  ? -53.999 -35.795 28.814 1.00 121.86 ? -53  DT  J "O4'" 1 
ATOM   9446  C  "C3'" . DT  J 6 20  ? -52.589 -37.186 27.441 1.00 122.94 ? -53  DT  J "C3'" 1 
ATOM   9447  O  "O3'" . DT  J 6 20  ? -53.237 -38.165 26.634 1.00 125.64 ? -53  DT  J "O3'" 1 
ATOM   9448  C  "C2'" . DT  J 6 20  ? -52.710 -35.775 26.870 1.00 122.86 ? -53  DT  J "C2'" 1 
ATOM   9449  C  "C1'" . DT  J 6 20  ? -54.057 -35.401 27.464 1.00 122.65 ? -53  DT  J "C1'" 1 
ATOM   9450  N  N1    . DT  J 6 20  ? -54.438 -33.948 27.353 1.00 123.09 ? -53  DT  J N1    1 
ATOM   9451  C  C2    . DT  J 6 20  ? -55.616 -33.628 26.680 1.00 123.76 ? -53  DT  J C2    1 
ATOM   9452  O  O2    . DT  J 6 20  ? -56.365 -34.453 26.155 1.00 123.93 ? -53  DT  J O2    1 
ATOM   9453  N  N3    . DT  J 6 20  ? -55.905 -32.279 26.632 1.00 123.97 ? -53  DT  J N3    1 
ATOM   9454  C  C4    . DT  J 6 20  ? -55.158 -31.243 27.177 1.00 123.87 ? -53  DT  J C4    1 
ATOM   9455  O  O4    . DT  J 6 20  ? -55.525 -30.071 27.069 1.00 124.09 ? -53  DT  J O4    1 
ATOM   9456  C  C5    . DT  J 6 20  ? -53.942 -31.647 27.867 1.00 123.57 ? -53  DT  J C5    1 
ATOM   9457  C  C7    . DT  J 6 20  ? -53.037 -30.627 28.505 1.00 123.32 ? -53  DT  J C7    1 
ATOM   9458  C  C6    . DT  J 6 20  ? -53.646 -32.959 27.921 1.00 123.24 ? -53  DT  J C6    1 
ATOM   9459  P  P     . DA  J 6 21  ? -52.421 -39.480 26.103 1.00 127.38 ? -52  DA  J P     1 
ATOM   9460  O  OP1   . DA  J 6 21  ? -52.630 -40.584 27.106 1.00 126.97 ? -52  DA  J OP1   1 
ATOM   9461  O  OP2   . DA  J 6 21  ? -51.121 -39.057 25.723 1.00 127.16 ? -52  DA  J OP2   1 
ATOM   9462  O  "O5'" . DA  J 6 21  ? -53.260 -39.809 24.748 1.00 129.78 ? -52  DA  J "O5'" 1 
ATOM   9463  C  "C5'" . DA  J 6 21  ? -54.695 -39.942 24.740 1.00 132.99 ? -52  DA  J "C5'" 1 
ATOM   9464  C  "C4'" . DA  J 6 21  ? -55.432 -39.072 23.659 1.00 135.05 ? -52  DA  J "C4'" 1 
ATOM   9465  O  "O4'" . DA  J 6 21  ? -55.550 -37.674 24.061 1.00 135.41 ? -52  DA  J "O4'" 1 
ATOM   9466  C  "C3'" . DA  J 6 21  ? -54.771 -39.133 22.289 1.00 136.43 ? -52  DA  J "C3'" 1 
ATOM   9467  O  "O3'" . DA  J 6 21  ? -55.722 -39.695 21.362 1.00 138.60 ? -52  DA  J "O3'" 1 
ATOM   9468  C  "C2'" . DA  J 6 21  ? -54.349 -37.676 22.021 1.00 136.32 ? -52  DA  J "C2'" 1 
ATOM   9469  C  "C1'" . DA  J 6 21  ? -55.429 -36.919 22.873 1.00 136.19 ? -52  DA  J "C1'" 1 
ATOM   9470  N  N9    . DA  J 6 21  ? -55.069 -35.527 23.177 1.00 136.61 ? -52  DA  J N9    1 
ATOM   9471  C  C8    . DA  J 6 21  ? -53.938 -35.058 23.721 1.00 136.52 ? -52  DA  J C8    1 
ATOM   9472  N  N7    . DA  J 6 21  ? -53.870 -33.755 23.883 1.00 136.55 ? -52  DA  J N7    1 
ATOM   9473  C  C5    . DA  J 6 21  ? -55.038 -33.330 23.411 1.00 136.90 ? -52  DA  J C5    1 
ATOM   9474  C  C6    . DA  J 6 21  ? -55.570 -32.048 23.307 1.00 137.00 ? -52  DA  J C6    1 
ATOM   9475  N  N6    . DA  J 6 21  ? -54.947 -30.921 23.692 1.00 136.84 ? -52  DA  J N6    1 
ATOM   9476  N  N1    . DA  J 6 21  ? -56.761 -31.970 22.787 1.00 137.27 ? -52  DA  J N1    1 
ATOM   9477  C  C2    . DA  J 6 21  ? -57.380 -33.099 22.396 1.00 137.38 ? -52  DA  J C2    1 
ATOM   9478  N  N3    . DA  J 6 21  ? -56.980 -34.357 22.452 1.00 137.36 ? -52  DA  J N3    1 
ATOM   9479  C  C4    . DA  J 6 21  ? -55.791 -34.409 22.972 1.00 137.02 ? -52  DA  J C4    1 
ATOM   9480  P  P     . DC  J 6 22  ? -55.638 -39.404 19.782 1.00 140.49 ? -51  DC  J P     1 
ATOM   9481  O  OP1   . DC  J 6 22  ? -56.359 -40.528 19.158 1.00 140.76 ? -51  DC  J OP1   1 
ATOM   9482  O  OP2   . DC  J 6 22  ? -54.221 -39.092 19.305 1.00 140.03 ? -51  DC  J OP2   1 
ATOM   9483  O  "O5'" . DC  J 6 22  ? -56.494 -38.068 19.714 1.00 142.45 ? -51  DC  J "O5'" 1 
ATOM   9484  C  "C5'" . DC  J 6 22  ? -57.687 -38.022 19.002 1.00 145.50 ? -51  DC  J "C5'" 1 
ATOM   9485  C  "C4'" . DC  J 6 22  ? -57.659 -36.917 17.950 1.00 147.77 ? -51  DC  J "C4'" 1 
ATOM   9486  O  "O4'" . DC  J 6 22  ? -57.099 -35.709 18.540 1.00 148.06 ? -51  DC  J "O4'" 1 
ATOM   9487  C  "C3'" . DC  J 6 22  ? -56.821 -37.214 16.703 1.00 149.26 ? -51  DC  J "C3'" 1 
ATOM   9488  O  "O3'" . DC  J 6 22  ? -57.496 -36.726 15.538 1.00 151.67 ? -51  DC  J "O3'" 1 
ATOM   9489  C  "C2'" . DC  J 6 22  ? -55.521 -36.460 16.985 1.00 148.85 ? -51  DC  J "C2'" 1 
ATOM   9490  C  "C1'" . DC  J 6 22  ? -56.074 -35.221 17.694 1.00 148.40 ? -51  DC  J "C1'" 1 
ATOM   9491  N  N1    . DC  J 6 22  ? -55.098 -34.409 18.507 1.00 148.39 ? -51  DC  J N1    1 
ATOM   9492  C  C2    . DC  J 6 22  ? -55.485 -33.069 18.864 1.00 148.40 ? -51  DC  J C2    1 
ATOM   9493  O  O2    . DC  J 6 22  ? -56.554 -32.580 18.515 1.00 148.51 ? -51  DC  J O2    1 
ATOM   9494  N  N3    . DC  J 6 22  ? -54.670 -32.347 19.595 1.00 148.24 ? -51  DC  J N3    1 
ATOM   9495  C  C4    . DC  J 6 22  ? -53.522 -32.909 19.961 1.00 148.17 ? -51  DC  J C4    1 
ATOM   9496  N  N4    . DC  J 6 22  ? -52.763 -32.157 20.678 1.00 148.04 ? -51  DC  J N4    1 
ATOM   9497  C  C5    . DC  J 6 22  ? -53.107 -34.265 19.610 1.00 148.16 ? -51  DC  J C5    1 
ATOM   9498  C  C6    . DC  J 6 22  ? -53.914 -34.969 18.891 1.00 148.28 ? -51  DC  J C6    1 
ATOM   9499  P  P     . DT  J 6 23  ? -57.002 -37.121 14.061 1.00 153.74 ? -50  DT  J P     1 
ATOM   9500  O  OP1   . DT  J 6 23  ? -57.056 -38.599 13.964 1.00 153.72 ? -50  DT  J OP1   1 
ATOM   9501  O  OP2   . DT  J 6 23  ? -55.721 -36.416 13.808 1.00 153.60 ? -50  DT  J OP2   1 
ATOM   9502  O  "O5'" . DT  J 6 23  ? -58.116 -36.488 13.087 1.00 154.58 ? -50  DT  J "O5'" 1 
ATOM   9503  C  "C5'" . DT  J 6 23  ? -58.848 -35.288 13.420 1.00 155.96 ? -50  DT  J "C5'" 1 
ATOM   9504  C  "C4'" . DT  J 6 23  ? -58.073 -33.988 13.165 1.00 157.01 ? -50  DT  J "C4'" 1 
ATOM   9505  O  "O4'" . DT  J 6 23  ? -57.138 -33.729 14.245 1.00 157.02 ? -50  DT  J "O4'" 1 
ATOM   9506  C  "C3'" . DT  J 6 23  ? -57.213 -33.882 11.897 1.00 157.78 ? -50  DT  J "C3'" 1 
ATOM   9507  O  "O3'" . DT  J 6 23  ? -58.014 -33.474 10.766 1.00 158.97 ? -50  DT  J "O3'" 1 
ATOM   9508  C  "C2'" . DT  J 6 23  ? -56.198 -32.846 12.292 1.00 157.43 ? -50  DT  J "C2'" 1 
ATOM   9509  C  "C1'" . DT  J 6 23  ? -56.377 -32.650 13.805 1.00 156.96 ? -50  DT  J "C1'" 1 
ATOM   9510  N  N1    . DT  J 6 23  ? -55.040 -32.590 14.583 1.00 156.43 ? -50  DT  J N1    1 
ATOM   9511  C  C2    . DT  J 6 23  ? -54.772 -31.479 15.383 1.00 156.15 ? -50  DT  J C2    1 
ATOM   9512  O  O2    . DT  J 6 23  ? -55.531 -30.529 15.506 1.00 155.91 ? -50  DT  J O2    1 
ATOM   9513  N  N3    . DT  J 6 23  ? -53.569 -31.522 16.052 1.00 155.98 ? -50  DT  J N3    1 
ATOM   9514  C  C4    . DT  J 6 23  ? -52.623 -32.539 16.003 1.00 155.86 ? -50  DT  J C4    1 
ATOM   9515  O  O4    . DT  J 6 23  ? -51.577 -32.468 16.645 1.00 155.41 ? -50  DT  J O4    1 
ATOM   9516  C  C5    . DT  J 6 23  ? -53.017 -33.667 15.146 1.00 156.10 ? -50  DT  J C5    1 
ATOM   9517  C  C7    . DT  J 6 23  ? -52.189 -34.845 14.999 1.00 156.16 ? -50  DT  J C7    1 
ATOM   9518  C  C6    . DT  J 6 23  ? -54.223 -33.636 14.487 1.00 156.27 ? -50  DT  J C6    1 
ATOM   9519  P  P     . DA  J 6 24  ? -57.478 -32.567 9.542  1.00 159.88 ? -49  DA  J P     1 
ATOM   9520  O  OP1   . DA  J 6 24  ? -58.546 -32.525 8.507  1.00 159.92 ? -49  DA  J OP1   1 
ATOM   9521  O  OP2   . DA  J 6 24  ? -56.109 -33.020 9.152  1.00 159.83 ? -49  DA  J OP2   1 
ATOM   9522  O  "O5'" . DA  J 6 24  ? -57.341 -31.113 10.226 1.00 160.13 ? -49  DA  J "O5'" 1 
ATOM   9523  C  "C5'" . DA  J 6 24  ? -57.937 -29.933 9.658  1.00 160.42 ? -49  DA  J "C5'" 1 
ATOM   9524  C  "C4'" . DA  J 6 24  ? -56.864 -28.870 9.497  1.00 160.56 ? -49  DA  J "C4'" 1 
ATOM   9525  O  "O4'" . DA  J 6 24  ? -55.920 -28.966 10.602 1.00 160.65 ? -49  DA  J "O4'" 1 
ATOM   9526  C  "C3'" . DA  J 6 24  ? -56.045 -28.995 8.212  1.00 160.60 ? -49  DA  J "C3'" 1 
ATOM   9527  O  "O3'" . DA  J 6 24  ? -55.884 -27.688 7.608  1.00 160.26 ? -49  DA  J "O3'" 1 
ATOM   9528  C  "C2'" . DA  J 6 24  ? -54.753 -29.663 8.692  1.00 160.72 ? -49  DA  J "C2'" 1 
ATOM   9529  C  "C1'" . DA  J 6 24  ? -54.608 -29.063 10.084 1.00 160.93 ? -49  DA  J "C1'" 1 
