data_4J8W
# 
_entry.id   4J8W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.330 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4J8W         
NDB   NA2366       
RCSB  RCSB077743   
WWPDB D_1000077743 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4J8U . unspecified 
PDB 4J8V . unspecified 
PDB 4J8X . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4J8W 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adhireksan, Z.' 1 
'Davey, C.A.'    2 
# 
_citation.id                        primary 
_citation.title                     
'Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents' 
_citation.journal_abbrev            'CHEM SCI' 
_citation.journal_volume            4 
_citation.page_first                1837 
_citation.page_last                 1846 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-6520 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      10.1039/C3SC22294B 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Meier, S.M.'     1  ? 
primary 'Hanif, M.'       2  ? 
primary 'Adhireksan, Z.'  3  ? 
primary 'Pichler, V.'     4  ? 
primary 'Novak, M.'       5  ? 
primary 'Jirkovsky, E.'   6  ? 
primary 'Jakupec, M.A.'   7  ? 
primary 'Arion, V.B.'     8  ? 
primary 'Davey, C.A.'     9  ? 
primary 'Keppler, B.K.'   10 ? 
primary 'Hartinger, C.G.' 11 ? 
# 
_cell.entry_id           4J8W 
_cell.length_a           106.780 
_cell.length_b           109.730 
_cell.length_c           181.910 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4J8W 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'                                                                15303.930 2 ? ? ? ? 
2 polymer     man 'Histone H4'                                                                  11263.231 2 ? ? ? ? 
3 polymer     man 'Histone H2A'                                                                 13907.163 2 ? ? ? ? 
4 polymer     man 'Histone H2B 1.1'                                                             13848.097 2 ? ? ? ? 
5 polymer     syn 'DNA (145-MER)'                                                               44749.664 1 ? ? ? ? 
6 polymer     syn 'DNA (145-MER)'                                                               44740.648 1 ? ? ? ? 
7 non-polymer syn 'SULFATE ION'                                                                 96.063    3 ? ? ? ? 
8 non-polymer syn 'chlorido(eta-6-p-cymene)(N-fluorophenyl-2-pyridinecarbothioamide)osmium(II)' 592.178   3 ? ? ? ? 
9 non-polymer syn 'MAGNESIUM ION'                                                               24.305    1 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 LYS n 
3 127 SER n 
3 128 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? 'synthetic construct' ? 32630 ? 
6 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA     P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 ? 
4 UNP H2B11_XENLA  P02281 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 ? 
5 PDB 4J8W         4J8W   5 ? ? ? 
6 PDB 4J8W         4J8W   6 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4J8W A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 4J8W B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 4J8W C 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
4  4 4J8W D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 4J8W E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 4J8W F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 4J8W G 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
8  4 4J8W H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 4J8W I 1 ? 145 ? 4J8W   -72 ? 72  ? -72 72  
10 6 4J8W J 1 ? 145 ? 4J8W   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4J8W ALA A 102 ? UNP P84233 GLY 103 conflict 102 1 
3 4J8W ?   C ?   ? UNP Q6AZJ8 ALA 127 deletion ?   2 
4 4J8W THR D 32  ? UNP P02281 SER 33  conflict 29  3 
5 4J8W ALA E 102 ? UNP P84233 GLY 103 conflict 102 4 
7 4J8W ?   G ?   ? UNP Q6AZJ8 ALA 127 deletion ?   5 
8 4J8W THR H 32  ? UNP P02281 SER 33  conflict 29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MK non-polymer         . 'chlorido(eta-6-p-cymene)(N-fluorophenyl-2-pyridinecarbothioamide)osmium(II)' ? 'C22 H23 Cl F N2 Os S' 
592.178 
ALA 'L-peptide linking' y ALANINE                                                                       ? 'C3 H7 N O2'           
89.093  
ARG 'L-peptide linking' y ARGININE                                                                      ? 'C6 H15 N4 O2 1'       
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                    ? 'C4 H8 N2 O3'          
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                               ? 'C4 H7 N O4'           
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                      ? 'C3 H7 N O2 S'         
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                          ? 'C10 H14 N5 O6 P'      
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                           ? 'C9 H14 N3 O7 P'       
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                          ? 'C10 H14 N5 O7 P'      
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                  ? 'C10 H15 N2 O8 P'      
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                     ? 'C5 H10 N2 O3'         
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                               ? 'C5 H9 N O4'           
147.129 
GLY 'peptide linking'   y GLYCINE                                                                       ? 'C2 H5 N O2'           
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                     ? 'C6 H10 N3 O2 1'       
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                    ? 'C6 H13 N O2'          
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                       ? 'C6 H13 N O2'          
131.173 
LYS 'L-peptide linking' y LYSINE                                                                        ? 'C6 H15 N2 O2 1'       
147.195 
MET 'L-peptide linking' y METHIONINE                                                                    ? 'C5 H11 N O2 S'        
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                               ? 'Mg 2'                 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                 ? 'C9 H11 N O2'          
165.189 
PRO 'L-peptide linking' y PROLINE                                                                       ? 'C5 H9 N O2'           
115.130 
SER 'L-peptide linking' y SERINE                                                                        ? 'C3 H7 N O3'           
105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                 ? 'O4 S -2'              
96.063  
THR 'L-peptide linking' y THREONINE                                                                     ? 'C4 H9 N O3'           
119.119 
TYR 'L-peptide linking' y TYROSINE                                                                      ? 'C9 H11 N O3'          
181.189 
VAL 'L-peptide linking' y VALINE                                                                        ? 'C5 H11 N O2'          
117.146 
# 
_exptl.entry_id          4J8W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.69 
_exptl_crystal.density_percent_sol   54.26 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'40 mM MnCl2, 30 mM KCl, 20 mM K-Cacodylate pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.14 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.14 
# 
_reflns.entry_id                     4J8W 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             93.96 
_reflns.d_resolution_high            2.41 
_reflns.number_obs                   80095 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.41 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4J8W 
_refine.ls_number_reflns_obs                     78440 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             93.96 
_refine.ls_d_res_high                            2.41 
_refine.ls_percent_reflns_obs                    96.23 
_refine.ls_R_factor_obs                          0.26535 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.26514 
_refine.ls_R_factor_R_free                       0.27513 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1587 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.924 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               74.813 
_refine.aniso_B[1][1]                            3.32 
_refine.aniso_B[2][2]                            -2.80 
_refine.aniso_B[3][3]                            -0.53 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.414 
_refine.pdbx_overall_ESU_R_Free                  0.266 
_refine.overall_SU_ML                            0.225 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.609 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         97 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12122 
_refine_hist.d_res_high                       2.41 
_refine_hist.d_res_low                        93.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.009  0.021  ? 12946 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.281  2.548  ? 18788 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       4.825  5.000  ? 757   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       33.022 21.255 ? 271   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       16.418 15.000 ? 1183  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       20.323 15.000 ? 86    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.069  0.200  ? 2125  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.020  ? 7723  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.643  1.500  ? 3797  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.245  2.000  ? 6110  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.289  3.000  ? 9149  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 2.121  4.500  ? 12606 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.410 
_refine_ls_shell.d_res_low                        2.473 
_refine_ls_shell.number_reflns_R_work             4601 
_refine_ls_shell.R_factor_R_work                  0.379 
_refine_ls_shell.percent_reflns_obs               76.67 
_refine_ls_shell.R_factor_R_free                  0.389 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             79 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4J8W 
_struct.title                     
'X-ray structure of NCP145 with chlorido(eta-6-p-cymene)(N-fluorophenyl-2-pyridinecarbothioamide)osmium(II)' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4J8W 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'nucleosomes, histone, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 9 ? 
N N N 7 ? 
O N N 7 ? 
P N N 8 ? 
Q N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 12 ILE C 79  ? ASN C 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 103 ? ALA D 124 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? LYS F 77  ? LEU F 49  LYS F 77  1 ? 29 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 103 ? SER H 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? H HIS 82  NE2 ? ? ? 1_555 Q 1MK .   OS1 ? ? H HIS 79  H 1MK 204  1_555 ? ? ? ? ? ? ?               2.042 ? 
metalc2   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 M MG  .   MG  ? ? E ASP 77  E MG  1001 1_555 ? ? ? ? ? ? ?               2.103 ? 
metalc3   metalc ? ? D HIS 82  NE2 ? ? ? 1_555 L 1MK .   OS1 ? ? D HIS 79  D 1MK 1102 1_555 ? ? ? ? ? ? ?               2.171 ? 
metalc4   metalc ? ? H HIS 109 NE2 ? ? ? 1_555 P 1MK .   OS1 ? ? H HIS 106 H 1MK 203  1_555 ? ? ? ? ? ? ?               2.624 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT  145 N3  ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT  145 O4  ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA  144 N1  ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA  144 N6  ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J DG  143 N1  ? ? I DC  -70 J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J DG  143 O6  ? ? I DC  -70 J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG  143 N2  ? ? I DC  -70 J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT  142 N3  ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J DT  142 O4  ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT  141 N3  ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DA  5   N6  ? ? ? 1_555 J DT  141 O4  ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA  140 N1  ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA  140 N6  ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT  139 N3  ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT  139 O4  ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA  138 N1  ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA  138 N6  ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  137 N1  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  137 O6  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  137 N2  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  136 N1  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG  136 O6  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  136 N2  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT  135 N3  ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J DT  135 O4  ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  12  N3  ? ? ? 1_555 J DG  134 N1  ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DC  12  N4  ? ? ? 1_555 J DG  134 O6  ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG  134 N2  ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DC  13  N3  ? ? ? 1_555 J DG  133 N1  ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DC  13  N4  ? ? ? 1_555 J DG  133 O6  ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG  133 N2  ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA  132 N1  ? ? I DT  -59 J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DT  14  O4  ? ? ? 1_555 J DA  132 N6  ? ? I DT  -59 J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC  131 N3  ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J DC  131 O2  ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J DC  131 N4  ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG  130 N1  ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG  130 O6  ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG  130 N2  ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT  129 N3  ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J DT  129 O4  ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J DC  128 O2  ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog43  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J DT  127 N3  ? ? I DA  -54 J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT  127 O4  ? ? I DA  -54 J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J DA  126 N1  ? ? I DT  -53 J DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J DA  126 N6  ? ? I DT  -53 J DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT  125 N3  ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT  125 O4  ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J DG  124 N1  ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J DG  124 O6  ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG  124 N2  ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J DA  123 N1  ? ? I DT  -50 J DA  50   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog53  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DT  122 N3  ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DT  122 O4  ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG  121 N1  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  121 O6  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  121 N2  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J DG  120 N1  ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J DG  120 O6  ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG  120 N2  ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT  119 N3  ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT  119 O4  ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT  118 N3  ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT  118 O4  ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT  117 N3  ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  117 O4  ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J DT  116 N3  ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J DT  116 O4  ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J DC  115 O2  ? ? I DG  -42 J DC  42   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog70  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J DA  114 N1  ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J DA  114 N6  ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC  113 N3  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J DC  113 O2  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J DC  113 N4  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA  112 N1  ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA  112 N6  ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J DT  111 N3  ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT  111 O4  ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J DA  110 N1  ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J DA  110 N6  ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA  109 N1  ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  109 N6  ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA  108 N1  ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DA  108 N6  ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC  107 N3  ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC  107 O2  ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC  107 N4  ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC  106 N3  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC  106 O2  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J DC  106 N4  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J DT  105 N3  ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J DT  105 O4  ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT  104 N3  ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J DT  104 O4  ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT  103 N3  ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT  103 O4  ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  44  N3  ? ? ? 1_555 J DG  102 N1  ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DC  44  N4  ? ? ? 1_555 J DG  102 O6  ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG  102 N2  ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  101 N1  ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  101 N6  ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DG  46  N1  ? ? ? 1_555 J DC  100 N3  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC  100 O2  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DG  46  O6  ? ? ? 1_555 J DC  100 N4  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG  99  N1  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG  99  O6  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG  99  N2  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA  98  N1  ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DT  48  O4  ? ? ? 1_555 J DA  98  N6  ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG  97  N1  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG  97  O6  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG  97  N2  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DC  50  N3  ? ? ? 1_555 J DG  96  N1  ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  50  N4  ? ? ? 1_555 J DG  96  O6  ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  50  O2  ? ? ? 1_555 J DG  96  N2  ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT  95  N3  ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J DT  95  O4  ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J DA  94  N1  ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DA  94  N6  ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG  93  N1  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG  93  O6  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG  93  N2  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DT  92  N3  ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DT  92  O4  ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J DT  91  N3  ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J DT  91  O4  ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT  90  N3  ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  90  O4  ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J DT  89  N3  ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J DT  89  O4  ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  88  N3  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J DC  88  O2  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J DC  88  N4  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J DC  87  N3  ? ? I DG  -14 J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J DC  87  O2  ? ? I DG  -14 J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J DC  87  N4  ? ? I DG  -14 J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J DG  86  N2  ? ? I DC  -13 J DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog138 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT  85  N3  ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT  85  O4  ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J DA  84  N1  ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J DA  84  N6  ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC  83  N3  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC  83  O2  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC  83  N4  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J DA  82  N1  ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J DA  82  N6  ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J DA  81  N1  ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J DA  81  N6  ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J DG  80  N1  ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J DG  80  O6  ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J DG  80  N2  ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J DT  79  N3  ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J DT  79  O4  ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC  78  N3  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC  78  O2  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC  78  N4  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG  77  N1  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG  77  O6  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG  77  N2  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J DA  76  N1  ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J DA  76  N6  ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J DC  75  N3  ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J DC  75  O2  ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J DC  75  N4  ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT  74  N3  ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT  74  O4  ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT  73  N3  ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT  73  O4  ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA  72  N1  ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA  72  N6  ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG  71  N1  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG  71  O6  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG  71  N2  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J DT  70  N3  ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J DT  70  O4  ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC  69  N3  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J DC  69  O2  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J DC  69  N4  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG  68  N1  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG  68  O6  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG  68  N2  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA  67  N1  ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA  67  N6  ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J DC  66  N3  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC  66  O2  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J DC  66  N4  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J DT  65  N3  ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J DT  65  O4  ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT  64  N3  ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J DT  64  O4  ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  63  N1  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  63  O6  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  63  N2  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J DT  62  N3  ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J DT  62  O4  ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA  61  N1  ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA  61  N6  ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC  60  N3  ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC  60  O2  ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC  60  N4  ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG  59  N1  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG  59  O6  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG  59  N2  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J DG  58  N1  ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J DG  58  O6  ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J DG  58  N2  ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA  57  N1  ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA  57  N6  ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J DA  56  N1  ? ? I DT  17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DT  90  O4  ? ? ? 1_555 J DA  56  N6  ? ? I DT  17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J DA  55  N1  ? ? I DT  18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DT  91  O4  ? ? ? 1_555 J DA  55  N6  ? ? I DT  18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J DA  54  N1  ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J DA  54  N6  ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J DC  53  N3  ? ? I DG  20  J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  93  N2  ? ? ? 1_555 J DC  53  O2  ? ? I DG  20  J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J DC  53  N4  ? ? I DG  20  J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DA  94  N1  ? ? ? 1_555 J DT  52  N3  ? ? I DA  21  J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DA  94  N6  ? ? ? 1_555 J DT  52  O4  ? ? I DA  21  J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DT  95  N3  ? ? ? 1_555 J DA  51  N1  ? ? I DT  22  J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DT  95  O4  ? ? ? 1_555 J DA  51  N6  ? ? I DT  22  J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DG  96  O6  ? ? ? 1_555 J DC  50  N4  ? ? I DG  23  J DC  -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog223 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC  49  N3  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC  49  O2  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC  49  N4  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J DT  48  N3  ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DT  48  O4  ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC  47  N3  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J DC  47  O2  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J DC  47  N4  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DC  100 N3  ? ? ? 1_555 J DG  46  N1  ? ? I DC  27  J DG  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DC  100 N4  ? ? ? 1_555 J DG  46  O6  ? ? I DC  27  J DG  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J DG  46  N2  ? ? I DC  27  J DG  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DA  101 N1  ? ? ? 1_555 J DT  45  N3  ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog235 hydrog ? ? I DG  102 N1  ? ? ? 1_555 J DC  44  N3  ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DC  44  O2  ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DG  102 O6  ? ? ? 1_555 J DC  44  N4  ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA  43  N1  ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DT  103 O4  ? ? ? 1_555 J DA  43  N6  ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA  42  N1  ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DA  42  N6  ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA  41  N1  ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA  41  N6  ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J DG  40  N2  ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog245 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DG  39  N1  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J DG  39  O6  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG  39  N2  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J DT  38  N3  ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT  38  O4  ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT  37  N3  ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT  37  O4  ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT  36  N3  ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT  36  O4  ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA  35  N1  ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DT  111 O4  ? ? ? 1_555 J DA  35  N6  ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT  34  N3  ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT  34  O4  ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG  33  N1  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG  33  O6  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG  33  N2  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DT  32  N3  ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DT  32  O4  ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG  31  N1  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG  31  O6  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG  31  N2  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DA  30  N1  ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J DA  30  N6  ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA  29  N1  ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA  29  N6  ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA  28  N1  ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  28  N6  ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J DA  27  N1  ? ? I DT  46  J DA  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J DA  27  N6  ? ? I DT  46  J DA  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DG  120 O6  ? ? ? 1_555 J DC  25  N4  ? ? I DG  47  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog275 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC  26  O2  ? ? I DG  47  J DC  -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog276 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DA  24  N6  ? ? I DG  48  J DA  -49  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog277 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC  25  O2  ? ? I DG  48  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog278 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT  23  N3  ? ? I DA  50  J DT  -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog279 hydrog ? ? I DG  124 N2  ? ? ? 1_555 J DC  22  O2  ? ? I DG  51  J DC  -51  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog280 hydrog ? ? I DT  125 N3  ? ? ? 1_555 J DA  21  N1  ? ? I DT  52  J DA  -52  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog281 hydrog ? ? I DA  126 N1  ? ? ? 1_555 J DT  20  N3  ? ? I DA  53  J DT  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DA  126 N6  ? ? ? 1_555 J DT  20  O4  ? ? I DA  53  J DT  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA  19  N1  ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J DA  19  N6  ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG  18  N1  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG  18  O6  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG  18  N2  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J DA  17  N1  ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J DA  17  N6  ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC  16  N3  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC  16  O2  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC  16  N4  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG  15  N1  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DG  15  O6  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG  15  N2  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT  14  N3  ? ? I DA  59  J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DA  132 N6  ? ? ? 1_555 J DT  14  O4  ? ? I DA  59  J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J DC  13  N3  ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DG  133 N2  ? ? ? 1_555 J DC  13  O2  ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DG  133 O6  ? ? ? 1_555 J DC  13  N4  ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC  12  N3  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC  12  O2  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC  12  N4  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA  11  N1  ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J DA  11  N6  ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC  10  N3  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC  10  O2  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC  10  N4  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC  9   N3  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC  9   O2  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC  9   N4  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT  8   N3  ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT  8   O4  ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA  7   N1  ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA  7   N6  ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT  6   N3  ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT  6   O4  ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA  5   N1  ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA  5   N6  ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA  4   N1  ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA  4   N6  ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC  3   N3  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC  3   O2  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC  3   N4  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog325 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  2   N3  ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog326 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  2   O4  ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog327 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA  1   N1  ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog328 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA  1   N6  ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 D 1101' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 1MK D 1102' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG E 1001'  
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 H 201'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 202'  
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE 1MK H 203'  
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE 1MK H 204'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 GLY C 44  ? GLY C 44  . ? 1_555 ? 
2  AC1 7 ALA C 45  ? ALA C 45  . ? 1_555 ? 
3  AC1 7 GLY C 46  ? GLY C 46  . ? 1_555 ? 
4  AC1 7 ALA C 47  ? ALA C 47  . ? 1_555 ? 
5  AC1 7 THR D 90  ? THR D 87  . ? 1_555 ? 
6  AC1 7 SER D 91  ? SER D 88  . ? 1_555 ? 
7  AC1 7 ARG D 92  ? ARG D 89  . ? 1_555 ? 
8  AC2 7 MET B 84  ? MET B 84  . ? 1_555 ? 
9  AC2 7 TYR B 88  ? TYR B 88  . ? 1_555 ? 
10 AC2 7 HIS D 82  ? HIS D 79  . ? 1_555 ? 
11 AC2 7 TYR D 83  ? TYR D 80  . ? 1_555 ? 
12 AC2 7 GLY G 37  ? GLY G 37  . ? 1_555 ? 
13 AC2 7 TYR G 39  ? TYR G 39  . ? 1_555 ? 
14 AC2 7 GLU H 71  ? GLU H 68  . ? 1_555 ? 
15 AC3 2 VAL D 48  ? VAL D 45  . ? 3_545 ? 
16 AC3 2 ASP E 77  ? ASP E 77  . ? 1_555 ? 
17 AC4 6 GLY G 44  ? GLY G 44  . ? 1_555 ? 
18 AC4 6 ALA G 45  ? ALA G 45  . ? 1_555 ? 
19 AC4 6 GLY G 46  ? GLY G 46  . ? 1_555 ? 
20 AC4 6 ALA G 47  ? ALA G 47  . ? 1_555 ? 
21 AC4 6 THR H 90  ? THR H 87  . ? 1_555 ? 
22 AC4 6 SER H 91  ? SER H 88  . ? 1_555 ? 
23 AC5 4 HIS H 49  ? HIS H 46  . ? 1_555 ? 
24 AC5 4 PRO H 50  ? PRO H 47  . ? 1_555 ? 
25 AC5 4 ASP H 51  ? ASP H 48  . ? 1_555 ? 
26 AC5 4 THR H 52  ? THR H 49  . ? 1_555 ? 
27 AC6 6 TYR G 57  ? TYR G 57  . ? 1_555 ? 
28 AC6 6 GLU G 61  ? GLU G 61  . ? 1_555 ? 
29 AC6 6 GLU G 92  ? GLU G 92  . ? 1_555 ? 
30 AC6 6 GLU H 105 ? GLU H 102 . ? 1_555 ? 
31 AC6 6 LEU H 106 ? LEU H 103 . ? 1_555 ? 
32 AC6 6 HIS H 109 ? HIS H 106 . ? 1_555 ? 
33 AC7 6 LYS C 36  ? LYS C 36  . ? 1_555 ? 
34 AC7 6 GLY C 37  ? GLY C 37  . ? 1_555 ? 
35 AC7 6 TYR C 39  ? TYR C 39  . ? 1_555 ? 
36 AC7 6 MET F 84  ? MET F 84  . ? 1_555 ? 
37 AC7 6 TYR F 88  ? TYR F 88  . ? 1_555 ? 
38 AC7 6 HIS H 82  ? HIS H 79  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4J8W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4J8W 
_atom_sites.fract_transf_matrix[1][1]   0.009365 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009113 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005497 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
OS 
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1 38  ? -60.857 -29.301 80.766 1.00 82.35  ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1 38  ? -59.776 -28.393 80.370 1.00 82.17  ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1 38  ? -58.481 -29.141 80.009 1.00 81.89  ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1 38  ? -57.907 -29.851 80.849 1.00 81.88  ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1 38  ? -59.590 -27.497 81.606 1.00 82.31  ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1 38  ? -60.115 -28.303 82.769 1.00 82.40  ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1 38  ? -60.996 -29.415 82.231 1.00 82.45  ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1 39  ? -58.037 -28.968 78.764 1.00 81.24  ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1 39  ? -56.958 -29.778 78.191 1.00 80.62  ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1 39  ? -55.826 -28.925 77.628 1.00 79.69  ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1 39  ? -56.067 -27.950 76.905 1.00 79.77  ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1 39  ? -57.508 -30.685 77.087 1.00 81.04  ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1 39  ? -56.514 -31.674 76.568 1.00 82.01  ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1 39  ? -55.671 -31.396 75.509 1.00 82.80  ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1 39  ? -56.221 -32.937 76.966 1.00 83.10  ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1 39  ? -54.908 -32.448 75.273 1.00 83.05  ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1 39  ? -55.222 -33.397 76.142 1.00 83.22  ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1 40  ? -54.592 -29.315 77.944 1.00 78.25  ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1 40  ? -53.427 -28.507 77.587 1.00 76.77  ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1 40  ? -52.208 -29.347 77.188 1.00 75.48  ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1 40  ? -51.745 -30.196 77.960 1.00 75.43  ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1 40  ? -53.078 -27.570 78.744 1.00 76.90  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1 40  ? -52.110 -26.475 78.378 1.00 76.92  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1 40  ? -51.961 -25.496 79.516 1.00 77.03  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1 40  ? -51.016 -24.431 79.188 1.00 77.34  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1 40  ? -51.343 -23.296 78.576 1.00 77.65  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1 40  ? -52.603 -23.063 78.211 1.00 77.70  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1 40  ? -50.406 -22.389 78.329 1.00 76.57  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1 41  ? -51.699 -29.107 75.980 1.00 73.70  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1 41  ? -50.491 -29.785 75.508 1.00 72.01  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1 41  ? -49.249 -29.089 76.068 1.00 70.90  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1 41  ? -49.219 -27.865 76.186 1.00 70.73  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1 41  ? -50.445 -29.850 73.970 1.00 71.83  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1 41  ? -51.395 -30.856 73.338 1.00 70.73  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1 41  ? -52.387 -30.445 72.444 1.00 70.46  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1 41  ? -51.296 -32.217 73.625 1.00 70.78  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1 41  ? -53.260 -31.363 71.853 1.00 69.86  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1 41  ? -52.165 -33.146 73.043 1.00 71.09  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1 41  ? -53.144 -32.709 72.158 1.00 70.54  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1 41  ? -53.996 -33.628 71.583 1.00 70.54  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1 42  ? -48.239 -29.877 76.426 1.00 69.55  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1 42  ? -46.990 -29.354 76.999 1.00 68.50  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1 42  ? -46.132 -28.588 75.981 1.00 67.19  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1 42  ? -46.259 -28.804 74.772 1.00 66.91  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1 42  ? -46.176 -30.493 77.623 1.00 68.71  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1 42  ? -47.030 -31.476 78.392 1.00 70.18  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1 42  ? -46.561 -31.625 79.818 1.00 72.57  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1 42  ? -45.569 -32.684 79.954 1.00 75.50  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1 42  ? -45.211 -33.222 81.118 1.00 77.19  ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1 42  ? -45.765 -32.796 82.247 1.00 78.26  ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1 42  ? -44.299 -34.186 81.156 1.00 78.12  ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1 43  ? -45.261 -27.680 76.469 1.00 66.09  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1 43  ? -44.332 -26.936 75.605 1.00 65.25  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1 43  ? -43.440 -27.863 74.797 1.00 64.23  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1 43  ? -42.730 -28.685 75.378 1.00 64.35  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1 43  ? -43.484 -26.153 76.604 1.00 65.17  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1 43  ? -44.360 -25.986 77.777 1.00 65.65  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1 43  ? -45.151 -27.247 77.872 1.00 65.93  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1 44  ? -43.494 -27.742 73.474 1.00 63.23  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1 44  ? -42.685 -28.586 72.589 1.00 62.18  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1 44  ? -43.472 -29.683 71.898 1.00 61.47  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1 44  ? -43.029 -30.220 70.884 1.00 61.55  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1 45  ? -44.639 -30.014 72.448 1.00 60.72  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1 45  ? -45.507 -31.038 71.881 1.00 59.92  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1 45  ? -46.075 -30.581 70.542 1.00 59.39  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1 45  ? -45.993 -31.305 69.548 1.00 59.49  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1 45  ? -46.644 -31.429 72.868 1.00 60.02  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 45  ? -46.067 -32.050 74.028 1.00 60.75  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 45  ? -47.617 -32.423 72.223 1.00 59.70  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 46  ? -46.639 -29.378 70.519 1.00 58.85  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 46  ? -47.224 -28.822 69.298 1.00 58.44  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 46  ? -46.128 -28.453 68.302 1.00 57.93  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1 46  ? -46.329 -28.566 67.091 1.00 57.96  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 46  ? -48.106 -27.580 69.580 1.00 58.27  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 46  ? -49.026 -27.296 68.395 1.00 58.06  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 46  ? -48.925 -27.793 70.838 1.00 58.61  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1 47  ? -44.977 -28.025 68.824 1.00 57.28  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1 47  ? -43.824 -27.654 67.999 1.00 56.82  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1 47  ? -43.341 -28.847 67.180 1.00 56.48  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1 47  ? -43.168 -28.737 65.965 1.00 56.59  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1 47  ? -42.705 -27.088 68.859 1.00 56.50  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1 48  ? -43.152 -29.983 67.851 1.00 55.99  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1 48  ? -42.860 -31.255 67.195 1.00 55.77  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1 48  ? -43.908 -31.631 66.141 1.00 55.44  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1 48  ? -43.562 -32.028 65.020 1.00 55.35  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1 48  ? -42.738 -32.361 68.248 1.00 55.64  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1 48  ? -41.350 -32.851 68.676 1.00 56.38  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1 48  ? -40.187 -31.941 68.219 1.00 57.43  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1 48  ? -41.317 -33.062 70.184 1.00 56.41  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1 49  ? -45.180 -31.488 66.512 1.00 55.07  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1 49  ? -46.312 -31.742 65.621 1.00 55.00  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1 49  ? -46.218 -30.883 64.357 1.00 54.50  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1 49  ? -46.469 -31.357 63.246 1.00 54.37  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1 49  ? -47.617 -31.459 66.374 1.00 55.25  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1 49  ? -48.873 -31.955 65.700 1.00 56.18  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1 49  ? -49.891 -32.434 66.729 1.00 57.42  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1 49  ? -50.649 -31.342 67.338 1.00 57.92  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1 49  ? -50.892 -31.230 68.644 1.00 58.07  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1 49  ? -50.458 -32.151 69.501 1.00 58.06  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1 49  ? -51.586 -30.197 69.091 1.00 58.07  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1 50  ? -45.832 -29.624 64.547 1.00 54.09  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1 50  ? -45.675 -28.675 63.457 1.00 53.76  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1 50  ? -44.485 -29.011 62.543 1.00 53.40  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1 50  ? -44.621 -28.973 61.310 1.00 53.44  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1 50  ? -45.565 -27.254 64.002 1.00 53.90  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1 50  ? -46.854 -26.714 64.605 1.00 55.05  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1 50  ? -46.743 -25.266 65.050 1.00 57.52  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1 50  ? -45.674 -24.644 64.837 1.00 58.02  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1 50  ? -47.735 -24.741 65.608 1.00 59.12  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1 51  ? -43.338 -29.355 63.133 1.00 52.65  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1 51  ? -42.171 -29.780 62.349 1.00 52.17  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1 51  ? -42.577 -30.898 61.404 1.00 52.10  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1 51  ? -42.287 -30.844 60.213 1.00 51.99  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1 51  ? -40.984 -30.255 63.242 1.00 52.07  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1 51  ? -40.458 -29.102 64.105 1.00 51.88  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1 51  ? -39.869 -30.828 62.389 1.00 51.22  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1 51  ? -39.486 -29.510 65.212 1.00 51.37  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1 52  ? -43.275 -31.896 61.943 1.00 52.35  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1 52  ? -43.750 -33.032 61.159 1.00 52.46  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1 52  ? -44.690 -32.601 60.033 1.00 52.08  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1 52  ? -44.574 -33.083 58.905 1.00 52.07  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1 52  ? -44.406 -34.075 62.071 1.00 52.77  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 52  ? -43.473 -34.582 63.160 1.00 54.80  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 52  ? -43.895 -35.930 63.740 1.00 59.07  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 52  ? -42.729 -36.677 64.222 1.00 61.69  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 52  ? -42.286 -36.681 65.480 1.00 63.59  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 52  ? -42.913 -35.992 66.431 1.00 63.29  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 52  ? -41.207 -37.393 65.791 1.00 65.45  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1 53  ? -45.597 -31.678 60.340 1.00 52.08  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1 53  ? -46.576 -31.201 59.368 1.00 52.51  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1 53  ? -45.891 -30.444 58.240 1.00 51.97  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1 53  ? -46.096 -30.750 57.064 1.00 52.10  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1 53  ? -47.641 -30.314 60.035 1.00 52.86  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1 53  ? -48.680 -29.778 59.067 1.00 55.18  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1 53  ? -49.490 -28.662 59.688 1.00 61.45  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1 53  ? -50.368 -28.017 58.711 1.00 65.88  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1 53  ? -51.026 -26.874 58.919 1.00 68.37  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1 53  ? -50.915 -26.232 60.080 1.00 69.23  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1 53  ? -51.800 -26.368 57.963 1.00 69.43  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1 54  ? -45.069 -29.466 58.599 1.00 51.68  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1 54  ? -44.404 -28.631 57.592 1.00 51.21  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1 54  ? -43.263 -29.309 56.825 1.00 50.76  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1 54  ? -42.918 -28.880 55.722 1.00 50.64  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1 54  ? -43.994 -27.286 58.187 1.00 50.94  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1 54  ? -45.197 -26.473 58.591 1.00 50.28  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1 54  ? -45.447 -26.180 59.928 1.00 50.56  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1 54  ? -46.104 -26.021 57.638 1.00 50.13  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1 54  ? -46.564 -25.440 60.309 1.00 50.62  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1 54  ? -47.223 -25.284 58.007 1.00 50.86  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1 54  ? -47.446 -24.999 59.344 1.00 51.33  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1 54  ? -48.558 -24.274 59.714 1.00 53.59  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1 55  ? -42.705 -30.374 57.391 1.00 50.43  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1 55  ? -41.720 -31.174 56.669 1.00 50.49  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1 55  ? -42.381 -32.122 55.671 1.00 50.77  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1 55  ? -41.734 -32.619 54.748 1.00 50.62  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1 55  ? -40.778 -31.909 57.631 1.00 50.01  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1 55  ? -39.793 -30.955 58.305 1.00 49.59  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1 55  ? -38.649 -31.630 59.052 1.00 49.95  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1 55  ? -38.635 -32.848 59.273 1.00 48.75  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1 55  ? -37.673 -30.822 59.452 1.00 50.38  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1 56  ? -43.676 -32.364 55.854 1.00 51.72  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1 56  ? -44.424 -33.238 54.949 1.00 52.32  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1 56  ? -44.864 -32.496 53.700 1.00 52.16  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1 56  ? -44.905 -33.071 52.614 1.00 52.34  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1 56  ? -45.631 -33.841 55.656 1.00 52.74  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1 56  ? -45.399 -35.252 56.150 1.00 54.93  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1 56  ? -46.416 -35.636 57.216 1.00 58.36  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1 56  ? -45.915 -36.816 58.064 1.00 60.18  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1 56  ? -46.652 -36.907 59.373 1.00 61.19  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1 57  ? -45.172 -31.213 53.862 1.00 52.24  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1 57  ? -45.738 -30.408 52.788 1.00 52.25  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1 57  ? -44.723 -29.505 52.094 1.00 52.65  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1 57  ? -43.575 -29.369 52.535 1.00 52.78  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1 57  ? -46.884 -29.569 53.320 1.00 52.16  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1 57  ? -46.423 -28.663 54.301 1.00 52.11  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1 58  ? -45.176 -28.877 51.007 1.00 53.05  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1 58  ? -44.333 -28.049 50.161 1.00 52.60  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1 58  ? -44.915 -26.658 49.902 1.00 52.60  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1 58  ? -44.309 -25.874 49.169 1.00 52.64  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1 58  ? -44.093 -28.728 48.808 1.00 52.70  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1 58  ? -45.334 -28.818 48.101 1.00 52.67  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1 58  ? -43.524 -30.117 48.990 1.00 52.34  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1 59  ? -46.076 -26.337 50.475 1.00 52.52  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1 59  ? -46.645 -25.005 50.206 1.00 53.04  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1 59  ? -45.808 -23.915 50.841 1.00 52.23  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1 59  ? -45.158 -24.137 51.860 1.00 52.13  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1 59  ? -48.148 -24.828 50.563 1.00 53.13  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1 59  ? -48.773 -25.721 51.616 1.00 56.22  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1 59  ? -48.052 -25.704 52.949 1.00 59.67  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1 59  ? -48.559 -25.056 53.895 1.00 59.60  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1 59  ? -46.990 -26.369 53.047 1.00 61.23  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1 60  ? -45.821 -22.750 50.207 1.00 51.70  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1 60  ? -45.184 -21.566 50.747 1.00 51.37  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1 60  ? -45.834 -21.167 52.060 1.00 51.19  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1 60  ? -47.050 -21.338 52.258 1.00 50.98  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1 60  ? -45.236 -20.412 49.743 1.00 51.61  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1 60  ? -44.616 -20.705 48.369 1.00 52.36  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1 60  ? -44.872 -19.551 47.436 1.00 53.91  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1 60  ? -43.113 -20.989 48.457 1.00 53.46  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1 61  ? -45.011 -20.626 52.949 1.00 50.84  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1 61  ? -45.389 -20.443 54.333 1.00 50.88  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1 61  ? -45.456 -18.974 54.727 1.00 51.23  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1 61  ? -45.784 -18.641 55.872 1.00 51.17  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1 61  ? -44.420 -21.212 55.235 1.00 50.80  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1 61  ? -44.241 -22.699 54.922 1.00 50.41  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1 61  ? -43.072 -23.279 55.701 1.00 49.84  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1 61  ? -45.529 -23.487 55.188 1.00 49.90  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1 62  ? -45.139 -18.104 53.773 1.00 51.81  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1 62  ? -45.320 -16.661 53.921 1.00 52.39  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1 62  ? -46.535 -16.276 53.081 1.00 53.15  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1 62  ? -46.687 -16.783 51.959 1.00 52.94  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1 62  ? -44.063 -15.892 53.443 1.00 52.23  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1 62  ? -42.836 -16.331 54.252 1.00 52.53  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1 62  ? -44.256 -14.377 53.553 1.00 50.89  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1 62  ? -41.510 -15.851 53.670 1.00 53.96  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1 63  ? -47.412 -15.420 53.618 1.00 54.18  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1 63  ? -48.598 -14.981 52.852 1.00 55.50  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1 63  ? -48.085 -14.224 51.627 1.00 55.88  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1 63  ? -47.067 -13.517 51.711 1.00 55.97  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1 63  ? -49.549 -14.096 53.682 1.00 55.73  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1 63  ? -49.895 -14.600 55.094 1.00 57.35  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1 63  ? -50.997 -15.653 55.118 1.00 61.80  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1 63  ? -52.343 -15.117 54.846 1.00 65.60  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1 63  ? -53.052 -14.338 55.671 1.00 67.27  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1 63  ? -52.562 -13.938 56.844 1.00 67.93  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1 63  ? -54.263 -13.932 55.307 1.00 68.71  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1 64  ? -48.754 -14.395 50.491 1.00 56.18  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1 64  ? -48.240 -13.866 49.224 1.00 56.90  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1 64  ? -48.229 -12.338 49.161 1.00 56.98  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1 64  ? -47.247 -11.733 48.723 1.00 57.11  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1 64  ? -49.005 -14.449 48.028 1.00 57.24  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1 64  ? -48.822 -15.952 47.875 1.00 59.54  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1 64  ? -49.386 -16.483 46.569 1.00 62.40  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1 64  ? -49.023 -17.961 46.396 1.00 64.29  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1 64  ? -49.118 -18.395 44.966 1.00 65.65  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1 65  ? -49.316 -11.712 49.600 1.00 57.05  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1 65  ? -49.432 -10.263 49.474 1.00 56.83  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1 65  ? -48.306 -9.516  50.207 1.00 56.22  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1 65  ? -47.585 -8.745  49.576 1.00 56.27  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1 65  ? -50.833 -9.767  49.889 1.00 57.18  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 65  ? -51.114 -8.258  49.831 1.00 57.68  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 65  ? -51.162 -7.756  48.400 1.00 57.83  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 65  ? -52.410 -7.927  50.556 1.00 59.59  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1 66  ? -48.144 -9.746  51.528 1.00 55.65  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1 66  ? -47.086 -9.045  52.256 1.00 55.32  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1 66  ? -45.690 -9.246  51.660 1.00 55.13  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1 66  ? -44.898 -8.298  51.618 1.00 55.20  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1 66  ? -47.149 -9.655  53.663 1.00 55.45  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1 66  ? -48.039 -10.812 53.575 1.00 55.55  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1 66  ? -48.954 -10.581 52.429 1.00 55.58  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1 67  ? -45.396 -10.465 51.202 1.00 54.73  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1 67  ? -44.135 -10.742 50.531 1.00 53.85  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1 67  ? -44.023 -9.907  49.268 1.00 54.00  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1 67  ? -42.973 -9.325  48.990 1.00 53.83  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1 67  ? -43.985 -12.222 50.181 1.00 53.60  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1 67  ? -42.633 -12.562 49.603 1.00 52.19  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1 67  ? -41.552 -12.813 50.437 1.00 51.26  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1 67  ? -42.438 -12.604 48.234 1.00 50.25  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1 67  ? -40.300 -13.110 49.916 1.00 49.93  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1 67  ? -41.194 -12.900 47.707 1.00 50.84  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1 67  ? -40.118 -13.149 48.550 1.00 49.55  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1 68  ? -45.107 -9.847  48.503 1.00 54.06  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1 68  ? -45.114 -9.051  47.280 1.00 54.22  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1 68  ? -44.818 -7.571  47.550 1.00 53.46  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1 68  ? -43.996 -6.968  46.863 1.00 53.44  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1 68  ? -46.426 -9.212  46.522 1.00 54.43  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1 68  ? -46.230 -9.061  45.037 1.00 57.71  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1 68  ? -47.520 -8.867  44.283 1.00 61.84  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1 68  ? -48.386 -8.078  44.693 1.00 63.85  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1 68  ? -47.656 -9.572  43.154 1.00 62.82  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1 69  ? -45.469 -6.994  48.557 1.00 52.70  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1 69  ? -45.178 -5.606  48.933 1.00 52.31  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1 69  ? -43.703 -5.400  49.263 1.00 51.34  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1 69  ? -43.080 -4.483  48.740 