ATOM   9530  N  N9    . DA  J 6 24  ? -53.734 -29.822 10.980 1.00 161.35 ? -49  DA  J N9    1 
ATOM   9531  C  C8    . DA  J 6 24  ? -53.434 -31.175 10.936 1.00 161.54 ? -49  DA  J C8    1 
ATOM   9532  N  N7    . DA  J 6 24  ? -52.605 -31.561 11.881 1.00 161.72 ? -49  DA  J N7    1 
ATOM   9533  C  C5    . DA  J 6 24  ? -52.336 -30.378 12.590 1.00 161.63 ? -49  DA  J C5    1 
ATOM   9534  C  C6    . DA  J 6 24  ? -51.524 -30.099 13.718 1.00 161.61 ? -49  DA  J C6    1 
ATOM   9535  N  N6    . DA  J 6 24  ? -50.798 -31.028 14.348 1.00 161.40 ? -49  DA  J N6    1 
ATOM   9536  N  N1    . DA  J 6 24  ? -51.487 -28.821 14.173 1.00 161.69 ? -49  DA  J N1    1 
ATOM   9537  C  C2    . DA  J 6 24  ? -52.211 -27.880 13.545 1.00 161.65 ? -49  DA  J C2    1 
ATOM   9538  N  N3    . DA  J 6 24  ? -53.006 -28.019 12.478 1.00 161.54 ? -49  DA  J N3    1 
ATOM   9539  C  C4    . DA  J 6 24  ? -53.024 -29.300 12.045 1.00 161.56 ? -49  DA  J C4    1 
ATOM   9540  P  P     . DC  J 6 25  ? -54.530 -27.143 6.915  1.00 159.65 ? -48  DC  J P     1 
ATOM   9541  O  OP1   . DC  J 6 25  ? -54.875 -25.938 6.123  1.00 159.71 ? -48  DC  J OP1   1 
ATOM   9542  O  OP2   . DC  J 6 25  ? -53.815 -28.255 6.239  1.00 159.51 ? -48  DC  J OP2   1 
ATOM   9543  O  "O5'" . DC  J 6 25  ? -53.667 -26.705 8.195  1.00 158.80 ? -48  DC  J "O5'" 1 
ATOM   9544  C  "C5'" . DC  J 6 25  ? -53.876 -25.457 8.846  1.00 157.67 ? -48  DC  J "C5'" 1 
ATOM   9545  C  "C4'" . DC  J 6 25  ? -52.524 -24.829 9.132  1.00 157.08 ? -48  DC  J "C4'" 1 
ATOM   9546  O  "O4'" . DC  J 6 25  ? -51.808 -25.658 10.084 1.00 157.03 ? -48  DC  J "O4'" 1 
ATOM   9547  C  "C3'" . DC  J 6 25  ? -51.608 -24.699 7.916  1.00 156.54 ? -48  DC  J "C3'" 1 
ATOM   9548  O  "O3'" . DC  J 6 25  ? -50.925 -23.459 7.978  1.00 155.72 ? -48  DC  J "O3'" 1 
ATOM   9549  C  "C2'" . DC  J 6 25  ? -50.635 -25.869 8.051  1.00 156.52 ? -48  DC  J "C2'" 1 
ATOM   9550  C  "C1'" . DC  J 6 25  ? -50.536 -26.011 9.570  1.00 156.73 ? -48  DC  J "C1'" 1 
ATOM   9551  N  N1    . DC  J 6 25  ? -50.152 -27.379 10.100 1.00 156.68 ? -48  DC  J N1    1 
ATOM   9552  C  C2    . DC  J 6 25  ? -49.410 -27.478 11.296 1.00 156.54 ? -48  DC  J C2    1 
ATOM   9553  O  O2    . DC  J 6 25  ? -49.065 -26.449 11.896 1.00 156.55 ? -48  DC  J O2    1 
ATOM   9554  N  N3    . DC  J 6 25  ? -49.070 -28.713 11.765 1.00 156.29 ? -48  DC  J N3    1 
ATOM   9555  C  C4    . DC  J 6 25  ? -49.444 -29.817 11.106 1.00 156.17 ? -48  DC  J C4    1 
ATOM   9556  N  N4    . DC  J 6 25  ? -49.086 -31.001 11.617 1.00 155.92 ? -48  DC  J N4    1 
ATOM   9557  C  C5    . DC  J 6 25  ? -50.204 -29.745 9.896  1.00 156.30 ? -48  DC  J C5    1 
ATOM   9558  C  C6    . DC  J 6 25  ? -50.532 -28.524 9.439  1.00 156.63 ? -48  DC  J C6    1 
ATOM   9559  P  P     . DC  J 6 26  ? -50.983 -22.410 6.761  1.00 154.85 ? -47  DC  J P     1 
ATOM   9560  O  OP1   . DC  J 6 26  ? -52.116 -21.483 7.019  1.00 154.82 ? -47  DC  J OP1   1 
ATOM   9561  O  OP2   . DC  J 6 26  ? -50.914 -23.152 5.475  1.00 154.72 ? -47  DC  J OP2   1 
ATOM   9562  O  "O5'" . DC  J 6 26  ? -49.599 -21.616 6.950  1.00 153.98 ? -47  DC  J "O5'" 1 
ATOM   9563  C  "C5'" . DC  J 6 26  ? -49.200 -21.141 8.244  1.00 152.18 ? -47  DC  J "C5'" 1 
ATOM   9564  C  "C4'" . DC  J 6 26  ? -47.901 -21.783 8.708  1.00 150.76 ? -47  DC  J "C4'" 1 
ATOM   9565  O  "O4'" . DC  J 6 26  ? -48.092 -23.185 9.038  1.00 150.57 ? -47  DC  J "O4'" 1 
ATOM   9566  C  "C3'" . DC  J 6 26  ? -46.753 -21.756 7.694  1.00 149.83 ? -47  DC  J "C3'" 1 
ATOM   9567  O  "O3'" . DC  J 6 26  ? -45.635 -21.043 8.237  1.00 148.43 ? -47  DC  J "O3'" 1 
ATOM   9568  C  "C2'" . DC  J 6 26  ? -46.438 -23.233 7.469  1.00 150.04 ? -47  DC  J "C2'" 1 
ATOM   9569  C  "C1'" . DC  J 6 26  ? -46.814 -23.753 8.850  1.00 150.60 ? -47  DC  J "C1'" 1 
ATOM   9570  N  N1    . DC  J 6 26  ? -46.812 -25.243 9.058  1.00 150.80 ? -47  DC  J N1    1 
ATOM   9571  C  C2    . DC  J 6 26  ? -46.387 -25.765 10.299 1.00 150.97 ? -47  DC  J C2    1 
ATOM   9572  O  O2    . DC  J 6 26  ? -46.020 -25.001 11.207 1.00 151.05 ? -47  DC  J O2    1 
ATOM   9573  N  N3    . DC  J 6 26  ? -46.381 -27.115 10.479 1.00 150.81 ? -47  DC  J N3    1 
ATOM   9574  C  C4    . DC  J 6 26  ? -46.773 -27.929 9.490  1.00 150.85 ? -47  DC  J C4    1 
ATOM   9575  N  N4    . DC  J 6 26  ? -46.756 -29.247 9.719  1.00 150.59 ? -47  DC  J N4    1 
ATOM   9576  C  C5    . DC  J 6 26  ? -47.214 -27.419 8.227  1.00 150.94 ? -47  DC  J C5    1 
ATOM   9577  C  C6    . DC  J 6 26  ? -47.209 -26.088 8.054  1.00 150.85 ? -47  DC  J C6    1 
ATOM   9578  P  P     . DA  J 6 27  ? -45.032 -19.787 7.436  1.00 147.25 ? -46  DA  J P     1 
ATOM   9579  O  OP1   . DA  J 6 27  ? -46.165 -18.892 7.101  1.00 147.34 ? -46  DA  J OP1   1 
ATOM   9580  O  OP2   . DA  J 6 27  ? -44.166 -20.321 6.356  1.00 146.88 ? -46  DA  J OP2   1 
ATOM   9581  O  "O5'" . DA  J 6 27  ? -44.080 -19.002 8.466  1.00 145.38 ? -46  DA  J "O5'" 1 
ATOM   9582  C  "C5'" . DA  J 6 27  ? -44.204 -19.088 9.890  1.00 141.87 ? -46  DA  J "C5'" 1 
ATOM   9583  C  "C4'" . DA  J 6 27  ? -43.024 -19.832 10.504 1.00 139.08 ? -46  DA  J "C4'" 1 
ATOM   9584  O  "O4'" . DA  J 6 27  ? -43.246 -21.258 10.377 1.00 137.82 ? -46  DA  J "O4'" 1 
ATOM   9585  C  "C3'" . DA  J 6 27  ? -41.637 -19.567 9.911  1.00 137.80 ? -46  DA  J "C3'" 1 
ATOM   9586  O  "O3'" . DA  J 6 27  ? -40.692 -19.581 10.978 1.00 136.76 ? -46  DA  J "O3'" 1 
ATOM   9587  C  "C2'" . DA  J 6 27  ? -41.442 -20.749 8.968  1.00 137.35 ? -46  DA  J "C2'" 1 
ATOM   9588  C  "C1'" . DA  J 6 27  ? -42.122 -21.850 9.769  1.00 137.32 ? -46  DA  J "C1'" 1 
ATOM   9589  N  N9    . DA  J 6 27  ? -42.604 -22.983 8.994  1.00 137.22 ? -46  DA  J N9    1 
ATOM   9590  C  C8    . DA  J 6 27  ? -42.939 -23.013 7.672  1.00 137.26 ? -46  DA  J C8    1 
ATOM   9591  N  N7    . DA  J 6 27  ? -43.347 -24.189 7.258  1.00 137.38 ? -46  DA  J N7    1 
ATOM   9592  C  C5    . DA  J 6 27  ? -43.285 -24.985 8.387  1.00 137.27 ? -46  DA  J C5    1 
ATOM   9593  C  C6    . DA  J 6 27  ? -43.582 -26.348 8.622  1.00 137.13 ? -46  DA  J C6    1 
ATOM   9594  N  N6    . DA  J 6 27  ? -44.032 -27.184 7.682  1.00 136.67 ? -46  DA  J N6    1 
ATOM   9595  N  N1    . DA  J 6 27  ? -43.398 -26.828 9.871  1.00 137.22 ? -46  DA  J N1    1 
ATOM   9596  C  C2    . DA  J 6 27  ? -42.948 -25.997 10.823 1.00 137.51 ? -46  DA  J C2    1 
ATOM   9597  N  N3    . DA  J 6 27  ? -42.634 -24.704 10.721 1.00 137.59 ? -46  DA  J N3    1 
ATOM   9598  C  C4    . DA  J 6 27  ? -42.827 -24.253 9.468  1.00 137.36 ? -46  DA  J C4    1 
ATOM   9599  P  P     . DA  J 6 28  ? -39.163 -19.076 10.884 1.00 135.69 ? -45  DA  J P     1 
ATOM   9600  O  OP1   . DA  J 6 28  ? -39.153 -17.605 11.076 1.00 135.68 ? -45  DA  J OP1   1 
ATOM   9601  O  OP2   . DA  J 6 28  ? -38.524 -19.680 9.690  1.00 135.28 ? -45  DA  J OP2   1 
ATOM   9602  O  "O5'" . DA  J 6 28  ? -38.525 -19.739 12.199 1.00 133.57 ? -45  DA  J "O5'" 1 
ATOM   9603  C  "C5'" . DA  J 6 28  ? -39.265 -20.701 12.968 1.00 130.21 ? -45  DA  J "C5'" 1 
ATOM   9604  C  "C4'" . DA  J 6 28  ? -38.793 -22.115 12.674 1.00 127.67 ? -45  DA  J "C4'" 1 
ATOM   9605  O  "O4'" . DA  J 6 28  ? -39.576 -22.749 11.626 1.00 126.89 ? -45  DA  J "O4'" 1 
ATOM   9606  C  "C3'" . DA  J 6 28  ? -37.339 -22.212 12.212 1.00 126.14 ? -45  DA  J "C3'" 1 
ATOM   9607  O  "O3'" . DA  J 6 28  ? -36.689 -23.183 12.988 1.00 124.19 ? -45  DA  J "O3'" 1 
ATOM   9608  C  "C2'" . DA  J 6 28  ? -37.448 -22.667 10.767 1.00 126.06 ? -45  DA  J "C2'" 1 
ATOM   9609  C  "C1'" . DA  J 6 28  ? -38.658 -23.565 10.934 1.00 126.17 ? -45  DA  J "C1'" 1 
ATOM   9610  N  N9    . DA  J 6 28  ? -39.178 -24.086 9.679  1.00 125.90 ? -45  DA  J N9    1 
ATOM   9611  C  C8    . DA  J 6 28  ? -39.338 -23.418 8.498  1.00 125.84 ? -45  DA  J C8    1 
ATOM   9612  N  N7    . DA  J 6 28  ? -39.818 -24.165 7.534  1.00 125.79 ? -45  DA  J N7    1 
ATOM   9613  C  C5    . DA  J 6 28  ? -39.967 -25.409 8.121  1.00 125.62 ? -45  DA  J C5    1 