1.00 51.16  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1 69  ? -46.035 -5.146  50.116 1.00 52.46  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1 69  ? -47.478 -4.803  49.771 1.00 53.63  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1 69  ? -48.121 -3.969  50.884 1.00 55.36  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1 69  ? -47.980 -4.587  52.202 1.00 54.23  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1 69  ? -48.864 -5.419  52.741 1.00 55.77  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1 69  ? -49.976 -5.737  52.087 1.00 56.75  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1 69  ? -48.637 -5.940  53.943 1.00 56.03  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1 70  ? -43.149 -6.255  50.122 1.00 50.54  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1 70  ? -41.728 -6.169  50.475 1.00 49.98  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1 70  ? -40.844 -6.177  49.232 1.00 49.73  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1 70  ? -39.972 -5.317  49.068 1.00 49.60  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1 70  ? -41.327 -7.308  51.410 1.00 49.98  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 70  ? -39.894 -7.280  51.955 1.00 49.88  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 70  ? -39.591 -6.016  52.777 1.00 49.21  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 70  ? -39.654 -8.514  52.779 1.00 48.64  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1 71  ? -41.102 -7.139  48.350 1.00 49.31  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1 71  ? -40.384 -7.252  47.088 1.00 49.36  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1 71  ? -40.427 -5.947  46.297 1.00 49.37  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1 71  ? -39.402 -5.467  45.813 1.00 49.09  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1 71  ? -40.941 -8.415  46.250 1.00 49.24  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1 71  ? -40.437 -8.347  44.816 1.00 49.50  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1 71  ? -40.549 -9.738  46.885 1.00 48.84  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1 72  ? -41.616 -5.368  46.181 1.00 49.76  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1 72  ? -41.776 -4.127  45.425 1.00 49.98  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1 72  ? -41.062 -2.962  46.110 1.00 49.96  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1 72  ? -40.388 -2.178  45.445 1.00 49.77  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1 72  ? -43.247 -3.830  45.176 1.00 49.62  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1 72  ? -43.871 -4.816  44.223 1.00 50.28  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1 72  ? -45.371 -4.611  44.102 1.00 49.95  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1 72  ? -46.010 -5.699  43.370 1.00 50.48  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1 72  ? -46.024 -5.808  42.042 1.00 51.76  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1 72  ? -45.422 -4.901  41.290 1.00 52.37  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1 72  ? -46.629 -6.839  41.463 1.00 52.30  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1 73  ? -41.179 -2.885  47.435 1.00 50.38  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1 73  ? -40.484 -1.861  48.211 1.00 51.32  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1 73  ? -38.977 -1.886  47.950 1.00 51.39  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1 73  ? -38.388 -0.853  47.622 1.00 51.71  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1 73  ? -40.772 -2.027  49.701 1.00 51.65  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 73  ? -39.944 -1.125  50.627 1.00 54.18  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 73  ? -40.338 -1.275  52.091 1.00 57.57  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 73  ? -41.546 -1.348  52.381 1.00 59.38  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 73  ? -39.443 -1.308  52.960 1.00 59.73  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1 74  ? -38.368 -3.066  48.089 1.00 51.37  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1 74  ? -36.930 -3.242  47.882 1.00 51.16  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1 74  ? -36.522 -2.880  46.447 1.00 51.65  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1 74  ? -35.516 -2.203  46.235 1.00 51.63  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1 74  ? -36.475 -4.671  48.284 1.00 50.93  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 74  ? -36.499 -4.818  49.813 1.00 50.80  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 74  ? -35.086 -4.978  47.753 1.00 50.49  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 74  ? -36.643 -6.247  50.322 1.00 50.80  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1 75  ? -37.327 -3.298  45.474 1.00 52.37  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1 75  ? -37.037 -3.035  44.065 1.00 53.63  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1 75  ? -37.091 -1.543  43.705 1.00 54.82  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1 75  ? -36.318 -1.077  42.856 1.00 54.53  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1 75  ? -37.975 -3.821  43.187 1.00 53.38  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1 76  ? -37.993 -0.811  44.369 1.00 56.14  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1 76  ? -38.166 0.635   44.173 1.00 57.54  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1 76  ? -36.882 1.430   44.417 1.00 57.90  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1 76  ? -36.695 2.481   43.817 1.00 58.29  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1 76  ? -39.311 1.163   45.059 1.00 57.96  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 76  ? -39.728 2.635   44.833 1.00 59.65  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 76  ? -40.675 2.840   43.639 1.00 62.67  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 76  ? -41.329 1.907   43.169 1.00 63.86  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 76  ? -40.753 4.078   43.153 1.00 63.68  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1 77  ? -36.000 0.932   45.284 1.00 58.66  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1 77  ? -34.724 1.609   45.554 1.00 59.12  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1 77  ? -33.726 1.436   44.408 1.00 59.17  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1 77  ? -32.712 2.128   44.358 1.00 59.58  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1 77  ? -34.100 1.111   46.863 1.00 59.48  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1 77  ? -34.793 1.669   48.110 1.00 61.68  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1 77  ? -35.068 0.870   49.039 1.00 63.17  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1 77  ? -35.051 2.902   48.180 1.00 63.69  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1 78  ? -33.997 0.511   43.490 1.00 59.01  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1 78  ? -33.066 0.259   42.390 1.00 58.86  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1 78  ? -33.595 0.852   41.098 1.00 59.21  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1 78  ? -32.829 1.337   40.258 1.00 59.24  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1 78  ? -32.778 -1.248  42.217 1.00 58.65  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1 78  ? -32.193 -1.908  43.444 1.00 57.78  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1 78  ? -32.780 -3.049  43.983 1.00 56.62  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1 78  ? -31.064 -1.381  44.069 1.00 57.33  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1 78  ? -32.253 -3.657  45.126 1.00 56.30  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1 78  ? -30.529 -1.984  45.211 1.00 57.22  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1 78  ? -31.125 -3.122  45.739 1.00 56.54  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1 79  ? -34.911 0.788   40.933 1.00 59.40  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1 79  ? -35.575 1.420   39.803 1.00 59.86  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1 79  ? -37.036 1.680   40.140 1.00 59.92  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1 79  ? -37.700 0.851   40.770 1.00 60.06  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1 79  ? -35.467 0.579   38.533 1.00 59.83  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1 79  ? -35.856 1.354   37.281 1.00 61.03  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1 79  ? -36.000 0.459   36.058 1.00 62.55  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1 79  ? -36.267 1.324   34.820 1.00 64.51  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1 79  ? -36.275 0.488   33.562 1.00 65.73  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1 80  ? -37.529 2.835   39.706 1.00 59.95  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1 80  ? -38.893 3.260   40.011 1.00 59.70  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1 80  ? -39.852 2.815   38.917 1.00 59.51  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1 80  ? -39.440 2.535   37.789 1.00 59.17  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1 80  ? -38.971 4.779   40.170 1.00 59.80  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1 80  ? -38.535 5.402   38.953 1.00 59.79  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1 80  ? -38.078 5.242   41.329 1.00 59.66  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1 81  ? -41.132 2.744   39.275 1.00 59.55  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1 81  ? -42.213 2.345   38.365 1.00 59.51  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1 81  ? -41.966 0.984   37.711 1.00 59.18  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1 81  ? -42.061 0.834   36.490 1.00 59.25  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1 81  ? -42.484 3.436   37.313 1.00 59.76  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1 81  ? -43.869 3.318   36.685 1.00 60.79  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1 81  ? -44.840 2.940   37.390 1.00 61.79  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1 81  ? -43.986 3.608   35.473 1.00 62.49  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1 82  ? -41.637 -0.006  38.536 1.00 58.55  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1 82  ? -41.412 -1.348  38.040 1.00 57.70  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1 82  ? -42.680 -2.148  38.139 1.00 57.17  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1 82  ? -43.459 -1.969  39.065 1.00 57.05  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1 82  ? -40.297 -2.049  38.823 1.00 57.65  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1 82  ? -38.857 -1.821  38.359 1.00 57.27  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1 82  ? -37.920 -2.625  39.224 1.00 56.17  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1 82  ? -38.669 -2.202  36.901 1.00 56.76  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1 83  ? -42.893 -3.015  37.162 1.00 56.88  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1 83  ? -43.933 -4.025  37.265 1.00 56.93  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1 83  ? -43.245 -5.385  37.410 1.00 56.61  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1 83  ? -42.050 -5.536  37.089 1.00 56.39  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1 83  ? -44.869 -4.001  36.049 1.00 57.11  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1 83  ? -45.352 -2.599  35.645 1.00 58.48  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1 83  ? -46.274 -2.654  34.436 1.00 60.68  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1 83  ? -47.674 -2.462  34.814 1.00 63.23  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1 83  ? -48.713 -2.891  34.106 1.00 63.64  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1 83  ? -48.522 -3.561  32.976 1.00 63.62  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1 83  ? -49.948 -2.662  34.540 1.00 65.21  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1 84  ? -43.999 -6.365  37.900 1.00 55.86  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1 84  ? -43.481 -7.704  38.134 1.00 54.94  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1 84  ? -44.371 -8.730  37.460 1.00 54.32  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1 84  ? -45.595 -8.695  37.629 1.00 54.41  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1 84  ? -43.439 -7.991  39.638 1.00 54.99  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 84  ? -42.205 -7.480  40.324 1.00 54.95  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 84  ? -42.119 -6.157  40.751 1.00 55.29  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 84  ? -41.127 -8.332  40.557 1.00 55.37  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 84  ? -40.967 -5.688  41.391 1.00 55.15  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 84  ? -39.975 -7.879  41.197 1.00 54.40  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 84  ? -39.892 -6.560  41.612 1.00 54.84  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1 85  ? -43.774 -9.645  36.699 1.00 53.37  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1 85  ? -44.512 -10.825 36.272 1.00 52.60  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1 85  ? -44.902 -11.583 37.526 1.00 52.38  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1 85  ? -44.151 -11.596 38.501 1.00 52.27  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1 85  ? -43.690 -11.721 35.355 1.00 52.53  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 85  ? -43.649 -11.242 33.927 1.00 51.59  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 85  ? -42.950 -12.205 32.991 1.00 50.88  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 85  ? -42.288 -13.158 33.418 1.00 51.41  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 85  ? -43.086 -11.952 31.696 1.00 49.54  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1 86  ? -46.098 -12.170 37.513 1.00 51.95  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1 86  ? -46.593 -12.972 38.627 1.00 51.30  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1 86  ? -45.598 -14.071 39.006 1.00 50.67  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1 86  ? -45.356 -14.330 40.185 1.00 50.41  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1 86  ? -47.926 -13.616 38.254 1.00 51.38  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1 86  ? -48.358 -14.483 39.287 1.00 52.42  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1 87  ? -45.029 -14.704 37.990 1.00 50.05  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1 87  ? -44.119 -15.819 38.177 1.00 50.08  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1 87  ? -42.758 -15.336 38.691 1.00 49.90  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1 87  ? -42.040 -16.088 39.352 1.00 49.48  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1 87  ? -43.945 -16.581 36.871 1.00 49.85  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1 87  ? -43.348 -15.735 35.910 1.00 50.71  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1 88  ? -42.424 -14.080 38.389 1.00 49.65  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1 88  ? -41.227 -13.430 38.940 1.00 49.14  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1 88  ? -41.273 -13.355 40.456 1.00 48.98  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1 88  ? -40.276 -13.648 41.122 1.00 49.20  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1 88  ? -41.038 -12.036 38.347 1.00 48.72  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1 89  ? -42.425 -12.964 41.000 1.00 48.87  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1 89  ? -42.589 -12.842 42.451 1.00 48.98  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1 89  ? -42.536 -14.233 43.084 1.00 49.25  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1 89  ? -41.900 -14.429 44.121 1.00 49.33  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1 89  ? -43.905 -12.105 42.842 1.00 48.68  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1 89  ? -44.045 -12.002 44.356 1.00 48.21  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1 89  ? -43.961 -10.709 42.222 1.00 48.57  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1 90  ? -43.194 -15.188 42.428 1.00 49.58  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1 90  ? -43.210 -16.587 42.851 1.00 49.92  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1 90  ? -41.797 -17.163 42.934 1.00 48.85  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1 90  ? -41.392 -17.685 43.969 1.00 48.97  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1 90  ? -44.078 -17.427 41.904 1.00 50.53  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1 90  ? -45.573 -17.176 42.043 1.00 54.21  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1 90  ? -46.083 -17.188 43.770 1.00 64.17  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1 90  ? -46.036 -18.955 44.090 1.00 63.17  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1 91  ? -41.051 -17.058 41.840 1.00 47.79  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1 91  ? -39.654 -17.453 41.823 1.00 46.56  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1 91  ? -38.911 -16.860 43.040 1.00 46.27  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1 91  ? -38.236 -17.601 43.769 1.00 46.12  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1 91  ? -39.005 -17.043 40.519 1.00 46.03  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1 92  ? -39.078 -15.556 43.297 1.00 45.03  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1 92  ? -38.422 -14.937 44.454 1.00 44.22  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1 92  ? -38.858 -15.559 45.769 1.00 44.07  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1 92  ? -38.031 -15.763 46.656 1.00 44.29  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1 92  ? -38.633 -13.415 44.500 1.00 43.77  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1 92  ? -37.761 -12.576 43.560 1.00 43.19  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1 92  ? -38.383 -11.201 43.290 1.00 42.63  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1 92  ? -36.330 -12.456 44.077 1.00 41.79  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1 93  ? -40.150 -15.862 45.899 1.00 43.55  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1 93  ? -40.642 -16.432 47.138 1.00 43.45  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1 93  ? -40.079 -17.839 47.368 1.00 43.24  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1 93  ? -39.598 -18.148 48.461 1.00 43.02  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1 93  ? -42.175 -16.416 47.212 1.00 43.16  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1 93  ? -42.669 -16.295 48.657 1.00 43.74  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1 93  ? -44.187 -16.302 48.796 1.00 44.43  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1 93  ? -44.904 -15.776 47.946 1.00 46.71  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1 93  ? -44.679 -16.886 49.879 1.00 43.08  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1 94  ? -40.134 -18.673 46.332 1.00 42.74  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1 94  ? -39.612 -20.020 46.415 1.00 42.34  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1 94  ? -38.147 -19.981 46.826 1.00 41.90  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1 94  ? -37.737 -20.731 47.715 1.00 41.59  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1 94  ? -39.763 -20.757 45.089 1.00 42.42  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1 94  ? -41.206 -21.048 44.668 1.00 44.44  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1 94  ? -41.805 -22.269 45.350 1.00 47.38  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1 94  ? -43.058 -22.361 45.393 1.00 48.67  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1 94  ? -41.033 -23.135 45.838 1.00 47.36  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1 95  ? -37.367 -19.096 46.203 1.00 41.23  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1 95  ? -35.941 -19.029 46.479 1.00 40.65  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1 95  ? -35.706 -18.508 47.891 1.00 40.86  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1 95  ? -34.864 -19.058 48.621 1.00 41.22  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1 95  ? -35.204 -18.195 45.444 1.00 39.97  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1 96  ? -36.483 -17.506 48.301 1.00 40.37  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1 96  ? -36.313 -16.915 49.628 1.00 40.38  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1 96  ? -36.690 -17.879 50.744 1.00 40.48  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1 96  ? -35.983 -17.967 51.758 1.00 41.05  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1 96  ? -37.097 -15.606 49.767 1.00 40.40  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1 96  ? -36.721 -14.687 48.757 1.00 39.98  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1 97  ? -37.793 -18.600 50.561 1.00 39.88  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1 97  ? -38.204 -19.625 51.527 1.00 39.46  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1 97  ? -37.249 -20.830 51.597 1.00 38.53  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1 97  ? -36.945 -21.308 52.685 1.00 38.62  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1 97  ? -39.655 -20.061 51.292 1.00 39.41  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1 97  ? -40.651 -18.918 51.536 1.00 41.93  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1 97  ? -42.091 -19.383 51.730 1.00 43.27  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1 97  ? -42.311 -20.564 52.077 1.00 43.27  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1 97  ? -43.001 -18.550 51.551 1.00 44.09  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1 98  ? -36.764 -21.310 50.454 1.00 37.45  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1 98  ? -35.766 -22.383 50.456 1.00 36.58  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1 98  ? -34.500 -21.932 51.207 1.00 36.40  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1 98  ? -33.962 -22.668 52.023 1.00 36.15  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1 98  ? -35.435 -22.794 49.057 1.00 36.54  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1 99  ? -34.062 -20.697 50.953 1.00 36.20  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1 99  ? -32.925 -20.125 51.638 1.00 35.37  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1 99  ? -33.153 -20.067 53.135 1.00 35.75  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1 99  ? -32.292 -20.498 53.908 1.00 36.71  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1 99  ? -32.596 -18.742 51.079 1.00 35.53  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1 99  ? -31.608 -17.953 51.913 1.00 34.85  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1 99  ? -30.217 -18.145 51.773 1.00 34.75  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1 99  ? -32.052 -17.027 52.841 1.00 33.55  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1 99  ? -29.307 -17.426 52.541 1.00 32.53  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1 99  ? -31.152 -16.306 53.615 1.00 33.92  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1 99  ? -29.783 -16.507 53.454 1.00 33.69  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1 99  ? -28.906 -15.781 54.230 1.00 35.71  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1 100 ? -34.302 -19.554 53.571 1.00 35.46  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1 100 ? -34.488 -19.379 55.007 1.00 35.35  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1 100 ? -34.625 -20.710 55.719 1.00 35.15  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1 100 ? -34.097 -20.877 56.825 1.00 35.59  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1 100 ? -35.662 -18.456 55.327 1.00 35.47  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 100 ? -35.490 -16.962 55.012 1.00 36.31  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 100 ? -36.838 -16.261 55.113 1.00 36.81  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 100 ? -34.452 -16.262 55.909 1.00 33.02  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1 101 ? -35.306 -21.659 55.075 1.00 34.88  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1 101 ? -35.472 -23.009 55.624 1.00 35.07  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1 101 ? -34.107 -23.665 55.850 1.00 34.86  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1 101 ? -33.851 -24.185 56.933 1.00 34.93  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1 101 ? -36.356 -23.919 54.722 1.00 35.49  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1 101 ? -36.207 -25.393 55.123 1.00 35.65  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1 101 ? -37.831 -23.502 54.791 1.00 34.84  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1 102 ? -33.227 -23.615 54.847 1.00 34.55  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1 102 ? -31.900 -24.212 54.994 1.00 34.24  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1 102 ? -31.070 -23.482 56.059 1.00 34.49  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1 102 ? -30.333 -24.114 56.822 1.00 35.22  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1 102 ? -31.187 -24.284 53.677 1.00 33.20  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1 103 ? -31.224 -22.166 56.151 1.00 34.77  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1 103 ? -30.495 -21.396 57.154 1.00 35.09  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1 103 ? -30.928 -21.768 58.571 1.00 35.37  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1 103 ? -30.097 -21.855 59.477 1.00 35.11  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1 103 ? -30.640 -19.886 56.906 1.00 34.94  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1 103 ? -29.961 -18.946 57.903 1.00 34.37  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1 103 ? -28.466 -19.151 57.870 1.00 33.62  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1 103 ? -30.308 -17.470 57.613 1.00 34.95  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1 104 ? -32.229 -21.989 58.759 1.00 35.97  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1 104 ? -32.724 -22.500 60.035 1.00 36.58  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1 104 ? -32.153 -23.872 60.394 1.00 37.28  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1 104 ? -31.928 -24.144 61.572 1.00 37.37  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1 104 ? -34.259 -22.540 60.076 1.00 37.08  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1 104 ? -34.900 -21.194 60.299 1.00 36.33  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1 104 ? -35.742 -20.643 59.345 1.00 34.73  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1 104 ? -34.651 -20.479 61.466 1.00 36.63  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1 104 ? -36.328 -19.399 59.552 1.00 34.47  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1 104 ? -35.223 -19.242 61.672 1.00 37.10  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1 104 ? -36.070 -18.703 60.717 1.00 36.02  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1 105 ? -31.913 -24.732 59.399 1.00 37.68  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1 105 ? -31.272 -26.022 59.671 1.00 38.79  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1 105 ? -29.866 -25.798 60.231 1.00 38.71  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1 105 ? -29.535 -26.328 61.282 1.00 39.57  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1 105 ? -31.222 -26.939 58.431 1.00 38.94  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1 105 ? -32.563 -27.318 57.849 1.00 41.21  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1 105 ? -32.470 -27.873 56.426 1.00 45.89  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1 105 ? -31.371 -28.338 56.057 1.00 50.30  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1 105 ? -33.487 -27.863 55.671 1.00 45.51  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1 106 ? -29.049 -25.003 59.542 1.00 38.83  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1 106 ? -27.708 -24.664 60.037 1.00 38.64  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1 106 ? -27.781 -23.992 61.400 1.00 38.35  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1 106 ? -26.977 -24.286 62.292 1.00 38.45  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1 106 ? -26.986 -23.745 59.053 1.00 38.98  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1 106 ? -26.726 -24.410 57.717 1.00 40.45  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1 106 ? -27.112 -25.585 57.571 1.00 43.73  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1 106 ? -26.139 -23.768 56.807 1.00 42.55  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1 107 ? -28.758 -23.099 61.565 1.00 37.58  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1 107 ? -28.884 -22.326 62.796 1.00 37.02  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1 107 ? -29.127 -23.293 63.945 1.00 36.91  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1 107 ? -28.512 -23.191 65.027 1.00 36.73  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1 107 ? -30.018 -21.279 62.678 1.00 37.30  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1 107 ? -29.689 -20.350 61.647 1.00 35.74  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 107 ? -30.235 -20.524 63.961 1.00 36.58  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1 108 ? -30.010 -24.250 63.685 1.00 36.55  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1 108 ? -30.349 -25.277 64.645 1.00 35.91  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1 108 ? -29.158 -26.146 65.021 1.00 35.47  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1 108 ? -28.972 -26.460 66.195 1.00 34.93  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1 108 ? -31.488 -26.138 64.107 1.00 36.53  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1 108 ? -32.360 -26.679 65.202 1.00 37.32  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1 108 ? -32.573 -26.020 66.221 1.00 40.70  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1 108 ? -32.870 -27.878 65.011 1.00 37.14  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1 109 ? -28.346 -26.533 64.039 1.00 35.29  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1 109 ? -27.099 -27.230 64.360 1.00 35.56  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1 109 ? -26.210 -26.359 65.258 1.00 35.50  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1 109 ? -25.608 -26.850 66.213 1.00 36.27  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1 109 ? -26.364 -27.681 63.093 1.00 35.35  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 109 ? -27.151 -28.662 62.210 1.00 35.73  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 109 ? -26.506 -28.831 60.852 1.00 35.37  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 109 ? -27.333 -30.037 62.892 1.00 34.56  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1 110 ? -26.158 -25.063 64.975 1.00 35.57  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1 110 ? -25.366 -24.140 65.795 1.00 36.07  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1 110 ? -25.862 -24.018 67.243 1.00 36.09  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1 110 ? -25.053 -24.005 68.176 1.00 35.95  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1 110 ? -25.255 -22.771 65.122 1.00 36.06  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1 110 ? -24.257 -22.828 63.635 1.00 36.58  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1 111 ? -27.182 -23.972 67.434 1.00 36.32  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1 111 ? -27.749 -24.017 68.791 1.00 36.39  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1 111 ? -27.424 -25.317 69.520 1.00 36.84  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1 111 ? -26.967 -25.297 70.676 1.00 37.32  