ATOM   9614  C  C6    . DA  J 6 28  ? -40.431 -26.648 7.631  1.00 125.46 ? -45  DA  J C6    1 
ATOM   9615  N  N6    . DA  J 6 28  ? -40.845 -26.829 6.376  1.00 125.37 ? -45  DA  J N6    1 
ATOM   9616  N  N1    . DA  J 6 28  ? -40.458 -27.698 8.482  1.00 125.44 ? -45  DA  J N1    1 
ATOM   9617  C  C2    . DA  J 6 28  ? -40.041 -27.520 9.744  1.00 125.46 ? -45  DA  J C2    1 
ATOM   9618  N  N3    . DA  J 6 28  ? -39.584 -26.405 10.316 1.00 125.60 ? -45  DA  J N3    1 
ATOM   9619  C  C4    . DA  J 6 28  ? -39.574 -25.379 9.445  1.00 125.68 ? -45  DA  J C4    1 
ATOM   9620  P  P     . DA  J 6 29  ? -35.919 -22.729 14.303 1.00 122.69 ? -44  DA  J P     1 
ATOM   9621  O  OP1   . DA  J 6 29  ? -36.368 -23.619 15.400 1.00 122.67 ? -44  DA  J OP1   1 
ATOM   9622  O  OP2   . DA  J 6 29  ? -36.072 -21.262 14.447 1.00 122.90 ? -44  DA  J OP2   1 
ATOM   9623  O  "O5'" . DA  J 6 29  ? -34.380 -23.022 13.941 1.00 122.01 ? -44  DA  J "O5'" 1 
ATOM   9624  C  "C5'" . DA  J 6 29  ? -33.987 -24.109 13.103 1.00 120.28 ? -44  DA  J "C5'" 1 
ATOM   9625  C  "C4'" . DA  J 6 29  ? -34.378 -25.445 13.723 1.00 119.19 ? -44  DA  J "C4'" 1 
ATOM   9626  O  "O4'" . DA  J 6 29  ? -35.590 -25.961 13.111 1.00 118.49 ? -44  DA  J "O4'" 1 
ATOM   9627  C  "C3'" . DA  J 6 29  ? -33.357 -26.563 13.602 1.00 118.76 ? -44  DA  J "C3'" 1 
ATOM   9628  O  "O3'" . DA  J 6 29  ? -33.502 -27.407 14.739 1.00 118.61 ? -44  DA  J "O3'" 1 
ATOM   9629  C  "C2'" . DA  J 6 29  ? -33.769 -27.236 12.296 1.00 118.49 ? -44  DA  J "C2'" 1 
ATOM   9630  C  "C1'" . DA  J 6 29  ? -35.272 -26.993 12.195 1.00 118.10 ? -44  DA  J "C1'" 1 
ATOM   9631  N  N9    . DA  J 6 29  ? -35.693 -26.595 10.847 1.00 117.44 ? -44  DA  J N9    1 
ATOM   9632  C  C8    . DA  J 6 29  ? -35.600 -25.350 10.285 1.00 117.03 ? -44  DA  J C8    1 
ATOM   9633  N  N7    . DA  J 6 29  ? -36.059 -25.272 9.059  1.00 116.46 ? -44  DA  J N7    1 
ATOM   9634  C  C5    . DA  J 6 29  ? -36.478 -26.561 8.788  1.00 116.25 ? -44  DA  J C5    1 
ATOM   9635  C  C6    . DA  J 6 29  ? -37.061 -27.146 7.649  1.00 115.89 ? -44  DA  J C6    1 
ATOM   9636  N  N6    . DA  J 6 29  ? -37.324 -26.463 6.534  1.00 115.78 ? -44  DA  J N6    1 
ATOM   9637  N  N1    . DA  J 6 29  ? -37.365 -28.460 7.693  1.00 115.75 ? -44  DA  J N1    1 
ATOM   9638  C  C2    . DA  J 6 29  ? -37.099 -29.142 8.815  1.00 116.10 ? -44  DA  J C2    1 
ATOM   9639  N  N3    . DA  J 6 29  ? -36.554 -28.703 9.950  1.00 116.42 ? -44  DA  J N3    1 
ATOM   9640  C  C4    . DA  J 6 29  ? -36.261 -27.391 9.875  1.00 116.68 ? -44  DA  J C4    1 
ATOM   9641  P  P     . DA  J 6 30  ? -32.814 -28.848 14.869 1.00 118.65 ? -43  DA  J P     1 
ATOM   9642  O  OP1   . DA  J 6 30  ? -32.982 -29.260 16.280 1.00 118.99 ? -43  DA  J OP1   1 
ATOM   9643  O  OP2   . DA  J 6 30  ? -31.461 -28.790 14.268 1.00 118.64 ? -43  DA  J OP2   1 
ATOM   9644  O  "O5'" . DA  J 6 30  ? -33.754 -29.779 13.961 1.00 118.96 ? -43  DA  J "O5'" 1 
ATOM   9645  C  "C5'" . DA  J 6 30  ? -33.898 -31.176 14.220 1.00 118.71 ? -43  DA  J "C5'" 1 
ATOM   9646  C  "C4'" . DA  J 6 30  ? -33.643 -31.940 12.930 1.00 118.62 ? -43  DA  J "C4'" 1 
ATOM   9647  O  "O4'" . DA  J 6 30  ? -34.033 -31.122 11.788 1.00 118.63 ? -43  DA  J "O4'" 1 
ATOM   9648  C  "C3'" . DA  J 6 30  ? -32.179 -32.308 12.715 1.00 118.61 ? -43  DA  J "C3'" 1 
ATOM   9649  O  "O3'" . DA  J 6 30  ? -32.106 -33.689 12.371 1.00 118.83 ? -43  DA  J "O3'" 1 
ATOM   9650  C  "C2'" . DA  J 6 30  ? -31.747 -31.383 11.579 1.00 118.73 ? -43  DA  J "C2'" 1 
ATOM   9651  C  "C1'" . DA  J 6 30  ? -33.043 -31.241 10.787 1.00 118.76 ? -43  DA  J "C1'" 1 
ATOM   9652  N  N9    . DA  J 6 30  ? -33.090 -30.086 9.881  1.00 118.74 ? -43  DA  J N9    1 
ATOM   9653  C  C8    . DA  J 6 30  ? -32.549 -28.848 10.092 1.00 118.68 ? -43  DA  J C8    1 
ATOM   9654  N  N7    . DA  J 6 30  ? -32.738 -27.997 9.115  1.00 118.72 ? -43  DA  J N7    1 
ATOM   9655  C  C5    . DA  J 6 30  ? -33.448 -28.729 8.182  1.00 118.85 ? -43  DA  J C5    1 
ATOM   9656  C  C6    . DA  J 6 30  ? -33.957 -28.400 6.906  1.00 118.90 ? -43  DA  J C6    1 
ATOM   9657  N  N6    . DA  J 6 30  ? -33.812 -27.195 6.343  1.00 118.82 ? -43  DA  J N6    1 
ATOM   9658  N  N1    . DA  J 6 30  ? -34.622 -29.361 6.228  1.00 119.14 ? -43  DA  J N1    1 
ATOM   9659  C  C2    . DA  J 6 30  ? -34.766 -30.573 6.789  1.00 119.07 ? -43  DA  J C2    1 
ATOM   9660  N  N3    . DA  J 6 30  ? -34.333 -30.998 7.978  1.00 118.85 ? -43  DA  J N3    1 
ATOM   9661  C  C4    . DA  J 6 30  ? -33.675 -30.021 8.634  1.00 118.84 ? -43  DA  J C4    1 
ATOM   9662  P  P     . DG  J 6 31  ? -30.718 -34.482 12.199 1.00 119.22 ? -42  DG  J P     1 
ATOM   9663  O  OP1   . DG  J 6 31  ? -30.594 -35.379 13.371 1.00 119.05 ? -42  DG  J OP1   1 
ATOM   9664  O  OP2   . DG  J 6 31  ? -29.593 -33.501 11.657 1.00 119.25 ? -42  DG  J OP2   1 
ATOM   9665  O  "O5'" . DG  J 6 31  ? -30.969 -35.388 10.881 1.00 120.28 ? -42  DG  J "O5'" 1 
ATOM   9666  C  "C5'" . DG  J 6 31  ? -32.241 -35.416 10.205 1.00 121.38 ? -42  DG  J "C5'" 1 
ATOM   9667  C  "C4'" . DG  J 6 31  ? -32.140 -35.358 8.675  1.00 122.28 ? -42  DG  J "C4'" 1 
ATOM   9668  O  "O4'" . DG  J 6 31  ? -32.282 -33.979 8.238  1.00 122.72 ? -42  DG  J "O4'" 1 
ATOM   9669  C  "C3'" . DG  J 6 31  ? -30.837 -35.872 8.055  1.00 122.90 ? -42  DG  J "C3'" 1 
ATOM   9670  O  "O3'" . DG  J 6 31  ? -31.126 -36.877 7.073  1.00 123.78 ? -42  DG  J "O3'" 1 
ATOM   9671  C  "C2'" . DG  J 6 31  ? -30.201 -34.629 7.429  1.00 123.02 ? -42  DG  J "C2'" 1 
ATOM   9672  C  "C1'" . DG  J 6 31  ? -31.414 -33.750 7.148  1.00 123.26 ? -42  DG  J "C1'" 1 
ATOM   9673  N  N9    . DG  J 6 31  ? -31.137 -32.315 7.064  1.00 123.85 ? -42  DG  J N9    1 
ATOM   9674  C  C8    . DG  J 6 31  ? -30.683 -31.509 8.080  1.00 123.93 ? -42  DG  J C8    1 
ATOM   9675  N  N7    . DG  J 6 31  ? -30.527 -30.265 7.732  1.00 124.34 ? -42  DG  J N7    1 
ATOM   9676  C  C5    . DG  J 6 31  ? -30.901 -30.237 6.396  1.00 124.70 ? -42  DG  J C5    1 
ATOM   9677  C  C6    . DG  J 6 31  ? -30.934 -29.151 5.484  1.00 125.19 ? -42  DG  J C6    1 
ATOM   9678  O  O6    . DG  J 6 31  ? -30.631 -27.967 5.690  1.00 125.66 ? -42  DG  J O6    1 
ATOM   9679  N  N1    . DG  J 6 31  ? -31.372 -29.540 4.217  1.00 125.54 ? -42  DG  J N1    1 
ATOM   9680  C  C2    . DG  J 6 31  ? -31.734 -30.825 3.877  1.00 125.52 ? -42  DG  J C2    1 
ATOM   9681  N  N2    . DG  J 6 31  ? -32.130 -31.009 2.607  1.00 125.94 ? -42  DG  J N2    1 
ATOM   9682  N  N3    . DG  J 6 31  ? -31.706 -31.852 4.725  1.00 125.01 ? -42  DG  J N3    1 
ATOM   9683  C  C4    . DG  J 6 31  ? -31.281 -31.491 5.966  1.00 124.44 ? -42  DG  J C4    1 
ATOM   9684  P  P     . DT  J 6 32  ? -30.062 -38.008 6.653  1.00 124.18 ? -41  DT  J P     1 
ATOM   9685  O  OP1   . DT  J 6 32  ? -30.644 -39.323 7.033  1.00 123.96 ? -41  DT  J OP1   1 
ATOM   9686  O  OP2   . DT  J 6 32  ? -28.728 -37.605 7.183  1.00 124.05 ? -41  DT  J OP2   1 
ATOM   9687  O  "O5'" . DT  J 6 32  ? -29.985 -37.905 5.043  1.00 125.47 ? -41  DT  J "O5'" 1 
ATOM   9688  C  "C5'" . DT  J 6 32  ? -31.078 -37.380 4.265  1.00 127.08 ? -41  DT  J "C5'" 1 
ATOM   9689  C  "C4'" . DT  J 6 32  ? -30.635 -36.747 2.948  1.00 128.41 ? -41  DT  J "C4'" 1 
ATOM   9690  O  "O4'" . DT  J 6 32  ? -30.502 -35.313 3.129  1.00 128.77 ? -41  DT  J "O4'" 1 
ATOM   9691  C  "C3'" . DT  J 6 32  ? -29.320 -37.230 2.325  1.00 129.30 ? -41  DT  J "C3'" 1 
ATOM   9692  O  "O3'" . DT  J 6 32  ? -29.551 -37.616 0.920  1.00 130.44 ? -41  DT  J "O3'" 1 
ATOM   9693  C  "C2'" . DT  J 6 32  ? -28.386 -36.031 2.498  1.00 129.31 ? -41  DT  J "C2'" 1 
ATOM   9694  C  "C1'" . DT  J 6 32  ? -29.369 -34.870 2.416  1.00 129.50 ? -41  DT  J "C1'" 1 
ATOM   9695  N  N1    . DT  J 6 32  ? -28.888 -33.580 3.013  1.00 130.16 ? -41  DT  J N1    1 
ATOM   9696  C  C2    . DT  J 6 32  ? -29.086 -32.384 2.336  1.00 130.49 ? -41  DT  J C2    1 
ATOM   9697  O  O2    . DT  J 6 32  ? -29.637 -32.282 1.253  1.00 130.75 ? -41  DT  J O2    1 
ATOM   9698  N  N3    . DT  J 6 32  ? -28.604 -31.275 2.985  1.00 130.66 ? -41  DT  J N3    1 
ATOM   9699  C  C4    . DT  J 6 32  ? -27.961 -31.235 4.211  1.00 130.97 ? -41  DT  J C4    1 
ATOM   9700  O  O4    . DT  J 6 32  ? -27.571 -30.175 4.694  1.00 131.33 ? -41  DT  J O4    1 
ATOM   9701  C  C5    . DT  J 6 32  ? -27.784 -32.514 4.866  1.00 130.92 ? -41  DT  J C5    1 
ATOM   9702  C  C7    . DT  J 6 32  ? -27.102 -32.615 6.202  1.00 130.99 ? -41  DT  J C7    1 
ATOM   9703  C  C6    . DT  J 6 32  ? -28.252 -33.606 4.243  1.00 130.56 ? -41  DT  J C6    1 
ATOM   9704  P  P     . DG  J 6 33  ? -28.371 -37.908 -0.152 1.00 131.63 ? -40  DG  J P     1 
ATOM   9705  O  OP1   . DG  J 6 33  ? -28.354 -39.290 -0.727 1.00 131.65 ? -40  DG  J OP1   1 
ATOM   9706  O  OP2   . DG  J 6 33  ? -27.043 -37.646 0.458  1.00 131.94 ? -40  DG  J OP2   1 
ATOM   9707  O  "O5'" . DG  J 6 33  ? -28.612 -36.722 -1.250 1.00 132.94 ? -40  DG  J "O5'" 1 
ATOM   9708  C  "C5'" . DG  J 6 33  ? -27.860 -36.654 -2.477 1.00 134.80 ? -40  DG  J "C5'" 1 
ATOM   9709  C  "C4'" . DG  J 6 33  ? -26.989 -35.395 -2.567 1.00 136.26 ? -40  DG  J "C4'" 1 
ATOM   9710  O  "O4'" . DG  J 6 33  ? -27.129 -34.557 -1.385 1.00 136.88 ? -40  DG  J "O4'" 1 
ATOM   9711  C  "C3'" . DG  J 6 33  ? -25.483 -35.680 -2.702 1.00 137.00 ? -40  DG  J "C3'" 1 
ATOM   9712  O  "O3'" . DG  J 6 33  ? -25.084 -35.628 -4.098 1.00 137.58 ? -40  DG  J "O3'" 1 
ATOM   9713  C  "C2'" . DG  J 6 33  ? -24.798 -34.665 -1.767 1.00 137.27 ? -40  DG  J "C2'" 1 
ATOM   9714  C  "C1'" . DG  J 6 33  ? -25.950 -33.766 -1.280 1.00 137.32 ? -40  DG  J "C1'" 1 
ATOM   9715  N  N9    . DG  J 6 33  ? -25.738 -33.254 0.082  1.00 137.53 ? -40  DG  J N9    1 
ATOM   9716  C  C8    . DG  J 6 33  ? -25.755 -33.995 1.244  1.00 137.62 ? -40  DG  J C8    1 
ATOM   9717  N  N7    . DG  J 6 33  ? -25.519 -33.293 2.318  1.00 137.62 ? -40  DG  J N7    1 
ATOM   9718  C  C5    . DG  J 6 33  ? -25.323 -31.998 1.847  1.00 137.62 ? -40  DG  J C5    1 
ATOM   9719  C  C6    . DG  J 6 33  ? -25.029 -30.800 2.556  1.00 137.63 ? -40  DG  J C6    1 
ATOM   9720  O  O6    . DG  J 6 33  ? -24.879 -30.648 3.775  1.00 137.47 ? -40  DG  J O6    1 
ATOM   9721  N  N1    . DG  J 6 33  ? -24.906 -29.694 1.712  1.00 137.70 ? -40  DG  J N1    1 
ATOM   9722  C  C2    . DG  J 6 33  ? -25.048 -29.744 0.346  1.00 137.79 ? -40  DG  J C2    1 
ATOM   9723  N  N2    . DG  J 6 33  ? -24.895 -28.574 -0.298 1.00 138.03 ? -40  DG  J N2    1 
ATOM   9724  N  N3    . DG  J 6 33  ? -25.324 -30.860 -0.334 1.00 137.73 ? -40  DG  J N3    1 
ATOM   9725  C  C4    . DG  J 6 33  ? -25.449 -31.953 0.473  1.00 137.59 ? -40  DG  J C4    1 
ATOM   9726  P  P     . DT  J 6 34  ? -23.861 -34.773 -4.714 1.00 138.50 ? -39  DT  J P     1 
ATOM   9727  O  OP1   . DT  J 6 34  ? -23.795 -35.118 -6.154 1.00 138.63 ? -39  DT  J OP1   1 
ATOM   9728  O  OP2   . DT  J 6 34  ? -22.641 -34.982 -3.892 1.00 138.58 ? -39  DT  J OP2   1 
ATOM   9729  O  "O5'" . DT  J 6 34  ? -24.341 -33.243 -4.556 1.00 138.72 ? -39  DT  J "O5'" 1 
ATOM   9730  C  "C5'" . DT  J 6 34  ? -24.020 -32.237 -5.529 1.00 139.00 ? -39  DT  J "C5'" 1 
ATOM   9731  C  "C4'" . DT  J 6 34  ? -22.760 -31.459 -5.165 1.00 139.20 ? -39  DT  J "C4'" 1 
ATOM   9732  O  "O4'" . DT  J 6 34  ? -22.719 -31.241 -3.732 1.00 139.47 ? -39  DT  J "O4'" 1 
ATOM   9733  C  "C3'" . DT  J 6 34  ? -21.438 -32.142 -5.544 1.00 139.07 ? -39  DT  J "C3'" 1 
ATOM   9734  O  "O3'" . DT  J 6 34  ? -20.802 -31.428 -6.638 1.00 138.73 ? -39  DT  J "O3'" 1 
ATOM   9735  C  "C2'" . DT  J 6 34  ? -20.644 -32.217 -4.236 1.00 139.43 ? -39  DT  J "C2'" 1 
ATOM   9736  C  "C1'" . DT  J 6 34  ? -21.364 -31.216 -3.332 1.00 139.97 ? -39  DT  J "C1'" 1 
ATOM   9737  N  N1    . DT  J 6 34  ? -21.248 -31.452 -1.831 1.00 140.60 ? -39  DT  J N1    1 
ATOM   9738  C  C2    . DT  J 6 34  ? -21.564 -30.419 -0.950 1.00 140.76 ? -39  DT  J C2    1 
ATOM   9739  O  O2    . DT  J 6 34  ? -21.946 -29.307 -1.293 1.00 140.83 ? -39  DT  J O2    1 
ATOM   9740  N  N3    . DT  J 6 34  ? -21.424 -30.733 0.381  1.00 140.77 ? -39  DT  J N3    1 
ATOM   9741  C  C4    . DT  J 6 34  ? -21.004 -31.940 0.921  1.00 140.79 ? -39  DT  J C4    1 
ATOM   9742  O  O4    . DT  J 6 34  ? -20.918 -32.099 2.134  1.00 140.80 ? -39  DT  J O4    1 
ATOM   9743  C  C5    . DT  J 6 34  ? -20.685 -32.979 -0.042 1.00 140.82 ? -39  DT  J C5    1 
ATOM   9744  C  C7    . DT  J 6 34  ? -20.218 -34.341 0.408  1.00 140.76 ? -39  DT  J C7    1 
ATOM   9745  C  C6    . DT  J 6 34  ? -20.820 -32.688 -1.348 1.00 140.73 ? -39  DT  J C6    1 
ATOM   9746  P  P     . DA  J 6 35  ? -19.568 -30.392 -6.539 1.00 138.62 ? -38  DA  J P     1 
ATOM   9747  O  OP1   . DA  J 6 35  ? -19.243 -30.004 -7.931 1.00 138.65 ? -38  DA  J OP1   1 
ATOM   9748  O  OP2   . DA  J 6 35  ? -18.492 -30.987 -5.708 1.00 138.44 ? -38  DA  J OP2   1 
ATOM   9749  O  "O5'" . DA  J 6 35  ? -20.191 -29.124 -5.767 1.00 138.07 ? -38  DA  J "O5'" 1 
ATOM   9750  C  "C5'" . DA  J 6 35  ? -19.884 -27.773 -6.153 1.00 137.23 ? -38  DA  J "C5'" 1 
ATOM   9751  C  "C4'" . DA  J 6 35  ? -18.996 -27.059 -5.139 1.00 136.68 ? -38  DA  J "C4'" 1 
ATOM   9752  O  "O4'" . DA  J 6 35  ? -19.172 -27.635 -3.815 1.00 136.63 ? -38  DA  J "O4'" 1 
ATOM   9753  C  "C3'" . DA  J 6 35  ? -17.490 -27.102 -5.424 1.00 136.26 ? -38  DA  J "C3'" 1 
ATOM   9754  O  "O3'" . DA  J 6 35  ? -16.925 -25.797 -5.202 1.00 135.45 ? -38  DA  J "O3'" 1 
ATOM   9755  C  "C2'" . DA  J 6 35  ? -16.989 -28.145 -4.422 1.00 136.51 ? -38  DA  J "C2'" 1 
ATOM   9756  C  "C1'" . DA  J 6 35  ? -17.891 -27.815 -3.242 1.00 136.91 ? -38  DA  J "C1'" 1 
ATOM   9757  N  N9    . DA  J 6 35  ? -17.925 -28.828 -2.183 1.00 137.50 ? -38  DA  J N9    1 
ATOM   9758  C  C8    . DA  J 6 35  ? -18.074 -30.186 -2.320 1.00 137.60 ? -38  DA  J C8    1 
ATOM   9759  N  N7    . DA  J 6 35  ? -18.064 -30.849 -1.184 1.00 137.54 ? -38  DA  J N7    1 
ATOM   9760  C  C5    . DA  J 6 35  ? -17.891 -29.857 -0.233 1.00 137.64 ? -38  DA  J C5    1 
ATOM   9761  C  C6    . DA  J 6 35  ? -17.796 -29.901 1.172  1.00 137.63 ? -38  DA  J C6    1 
ATOM   9762  N  N6    . DA  J 6 35  ? -17.866 -31.043 1.864  1.00 137.62 ? -38  DA  J N6    1 
ATOM   9763  N  N1    . DA  J 6 35  ? -17.628 -28.727 1.831  1.00 137.80 ? -38  DA  J N1    1 
ATOM   9764  C  C2    . DA  J 6 35  ? -17.554 -27.582 1.129  1.00 137.75 ? -38  DA  J C2    1 
ATOM   9765  N  N3    . DA  J 6 35  ? -17.634 -27.418 -0.194 1.00 137.77 ? -38  DA  J N3    1 
ATOM   9766  C  C4    . DA  J 6 35  ? -17.802 -28.603 -0.826 1.00 137.73 ? -38  DA  J C4    1 
ATOM   9767  P  P     . DT  J 6 36  ? -15.347 -25.522 -5.022 1.00 134.99 ? -37  DT  J P     1 
ATOM   9768  O  OP1   . DT  J 6 36  ? -15.105 -24.129 -5.471 1.00 134.82 ? -37  DT  J OP1   1 
ATOM   9769  O  OP2   . DT  J 6 36  ? -14.566 -26.631 -5.633 1.00 134.75 ? -37  DT  J OP2   1 
ATOM   9770  O  "O5'" . DT  J 6 36  ? -15.143 -25.606 -3.431 1.00 134.35 ? -37  DT  J "O5'" 1 
ATOM   9771  C  "C5'" . DT  J 6 36  ? -15.779 -24.665 -2.550 1.00 133.43 ? -37  DT  J "C5'" 1 
ATOM   9772  C  "C4'" . DT  J 6 36  ? -15.030 -24.473 -1.231 1.00 132.54 ? -37  DT  J "C4'" 1 
ATOM   9773  O  "O4'" . DT  J 6 36  ? -15.286 -25.596 -0.343 1.00 132.33 ? -37  DT  J "O4'" 1 
ATOM   9774  C  "C3'" . DT  J 6 36  ? -13.505 -24.322 -1.309 1.00 131.96 ? -37  DT  J "C3'" 1 
ATOM   9775  O  "O3'" . DT  J 6 36  ? -13.099 -23.276 -0.411 1.00 130.79 ? -37  DT  J "O3'" 1 
ATOM   9776  C  "C2'" . DT  J 6 36  ? -13.000 -25.703 -0.880 1.00 132.15 ? -37  DT  J "C2'" 1 
ATOM   9777  C  "C1'" . DT  J 6 36  ? -14.057 -26.099 0.154  1.00 132.46 ? -37  DT  J "C1'" 1 
ATOM   9778  N  N1    . DT  J 6 36  ? -14.210 -27.576 0.431  1.00 132.45 ? -37  DT  J N1    1 
ATOM   9779  C  C2    . DT  J 6 36  ? -14.423 -27.997 1.741  1.00 132.40 ? -37  DT  J C2    1 
ATOM   9780  O  O2    . DT  J 6 36  ? -14.499 -27.240 2.701  1.00 132.19 ? -37  DT  J O2    1 
ATOM   9781  N  N3    . DT  J 6 36  ? -14.561 -29.356 1.889  1.00 132.44 ? -37  DT  J N3    1 
ATOM   9782  C  C4    . DT  J 6 36  ? -14.502 -30.320 0.892  1.00 132.46 ? -37  DT  J C4    1 