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1 111 ? -29.245 -23.772 68.778 1.00 36.22  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1 112 ? -27.647 -26.444 68.848 1.00 37.08  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1 112 ? -27.349 -27.753 69.419 1.00 37.49  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1 112 ? -25.859 -27.928 69.754 1.00 38.19  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1 112 ? -25.525 -28.533 70.782 1.00 38.51  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1 112 ? -27.859 -28.905 68.505 1.00 37.74  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1 112 ? -29.389 -28.958 68.524 1.00 37.03  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1 112 ? -27.318 -30.268 68.958 1.00 37.82  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1 112 ? -29.982 -29.549 67.284 1.00 35.58  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1 113 ? -24.971 -27.396 68.905 1.00 38.63  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1 113 ? -23.534 -27.432 69.178 1.00 38.78  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1 113 ? -23.249 -26.810 70.530 1.00 39.06  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1 113 ? -22.447 -27.330 71.284 1.00 39.91  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1 113 ? -22.751 -26.706 68.078 1.00 38.52  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1 113 ? -21.258 -26.806 68.215 1.00 38.18  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1 113 ? -20.558 -27.965 67.949 1.00 36.10  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1 113 ? -20.331 -25.877 68.555 1.00 37.51  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1 113 ? -19.268 -27.745 68.125 1.00 36.41  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1 113 ? -19.104 -26.487 68.496 1.00 34.68  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1 114 ? -23.918 -25.703 70.837 1.00 39.60  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1 114 ? -23.742 -25.023 72.121 1.00 40.18  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1 114 ? -24.627 -25.610 73.232 1.00 41.10  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1 114 ? -24.773 -25.013 74.300 1.00 41.52  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1 114 ? -23.982 -23.534 71.962 1.00 39.65  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1 115 ? -25.205 -26.783 72.968 1.00 42.32  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1 115 ? -25.926 -27.589 73.965 1.00 43.14  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1 115 ? -27.240 -26.947 74.402 1.00 42.90  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1 115 ? -27.688 -27.105 75.540 1.00 43.17  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1 115 ? -25.020 -27.949 75.159 1.00 43.56  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1 115 ? -23.721 -28.663 74.743 1.00 45.32  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1 115 ? -22.974 -29.182 75.947 1.00 50.21  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1 115 ? -21.664 -29.853 75.538 1.00 53.35  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1 115 ? -20.867 -30.251 76.742 1.00 55.38  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1 116 ? -27.848 -26.227 73.468 1.00 42.58  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1 116 ? -29.161 -25.636 73.656 1.00 42.09  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1 116 ? -30.134 -26.296 72.687 1.00 42.05  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1 116 ? -29.729 -27.004 71.765 1.00 41.72  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1 116 ? -29.114 -24.123 73.388 1.00 41.90  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1 116 ? -28.355 -23.289 74.440 1.00 41.14  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1 116 ? -28.384 -21.797 74.109 1.00 39.45  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1 116 ? -27.364 -21.401 73.128 1.00 38.60  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1 116 ? -27.579 -21.226 71.824 1.00 37.77  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1 116 ? -28.783 -21.406 71.312 1.00 37.62  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1 116 ? -26.588 -20.857 71.021 1.00 37.93  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1 117 ? -31.419 -26.040 72.892 1.00 41.80  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1 117 ? -32.448 -26.485 71.970 1.00 41.75  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1 117 ? -33.210 -25.262 71.441 1.00 42.13  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1 117 ? -34.190 -25.382 70.700 1.00 41.91  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1 117 ? -33.413 -27.507 72.651 1.00 41.86  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1 117 ? -32.723 -28.862 72.879 1.00 40.77  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1 117 ? -33.945 -26.951 73.962 1.00 40.85  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1 118 ? -32.741 -24.076 71.823 1.00 42.45  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1 118 ? -33.414 -22.830 71.458 1.00 42.57  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1 118 ? -32.542 -22.031 70.518 1.00 42.22  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1 118 ? -31.444 -21.655 70.894 1.00 42.05  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1 118 ? -33.663 -21.963 72.699 1.00 42.40  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1 118 ? -34.267 -22.763 73.720 1.00 43.57  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1 118 ? -34.554 -20.778 72.367 1.00 43.28  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1 119 ? -33.031 -21.753 69.307 1.00 42.18  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1 119 ? -32.255 -20.921 68.379 1.00 41.75  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1 119 ? -32.249 -19.437 68.768 1.00 42.03  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1 119 ? -33.279 -18.862 69.161 1.00 41.98  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1 119 ? -32.654 -21.103 66.893 1.00 41.44  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 119 ? -34.070 -20.588 66.635 1.00 40.52  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 119 ? -32.446 -22.542 66.473 1.00 40.74  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 119 ? -34.394 -20.401 65.165 1.00 40.83  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1 120 ? -31.072 -18.840 68.633 1.00 41.68  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1 120 ? -30.826 -17.468 69.009 1.00 41.85  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1 120 ? -30.130 -16.766 67.853 1.00 41.79  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1 120 ? -29.558 -17.428 66.989 1.00 41.60  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1 120 ? -29.950 -17.418 70.265 1.00 41.94  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1 120 ? -30.700 -17.775 71.521 1.00 43.29  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1 120 ? -29.658 -18.068 72.947 1.00 45.42  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1 120 ? -30.854 -18.822 74.058 1.00 45.29  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1 121 ? -30.187 -15.422 67.826 1.00 41.57  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1 121 ? -29.540 -14.661 66.775 1.00 41.37  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1 121 ? -28.069 -15.012 66.608 1.00 41.25  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1 121 ? -27.561 -15.006 65.478 1.00 41.38  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1 121 ? -29.697 -13.213 67.249 1.00 41.55  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1 121 ? -30.991 -13.228 67.983 1.00 41.58  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1 121 ? -30.988 -14.549 68.711 1.00 41.88  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1 122 ? -27.380 -15.328 67.702 1.00 40.80  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1 122 ? -25.960 -15.660 67.573 1.00 40.16  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1 122 ? -25.762 -16.946 66.767 1.00 39.60  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1 122 ? -24.744 -17.104 66.085 1.00 39.79  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1 122 ? -25.239 -15.707 68.922 1.00 39.84  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1 122 ? -25.743 -16.746 69.886 1.00 41.57  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1 122 ? -24.946 -16.694 71.161 1.00 45.21  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1 122 ? -25.845 -16.943 72.354 1.00 47.91  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1 122 ? -25.127 -16.620 73.614 1.00 49.98  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1 123 ? -26.739 -17.850 66.831 1.00 38.87  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1 123 ? -26.707 -19.075 66.018 1.00 38.18  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1 123 ? -26.841 -18.747 64.536 1.00 37.72  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1 123 ? -26.065 -19.245 63.736 1.00 38.03  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1 123 ? -27.791 -20.061 66.456 1.00 38.17  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1 123 ? -27.684 -20.433 67.920 1.00 38.00  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1 123 ? -26.584 -20.814 68.354 1.00 38.09  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1 123 ? -28.698 -20.371 68.643 1.00 39.44  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1 124 ? -27.797 -17.888 64.172 1.00 37.28  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1 124 ? -27.924 -17.424 62.786 1.00 36.88  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1 124 ? -26.634 -16.731 62.365 1.00 36.80  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1 124 ? -26.154 -16.931 61.259 1.00 36.49  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1 124 ? -29.132 -16.449 62.577 1.00 37.27  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1 124 ? -30.470 -17.154 62.789 1.00 37.55  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1 124 ? -29.149 -15.855 61.165 1.00 36.68  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1 124 ? -31.657 -16.191 62.848 1.00 39.40  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1 125 ? -26.079 -15.920 63.258 1.00 37.21  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1 125 ? -24.864 -15.143 62.982 1.00 37.62  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1 125 ? -23.692 -16.060 62.657 1.00 36.83  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1 125 ? -23.058 -15.901 61.628 1.00 36.84  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1 125 ? -24.547 -14.203 64.157 1.00 37.94  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 125 ? -25.337 -12.897 64.112 1.00 39.91  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 125 ? -25.548 -12.249 65.481 1.00 44.88  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 125 ? -24.726 -12.395 66.399 1.00 47.71  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 125 ? -26.655 -11.512 65.617 1.00 43.69  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1 126 ? -23.461 -17.055 63.504 1.00 36.52  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1 126 ? -22.410 -18.039 63.273 1.00 36.54  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1 126 ? -22.610 -18.786 61.957 1.00 36.39  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1 126 ? -21.663 -18.937 61.169 1.00 36.49  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1 126 ? -22.341 -19.043 64.422 1.00 36.39  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 126 ? -21.195 -20.044 64.306 1.00 37.04  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 126 ? -19.812 -19.357 64.548 1.00 36.69  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 126 ? -21.433 -21.200 65.266 1.00 36.52  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1 127 ? -23.829 -19.257 61.720 1.00 36.03  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1 127 ? -24.115 -19.975 60.484 1.00 36.42  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1 127 ? -23.748 -19.133 59.262 1.00 36.68  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1 127 ? -23.070 -19.618 58.350 1.00 36.82  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1 127 ? -25.552 -20.404 60.437 1.00 36.53  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1 128 ? -24.145 -17.859 59.264 1.00 36.96  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1 128 ? -23.841 -16.968 58.142 1.00 37.14  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1 128 ? -22.359 -16.672 57.995 1.00 37.10  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1 128 ? -21.861 -16.608 56.885 1.00 37.01  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1 128 ? -24.673 -15.683 58.205 1.00 37.12  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1 128 ? -26.162 -15.962 57.998 1.00 37.62  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1 128 ? -27.008 -14.696 57.907 1.00 38.17  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1 128 ? -26.782 -13.970 56.659 1.00 38.80  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1 128 ? -26.353 -12.712 56.609 1.00 37.52  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1 128 ? -26.127 -12.048 57.729 1.00 37.33  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1 128 ? -26.155 -12.117 55.446 1.00 37.43  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1 129 ? -21.663 -16.480 59.107 1.00 37.59  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1 129 ? -20.230 -16.232 59.064 1.00 38.53  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1 129 ? -19.515 -17.435 58.428 1.00 38.96  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1 129 ? -18.743 -17.285 57.488 1.00 38.55  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1 129 ? -19.712 -15.833 60.463 1.00 38.82  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1 129 ? -18.204 -15.954 60.708 1.00 40.51  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1 129 ? -17.326 -15.215 59.694 1.00 43.20  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1 129 ? -15.919 -15.594 59.864 1.00 44.60  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1 129 ? -15.353 -16.664 59.293 1.00 46.29  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1 129 ? -16.067 -17.460 58.491 1.00 44.35  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1 129 ? -14.068 -16.941 59.517 1.00 44.41  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1 130 ? -19.846 -18.637 58.884 1.00 39.99  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1 130 ? -19.212 -19.845 58.360 1.00 40.88  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1 130 ? -19.556 -20.116 56.893 1.00 42.26  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1 130 ? -18.679 -20.499 56.106 1.00 42.52  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1 130 ? -19.475 -21.046 59.275 1.00 40.82  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1 130 ? -18.743 -20.815 60.586 1.00 40.25  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1 130 ? -19.008 -22.359 58.637 1.00 39.74  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1 130 ? -19.186 -21.706 61.666 1.00 43.91  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1 131 ? -20.815 -19.889 56.522 1.00 43.70  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1 131 ? -21.234 -19.950 55.118 1.00 45.04  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1 131 ? -20.480 -18.978 54.210 1.00 46.52  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1 131 ? -20.448 -19.165 53.003 1.00 46.50  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1 131 ? -22.727 -19.671 54.989 1.00 44.88  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1 131 ? -23.639 -20.853 55.231 1.00 43.61  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1 131 ? -25.023 -20.308 55.400 1.00 44.29  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1 131 ? -26.049 -21.338 55.415 1.00 43.61  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1 131 ? -27.176 -21.263 54.724 1.00 41.43  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1 131 ? -27.405 -20.202 53.958 1.00 39.56  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1 131 ? -28.060 -22.256 54.795 1.00 42.09  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1 132 ? -19.895 -17.933 54.789 1.00 48.52  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1 132 ? -19.176 -16.936 54.008 1.00 51.03  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1 132 ? -20.058 -15.780 53.576 1.00 52.68  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1 132 ? -19.722 -15.047 52.646 1.00 53.02  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1 133 ? -21.186 -15.608 54.255 1.00 54.18  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1 133 ? -22.109 -14.519 53.941 1.00 55.90  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1 133 ? -21.763 -13.256 54.735 1.00 57.48  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1 133 ? -22.238 -12.166 54.415 1.00 57.66  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1 133 ? -23.570 -14.948 54.168 1.00 55.37  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1 133 ? -24.060 -16.015 53.182 1.00 54.72  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1 133 ? -25.450 -16.589 53.506 1.00 54.07  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1 133 ? -26.284 -15.898 54.125 1.00 53.19  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1 133 ? -25.712 -17.745 53.120 1.00 54.44  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1 134 ? -20.925 -13.407 55.763 1.00 59.50  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1 134 ? -20.470 -12.262 56.563 1.00 61.11  ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1 134 ? -19.048 -11.838 56.156 1.00 61.59  ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A 1 134 ? -18.114 -11.822 56.972 1.00 62.36  ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1 134 ? -20.568 -12.548 58.078 1.00 61.61  ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1 134 ? -21.958 -13.011 58.566 1.00 63.27  ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1 134 ? -22.396 -12.302 59.845 1.00 67.44  ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1 134 ? -22.694 -10.881 59.588 1.00 71.42  ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1 134 ? -23.350 -10.065 60.422 1.00 72.55  ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1 134 ? -23.806 -10.510 61.593 1.00 72.79  ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1 134 ? -23.553 -8.794  60.081 1.00 72.10  ? 134  ARG A NH2   1 
ATOM   803   N  N     . VAL B 2 21  ? -54.034 2.109   60.650 1.00 85.27  ? 21   VAL B N     1 
ATOM   804   C  CA    . VAL B 2 21  ? -53.222 1.050   61.324 1.00 85.32  ? 21   VAL B CA    1 
ATOM   805   C  C     . VAL B 2 21  ? -51.960 0.745   60.492 1.00 85.13  ? 21   VAL B C     1 
ATOM   806   O  O     . VAL B 2 21  ? -51.731 -0.405  60.089 1.00 85.17  ? 21   VAL B O     1 
ATOM   807   C  CB    . VAL B 2 21  ? -54.045 -0.262  61.571 1.00 85.41  ? 21   VAL B CB    1 
ATOM   808   C  CG1   . VAL B 2 21  ? -53.525 -0.991  62.814 1.00 85.50  ? 21   VAL B CG1   1 
ATOM   809   C  CG2   . VAL B 2 21  ? -55.553 0.024   61.711 1.00 85.64  ? 21   VAL B CG2   1 
ATOM   810   N  N     . LEU B 2 22  ? -51.147 1.776   60.245 1.00 84.71  ? 22   LEU B N     1 
ATOM   811   C  CA    . LEU B 2 22  ? -49.963 1.651   59.379 1.00 84.31  ? 22   LEU B CA    1 
ATOM   812   C  C     . LEU B 2 22  ? -48.916 0.660   59.897 1.00 83.61  ? 22   LEU B C     1 
ATOM   813   O  O     . LEU B 2 22  ? -48.607 0.627   61.096 1.00 83.94  ? 22   LEU B O     1 
ATOM   814   C  CB    . LEU B 2 22  ? -49.313 3.017   59.086 1.00 84.60  ? 22   LEU B CB    1 
ATOM   815   C  CG    . LEU B 2 22  ? -49.103 4.157   60.105 1.00 85.47  ? 22   LEU B CG    1 
ATOM   816   C  CD1   . LEU B 2 22  ? -48.588 3.705   61.483 1.00 86.32  ? 22   LEU B CD1   1 
ATOM   817   C  CD2   . LEU B 2 22  ? -48.150 5.199   59.501 1.00 85.93  ? 22   LEU B CD2   1 
ATOM   818   N  N     . ARG B 2 23  ? -48.381 -0.145  58.981 1.00 82.34  ? 23   ARG B N     1 
ATOM   819   C  CA    . ARG B 2 23  ? -47.372 -1.146  59.320 1.00 81.06  ? 23   ARG B CA    1 
ATOM   820   C  C     . ARG B 2 23  ? -46.288 -1.211  58.242 1.00 79.55  ? 23   ARG B C     1 
ATOM   821   O  O     . ARG B 2 23  ? -46.596 -1.175  57.048 1.00 79.41  ? 23   ARG B O     1 
ATOM   822   C  CB    . ARG B 2 23  ? -48.030 -2.521  59.525 1.00 81.37  ? 23   ARG B CB    1 
ATOM   823   C  CG    . ARG B 2 23  ? -47.061 -3.637  59.927 1.00 82.75  ? 23   ARG B CG    1 
ATOM   824   C  CD    . ARG B 2 23  ? -47.747 -4.845  60.592 1.00 85.01  ? 23   ARG B CD    1 
ATOM   825   N  NE    . ARG B 2 23  ? -48.693 -5.606  59.756 1.00 87.11  ? 23   ARG B NE    1 
ATOM   826   C  CZ    . ARG B 2 23  ? -48.605 -5.832  58.440 1.00 87.91  ? 23   ARG B CZ    1 
ATOM   827   N  NH1   . ARG B 2 23  ? -47.588 -5.368  57.718 1.00 88.35  ? 23   ARG B NH1   1 
ATOM   828   N  NH2   . ARG B 2 23  ? -49.554 -6.540  57.835 1.00 87.43  ? 23   ARG B NH2   1 
ATOM   829   N  N     . ASP B 2 24  ? -45.026 -1.286  58.674 1.00 77.64  ? 24   ASP B N     1 
ATOM   830   C  CA    . ASP B 2 24  ? -43.889 -1.519  57.773 1.00 75.65  ? 24   ASP B CA    1 
ATOM   831   C  C     . ASP B 2 24  ? -44.084 -2.798  56.957 1.00 73.82  ? 24   ASP B C     1 
ATOM   832   O  O     . ASP B 2 24  ? -44.668 -3.770  57.445 1.00 73.55  ? 24   ASP B O     1 
ATOM   833   C  CB    . ASP B 2 24  ? -42.589 -1.632  58.573 1.00 76.12  ? 24   ASP B CB    1 
ATOM   834   C  CG    . ASP B 2 24  ? -41.804 -0.332  58.610 1.00 77.14  ? 24   ASP B CG    1 
ATOM   835   O  OD1   . ASP B 2 24  ? -41.344 0.124   57.523 1.00 78.57  ? 24   ASP B OD1   1 
ATOM   836   O  OD2   . ASP B 2 24  ? -41.625 0.217   59.728 1.00 77.31  ? 24   ASP B OD2   1 
ATOM   837   N  N     . ASN B 2 25  ? -43.592 -2.795  55.721 1.00 71.50  ? 25   ASN B N     1 
ATOM   838   C  CA    . ASN B 2 25  ? -43.747 -3.951  54.841 1.00 69.32  ? 25   ASN B CA    1 
ATOM   839   C  C     . ASN B 2 25  ? -43.005 -5.202  55.322 1.00 67.92  ? 25   ASN B C     1 
ATOM   840   O  O     . ASN B 2 25  ? -43.543 -6.307  55.246 1.00 67.30  ? 25   ASN B O     1 
ATOM   841   C  CB    . ASN B 2 25  ? -43.365 -3.597  53.404 1.00 69.15  ? 25   ASN B CB    1 
ATOM   842   C  CG    . ASN B 2 25  ? -44.468 -2.838  52.674 1.00 68.58  ? 25   ASN B CG    1 
ATOM   843   O  OD1   . ASN B 2 25  ? -45.629 -3.248  52.663 1.00 67.74  ? 25   ASN B OD1   1 
ATOM   844   N  ND2   . ASN B 2 25  ? -44.100 -1.738  52.040 1.00 68.83  ? 25   ASN B ND2   1 
ATOM   845   N  N     . ILE B 2 26  ? -41.787 -5.014  55.832 1.00 66.34  ? 26   ILE B N     1 
ATOM   846   C  CA    . ILE B 2 26  ? -41.004 -6.098  56.429 1.00 64.88  ? 26   ILE B CA    1 
ATOM   847   C  C     . ILE B 2 26  ? -41.744 -6.798  57.578 1.00 63.84  ? 26   ILE B C     1 
ATOM   848   O  O     . ILE B 2 26  ? -41.587 -8.004  57.784 1.00 63.54  ? 26   ILE B O     1 
ATOM   849   C  CB    . ILE B 2 26  ? -39.593 -5.615  56.893 1.00 65.05  ? 26   ILE B CB    1 
ATOM   850   C  CG1   . ILE B 2 26  ? -38.686 -6.798  57.251 1.00 65.23  ? 26   ILE B CG1   1 
ATOM   851   C  CG2   . ILE B 2 26  ? -39.679 -4.666  58.076 1.00 64.61  ? 26   ILE B CG2   1 
ATOM   852   C  CD1   . ILE B 2 26  ? -38.163 -7.565  56.060 1.00 65.17  ? 26   ILE B CD1   1 
ATOM   853   N  N     . GLN B 2 27  ? -42.557 -6.042  58.313 1.00 62.42  ? 27   GLN B N     1 
ATOM   854   C  CA    . GLN B 2 27  ? -43.293 -6.597  59.443 1.00 61.18  ? 27   GLN B CA    1 
ATOM   855   C  C     . GLN B 2 27  ? -44.450 -7.467  58.963 1.00 60.23  ? 27   GLN B C     1 
ATOM   856   O  O     . GLN B 2 27  ? -45.024 -8.248  59.737 1.00 60.07  ? 27   GLN B O     1 
ATOM   857   C  CB    . GLN B 2 27  ? -43.775 -5.486  60.378 1.00 61.17  ? 27   GLN B CB    1 
ATOM   858   C  CG    . GLN B 2 27  ? -42.645 -4.688  61.016 1.00 61.11  ? 27   GLN B CG    1 
ATOM   859   C  CD    . GLN B 2 27  ? -41.723 -5.535  61.886 1.00 61.66  ? 27   GLN B CD    1 
ATOM   860   O  OE1   . GLN B 2 27  ? -42.175 -6.400  62.649 1.00 61.43  ? 27   GLN B OE1   1 
ATOM   861   N  NE2   . GLN B 2 27  ? -40.419 -5.275  61.785 1.00 62.07  ? 27   GLN B NE2   1 
ATOM   862   N  N     . GLY B 2 28  ? -44.765 -7.335  57.678 1.00 59.01  ? 28   GLY B N     1 
ATOM   863   C  CA    . GLY B 2 28  ? -45.716 -8.209  57.007 1.00 58.10  ? 28   GLY B CA    1 
ATOM   864   C  C     . GLY B 2 28  ? -45.237 -9.649  57.007 1.00 57.60  ? 28   GLY B C     1 
ATOM   865   O  O     . GLY B 2 28  ? -46.038 -10.577 56.843 1.00 57.83  ? 28   GLY B O     1 
ATOM   866   N  N     . ILE B 2 29  ? -43.925 -9.832  57.170 1.00 56.56  ? 29   ILE B N     1 
ATOM   867   C  CA    . ILE B 2 29  ? -43.346 -11.148 57.394 1.00 55.52  ? 29   ILE B CA    1 
ATOM   868   C  C     . ILE B 2 29  ? -43.515 -11.442 58.875 1.00 54.97  ? 29   ILE B C     1 
ATOM   869   O  O     . ILE B 2 29  ? -42.703 -11.041 59.708 1.00 54.92  ? 29   ILE B O     1 
ATOM   870   C  CB    . ILE B 2 29  ? -41.841 -11.223 56.992 1.00 55.54  ? 29   ILE B CB    1 
ATOM   871   C  CG1   . ILE B 2 29  ? -41.574 -10.576 55.619 1.00 54.72  ? 29   ILE B CG1   1 
ATOM   872   C  CG2   . ILE B 2 29  ? -41.330 -12.674 57.074 1.00 55.57  ? 29   ILE B CG2   1 
ATOM   873   C  CD1   . ILE B 2 29  ? -42.111 -11.322 54.413 1.00 53.82  ? 29   ILE B CD1   1 
ATOM   874   N  N     . THR B 2 30  ? -44.587 -12.142 59.200 1.00 54.51  ? 30   THR B N     1 
ATOM   875   C  CA    . THR B 2 30  ? -45.059 -12.207 60.575 1.00 54.19  ? 30   THR B CA    1 
ATOM   876   C  C     . THR B 2 30  ? -44.369 -13.293 61.391 1.00 54.35  ? 30   THR B C     1 
ATOM   877   O  O     . THR B 2 30  ? -43.767 -14.226 60.838 1.00 54.45  ? 30   THR B O     1 
ATOM   878   C  CB    . THR B 2 30  ? -46.585 -12.423 60.605 1.00 54.14  ? 30   THR B CB    1 
ATOM   879   O  OG1   . THR B 2 30  ? -46.900 -13.665 59.974 1.00 54.07  ? 30   THR B OG1   1 
ATOM   880   C  CG2   . THR B 2 30  ? -47.302 -11.295 59.863 1.00 53.75  ? 30   THR B CG2   1 
ATOM   881   N  N     . LYS B 2 31  ? -44.475 -13.170 62.710 1.00 54.05  ? 31   LYS B N     1 
ATOM   882   C  CA    . LYS B 2 31  ? -43.985 -14.184 63.623 1.00 54.04  ? 31   LYS B CA    1 
ATOM   883   C  C     . LYS B 2 31  ? -44.437 -15.607 63.248 1.00 53.91  ? 31   LYS B C     1 
ATOM   884   O  O     . LYS B 2 31  ? -43.590 -16.484 63.117 1.00 54.23  ? 31   LYS B O     1 
ATOM   885   C  CB    . LYS B 2 31  ? -44.355 -13.835 65.072 1.00 54.09  ? 31   LYS B CB    1 
ATOM   886   C  CG    . LYS B 2 31  ? -44.128 -14.979 66.049 1.00 54.99  ? 31   LYS B CG    1 
ATOM   887   C  CD    . LYS B 2 31  ? -44.344 -14.558 67.489 1.00 56.38  ? 31   LYS B CD    1 
ATOM   888   C  CE    . LYS B 2 31  ? -44.051 -15.726 68.422 1.00 56.72  ? 31   LYS B CE    1 
ATOM   889   N  NZ    . LYS B 2 31  ? -43.985 -15.261 69.835 1.00 57.17  ? 31   LYS B NZ    1 
ATOM   890   N  N     . PRO B 2 32  ? -45.759 -15.842 63.070 1.00 53.87  ? 32   PRO B N     1 
ATOM   891   C  CA    . PRO B 2 32  ? -46.216 -17.193 62.725 1.00 53.55  ? 32   PRO B CA    1 
ATOM   892   C  C     . PRO B 2 32  ? -45.586 -17.731 61.451 1.00 53.16  ? 32   PRO B C     1 
ATOM   893   O  O     . PRO B 2 32  ? -45.315 -18.924 61.354 1.00 53.35  ? 32   PRO B O     1 
ATOM   894   C  CB    . PRO B 2 32  ? -47.721 -17.002 62.484 1.00 53.71  ? 32   PRO B CB    1 
ATOM   895   C  CG    . PRO B 2 32  ? -48.077 -15.796 63.256 1.00 53.96  ? 32   PRO B CG    1 
ATOM   896   C  CD    . PRO B 2 32  ? -46.894 -14.898 63.148 1.00 53.82  ? 32   PRO B CD    1 
ATOM   897   N  N     . ALA B 2 33  ? -45.383 -16.849 60.479 1.00 52.78  ? 33   ALA B N     1 
ATOM   898   C  CA    . ALA B 2 33  ? -44.809 -17.211 59.188 1.00 52.25  ? 33   ALA B CA    1 
ATOM   899   C  C     . ALA B 2 33  ? -43.335 -17.588 59.317 1.00 51.75  ? 33   ALA B C     1 
ATOM   900   O  O     . ALA B 2 33  ? -42.887 -18.579 58.724 1.00 52.22  ? 33   ALA B O     1 
ATOM   901   C  CB    . ALA B 2 33  ? -44.981 -16.069 58.201 1.00 52.27  ? 33   ALA B CB    1 
ATOM   902   N  N     . ILE B 2 34  ? -42.589 -16.799 60.088 1.00 50.64  ? 34   ILE B N     1 
ATOM   903   C  CA    . ILE B 2 34  ? -41.196 -17.107 60.391 1.00 49.66  ? 34   ILE B CA    1 
ATOM   904   C  C     . ILE B 2 34  ? -41.118 -18.368 61.251 1.00 49.44  ? 34   ILE B C     1 
ATOM   905   O  O     . ILE B 2 34  ? -40.170 -19.152 61.135 1.00 49.34  ? 34   ILE B O     1 
ATOM   906   C  CB    . ILE B 2 34  ? -40.471 -15.928 61.077 1.00 49.37  ? 34   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2 34  ? -40.471 -14.705 60.166 1.00 48.93  ? 34   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2 34  ? -39.030 -16.292 61.413 1.00 48.87  ? 34   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2 34  ? -40.132 -13.401 60.876 1.00 48.24  ? 34   ILE B CD1   1 
ATOM   910   N  N     . ARG B 2 35  ? -42.130 -18.566 62.090 1.00 48.94  ? 35   ARG B N     1 
ATOM   911   C  CA    . ARG B 2 35  ? -42.224 -19.767 62.913 1.00 49.03  ? 35   ARG B CA    1 
ATOM   912   C  C     . ARG B 2 35  ? -42.397 -21.016 62.043 1.00 48.73  ? 35   ARG B C     1 
ATOM   913   O  O     . ARG B 2 35  ? -41.779 -22.052 62.324 1.00 49.05  ? 35   ARG B O     1 
ATOM   914   C  CB    . ARG B 2 35  ? -43.350 -19.629 63.939 1.00 49.09  ? 35   ARG B CB    1 
ATOM   915   C  CG    . ARG B 2 35  ? -43.553 -20.828 64.843 1.00 51.31  ? 35   ARG B CG    1 
ATOM   916   C  CD    . ARG B 2 35  ? -44.584 -20.535 65.917 1.00 53.57  ? 35   ARG B CD    1 
ATOM   917   N  NE    . ARG B 2 35  ? -43.988 -19.794 67.029 1.00 55.41  ? 35   ARG B NE    1 
ATOM   918   C  CZ    . ARG B 2 35  ? -43.913 -20.240 68.285 1.00 56.59  ? 35   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B 2 35  ? -44.419 -21.422 68.637 1.00 56.79  ? 35   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B 2 35  ? -43.348 -19.481 69.208 1.00 57.97  ? 35   ARG B NH2   1 
ATOM   921   N  N     . ARG B 2 36  ? -43.204 -20.906 60.980 1.00 47.97  ? 36   ARG B N     1 
ATOM   922   C  CA    . ARG B 2 36  ? -43.460 -22.028 60.072 1.00 47.19  ? 36   ARG B CA    1 
ATOM   923   C  C     . ARG B 2 36  ? -42.186 -22.408 59.330 1.00 46.30  ? 36   ARG B C     1 
ATOM   924   O  O     . ARG B 2 36  ? -41.875 -23.593 59.174 1.00 46.12  ? 36   ARG B O     1 
ATOM   925   C  CB    . ARG B 2 36  ? -44.570 -21.696 59.066 1.00 47.46  ? 36   ARG B CB    1 
ATOM   926   C  CG    . ARG B 2 36  ? -45.993 -21.689 59.650 1.00 48.79  ? 36   ARG B CG    1 
ATOM   927   C  CD    . ARG B 2 36  ? -47.067 -21.687 58.541 1.00 50.42  ? 36   ARG B CD    1 
ATOM   928   N  NE    . ARG B 2 36  ? -47.241 -20.382 57.910 1.00 50.66  ? 36   ARG B NE    1 
ATOM   929   C  CZ    . ARG B 2 36  ? -47.950 -19.385 58.435 1.00 52.21  ? 36   ARG B CZ    1 
ATOM   930   N  NH1   . ARG B 2 36  ? -48.555 -19.537 59.611 1.00 52.58  ? 36   ARG B NH1   1 
ATOM   931   N  NH2   . ARG B 2 36  ? -48.049 -18.228 57.789 1.00 52.06  ? 36   ARG B NH2   1 
ATOM   932   N  N     . LEU B 2 37  ? -41.457 -21.390 58.880 1.00 45.07  ? 37   LEU B N     1 
ATOM   933   C  CA    . LEU B 2 37  ? -40.217 -21.591 58.145 1.00 44.04  ? 37   LEU B CA    1 
ATOM   934   C  C     . LEU B 2 37  ? -39.214 -22.335 59.007 1.00 43.19  ? 37   LEU B C     1 
ATOM   935   O  O     . LEU B 2 37  ? -38.689 -23.368 58.608 1.00 42.78  ? 37   LEU B O     1 
ATOM   936   C  CB    . LEU B 2 37  ? -39.657 -20.250 57.673 1.00 44.00  ? 37   LEU B CB    1 
ATOM   937   C  CG    . LEU B 2 37  ? -40.400 -19.688 56.460 1.00 43.71  ? 37   LEU B CG    1 
ATOM   938   C  CD1   . LEU B 2 37  ? -40.145 -18.196 56.280 1.00 43.10  ? 37   LEU B CD1   1 
ATOM   939   C  CD2   . LEU B 2 37  ? -40.041 -20.468 55.208 1.00 43.12  ? 37   LEU B CD2   1 
ATOM   940   N  N     . ALA B 2 38  ? -39.002 -21.823 60.211 1.00 42.50  ? 38   ALA B N     1 
ATOM   941   C  CA    . ALA B 2 38  ? -38.188 -22.492 61.205 1.00 42.39  ? 38   ALA B CA    1 
ATOM   942   C  C     . ALA B 2 38  ? -38.613 -23.953 61.423 1.00 42.33  ? 38   ALA B C     1 
ATOM   943   O  O     . ALA B 2 38  ? -37.761 -24.835 61.511 1.00 42.64  ? 38   ALA B O     1 
ATOM   944   C  CB    . ALA B 2 38  ? -38.229 -21.715 62.504 1.00 41.83  ? 38   ALA B CB    1 
ATOM   945   N  N     . ARG B 2 39  ? -39.924 -24.200 61.485 1.00 42.00  ? 39   ARG B N     1 