ATOM   9783  O  O4    . DT  J 6 36  ? -14.637 -31.511 1.151  1.00 132.40 ? -37  DT  J O4    1 
ATOM   9784  C  C5    . DT  J 6 36  ? -14.273 -29.818 -0.455 1.00 132.61 ? -37  DT  J C5    1 
ATOM   9785  C  C7    . DT  J 6 36  ? -14.161 -30.754 -1.647 1.00 132.82 ? -37  DT  J C7    1 
ATOM   9786  C  C6    . DT  J 6 36  ? -14.143 -28.491 -0.616 1.00 132.60 ? -37  DT  J C6    1 
ATOM   9787  P  P     . DT  J 6 37  ? -11.612 -22.651 -0.345 1.00 129.89 ? -36  DT  J P     1 
ATOM   9788  O  OP1   . DT  J 6 37  ? -11.674 -21.256 -0.843 1.00 129.96 ? -36  DT  J OP1   1 
ATOM   9789  O  OP2   . DT  J 6 37  ? -10.632 -23.600 -0.929 1.00 129.90 ? -36  DT  J OP2   1 
ATOM   9790  O  "O5'" . DT  J 6 37  ? -11.368 -22.592 1.246  1.00 129.05 ? -36  DT  J "O5'" 1 
ATOM   9791  C  "C5'" . DT  J 6 37  ? -12.306 -22.374 2.172  1.00 127.36 ? -36  DT  J "C5'" 1 
ATOM   9792  C  "C4'" . DT  J 6 37  ? -12.212 -23.041 3.533  1.00 125.77 ? -36  DT  J "C4'" 1 
ATOM   9793  O  "O4'" . DT  J 6 37  ? -12.519 -24.459 3.462  1.00 125.32 ? -36  DT  J "O4'" 1 
ATOM   9794  C  "C3'" . DT  J 6 37  ? -10.771 -22.916 4.042  1.00 124.66 ? -36  DT  J "C3'" 1 
ATOM   9795  O  "O3'" . DT  J 6 37  ? -10.715 -22.171 5.256  1.00 122.62 ? -36  DT  J "O3'" 1 
ATOM   9796  C  "C2'" . DT  J 6 37  ? -10.281 -24.348 4.252  1.00 124.89 ? -36  DT  J "C2'" 1 
ATOM   9797  C  "C1'" . DT  J 6 37  ? -11.559 -25.183 4.229  1.00 125.23 ? -36  DT  J "C1'" 1 
ATOM   9798  N  N1    . DT  J 6 37  ? -11.293 -26.521 3.610  1.00 125.67 ? -36  DT  J N1    1 
ATOM   9799  C  C2    . DT  J 6 37  ? -11.639 -27.658 4.314  1.00 125.86 ? -36  DT  J C2    1 
ATOM   9800  O  O2    . DT  J 6 37  ? -12.165 -27.631 5.412  1.00 125.93 ? -36  DT  J O2    1 
ATOM   9801  N  N3    . DT  J 6 37  ? -11.347 -28.840 3.678  1.00 126.04 ? -36  DT  J N3    1 
ATOM   9802  C  C4    . DT  J 6 37  ? -10.749 -28.998 2.435  1.00 126.40 ? -36  DT  J C4    1 
ATOM   9803  O  O4    . DT  J 6 37  ? -10.535 -30.113 1.965  1.00 126.59 ? -36  DT  J O4    1 
ATOM   9804  C  C5    . DT  J 6 37  ? -10.401 -27.767 1.748  1.00 126.41 ? -36  DT  J C5    1 
ATOM   9805  C  C7    . DT  J 6 37  ? -9.745  -27.790 0.391  1.00 126.57 ? -36  DT  J C7    1 
ATOM   9806  C  C6    . DT  J 6 37  ? -10.684 -26.606 2.364  1.00 126.16 ? -36  DT  J C6    1 
ATOM   9807  P  P     . DT  J 6 38  ? -9.295  -21.740 5.867  1.00 121.47 ? -35  DT  J P     1 
ATOM   9808  O  OP1   . DT  J 6 38  ? -9.512  -20.475 6.606  1.00 121.35 ? -35  DT  J OP1   1 
ATOM   9809  O  OP2   . DT  J 6 38  ? -8.245  -21.820 4.820  1.00 121.52 ? -35  DT  J OP2   1 
ATOM   9810  O  "O5'" . DT  J 6 38  ? -9.009  -22.919 6.908  1.00 120.44 ? -35  DT  J "O5'" 1 
ATOM   9811  C  "C5'" . DT  J 6 38  ? -10.026 -23.416 7.802  1.00 118.25 ? -35  DT  J "C5'" 1 
ATOM   9812  C  "C4'" . DT  J 6 38  ? -9.466  -24.551 8.662  1.00 116.58 ? -35  DT  J "C4'" 1 
ATOM   9813  O  "O4'" . DT  J 6 38  ? -9.596  -25.838 7.972  1.00 116.30 ? -35  DT  J "O4'" 1 
ATOM   9814  C  "C3'" . DT  J 6 38  ? -7.989  -24.419 9.047  1.00 115.38 ? -35  DT  J "C3'" 1 
ATOM   9815  O  "O3'" . DT  J 6 38  ? -7.804  -24.816 10.402 1.00 113.23 ? -35  DT  J "O3'" 1 
ATOM   9816  C  "C2'" . DT  J 6 38  ? -7.298  -25.397 8.098  1.00 115.74 ? -35  DT  J "C2'" 1 
ATOM   9817  C  "C1'" . DT  J 6 38  ? -8.346  -26.508 8.014  1.00 116.25 ? -35  DT  J "C1'" 1 
ATOM   9818  N  N1    . DT  J 6 38  ? -8.227  -27.417 6.815  1.00 116.38 ? -35  DT  J N1    1 
ATOM   9819  C  C2    . DT  J 6 38  ? -8.901  -28.625 6.807  1.00 116.24 ? -35  DT  J C2    1 
ATOM   9820  O  O2    . DT  J 6 38  ? -9.598  -29.016 7.728  1.00 115.93 ? -35  DT  J O2    1 
ATOM   9821  N  N3    . DT  J 6 38  ? -8.723  -29.370 5.663  1.00 116.33 ? -35  DT  J N3    1 
ATOM   9822  C  C4    . DT  J 6 38  ? -7.956  -29.043 4.554  1.00 116.46 ? -35  DT  J C4    1 
ATOM   9823  O  O4    . DT  J 6 38  ? -7.871  -29.798 3.586  1.00 116.23 ? -35  DT  J O4    1 
ATOM   9824  C  C5    . DT  J 6 38  ? -7.277  -27.764 4.629  1.00 116.56 ? -35  DT  J C5    1 
ATOM   9825  C  C7    . DT  J 6 38  ? -6.408  -27.260 3.510  1.00 116.77 ? -35  DT  J C7    1 
ATOM   9826  C  C6    . DT  J 6 38  ? -7.446  -27.031 5.738  1.00 116.49 ? -35  DT  J C6    1 
ATOM   9827  P  P     . DG  J 6 39  ? -7.925  -23.821 11.657 1.00 111.12 ? -34  DG  J P     1 
ATOM   9828  O  OP1   . DG  J 6 39  ? -8.997  -22.818 11.422 1.00 111.15 ? -34  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J 6 39  ? -6.554  -23.381 12.011 1.00 111.51 ? -34  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J 6 39  ? -8.430  -24.820 12.798 1.00 109.07 ? -34  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J 6 39  ? -9.461  -25.761 12.503 1.00 106.58 ? -34  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J 6 39  ? -9.237  -27.158 13.083 1.00 105.27 ? -34  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J 6 39  ? -8.658  -28.050 12.096 1.00 104.73 ? -34  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J 6 39  ? -8.316  -27.297 14.293 1.00 104.55 ? -34  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J 6 39  ? -8.723  -28.426 15.083 1.00 102.18 ? -34  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J 6 39  ? -6.949  -27.520 13.655 1.00 105.27 ? -34  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J 6 39  ? -7.341  -28.398 12.476 1.00 105.88 ? -34  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J 6 39  ? -6.538  -28.203 11.284 1.00 107.50 ? -34  DG  J N9    1 
ATOM   9839  C  C8    . DG  J 6 39  ? -5.900  -27.061 10.847 1.00 108.09 ? -34  DG  J C8    1 
ATOM   9840  N  N7    . DG  J 6 39  ? -5.267  -27.225 9.714  1.00 108.54 ? -34  DG  J N7    1 
ATOM   9841  C  C5    . DG  J 6 39  ? -5.510  -28.558 9.385  1.00 108.55 ? -34  DG  J C5    1 
ATOM   9842  C  C6    . DG  J 6 39  ? -5.086  -29.321 8.269  1.00 108.82 ? -34  DG  J C6    1 
ATOM   9843  O  O6    . DG  J 6 39  ? -4.385  -28.947 7.318  1.00 109.20 ? -34  DG  J O6    1 
ATOM   9844  N  N1    . DG  J 6 39  ? -5.553  -30.639 8.333  1.00 108.58 ? -34  DG  J N1    1 
ATOM   9845  C  C2    . DG  J 6 39  ? -6.336  -31.151 9.348  1.00 108.54 ? -34  DG  J C2    1 
ATOM   9846  N  N2    . DG  J 6 39  ? -6.691  -32.438 9.250  1.00 108.62 ? -34  DG  J N2    1 
ATOM   9847  N  N3    . DG  J 6 39  ? -6.742  -30.451 10.397 1.00 108.01 ? -34  DG  J N3    1 
ATOM   9848  C  C4    . DG  J 6 39  ? -6.291  -29.171 10.344 1.00 108.18 ? -34  DG  J C4    1 
ATOM   9849  P  P     . DG  J 6 40  ? -8.197  -28.651 16.581 1.00 99.86  ? -33  DG  J P     1 
ATOM   9850  O  OP1   . DG  J 6 40  ? -9.368  -29.120 17.357 1.00 99.29  ? -33  DG  J OP1   1 
ATOM   9851  O  OP2   . DG  J 6 40  ? -7.399  -27.474 17.018 1.00 99.40  ? -33  DG  J OP2   1 
ATOM   9852  O  "O5'" . DG  J 6 40  ? -7.195  -29.881 16.435 1.00 100.27 ? -33  DG  J "O5'" 1 
ATOM   9853  C  "C5'" . DG  J 6 40  ? -7.671  -31.144 15.974 1.00 101.29 ? -33  DG  J "C5'" 1 
ATOM   9854  C  "C4'" . DG  J 6 40  ? -6.497  -31.997 15.532 1.00 102.43 ? -33  DG  J "C4'" 1 
ATOM   9855  O  "O4'" . DG  J 6 40  ? -5.828  -31.366 14.410 1.00 103.15 ? -33  DG  J "O4'" 1 
ATOM   9856  C  "C3'" . DG  J 6 40  ? -5.412  -32.185 16.590 1.00 103.24 ? -33  DG  J "C3'" 1 
ATOM   9857  O  "O3'" . DG  J 6 40  ? -5.014  -33.549 16.616 1.00 103.81 ? -33  DG  J "O3'" 1 
ATOM   9858  C  "C2'" . DG  J 6 40  ? -4.267  -31.282 16.128 1.00 103.61 ? -33  DG  J "C2'" 1 
ATOM   9859  C  "C1'" . DG  J 6 40  ? -4.432  -31.440 14.623 1.00 103.65 ? -33  DG  J "C1'" 1 
ATOM   9860  N  N9    . DG  J 6 40  ? -3.770  -30.458 13.767 1.00 104.15 ? -33  DG  J N9    1 
ATOM   9861  C  C8    . DG  J 6 40  ? -3.339  -29.178 14.051 1.00 104.36 ? -33  DG  J C8    1 
ATOM   9862  N  N7    . DG  J 6 40  ? -2.788  -28.580 13.027 1.00 104.62 ? -33  DG  J N7    1 
ATOM   9863  C  C5    . DG  J 6 40  ? -2.863  -29.524 12.003 1.00 104.71 ? -33  DG  J C5    1 
ATOM   9864  C  C6    . DG  J 6 40  ? -2.428  -29.466 10.649 1.00 104.84 ? -33  DG  J C6    1 
ATOM   9865  O  O6    . DG  J 6 40  ? -1.870  -28.518 10.067 1.00 104.87 ? -33  DG  J O6    1 
ATOM   9866  N  N1    . DG  J 6 40  ? -2.702  -30.662 9.964  1.00 104.56 ? -33  DG  J N1    1 
ATOM   9867  C  C2    . DG  J 6 40  ? -3.318  -31.770 10.521 1.00 104.41 ? -33  DG  J C2    1 
ATOM   9868  N  N2    . DG  J 6 40  ? -3.514  -32.838 9.734  1.00 104.03 ? -33  DG  J N2    1 
ATOM   9869  N  N3    . DG  J 6 40  ? -3.728  -31.832 11.780 1.00 104.00 ? -33  DG  J N3    1 
ATOM   9870  C  C4    . DG  J 6 40  ? -3.466  -30.682 12.452 1.00 104.29 ? -33  DG  J C4    1 
ATOM   9871  P  P     . DA  J 6 41  ? -5.178  -34.422 17.949 1.00 103.72 ? -32  DA  J P     1 
ATOM   9872  O  OP1   . DA  J 6 41  ? -6.633  -34.580 18.193 1.00 103.24 ? -32  DA  J OP1   1 
ATOM   9873  O  OP2   . DA  J 6 41  ? -4.302  -33.827 18.990 1.00 103.42 ? -32  DA  J OP2   1 
ATOM   9874  O  "O5'" . DA  J 6 41  ? -4.561  -35.844 17.538 1.00 104.68 ? -32  DA  J "O5'" 1 
ATOM   9875  C  "C5'" . DA  J 6 41  ? -5.068  -36.577 16.423 1.00 107.35 ? -32  DA  J "C5'" 1 
ATOM   9876  C  "C4'" . DA  J 6 41  ? -3.944  -37.214 15.616 1.00 109.93 ? -32  DA  J "C4'" 1 
ATOM   9877  O  "O4'" . DA  J 6 41  ? -3.394  -36.262 14.663 1.00 110.52 ? -32  DA  J "O4'" 1 
ATOM   9878  C  "C3'" . DA  J 6 41  ? -2.777  -37.750 16.445 1.00 111.69 ? -32  DA  J "C3'" 1 
ATOM   9879  O  "O3'" . DA  J 6 41  ? -2.666  -39.186 16.214 1.00 114.22 ? -32  DA  J "O3'" 1 
ATOM   9880  C  "C2'" . DA  J 6 41  ? -1.583  -36.866 16.047 1.00 111.35 ? -32  DA  J "C2'" 1 
ATOM   9881  C  "C1'" . DA  J 6 41  ? -1.976  -36.258 14.699 1.00 111.03 ? -32  DA  J "C1'" 1 
ATOM   9882  N  N9    . DA  J 6 41  ? -1.522  -34.876 14.474 1.00 110.99 ? -32  DA  J N9    1 
ATOM   9883  C  C8    . DA  J 6 41  ? -1.467  -33.867 15.401 1.00 110.98 ? -32  DA  J C8    1 
ATOM   9884  N  N7    . DA  J 6 41  ? -1.036  -32.720 14.934 1.00 110.93 ? -32  DA  J N7    1 
ATOM   9885  C  C5    . DA  J 6 41  ? -0.786  -32.980 13.596 1.00 111.11 ? -32  DA  J C5    1 
ATOM   9886  C  C6    . DA  J 6 41  ? -0.305  -32.166 12.537 1.00 111.12 ? -32  DA  J C6    1 
ATOM   9887  N  N6    . DA  J 6 41  ? 0.020   -30.876 12.687 1.00 111.00 ? -32  DA  J N6    1 
ATOM   9888  N  N1    . DA  J 6 41  ? -0.168  -32.727 11.313 1.00 111.02 ? -32  DA  J N1    1 
ATOM   9889  C  C2    . DA  J 6 41  ? -0.494  -34.022 11.164 1.00 111.13 ? -32  DA  J C2    1 
ATOM   9890  N  N3    . DA  J 6 41  ? -0.952  -34.885 12.081 1.00 111.21 ? -32  DA  J N3    1 
ATOM   9891  C  C4    . DA  J 6 41  ? -1.081  -34.303 13.293 1.00 111.14 ? -32  DA  J C4    1 
ATOM   9892  P  P     . DA  J 6 42  ? -1.334  -40.025 15.865 1.00 115.86 ? -31  DA  J P     1 
ATOM   9893  O  OP1   . DA  J 6 42  ? -1.732  -41.450 15.826 1.00 115.43 ? -31  DA  J OP1   1 
ATOM   9894  O  OP2   . DA  J 6 42  ? -0.240  -39.609 16.772 1.00 115.50 ? -31  DA  J OP2   1 
ATOM   9895  O  "O5'" . DA  J 6 42  ? -0.982  -39.546 14.372 1.00 117.53 ? -31  DA  J "O5'" 1 
ATOM   9896  C  "C5'" . DA  J 6 42  ? -0.290  -40.402 13.457 1.00 119.76 ? -31  DA  J "C5'" 1 
ATOM   9897  C  "C4'" . DA  J 6 42  ? 1.123   -39.909 13.202 1.00 121.34 ? -31  DA  J "C4'" 1 
ATOM   9898  O  "O4'" . DA  J 6 42  ? 1.128   -38.460 13.138 1.00 121.74 ? -31  DA  J "O4'" 1 
ATOM   9899  C  "C3'" . DA  J 6 42  ? 2.124   -40.266 14.302 1.00 122.34 ? -31  DA  J "C3'" 1 
ATOM   9900  O  "O3'" . DA  J 6 42  ? 2.801   -41.543 14.066 1.00 123.94 ? -31  DA  J "O3'" 1 
ATOM   9901  C  "C2'" . DA  J 6 42  ? 3.053   -39.051 14.384 1.00 122.30 ? -31  DA  J "C2'" 1 
ATOM   9902  C  "C1'" . DA  J 6 42  ? 2.428   -38.012 13.447 1.00 122.22 ? -31  DA  J "C1'" 1 
ATOM   9903  N  N9    . DA  J 6 42  ? 2.358   -36.668 14.024 1.00 122.64 ? -31  DA  J N9    1 
ATOM   9904  C  C8    . DA  J 6 42  ? 1.871   -36.325 15.256 1.00 122.79 ? -31  DA  J C8    1 
ATOM   9905  N  N7    . DA  J 6 42  ? 1.937   -35.040 15.519 1.00 123.09 ? -31  DA  J N7    1 
ATOM   9906  C  C5    . DA  J 6 42  ? 2.511   -34.497 14.381 1.00 123.13 ? -31  DA  J C5    1 
ATOM   9907  C  C6    . DA  J 6 42  ? 2.855   -33.171 14.021 1.00 123.20 ? -31  DA  J C6    1 
ATOM   9908  N  N6    . DA  J 6 42  ? 2.657   -32.117 14.821 1.00 123.21 ? -31  DA  J N6    1 
ATOM   9909  N  N1    . DA  J 6 42  ? 3.417   -32.967 12.806 1.00 123.30 ? -31  DA  J N1    1 
ATOM   9910  C  C2    . DA  J 6 42  ? 3.617   -34.023 12.002 1.00 123.23 ? -31  DA  J C2    1 
ATOM   9911  N  N3    . DA  J 6 42  ? 3.334   -35.311 12.231 1.00 123.10 ? -31  DA  J N3    1 
ATOM   9912  C  C4    . DA  J 6 42  ? 2.778   -35.487 13.447 1.00 123.00 ? -31  DA  J C4    1 
ATOM   9913  P  P     . DA  J 6 43  ? 3.831   -41.928 12.875 1.00 125.33 ? -30  DA  J P     1 
ATOM   9914  O  OP1   . DA  J 6 43  ? 3.088   -42.841 11.973 1.00 124.97 ? -30  DA  J OP1   1 
ATOM   9915  O  OP2   . DA  J 6 43  ? 5.083   -42.404 13.513 1.00 125.21 ? -30  DA  J OP2   1 
ATOM   9916  O  "O5'" . DA  J 6 43  ? 4.201   -40.571 12.090 1.00 125.94 ? -30  DA  J "O5'" 1 
ATOM   9917  C  "C5'" . DA  J 6 43  ? 5.226   -40.549 11.082 1.00 126.50 ? -30  DA  J "C5'" 1 
ATOM   9918  C  "C4'" . DA  J 6 43  ? 6.339   -39.536 11.366 1.00 126.95 ? -30  DA  J "C4'" 1 
ATOM   9919  O  "O4'" . DA  J 6 43  ? 5.820   -38.389 12.102 1.00 126.93 ? -30  DA  J "O4'" 1 
ATOM   9920  C  "C3'" . DA  J 6 43  ? 7.526   -40.074 12.184 1.00 127.19 ? -30  DA  J "C3'" 1 
ATOM   9921  O  "O3'" . DA  J 6 43  ? 8.730   -40.028 11.371 1.00 127.56 ? -30  DA  J "O3'" 1 
ATOM   9922  C  "C2'" . DA  J 6 43  ? 7.586   -39.165 13.440 1.00 127.10 ? -30  DA  J "C2'" 1 
ATOM   9923  C  "C1'" . DA  J 6 43  ? 6.899   -37.891 12.907 1.00 126.88 ? -30  DA  J "C1'" 1 
ATOM   9924  N  N9    . DA  J 6 43  ? 6.395   -36.950 13.918 1.00 126.55 ? -30  DA  J N9    1 
ATOM   9925  C  C8    . DA  J 6 43  ? 5.721   -37.242 15.073 1.00 126.38 ? -30  DA  J C8    1 
ATOM   9926  N  N7    . DA  J 6 43  ? 5.397   -36.188 15.786 1.00 126.50 ? -30  DA  J N7    1 
ATOM   9927  C  C5    . DA  J 6 43  ? 5.892   -35.122 15.054 1.00 126.54 ? -30  DA  J C5    1 
ATOM   9928  C  C6    . DA  J 6 43  ? 5.880   -33.721 15.264 1.00 126.71 ? -30  DA  J C6    1 
ATOM   9929  N  N6    . DA  J 6 43  ? 5.321   -33.137 16.327 1.00 127.09 ? -30  DA  J N6    1 
ATOM   9930  N  N1    . DA  J 6 43  ? 6.463   -32.927 14.337 1.00 126.75 ? -30  DA  J N1    1 
ATOM   9931  C  C2    . DA  J 6 43  ? 7.027   -33.502 13.267 1.00 126.74 ? -30  DA  J C2    1 
ATOM   9932  N  N3    . DA  J 6 43  ? 7.099   -34.803 12.963 1.00 126.77 ? -30  DA  J N3    1 
ATOM   9933  C  C4    . DA  J 6 43  ? 6.510   -35.573 13.901 1.00 126.57 ? -30  DA  J C4    1 
ATOM   9934  P  P     . DC  J 6 44  ? 10.178  -40.542 11.867 1.00 127.95 ? -29  DC  J P     1 
ATOM   9935  O  OP1   . DC  J 6 44  ? 10.907  -41.021 10.670 1.00 127.48 ? -29  DC  J OP1   1 
ATOM   9936  O  OP2   . DC  J 6 44  ? 10.004  -41.472 13.012 1.00 127.53 ? -29  DC  J OP2   1 
ATOM   9937  O  "O5'" . DC  J 6 44  ? 10.871  -39.195 12.408 1.00 128.02 ? -29  DC  J "O5'" 1 
ATOM   9938  C  "C5'" . DC  J 6 44  ? 11.382  -38.206 11.503 1.00 128.11 ? -29  DC  J "C5'" 1 
ATOM   9939  C  "C4'" . DC  J 6 44  ? 11.870  -36.957 12.223 1.00 128.31 ? -29  DC  J "C4'" 1 
ATOM   9940  O  "O4'" . DC  J 6 44  ? 10.791  -36.381 13.005 1.00 128.41 ? -29  DC  J "O4'" 1 
ATOM   9941  C  "C3'" . DC  J 6 44  ? 13.045  -37.153 13.185 1.00 128.38 ? -29  DC  J "C3'" 1 
ATOM   9942  O  "O3'" . DC  J 6 44  ? 14.130  -36.318 12.767 1.00 128.44 ? -29  DC  J "O3'" 1 
ATOM   9943  C  "C2'" . DC  J 6 44  ? 12.495  -36.739 14.556 1.00 128.52 ? -29  DC  J "C2'" 1 
ATOM   9944  C  "C1'" . DC  J 6 44  ? 11.353  -35.802 14.166 1.00 128.69 ? -29  DC  J "C1'" 1 
ATOM   9945  N  N1    . DC  J 6 44  ? 10.280  -35.589 15.214 1.00 128.87 ? -29  DC  J N1    1 
ATOM   9946  C  C2    . DC  J 6 44  ? 10.044  -34.290 15.719 1.00 129.19 ? -29  DC  J C2    1 
ATOM   9947  O  O2    . DC  J 6 44  ? 10.714  -33.330 15.311 1.00 129.34 ? -29  DC  J O2    1 
ATOM   9948  N  N3    . DC  J 6 44  ? 9.074   -34.112 16.657 1.00 129.17 ? -29  DC  J N3    1 
ATOM   9949  C  C4    . DC  J 6 44  ? 8.359   -35.155 17.091 1.00 128.94 ? -29  DC  J C4    1 
ATOM   9950  N  N4    . DC  J 6 44  ? 7.420   -34.918 18.014 1.00 128.86 ? -29  DC  J N4    1 