ATOM   946   C  CA    . ARG B 2 39  ? -40.451 -25.551 61.674 1.00 41.78  ? 39   ARG B CA    1 
ATOM   947   C  C     . ARG B 2 39  ? -40.038 -26.491 60.559 1.00 41.76  ? 39   ARG B C     1 
ATOM   948   O  O     . ARG B 2 39  ? -39.563 -27.597 60.828 1.00 41.93  ? 39   ARG B O     1 
ATOM   949   C  CB    . ARG B 2 39  ? -41.977 -25.543 61.812 1.00 41.99  ? 39   ARG B CB    1 
ATOM   950   C  CG    . ARG B 2 39  ? -42.501 -24.832 63.058 1.00 42.02  ? 39   ARG B CG    1 
ATOM   951   C  CD    . ARG B 2 39  ? -42.279 -25.658 64.296 1.00 43.62  ? 39   ARG B CD    1 
ATOM   952   N  NE    . ARG B 2 39  ? -42.899 -25.049 65.465 1.00 46.92  ? 39   ARG B NE    1 
ATOM   953   C  CZ    . ARG B 2 39  ? -42.225 -24.455 66.442 1.00 50.18  ? 39   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B 2 39  ? -40.900 -24.399 66.402 1.00 50.96  ? 39   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B 2 39  ? -42.873 -23.927 67.469 1.00 52.75  ? 39   ARG B NH2   1 
ATOM   956   N  N     . ARG B 2 40  ? -40.218 -26.059 59.311 1.00 41.56  ? 40   ARG B N     1 
ATOM   957   C  CA    . ARG B 2 40  ? -39.799 -26.851 58.158 1.00 41.54  ? 40   ARG B CA    1 
ATOM   958   C  C     . ARG B 2 40  ? -38.280 -27.071 58.207 1.00 41.63  ? 40   ARG B C     1 
ATOM   959   O  O     . ARG B 2 40  ? -37.778 -28.073 57.695 1.00 41.66  ? 40   ARG B O     1 
ATOM   960   C  CB    . ARG B 2 40  ? -40.219 -26.169 56.854 1.00 41.54  ? 40   ARG B CB    1 
ATOM   961   C  CG    . ARG B 2 40  ? -39.960 -26.990 55.582 1.00 42.75  ? 40   ARG B CG    1 
ATOM   962   C  CD    . ARG B 2 40  ? -40.692 -26.421 54.372 1.00 43.73  ? 40   ARG B CD    1 
ATOM   963   N  NE    . ARG B 2 40  ? -42.114 -26.764 54.403 1.00 45.66  ? 40   ARG B NE    1 
ATOM   964   C  CZ    . ARG B 2 40  ? -43.042 -26.252 53.588 1.00 45.97  ? 40   ARG B CZ    1 
ATOM   965   N  NH1   . ARG B 2 40  ? -42.718 -25.350 52.661 1.00 43.47  ? 40   ARG B NH1   1 
ATOM   966   N  NH2   . ARG B 2 40  ? -44.307 -26.642 53.710 1.00 45.13  ? 40   ARG B NH2   1 
ATOM   967   N  N     . GLY B 2 41  ? -37.574 -26.134 58.851 1.00 41.49  ? 41   GLY B N     1 
ATOM   968   C  CA    . GLY B 2 41  ? -36.138 -26.231 59.084 1.00 41.49  ? 41   GLY B CA    1 
ATOM   969   C  C     . GLY B 2 41  ? -35.768 -27.130 60.249 1.00 41.55  ? 41   GLY B C     1 
ATOM   970   O  O     . GLY B 2 41  ? -34.584 -27.318 60.536 1.00 41.51  ? 41   GLY B O     1 
ATOM   971   N  N     . GLY B 2 42  ? -36.781 -27.685 60.917 1.00 41.52  ? 42   GLY B N     1 
ATOM   972   C  CA    . GLY B 2 42  ? -36.580 -28.609 62.038 1.00 41.50  ? 42   GLY B CA    1 
ATOM   973   C  C     . GLY B 2 42  ? -36.360 -27.966 63.400 1.00 41.91  ? 42   GLY B C     1 
ATOM   974   O  O     . GLY B 2 42  ? -35.835 -28.594 64.319 1.00 41.54  ? 42   GLY B O     1 
ATOM   975   N  N     . VAL B 2 43  ? -36.767 -26.711 63.537 1.00 42.37  ? 43   VAL B N     1 
ATOM   976   C  CA    . VAL B 2 43  ? -36.550 -25.965 64.768 1.00 43.11  ? 43   VAL B CA    1 
ATOM   977   C  C     . VAL B 2 43  ? -37.698 -26.165 65.764 1.00 43.62  ? 43   VAL B C     1 
ATOM   978   O  O     . VAL B 2 43  ? -38.867 -26.013 65.413 1.00 43.78  ? 43   VAL B O     1 
ATOM   979   C  CB    . VAL B 2 43  ? -36.363 -24.460 64.473 1.00 43.08  ? 43   VAL B CB    1 
ATOM   980   C  CG1   . VAL B 2 43  ? -36.123 -23.688 65.756 1.00 42.62  ? 43   VAL B CG1   1 
ATOM   981   C  CG2   . VAL B 2 43  ? -35.204 -24.241 63.496 1.00 44.30  ? 43   VAL B CG2   1 
ATOM   982   N  N     . LYS B 2 44  ? -37.351 -26.500 67.002 1.00 44.29  ? 44   LYS B N     1 
ATOM   983   C  CA    . LYS B 2 44  ? -38.328 -26.810 68.040 1.00 45.23  ? 44   LYS B CA    1 
ATOM   984   C  C     . LYS B 2 44  ? -38.646 -25.584 68.881 1.00 45.85  ? 44   LYS B C     1 
ATOM   985   O  O     . LYS B 2 44  ? -39.803 -25.322 69.204 1.00 46.11  ? 44   LYS B O     1 
ATOM   986   C  CB    . LYS B 2 44  ? -37.792 -27.913 68.951 1.00 45.43  ? 44   LYS B CB    1 
ATOM   987   C  CG    . LYS B 2 44  ? -38.745 -28.334 70.074 1.00 46.25  ? 44   LYS B CG    1 
ATOM   988   C  CD    . LYS B 2 44  ? -38.305 -29.665 70.673 1.00 47.25  ? 44   LYS B CD    1 
ATOM   989   C  CE    . LYS B 2 44  ? -38.987 -29.949 71.998 1.00 48.57  ? 44   LYS B CE    1 
ATOM   990   N  NZ    . LYS B 2 44  ? -38.577 -31.277 72.570 1.00 48.95  ? 44   LYS B NZ    1 
ATOM   991   N  N     . ARG B 2 45  ? -37.606 -24.837 69.234 1.00 46.01  ? 45   ARG B N     1 
ATOM   992   C  CA    . ARG B 2 45  ? -37.740 -23.754 70.168 1.00 46.27  ? 45   ARG B CA    1 
ATOM   993   C  C     . ARG B 2 45  ? -37.040 -22.503 69.660 1.00 46.35  ? 45   ARG B C     1 
ATOM   994   O  O     . ARG B 2 45  ? -35.899 -22.550 69.178 1.00 46.42  ? 45   ARG B O     1 
ATOM   995   C  CB    . ARG B 2 45  ? -37.204 -24.178 71.524 1.00 46.74  ? 45   ARG B CB    1 
ATOM   996   C  CG    . ARG B 2 45  ? -37.793 -23.401 72.674 1.00 47.58  ? 45   ARG B CG    1 
ATOM   997   C  CD    . ARG B 2 45  ? -37.395 -24.044 73.970 1.00 50.08  ? 45   ARG B CD    1 
ATOM   998   N  NE    . ARG B 2 45  ? -38.031 -23.402 75.109 1.00 52.84  ? 45   ARG B NE    1 
ATOM   999   C  CZ    . ARG B 2 45  ? -37.515 -22.370 75.773 1.00 54.74  ? 45   ARG B CZ    1 
ATOM   1000  N  NH1   . ARG B 2 45  ? -36.345 -21.840 75.417 1.00 54.63  ? 45   ARG B NH1   1 
ATOM   1001  N  NH2   . ARG B 2 45  ? -38.179 -21.865 76.800 1.00 56.15  ? 45   ARG B NH2   1 
ATOM   1002  N  N     . ILE B 2 46  ? -37.743 -21.378 69.779 1.00 46.21  ? 46   ILE B N     1 
ATOM   1003  C  CA    . ILE B 2 46  ? -37.375 -20.149 69.088 1.00 45.58  ? 46   ILE B CA    1 
ATOM   1004  C  C     . ILE B 2 46  ? -37.337 -18.960 70.041 1.00 45.95  ? 46   ILE B C     1 
ATOM   1005  O  O     . ILE B 2 46  ? -38.327 -18.652 70.697 1.00 46.23  ? 46   ILE B O     1 
ATOM   1006  C  CB    . ILE B 2 46  ? -38.365 -19.849 67.959 1.00 45.37  ? 46   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B 2 46  ? -38.446 -21.038 66.990 1.00 44.14  ? 46   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B 2 46  ? -38.007 -18.542 67.264 1.00 44.07  ? 46   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B 2 46  ? -39.524 -20.908 65.923 1.00 42.37  ? 46   ILE B CD1   1 
ATOM   1010  N  N     . SER B 2 47  ? -36.188 -18.294 70.099 1.00 45.77  ? 47   SER B N     1 
ATOM   1011  C  CA    . SER B 2 47  ? -36.021 -17.111 70.923 1.00 45.57  ? 47   SER B CA    1 
ATOM   1012  C  C     . SER B 2 47  ? -36.719 -15.908 70.322 1.00 45.62  ? 47   SER B C     1 
ATOM   1013  O  O     . SER B 2 47  ? -36.764 -15.741 69.094 1.00 45.44  ? 47   SER B O     1 
ATOM   1014  C  CB    . SER B 2 47  ? -34.535 -16.835 71.166 1.00 45.58  ? 47   SER B CB    1 
ATOM   1015  O  OG    . SER B 2 47  ? -34.184 -15.508 70.853 1.00 46.14  ? 47   SER B OG    1 
ATOM   1016  N  N     . GLY B 2 48  ? -37.242 -15.058 71.206 1.00 45.81  ? 48   GLY B N     1 
ATOM   1017  C  CA    . GLY B 2 48  ? -38.002 -13.875 70.819 1.00 45.54  ? 48   GLY B CA    1 
ATOM   1018  C  C     . GLY B 2 48  ? -37.285 -12.974 69.841 1.00 45.86  ? 48   GLY B C     1 
ATOM   1019  O  O     . GLY B 2 48  ? -37.917 -12.360 68.984 1.00 46.26  ? 48   GLY B O     1 
ATOM   1020  N  N     . LEU B 2 49  ? -35.961 -12.901 69.945 1.00 45.74  ? 49   LEU B N     1 
ATOM   1021  C  CA    . LEU B 2 49  ? -35.189 -11.982 69.104 1.00 45.43  ? 49   LEU B CA    1 
ATOM   1022  C  C     . LEU B 2 49  ? -34.968 -12.504 67.681 1.00 45.19  ? 49   LEU B C     1 
ATOM   1023  O  O     . LEU B 2 49  ? -34.510 -11.762 66.809 1.00 44.96  ? 49   LEU B O     1 
ATOM   1024  C  CB    . LEU B 2 49  ? -33.850 -11.634 69.769 1.00 45.71  ? 49   LEU B CB    1 
ATOM   1025  C  CG    . LEU B 2 49  ? -33.905 -10.933 71.135 1.00 46.30  ? 49   LEU B CG    1 
ATOM   1026  C  CD1   . LEU B 2 49  ? -32.602 -11.142 71.890 1.00 46.66  ? 49   LEU B CD1   1 
ATOM   1027  C  CD2   . LEU B 2 49  ? -34.216 -9.434  70.979 1.00 45.17  ? 49   LEU B CD2   1 
ATOM   1028  N  N     . ILE B 2 50  ? -35.301 -13.775 67.448 1.00 45.10  ? 50   ILE B N     1 
ATOM   1029  C  CA    . ILE B 2 50  ? -35.082 -14.431 66.147 1.00 44.23  ? 50   ILE B CA    1 
ATOM   1030  C  C     . ILE B 2 50  ? -35.871 -13.773 65.022 1.00 44.11  ? 50   ILE B C     1 
ATOM   1031  O  O     . ILE B 2 50  ? -35.375 -13.666 63.892 1.00 44.46  ? 50   ILE B O     1 
ATOM   1032  C  CB    . ILE B 2 50  ? -35.404 -15.974 66.202 1.00 44.06  ? 50   ILE B CB    1 
ATOM   1033  C  CG1   . ILE B 2 50  ? -34.274 -16.764 66.885 1.00 43.53  ? 50   ILE B CG1   1 
ATOM   1034  C  CG2   . ILE B 2 50  ? -35.730 -16.531 64.814 1.00 43.37  ? 50   ILE B CG2   1 
ATOM   1035  C  CD1   . ILE B 2 50  ? -32.966 -16.870 66.093 1.00 43.85  ? 50   ILE B CD1   1 
ATOM   1036  N  N     . TYR B 2 51  ? -37.086 -13.326 65.329 1.00 43.80  ? 51   TYR B N     1 
ATOM   1037  C  CA    . TYR B 2 51  ? -38.001 -12.814 64.301 1.00 43.65  ? 51   TYR B CA    1 
ATOM   1038  C  C     . TYR B 2 51  ? -37.440 -11.568 63.622 1.00 44.12  ? 51   TYR B C     1 
ATOM   1039  O  O     . TYR B 2 51  ? -37.481 -11.444 62.393 1.00 44.13  ? 51   TYR B O     1 
ATOM   1040  C  CB    . TYR B 2 51  ? -39.432 -12.622 64.855 1.00 43.34  ? 51   TYR B CB    1 
ATOM   1041  C  CG    . TYR B 2 51  ? -39.939 -13.863 65.595 1.00 42.54  ? 51   TYR B CG    1 
ATOM   1042  C  CD1   . TYR B 2 51  ? -40.312 -15.010 64.905 1.00 41.45  ? 51   TYR B CD1   1 
ATOM   1043  C  CD2   . TYR B 2 51  ? -40.001 -13.893 66.991 1.00 42.37  ? 51   TYR B CD2   1 
ATOM   1044  C  CE1   . TYR B 2 51  ? -40.751 -16.157 65.584 1.00 42.68  ? 51   TYR B CE1   1 
ATOM   1045  C  CE2   . TYR B 2 51  ? -40.435 -15.032 67.675 1.00 41.94  ? 51   TYR B CE2   1 
ATOM   1046  C  CZ    . TYR B 2 51  ? -40.806 -16.162 66.970 1.00 42.44  ? 51   TYR B CZ    1 
ATOM   1047  O  OH    . TYR B 2 51  ? -41.226 -17.302 67.648 1.00 43.63  ? 51   TYR B OH    1 
ATOM   1048  N  N     . GLU B 2 52  ? -36.864 -10.671 64.412 1.00 44.84  ? 52   GLU B N     1 
ATOM   1049  C  CA    . GLU B 2 52  ? -36.219 -9.489  63.850 1.00 45.72  ? 52   GLU B CA    1 
ATOM   1050  C  C     . GLU B 2 52  ? -34.929 -9.821  63.109 1.00 45.46  ? 52   GLU B C     1 
ATOM   1051  O  O     . GLU B 2 52  ? -34.673 -9.259  62.048 1.00 45.89  ? 52   GLU B O     1 
ATOM   1052  C  CB    . GLU B 2 52  ? -35.976 -8.406  64.912 1.00 46.18  ? 52   GLU B CB    1 
ATOM   1053  C  CG    . GLU B 2 52  ? -37.194 -7.533  65.208 1.00 48.77  ? 52   GLU B CG    1 
ATOM   1054  C  CD    . GLU B 2 52  ? -37.659 -6.740  64.000 1.00 53.03  ? 52   GLU B CD    1 
ATOM   1055  O  OE1   . GLU B 2 52  ? -36.917 -5.824  63.564 1.00 54.24  ? 52   GLU B OE1   1 
ATOM   1056  O  OE2   . GLU B 2 52  ? -38.766 -7.038  63.480 1.00 53.91  ? 52   GLU B OE2   1 
ATOM   1057  N  N     . GLU B 2 53  ? -34.120 -10.728 63.650 1.00 45.37  ? 53   GLU B N     1 
ATOM   1058  C  CA    . GLU B 2 53  ? -32.911 -11.158 62.941 1.00 45.17  ? 53   GLU B CA    1 
ATOM   1059  C  C     . GLU B 2 53  ? -33.270 -11.766 61.570 1.00 44.61  ? 53   GLU B C     1 
ATOM   1060  O  O     . GLU B 2 53  ? -32.640 -11.434 60.559 1.00 44.55  ? 53   GLU B O     1 
ATOM   1061  C  CB    . GLU B 2 53  ? -32.074 -12.131 63.784 1.00 45.25  ? 53   GLU B CB    1 
ATOM   1062  C  CG    . GLU B 2 53  ? -30.620 -12.295 63.296 1.00 47.28  ? 53   GLU B CG    1 
ATOM   1063  C  CD    . GLU B 2 53  ? -29.677 -11.187 63.788 1.00 50.35  ? 53   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B 2 53  ? -30.059 -10.395 64.686 1.00 50.77  ? 53   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B 2 53  ? -28.537 -11.110 63.276 1.00 51.80  ? 53   GLU B OE2   1 
ATOM   1066  N  N     . THR B 2 54  ? -34.294 -12.621 61.534 1.00 43.85  ? 54   THR B N     1 
ATOM   1067  C  CA    . THR B 2 54  ? -34.714 -13.254 60.284 1.00 43.56  ? 54   THR B CA    1 
ATOM   1068  C  C     . THR B 2 54  ? -35.102 -12.223 59.222 1.00 43.27  ? 54   THR B C     1 
ATOM   1069  O  O     . THR B 2 54  ? -34.735 -12.352 58.036 1.00 43.51  ? 54   THR B O     1 
ATOM   1070  C  CB    . THR B 2 54  ? -35.878 -14.253 60.503 1.00 43.63  ? 54   THR B CB    1 
ATOM   1071  O  OG1   . THR B 2 54  ? -35.501 -15.234 61.476 1.00 44.27  ? 54   THR B OG1   1 
ATOM   1072  C  CG2   . THR B 2 54  ? -36.224 -14.974 59.218 1.00 43.65  ? 54   THR B CG2   1 
ATOM   1073  N  N     . ARG B 2 55  ? -35.839 -11.202 59.648 1.00 42.59  ? 55   ARG B N     1 
ATOM   1074  C  CA    . ARG B 2 55  ? -36.295 -10.147 58.740 1.00 42.16  ? 55   ARG B CA    1 
ATOM   1075  C  C     . ARG B 2 55  ? -35.126 -9.426  58.095 1.00 41.40  ? 55   ARG B C     1 
ATOM   1076  O  O     . ARG B 2 55  ? -35.126 -9.192  56.884 1.00 41.14  ? 55   ARG B O     1 
ATOM   1077  C  CB    . ARG B 2 55  ? -37.228 -9.171  59.464 1.00 42.34  ? 55   ARG B CB    1 
ATOM   1078  C  CG    . ARG B 2 55  ? -38.599 -9.795  59.767 1.00 43.29  ? 55   ARG B CG    1 
ATOM   1079  C  CD    . ARG B 2 55  ? -39.554 -8.814  60.397 1.00 43.78  ? 55   ARG B CD    1 
ATOM   1080  N  NE    . ARG B 2 55  ? -40.761 -9.484  60.876 1.00 44.44  ? 55   ARG B NE    1 
ATOM   1081  C  CZ    . ARG B 2 55  ? -41.061 -9.664  62.157 1.00 44.80  ? 55   ARG B CZ    1 
ATOM   1082  N  NH1   . ARG B 2 55  ? -40.247 -9.210  63.113 1.00 44.82  ? 55   ARG B NH1   1 
ATOM   1083  N  NH2   . ARG B 2 55  ? -42.184 -10.291 62.482 1.00 44.41  ? 55   ARG B NH2   1 
ATOM   1084  N  N     . GLY B 2 56  ? -34.124 -9.095  58.907 1.00 40.79  ? 56   GLY B N     1 
ATOM   1085  C  CA    . GLY B 2 56  ? -32.883 -8.520  58.403 1.00 40.01  ? 56   GLY B CA    1 
ATOM   1086  C  C     . GLY B 2 56  ? -32.219 -9.419  57.374 1.00 39.55  ? 56   GLY B C     1 
ATOM   1087  O  O     . GLY B 2 56  ? -31.849 -8.972  56.290 1.00 39.66  ? 56   GLY B O     1 
ATOM   1088  N  N     . VAL B 2 57  ? -32.097 -10.702 57.700 1.00 39.05  ? 57   VAL B N     1 
ATOM   1089  C  CA    . VAL B 2 57  ? -31.472 -11.665 56.792 1.00 38.27  ? 57   VAL B CA    1 
ATOM   1090  C  C     . VAL B 2 57  ? -32.230 -11.747 55.463 1.00 38.04  ? 57   VAL B C     1 
ATOM   1091  O  O     . VAL B 2 57  ? -31.627 -11.690 54.400 1.00 37.81  ? 57   VAL B O     1 
ATOM   1092  C  CB    . VAL B 2 57  ? -31.332 -13.048 57.469 1.00 38.29  ? 57   VAL B CB    1 
ATOM   1093  C  CG1   . VAL B 2 57  ? -30.989 -14.109 56.452 1.00 38.43  ? 57   VAL B CG1   1 
ATOM   1094  C  CG2   . VAL B 2 57  ? -30.272 -12.987 58.589 1.00 37.82  ? 57   VAL B CG2   1 
ATOM   1095  N  N     . LEU B 2 58  ? -33.552 -11.849 55.526 1.00 38.02  ? 58   LEU B N     1 
ATOM   1096  C  CA    . LEU B 2 58  ? -34.379 -11.886 54.316 1.00 38.82  ? 58   LEU B CA    1 
ATOM   1097  C  C     . LEU B 2 58  ? -34.205 -10.643 53.450 1.00 39.22  ? 58   LEU B C     1 
ATOM   1098  O  O     . LEU B 2 58  ? -34.146 -10.721 52.203 1.00 39.52  ? 58   LEU B O     1 
ATOM   1099  C  CB    . LEU B 2 58  ? -35.849 -12.040 54.691 1.00 38.85  ? 58   LEU B CB    1 
ATOM   1100  C  CG    . LEU B 2 58  ? -36.832 -12.050 53.526 1.00 40.75  ? 58   LEU B CG    1 
ATOM   1101  C  CD1   . LEU B 2 58  ? -36.507 -13.157 52.502 1.00 40.48  ? 58   LEU B CD1   1 
ATOM   1102  C  CD2   . LEU B 2 58  ? -38.255 -12.173 54.064 1.00 41.56  ? 58   LEU B CD2   1 
ATOM   1103  N  N     . LYS B 2 59  ? -34.133 -9.495  54.117 1.00 39.43  ? 59   LYS B N     1 
ATOM   1104  C  CA    . LYS B 2 59  ? -33.946 -8.231  53.434 1.00 39.68  ? 59   LYS B CA    1 
ATOM   1105  C  C     . LYS B 2 59  ? -32.631 -8.231  52.674 1.00 39.46  ? 59   LYS B C     1 
ATOM   1106  O  O     . LYS B 2 59  ? -32.628 -7.912  51.494 1.00 39.71  ? 59   LYS B O     1 
ATOM   1107  C  CB    . LYS B 2 59  ? -34.005 -7.066  54.423 1.00 40.28  ? 59   LYS B CB    1 
ATOM   1108  C  CG    . LYS B 2 59  ? -34.216 -5.698  53.784 1.00 41.63  ? 59   LYS B CG    1 
ATOM   1109  C  CD    . LYS B 2 59  ? -34.547 -4.628  54.841 1.00 44.57  ? 59   LYS B CD    1 
ATOM   1110  C  CE    . LYS B 2 59  ? -34.365 -3.211  54.269 1.00 45.56  ? 59   LYS B CE    1 
ATOM   1111  N  NZ    . LYS B 2 59  ? -32.916 -2.786  54.195 1.00 46.23  ? 59   LYS B NZ    1 
ATOM   1112  N  N     . VAL B 2 60  ? -31.517 -8.575  53.330 1.00 39.10  ? 60   VAL B N     1 
ATOM   1113  C  CA    . VAL B 2 60  ? -30.234 -8.648  52.618 1.00 38.59  ? 60   VAL B CA    1 
ATOM   1114  C  C     . VAL B 2 60  ? -30.342 -9.650  51.466 1.00 38.56  ? 60   VAL B C     1 
ATOM   1115  O  O     . VAL B 2 60  ? -29.906 -9.366  50.358 1.00 38.86  ? 60   VAL B O     1 
ATOM   1116  C  CB    . VAL B 2 60  ? -29.050 -9.021  53.547 1.00 38.93  ? 60   VAL B CB    1 
ATOM   1117  C  CG1   . VAL B 2 60  ? -27.823 -9.344  52.729 1.00 38.18  ? 60   VAL B CG1   1 
ATOM   1118  C  CG2   . VAL B 2 60  ? -28.748 -7.890  54.530 1.00 38.27  ? 60   VAL B CG2   1 
ATOM   1119  N  N     . PHE B 2 61  ? -30.944 -10.810 51.710 1.00 38.30  ? 61   PHE B N     1 
ATOM   1120  C  CA    . PHE B 2 61  ? -31.112 -11.781 50.641 1.00 38.55  ? 61   PHE B CA    1 
ATOM   1121  C  C     . PHE B 2 61  ? -31.847 -11.165 49.447 1.00 39.31  ? 61   PHE B C     1 
ATOM   1122  O  O     . PHE B 2 61  ? -31.351 -11.215 48.320 1.00 40.14  ? 61   PHE B O     1 
ATOM   1123  C  CB    . PHE B 2 61  ? -31.824 -13.045 51.149 1.00 38.33  ? 61   PHE B CB    1 
ATOM   1124  C  CG    . PHE B 2 61  ? -32.000 -14.105 50.100 1.00 37.54  ? 61   PHE B CG    1 
ATOM   1125  C  CD1   . PHE B 2 61  ? -30.958 -14.989 49.801 1.00 36.35  ? 61   PHE B CD1   1 
ATOM   1126  C  CD2   . PHE B 2 61  ? -33.211 -14.232 49.406 1.00 37.09  ? 61   PHE B CD2   1 
ATOM   1127  C  CE1   . PHE B 2 61  ? -31.116 -15.987 48.819 1.00 35.40  ? 61   PHE B CE1   1 
ATOM   1128  C  CE2   . PHE B 2 61  ? -33.372 -15.229 48.415 1.00 37.15  ? 61   PHE B CE2   1 
ATOM   1129  C  CZ    . PHE B 2 61  ? -32.317 -16.107 48.128 1.00 34.41  ? 61   PHE B CZ    1 
ATOM   1130  N  N     . LEU B 2 62  ? -33.018 -10.572 49.682 1.00 39.85  ? 62   LEU B N     1 
ATOM   1131  C  CA    . LEU B 2 62  ? -33.807 -9.998  48.576 1.00 40.04  ? 62   LEU B CA    1 
ATOM   1132  C  C     . LEU B 2 62  ? -33.122 -8.814  47.902 1.00 40.50  ? 62   LEU B C     1 
ATOM   1133  O  O     . LEU B 2 62  ? -33.164 -8.686  46.675 1.00 41.07  ? 62   LEU B O     1 
ATOM   1134  C  CB    . LEU B 2 62  ? -35.235 -9.632  49.009 1.00 39.75  ? 62   LEU B CB    1 
ATOM   1135  C  CG    . LEU B 2 62  ? -36.159 -10.803 49.372 1.00 39.79  ? 62   LEU B CG    1 
ATOM   1136  C  CD1   . LEU B 2 62  ? -37.403 -10.303 50.069 1.00 40.08  ? 62   LEU B CD1   1 
ATOM   1137  C  CD2   . LEU B 2 62  ? -36.534 -11.655 48.154 1.00 37.87  ? 62   LEU B CD2   1 
ATOM   1138  N  N     . GLU B 2 63  ? -32.488 -7.948  48.681 1.00 40.53  ? 63   GLU B N     1 
ATOM   1139  C  CA    . GLU B 2 63  ? -31.672 -6.879  48.096 1.00 41.04  ? 63   GLU B CA    1 
ATOM   1140  C  C     . GLU B 2 63  ? -30.672 -7.428  47.085 1.00 40.51  ? 63   GLU B C     1 
ATOM   1141  O  O     . GLU B 2 63  ? -30.662 -6.999  45.936 1.00 40.66  ? 63   GLU B O     1 
ATOM   1142  C  CB    . GLU B 2 63  ? -30.933 -6.084  49.177 1.00 41.38  ? 63   GLU B CB    1 
ATOM   1143  C  CG    . GLU B 2 63  ? -31.831 -5.151  49.946 1.00 44.60  ? 63   GLU B CG    1 
ATOM   1144  C  CD    . GLU B 2 63  ? -31.162 -4.514  51.142 1.00 49.35  ? 63   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B 2 63  ? -29.982 -4.831  51.439 1.00 50.08  ? 63   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B 2 63  ? -31.843 -3.688  51.794 1.00 51.99  ? 63   GLU B OE2   1 
ATOM   1147  N  N     . ASN B 2 64  ? -29.850 -8.390  47.502 1.00 40.53  ? 64   ASN B N     1 
ATOM   1148  C  CA    . ASN B 2 64  ? -28.812 -8.944  46.618 1.00 40.42  ? 64   ASN B CA    1 
ATOM   1149  C  C     . ASN B 2 64  ? -29.362 -9.519  45.331 1.00 40.17  ? 64   ASN B C     1 
ATOM   1150  O  O     . ASN B 2 64  ? -28.810 -9.269  44.262 1.00 40.35  ? 64   ASN B O     1 
ATOM   1151  C  CB    . ASN B 2 64  ? -27.964 -9.983  47.348 1.00 40.42  ? 64   ASN B CB    1 
ATOM   1152  C  CG    . ASN B 2 64  ? -26.939 -9.355  48.257 1.00 41.64  ? 64   ASN B CG    1 
ATOM   1153  O  OD1   . ASN B 2 64  ? -26.291 -8.370  47.895 1.00 45.23  ? 64   ASN B OD1   1 
ATOM   1154  N  ND2   . ASN B 2 64  ? -26.783 -9.913  49.448 1.00 42.55  ? 64   ASN B ND2   1 
ATOM   1155  N  N     . VAL B 2 65  ? -30.463 -10.269 45.439 1.00 40.04  ? 65   VAL B N     1 
ATOM   1156  C  CA    . VAL B 2 65  ? -31.085 -10.929 44.287 1.00 39.56  ? 65   VAL B CA    1 
ATOM   1157  C  C     . VAL B 2 65  ? -31.855 -9.945  43.405 1.00 39.51  ? 65   VAL B C     1 
ATOM   1158  O  O     . VAL B 2 65  ? -31.666 -9.924  42.177 1.00 39.24  ? 65   VAL B O     1 
ATOM   1159  C  CB    . VAL B 2 65  ? -32.031 -12.080 44.740 1.00 40.08  ? 65   VAL B CB    1 
ATOM   1160  C  CG1   . VAL B 2 65  ? -32.567 -12.854 43.533 1.00 38.97  ? 65   VAL B CG1   1 
ATOM   1161  C  CG2   . VAL B 2 65  ? -31.293 -13.033 45.670 1.00 40.66  ? 65   VAL B CG2   1 
ATOM   1162  N  N     . ILE B 2 66  ? -32.729 -9.140  44.017 1.00 39.32  ? 66   ILE B N     1 
ATOM   1163  C  CA    . ILE B 2 66  ? -33.486 -8.137  43.257 1.00 39.37  ? 66   ILE B CA    1 
ATOM   1164  C  C     . ILE B 2 66  ? -32.556 -7.157  42.533 1.00 39.30  ? 66   ILE B C     1 
ATOM   1165  O  O     . ILE B 2 66  ? -32.734 -6.904  41.333 1.00 38.51  ? 66   ILE B O     1 
ATOM   1166  C  CB    . ILE B 2 66  ? -34.529 -7.406  44.111 1.00 39.57  ? 66   ILE B CB    1 
ATOM   1167  C  CG1   . ILE B 2 66  ? -35.594 -8.407  44.596 1.00 40.21  ? 66   ILE B CG1   1 
ATOM   1168  C  CG2   . ILE B 2 66  ? -35.189 -6.290  43.306 1.00 39.23  ? 66   ILE B CG2   1 
ATOM   1169  C  CD1   . ILE B 2 66  ? -36.348 -7.955  45.835 1.00 40.77  ? 66   ILE B CD1   1 
ATOM   1170  N  N     . ARG B 2 67  ? -31.550 -6.642  43.245 1.00 39.24  ? 67   ARG B N     1 
ATOM   1171  C  CA    . ARG B 2 67  ? -30.529 -5.804  42.608 1.00 39.67  ? 67   ARG B CA    1 
ATOM   1172  C  C     . ARG B 2 67  ? -30.102 -6.394  41.269 1.00 39.17  ? 67   ARG B C     1 
ATOM   1173  O  O     . ARG B 2 67  ? -30.174 -5.721  40.251 1.00 39.63  ? 67   ARG B O     1 
ATOM   1174  C  CB    . ARG B 2 67  ? -29.317 -5.573  43.530 1.00 39.75  ? 67   ARG B CB    1 
ATOM   1175  C  CG    . ARG B 2 67  ? -28.254 -4.652  42.922 1.00 43.39  ? 67   ARG B CG    1 
ATOM   1176  C  CD    . ARG B 2 67  ? -26.949 -4.600  43.757 1.00 48.32  ? 67   ARG B CD    1 
ATOM   1177  N  NE    . ARG B 2 67  ? -27.129 -3.845  45.003 1.00 52.61  ? 67   ARG B NE    1 
ATOM   1178  C  CZ    . ARG B 2 67  ? -27.072 -4.363  46.230 1.00 54.56  ? 67   ARG B CZ    1 
ATOM   1179  N  NH1   . ARG B 2 67  ? -26.815 -5.656  46.416 1.00 55.64  ? 67   ARG B NH1   1 
ATOM   1180  N  NH2   . ARG B 2 67  ? -27.262 -3.575  47.279 1.00 55.75  ? 67   ARG B NH2   1 
ATOM   1181  N  N     . ASP B 2 68  ? -29.690 -7.662  41.260 1.00 39.21  ? 68   ASP B N     1 
ATOM   1182  C  CA    . ASP B 2 68  ? -29.211 -8.289  40.034 1.00 38.85  ? 68   ASP B CA    1 
ATOM   1183  C  C     . ASP B 2 68  ? -30.325 -8.497  38.993 1.00 38.69  ? 68   ASP B C     1 
ATOM   1184  O  O     . ASP B 2 68  ? -30.085 -8.338  37.793 1.00 38.19  ? 68   ASP B O     1 
ATOM   1185  C  CB    . ASP B 2 68  ? -28.464 -9.591  40.344 1.00 39.51  ? 68   ASP B CB    1 
ATOM   1186  C  CG    . ASP B 2 68  ? -27.032 -9.356  40.877 1.00 41.19  ? 68   ASP B CG    1 
ATOM   1187  O  OD1   . ASP B 2 68  ? -26.665 -8.207  41.231 1.00 43.86  ? 68   ASP B OD1   1 
ATOM   1188  O  OD2   . ASP B 2 68  ? -26.266 -10.343 40.950 1.00 41.64  ? 68   ASP B OD2   1 
ATOM   1189  N  N     . ALA B 2 69  ? -31.531 -8.851  39.443 1.00 38.32  ? 69   ALA B N     1 
ATOM   1190  C  CA    . ALA B 2 69  ? -32.667 -9.051  38.520 1.00 38.68  ? 69   ALA B CA    1 
ATOM   1191  C  C     . ALA B 2 69  ? -33.029 -7.753  37.802 1.00 38.78  ? 69   ALA B C     1 
ATOM   1192  O  O     . ALA B 2 69  ? -33.093 -7.706  36.573 1.00 38.22  ? 69   ALA B O     1 
ATOM   1193  C  CB    . ALA B 2 69  ? -33.892 -9.614  39.262 1.00 38.79  ? 69   ALA B CB    1 
ATOM   1194  N  N     . VAL B 2 70  ? -33.235 -6.692  38.582 1.00 39.24  ? 70   VAL B N     1 
ATOM   1195  C  CA    . VAL B 2 70  ? -33.489 -5.368  38.028 1.00 39.30  ? 70   VAL B CA    1 
ATOM   1196  C  C     . VAL B 2 70  ? -32.381 -4.999  37.034 1.00 40.02  ? 70   VAL B C     1 
ATOM   1197  O  O     . VAL B 2 70  ? -32.677 -4.550  35.924 1.00 40.76  ? 70   VAL B O     1 
ATOM   1198  C  CB    . VAL B 2 70  ? -33.663 -4.311  39.130 1.00 39.32  ? 70   VAL B CB    1 
ATOM   1199  C  CG1   . VAL B 2 70  ? -33.822 -2.910  38.526 1.00 39.59  ? 70   VAL B CG1   1 
ATOM   1200  C  CG2   . VAL B 2 70  ? -34.870 -4.653  40.004 1.00 39.24  ? 70   VAL B CG2   1 
ATOM   1201  N  N     . THR B 2 71  ? -31.118 -5.219  37.399 1.00 39.76  ? 71   THR B N     1 
ATOM   1202  C  CA    . THR B 2 71  ? -30.019 -4.964  36.467 1.00 39.87  ? 71   THR B CA    1 
ATOM   1203  C  C     . THR B 2 71  ? -30.215 -5.684  35.146 1.00 40.64  ? 71   THR B C     1 
ATOM   1204  O  O     . THR B 2 71  ? -29.867 -5.158  34.100 1.00 41.25  ? 71   THR B O     1 
ATOM   1205  C  CB    . THR B 2 71  ? -28.663 -5.365  37.053 1.00 39.65  ? 71   THR B CB    1 
ATOM   1206  O  OG1   . THR B 2 71  ? -28.410 -4.587  38.228 1.00 39.01  ? 71   THR B OG1   1 
ATOM   1207  C  CG2   . THR B 2 71  ? -27.563 -5.115  36.057 1.00 38.72  ? 71   THR B CG2   1 
ATOM   1208  N  N     . TYR B 2 72  ? -30.758 -6.894  35.191 1.00 41.61  ? 72   TYR B N     1 
ATOM   1209  C  CA    . TYR B 2 72  ? -31.081 -7.614  33.962 1.00 42.43  ? 72   TYR B CA    1 
ATOM   1210  C  C     . TYR B 2 72  ? -32.255 -6.951  33.240 1.00 43.36  ? 72   TYR B C     1 
ATOM   1211  O  O     . TYR B 2 72  ? -32.248 -6.871  32.018 1.00 43.37  ? 72   TYR B O     1 
ATOM   1212  C  CB    . TYR B 2 72  ? -31.393 -9.097  34.233 1.00 42.02  ? 72   TYR B CB    1 
ATOM   1213  C  CG    . TYR B 2 72  ? -30.173 -9.975  34.426 1.00 41.38  ? 72   TYR B CG    1 
ATOM   1214  C  CD1   . TYR B 2 72  ? -29.946 -10.624 35.637 1.00 41.00  ? 72   TYR B CD1   1 
ATOM   1215  C  CD2   . TYR B 2 72  ? -29.257 -10.169 33.396 1.00 40.16  ? 72   TYR B CD2   1 
ATOM   1216  C  CE1   . TYR B 2 72  ? -28.840 -11.427 35.829 1.00 40.15  ? 72   TYR B CE1   1 
ATOM   1217  C  CE2   . TYR B 2 72  ? -28.145 -10.976 33.577 1.00 41.13  ? 72   TYR B CE2   1 
ATOM   1218  C  CZ    . TYR B 2 72  ? -27.945 -11.602 34.803 1.00 40.84  ? 72   TYR B CZ    1 
ATOM   1219  O  OH    . TYR B 2 72  ? -26.846 -12.402 35.012 1.00 40.50  ? 72   TYR B OH    1 
ATOM   1220  N  N     . THR B 2 73  ? -33.250 -6.485  34.000 1.00 44.53  ? 73   THR B N     1 
ATOM   1221  C  CA    . THR B 2 73  ? -34.410 -5.806  33.428 1.00 45.71  ? 73   THR B CA    1 
ATOM   1222  C  C     . THR B 2 73  ? -33.978 -4.550  32.673 1.00 47.11  ? 73   THR B C     1 
ATOM   1223  O  O     . THR B 2 73  ? -34.286 -4.409  31.487 1.00 47.75  ? 73   THR B O     1 
ATOM   1224  C  CB    . THR B 2 73  ? -35.475 -5.458  34.490 1.00 45.50  ? 73   THR B CB    1 
ATOM   1225  O  OG1   . THR B 2 73  ? -35.761 -6.619  35.274 1.00 44.27  ? 73   THR B OG1   1 
ATOM   1226  C  CG2   . THR B 2 73  ? -36.776 -4.986  33.823 1.00 45.00  ? 73   THR B CG2   1 
ATOM   1227  N  N     . GLU B 2 74  ? -33.239 -3.668  33.343 1.00 48.38  ? 74   GLU B N     1 
ATOM   1228  C  CA    . GLU B 2 74  ? -32.711 -2.455  32.713 1.00 49.69  ? 74   GLU B CA    1 
ATOM   1229  C  C     . GLU B 2 74  ? -31.923 -2.755  31.440 1.00 49.80  ? 74   GLU B C     1 
ATOM   1230  O  O     . GLU B 2 74  ? -32.096 -2.069  30.422 1.00 50.20  ? 74   GLU B O     1 
ATOM   1231  C  CB    . GLU B 2 74  ? -31.849 -1.639  33.687 1.00 50.13  ? 74   GLU B CB    1 
ATOM   1232  C  CG    . GLU B 2 74  ? -32.648 -0.871  34.733 1.00 53.53  ? 74   GLU B CG    1 
ATOM   1233  C  CD    . GLU B 2 74  ? -31.774 0.034   35.592 1.00 58.38  ? 74   GLU B CD    1 
ATOM   1234  O  OE1   . GLU B 2 74  ? -31.790 1.268   35.352 1.00 61.17  ? 74   GLU B OE1   1 
ATOM   1235  O  OE2   . GLU B 2 74  ? -31.068 -0.481  36.495 1.00 59.30  ? 74   GLU B OE2   1 
ATOM   1236  N  N     . HIS B 2 75  ? -31.073 -3.779  31.475 1.00 49.59  ? 75   HIS B N     1 
ATOM   1237  C  CA    . HIS B 2 75  ? -30.314 -4.129  30.273 1.00 49.67  ? 75   HIS B CA    1 
ATOM   1238  C  C     . HIS B 2 75  ? -31.208 -4.453  29.064 1.00 50.07  ? 75   HIS B C     1 
ATOM   1239  O  O     . HIS B 2 75  ? -30.871 -4.130  27.933 1.00 49.98  ? 75   HIS B O     1 
ATOM   1240  C  CB    . HIS B 2 75  ? -29.322 -5.272  30.516 1.00 49.17  ? 75   HIS B CB    1 
ATOM   1241  C  CG    . HIS B 2 75  ? -28.391 -5.486  29.369 1.00 47.57  ? 75   HIS B CG    1 
ATOM   1242  N  ND1   . HIS B 2 75  ? -27.254 -4.731  29.191 1.00 45.80  ? 75   HIS B ND1   1 
ATOM   1243  C  CD2   . HIS B 2 75  ? -28.459 -6.323  28.307 1.00 46.39  ? 75   HIS B CD2   1 
ATOM   1244  C  CE1   . HIS B 2 75  ? -26.645 -5.113  28.082 1.00 46.06  ? 75   HIS B CE1   1 
ATOM   1245  N  NE2   . HIS B 2 75  ? -27.357 -6.075  27.523 1.00 45.26  ? 75   HIS B NE2   1 
ATOM   1246  N  N     . ALA B 2 76  ? -32.343 -5.092  29.318 1.00 50.70  ? 76   ALA B N     1 
ATOM   1247  C  CA    . ALA B 2 76  ? -33.247 -5.508  28.256 1.00 51.56  ? 76   ALA B CA    1 
ATOM   1248  C  C     . ALA B 2 76  ? -34.210 -4.382  27.854 1.00 52.11  ? 76   ALA B C     1 
ATOM   1249  O  O     . ALA B 2 76  ? -34.994 -4.528  26.903 1.00 51.99  ? 76   ALA B O     1 
ATOM   1250  C  CB    . ALA B 2 76  ? -34.018 -6.746  28.684 1.00 51.34  ? 76   ALA B CB    1 
ATOM   1251  N  N     . LYS B 2 77  ? -34.148 -3.268  28.585 1.00 52.57  ? 77   LYS B N     1 
ATOM   1252  C  CA    . LYS B 2 77  ? -34.993 -2.100  28.319 1.00 53.17  ? 77   LYS B CA    1 
ATOM   1253  C  C     . LYS B 2 77  ? -36.467 -2.416  28.578 1.00 53.13  ? 77   LYS B C     1 
ATOM   1254  O  O     . LYS B 2 77  ? -37.344 -2.081  27.767 1.00 53.40  ? 77   LYS B O     1 
ATOM   1255  C  CB    . LYS B 2 77  ? -34.774 -1.593  26.889 1.00 53.24  ? 77   LYS B CB    1 
ATOM   1256  C  CG    . LYS B 2 77  ? -33.330 -1.209  26.595 1.00 54.90  ? 77   LYS B CG    1 
ATOM   1257  C  CD    . LYS B 2 77  ? -33.017 -1.301  25.117 1.00 57.71  ? 77   LYS B CD    1 
ATOM   1258  C  CE    . LYS B 2 77  ? -31.543 -0.948  24.850 1.00 60.69  ? 77   LYS B CE    1 
ATOM   1259  N  NZ    . LYS B 2 77  ? -31.216 -0.890  23.384 1.00 61.57  ? 77   LYS B NZ    1 
ATOM   1260  N  N     . ARG B 2 78  ? -36.727 -3.071  29.709 1.00 52.63  ? 78   ARG B N     1 
ATOM   1261  C  CA    . ARG B 2 78  ? -38.086 -3.380  30.126 1.00 52.47  ? 78   ARG B CA    1 
ATOM   1262  C  C     . ARG B 2 78  ? -38.425 -2.626  31.402 1.00 52.59  ? 78   ARG B C     1 
ATOM   1263  O  O     . ARG B 2 78  ? -37.545 -2.067  32.053 1.00 52.52  ? 78   ARG B O     1 
ATOM   1264  C  CB    . ARG B 2 78  ? -38.265 -4.892  30.314 1.00 52.61  ? 78   ARG B CB    1 
ATOM   1265  C  CG    . ARG B 2 78  ? -38.366 -5.668  29.017 1.00 51.76  ? 78   ARG B CG    1 
ATOM   1266  C  CD    . ARG B 2 78  ? -38.634 -7.135  29.267 1.00 53.30  ? 78   ARG B CD    1 
ATOM   1267  N  NE    . ARG B 2 78  ? -37.404 -7.917  29.429 1.00 53.30  ? 78   ARG B NE    1 
ATOM   1268  C  CZ    . ARG B 2 78  ? -36.899 -8.299  30.602 1.00 53.09  ? 78   ARG B CZ    1 
ATOM   1269  N  NH1   . ARG B 2 78  ? -37.515 -7.981  31.738 1.00 51.58  ? 78   ARG B NH1   1 
ATOM   1270  N  NH2   . ARG B 2 78  ? -35.776 -9.010  30.640 1.00 52.10  ? 78   ARG B NH2   1 
ATOM   1271  N  N     . LYS B 2 79  ? -39.708 -2.588  31.742 1.00 52.95  ? 79   LYS B N     1 
ATOM   1272  C  CA    . LYS B 2 79  ? -40.166 -1.962  32.975 1.00 53.25  ? 79   LYS B CA    1 
ATOM   1273  C  C     . LYS B 2 79  ? -40.798 -3.049  33.827 1.00 52.93  ? 79   LYS B C     1 
ATOM   1274  O  O     . LYS B 2 79  ? -41.360 -2.778  34.910 1.00 52.95  ? 79   LYS B O     1 
ATOM   1275  C  CB    . LYS B 2 79  ? -41.179 -0.854  32.678 1.00 54.01  ? 79   LYS B CB    1 
ATOM   1276  C  CG    . LYS B 2 79  ? -40.662 0.265   31.764 1.00 56.02  ? 79   LYS B CG    1 
ATOM   1277  C  CD    . LYS B 2 79  ? -41.633 1.443   31.757 1.00 60.20  ? 79   LYS B CD    1 
ATOM   1278  C  CE    . LYS B 2 79  ? -41.413 2.323   30.527 1.00 63.14  ? 79   LYS B CE    1 
ATOM   1279  N  NZ    . LYS B 2 79  ? -42.641 3.119   30.168 1.00 65.14  ? 79   LYS B NZ    1 
ATOM   1280  N  N     . THR B 2 80  ? -40.696 -4.280  33.320 1.00 52.27  ? 80   THR B N     1 
ATOM   1281  C  CA    . THR B 2 80  ? -41.233 -5.464  33.993 1.00 52.24  ? 80   THR B CA    1 
ATOM   1282  C  C     . THR B 2 80  ? -40.106 -6.440  34.314 1.00 51.44  ? 80   THR B C     1 
ATOM   1283  O  O     . THR B 2 80  ? -39.374 -6.870  33.426 1.00 51.06  ? 80   THR B O     1 
ATOM   1284  C  CB    . THR B 2 80  ? -42.277 -6.214  33.110 1.00 52.19  ? 80   THR B CB    1 
ATOM   1285  O  OG1   . THR B 2 80  ? -43.126 -5.257  32.455 1.00 52.79  ? 80   THR B OG1   1 
ATOM   1286  C  CG2   . THR B 2 80  ? -43.126 -7.155  33.962 1.00 52.38  ? 80   THR B CG2   1 
ATOM   1287  N  N     . VAL B 2 81  ? -39.973 -6.775  35.590 1.00 50.75  ? 81   VAL B N     1 
ATOM   1288  C  CA    . VAL B 2 81  ? -39.056 -7.832  36.017 1.00 49.63  ? 81   VAL B CA    1 
ATOM   1289  C  C     . VAL B 2 81  ? -39.684 -9.165  35.633 1.00 49.04  ? 81   VAL B C     1 
ATOM   1290  O  O     . VAL B 2 81  ? -40.808 -9.482  36.060 1.00 48.75  ? 81   VAL B O     1 
ATOM   1291  C  CB    . VAL B 2 81  ? -38.822 -7.790  37.537 1.00 49.70  ? 81   VAL B CB    1 
ATOM   1292  C  CG1   . VAL B 2 81  ? -37.763 -8.812  37.954 1.00 50.09  ? 81   VAL B CG1   1 
ATOM   1293  C  CG2   . VAL B 2 81  ? -38.410 -6.378  37.974 1.00 49.31  ? 81   VAL B CG2   1 
ATOM   1294  N  N     . THR B 2 82  ? -38.988 -9.929  34.797 1.00 48.16  ? 82   THR B N     1 
ATOM   1295  C  CA    . THR B 2 82  ? -39.495 -11.252 34.407 1.00 47.57  ? 82   THR B CA    1 
ATOM   1296  C  C     . THR B 2 82  ? -38.922 -12.382 35.261 1.00 46.88  ? 82   THR B C     1 
ATOM   1297  O  O     . THR B 2 82  ? -37.821 -12.280 35.806 1.00 46.28  ? 82   THR B O     1 
ATOM   1298  C  CB    . THR B 2 82  ? -39.166 -11.596 32.973 1.00 47.57  ? 82   THR B CB    1 
ATOM   1299  O  OG1   . THR B 2 82  ? -37.745 -11.664 32.835 1.00 48.23  ? 82   THR B OG1   1 
ATOM   1300  C  CG2   . THR B 2 82  ? -39.751 -10.558 32.004 1.00 48.17  ? 82   THR B CG2   1 
ATOM   1301  N  N     . ALA B 2 83  ? -39.690 -13.462 35.360 1.00 45.98  ? 83   ALA B N     1 
ATOM   1302  C  CA    . ALA B 2 83  ? -39.229 -14.701 35.964 1.00 44.90  ? 83   ALA B CA    1 
ATOM   1303  C  C     . ALA B 2 83  ? -37.794 -15.038 35.559 1.00 44.31  ? 83   ALA B C     1 
ATOM   1304  O  O     . ALA B 2 83  ? -37.013 -15.434 36.417 1.00 43.99  ? 83   ALA B O     1 
ATOM   1305  C  CB    . ALA B 2 83  ? -40.157 -15.839 35.593 1.00 45.15  ? 83   ALA B CB    1 
ATOM   1306  N  N     . MET B 2 84  ? -37.455 -14.881 34.274 1.00 43.48  ? 84   MET B N     1 
ATOM   1307  C  CA    . MET B 2 84  ? -36.096 -15.131 33.797 1.00 43.54  ? 84   MET B CA    1 
ATOM   1308  C  C     . MET B 2 84  ? -35.077 -14.180 34.412 1.00 43.62  ? 84   MET B C     1 
ATOM   1309  O  O     . MET B 2 84  ? -33.993 -14.631 34.821 1.00 43.92  ? 84   MET B O     1 
ATOM   1310  C  CB    . MET B 2 84  ? -35.984 -15.065 32.277 1.00 43.70  ? 84   MET B CB    1 
ATOM   1311  C  CG    . MET B 2 84  ? -36.611 -16.235 31.527 1.00 45.63  ? 84   MET B CG    1 
ATOM   1312  S  SD    . MET B 2 84  ? -36.391 -17.849 32.311 1.00 51.40  ? 84   MET B SD    1 
ATOM   1313  C  CE    . MET B 2 84  ? -34.659 -18.199 31.945 1.00 51.01  ? 84   MET B CE    1 
ATOM   1314  N  N     . ASP B 2 85  ? -35.410 -12.882 34.479 1.00 42.81  ? 85   ASP B N     1 
ATOM   1315  C  CA    . ASP B 2 85  ? -34.550 -11.918 35.160 1.00 42.25  ? 85   ASP B CA    1 
ATOM   1316  C  C     . ASP B 2 85  ? -34.182 -12.482 36.515 1.00 41.83  ? 85   ASP B C     1 
ATOM   1317  O  O     . ASP B 2 85  ? -33.004 -12.460 36.896 1.00 42.32  ? 85   ASP B O     1 
ATOM   1318  C  CB    . ASP B 2 85  ? -35.221 -10.553 35.355 1.00 42.45  ? 85   ASP B CB    1 
ATOM   1319  C  CG    . ASP B 2 85  ? -35.409 -9.790  34.055 1.00 43.34  ? 85   ASP B CG    1 
ATOM   1320  O  OD1   . ASP B 2 85  ? -34.679 -10.054 33.073 1.00 43.85  ? 85   ASP B OD1   1 
ATOM   1321  O  OD2   . ASP B 2 85  ? -36.287 -8.898  34.028 1.00 44.48  ? 85   ASP B OD2   1 
ATOM   1322  N  N     . VAL B 2 86  ? -35.186 -12.997 37.223 1.00 40.68  ? 86   VAL B N     1 
ATOM   1323  C  CA    . VAL B 2 86  ? -35.006 -13.494 38.579 1.00 40.78  ? 86   VAL B CA    1 
ATOM   1324  C  C     . VAL B 2 86  ? -34.182 -14.783 38.601 1.00 41.02  ? 86   VAL B C     1 
ATOM   1325  O  O     . VAL B 2 86  ? -33.241 -14.917 39.392 1.00 40.88  ? 86   VAL B O     1 
ATOM   1326  C  CB    . VAL B 2 86  ? -36.353 -13.679 39.304 1.00 40.77  ? 86   VAL B CB    1 
ATOM   1327  C  CG1   . VAL B 2 86  ? -36.177 -14.427 40.624 1.00 41.02  ? 86   VAL B CG1   1 
ATOM   1328  C  CG2   . VAL B 2 86  ? -36.994 -12.314 39.571 1.00 40.77  ? 86   VAL B CG2   1 
ATOM   1329  N  N     . VAL B 2 87  ? -34.529 -15.707 37.708 1.00 40.89  ? 87   VAL B N     1 
ATOM   1330  C  CA    . VAL B 2 87  ? -33.823 -16.969 37.563 1.00 40.28  ? 87   VAL B CA    1 
ATOM   1331  C  C     . VAL B 2 87  ? -32.339 -16.764 37.237 1.00 40.74  ? 87   VAL B C     1 
ATOM   1332  O  O     . VAL B 2 87  ? -31.486 -17.430 37.821 1.00 40.46  ? 87   VAL B O     1 
ATOM   1333  C  CB    . VAL B 2 87  ? -34.510 -17.863 36.509 1.00 40.43  ? 87   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B 2 87  ? -33.596 -19.035 36.079 1.00 39.52  ? 87   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B 2 87  ? -35.834 -18.375 37.054 1.00 38.61  ? 87   VAL B CG2   1 
ATOM   1336  N  N     . TYR B 2 88  ? -32.028 -15.844 36.325 1.00 41.28  ? 88   TYR B N     1 
ATOM   1337  C  CA    . TYR B 2 88  ? -30.626 -15.537 36.020 1.00 41.78  ? 88   TYR B CA    1 
ATOM   1338  C  C     . TYR B 2 88  ? -29.904 -14.939 37.228 1.00 41.70  ? 88   TYR B C     1 
ATOM   1339  O  O     . TYR B 2 88  ? -28.716 -15.215 37.440 1.00 42.06  ? 88   TYR B O     1 
ATOM   1340  C  CB    . TYR B 2 88  ? -30.502 -14.574 34.846 1.00 42.41  ? 88   TYR B CB    1 
ATOM   1341  C  CG    . TYR B 2 88  ? -31.020 -15.104 33.529 1.00 44.36  ? 88   TYR B CG    1 
ATOM   1342  C  CD1   . TYR B 2 88  ? -31.743 -14.281 32.669 1.00 45.66  ? 88   TYR B CD1   1 
ATOM   1343  C  CD2   . TYR B 2 88  ? -30.779 -16.425 33.139 1.00 46.09  ? 88   TYR B CD2   1 
ATOM   1344  C  CE1   . TYR B 2 88  ? -32.220 -14.758 31.443 1.00 47.04  ? 88   TYR B CE1   1 
ATOM   1345  C  CE2   . TYR B 2 88  ? -31.258 -16.918 31.927 1.00 47.73  ? 88   TYR B CE2   1 
ATOM   1346  C  CZ    . TYR B 2 88  ? -31.975 -16.068 31.085 1.00 48.79  ? 88   TYR B CZ    1 
ATOM   1347  O  OH    . TYR B 2 88  ? -32.443 -16.535 29.885 1.00 50.47  ? 88   TYR B OH    1 
ATOM   1348  N  N     . ALA B 2 89  ? -30.612 -14.142 38.029 1.00 40.81  ? 89   ALA B N     1 
ATOM   1349  C  CA    . ALA B 2 89  ? -29.966 -13.474 39.155 1.00 40.18  ? 89   ALA B CA    1 
ATOM   1350  C  C     . ALA B 2 89  ? -29.619 -14.504 40.205 1.00 39.98  ? 89   ALA B C     1 
ATOM   1351  O  O     . ALA B 2 89  ? -28.508 -14.513 40.729 1.00 40.28  ? 89   ALA B O     1 
ATOM   1352  C  CB    . ALA B 2 89  ? -30.835 -12.391 39.737 1.00 40.20  ? 89   ALA B CB    1 
ATOM   1353  N  N     . LEU B 2 90  ? -30.576 -15.372 40.498 1.00 39.42  ? 90   LEU B N     1 
ATOM   1354  C  CA    . LEU B 2 90  ? -30.370 -16.527 41.359 1.00 39.00  ? 90   LEU B CA    1 
ATOM   1355  C  C     . LEU B 2 90  ? -29.209 -17.433 40.903 1.00 39.42  ? 90   LEU B C     1 
ATOM   1356  O  O     . LEU B 2 90  ? -28.401 -17.875 41.720 1.00 38.79  ? 90   LEU B O     1 
ATOM   1357  C  CB    . LEU B 2 90  ? -31.660 -17.334 41.445 1.00 38.45  ? 90   LEU B CB    1 
ATOM   1358  C  CG    . LEU B 2 90  ? -32.776 -16.677 42.253 1.00 37.33  ? 90   LEU B CG    1 
ATOM   1359  C  CD1   . LEU B 2 90  ? -34.122 -17.360 42.024 1.00 35.59  ? 90   LEU B CD1   1 
ATOM   1360  C  CD2   . LEU B 2 90  ? -32.417 -16.657 43.740 1.00 36.73  ? 90   LEU B CD2   1 
ATOM   1361  N  N     . LYS B 2 91  ? -29.112 -17.688 39.605 1.00 40.19  ? 91   LYS B N     1 
ATOM   1362  C  CA    . LYS B 2 91  ? -28.032 -18.523 39.093 1.00 41.21  ? 91   LYS B CA    1 
ATOM   1363  C  C     . LYS B 2 91  ? -26.670 -17.893 39.390 1.00 41.53  ? 91   LYS B C     1 
ATOM   1364  O  O     . LYS B 2 91  ? -25.756 -18.586 39.835 1.00 42.39  ? 91   LYS B O     1 
ATOM   1365  C  CB    . LYS B 2 91  ? -28.199 -18.812 37.594 1.00 41.26  ? 91   LYS B CB    1 
ATOM   1366  C  CG    . LYS B 2 91  ? -27.096 -19.697 37.017 1.00 43.30  ? 91   LYS B CG    1 
ATOM   1367  C  CD    . LYS B 2 91  ? -27.631 -20.846 36.137 1.00 46.45  ? 91   LYS B CD    1 
ATOM   1368  C  CE    . LYS B 2 91  ? -28.041 -20.366 34.736 1.00 49.54  ? 91   LYS B CE    1 
ATOM   1369  N  NZ    . LYS B 2 91  ? -28.119 -21.492 33.727 1.00 50.38  ? 91   LYS B NZ    1 
ATOM   1370  N  N     . ARG B 2 92  ? -26.535 -16.588 39.180 1.00 41.49  ? 92   ARG B N     1 
ATOM   1371  C  CA    . ARG B 2 92  ? -25.235 -15.961 39.373 1.00 42.06  ? 92   ARG B CA    1 
ATOM   1372  C  C     . ARG B 2 92  ? -24.878 -15.755 40.847 1.00 42.42  ? 92   ARG B C     1 
ATOM   1373  O  O     . ARG B 2 92  ? -23.700 -15.618 41.167 1.00 42.93  ? 92   ARG B O     1 
ATOM   1374  C  CB    . ARG B 2 92  ? -25.072 -14.672 38.543 1.00 41.61  ? 92   ARG B CB    1 
ATOM   1375  C  CG    . ARG B 2 92  ? -25.841 -13.457 39.045 1.00 42.21  ? 92   ARG B CG    1 
ATOM   1376  C  CD    . ARG B 2 92  ? -25.382 -12.198 38.304 1.00 43.95  ? 92   ARG B CD    1 
ATOM   1377  N  NE    . ARG B 2 92  ? -23.919 -12.097 38.205 1.00 42.64  ? 92   ARG B NE    1 
ATOM   1378  C  CZ    . ARG B 2 92  ? -23.130 -11.675 39.191 1.00 42.76  ? 92   ARG B CZ    1 
ATOM   1379  N  NH1   . ARG B 2 92  ? -23.651 -11.312 40.355 1.00 40.35  ? 92   ARG B NH1   1 
ATOM   1380  N  NH2   . ARG B 2 92  ? -21.811 -11.621 39.012 1.00 44.75  ? 92   ARG B NH2   1 
ATOM   1381  N  N     . GLN B 2 93  ? -25.882 -15.741 41.729 1.00 42.46  ? 93   GLN B N     1 
ATOM   1382  C  CA    . GLN B 2 93  ? -25.643 -15.731 43.175 1.00 42.95  ? 93   GLN B CA    1 
ATOM   1383  C  C     . GLN B 2 93  ? -25.335 -17.143 43.712 1.00 42.57  ? 93   GLN B C     1 
ATOM   1384  O  O     . GLN B 2 93  ? -25.198 -17.333 44.923 1.00 42.48  ? 93   GLN B O     1 
ATOM   1385  C  CB    . GLN B 2 93  ? -26.862 -15.194 43.943 1.00 43.40  ? 93   GLN B CB    1 
ATOM   1386  C  CG    . GLN B 2 93  ? -27.392 -13.828 43.527 1.00 46.10  ? 93   GLN B CG    1 
ATOM   1387  C  CD    . GLN B 2 93  ? -26.511 -12.663 43.949 1.00 50.17  ? 93   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B 2 93  ? -25.832 -12.702 44.983 1.00 51.45  ? 93   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B 2 93  ? -26.521 -11.609 43.139 1.00 51.70  ? 93   GLN B NE2   1 
ATOM   1390  N  N     . GLY B 2 94  ? -25.250 -18.127 42.820 1.00 42.22  ? 94   GLY B N     1 
ATOM   1391  C  CA    . GLY B 2 94  ? -25.048 -19.513 43.219 1.00 41.76  ? 94   GLY B CA    1 
ATOM   1392  C  C     . GLY B 2 94  ? -26.247 -20.126 43.931 1.00 41.71  ? 94   GLY B C     1 
ATOM   1393  O  O     . GLY B 2 94  ? -26.091 -20.981 44.797 1.00 41.66  ? 94   GLY B O     1 
ATOM   1394  N  N     . ARG B 2 95  ? -27.449 -19.686 43.574 1.00 41.48  ? 95   ARG B N     1 
ATOM   1395  C  CA    . ARG B 2 95  ? -28.667 -20.240 44.149 1.00 41.28  ? 95   ARG B CA    1 
ATOM   1396  C  C     . ARG B 2 95  ? -29.622 -20.642 43.033 1.00 40.65  ? 95   ARG B C     1 
ATOM   1397  O  O     . ARG B 2 95  ? -30.756 -20.182 43.002 1.00 40.63  ? 95   ARG B O     1 
ATOM   1398  C  CB    . ARG B 2 95  ? -29.375 -19.236 45.065 1.00 41.47  ? 95   ARG B CB    1 
ATOM   1399  C  CG    . ARG B 2 95  ? -28.501 -18.429 45.997 1.00 44.07  ? 95   ARG B CG    1 
ATOM   1400  C  CD    . ARG B 2 95  ? -28.477 -18.975 47.408 1.00 48.23  ? 95   ARG B CD    1 
ATOM   1401  N  NE    . ARG B 2 95  ? -29.586 -19.883 47.691 1.00 50.65  ? 95   ARG B NE    1 
ATOM   1402  C  CZ    . ARG B 2 95  ? -29.573 -20.773 48.686 1.00 51.29  ? 95   ARG B CZ    1 
ATOM   1403  N  NH1   . ARG B 2 95  ? -28.504 -20.865 49.487 1.00 48.93  ? 95   ARG B NH1   1 
ATOM   1404  N  NH2   . ARG B 2 95  ? -30.626 -21.566 48.882 1.00 50.50  ? 95   ARG B NH2   1 
ATOM   1405  N  N     . THR B 2 96  ? -29.153 -21.496 42.122 1.00 40.24  ? 96   THR B N     1 
ATOM   1406  C  CA    . THR B 2 96  ? -29.943 -21.998 40.994 1.00 39.77  ? 96   THR B CA    1 
ATOM   1407  C  C     . THR B 2 96  ? -31.331 -22.483 41.401 1.00 40.13  ? 96   THR B C     1 
ATOM   1408  O  O     . THR B 2 96  ? -31.490 -23.225 42.372 1.00 40.37  ? 96   THR B O     1 
ATOM   1409  C  CB    . THR B 2 96  ? -29.203 -23.115 40.246 1.00 39.56  ? 96   THR B CB    1 
ATOM   1410  O  OG1   . THR B 2 96  ? -27.936 -22.629 39.788 1.00 39.83  ? 96   THR B OG1   1 
ATOM   1411  C  CG2   . THR B 2 96  ? -29.973 -23.566 39.044 1.00 39.61  ? 96   THR B CG2   1 
ATOM   1412  N  N     . LEU B 2 97  ? -32.334 -22.038 40.657 1.00 40.31  ? 97   LEU B N     1 
ATOM   1413  C  CA    . LEU B 2 97  ? -33.711 -22.429 40.886 1.00 40.59  ? 97   LEU B CA    1 
ATOM   1414  C  C     . LEU B 2 97  ? -34.259 -23.105 39.634 1.00 40.85  ? 97   LEU B C     1 
ATOM   1415  O  O     . LEU B 2 97  ? -34.076 -22.621 38.524 1.00 40.86  ? 97   LEU B O     1 
ATOM   1416  C  CB    . LEU B 2 97  ? -34.545 -21.203 41.256 1.00 40.77  ? 97   LEU B CB    1 
ATOM   1417  C  CG    . LEU B 2 97  ? -36.050 -21.336 41.523 1.00 41.01  ? 97   LEU B CG    1 
ATOM   1418  C  CD1   . LEU B 2 97  ? -36.309 -22.038 42.841 1.00 40.81  ? 97   LEU B CD1   1 
ATOM   1419  C  CD2   . LEU B 2 97  ? -36.728 -19.964 41.521 1.00 38.41  ? 97   LEU B CD2   1 
ATOM   1420  N  N     . TYR B 2 98  ? -34.914 -24.246 39.834 1.00 41.32  ? 98   TYR B N     1 
ATOM   1421  C  CA    . TYR B 2 98  ? -35.606 -24.967 38.777 1.00 41.53  ? 98   TYR B CA    1 
ATOM   1422  C  C     . TYR B 2 98  ? -37.112 -24.774 38.917 1.00 42.39  ? 98   TYR B C     1 
ATOM   1423  O  O     . TYR B 2 98  ? -37.623 -24.745 40.028 1.00 42.03  ? 98   TYR B O     1 
ATOM   1424  C  CB    . TYR B 2 98  ? -35.324 -26.461 38.901 1.00 41.30  ? 98   TYR B CB    1 
ATOM   1425  C  CG    . TYR B 2 98  ? -33.933 -26.945 38.539 1.00 39.37  ? 98   TYR B CG    1 
ATOM   1426  C  CD1   . TYR B 2 98  ? -32.949 -26.084 38.050 1.00 37.90  ? 98   TYR B CD1   1 
ATOM   1427  C  CD2   . TYR B 2 98  ? -33.619 -28.294 38.666 1.00 38.15  ? 98   TYR B CD2   1 
ATOM   1428  C  CE1   . TYR B 2 98  ? -31.680 -26.562 37.702 1.00 37.17  ? 98   TYR B CE1   1 
ATOM   1429  C  CE2   . TYR B 2 98  ? -32.375 -28.775 38.315 1.00 38.14  ? 98   TYR B CE2   1 
ATOM   1430  C  CZ    . TYR B 2 98  ? -31.411 -27.911 37.832 1.00 37.51  ? 98   TYR B CZ    1 
ATOM   1431  O  OH    . TYR B 2 98  ? -30.187 -28.432 37.509 1.00 36.86  ? 98   TYR B OH    1 
ATOM   1432  N  N     . GLY B 2 99  ? -37.821 -24.660 37.794 1.00 43.66  ? 99   GLY B N     1 
ATOM   1433  C  CA    . GLY B 2 99  ? -39.273 -24.516 37.823 1.00 45.20  ? 99   GLY B CA    1 
ATOM   1434  C  C     . GLY B 2 99  ? -39.898 -23.310 37.140 1.00 46.23  ? 99   GLY B C     1 
ATOM   1435  O  O     . GLY B 2 99  ? -41.116 -23.242 37.016 1.00 46.96  ? 99   GLY B O     1 
ATOM   1436  N  N     . PHE B 2 100 ? -39.088 -22.357 36.693 1.00 47.13  ? 100  PHE B N     1 
ATOM   1437  C  CA    . PHE B 2 100 ? -39.625 -21.103 36.159 1.00 47.76  ? 100  PHE B CA    1 
ATOM   1438  C  C     . PHE B 2 100 ? -39.026 -20.713 34.804 1.00 48.86  ? 100  PHE B C     1 
ATOM   1439  O  O     . PHE B 2 100 ? -39.177 -19.575 34.359 1.00 49.65  ? 100  PHE B O     1 
ATOM   1440  C  CB    . PHE B 2 100 ? -39.460 -19.973 37.188 1.00 47.15  ? 100  PHE B CB    1 
ATOM   1441  C  CG    . PHE B 2 100 ? -40.269 -20.174 38.456 1.00 45.59  ? 100  PHE B CG    1 
ATOM   1442  C  CD1   . PHE B 2 100 ? -39.736 -20.869 39.540 1.00 44.59  ? 100  PHE B CD1   1 
ATOM   1443  C  CD2   . PHE B 2 100 ? -41.558 -19.665 38.565 1.00 43.84  ? 100  PHE B CD2   1 
ATOM   1444  C  CE1   . PHE B 2 100 ? -40.476 -21.055 40.714 1.00 44.12  ? 100  PHE B CE1   1 
ATOM   1445  C  CE2   . PHE B 2 100 ? -42.311 -19.849 39.730 1.00 44.05  ? 100  PHE B CE2   1 
ATOM   1446  C  CZ    . PHE B 2 100 ? -41.774 -20.544 40.805 1.00 43.58  ? 100  PHE B CZ    1 
ATOM   1447  N  N     . GLY B 2 101 ? -38.369 -21.661 34.142 1.00 50.03  ? 101  GLY B N     1 
ATOM   1448  C  CA    . GLY B 2 101 ? -37.769 -21.418 32.823 1.00 51.69  ? 101  GLY B CA    1 
ATOM   1449  C  C     . GLY B 2 101 ? -36.253 -21.504 32.857 1.00 53.01  ? 101  GLY B C     1 
ATOM   1450  O  O     . GLY B 2 101 ? -35.651 -21.605 33.931 1.00 53.44  ? 101  GLY B O     1 
ATOM   1451  N  N     . GLY B 2 102 ? -35.626 -21.464 31.687 1.00 53.65  ? 102  GLY B N     1 
ATOM   1452  C  CA    . GLY B 2 102 ? -34.167 -21.538 31.604 1.00 54.56  ? 102  GLY B CA    1 
ATOM   1453  C  C     . GLY B 2 102 ? -33.600 -22.938 31.775 1.00 55.12  ? 102  GLY B C     1 
ATOM   1454  O  O     . GLY B 2 102 ? -32.431 -23.094 32.151 1.00 55.61  ? 102  GLY B O     1 
ATOM   1455  O  OXT   . GLY B 2 102 ? -34.273 -23.948 31.535 1.00 55.26  ? 102  GLY B OXT   1 
ATOM   1456  N  N     . ALA C 3 14  ? -0.201  7.201   12.946 1.00 71.76  ? 14   ALA C N     1 
ATOM   1457  C  CA    . ALA C 3 14  ? -0.586  5.898   13.578 1.00 71.95  ? 14   ALA C CA    1 
ATOM   1458  C  C     . ALA C 3 14  ? -0.580  5.956   15.112 1.00 71.81  ? 14   ALA C C     1 
ATOM   1459  O  O     . ALA C 3 14  ? 0.439   5.682   15.761 1.00 71.88  ? 14   ALA C O     1 
ATOM   1460  C  CB    . ALA C 3 14  ? 0.316   4.759   13.074 1.00 71.93  ? 14   ALA C CB    1 
ATOM   1461  N  N     . LYS C 3 15  ? -1.724  6.322   15.681 1.00 71.34  ? 15   LYS C N     1 
ATOM   1462  C  CA    . LYS C 3 15  ? -1.894  6.316   17.128 1.00 71.02  ? 15   LYS C CA    1 
ATOM   1463  C  C     . LYS C 3 15  ? -2.624  5.053   17.593 1.00 70.20  ? 15   LYS C C     1 
ATOM   1464  O  O     . LYS C 3 15  ? -3.721  4.746   17.101 1.00 70.35  ? 15   LYS C O     1 
ATOM   1465  C  CB    . LYS C 3 15  ? -2.633  7.574   17.584 1.00 71.24  ? 15   LYS C CB    1 
ATOM   1466  C  CG    . LYS C 3 15  ? -1.739  8.802   17.629 1.00 72.89  ? 15   LYS C CG    1 
ATOM   1467  C  CD    . LYS C 3 15  ? -2.540  10.065  17.867 1.00 75.80  ? 15   LYS C CD    1 
ATOM   1468  C  CE    . LYS C 3 15  ? -1.641  11.298  17.798 1.00 77.44  ? 15   LYS C CE    1 
ATOM   1469  N  NZ    . LYS C 3 15  ? -2.352  12.537  18.245 1.00 78.53  ? 15   LYS C NZ    1 
ATOM   1470  N  N     . THR C 3 16  ? -2.014  4.329   18.536 1.00 68.81  ? 16   THR C N     1 
ATOM   1471  C  CA    . THR C 3 16  ? -2.638  3.137   19.126 1.00 67.30  ? 16   THR C CA    1 
ATOM   1472  C  C     . THR C 3 16  ? -4.042  3.459   19.626 1.00 66.21  ? 16   THR C C     1 
ATOM   1473  O  O     . THR C 3 16  ? -4.349  4.607   19.963 1.00 65.89  ? 16   THR C O     1 
ATOM   1474  C  CB    . THR C 3 16  ? -1.833  2.560   20.318 1.00 67.17  ? 16   THR C CB    1 
ATOM   1475  O  OG1   . THR C 3 16  ? -1.909  3.453   21.435 1.00 67.29  ? 16   THR C OG1   1 
ATOM   1476  C  CG2   . THR C 3 16  ? -0.383  2.323   19.949 1.00 67.17  ? 16   THR C CG2   1 
ATOM   1477  N  N     . ARG C 3 17  ? -4.887  2.435   19.679 1.00 64.89  ? 17   ARG C N     1 
ATOM   1478  C  CA    . ARG C 3 17  ? -6.241  2.581   20.209 1.00 63.63  ? 17   ARG C CA    1 
ATOM   1479  C  C     . ARG C 3 17  ? -6.228  2.842   21.710 1.00 62.64  ? 17   ARG C C     1 
ATOM   1480  O  O     . ARG C 3 17  ? -7.184  3.388   22.268 1.00 62.39  ? 17   ARG C O     1 
ATOM   1481  C  CB    . ARG C 3 17  ? -7.055  1.333   19.908 1.00 63.76  ? 17   ARG C CB    1 
ATOM   1482  C  CG    . ARG C 3 17  ? -7.362  1.167   18.442 1.00 63.49  ? 17   ARG C CG    1 
ATOM   1483  C  CD    . ARG C 3 17  ? -8.601  0.342   18.278 1.00 62.03  ? 17   ARG C CD    1 
ATOM   1484  N  NE    . ARG C 3 17  ? -8.299  -1.082  18.265 1.00 60.67  ? 17   ARG C NE    1 
ATOM   1485  C  CZ    . ARG C 3 17  ? -9.205  -2.029  18.472 1.00 60.12  ? 17   ARG C CZ    1 
ATOM   1486  N  NH1   . ARG C 3 17  ? -10.472 -1.705  18.729 1.00 60.38  ? 17   ARG C NH1   1 
ATOM   1487  N  NH2   . ARG C 3 17  ? -8.839  -3.296  18.434 1.00 58.96  ? 17   ARG C NH2   1 
ATOM   1488  N  N     . SER C 3 18  ? -5.139  2.432   22.354 1.00 61.65  ? 18   SER C N     1 
ATOM   1489  C  CA    . SER C 3 18  ? -4.894  2.741   23.758 1.00 60.86  ? 18   SER C CA    1 
ATOM   1490  C  C     . SER C 3 18  ? -4.706  4.246   23.974 1.00 60.15  ? 18   SER C C     1 
ATOM   1491  O  O     . SER C 3 18  ? -5.405  4.843   24.793 1.00 59.89  ? 18   SER C O     1 
ATOM   1492  C  CB    . SER C 3 18  ? -3.686  1.958   24.276 1.00 60.86  ? 18   SER C CB    1 
ATOM   1493  O  OG    . SER C 3 18  ? -3.972  0.578   24.333 1.00 60.17  ? 18   SER C OG    1 
ATOM   1494  N  N     . SER C 3 19  ? -3.781  4.855   23.225 1.00 59.76  ? 19   SER C N     1 
ATOM   1495  C  CA    . SER C 3 19  ? -3.600  6.319   23.283 1.00 59.25  ? 19   SER C CA    1 
ATOM   1496  C  C     . SER C 3 19  ? -4.846  7.089   22.835 1.00 58.52  ? 19   SER C C     1 
ATOM   1497  O  O     . SER C 3 19  ? -5.152  8.136   23.397 1.00 58.47  ? 19   SER C O     1 
ATOM   1498  C  CB    . SER C 3 19  ? -2.327  6.783   22.546 1.00 59.18  ? 19   SER C CB    1 
ATOM   1499  O  OG    . SER C 3 19  ? -2.113  6.081   21.332 1.00 59.11  ? 19   SER C OG    1 
ATOM   1500  N  N     . ARG C 3 20  ? -5.576  6.546   21.861 1.00 58.00  ? 20   ARG C N     1 
ATOM   1501  C  CA    . ARG C 3 20  ? -6.869  7.101   21.448 1.00 58.08  ? 20   ARG C CA    1 
ATOM   1502  C  C     . ARG C 3 20  ? -7.892  7.161   22.580 1.00 57.37  ? 20   ARG C C     1 
ATOM   1503  O  O     . ARG C 3 20  ? -8.664  8.122   22.674 1.00 57.52  ? 20   ARG C O     1 
ATOM   1504  C  CB    . ARG C 3 20  ? -7.474  6.306   20.282 1.00 58.59  ? 20   ARG C CB    1 
ATOM   1505  C  CG    . ARG C 3 20  ? -6.819  6.514   18.917 1.00 60.68  ? 20   ARG C CG    1 
ATOM   1506  C  CD    . ARG C 3 20  ? -7.709  5.947   17.811 1.00 64.54  ? 20   ARG C CD    1 
ATOM   1507  N  NE    . ARG C 3 20  ? -6.944  5.570   16.619 1.00 68.55  ? 20   ARG C NE    1 
ATOM   1508  C  CZ    . ARG C 3 20  ? -6.643  6.399   15.612 1.00 71.19  ? 20   ARG C CZ    1 
ATOM   1509  N  NH1   . ARG C 3 20  ? -7.031  7.677   15.636 1.00 71.39  ? 20   ARG C NH1   1 
ATOM   1510  N  NH2   . ARG C 3 20  ? -5.946  5.949   14.571 1.00 72.29  ? 20   ARG C NH2   1 
ATOM   1511  N  N     . ALA C 3 21  ? -7.910  6.124   23.418 1.00 56.63  ? 21   ALA C N     1 
ATOM   1512  C  CA    . ALA C 3 21  ? -8.832  6.056   24.561 1.00 55.92  ? 21   ALA C CA    1 
ATOM   1513  C  C     . ALA C 3 21  ? -8.220  6.628   25.837 1.00 55.19  ? 21   ALA C C     1 
ATOM   1514  O  O     . ALA C 3 21  ? -8.921  6.832   26.824 1.00 55.71  ? 21   ALA C O     1 
ATOM   1515  C  CB    . ALA C 3 21  ? -9.303  4.625   24.790 1.00 55.86  ? 21   ALA C CB    1 
ATOM   1516  N  N     . GLY C 3 22  ? -6.918  6.895   25.803 1.00 54.21  ? 22   GLY C N     1 
ATOM   1517  C  CA    . GLY C 3 22  ? -6.212  7.483   26.936 1.00 53.05  ? 22   GLY C CA    1 
ATOM   1518  C  C     . GLY C 3 22  ? -5.895  6.453   28.001 1.00 52.27  ? 22   GLY C C     1 
ATOM   1519  O  O     . GLY C 3 22  ? -6.055  6.712   29.198 1.00 51.95  ? 22   GLY C O     1 
ATOM   1520  N  N     . LEU C 3 23  ? -5.424  5.291   27.549 1.00 51.53  ? 23   LEU C N     1 
ATOM   1521  C  CA    . LEU C 3 23  ? -5.227  4.129   28.405 1.00 50.65  ? 23   LEU C CA    1 
ATOM   1522  C  C     . LEU C 3 23  ? -3.826  3.553   28.319 1.00 50.41  ? 23   LEU C C     1 
ATOM   1523  O  O     . LEU C 3 23  ? -3.193  3.570   27.266 1.00 50.30  ? 23   LEU C O     1 
ATOM   1524  C  CB    . LEU C 3 23  ? -6.250  3.040   28.066 1.00 50.42  ? 23   LEU C CB    1 
ATOM   1525  C  CG    . LEU C 3 23  ? -7.738  3.324   28.294 1.00 49.85  ? 23   LEU C CG    1 
ATOM   1526  C  CD1   . LEU C 3 23  ? -8.539  2.118   27.867 1.00 49.68  ? 23   LEU C CD1   1 
ATOM   1527  C  CD2   . LEU C 3 23  ? -8.057  3.688   29.738 1.00 48.18  ? 23   LEU C CD2   1 
ATOM   1528  N  N     . GLN C 3 24  ? -3.354  3.047   29.454 1.00 50.41  ? 24   GLN C N     1 
ATOM   1529  C  CA    . GLN C 3 24  ? -2.086  2.340   29.540 1.00 50.26  ? 24   GLN C CA    1 
ATOM   1530  C  C     . GLN C 3 24  ? -2.264  0.901   29.092 1.00 50.34  ? 24   GLN C C     1 
ATOM   1531  O  O     . GLN C 3 24  ? -1.383  0.326   28.451 1.00 50.53  ? 24   GLN C O     1 
ATOM   1532  C  CB    . GLN C 3 24  ? -1.578  2.359   30.981 1.00 50.75  ? 24   GLN C CB    1 
ATOM   1533  C  CG    . GLN C 3 24  ? -1.456  3.752   31.597 1.00 50.20  ? 24   GLN C CG    1 
ATOM   1534  C  CD    . GLN C 3 24  ? -0.546  4.656   30.790 1.00 49.83  ? 24   GLN C CD    1 
ATOM   1535  O  OE1   . GLN C 3 24  ? 0.577   4.281   30.439 1.00 48.70  ? 24   GLN C OE1   1 
ATOM   1536  N  NE2   . GLN C 3 24  ? -1.035  5.851   30.480 1.00 50.56  ? 24   GLN C NE2   1 
ATOM   1537  N  N     . PHE C 3 25  ? -3.414  0.328   29.432 1.00 50.16  ? 25   PHE C N     1 
ATOM   1538  C  CA    . PHE C 3 25  ? -3.715  -1.058  29.109 1.00 50.31  ? 25   PHE C CA    1 
ATOM   1539  C  C     . PHE C 3 25  ? -3.978  -1.250  27.617 1.00 50.39  ? 25   PHE C C     1 
ATOM   1540  O  O     . PHE C 3 25  ? -4.538  -0.366  26.979 1.00 50.46  ? 25   PHE C O     1 
ATOM   1541  C  CB    . PHE C 3 25  ? -4.873  -1.573  29.976 1.00 50.32  ? 25   PHE C CB    1 
ATOM   1542  C  CG    . PHE C 3 25  ? -4.417  -2.286  31.214 1.00 49.89  ? 25   PHE C CG    1 
ATOM   1543  C  CD1   . PHE C 3 25  ? -3.571  -1.662  32.121 1.00 49.42  ? 25   PHE C CD1   1 
ATOM   1544  C  CD2   . PHE C 3 25  ? -4.814  -3.594  31.465 1.00 50.15  ? 25   PHE C CD2   1 
ATOM   1545  C  CE1   . PHE C 3 25  ? -3.137  -2.322  33.258 1.00 49.44  ? 25   PHE C CE1   1 
ATOM   1546  C  CE2   . PHE C 3 25  ? -4.383  -4.268  32.609 1.00 48.80  ? 25   PHE C CE2   1 
ATOM   1547  C  CZ    . PHE C 3 25  ? -3.546  -3.636  33.501 1.00 48.83  ? 25   PHE C CZ    1 
ATOM   1548  N  N     . PRO C 3 26  ? -3.553  -2.404  27.059 1.00 50.44  ? 26   PRO C N     1 
ATOM   1549  C  CA    . PRO C 3 26  ? -3.552  -2.643  25.614 1.00 50.30  ? 26   PRO C CA    1 
ATOM   1550  C  C     . PRO C 3 26  ? -4.916  -2.991  25.052 1.00 50.54  ? 26   PRO C C     1 
ATOM   1551  O  O     . PRO C 3 26  ? -5.381  -4.122  25.209 1.00 50.52  ? 26   PRO C O     1 
ATOM   1552  C  CB    . PRO C 3 26  ? -2.586  -3.817  25.450 1.00 50.21  ? 26   PRO C CB    1 
ATOM   1553  C  CG    . PRO C 3 26  ? -2.655  -4.536  26.718 1.00 50.55  ? 26   PRO C CG    1 
ATOM   1554  C  CD    . PRO C 3 26  ? -2.936  -3.523  27.795 1.00 50.47  ? 26   PRO C CD    1 
ATOM   1555  N  N     . VAL C 3 27  ? -5.543  -2.021  24.391 1.00 50.56  ? 27   VAL C N     1 
ATOM   1556  C  CA    . VAL C 3 27  ? -6.854  -2.222  23.785 1.00 50.63  ? 27   VAL C CA    1 
ATOM   1557  C  C     . VAL C 3 27  ? -6.792  -3.284  22.685 1.00 50.88  ? 27   VAL C C     1 
ATOM   1558  O  O     . VAL C 3 27  ? -7.721  -4.073  22.531 1.00 50.78  ? 27   VAL C O     1 
ATOM   1559  C  CB    . VAL C 3 27  ? -7.439  -0.901  23.233 1.00 50.50  ? 27   VAL C CB    1 
ATOM   1560  C  CG1   . VAL C 3 27  ? -8.734  -1.155  22.467 1.00 50.41  ? 27   VAL C CG1   1 
ATOM   1561  C  CG2   . VAL C 3 27  ? -7.677  0.089   24.367 1.00 50.18  ? 27   VAL C CG2   1 
ATOM   1562  N  N     . GLY C 3 28  ? -5.691  -3.300  21.933 1.00 51.23  ? 28   GLY C N     1 
ATOM   1563  C  CA    . GLY C 3 28  ? -5.516  -4.250  20.843 1.00 51.47  ? 28   GLY C CA    1 
ATOM   1564  C  C     . GLY C 3 28  ? -5.513  -5.676  21.357 1.00 51.67  ? 28   GLY C C     1 
ATOM   1565  O  O     . GLY C 3 28  ? -6.250  -6.523  20.875 1.00 51.69  ? 28   GLY C O     1 
ATOM   1566  N  N     . ARG C 3 29  ? -4.676  -5.923  22.355 1.00 52.20  ? 29   ARG C N     1 
ATOM   1567  C  CA    . ARG C 3 29  ? -4.614  -7.201  23.052 1.00 52.39  ? 29   ARG C CA    1 
ATOM   1568  C  C     . ARG C 3 29  ? -5.992  -7.637  23.559 1.00 52.75  ? 29   ARG C C     1 
ATOM   1569  O  O     . ARG C 3 29  ? -6.399  -8.776  23.356 1.00 53.10  ? 29   ARG C O     1 
ATOM   1570  C  CB    . ARG C 3 29  ? -3.648  -7.092  24.226 1.00 52.01  ? 29   ARG C CB    1 
ATOM   1571  C  CG    . ARG C 3 29  ? -3.331  -8.413  24.889 1.00 52.39  ? 29   ARG C CG    1 
ATOM   1572  C  CD    . ARG C 3 29  ? -1.877  -8.765  24.679 1.00 53.30  ? 29   ARG C CD    1 
ATOM   1573  N  NE    . ARG C 3 29  ? -1.119  -8.584  25.906 1.00 53.36  ? 29   ARG C NE    1 
ATOM   1574  C  CZ    . ARG C 3 29  ? 0.210   -8.565  25.987 1.00 54.44  ? 29   ARG C CZ    1 
ATOM   1575  N  NH1   . ARG C 3 29  ? 0.964   -8.698  24.905 1.00 53.21  ? 29   ARG C NH1   1 
ATOM   1576  N  NH2   . ARG C 3 29  ? 0.788   -8.401  27.170 1.00 55.44  ? 29   ARG C NH2   1 
ATOM   1577  N  N     . VAL C 3 30  ? -6.707  -6.728  24.208 1.00 52.93  ? 30   VAL C N     1 
ATOM   1578  C  CA    . VAL C 3 30  ? -8.014  -7.051  24.760 1.00 53.45  ? 30   VAL C CA    1 
ATOM   1579  C  C     . VAL C 3 30  ? -9.061  -7.356  23.677 1.00 54.34  ? 30   VAL C C     1 
ATOM   1580  O  O     . VAL C 3 30  ? -9.892  -8.249  23.867 1.00 54.70  ? 30   VAL C O     1 
ATOM   1581  C  CB    . VAL C 3 30  ? -8.509  -5.962  25.747 1.00 53.19  ? 30   VAL C CB    1 
ATOM   1582  C  CG1   . VAL C 3 30  ? -9.941  -6.240  26.205 1.00 52.58  ? 30   VAL C CG1   1 
ATOM   1583  C  CG2   . VAL C 3 30  ? -7.579  -5.883  26.941 1.00 51.93  ? 30   VAL C CG2   1 
ATOM   1584  N  N     . HIS C 3 31  ? -9.017  -6.640  22.550 1.00 55.20  ? 31   HIS C N     1 
ATOM   1585  C  CA    . HIS C 3 31  ? -9.942  -6.900  21.439 1.00 55.88  ? 31   HIS C CA    1 
ATOM   1586  C  C     . HIS C 3 31  ? -9.726  -8.314  20.960 1.00 56.15  ? 31   HIS C C     1 
ATOM   1587  O  O     . HIS C 3 31  ? -10.680 -9.056  20.732 1.00 56.05  ? 31   HIS C O     1 
ATOM   1588  C  CB    . HIS C 3 31  ? -9.710  -5.948  20.264 1.00 56.09  ? 31   HIS C CB    1 
ATOM   1589  C  CG    . HIS C 3 31  ? -10.911 -5.765  19.385 1.00 57.33  ? 31   HIS C CG    1 
ATOM   1590  N  ND1   . HIS C 3 31  ? -11.929 -6.691  19.306 1.00 59.15  ? 31   HIS C ND1   1 
ATOM   1591  C  CD2   . HIS C 3 31  ? -11.254 -4.761  18.543 1.00 58.52  ? 31   HIS C CD2   1 
ATOM   1592  C  CE1   . HIS C 3 31  ? -12.856 -6.257  18.470 1.00 58.83  ? 31   HIS C CE1   1 
ATOM   1593  N  NE2   . HIS C 3 31  ? -12.465 -5.094  17.983 1.00 58.99  ? 31   HIS C NE2   1 
ATOM   1594  N  N     . ARG C 3 32  ? -8.452  -8.673  20.834 1.00 56.37  ? 32   ARG C N     1 
ATOM   1595  C  CA    . ARG C 3 32  ? -8.041  -9.959  20.316 1.00 56.75  ? 32   ARG C CA    1 
ATOM   1596  C  C     . ARG C 3 32  ? -8.498  -11.095 21.221 1.00 56.77  ? 32   ARG C C     1 
ATOM   1597  O  O     . ARG C 3 32  ? -9.080  -12.070 20.748 1.00 57.08  ? 32   ARG C O     1 
ATOM   1598  C  CB    . ARG C 3 32  ? -6.523  -9.994  20.167 1.00 56.90  ? 32   ARG C CB    1 
ATOM   1599  C  CG    . ARG C 3 32  ? -6.052  -11.079 19.240 1.00 58.08  ? 32   ARG C CG    1 
ATOM   1600  C  CD    . ARG C 3 32  ? -4.552  -11.146 19.183 1.00 61.00  ? 32   ARG C CD    1 
ATOM   1601  N  NE    . ARG C 3 32  ? -4.016  -11.799 20.370 1.00 61.78  ? 32   ARG C NE    1 
ATOM   1602  C  CZ    . ARG C 3 32  ? -3.111  -11.263 21.182 1.00 63.33  ? 32   ARG C CZ    1 
ATOM   1603  N  NH1   . ARG C 3 32  ? -2.609  -10.054 20.952 1.00 64.58  ? 32   ARG C NH1   1 
ATOM   1604  N  NH2   . ARG C 3 32  ? -2.698  -11.947 22.231 1.00 63.45  ? 32   ARG C NH2   1 
ATOM   1605  N  N     . LEU C 3 33  ? -8.232  -10.962 22.518 1.00 56.61  ? 33   LEU C N     1 
ATOM   1606  C  CA    . LEU C 3 33  ? -8.631  -11.973 23.492 1.00 56.36  ? 33   LEU C CA    1 
ATOM   1607  C  C     . LEU C 3 33  ? -10.149 -12.174 23.553 1.00 56.65  ? 33   LEU C C     1 
ATOM   1608  O  O     . LEU C 3 33  ? -10.603 -13.281 23.829 1.00 56.70  ? 33   LEU C O     1 
ATOM   1609  C  CB    . LEU C 3 33  ? -8.083  -11.655 24.882 1.00 55.91  ? 33   LEU C CB    1 
ATOM   1610  C  CG    . LEU C 3 33  ? -6.565  -11.609 25.090 1.00 55.65  ? 33   LEU C CG    1 
ATOM   1611  C  CD1   . LEU C 3 33  ? -6.259  -10.989 26.439 1.00 54.72  ? 33   LEU C CD1   1 
ATOM   1612  C  CD2   . LEU C 3 33  ? -5.917  -12.981 24.973 1.00 53.91  ? 33   LEU C CD2   1 
ATOM   1613  N  N     . LEU C 3 34  ? -10.926 -11.121 23.296 1.00 56.81  ? 34   LEU C N     1 
ATOM   1614  C  CA    . LEU C 3 34  ? -12.384 -11.248 23.266 1.00 57.24  ? 34   LEU C CA    1 
ATOM   1615  C  C     . LEU C 3 34  ? -12.859 -12.096 22.085 1.00 57.91  ? 34   LEU C C     1 
ATOM   1616  O  O     . LEU C 3 34  ? -13.854 -12.812 22.196 1.00 57.83  ? 34   LEU C O     1 
ATOM   1617  C  CB    . LEU C 3 34  ? -13.074 -9.880  23.249 1.00 56.89  ? 34   LEU C CB    1 
ATOM   1618  C  CG    . LEU C 3 34  ? -13.197 -9.074  24.554 1.00 56.53  ? 34   LEU C CG    1 
ATOM   1619  C  CD1   . LEU C 3 34  ? -13.888 -7.730  24.304 1.00 54.65  ? 34   LEU C CD1   1 
ATOM   1620  C  CD2   . LEU C 3 34  ? -13.923 -9.838  25.662 1.00 54.58  ? 34   LEU C CD2   1 