ATOM   9951  C  C5    . DC  J 6 44  ? 8.579   -36.481 16.594 1.00 128.61 ? -29  DC  J C5    1 
ATOM   9952  C  C6    . DC  J 6 44  ? 9.534   -36.649 15.669 1.00 128.52 ? -29  DC  J C6    1 
ATOM   9953  P  P     . DT  J 6 45  ? 15.605  -36.447 13.400 1.00 128.36 ? -28  DT  J P     1 
ATOM   9954  O  OP1   . DT  J 6 45  ? 16.576  -36.066 12.344 1.00 128.18 ? -28  DT  J OP1   1 
ATOM   9955  O  OP2   . DT  J 6 45  ? 15.713  -37.764 14.074 1.00 128.24 ? -28  DT  J OP2   1 
ATOM   9956  O  "O5'" . DT  J 6 45  ? 15.614  -35.322 14.541 1.00 128.25 ? -28  DT  J "O5'" 1 
ATOM   9957  C  "C5'" . DT  J 6 45  ? 15.606  -33.931 14.215 1.00 127.83 ? -28  DT  J "C5'" 1 
ATOM   9958  C  "C4'" . DT  J 6 45  ? 15.379  -33.123 15.479 1.00 127.44 ? -28  DT  J "C4'" 1 
ATOM   9959  O  "O4'" . DT  J 6 45  ? 14.100  -33.506 16.055 1.00 127.18 ? -28  DT  J "O4'" 1 
ATOM   9960  C  "C3'" . DT  J 6 45  ? 16.425  -33.373 16.567 1.00 127.33 ? -28  DT  J "C3'" 1 
ATOM   9961  O  "O3'" . DT  J 6 45  ? 16.898  -32.131 17.079 1.00 127.03 ? -28  DT  J "O3'" 1 
ATOM   9962  C  "C2'" . DT  J 6 45  ? 15.666  -34.164 17.632 1.00 127.44 ? -28  DT  J "C2'" 1 
ATOM   9963  C  "C1'" . DT  J 6 45  ? 14.264  -33.587 17.455 1.00 127.48 ? -28  DT  J "C1'" 1 
ATOM   9964  N  N1    . DT  J 6 45  ? 13.134  -34.377 18.068 1.00 127.62 ? -28  DT  J N1    1 
ATOM   9965  C  C2    . DT  J 6 45  ? 12.043  -33.710 18.609 1.00 127.45 ? -28  DT  J C2    1 
ATOM   9966  O  O2    . DT  J 6 45  ? 11.914  -32.496 18.634 1.00 127.25 ? -28  DT  J O2    1 
ATOM   9967  N  N3    . DT  J 6 45  ? 11.078  -34.533 19.138 1.00 127.44 ? -28  DT  J N3    1 
ATOM   9968  C  C4    . DT  J 6 45  ? 11.086  -35.917 19.185 1.00 127.45 ? -28  DT  J C4    1 
ATOM   9969  O  O4    . DT  J 6 45  ? 10.159  -36.544 19.689 1.00 127.29 ? -28  DT  J O4    1 
ATOM   9970  C  C5    . DT  J 6 45  ? 12.253  -36.553 18.605 1.00 127.56 ? -28  DT  J C5    1 
ATOM   9971  C  C7    . DT  J 6 45  ? 12.398  -38.049 18.584 1.00 127.60 ? -28  DT  J C7    1 
ATOM   9972  C  C6    . DT  J 6 45  ? 13.202  -35.762 18.084 1.00 127.64 ? -28  DT  J C6    1 
ATOM   9973  P  P     . DG  J 6 46  ? 18.454  -31.990 17.490 1.00 126.83 ? -27  DG  J P     1 
ATOM   9974  O  OP1   . DG  J 6 46  ? 19.257  -32.186 16.244 1.00 126.76 ? -27  DG  J OP1   1 
ATOM   9975  O  OP2   . DG  J 6 46  ? 18.669  -32.855 18.698 1.00 126.32 ? -27  DG  J OP2   1 
ATOM   9976  O  "O5'" . DG  J 6 46  ? 18.619  -30.454 17.928 1.00 126.43 ? -27  DG  J "O5'" 1 
ATOM   9977  C  "C5'" . DG  J 6 46  ? 17.882  -29.403 17.280 1.00 125.57 ? -27  DG  J "C5'" 1 
ATOM   9978  C  "C4'" . DG  J 6 46  ? 17.165  -28.514 18.293 1.00 124.71 ? -27  DG  J "C4'" 1 
ATOM   9979  O  "O4'" . DG  J 6 46  ? 16.004  -29.180 18.856 1.00 124.38 ? -27  DG  J "O4'" 1 
ATOM   9980  C  "C3'" . DG  J 6 46  ? 17.989  -28.070 19.495 1.00 124.23 ? -27  DG  J "C3'" 1 
ATOM   9981  O  "O3'" . DG  J 6 46  ? 17.587  -26.757 19.842 1.00 123.69 ? -27  DG  J "O3'" 1 
ATOM   9982  C  "C2'" . DG  J 6 46  ? 17.620  -29.087 20.571 1.00 124.01 ? -27  DG  J "C2'" 1 
ATOM   9983  C  "C1'" . DG  J 6 46  ? 16.145  -29.313 20.258 1.00 124.36 ? -27  DG  J "C1'" 1 
ATOM   9984  N  N9    . DG  J 6 46  ? 15.656  -30.639 20.609 1.00 124.55 ? -27  DG  J N9    1 
ATOM   9985  C  C8    . DG  J 6 46  ? 16.187  -31.839 20.204 1.00 124.68 ? -27  DG  J C8    1 
ATOM   9986  N  N7    . DG  J 6 46  ? 15.546  -32.876 20.664 1.00 124.81 ? -27  DG  J N7    1 
ATOM   9987  C  C5    . DG  J 6 46  ? 14.519  -32.329 21.420 1.00 124.96 ? -27  DG  J C5    1 
ATOM   9988  C  C6    . DG  J 6 46  ? 13.498  -32.974 22.160 1.00 125.04 ? -27  DG  J C6    1 
ATOM   9989  O  O6    . DG  J 6 46  ? 13.307  -34.191 22.286 1.00 124.83 ? -27  DG  J O6    1 
ATOM   9990  N  N1    . DG  J 6 46  ? 12.649  -32.059 22.791 1.00 125.38 ? -27  DG  J N1    1 
ATOM   9991  C  C2    . DG  J 6 46  ? 12.777  -30.687 22.712 1.00 125.53 ? -27  DG  J C2    1 
ATOM   9992  N  N2    . DG  J 6 46  ? 11.868  -29.962 23.389 1.00 125.71 ? -27  DG  J N2    1 
ATOM   9993  N  N3    . DG  J 6 46  ? 13.736  -30.071 22.018 1.00 125.30 ? -27  DG  J N3    1 
ATOM   9994  C  C4    . DG  J 6 46  ? 14.569  -30.950 21.397 1.00 124.89 ? -27  DG  J C4    1 
ATOM   9995  P  P     . DC  J 6 47  ? 18.422  -25.882 20.891 1.00 123.44 ? -26  DC  J P     1 
ATOM   9996  O  OP1   . DC  J 6 47  ? 18.083  -24.458 20.632 1.00 123.20 ? -26  DC  J OP1   1 
ATOM   9997  O  OP2   . DC  J 6 47  ? 19.840  -26.327 20.848 1.00 123.43 ? -26  DC  J OP2   1 
ATOM   9998  O  "O5'" . DC  J 6 47  ? 17.821  -26.351 22.304 1.00 121.95 ? -26  DC  J "O5'" 1 
ATOM   9999  C  "C5'" . DC  J 6 47  ? 16.453  -26.121 22.683 1.00 119.56 ? -26  DC  J "C5'" 1 
ATOM   10000 C  "C4'" . DC  J 6 47  ? 16.173  -26.633 24.093 1.00 117.66 ? -26  DC  J "C4'" 1 
ATOM   10001 O  "O4'" . DC  J 6 47  ? 15.903  -28.059 24.039 1.00 117.35 ? -26  DC  J "O4'" 1 
ATOM   10002 C  "C3'" . DC  J 6 47  ? 17.306  -26.477 25.111 1.00 116.52 ? -26  DC  J "C3'" 1 
ATOM   10003 O  "O3'" . DC  J 6 47  ? 16.771  -26.137 26.383 1.00 114.54 ? -26  DC  J "O3'" 1 
ATOM   10004 C  "C2'" . DC  J 6 47  ? 17.933  -27.865 25.152 1.00 116.70 ? -26  DC  J "C2'" 1 
ATOM   10005 C  "C1'" . DC  J 6 47  ? 16.664  -28.699 25.043 1.00 117.30 ? -26  DC  J "C1'" 1 
ATOM   10006 N  N1    . DC  J 6 47  ? 16.867  -30.134 24.679 1.00 117.83 ? -26  DC  J N1    1 
ATOM   10007 C  C2    . DC  J 6 47  ? 16.189  -31.141 25.394 1.00 118.14 ? -26  DC  J C2    1 
ATOM   10008 O  O2    . DC  J 6 47  ? 15.427  -30.846 26.326 1.00 118.16 ? -26  DC  J O2    1 
ATOM   10009 N  N3    . DC  J 6 47  ? 16.387  -32.437 25.041 1.00 118.27 ? -26  DC  J N3    1 
ATOM   10010 C  C4    . DC  J 6 47  ? 17.212  -32.742 24.033 1.00 118.38 ? -26  DC  J C4    1 
ATOM   10011 N  N4    . DC  J 6 47  ? 17.371  -34.035 23.730 1.00 118.61 ? -26  DC  J N4    1 
ATOM   10012 C  C5    . DC  J 6 47  ? 17.910  -31.736 23.295 1.00 118.30 ? -26  DC  J C5    1 
ATOM   10013 C  C6    . DC  J 6 47  ? 17.708  -30.461 23.650 1.00 118.03 ? -26  DC  J C6    1 
ATOM   10014 P  P     . DT  J 6 48  ? 16.992  -24.680 27.012 1.00 113.40 ? -25  DT  J P     1 
ATOM   10015 O  OP1   . DT  J 6 48  ? 16.650  -23.660 25.983 1.00 113.11 ? -25  DT  J OP1   1 
ATOM   10016 O  OP2   . DT  J 6 48  ? 18.329  -24.682 27.654 1.00 113.46 ? -25  DT  J OP2   1 
ATOM   10017 O  "O5'" . DT  J 6 48  ? 15.874  -24.669 28.162 1.00 111.35 ? -25  DT  J "O5'" 1 
ATOM   10018 C  "C5'" . DT  J 6 48  ? 14.485  -24.514 27.821 1.00 107.58 ? -25  DT  J "C5'" 1 
ATOM   10019 C  "C4'" . DT  J 6 48  ? 13.560  -25.401 28.646 1.00 104.23 ? -25  DT  J "C4'" 1 
ATOM   10020 O  "O4'" . DT  J 6 48  ? 13.853  -26.797 28.388 1.00 103.74 ? -25  DT  J "O4'" 1 
ATOM   10021 C  "C3'" . DT  J 6 48  ? 13.656  -25.238 30.160 1.00 102.02 ? -25  DT  J "C3'" 1 
ATOM   10022 O  "O3'" . DT  J 6 48  ? 12.371  -25.375 30.741 1.00 97.79  ? -25  DT  J "O3'" 1 
ATOM   10023 C  "C2'" . DT  J 6 48  ? 14.544  -26.395 30.591 1.00 102.58 ? -25  DT  J "C2'" 1 
ATOM   10024 C  "C1'" . DT  J 6 48  ? 14.052  -27.457 29.619 1.00 103.88 ? -25  DT  J "C1'" 1 
ATOM   10025 N  N1    . DT  J 6 48  ? 15.038  -28.531 29.414 1.00 105.15 ? -25  DT  J N1    1 
ATOM   10026 C  C2    . DT  J 6 48  ? 14.649  -29.850 29.563 1.00 105.87 ? -25  DT  J C2    1 
ATOM   10027 O  O2    . DT  J 6 48  ? 13.516  -30.196 29.856 1.00 106.36 ? -25  DT  J O2    1 
ATOM   10028 N  N3    . DT  J 6 48  ? 15.652  -30.764 29.355 1.00 106.09 ? -25  DT  J N3    1 
ATOM   10029 C  C4    . DT  J 6 48  ? 16.970  -30.490 29.020 1.00 106.60 ? -25  DT  J C4    1 
ATOM   10030 O  O4    . DT  J 6 48  ? 17.780  -31.394 28.853 1.00 106.99 ? -25  DT  J O4    1 
ATOM   10031 C  C5    . DT  J 6 48  ? 17.312  -29.084 28.881 1.00 106.82 ? -25  DT  J C5    1 
ATOM   10032 C  C7    . DT  J 6 48  ? 18.705  -28.632 28.522 1.00 106.89 ? -25  DT  J C7    1 
ATOM   10033 C  C6    . DT  J 6 48  ? 16.337  -28.187 29.084 1.00 106.16 ? -25  DT  J C6    1 
ATOM   10034 P  P     . DC  J 6 49  ? 12.109  -24.854 32.229 1.00 94.17  ? -24  DC  J P     1 
ATOM   10035 O  OP1   . DC  J 6 49  ? 11.152  -23.733 32.083 1.00 94.51  ? -24  DC  J OP1   1 