ATOM   1621  N  N     . ARG C 3 35  ? -12.133 -12.013 20.966 1.00 58.76  ? 35   ARG C N     1 
ATOM   1622  C  CA    . ARG C 3 35  ? -12.424 -12.809 19.770 1.00 59.50  ? 35   ARG C CA    1 
ATOM   1623  C  C     . ARG C 3 35  ? -12.058 -14.277 19.956 1.00 59.65  ? 35   ARG C C     1 
ATOM   1624  O  O     . ARG C 3 35  ? -12.900 -15.157 19.769 1.00 59.73  ? 35   ARG C O     1 
ATOM   1625  C  CB    . ARG C 3 35  ? -11.674 -12.266 18.555 1.00 59.63  ? 35   ARG C CB    1 
ATOM   1626  C  CG    . ARG C 3 35  ? -11.962 -10.824 18.220 1.00 60.53  ? 35   ARG C CG    1 
ATOM   1627  C  CD    . ARG C 3 35  ? -11.463 -10.511 16.824 1.00 62.20  ? 35   ARG C CD    1 
ATOM   1628  N  NE    . ARG C 3 35  ? -11.656 -9.107  16.466 1.00 65.00  ? 35   ARG C NE    1 
ATOM   1629  C  CZ    . ARG C 3 35  ? -12.817 -8.559  16.104 1.00 65.46  ? 35   ARG C CZ    1 
ATOM   1630  N  NH1   . ARG C 3 35  ? -13.929 -9.279  16.068 1.00 65.82  ? 35   ARG C NH1   1 
ATOM   1631  N  NH2   . ARG C 3 35  ? -12.869 -7.272  15.784 1.00 66.25  ? 35   ARG C NH2   1 
ATOM   1632  N  N     . LYS C 3 36  ? -10.801 -14.530 20.326 1.00 59.99  ? 36   LYS C N     1 
ATOM   1633  C  CA    . LYS C 3 36  ? -10.282 -15.892 20.471 1.00 60.49  ? 36   LYS C CA    1 
ATOM   1634  C  C     . LYS C 3 36  ? -11.000 -16.633 21.606 1.00 60.19  ? 36   LYS C C     1 
ATOM   1635  O  O     . LYS C 3 36  ? -10.914 -17.857 21.720 1.00 60.48  ? 36   LYS C O     1 
ATOM   1636  C  CB    . LYS C 3 36  ? -8.750  -15.881 20.686 1.00 60.77  ? 36   LYS C CB    1 
ATOM   1637  C  CG    . LYS C 3 36  ? -8.279  -16.141 22.137 1.00 62.31  ? 36   LYS C CG    1 
ATOM   1638  C  CD    . LYS C 3 36  ? -6.835  -15.699 22.415 1.00 64.76  ? 36   LYS C CD    1 
ATOM   1639  C  CE    . LYS C 3 36  ? -5.787  -16.552 21.676 1.00 66.66  ? 36   LYS C CE    1 
ATOM   1640  N  NZ    . LYS C 3 36  ? -4.395  -16.188 22.108 1.00 67.00  ? 36   LYS C NZ    1 
ATOM   1641  N  N     . GLY C 3 37  ? -11.728 -15.883 22.425 1.00 59.80  ? 37   GLY C N     1 
ATOM   1642  C  CA    . GLY C 3 37  ? -12.295 -16.420 23.649 1.00 59.15  ? 37   GLY C CA    1 
ATOM   1643  C  C     . GLY C 3 37  ? -13.671 -17.039 23.531 1.00 58.83  ? 37   GLY C C     1 
ATOM   1644  O  O     . GLY C 3 37  ? -14.190 -17.588 24.511 1.00 58.54  ? 37   GLY C O     1 
ATOM   1645  N  N     . ASN C 3 38  ? -14.262 -16.951 22.340 1.00 58.46  ? 38   ASN C N     1 
ATOM   1646  C  CA    . ASN C 3 38  ? -15.578 -17.543 22.080 1.00 58.26  ? 38   ASN C CA    1 
ATOM   1647  C  C     . ASN C 3 38  ? -16.614 -17.053 23.086 1.00 57.47  ? 38   ASN C C     1 
ATOM   1648  O  O     . ASN C 3 38  ? -17.188 -17.834 23.850 1.00 57.10  ? 38   ASN C O     1 
ATOM   1649  C  CB    . ASN C 3 38  ? -15.510 -19.081 22.095 1.00 58.75  ? 38   ASN C CB    1 
ATOM   1650  C  CG    . ASN C 3 38  ? -14.571 -19.634 21.035 1.00 60.71  ? 38   ASN C CG    1 
ATOM   1651  O  OD1   . ASN C 3 38  ? -13.508 -20.179 21.360 1.00 62.73  ? 38   ASN C OD1   1 
ATOM   1652  N  ND2   . ASN C 3 38  ? -14.949 -19.482 19.753 1.00 61.71  ? 38   ASN C ND2   1 
ATOM   1653  N  N     . TYR C 3 39  ? -16.834 -15.745 23.092 1.00 56.43  ? 39   TYR C N     1 
ATOM   1654  C  CA    . TYR C 3 39  ? -17.805 -15.161 23.985 1.00 55.44  ? 39   TYR C CA    1 
ATOM   1655  C  C     . TYR C 3 39  ? -19.085 -14.815 23.240 1.00 55.70  ? 39   TYR C C     1 
ATOM   1656  O  O     . TYR C 3 39  ? -20.172 -14.890 23.808 1.00 55.34  ? 39   TYR C O     1 
ATOM   1657  C  CB    . TYR C 3 39  ? -17.209 -13.944 24.683 1.00 54.91  ? 39   TYR C CB    1 
ATOM   1658  C  CG    . TYR C 3 39  ? -16.035 -14.264 25.590 1.00 52.44  ? 39   TYR C CG    1 
ATOM   1659  C  CD1   . TYR C 3 39  ? -14.730 -13.905 25.235 1.00 49.74  ? 39   TYR C CD1   1 
ATOM   1660  C  CD2   . TYR C 3 39  ? -16.231 -14.921 26.806 1.00 49.45  ? 39   TYR C CD2   1 
ATOM   1661  C  CE1   . TYR C 3 39  ? -13.656 -14.194 26.068 1.00 48.08  ? 39   TYR C CE1   1 
ATOM   1662  C  CE2   . TYR C 3 39  ? -15.167 -15.219 27.639 1.00 48.04  ? 39   TYR C CE2   1 
ATOM   1663  C  CZ    . TYR C 3 39  ? -13.886 -14.852 27.265 1.00 48.53  ? 39   TYR C CZ    1 
ATOM   1664  O  OH    . TYR C 3 39  ? -12.836 -15.138 28.102 1.00 49.89  ? 39   TYR C OH    1 
ATOM   1665  N  N     . ALA C 3 40  ? -18.946 -14.453 21.966 1.00 56.17  ? 40   ALA C N     1 
ATOM   1666  C  CA    . ALA C 3 40  ? -20.078 -14.150 21.093 1.00 57.12  ? 40   ALA C CA    1 
ATOM   1667  C  C     . ALA C 3 40  ? -19.615 -14.204 19.656 1.00 57.90  ? 40   ALA C C     1 
ATOM   1668  O  O     . ALA C 3 40  ? -18.416 -14.323 19.392 1.00 57.84  ? 40   ALA C O     1 
ATOM   1669  C  CB    . ALA C 3 40  ? -20.665 -12.778 21.409 1.00 56.97  ? 40   ALA C CB    1 
ATOM   1670  N  N     . GLU C 3 41  ? -20.559 -14.134 18.718 1.00 59.13  ? 41   GLU C N     1 
ATOM   1671  C  CA    . GLU C 3 41  ? -20.199 -14.077 17.298 1.00 60.10  ? 41   GLU C CA    1 
ATOM   1672  C  C     . GLU C 3 41  ? -19.401 -12.816 16.999 1.00 59.79  ? 41   GLU C C     1 
ATOM   1673  O  O     . GLU C 3 41  ? -18.381 -12.868 16.320 1.00 59.87  ? 41   GLU C O     1 
ATOM   1674  C  CB    . GLU C 3 41  ? -21.443 -14.127 16.402 1.00 60.62  ? 41   GLU C CB    1 
ATOM   1675  C  CG    . GLU C 3 41  ? -22.127 -15.484 16.366 1.00 63.75  ? 41   GLU C CG    1 
ATOM   1676  C  CD    . GLU C 3 41  ? -21.145 -16.620 16.122 1.00 68.13  ? 41   GLU C CD    1 
ATOM   1677  O  OE1   . GLU C 3 41  ? -20.454 -16.592 15.076 1.00 70.49  ? 41   GLU C OE1   1 
ATOM   1678  O  OE2   . GLU C 3 41  ? -21.063 -17.539 16.974 1.00 68.98  ? 41   GLU C OE2   1 
ATOM   1679  N  N     . ARG C 3 42  ? -19.871 -11.688 17.523 1.00 59.62  ? 42   ARG C N     1 
ATOM   1680  C  CA    . ARG C 3 42  ? -19.294 -10.397 17.194 1.00 59.47  ? 42   ARG C CA    1 
ATOM   1681  C  C     . ARG C 3 42  ? -18.815 -9.663  18.438 1.00 58.91  ? 42   ARG C C     1 
ATOM   1682  O  O     . ARG C 3 42  ? -19.383 -9.822  19.523 1.00 58.82  ? 42   ARG C O     1 
ATOM   1683  C  CB    . ARG C 3 42  ? -20.323 -9.541  16.449 1.00 59.80  ? 42   ARG C CB    1 
ATOM   1684  C  CG    . ARG C 3 42  ? -20.841 -10.169 15.169 1.00 60.84  ? 42   ARG C CG    1 
ATOM   1685  C  CD    . ARG C 3 42  ? -21.709 -9.220  14.382 1.00 63.46  ? 42   ARG C CD    1 
ATOM   1686  N  NE    . ARG C 3 42  ? -21.719 -9.609  12.977 1.00 65.69  ? 42   ARG C NE    1 
ATOM   1687  C  CZ    . ARG C 3 42  ? -22.140 -8.842  11.976 1.00 67.12  ? 42   ARG C CZ    1 
ATOM   1688  N  NH1   . ARG C 3 42  ? -22.603 -7.614  12.207 1.00 67.72  ? 42   ARG C NH1   1 
ATOM   1689  N  NH2   . ARG C 3 42  ? -22.101 -9.313  10.734 1.00 67.51  ? 42   ARG C NH2   1 
ATOM   1690  N  N     . VAL C 3 43  ? -17.779 -8.849  18.264 1.00 58.16  ? 43   VAL C N     1 
ATOM   1691  C  CA    . VAL C 3 43  ? -17.310 -7.956  19.317 1.00 57.58  ? 43   VAL C CA    1 
ATOM   1692  C  C     . VAL C 3 43  ? -17.392 -6.513  18.834 1.00 56.74  ? 43   VAL C C     1 
ATOM   1693  O  O     . VAL C 3 43  ? -16.751 -6.143  17.855 1.00 56.77  ? 43   VAL C O     1 
ATOM   1694  C  CB    . VAL C 3 43  ? -15.853 -8.281  19.756 1.00 57.77  ? 43   VAL C CB    1 
ATOM   1695  C  CG1   . VAL C 3 43  ? -15.450 -7.442  20.950 1.00 57.40  ? 43   VAL C CG1   1 
ATOM   1696  C  CG2   . VAL C 3 43  ? -15.704 -9.756  20.087 1.00 58.05  ? 43   VAL C CG2   1 
ATOM   1697  N  N     . GLY C 3 44  ? -18.195 -5.709  19.525 1.00 56.08  ? 44   GLY C N     1 
ATOM   1698  C  CA    . GLY C 3 44  ? -18.255 -4.265  19.291 1.00 54.98  ? 44   GLY C CA    1 
ATOM   1699  C  C     . GLY C 3 44  ? -16.924 -3.576  19.552 1.00 54.36  ? 44   GLY C C     1 
ATOM   1700  O  O     . GLY C 3 44  ? -16.137 -4.022  20.394 1.00 54.14  ? 44   GLY C O     1 
ATOM   1701  N  N     . ALA C 3 45  ? -16.681 -2.487  18.824 1.00 53.51  ? 45   ALA C N     1 
ATOM   1702  C  CA    . ALA C 3 45  ? -15.415 -1.746  18.883 1.00 52.45  ? 45   ALA C CA    1 
ATOM   1703  C  C     . ALA C 3 45  ? -15.159 -1.065  20.237 1.00 51.50  ? 45   ALA C C     1 
ATOM   1704  O  O     . ALA C 3 45  ? -14.010 -0.871  20.623 1.00 51.67  ? 45   ALA C O     1 
ATOM   1705  C  CB    . ALA C 3 45  ? -15.352 -0.716  17.739 1.00 52.59  ? 45   ALA C CB    1 
ATOM   1706  N  N     . GLY C 3 46  ? -16.226 -0.700  20.938 1.00 50.17  ? 46   GLY C N     1 
ATOM   1707  C  CA    . GLY C 3 46  ? -16.104 -0.055  22.231 1.00 49.23  ? 46   GLY C CA    1 
ATOM   1708  C  C     . GLY C 3 46  ? -15.887 -1.038  23.371 1.00 48.53  ? 46   GLY C C     1 
ATOM   1709  O  O     . GLY C 3 46  ? -15.342 -0.670  24.420 1.00 48.73  ? 46   GLY C O     1 
ATOM   1710  N  N     . ALA C 3 47  ? -16.312 -2.283  23.167 1.00 47.34  ? 47   ALA C N     1 
ATOM   1711  C  CA    . ALA C 3 47  ? -16.172 -3.339  24.173 1.00 46.20  ? 47   ALA C CA    1 
ATOM   1712  C  C     . ALA C 3 47  ? -14.751 -3.522  24.732 1.00 45.02  ? 47   ALA C C     1 
ATOM   1713  O  O     . ALA C 3 47  ? -14.586 -3.494  25.946 1.00 45.12  ? 47   ALA C O     1 
ATOM   1714  C  CB    . ALA C 3 47  ? -16.730 -4.675  23.651 1.00 46.66  ? 47   ALA C CB    1 
ATOM   1715  N  N     . PRO C 3 48  ? -13.725 -3.693  23.866 1.00 43.90  ? 48   PRO C N     1 
ATOM   1716  C  CA    . PRO C 3 48  ? -12.360 -3.803  24.421 1.00 43.11  ? 48   PRO C CA    1 
ATOM   1717  C  C     . PRO C 3 48  ? -11.835 -2.500  25.036 1.00 42.85  ? 48   PRO C C     1 
ATOM   1718  O  O     . PRO C 3 48  ? -10.981 -2.535  25.930 1.00 43.06  ? 48   PRO C O     1 
ATOM   1719  C  CB    . PRO C 3 48  ? -11.508 -4.182  23.208 1.00 43.05  ? 48   PRO C CB    1 
ATOM   1720  C  CG    . PRO C 3 48  ? -12.286 -3.690  22.024 1.00 43.45  ? 48   PRO C CG    1 
ATOM   1721  C  CD    . PRO C 3 48  ? -13.733 -3.809  22.396 1.00 43.56  ? 48   PRO C CD    1 
ATOM   1722  N  N     . VAL C 3 49  ? -12.330 -1.359  24.558 1.00 42.24  ? 49   VAL C N     1 
ATOM   1723  C  CA    . VAL C 3 49  ? -11.976 -0.078  25.151 1.00 41.23  ? 49   VAL C CA    1 
ATOM   1724  C  C     . VAL C 3 49  ? -12.497 -0.024  26.587 1.00 40.74  ? 49   VAL C C     1 
ATOM   1725  O  O     . VAL C 3 49  ? -11.728 0.223   27.515 1.00 40.40  ? 49   VAL C O     1 
ATOM   1726  C  CB    . VAL C 3 49  ? -12.501 1.126   24.291 1.00 41.52  ? 49   VAL C CB    1 
ATOM   1727  C  CG1   . VAL C 3 49  ? -12.410 2.432   25.058 1.00 40.65  ? 49   VAL C CG1   1 
ATOM   1728  C  CG2   . VAL C 3 49  ? -11.721 1.241   22.988 1.00 40.79  ? 49   VAL C CG2   1 
ATOM   1729  N  N     . TYR C 3 50  ? -13.795 -0.269  26.766 1.00 40.21  ? 50   TYR C N     1 
ATOM   1730  C  CA    . TYR C 3 50  ? -14.427 -0.217  28.086 1.00 40.09  ? 50   TYR C CA    1 
ATOM   1731  C  C     . TYR C 3 50  ? -13.776 -1.230  29.020 1.00 40.47  ? 50   TYR C C     1 
ATOM   1732  O  O     . TYR C 3 50  ? -13.427 -0.902  30.161 1.00 41.06  ? 50   TYR C O     1 
ATOM   1733  C  CB    . TYR C 3 50  ? -15.913 -0.526  27.949 1.00 40.00  ? 50   TYR C CB    1 
ATOM   1734  C  CG    . TYR C 3 50  ? -16.820 -0.057  29.072 1.00 40.13  ? 50   TYR C CG    1 
ATOM   1735  C  CD1   . TYR C 3 50  ? -17.823 0.889   28.826 1.00 39.30  ? 50   TYR C CD1   1 
ATOM   1736  C  CD2   . TYR C 3 50  ? -16.719 -0.587  30.364 1.00 40.56  ? 50   TYR C CD2   1 
ATOM   1737  C  CE1   . TYR C 3 50  ? -18.687 1.315   29.834 1.00 38.47  ? 50   TYR C CE1   1 
ATOM   1738  C  CE2   . TYR C 3 50  ? -17.586 -0.161  31.387 1.00 40.28  ? 50   TYR C CE2   1 
ATOM   1739  C  CZ    . TYR C 3 50  ? -18.565 0.793   31.107 1.00 39.92  ? 50   TYR C CZ    1 
ATOM   1740  O  OH    . TYR C 3 50  ? -19.438 1.217   32.093 1.00 42.11  ? 50   TYR C OH    1 
ATOM   1741  N  N     . LEU C 3 51  ? -13.591 -2.453  28.529 1.00 40.08  ? 51   LEU C N     1 
ATOM   1742  C  CA    . LEU C 3 51  ? -13.002 -3.522  29.337 1.00 39.86  ? 51   LEU C CA    1 
ATOM   1743  C  C     . LEU C 3 51  ? -11.580 -3.205  29.775 1.00 39.83  ? 51   LEU C C     1 
ATOM   1744  O  O     . LEU C 3 51  ? -11.231 -3.393  30.948 1.00 39.82  ? 51   LEU C O     1 
ATOM   1745  C  CB    . LEU C 3 51  ? -13.047 -4.888  28.608 1.00 39.51  ? 51   LEU C CB    1 
ATOM   1746  C  CG    . LEU C 3 51  ? -12.518 -6.142  29.329 1.00 39.13  ? 51   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C 3 51  ? -13.077 -6.311  30.729 1.00 37.69  ? 51   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C 3 51  ? -12.764 -7.423  28.528 1.00 40.63  ? 51   LEU C CD2   1 
ATOM   1749  N  N     . ALA C 3 52  ? -10.757 -2.728  28.845 1.00 39.96  ? 52   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3 52  ? -9.362  -2.419  29.172 1.00 39.84  ? 52   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3 52  ? -9.265  -1.315  30.217 1.00 39.93  ? 52   ALA C C     1 
ATOM   1752  O  O     . ALA C 3 52  ? -8.341  -1.327  31.040 1.00 40.57  ? 52   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3 52  ? -8.584  -2.056  27.941 1.00 40.05  ? 52   ALA C CB    1 
ATOM   1754  N  N     . ALA C 3 53  ? -10.231 -0.390  30.210 1.00 38.96  ? 53   ALA C N     1 
ATOM   1755  C  CA    . ALA C 3 53  ? -10.278 0.667   31.217 1.00 38.39  ? 53   ALA C CA    1 
ATOM   1756  C  C     . ALA C 3 53  ? -10.692 0.143   32.580 1.00 37.93  ? 53   ALA C C     1 
ATOM   1757  O  O     . ALA C 3 53  ? -10.132 0.556   33.593 1.00 38.16  ? 53   ALA C O     1 
ATOM   1758  C  CB    . ALA C 3 53  ? -11.209 1.817   30.784 1.00 38.12  ? 53   ALA C CB    1 
ATOM   1759  N  N     . VAL C 3 54  ? -11.696 -0.736  32.613 1.00 37.33  ? 54   VAL C N     1 
ATOM   1760  C  CA    . VAL C 3 54  ? -12.099 -1.365  33.868 1.00 36.26  ? 54   VAL C CA    1 
ATOM   1761  C  C     . VAL C 3 54  ? -10.916 -2.121  34.468 1.00 35.99  ? 54   VAL C C     1 
ATOM   1762  O  O     . VAL C 3 54  ? -10.634 -2.009  35.664 1.00 34.85  ? 54   VAL C O     1 
ATOM   1763  C  CB    . VAL C 3 54  ? -13.324 -2.273  33.693 1.00 36.54  ? 54   VAL C CB    1 
ATOM   1764  C  CG1   . VAL C 3 54  ? -13.572 -3.112  34.952 1.00 35.43  ? 54   VAL C CG1   1 
ATOM   1765  C  CG2   . VAL C 3 54  ? -14.553 -1.426  33.348 1.00 35.79  ? 54   VAL C CG2   1 
ATOM   1766  N  N     . LEU C 3 55  ? -10.195 -2.842  33.612 1.00 36.59  ? 55   LEU C N     1 
ATOM   1767  C  CA    . LEU C 3 55  ? -9.057  -3.644  34.048 1.00 37.05  ? 55   LEU C CA    1 
ATOM   1768  C  C     . LEU C 3 55  ? -7.973  -2.750  34.613 1.00 37.64  ? 55   LEU C C     1 
ATOM   1769  O  O     . LEU C 3 55  ? -7.445  -3.023  35.692 1.00 37.90  ? 55   LEU C O     1 
ATOM   1770  C  CB    . LEU C 3 55  ? -8.511  -4.509  32.911 1.00 37.04  ? 55   LEU C CB    1 
ATOM   1771  C  CG    . LEU C 3 55  ? -9.437  -5.601  32.346 1.00 37.64  ? 55   LEU C CG    1 
ATOM   1772  C  CD1   . LEU C 3 55  ? -8.864  -6.193  31.054 1.00 37.19  ? 55   LEU C CD1   1 
ATOM   1773  C  CD2   . LEU C 3 55  ? -9.746  -6.698  33.354 1.00 36.19  ? 55   LEU C CD2   1 
ATOM   1774  N  N     . GLU C 3 56  ? -7.673  -1.666  33.903 1.00 38.35  ? 56   GLU C N     1 
ATOM   1775  C  CA    . GLU C 3 56  ? -6.689  -0.673  34.345 1.00 38.51  ? 56   GLU C CA    1 
ATOM   1776  C  C     . GLU C 3 56  ? -7.099  -0.015  35.656 1.00 37.76  ? 56   GLU C C     1 
ATOM   1777  O  O     . GLU C 3 56  ? -6.274  0.144   36.562 1.00 37.48  ? 56   GLU C O     1 
ATOM   1778  C  CB    . GLU C 3 56  ? -6.520  0.392   33.267 1.00 39.12  ? 56   GLU C CB    1 
ATOM   1779  C  CG    . GLU C 3 56  ? -5.393  1.362   33.512 1.00 40.87  ? 56   GLU C CG    1 
ATOM   1780  C  CD    . GLU C 3 56  ? -5.180  2.259   32.320 1.00 44.52  ? 56   GLU C CD    1 
ATOM   1781  O  OE1   . GLU C 3 56  ? -5.007  1.716   31.196 1.00 45.24  ? 56   GLU C OE1   1 
ATOM   1782  O  OE2   . GLU C 3 56  ? -5.194  3.500   32.508 1.00 45.84  ? 56   GLU C OE2   1 
ATOM   1783  N  N     . TYR C 3 57  ? -8.366  0.378   35.747 1.00 37.02  ? 57   TYR C N     1 
ATOM   1784  C  CA    . TYR C 3 57  ? -8.877  0.972   36.971 1.00 37.35  ? 57   TYR C CA    1 
ATOM   1785  C  C     . TYR C 3 57  ? -8.593  0.018   38.140 1.00 37.29  ? 57   TYR C C     1 
ATOM   1786  O  O     . TYR C 3 57  ? -7.937  0.400   39.121 1.00 37.74  ? 57   TYR C O     1 
ATOM   1787  C  CB    . TYR C 3 57  ? -10.386 1.272   36.858 1.00 37.81  ? 57   TYR C CB    1 
ATOM   1788  C  CG    . TYR C 3 57  ? -11.052 1.460   38.204 1.00 38.85  ? 57   TYR C CG    1 
ATOM   1789  C  CD1   . TYR C 3 57  ? -10.824 2.611   38.958 1.00 40.66  ? 57   TYR C CD1   1 
ATOM   1790  C  CD2   . TYR C 3 57  ? -11.900 0.483   38.729 1.00 40.52  ? 57   TYR C CD2   1 
ATOM   1791  C  CE1   . TYR C 3 57  ? -11.426 2.786   40.208 1.00 41.88  ? 57   TYR C CE1   1 
ATOM   1792  C  CE2   . TYR C 3 57  ? -12.518 0.649   39.987 1.00 39.93  ? 57   TYR C CE2   1 
ATOM   1793  C  CZ    . TYR C 3 57  ? -12.263 1.795   40.717 1.00 41.36  ? 57   TYR C CZ    1 
ATOM   1794  O  OH    . TYR C 3 57  ? -12.839 1.975   41.956 1.00 44.07  ? 57   TYR C OH    1 
ATOM   1795  N  N     . LEU C 3 58  ? -9.057  -1.229  38.016 1.00 36.32  ? 58   LEU C N     1 
ATOM   1796  C  CA    . LEU C 3 58  ? -8.951  -2.199  39.103 1.00 35.20  ? 58   LEU C CA    1 
ATOM   1797  C  C     . LEU C 3 58  ? -7.514  -2.422  39.541 1.00 34.69  ? 58   LEU C C     1 
ATOM   1798  O  O     . LEU C 3 58  ? -7.234  -2.466  40.742 1.00 34.70  ? 58   LEU C O     1 
ATOM   1799  C  CB    . LEU C 3 58  ? -9.629  -3.526  38.741 1.00 35.23  ? 58   LEU C CB    1 
ATOM   1800  C  CG    . LEU C 3 58  ? -11.159 -3.498  38.814 1.00 35.38  ? 58   LEU C CG    1 
ATOM   1801  C  CD1   . LEU C 3 58  ? -11.778 -4.818  38.385 1.00 35.52  ? 58   LEU C CD1   1 
ATOM   1802  C  CD2   . LEU C 3 58  ? -11.639 -3.111  40.202 1.00 35.24  ? 58   LEU C CD2   1 
ATOM   1803  N  N     . THR C 3 59  ? -6.595  -2.528  38.589 1.00 33.96  ? 59   THR C N     1 
ATOM   1804  C  CA    . THR C 3 59  ? -5.201  -2.729  38.958 1.00 33.84  ? 59   THR C CA    1 
ATOM   1805  C  C     . THR C 3 59  ? -4.552  -1.491  39.599 1.00 34.08  ? 59   THR C C     1 
ATOM   1806  O  O     . THR C 3 59  ? -3.676  -1.624  40.475 1.00 35.00  ? 59   THR C O     1 
ATOM   1807  C  CB    . THR C 3 59  ? -4.349  -3.420  37.839 1.00 33.99  ? 59   THR C CB    1 
ATOM   1808  O  OG1   . THR C 3 59  ? -3.180  -2.639  37.540 1.00 36.65  ? 59   THR C OG1   1 
ATOM   1809  C  CG2   . THR C 3 59  ? -5.139  -3.623  36.591 1.00 31.91  ? 59   THR C CG2   1 
ATOM   1810  N  N     . ALA C 3 60  ? -5.019  -0.299  39.231 1.00 33.41  ? 60   ALA C N     1 
ATOM   1811  C  CA    . ALA C 3 60  ? -4.603  0.928   39.925 1.00 32.91  ? 60   ALA C CA    1 
ATOM   1812  C  C     . ALA C 3 60  ? -5.069  0.921   41.365 1.00 32.89  ? 60   ALA C C     1 
ATOM   1813  O  O     . ALA C 3 60  ? -4.302  1.240   42.280 1.00 32.63  ? 60   ALA C O     1 
ATOM   1814  C  CB    . ALA C 3 60  ? -5.124  2.185   39.197 1.00 32.79  ? 60   ALA C CB    1 
ATOM   1815  N  N     . GLU C 3 61  ? -6.335  0.557   41.566 1.00 33.17  ? 61   GLU C N     1 
ATOM   1816  C  CA    . GLU C 3 61  ? -6.905  0.458   42.913 1.00 33.87  ? 61   GLU C CA    1 
ATOM   1817  C  C     . GLU C 3 61  ? -6.064  -0.462  43.822 1.00 33.53  ? 61   GLU C C     1 
ATOM   1818  O  O     . GLU C 3 61  ? -5.708  -0.079  44.931 1.00 33.80  ? 61   GLU C O     1 
ATOM   1819  C  CB    . GLU C 3 61  ? -8.362  -0.002  42.815 1.00 34.21  ? 61   GLU C CB    1 
ATOM   1820  C  CG    . GLU C 3 61  ? -9.169  0.057   44.116 1.00 38.43  ? 61   GLU C CG    1 
ATOM   1821  C  CD    . GLU C 3 61  ? -9.433  1.473   44.644 1.00 43.46  ? 61   GLU C CD    1 
ATOM   1822  O  OE1   . GLU C 3 61  ? -9.635  2.413   43.830 1.00 46.09  ? 61   GLU C OE1   1 
ATOM   1823  O  OE2   . GLU C 3 61  ? -9.462  1.632   45.895 1.00 45.40  ? 61   GLU C OE2   1 
ATOM   1824  N  N     . ILE C 3 62  ? -5.714  -1.655  43.336 1.00 33.56  ? 62   ILE C N     1 
ATOM   1825  C  CA    . ILE C 3 62  ? -4.949  -2.617  44.142 1.00 33.20  ? 62   ILE C CA    1 
ATOM   1826  C  C     . ILE C 3 62  ? -3.499  -2.178  44.357 1.00 32.54  ? 62   ILE C C     1 
ATOM   1827  O  O     . ILE C 3 62  ? -2.981  -2.323  45.464 1.00 31.83  ? 62   ILE C O     1 
ATOM   1828  C  CB    . ILE C 3 62  ? -5.062  -4.096  43.587 1.00 33.25  ? 62   ILE C CB    1 
ATOM   1829  C  CG1   . ILE C 3 62  ? -4.467  -5.126  44.535 1.00 34.41  ? 62   ILE C CG1   1 
ATOM   1830  C  CG2   . ILE C 3 62  ? -4.348  -4.261  42.299 1.00 34.81  ? 62   ILE C CG2   1 
ATOM   1831  C  CD1   . ILE C 3 62  ? -4.992  -6.573  44.242 1.00 38.83  ? 62   ILE C CD1   1 
ATOM   1832  N  N     . LEU C 3 63  ? -2.854  -1.613  43.327 1.00 32.60  ? 63   LEU C N     1 
ATOM   1833  C  CA    . LEU C 3 63  ? -1.439  -1.195  43.472 1.00 32.14  ? 63   LEU C CA    1 
ATOM   1834  C  C     . LEU C 3 63  ? -1.296  -0.006  44.410 1.00 32.85  ? 63   LEU C C     1 
ATOM   1835  O  O     . LEU C 3 63  ? -0.303  0.103   45.131 1.00 32.76  ? 63   LEU C O     1 
ATOM   1836  C  CB    . LEU C 3 63  ? -0.800  -0.892  42.134 1.00 32.07  ? 63   LEU C CB    1 
ATOM   1837  C  CG    . LEU C 3 63  ? -0.581  -2.058  41.170 1.00 32.65  ? 63   LEU C CG    1 
ATOM   1838  C  CD1   . LEU C 3 63  ? -0.292  -1.555  39.788 1.00 31.59  ? 63   LEU C CD1   1 
ATOM   1839  C  CD2   . LEU C 3 63  ? 0.519   -3.007  41.660 1.00 33.54  ? 63   LEU C CD2   1 
ATOM   1840  N  N     . GLU C 3 64  ? -2.306  0.867   44.418 1.00 33.29  ? 64   GLU C N     1 
ATOM   1841  C  CA    . GLU C 3 64  ? -2.352  1.967   45.347 1.00 33.96  ? 64   GLU C CA    1 
ATOM   1842  C  C     . GLU C 3 64  ? -2.309  1.420   46.753 1.00 34.06  ? 64   GLU C C     1 
ATOM   1843  O  O     . GLU C 3 64  ? -1.391  1.721   47.511 1.00 34.65  ? 64   GLU C O     1 
ATOM   1844  C  CB    . GLU C 3 64  ? -3.625  2.803   45.134 1.00 34.39  ? 64   GLU C CB    1 
ATOM   1845  C  CG    . GLU C 3 64  ? -3.852  3.884   46.192 1.00 36.41  ? 64   GLU C CG    1 
ATOM   1846  C  CD    . GLU C 3 64  ? -2.905  5.082   46.070 1.00 39.65  ? 64   GLU C CD    1 
ATOM   1847  O  OE1   . GLU C 3 64  ? -3.091  6.052   46.838 1.00 44.44  ? 64   GLU C OE1   1 
ATOM   1848  O  OE2   . GLU C 3 64  ? -1.969  5.061   45.247 1.00 39.36  ? 64   GLU C OE2   1 
ATOM   1849  N  N     . LEU C 3 65  ? -3.301  0.595   47.091 1.00 34.32  ? 65   LEU C N     1 
ATOM   1850  C  CA    . LEU C 3 65  ? -3.428  0.023   48.442 1.00 33.85  ? 65   LEU C CA    1 
ATOM   1851  C  C     . LEU C 3 65  ? -2.233  -0.841  48.847 1.00 33.65  ? 65   LEU C C     1 
ATOM   1852  O  O     . LEU C 3 65  ? -1.797  -0.796  49.992 1.00 34.10  ? 65   LEU C O     1 
ATOM   1853  C  CB    . LEU C 3 65  ? -4.721  -0.782  48.564 1.00 33.45  ? 65   LEU C CB    1 
ATOM   1854  C  CG    . LEU C 3 65  ? -6.014  0.030   48.512 1.00 34.01  ? 65   LEU C CG    1 
ATOM   1855  C  CD1   . LEU C 3 65  ? -7.253  -0.887  48.447 1.00 29.96  ? 65   LEU C CD1   1 
ATOM   1856  C  CD2   . LEU C 3 65  ? -6.081  1.017   49.718 1.00 30.06  ? 65   LEU C CD2   1 
ATOM   1857  N  N     . ALA C 3 66  ? -1.712  -1.616  47.909 1.00 33.67  ? 66   ALA C N     1 
ATOM   1858  C  CA    . ALA C 3 66  ? -0.591  -2.516  48.171 1.00 34.24  ? 66   ALA C CA    1 
ATOM   1859  C  C     . ALA C 3 66  ? 0.698   -1.717  48.383 1.00 35.07  ? 66   ALA C C     1 
ATOM   1860  O  O     . ALA C 3 66  ? 1.505   -2.012  49.285 1.00 34.29  ? 66   ALA C O     1 
ATOM   1861  C  CB    . ALA C 3 66  ? -0.429  -3.484  47.020 1.00 33.62  ? 66   ALA C CB    1 
ATOM   1862  N  N     . GLY C 3 67  ? 0.879   -0.707  47.529 1.00 35.74  ? 67   GLY C N     1 
ATOM   1863  C  CA    . GLY C 3 67  ? 1.931   0.285   47.719 1.00 36.49  ? 67   GLY C CA    1 
ATOM   1864  C  C     . GLY C 3 67  ? 1.922   0.855   49.124 1.00 36.85  ? 67   GLY C C     1 
ATOM   1865  O  O     . GLY C 3 67  ? 2.995   1.035   49.729 1.00 37.38  ? 67   GLY C O     1 
ATOM   1866  N  N     . ASN C 3 68  ? 0.731   1.134   49.655 1.00 36.58  ? 68   ASN C N     1 
ATOM   1867  C  CA    . ASN C 3 68  ? 0.636   1.673   51.008 1.00 37.18  ? 68   ASN C CA    1 
ATOM   1868  C  C     . ASN C 3 68  ? 1.067   0.682   52.066 1.00 37.75  ? 68   ASN C C     1 
ATOM   1869  O  O     . ASN C 3 68  ? 1.789   1.044   53.000 1.00 37.92  ? 68   ASN C O     1 
ATOM   1870  C  CB    . ASN C 3 68  ? -0.762  2.216   51.316 1.00 37.08  ? 68   ASN C CB    1 
ATOM   1871  C  CG    . ASN C 3 68  ? -1.121  3.438   50.466 1.00 38.22  ? 68   ASN C CG    1 
ATOM   1872  O  OD1   . ASN C 3 68  ? -0.254  4.078   49.862 1.00 38.70  ? 68   ASN C OD1   1 
ATOM   1873  N  ND2   . ASN C 3 68  ? -2.412  3.761   50.423 1.00 39.03  ? 68   ASN C ND2   1 
ATOM   1874  N  N     . ALA C 3 69  ? 0.626   -0.571  51.927 1.00 38.33  ? 69   ALA C N     1 
ATOM   1875  C  CA    . ALA C 3 69  ? 1.065   -1.634  52.838 1.00 38.81  ? 69   ALA C CA    1 
ATOM   1876  C  C     . ALA C 3 69  ? 2.588   -1.826  52.788 1.00 39.30  ? 69   ALA C C     1 
ATOM   1877  O  O     . ALA C 3 69  ? 3.226   -2.022  53.810 1.00 39.49  ? 69   ALA C O     1 
ATOM   1878  C  CB    . ALA C 3 69  ? 0.350   -2.926  52.538 1.00 38.55  ? 69   ALA C CB    1 
ATOM   1879  N  N     . ALA C 3 70  ? 3.167   -1.743  51.605 1.00 40.38  ? 70   ALA C N     1 
ATOM   1880  C  CA    . ALA C 3 70  ? 4.613   -1.818  51.480 1.00 42.77  ? 70   ALA C CA    1 
ATOM   1881  C  C     . ALA C 3 70  ? 5.306   -0.694  52.260 1.00 44.23  ? 70   ALA C C     1 
ATOM   1882  O  O     . ALA C 3 70  ? 6.280   -0.957  52.969 1.00 44.68  ? 70   ALA C O     1 
ATOM   1883  C  CB    . ALA C 3 70  ? 5.028   -1.801  50.022 1.00 42.20  ? 70   ALA C CB    1 
ATOM   1884  N  N     . ARG C 3 71  ? 4.792   0.535   52.142 1.00 45.94  ? 71   ARG C N     1 
ATOM   1885  C  CA    . ARG C 3 71  ? 5.354   1.689   52.852 1.00 47.98  ? 71   ARG C CA    1 
ATOM   1886  C  C     . ARG C 3 71  ? 5.187   1.553   54.350 1.00 48.55  ? 71   ARG C C     1 
ATOM   1887  O  O     . ARG C 3 71  ? 6.150   1.765   55.089 1.00 48.83  ? 71   ARG C O     1 
ATOM   1888  C  CB    . ARG C 3 71  ? 4.772   3.031   52.360 1.00 48.45  ? 71   ARG C CB    1 
ATOM   1889  C  CG    . ARG C 3 71  ? 5.088   4.231   53.296 1.00 51.90  ? 71   ARG C CG    1 
ATOM   1890  C  CD    . ARG C 3 71  ? 4.712   5.598   52.730 1.00 57.35  ? 71   ARG C CD    1 
ATOM   1891  N  NE    . ARG C 3 71  ? 5.560   5.967   51.593 1.00 63.65  ? 71   ARG C NE    1 
ATOM   1892  C  CZ    . ARG C 3 71  ? 5.498   7.127   50.931 1.00 66.22  ? 71   ARG C CZ    1 
ATOM   1893  N  NH1   . ARG C 3 71  ? 4.624   8.071   51.278 1.00 65.60  ? 71   ARG C NH1   1 
ATOM   1894  N  NH2   . ARG C 3 71  ? 6.319   7.338   49.903 1.00 67.81  ? 71   ARG C NH2   1 
ATOM   1895  N  N     . ASP C 3 72  ? 3.980   1.189   54.789 1.00 49.49  ? 72   ASP C N     1 
ATOM   1896  C  CA    . ASP C 3 72  ? 3.692   0.916   56.204 1.00 50.79  ? 72   ASP C CA    1 
ATOM   1897  C  C     . ASP C 3 72  ? 4.674   -0.109  56.801 1.00 51.50  ? 72   ASP C C     1 
ATOM   1898  O  O     . ASP C 3 72  ? 4.889   -0.148  58.015 1.00 51.36  ? 72   ASP C O     1 
ATOM   1899  C  CB    . ASP C 3 72  ? 2.267   0.373   56.367 1.00 51.01  ? 72   ASP C CB    1 
ATOM   1900  C  CG    . ASP C 3 72  ? 1.185   1.427   56.139 1.00 52.77  ? 72   ASP C CG    1 
ATOM   1901  O  OD1   . ASP C 3 72  ? 1.455   2.649   56.282 1.00 53.55  ? 72   ASP C OD1   1 
ATOM   1902  O  OD2   . ASP C 3 72  ? 0.040   1.018   55.826 1.00 53.62  ? 72   ASP C OD2   1 
ATOM   1903  N  N     . ASN C 3 73  ? 5.244   -0.942  55.933 1.00 52.29  ? 73   ASN C N     1 
ATOM   1904  C  CA    . ASN C 3 73  ? 6.178   -1.984  56.323 1.00 53.21  ? 73   ASN C CA    1 
ATOM   1905  C  C     . ASN C 3 73  ? 7.633   -1.609  56.072 1.00 53.06  ? 73   ASN C C     1 
ATOM   1906  O  O     . ASN C 3 73  ? 8.517   -2.471  56.097 1.00 52.96  ? 73   ASN C O     1 
ATOM   1907  C  CB    . ASN C 3 73  ? 5.857   -3.271  55.571 1.00 53.93  ? 73   ASN C CB    1 
ATOM   1908  C  CG    . ASN C 3 73  ? 5.039   -4.229  56.395 1.00 56.33  ? 73   ASN C CG    1 
ATOM   1909  O  OD1   . ASN C 3 73  ? 5.586   -4.950  57.236 1.00 59.69  ? 73   ASN C OD1   1 
ATOM   1910  N  ND2   . ASN C 3 73  ? 3.719   -4.246  56.167 1.00 56.94  ? 73   ASN C ND2   1 
ATOM   1911  N  N     . LYS C 3 74  ? 7.870   -0.325  55.825 1.00 52.67  ? 74   LYS C N     1 
ATOM   1912  C  CA    . LYS C 3 74  ? 9.211   0.183   55.565 1.00 52.32  ? 74   LYS C CA    1 
ATOM   1913  C  C     . LYS C 3 74  ? 9.901   -0.583  54.432 1.00 51.47  ? 74   LYS C C     1 
ATOM   1914  O  O     . LYS C 3 74  ? 11.114  -0.851  54.490 1.00 51.49  ? 74   LYS C O     1 
ATOM   1915  C  CB    . LYS C 3 74  ? 10.034  0.168   56.859 1.00 52.93  ? 74   LYS C CB    1 
ATOM   1916  C  CG    . LYS C 3 74  ? 9.621   1.270   57.842 1.00 55.46  ? 74   LYS C CG    1 
ATOM   1917  C  CD    . LYS C 3 74  ? 9.844   0.880   59.298 1.00 58.78  ? 74   LYS C CD    1 
ATOM   1918  C  CE    . LYS C 3 74  ? 8.971   1.754   60.198 1.00 61.74  ? 74   LYS C CE    1 
ATOM   1919  N  NZ    . LYS C 3 74  ? 9.126   1.447   61.653 1.00 63.35  ? 74   LYS C NZ    1 
ATOM   1920  N  N     . LYS C 3 75  ? 9.111   -0.936  53.413 1.00 49.83  ? 75   LYS C N     1 
ATOM   1921  C  CA    . LYS C 3 75  ? 9.604   -1.659  52.235 1.00 48.64  ? 75   LYS C CA    1 
ATOM   1922  C  C     . LYS C 3 75  ? 9.335   -0.862  50.982 1.00 47.54  ? 75   LYS C C     1 
ATOM   1923  O  O     . LYS C 3 75  ? 8.379   -0.095  50.907 1.00 47.60  ? 75   LYS C O     1 
ATOM   1924  C  CB    . LYS C 3 75  ? 8.952   -3.050  52.059 1.00 48.62  ? 75   LYS C CB    1 
ATOM   1925  C  CG    . LYS C 3 75  ? 9.019   -3.993  53.249 1.00 48.79  ? 75   LYS C CG    1 
ATOM   1926  C  CD    . LYS C 3 75  ? 10.418  -4.542  53.465 1.00 49.64  ? 75   LYS C CD    1 
ATOM   1927  C  CE    . LYS C 3 75  ? 10.439  -5.570  54.585 1.00 48.90  ? 75   LYS C CE    1 
ATOM   1928  N  NZ    . LYS C 3 75  ? 10.178  -4.986  55.923 1.00 49.40  ? 75   LYS C NZ    1 
ATOM   1929  N  N     . THR C 3 76  ? 10.176  -1.098  49.991 1.00 46.22  ? 76   THR C N     1 
ATOM   1930  C  CA    . THR C 3 76  ? 10.179  -0.383  48.739 1.00 45.01  ? 76   THR C CA    1 
ATOM   1931  C  C     . THR C 3 76  ? 9.610   -1.277  47.642 1.00 44.11  ? 76   THR C C     1 
ATOM   1932  O  O     . THR C 3 76  ? 9.144   -0.796  46.596 1.00 43.76  ? 76   THR C O     1 
ATOM   1933  C  CB    . THR C 3 76  ? 11.637  0.048   48.414 1.00 45.34  ? 76   THR C CB    1 
ATOM   1934  O  OG1   . THR C 3 76  ? 11.791  1.439   48.737 1.00 47.28  ? 76   THR C OG1   1 
ATOM   1935  C  CG2   . THR C 3 76  ? 12.018  -0.201  46.952 1.00 44.14  ? 76   THR C CG2   1 
ATOM   1936  N  N     . ARG C 3 77  ? 9.668   -2.584  47.872 1.00 42.26  ? 77   ARG C N     1 
ATOM   1937  C  CA    . ARG C 3 77  ? 9.168   -3.519  46.892 1.00 41.02  ? 77   ARG C CA    1 
ATOM   1938  C  C     . ARG C 3 77  ? 7.858   -4.165  47.363 1.00 39.24  ? 77   ARG C C     1 
ATOM   1939  O  O     . ARG C 3 77  ? 7.803   -4.740  48.447 1.00 39.76  ? 77   ARG C O     1 
ATOM   1940  C  CB    . ARG C 3 77  ? 10.232  -4.568  46.617 1.00 41.33  ? 77   ARG C CB    1 
ATOM   1941  C  CG    . ARG C 3 77  ? 9.915   -5.439  45.434 1.00 43.95  ? 77   ARG C CG    1 
ATOM   1942  C  CD    . ARG C 3 77  ? 10.984  -6.462  45.217 1.00 44.34  ? 77   ARG C CD    1 
ATOM   1943  N  NE    . ARG C 3 77  ? 12.166  -5.851  44.630 1.00 48.43  ? 77   ARG C NE    1 
ATOM   1944  C  CZ    . ARG C 3 77  ? 13.383  -5.894  45.172 1.00 49.80  ? 77   ARG C CZ    1 
ATOM   1945  N  NH1   . ARG C 3 77  ? 13.583  -6.532  46.321 1.00 49.35  ? 77   ARG C NH1   1 
ATOM   1946  N  NH2   . ARG C 3 77  ? 14.402  -5.305  44.552 1.00 49.08  ? 77   ARG C NH2   1 
ATOM   1947  N  N     . ILE C 3 78  ? 6.806   -4.030  46.564 1.00 37.03  ? 78   ILE C N     1 
ATOM   1948  C  CA    . ILE C 3 78  ? 5.558   -4.777  46.773 1.00 35.57  ? 78   ILE C CA    1 
ATOM   1949  C  C     . ILE C 3 78  ? 5.777   -6.297  46.604 1.00 35.09  ? 78   ILE C C     1 
ATOM   1950  O  O     . ILE C 3 78  ? 6.202   -6.758  45.530 1.00 35.08  ? 78   ILE C O     1 
ATOM   1951  C  CB    . ILE C 3 78  ? 4.470   -4.342  45.773 1.00 35.08  ? 78   ILE C CB    1 
ATOM   1952  C  CG1   . ILE C 3 78  ? 3.981   -2.931  46.089 1.00 33.24  ? 78   ILE C CG1   1 
ATOM   1953  C  CG2   . ILE C 3 78  ? 3.302   -5.323  45.776 1.00 33.90  ? 78   ILE C CG2   1 
ATOM   1954  C  CD1   . ILE C 3 78  ? 3.129   -2.331  44.987 1.00 30.01  ? 78   ILE C CD1   1 
ATOM   1955  N  N     . ILE C 3 79  ? 5.516   -7.054  47.669 1.00 34.00  ? 79   ILE C N     1 
ATOM   1956  C  CA    . ILE C 3 79  ? 5.569   -8.529  47.634 1.00 33.12  ? 79   ILE C CA    1 
ATOM   1957  C  C     . ILE C 3 79  ? 4.162   -9.079  47.878 1.00 32.86  ? 79   ILE C C     1 
ATOM   1958  O  O     . ILE C 3 79  ? 3.253   -8.296  48.213 1.00 33.28  ? 79   ILE C O     1 