ATOM   10036 O  OP2   . DC  J 6 49  ? 13.397  -24.636 32.937 1.00 93.95  ? -24  DC  J OP2   1 
ATOM   10037 O  "O5'" . DC  J 6 49  ? 11.373  -26.099 32.929 1.00 91.92  ? -24  DC  J "O5'" 1 
ATOM   10038 C  "C5'" . DC  J 6 49  ? 11.306  -27.419 32.362 1.00 87.45  ? -24  DC  J "C5'" 1 
ATOM   10039 C  "C4'" . DC  J 6 49  ? 11.509  -28.531 33.393 1.00 84.68  ? -24  DC  J "C4'" 1 
ATOM   10040 O  "O4'" . DC  J 6 49  ? 12.669  -29.306 33.004 1.00 85.15  ? -24  DC  J "O4'" 1 
ATOM   10041 C  "C3'" . DC  J 6 49  ? 11.772  -28.141 34.856 1.00 82.40  ? -24  DC  J "C3'" 1 
ATOM   10042 O  "O3'" . DC  J 6 49  ? 11.398  -29.175 35.765 1.00 77.13  ? -24  DC  J "O3'" 1 
ATOM   10043 C  "C2'" . DC  J 6 49  ? 13.283  -27.992 34.883 1.00 84.14  ? -24  DC  J "C2'" 1 
ATOM   10044 C  "C1'" . DC  J 6 49  ? 13.646  -29.209 34.029 1.00 86.35  ? -24  DC  J "C1'" 1 
ATOM   10045 N  N1    . DC  J 6 49  ? 15.031  -29.198 33.432 1.00 88.22  ? -24  DC  J N1    1 
ATOM   10046 C  C2    . DC  J 6 49  ? 15.508  -30.371 32.814 1.00 89.06  ? -24  DC  J C2    1 
ATOM   10047 O  O2    . DC  J 6 49  ? 14.776  -31.375 32.769 1.00 88.65  ? -24  DC  J O2    1 
ATOM   10048 N  N3    . DC  J 6 49  ? 16.765  -30.364 32.276 1.00 89.40  ? -24  DC  J N3    1 
ATOM   10049 C  C4    . DC  J 6 49  ? 17.523  -29.258 32.347 1.00 89.79  ? -24  DC  J C4    1 
ATOM   10050 N  N4    . DC  J 6 49  ? 18.750  -29.297 31.812 1.00 90.09  ? -24  DC  J N4    1 
ATOM   10051 C  C5    . DC  J 6 49  ? 17.054  -28.056 32.977 1.00 89.76  ? -24  DC  J C5    1 
ATOM   10052 C  C6    . DC  J 6 49  ? 15.819  -28.071 33.502 1.00 88.89  ? -24  DC  J C6    1 
ATOM   10053 P  P     . DC  J 6 50  ? 9.922   -29.251 36.385 1.00 73.77  ? -23  DC  J P     1 
ATOM   10054 O  OP1   . DC  J 6 50  ? 8.945   -29.004 35.303 1.00 73.37  ? -23  DC  J OP1   1 
ATOM   10055 O  OP2   . DC  J 6 50  ? 9.866   -28.470 37.644 1.00 73.47  ? -23  DC  J OP2   1 
ATOM   10056 O  "O5'" . DC  J 6 50  ? 9.798   -30.783 36.784 1.00 72.16  ? -23  DC  J "O5'" 1 
ATOM   10057 C  "C5'" . DC  J 6 50  ? 9.511   -31.738 35.773 1.00 70.99  ? -23  DC  J "C5'" 1 
ATOM   10058 C  "C4'" . DC  J 6 50  ? 10.242  -33.035 36.058 1.00 70.14  ? -23  DC  J "C4'" 1 
ATOM   10059 O  "O4'" . DC  J 6 50  ? 11.611  -32.932 35.595 1.00 70.64  ? -23  DC  J "O4'" 1 
ATOM   10060 C  "C3'" . DC  J 6 50  ? 10.293  -33.387 37.541 1.00 69.48  ? -23  DC  J "C3'" 1 
ATOM   10061 O  "O3'" . DC  J 6 50  ? 9.771   -34.698 37.739 1.00 66.50  ? -23  DC  J "O3'" 1 
ATOM   10062 C  "C2'" . DC  J 6 50  ? 11.770  -33.258 37.930 1.00 70.80  ? -23  DC  J "C2'" 1 
ATOM   10063 C  "C1'" . DC  J 6 50  ? 12.507  -33.356 36.600 1.00 71.84  ? -23  DC  J "C1'" 1 
ATOM   10064 N  N1    . DC  J 6 50  ? 13.764  -32.522 36.512 1.00 74.07  ? -23  DC  J N1    1 
ATOM   10065 C  C2    . DC  J 6 50  ? 14.886  -33.061 35.849 1.00 74.75  ? -23  DC  J C2    1 
ATOM   10066 O  O2    . DC  J 6 50  ? 14.801  -34.198 35.361 1.00 73.60  ? -23  DC  J O2    1 
ATOM   10067 N  N3    . DC  J 6 50  ? 16.030  -32.316 35.763 1.00 75.38  ? -23  DC  J N3    1 
ATOM   10068 C  C4    . DC  J 6 50  ? 16.077  -31.090 36.301 1.00 76.19  ? -23  DC  J C4    1 
ATOM   10069 N  N4    . DC  J 6 50  ? 17.221  -30.407 36.191 1.00 77.62  ? -23  DC  J N4    1 
ATOM   10070 C  C5    . DC  J 6 50  ? 14.954  -30.519 36.985 1.00 75.72  ? -23  DC  J C5    1 
ATOM   10071 C  C6    . DC  J 6 50  ? 13.830  -31.261 37.063 1.00 75.10  ? -23  DC  J C6    1 
ATOM   10072 P  P     . DA  J 6 51  ? 9.547   -35.319 39.195 1.00 64.38  ? -22  DA  J P     1 
ATOM   10073 O  OP1   . DA  J 6 51  ? 8.234   -35.975 39.195 1.00 63.41  ? -22  DA  J OP1   1 
ATOM   10074 O  OP2   . DA  J 6 51  ? 9.876   -34.320 40.240 1.00 65.00  ? -22  DA  J OP2   1 
ATOM   10075 O  "O5'" . DA  J 6 51  ? 10.647  -36.471 39.288 1.00 68.89  ? -22  DA  J "O5'" 1 
ATOM   10076 C  "C5'" . DA  J 6 51  ? 10.945  -37.361 38.201 1.00 74.50  ? -22  DA  J "C5'" 1 
ATOM   10077 C  "C4'" . DA  J 6 51  ? 12.212  -38.167 38.477 1.00 78.57  ? -22  DA  J "C4'" 1 
ATOM   10078 O  "O4'" . DA  J 6 51  ? 13.390  -37.342 38.264 1.00 80.48  ? -22  DA  J "O4'" 1 
ATOM   10079 C  "C3'" . DA  J 6 51  ? 12.354  -38.752 39.880 1.00 80.86  ? -22  DA  J "C3'" 1 
ATOM   10080 O  "O3'" . DA  J 6 51  ? 12.817  -40.097 39.777 1.00 84.25  ? -22  DA  J "O3'" 1 
ATOM   10081 C  "C2'" . DA  J 6 51  ? 13.371  -37.838 40.565 1.00 81.11  ? -22  DA  J "C2'" 1 
ATOM   10082 C  "C1'" . DA  J 6 51  ? 14.227  -37.349 39.404 1.00 81.82  ? -22  DA  J "C1'" 1 
ATOM   10083 N  N9    . DA  J 6 51  ? 14.705  -35.981 39.573 1.00 83.97  ? -22  DA  J N9    1 
ATOM   10084 C  C8    . DA  J 6 51  ? 14.012  -34.937 40.130 1.00 84.80  ? -22  DA  J C8    1 
ATOM   10085 N  N7    . DA  J 6 51  ? 14.675  -33.806 40.153 1.00 85.54  ? -22  DA  J N7    1 
ATOM   10086 C  C5    . DA  J 6 51  ? 15.886  -34.125 39.558 1.00 85.77  ? -22  DA  J C5    1 
ATOM   10087 C  C6    . DA  J 6 51  ? 17.039  -33.354 39.283 1.00 86.78  ? -22  DA  J C6    1 
ATOM   10088 N  N6    . DA  J 6 51  ? 17.147  -32.049 39.583 1.00 87.46  ? -22  DA  J N6    1 
ATOM   10089 N  N1    . DA  J 6 51  ? 18.082  -33.981 38.686 1.00 87.35  ? -22  DA  J N1    1 
ATOM   10090 C  C2    . DA  J 6 51  ? 17.973  -35.288 38.389 1.00 86.90  ? -22  DA  J C2    1 
ATOM   10091 N  N3    . DA  J 6 51  ? 16.941  -36.111 38.600 1.00 85.94  ? -22  DA  J N3    1 
ATOM   10092 C  C4    . DA  J 6 51  ? 15.923  -35.464 39.195 1.00 85.03  ? -22  DA  J C4    1 
ATOM   10093 P  P     . DT  J 6 52  ? 13.142  -41.018 41.059 1.00 87.07  ? -21  DT  J P     1 
ATOM   10094 O  OP1   . DT  J 6 52  ? 13.003  -42.418 40.612 1.00 87.59  ? -21  DT  J OP1   1 
ATOM   10095 O  OP2   . DT  J 6 52  ? 12.321  -40.558 42.203 1.00 85.78  ? -21  DT  J OP2   1 
ATOM   10096 O  "O5'" . DT  J 6 52  ? 14.702  -40.751 41.355 1.00 90.13  ? -21  DT  J "O5'" 1 
ATOM   10097 C  "C5'" . DT  J 6 52  ? 15.700  -40.970 40.350 1.00 94.56  ? -21  DT  J "C5'" 1 
ATOM   10098 C  "C4'" . DT  J 6 52  ? 17.066  -40.497 40.812 1.00 98.21  ? -21  DT  J "C4'" 1 
ATOM   10099 O  "O4'" . DT  J 6 52  ? 17.161  -39.055 40.652 1.00 99.04  ? -21  DT  J "O4'" 1 
ATOM   10100 C  "C3'" . DT  J 6 52  ? 17.360  -40.797 42.280 1.00 100.81 ? -21  DT  J "C3'" 1 
ATOM   10101 O  "O3'" . DT  J 6 52  ? 18.497  -41.660 42.430 1.00 105.01 ? -21  DT  J "O3'" 1 
ATOM   10102 C  "C2'" . DT  J 6 52  ? 17.618  -39.425 42.891 1.00 100.40 ? -21  DT  J "C2'" 1 
ATOM   10103 C  "C1'" . DT  J 6 52  ? 17.967  -38.550 41.690 1.00 99.63  ? -21  DT  J "C1'" 1 
ATOM   10104 N  N1    . DT  J 6 52  ? 17.705  -37.088 41.955 1.00 99.84  ? -21  DT  J N1    1 
ATOM   10105 C  C2    . DT  J 6 52  ? 18.655  -36.123 41.642 1.00 99.95  ? -21  DT  J C2    1 
ATOM   10106 O  O2    . DT  J 6 52  ? 19.732  -36.354 41.119 1.00 99.85  ? -21  DT  J O2    1 
ATOM   10107 N  N3    . DT  J 6 52  ? 18.288  -34.833 41.962 1.00 100.21 ? -21  DT  J N3    1 
ATOM   10108 C  C4    . DT  J 6 52  ? 17.102  -34.415 42.559 1.00 100.63 ? -21  DT  J C4    1 
ATOM   10109 O  O4    . DT  J 6 52  ? 16.870  -33.229 42.798 1.00 100.90 ? -21  DT  J O4    1 
ATOM   10110 C  C5    . DT  J 6 52  ? 16.156  -35.469 42.866 1.00 100.46 ? -21  DT  J C5    1 
ATOM   10111 C  C7    . DT  J 6 52  ? 14.834  -35.155 43.512 1.00 100.00 ? -21  DT  J C7    1 
ATOM   10112 C  C6    . DT  J 6 52  ? 16.504  -36.732 42.554 1.00 100.23 ? -21  DT  J C6    1 
ATOM   10113 P  P     . DC  J 6 53  ? 18.653  -42.645 43.697 1.00 107.95 ? -20  DC  J P     1 
ATOM   10114 O  OP1   . DC  J 6 53  ? 18.901  -44.007 43.188 1.00 107.46 ? -20  DC  J OP1   1 
ATOM   10115 O  OP2   . DC  J 6 53  ? 17.507  -42.439 44.614 1.00 107.67 ? -20  DC  J OP2   1 
ATOM   10116 O  "O5'" . DC  J 6 53  ? 19.992  -42.129 44.407 1.00 110.30 ? -20  DC  J "O5'" 1 
ATOM   10117 C  "C5'" . DC  J 6 53  ? 21.182  -41.934 43.648 1.00 114.41 ? -20  DC  J "C5'" 1 
ATOM   10118 C  "C4'" . DC  J 6 53  ? 21.899  -40.701 44.163 1.00 118.00 ? -20  DC  J "C4'" 1 
ATOM   10119 O  "O4'" . DC  J 6 53  ? 21.092  -39.529 43.874 1.00 118.79 ? -20  DC  J "O4'" 1 
ATOM   10120 C  "C3'" . DC  J 6 53  ? 22.061  -40.65