ATOM   1959  C  CB    . ILE C 3 79  ? 6.567   -9.134  48.690 1.00 32.66  ? 79   ILE C CB    1 
ATOM   1960  C  CG1   . ILE C 3 79  ? 6.072   -8.892  50.123 1.00 30.90  ? 79   ILE C CG1   1 
ATOM   1961  C  CG2   . ILE C 3 79  ? 7.979   -8.619  48.432 1.00 33.02  ? 79   ILE C CG2   1 
ATOM   1962  C  CD1   . ILE C 3 79  ? 6.876   -9.563  51.238 1.00 27.93  ? 79   ILE C CD1   1 
ATOM   1963  N  N     . PRO C 3 80  ? 3.969   -10.414 47.719 1.00 31.72  ? 80   PRO C N     1 
ATOM   1964  C  CA    . PRO C 3 80  ? 2.625   -10.977 47.874 1.00 31.12  ? 80   PRO C CA    1 
ATOM   1965  C  C     . PRO C 3 80  ? 1.965   -10.668 49.213 1.00 30.59  ? 80   PRO C C     1 
ATOM   1966  O  O     . PRO C 3 80  ? 0.769   -10.475 49.249 1.00 31.41  ? 80   PRO C O     1 
ATOM   1967  C  CB    . PRO C 3 80  ? 2.844   -12.485 47.672 1.00 31.39  ? 80   PRO C CB    1 
ATOM   1968  C  CG    . PRO C 3 80  ? 4.029   -12.553 46.710 1.00 31.19  ? 80   PRO C CG    1 
ATOM   1969  C  CD    . PRO C 3 80  ? 4.913   -11.400 47.153 1.00 31.77  ? 80   PRO C CD    1 
ATOM   1970  N  N     . ARG C 3 81  ? 2.709   -10.559 50.302 1.00 30.13  ? 81   ARG C N     1 
ATOM   1971  C  CA    . ARG C 3 81  ? 2.067   -10.153 51.549 1.00 29.85  ? 81   ARG C CA    1 
ATOM   1972  C  C     . ARG C 3 81  ? 1.348   -8.807  51.442 1.00 29.72  ? 81   ARG C C     1 
ATOM   1973  O  O     . ARG C 3 81  ? 0.297   -8.637  52.060 1.00 29.41  ? 81   ARG C O     1 
ATOM   1974  C  CB    . ARG C 3 81  ? 3.013   -10.210 52.771 1.00 29.43  ? 81   ARG C CB    1 
ATOM   1975  C  CG    . ARG C 3 81  ? 2.587   -9.307  53.910 1.00 30.45  ? 81   ARG C CG    1 
ATOM   1976  C  CD    . ARG C 3 81  ? 2.376   -9.946  55.275 1.00 31.66  ? 81   ARG C CD    1 
ATOM   1977  N  NE    . ARG C 3 81  ? 1.131   -10.708 55.298 1.00 35.15  ? 81   ARG C NE    1 
ATOM   1978  C  CZ    . ARG C 3 81  ? 0.391   -11.002 56.372 1.00 34.04  ? 81   ARG C CZ    1 
ATOM   1979  N  NH1   . ARG C 3 81  ? 0.717   -10.594 57.588 1.00 29.82  ? 81   ARG C NH1   1 
ATOM   1980  N  NH2   . ARG C 3 81  ? -0.714  -11.724 56.202 1.00 34.65  ? 81   ARG C NH2   1 
ATOM   1981  N  N     . HIS C 3 82  ? 1.913   -7.867  50.664 1.00 29.67  ? 82   HIS C N     1 
ATOM   1982  C  CA    . HIS C 3 82  ? 1.363   -6.507  50.573 1.00 29.05  ? 82   HIS C CA    1 
ATOM   1983  C  C     . HIS C 3 82  ? 0.072   -6.515  49.793 1.00 28.84  ? 82   HIS C C     1 
ATOM   1984  O  O     . HIS C 3 82  ? -0.863  -5.808  50.155 1.00 27.99  ? 82   HIS C O     1 
ATOM   1985  C  CB    . HIS C 3 82  ? 2.348   -5.472  49.996 1.00 28.37  ? 82   HIS C CB    1 
ATOM   1986  C  CG    . HIS C 3 82  ? 3.653   -5.433  50.715 1.00 27.93  ? 82   HIS C CG    1 
ATOM   1987  N  ND1   . HIS C 3 82  ? 4.867   -5.432  50.058 1.00 28.41  ? 82   HIS C ND1   1 
ATOM   1988  C  CD2   . HIS C 3 82  ? 3.939   -5.461  52.036 1.00 26.53  ? 82   HIS C CD2   1 
ATOM   1989  C  CE1   . HIS C 3 82  ? 5.845   -5.449  50.947 1.00 27.96  ? 82   HIS C CE1   1 
ATOM   1990  N  NE2   . HIS C 3 82  ? 5.307   -5.469  52.154 1.00 28.97  ? 82   HIS C NE2   1 
ATOM   1991  N  N     . LEU C 3 83  ? 0.024   -7.331  48.743 1.00 29.12  ? 83   LEU C N     1 
ATOM   1992  C  CA    . LEU C 3 83  ? -1.204  -7.511  47.980 1.00 29.36  ? 83   LEU C CA    1 
ATOM   1993  C  C     . LEU C 3 83  ? -2.305  -8.108  48.846 1.00 30.13  ? 83   LEU C C     1 
ATOM   1994  O  O     . LEU C 3 83  ? -3.481  -7.690  48.750 1.00 30.35  ? 83   LEU C O     1 
ATOM   1995  C  CB    . LEU C 3 83  ? -0.971  -8.381  46.758 1.00 29.45  ? 83   LEU C CB    1 
ATOM   1996  C  CG    . LEU C 3 83  ? -0.014  -7.838  45.694 1.00 29.73  ? 83   LEU C CG    1 
ATOM   1997  C  CD1   . LEU C 3 83  ? 0.166   -8.879  44.597 1.00 26.86  ? 83   LEU C CD1   1 
ATOM   1998  C  CD2   . LEU C 3 83  ? -0.489  -6.488  45.114 1.00 31.28  ? 83   LEU C CD2   1 
ATOM   1999  N  N     . GLN C 3 84  ? -1.919  -9.032  49.733 1.00 29.98  ? 84   GLN C N     1 
ATOM   2000  C  CA    . GLN C 3 84  ? -2.897  -9.688  50.583 1.00 30.51  ? 84   GLN C CA    1 
ATOM   2001  C  C     . GLN C 3 84  ? -3.436  -8.700  51.623 1.00 30.90  ? 84   GLN C C     1 
ATOM   2002  O  O     . GLN C 3 84  ? -4.654  -8.527  51.753 1.00 30.93  ? 84   GLN C O     1 
ATOM   2003  C  CB    . GLN C 3 84  ? -2.337  -10.992 51.198 1.00 29.98  ? 84   GLN C CB    1 
ATOM   2004  C  CG    . GLN C 3 84  ? -3.129  -11.544 52.392 1.00 29.29  ? 84   GLN C CG    1 
ATOM   2005  C  CD    . GLN C 3 84  ? -4.385  -12.374 51.991 1.00 30.69  ? 84   GLN C CD    1 
ATOM   2006  O  OE1   . GLN C 3 84  ? -4.963  -12.203 50.905 1.00 26.50  ? 84   GLN C OE1   1 
ATOM   2007  N  NE2   . GLN C 3 84  ? -4.811  -13.259 52.893 1.00 27.79  ? 84   GLN C NE2   1 
ATOM   2008  N  N     . LEU C 3 85  ? -2.539  -8.039  52.351 1.00 31.16  ? 85   LEU C N     1 
ATOM   2009  C  CA    . LEU C 3 85  ? -2.968  -6.951  53.257 1.00 31.58  ? 85   LEU C CA    1 
ATOM   2010  C  C     . LEU C 3 85  ? -3.910  -5.916  52.597 1.00 31.09  ? 85   LEU C C     1 
ATOM   2011  O  O     . LEU C 3 85  ? -4.922  -5.519  53.176 1.00 31.16  ? 85   LEU C O     1 
ATOM   2012  C  CB    . LEU C 3 85  ? -1.756  -6.225  53.831 1.00 31.86  ? 85   LEU C CB    1 
ATOM   2013  C  CG    . LEU C 3 85  ? -0.871  -7.042  54.767 1.00 32.83  ? 85   LEU C CG    1 
ATOM   2014  C  CD1   . LEU C 3 85  ? 0.439   -6.303  54.976 1.00 31.59  ? 85   LEU C CD1   1 
ATOM   2015  C  CD2   . LEU C 3 85  ? -1.602  -7.322  56.083 1.00 32.57  ? 85   LEU C CD2   1 
ATOM   2016  N  N     . ALA C 3 86  ? -3.569  -5.505  51.387 1.00 30.29  ? 86   ALA C N     1 
ATOM   2017  C  CA    . ALA C 3 86  ? -4.374  -4.564  50.616 1.00 30.69  ? 86   ALA C CA    1 
ATOM   2018  C  C     . ALA C 3 86  ? -5.795  -5.064  50.332 1.00 30.93  ? 86   ALA C C     1 
ATOM   2019  O  O     . ALA C 3 86  ? -6.765  -4.348  50.538 1.00 31.03  ? 86   ALA C O     1 
ATOM   2020  C  CB    . ALA C 3 86  ? -3.673  -4.244  49.317 1.00 30.46  ? 86   ALA C CB    1 
ATOM   2021  N  N     . VAL C 3 87  ? -5.899  -6.305  49.867 1.00 31.60  ? 87   VAL C N     1 
ATOM   2022  C  CA    . VAL C 3 87  ? -7.160  -6.903  49.477 1.00 31.50  ? 87   VAL C CA    1 
ATOM   2023  C  C     . VAL C 3 87  ? -8.013  -7.176  50.690 1.00 32.27  ? 87   VAL C C     1 
ATOM   2024  O  O     . VAL C 3 87  ? -9.210  -6.878  50.682 1.00 32.07  ? 87   VAL C O     1 
ATOM   2025  C  CB    . VAL C 3 87  ? -6.952  -8.203  48.668 1.00 31.38  ? 87   VAL C CB    1 
ATOM   2026  C  CG1   . VAL C 3 87  ? -8.289  -8.891  48.399 1.00 31.63  ? 87   VAL C CG1   1 
ATOM   2027  C  CG2   . VAL C 3 87  ? -6.274  -7.885  47.361 1.00 30.74  ? 87   VAL C CG2   1 
ATOM   2028  N  N     . ARG C 3 88  ? -7.403  -7.713  51.744 1.00 32.81  ? 88   ARG C N     1 
ATOM   2029  C  CA    . ARG C 3 88  ? -8.185  -8.164  52.883 1.00 33.53  ? 88   ARG C CA    1 
ATOM   2030  C  C     . ARG C 3 88  ? -8.637  -7.030  53.778 1.00 34.45  ? 88   ARG C C     1 
ATOM   2031  O  O     . ARG C 3 88  ? -9.667  -7.139  54.448 1.00 35.60  ? 88   ARG C O     1 
ATOM   2032  C  CB    . ARG C 3 88  ? -7.444  -9.252  53.677 1.00 33.17  ? 88   ARG C CB    1 
ATOM   2033  C  CG    . ARG C 3 88  ? -7.120  -10.528 52.869 1.00 30.91  ? 88   ARG C CG    1 
ATOM   2034  C  CD    . ARG C 3 88  ? -8.342  -11.164 52.179 1.00 26.16  ? 88   ARG C CD    1 
ATOM   2035  N  NE    . ARG C 3 88  ? -7.943  -11.981 51.032 1.00 20.75  ? 88   ARG C NE    1 
ATOM   2036  C  CZ    . ARG C 3 88  ? -8.750  -12.364 50.056 1.00 21.35  ? 88   ARG C CZ    1 
ATOM   2037  N  NH1   . ARG C 3 88  ? -10.036 -12.003 50.065 1.00 23.85  ? 88   ARG C NH1   1 
ATOM   2038  N  NH2   . ARG C 3 88  ? -8.280  -13.094 49.050 1.00 20.77  ? 88   ARG C NH2   1 
ATOM   2039  N  N     . ASN C 3 89  ? -7.887  -5.933  53.768 1.00 35.41  ? 89   ASN C N     1 
ATOM   2040  C  CA    . ASN C 3 89  ? -8.218  -4.754  54.570 1.00 36.20  ? 89   ASN C CA    1 
ATOM   2041  C  C     . ASN C 3 89  ? -9.237  -3.843  53.887 1.00 36.83  ? 89   ASN C C     1 
ATOM   2042  O  O     . ASN C 3 89  ? -9.713  -2.898  54.491 1.00 36.70  ? 89   ASN C O     1 
ATOM   2043  C  CB    . ASN C 3 89  ? -6.952  -3.970  54.937 1.00 35.97  ? 89   ASN C CB    1 
ATOM   2044  C  CG    . ASN C 3 89  ? -6.188  -4.599  56.086 1.00 36.05  ? 89   ASN C CG    1 
ATOM   2045  O  OD1   . ASN C 3 89  ? -6.742  -4.843  57.149 1.00 35.99  ? 89   ASN C OD1   1 
ATOM   2046  N  ND2   . ASN C 3 89  ? -4.903  -4.858  55.876 1.00 39.23  ? 89   ASN C ND2   1 
ATOM   2047  N  N     . ASP C 3 90  ? -9.575  -4.154  52.635 1.00 38.04  ? 90   ASP C N     1 
ATOM   2048  C  CA    . ASP C 3 90  ? -10.541 -3.382  51.858 1.00 38.94  ? 90   ASP C CA    1 
ATOM   2049  C  C     . ASP C 3 90  ? -11.814 -4.183  51.609 1.00 39.21  ? 90   ASP C C     1 
ATOM   2050  O  O     . ASP C 3 90  ? -11.788 -5.187  50.891 1.00 39.23  ? 90   ASP C O     1 
ATOM   2051  C  CB    . ASP C 3 90  ? -9.934  -2.994  50.518 1.00 39.31  ? 90   ASP C CB    1 
ATOM   2052  C  CG    . ASP C 3 90  ? -10.832 -2.085  49.723 1.00 41.67  ? 90   ASP C CG    1 
ATOM   2053  O  OD1   . ASP C 3 90  ? -10.798 -0.868  49.997 1.00 46.91  ? 90   ASP C OD1   1 
ATOM   2054  O  OD2   . ASP C 3 90  ? -11.573 -2.570  48.831 1.00 43.71  ? 90   ASP C OD2   1 
ATOM   2055  N  N     . GLU C 3 91  ? -12.923 -3.718  52.183 1.00 39.46  ? 91   GLU C N     1 
ATOM   2056  C  CA    . GLU C 3 91  ? -14.213 -4.399  52.113 1.00 39.88  ? 91   GLU C CA    1 
ATOM   2057  C  C     . GLU C 3 91  ? -14.591 -4.886  50.724 1.00 39.10  ? 91   GLU C C     1 
ATOM   2058  O  O     . GLU C 3 91  ? -15.015 -6.032  50.546 1.00 39.36  ? 91   GLU C O     1 
ATOM   2059  C  CB    . GLU C 3 91  ? -15.312 -3.486  52.636 1.00 40.71  ? 91   GLU C CB    1 
ATOM   2060  C  CG    . GLU C 3 91  ? -15.803 -3.791  54.040 1.00 45.15  ? 91   GLU C CG    1 
ATOM   2061  C  CD    . GLU C 3 91  ? -17.200 -3.206  54.284 1.00 51.92  ? 91   GLU C CD    1 
ATOM   2062  O  OE1   . GLU C 3 91  ? -18.112 -3.437  53.443 1.00 53.77  ? 91   GLU C OE1   1 
ATOM   2063  O  OE2   . GLU C 3 91  ? -17.382 -2.509  55.314 1.00 54.46  ? 91   GLU C OE2   1 
ATOM   2064  N  N     . GLU C 3 92  ? -14.419 -4.020  49.737 1.00 38.37  ? 92   GLU C N     1 
ATOM   2065  C  CA    . GLU C 3 92  ? -14.845 -4.321  48.375 1.00 37.89  ? 92   GLU C CA    1 
ATOM   2066  C  C     . GLU C 3 92  ? -13.913 -5.256  47.589 1.00 36.77  ? 92   GLU C C     1 
ATOM   2067  O  O     . GLU C 3 92  ? -14.366 -6.147  46.855 1.00 36.05  ? 92   GLU C O     1 
ATOM   2068  C  CB    . GLU C 3 92  ? -15.188 -3.025  47.628 1.00 37.90  ? 92   GLU C CB    1 
ATOM   2069  C  CG    . GLU C 3 92  ? -16.478 -2.400  48.190 1.00 40.77  ? 92   GLU C CG    1 
ATOM   2070  C  CD    . GLU C 3 92  ? -17.051 -1.275  47.348 1.00 45.15  ? 92   GLU C CD    1 
ATOM   2071  O  OE1   . GLU C 3 92  ? -16.401 -0.866  46.364 1.00 47.35  ? 92   GLU C OE1   1 
ATOM   2072  O  OE2   . GLU C 3 92  ? -18.159 -0.788  47.679 1.00 48.80  ? 92   GLU C OE2   1 
ATOM   2073  N  N     . LEU C 3 93  ? -12.613 -5.055  47.747 1.00 36.07  ? 93   LEU C N     1 
ATOM   2074  C  CA    . LEU C 3 93  ? -11.659 -5.961  47.131 1.00 35.48  ? 93   LEU C CA    1 
ATOM   2075  C  C     . LEU C 3 93  ? -11.732 -7.350  47.773 1.00 34.99  ? 93   LEU C C     1 
ATOM   2076  O  O     . LEU C 3 93  ? -11.693 -8.353  47.079 1.00 34.84  ? 93   LEU C O     1 
ATOM   2077  C  CB    . LEU C 3 93  ? -10.256 -5.388  47.188 1.00 35.02  ? 93   LEU C CB    1 
ATOM   2078  C  CG    . LEU C 3 93  ? -9.986  -4.248  46.204 1.00 34.75  ? 93   LEU C CG    1 
ATOM   2079  C  CD1   . LEU C 3 93  ? -8.581  -3.656  46.419 1.00 31.64  ? 93   LEU C CD1   1 
ATOM   2080  C  CD2   . LEU C 3 93  ? -10.169 -4.706  44.757 1.00 32.33  ? 93   LEU C CD2   1 
ATOM   2081  N  N     . ASN C 3 94  ? -11.905 -7.378  49.090 1.00 34.87  ? 94   ASN C N     1 
ATOM   2082  C  CA    . ASN C 3 94  ? -12.112 -8.605  49.823 1.00 35.19  ? 94   ASN C CA    1 
ATOM   2083  C  C     . ASN C 3 94  ? -13.299 -9.437  49.322 1.00 35.65  ? 94   ASN C C     1 
ATOM   2084  O  O     . ASN C 3 94  ? -13.160 -10.642 49.083 1.00 36.49  ? 94   ASN C O     1 
ATOM   2085  C  CB    . ASN C 3 94  ? -12.230 -8.348  51.324 1.00 34.53  ? 94   ASN C CB    1 
ATOM   2086  C  CG    . ASN C 3 94  ? -12.253 -9.639  52.118 1.00 34.60  ? 94   ASN C CG    1 
ATOM   2087  O  OD1   . ASN C 3 94  ? -11.452 -10.541 51.867 1.00 37.10  ? 94   ASN C OD1   1 
ATOM   2088  N  ND2   . ASN C 3 94  ? -13.183 -9.751  53.045 1.00 31.49  ? 94   ASN C ND2   1 
ATOM   2089  N  N     . LYS C 3 95  ? -14.449 -8.799  49.156 1.00 35.77  ? 95   LYS C N     1 
ATOM   2090  C  CA    . LYS C 3 95  ? -15.606 -9.453  48.559 1.00 36.52  ? 95   LYS C CA    1 
ATOM   2091  C  C     . LYS C 3 95  ? -15.399 -9.879  47.098 1.00 35.66  ? 95   LYS C C     1 
ATOM   2092  O  O     . LYS C 3 95  ? -15.818 -10.978 46.696 1.00 36.90  ? 95   LYS C O     1 
ATOM   2093  C  CB    . LYS C 3 95  ? -16.843 -8.562  48.688 1.00 37.25  ? 95   LYS C CB    1 
ATOM   2094  C  CG    . LYS C 3 95  ? -18.110 -9.144  48.088 1.00 40.61  ? 95   LYS C CG    1 
ATOM   2095  C  CD    . LYS C 3 95  ? -19.300 -8.271  48.471 1.00 47.34  ? 95   LYS C CD    1 
ATOM   2096  C  CE    . LYS C 3 95  ? -20.570 -9.107  48.679 1.00 52.46  ? 95   LYS C CE    1 
ATOM   2097  N  NZ    . LYS C 3 95  ? -21.440 -8.536  49.784 1.00 54.33  ? 95   LYS C NZ    1 
ATOM   2098  N  N     . LEU C 3 96  ? -14.769 -9.031  46.302 1.00 33.71  ? 96   LEU C N     1 
ATOM   2099  C  CA    . LEU C 3 96  ? -14.519 -9.376  44.901 1.00 33.35  ? 96   LEU C CA    1 
ATOM   2100  C  C     . LEU C 3 96  ? -13.555 -10.568 44.741 1.00 33.32  ? 96   LEU C C     1 
ATOM   2101  O  O     . LEU C 3 96  ? -13.636 -11.313 43.758 1.00 33.44  ? 96   LEU C O     1 
ATOM   2102  C  CB    . LEU C 3 96  ? -13.997 -8.162  44.120 1.00 32.78  ? 96   LEU C CB    1 
ATOM   2103  C  CG    . LEU C 3 96  ? -13.459 -8.421  42.704 1.00 33.29  ? 96   LEU C CG    1 
ATOM   2104  C  CD1   . LEU C 3 96  ? -14.592 -8.733  41.712 1.00 31.97  ? 96   LEU C CD1   1 
ATOM   2105  C  CD2   . LEU C 3 96  ? -12.595 -7.278  42.204 1.00 32.09  ? 96   LEU C CD2   1 
ATOM   2106  N  N     . LEU C 3 97  ? -12.635 -10.718 45.692 1.00 33.39  ? 97   LEU C N     1 
ATOM   2107  C  CA    . LEU C 3 97  ? -11.686 -11.815 45.684 1.00 33.84  ? 97   LEU C CA    1 
ATOM   2108  C  C     . LEU C 3 97  ? -11.955 -12.738 46.875 1.00 34.56  ? 97   LEU C C     1 
ATOM   2109  O  O     . LEU C 3 97  ? -11.021 -13.304 47.489 1.00 34.69  ? 97   LEU C O     1 
ATOM   2110  C  CB    . LEU C 3 97  ? -10.266 -11.271 45.707 1.00 33.46  ? 97   LEU C CB    1 
ATOM   2111  C  CG    . LEU C 3 97  ? -9.879  -10.344 44.556 1.00 34.00  ? 97   LEU C CG    1 
ATOM   2112  C  CD1   . LEU C 3 97  ? -8.482  -9.771  44.765 1.00 33.19  ? 97   LEU C CD1   1 
ATOM   2113  C  CD2   . LEU C 3 97  ? -9.995  -11.056 43.214 1.00 31.52  ? 97   LEU C CD2   1 
ATOM   2114  N  N     . GLY C 3 98  ? -13.241 -12.868 47.209 1.00 34.78  ? 98   GLY C N     1 
ATOM   2115  C  CA    . GLY C 3 98  ? -13.660 -13.616 48.386 1.00 35.43  ? 98   GLY C CA    1 
ATOM   2116  C  C     . GLY C 3 98  ? -13.417 -15.107 48.274 1.00 36.14  ? 98   GLY C C     1 
ATOM   2117  O  O     . GLY C 3 98  ? -13.337 -15.799 49.273 1.00 36.87  ? 98   GLY C O     1 
ATOM   2118  N  N     . ARG C 3 99  ? -13.287 -15.602 47.056 1.00 36.39  ? 99   ARG C N     1 
ATOM   2119  C  CA    . ARG C 3 99  ? -13.066 -17.014 46.821 1.00 36.66  ? 99   ARG C CA    1 
ATOM   2120  C  C     . ARG C 3 99  ? -11.756 -17.221 46.049 1.00 35.59  ? 99   ARG C C     1 
ATOM   2121  O  O     . ARG C 3 99  ? -11.674 -18.063 45.162 1.00 36.44  ? 99   ARG C O     1 
ATOM   2122  C  CB    . ARG C 3 99  ? -14.271 -17.585 46.080 1.00 36.80  ? 99   ARG C CB    1 
ATOM   2123  C  CG    . ARG C 3 99  ? -15.423 -17.899 47.034 1.00 42.35  ? 99   ARG C CG    1 
ATOM   2124  C  CD    . ARG C 3 99  ? -16.729 -18.223 46.257 1.00 51.76  ? 99   ARG C CD    1 
ATOM   2125  N  NE    . ARG C 3 99  ? -17.627 -19.100 47.028 1.00 57.82  ? 99   ARG C NE    1 
ATOM   2126  C  CZ    . ARG C 3 99  ? -18.910 -19.334 46.733 1.00 61.35  ? 99   ARG C CZ    1 
ATOM   2127  N  NH1   . ARG C 3 99  ? -19.490 -18.757 45.680 1.00 63.50  ? 99   ARG C NH1   1 
ATOM   2128  N  NH2   . ARG C 3 99  ? -19.629 -20.143 47.502 1.00 63.17  ? 99   ARG C NH2   1 
ATOM   2129  N  N     . VAL C 3 100 ? -10.749 -16.421 46.393 1.00 33.92  ? 100  VAL C N     1 
ATOM   2130  C  CA    . VAL C 3 100 ? -9.455  -16.407 45.722 1.00 32.45  ? 100  VAL C CA    1 
ATOM   2131  C  C     . VAL C 3 100 ? -8.334  -16.538 46.759 1.00 31.61  ? 100  VAL C C     1 
ATOM   2132  O  O     . VAL C 3 100 ? -8.453  -16.072 47.885 1.00 30.77  ? 100  VAL C O     1 
ATOM   2133  C  CB    . VAL C 3 100 ? -9.280  -15.081 44.912 1.00 33.04  ? 100  VAL C CB    1 
ATOM   2134  C  CG1   . VAL C 3 100 ? -7.812  -14.784 44.603 1.00 32.69  ? 100  VAL C CG1   1 
ATOM   2135  C  CG2   . VAL C 3 100 ? -10.095 -15.116 43.629 1.00 32.03  ? 100  VAL C CG2   1 
ATOM   2136  N  N     . THR C 3 101 ? -7.243  -17.185 46.380 1.00 31.32  ? 101  THR C N     1 
ATOM   2137  C  CA    . THR C 3 101 ? -6.121  -17.354 47.282 1.00 30.77  ? 101  THR C CA    1 
ATOM   2138  C  C     . THR C 3 101 ? -4.886  -16.753 46.644 1.00 30.36  ? 101  THR C C     1 
ATOM   2139  O  O     . THR C 3 101 ? -4.522  -17.084 45.509 1.00 30.06  ? 101  THR C O     1 
ATOM   2140  C  CB    . THR C 3 101 ? -5.866  -18.853 47.629 1.00 31.57  ? 101  THR C CB    1 
ATOM   2141  O  OG1   . THR C 3 101 ? -7.030  -19.408 48.266 1.00 32.20  ? 101  THR C OG1   1 
ATOM   2142  C  CG2   . THR C 3 101 ? -4.647  -19.002 48.576 1.00 30.26  ? 101  THR C CG2   1 
ATOM   2143  N  N     . ILE C 3 102 ? -4.261  -15.862 47.399 1.00 30.08  ? 102  ILE C N     1 
ATOM   2144  C  CA    . ILE C 3 102 ? -3.032  -15.208 47.011 1.00 30.04  ? 102  ILE C CA    1 
ATOM   2145  C  C     . ILE C 3 102 ? -1.935  -16.003 47.660 1.00 29.74  ? 102  ILE C C     1 
ATOM   2146  O  O     . ILE C 3 102 ? -1.814  -16.005 48.874 1.00 29.78  ? 102  ILE C O     1 
ATOM   2147  C  CB    . ILE C 3 102 ? -3.005  -13.695 47.487 1.00 30.03  ? 102  ILE C CB    1 
ATOM   2148  C  CG1   . ILE C 3 102 ? -4.082  -12.882 46.748 1.00 30.52  ? 102  ILE C CG1   1 
ATOM   2149  C  CG2   . ILE C 3 102 ? -1.609  -13.070 47.319 1.00 29.59  ? 102  ILE C CG2   1 
ATOM   2150  C  CD1   . ILE C 3 102 ? -4.365  -11.472 47.306 1.00 28.37  ? 102  ILE C CD1   1 
ATOM   2151  N  N     . ALA C 3 103 ? -1.149  -16.695 46.849 1.00 30.71  ? 103  ALA C N     1 
ATOM   2152  C  CA    . ALA C 3 103 ? -0.022  -17.495 47.354 1.00 31.87  ? 103  ALA C CA    1 
ATOM   2153  C  C     . ALA C 3 103 ? 0.914   -16.590 48.119 1.00 32.39  ? 103  ALA C C     1 
ATOM   2154  O  O     . ALA C 3 103 ? 1.097   -15.462 47.711 1.00 32.91  ? 103  ALA C O     1 
ATOM   2155  C  CB    . ALA C 3 103 ? 0.716   -18.153 46.204 1.00 31.05  ? 103  ALA C CB    1 
ATOM   2156  N  N     . GLN C 3 104 ? 1.500   -17.085 49.212 1.00 33.10  ? 104  GLN C N     1 
ATOM   2157  C  CA    . GLN C 3 104 ? 2.467   -16.331 50.021 1.00 33.69  ? 104  GLN C CA    1 
ATOM   2158  C  C     . GLN C 3 104 ? 1.906   -14.997 50.558 1.00 34.01  ? 104  GLN C C     1 
ATOM   2159  O  O     . GLN C 3 104 ? 2.661   -14.023 50.774 1.00 34.41  ? 104  GLN C O     1 
ATOM   2160  C  CB    . GLN C 3 104 ? 3.797   -16.142 49.272 1.00 33.87  ? 104  GLN C CB    1 
ATOM   2161  C  CG    . GLN C 3 104 ? 4.682   -17.413 49.234 1.00 37.54  ? 104  GLN C CG    1 
ATOM   2162  C  CD    . GLN C 3 104 ? 5.143   -17.859 50.648 1.00 41.91  ? 104  GLN C CD    1 
ATOM   2163  O  OE1   . GLN C 3 104 ? 5.800   -17.101 51.367 1.00 45.21  ? 104  GLN C OE1   1 
ATOM   2164  N  NE2   . GLN C 3 104 ? 4.772   -19.074 51.046 1.00 41.35  ? 104  GLN C NE2   1 
ATOM   2165  N  N     . GLY C 3 105 ? 0.592   -14.963 50.797 1.00 32.71  ? 105  GLY C N     1 
ATOM   2166  C  CA    . GLY C 3 105 ? -0.031  -13.793 51.383 1.00 31.81  ? 105  GLY C CA    1 
ATOM   2167  C  C     . GLY C 3 105 ? -0.290  -13.816 52.878 1.00 31.50  ? 105  GLY C C     1 
ATOM   2168  O  O     . GLY C 3 105 ? -0.459  -12.748 53.510 1.00 31.77  ? 105  GLY C O     1 
ATOM   2169  N  N     . GLY C 3 106 ? -0.329  -15.019 53.451 1.00 30.79  ? 106  GLY C N     1 
ATOM   2170  C  CA    . GLY C 3 106 ? -0.690  -15.212 54.845 1.00 29.77  ? 106  GLY C CA    1 
ATOM   2171  C  C     . GLY C 3 106 ? -2.058  -14.659 55.132 1.00 29.96  ? 106  GLY C C     1 
ATOM   2172  O  O     . GLY C 3 106 ? -2.867  -14.488 54.224 1.00 30.07  ? 106  GLY C O     1 
ATOM   2173  N  N     . VAL C 3 107 ? -2.297  -14.348 56.399 1.00 30.48  ? 107  VAL C N     1 
ATOM   2174  C  CA    . VAL C 3 107 ? -3.579  -13.846 56.882 1.00 30.93  ? 107  VAL C CA    1 
ATOM   2175  C  C     . VAL C 3 107 ? -3.437  -12.498 57.600 1.00 32.16  ? 107  VAL C C     1 
ATOM   2176  O  O     . VAL C 3 107 ? -2.332  -12.066 57.913 1.00 32.09  ? 107  VAL C O     1 
ATOM   2177  C  CB    . VAL C 3 107 ? -4.223  -14.884 57.872 1.00 31.24  ? 107  VAL C CB    1 
ATOM   2178  C  CG1   . VAL C 3 107 ? -4.395  -16.280 57.189 1.00 29.81  ? 107  VAL C CG1   1 
ATOM   2179  C  CG2   . VAL C 3 107 ? -3.413  -14.994 59.162 1.00 28.72  ? 107  VAL C CG2   1 
ATOM   2180  N  N     . LEU C 3 108 ? -4.558  -11.851 57.893 1.00 33.80  ? 108  LEU C N     1 
ATOM   2181  C  CA    . LEU C 3 108 ? -4.575  -10.687 58.778 1.00 35.34  ? 108  LEU C CA    1 
ATOM   2182  C  C     . LEU C 3 108 ? -4.348  -11.085 60.243 1.00 37.03  ? 108  LEU C C     1 
ATOM   2183  O  O     . LEU C 3 108 ? -4.959  -12.047 60.719 1.00 38.12  ? 108  LEU C O     1 
ATOM   2184  C  CB    . LEU C 3 108 ? -5.922  -9.977  58.670 1.00 34.79  ? 108  LEU C CB    1 
ATOM   2185  C  CG    . LEU C 3 108 ? -6.317  -9.259  57.369 1.00 35.06  ? 108  LEU C CG    1 
ATOM   2186  C  CD1   . LEU C 3 108 ? -7.651  -8.524  57.567 1.00 30.98  ? 108  LEU C CD1   1 
ATOM   2187  C  CD2   . LEU C 3 108 ? -5.232  -8.303  56.814 1.00 33.87  ? 108  LEU C CD2   1 
ATOM   2188  N  N     . PRO C 3 109 ? -3.486  -10.348 60.979 1.00 38.44  ? 109  PRO C N     1 
ATOM   2189  C  CA    . PRO C 3 109 ? -3.439  -10.572 62.425 1.00 39.41  ? 109  PRO C CA    1 
ATOM   2190  C  C     . PRO C 3 109 ? -4.822  -10.395 63.040 1.00 40.46  ? 109  PRO C C     1 
ATOM   2191  O  O     . PRO C 3 109 ? -5.413  -9.336  62.920 1.00 41.10  ? 109  PRO C O     1 
ATOM   2192  C  CB    . PRO C 3 109 ? -2.496  -9.476  62.909 1.00 39.37  ? 109  PRO C CB    1 
ATOM   2193  C  CG    . PRO C 3 109 ? -1.535  -9.315  61.768 1.00 39.15  ? 109  PRO C CG    1 
ATOM   2194  C  CD    . PRO C 3 109 ? -2.409  -9.440  60.539 1.00 38.62  ? 109  PRO C CD    1 
ATOM   2195  N  N     . ASN C 3 110 ? -5.350  -11.448 63.647 1.00 41.66  ? 110  ASN C N     1 
ATOM   2196  C  CA    . ASN C 3 110 ? -6.654  -11.400 64.284 1.00 42.46  ? 110  ASN C CA    1 
ATOM   2197  C  C     . ASN C 3 110 ? -6.780  -12.515 65.301 1.00 42.45  ? 110  ASN C C     1 
ATOM   2198  O  O     . ASN C 3 110 ? -6.699  -13.701 64.953 1.00 42.40  ? 110  ASN C O     1 
ATOM   2199  C  CB    . ASN C 3 110 ? -7.784  -11.476 63.251 1.00 43.01  ? 110  ASN C CB    1 
ATOM   2200  C  CG    . ASN C 3 110 ? -9.160  -11.212 63.859 1.00 46.16  ? 110  ASN C CG    1 
ATOM   2201  O  OD1   . ASN C 3 110 ? -9.278  -10.771 65.014 1.00 51.33  ? 110  ASN C OD1   1 
ATOM   2202  N  ND2   . ASN C 3 110 ? -10.213 -11.481 63.084 1.00 47.53  ? 110  ASN C ND2   1 
ATOM   2203  N  N     . ILE C 3 111 ? -6.969  -12.100 66.556 1.00 42.83  ? 111  ILE C N     1 
ATOM   2204  C  CA    . ILE C 3 111 ? -7.119  -12.967 67.713 1.00 42.90  ? 111  ILE C CA    1 
ATOM   2205  C  C     . ILE C 3 111 ? -8.467  -12.665 68.361 1.00 43.66  ? 111  ILE C C     1 
ATOM   2206  O  O     . ILE C 3 111 ? -8.768  -11.517 68.661 1.00 44.42  ? 111  ILE C O     1 
ATOM   2207  C  CB    . ILE C 3 111 ? -6.007  -12.718 68.757 1.00 42.39  ? 111  ILE C CB    1 
ATOM   2208  C  CG1   . ILE C 3 111 ? -4.626  -12.669 68.081 1.00 42.41  ? 111  ILE C CG1   1 
ATOM   2209  C  CG2   . ILE C 3 111 ? -6.078  -13.774 69.878 1.00 42.41  ? 111  ILE C CG2   1 
ATOM   2210  C  CD1   . ILE C 3 111 ? -3.426  -12.663 69.048 1.00 41.28  ? 111  ILE C CD1   1 
ATOM   2211  N  N     . GLN C 3 112 ? -9.265  -13.698 68.593 1.00 44.23  ? 112  GLN C N     1 
ATOM   2212  C  CA    . GLN C 3 112 ? -10.559 -13.545 69.219 1.00 44.65  ? 112  GLN C CA    1 
ATOM   2213  C  C     . GLN C 3 112 ? -10.410 -13.128 70.666 1.00 45.70  ? 112  GLN C C     1 
ATOM   2214  O  O     . GLN C 3 112 ? -9.568  -13.665 71.397 1.00 45.87  ? 112  GLN C O     1 
ATOM   2215  C  CB    . GLN C 3 112 ? -11.333 -14.861 69.147 1.00 44.62  ? 112  GLN C CB    1 
ATOM   2216  C  CG    . GLN C 3 112 ? -11.609 -15.334 67.734 1.00 43.72  ? 112  GLN C CG    1 
ATOM   2217  C  CD    . GLN C 3 112 ? -12.530 -14.400 66.984 1.00 44.11  ? 112  GLN C CD    1 
ATOM   2218  O  OE1   . GLN C 3 112 ? -13.593 -14.004 67.481 1.00 43.66  ? 112  GLN C OE1   1 
ATOM   2219  N  NE2   . GLN C 3 112 ? -12.132 -14.041 65.777 1.00 44.51  ? 112  GLN C NE2   1 
ATOM   2220  N  N     . SER C 3 113 ? -11.261 -12.185 71.069 1.00 46.73  ? 113  SER C N     1 
ATOM   2221  C  CA    . SER C 3 113 ? -11.269 -11.593 72.413 1.00 47.50  ? 113  SER C CA    1 
ATOM   2222  C  C     . SER C 3 113 ? -11.103 -12.524 73.592 1.00 48.24  ? 113  SER C C     1 
ATOM   2223  O  O     . SER C 3 113 ? -10.250 -12.278 74.440 1.00 48.52  ? 113  SER C O     1 
ATOM   2224  C  CB    . SER C 3 113 ? -12.543 -10.773 72.623 1.00 47.66  ? 113  SER C CB    1 
ATOM   2225  O  OG    . SER C 3 113 ? -12.400 -9.519  72.008 1.00 45.92  ? 113  SER C OG    1 
ATOM   2226  N  N     . VAL C 3 114 ? -11.930 -13.568 73.657 1.00 49.25  ? 114  VAL C N     1 
ATOM   2227  C  CA    . VAL C 3 114 ? -11.942 -14.500 74.796 1.00 50.21  ? 114  VAL C CA    1 
ATOM   2228  C  C     . VAL C 3 114 ? -10.605 -15.212 74.976 1.00 51.07  ? 114  VAL C C     1 
ATOM   2229  O  O     . VAL C 3 114 ? -10.348 -15.803 76.029 1.00 51.72  ? 114  VAL C O     1 
ATOM   2230  C  CB    . VAL C 3 114 ? -13.083 -15.557 74.686 1.00 50.22  ? 114  VAL C CB    1 
ATOM   2231  C  CG1   . VAL C 3 114 ? -14.442 -14.878 74.702 1.00 50.33  ? 114  VAL C CG1   1 
ATOM   2232  C  CG2   . VAL C 3 114 ? -12.928 -16.420 73.424 1.00 49.63  ? 114  VAL C CG2   1 
ATOM   2233  N  N     . LEU C 3 115 ? -9.767  -15.155 73.944 1.00 52.05  ? 115  LEU C N     1 
ATOM   2234  C  CA    . LEU C 3 115 ? -8.484  -15.849 73.945 1.00 53.52  ? 115  LEU C CA    1 
ATOM   2235  C  C     . LEU C 3 115 ? -7.386  -15.097 74.679 1.00 54.78  ? 115  LEU C C     1 
ATOM   2236  O  O     . LEU C 3 115 ? -6.371  -15.687 75.042 1.00 54.57  ? 115  LEU C O     1 
ATOM   2237  C  CB    . LEU C 3 115 ? -8.042  -16.178 72.516 1.00 53.18  ? 115  LEU C CB    1 
ATOM   2238  C  CG    . LEU C 3 115 ? -8.979  -17.085 71.704 1.00 52.50  ? 115  LEU C CG    1 
ATOM   2239  C  CD1   . LEU C 3 115 ? -8.323  -17.441 70.379 1.00 50.26  ? 115  LEU C CD1   1 
ATOM   2240  C  CD2   . LEU C 3 115 ? -9.375  -18.345 72.497 1.00 49.96  ? 115  LEU C CD2   1 
ATOM   2241  N  N     . LEU C 3 116 ? -7.607  -13.801 74.896 1.00 56.80  ? 116  LEU C N     1 
ATOM   2242  C  CA    . LEU C 3 116 ? -6.670  -12.945 75.624 1.00 59.06  ? 116  LEU C CA    1 
ATOM   2243  C  C     . LEU C 3 116 ? -6.693  -13.221 77.132 1.00 60.68  ? 116  LEU C C     1 
ATOM   2244  O  O     . LEU C 3 116 ? -7.741  -13.564 77.679 1.00 60.46  ? 116  LEU C O     1 
ATOM   2245  C  CB    . LEU C 3 116 ? -6.946  -11.461 75.338 1.00 58.80  ? 116  LEU C CB    1 
ATOM   2246  C  CG    . LEU C 3 116 ? -6.819  -10.947 73.894 1.00 59.35  ? 116  LEU C CG    1 
ATOM   2247  C  CD1   . LEU C 3 116 ? -7.238  -9.489  73.802 1.00 59.78  ? 116  LEU C CD1   1 
ATOM   2248  C  CD2   . LEU C 3 116 ? -5.423  -11.120 73.312 1.00 58.47  ? 116  LEU C CD2   1 
ATOM   2249  N  N     . PRO C 3 117 ? -5.531  -13.070 77.803 1.00 62.72  ? 117  PRO C N     1 
ATOM   2250  C  CA    . PRO C 3 117 ? -5.364  -13.391 79.235 1.00 64.63  ? 117  PRO C CA    1 
ATOM   2251  C  C     . PRO C 3 117 ? -6.078  -12.447 80.221 1.00 66.72  ? 117  PRO C C     1 
ATOM   2252  O  O     . PRO C 3 117 ? -6.572  -11.387 79.822 1.00 66.73  ? 117  PRO C O     1 
ATOM   2253  C  CB    . PRO C 3 117 ? -3.845  -13.314 79.433 1.00 64.39  ? 117  PRO C CB    1 
ATOM   2254  C  CG    . PRO C 3 117 ? -3.372  -12.403 78.355 1.00 63.31  ? 117  PRO C CG    1 
ATOM   2255  C  CD    . PRO C 3 117 ? -4.260  -12.645 77.186 1.00 62.58  ? 117  PRO C CD    1 
ATOM   2256  N  N     . LYS C 3 118 ? -6.102  -12.859 81.497 1.00 69.33  ? 118  LYS C N     1 
ATOM   2257  C  CA    . LYS C 3 118 ? -6.711  -12.138 82.647 1.00 71.51  ? 118  LYS C CA    1 
ATOM   2258  C  C     . LYS C 3 118 ? -8.226  -11.964 82.506 1.00 72.86  ? 118  LYS C C     1 
ATOM   2259  O  O     . LYS C 3 118 ? -8.978  -12.949 82.478 1.00 73.44  ? 118  LYS C O     1 
ATOM   2260  C  CB    . LYS C 3 118 ? -6.053  -10.766 82.917 1.00 71.59  ? 118  LYS C CB    1 
ATOM   2261  C  CG    . LYS C 3 118 ? -4.546  -10.660 82.703 1.00 72.95  ? 118  LYS C CG    1 
ATOM   2262  C  CD    . LYS C 3 118 ? -4.167  -9.220  82.325 1.00 74.56  ? 118  LYS C CD    1 
ATOM   2263  C  CE    . LYS C 3 118 ? -4.790  -8.815  80.980 1.00 75.74  ? 118  LYS C CE    1 
ATOM   2264  N  NZ    . LYS C 3 118 ? -4.825  -7.338  80.726 1.00 75.77  ? 118  LYS C NZ    1 
ATOM   2265  N  N     . LYS C 3 119 ? -8.656  -10.700 82.442 1.00 74.29  ? 119  LYS C N     1 
ATOM   2266  C  CA    . LYS C 3 119 ? -10.054 -10.327 82.207 1.00 75.40  ? 119  LYS C CA    1 
ATOM   2267  C  C     . LYS C 3 119 ? -10.127 -8.918  81.622 1.00 75.68  ? 119  LYS C C     1 
ATOM   2268  O  O     . LYS C 3 119 ? -9.301  -8.059  81.958 1.00 76.22  ? 119  LYS C O     1 
ATOM   2269  C  CB    . LYS C 3 119 ? -10.890 -10.412 83.500 1.00 75.88  ? 119  LYS C CB    1 
ATOM   2270  C  CG    . LYS C 3 119 ? -10.498 -9.436  84.618 1.00 77.27  ? 119  LYS C CG    1 
ATOM   2271  C  CD    . LYS C 3 119 ? -9.490  -10.047 85.592 1.00 79.79  ? 119  LYS C CD    1 
ATOM   2272  C  CE    . LYS C 3 119 ? -9.320  -9.157  86.820 1.00 81.30  ? 119  LYS C CE    1 
ATOM   2273  N  NZ    . LYS C 3 119 ? -8.577  -9.846  87.920 1.00 82.73  ? 119  LYS C NZ    1 
ATOM   2274  N  N     . LYS D 4 31  ? 10.611  -21.333 20.283 1.00 80.70  ? 28   LYS D N     1 
ATOM   2275  C  CA    . LYS D 4 31  ? 10.869  -20.795 21.660 1.00 80.77  ? 28   LYS D CA    1 
ATOM   2276  C  C     . LYS D 4 31  ? 9.713   -19.874 22.088 1.00 80.45  ? 28   LYS D C     1 
ATOM   2277  O  O     . LYS D 4 31  ? 9.925   -18.699 22.425 1.00 80.30  ? 28   LYS D O     1 
ATOM   2278  C  CB    . LYS D 4 31  ? 12.215  -20.056 21.702 1.00 80.99  ? 28   LYS D CB    1 
ATOM   2279  C  CG    . LYS D 4 31  ? 13.418  -20.902 21.279 1.00 81.63  ? 28   LYS D CG    1 
ATOM   2280  C  CD    . LYS D 4 31  ? 13.802  -20.659 19.812 1.00 82.79  ? 28   LYS D CD    1 
ATOM   2281  C  CE    . LYS D 4 31  ? 14.093  -21.970 19.068 1.00 83.16  ? 28   LYS D CE    1 
ATOM   2282  N  NZ    . LYS D 4 31  ? 15.043  -22.862 19.806 1.00 83.33  ? 28   LYS D NZ    1 
ATOM   2283  N  N     . THR D 4 32  ? 8.508   -20.455 22.101 1.00 79.98  ? 29   THR D N     1 
ATOM   2284  C  CA    . THR D 4 32  ? 7.218   -19.740 22.049 1.00 79.56  ? 29   THR D CA    1 
ATOM   2285  C  C     . THR D 4 32  ? 7.038   -18.507 22.951 1.00 78.79  ? 29   THR D C     1 
ATOM   2286  O  O     . THR D 4 32  ? 7.573   -18.442 24.064 1.00 78.87  ? 29   THR D O     1 
ATOM   2287  C  CB    . THR D 4 32  ? 6.016   -20.721 22.222 1.00 79.76  ? 29   THR D CB    1 
ATOM   2288  O  OG1   . THR D 4 32  ? 4.890   -20.242 21.473 1.00 80.86  ? 29   THR D OG1   1 
ATOM   2289  C  CG2   . THR D 4 32  ? 5.621   -20.879 23.694 1.00 80.16  ? 29   THR D CG2   1 
ATOM   2290  N  N     . ARG D 4 33  ? 6.264   -17.545 22.445 1.00 77.68  ? 30   ARG D N     1 
ATOM   2291  C  CA    . ARG D 4 33  ? 6.050   -16.255 23.105 1.00 76.47  ? 30   ARG D CA    1 
ATOM   2292  C  C     . ARG D 4 33  ? 4.922   -16.327 24.137 1.00 75.10  ? 30   ARG D C     1 
ATOM   2293  O  O     . ARG D 4 33  ? 3.800   -16.742 23.821 1.00 75.15  ? 30   ARG D O     1 
ATOM   2294  C  CB    . ARG D 4 33  ? 5.753   -15.155 22.062 1.00 76.84  ? 30   ARG D CB    1 
ATOM   2295  C  CG    . ARG D 4 33  ? 4.344   -15.219 21.426 1.00 77.96  ? 30   ARG D CG    1 
ATOM   2296  C  CD    . ARG D 4 33  ? 3.957   -13.946 20.661 1.00 79.68  ? 30   ARG D CD    1 
ATOM   2297  N  NE    . ARG D 4 33  ? 4.514   -12.726 21.248 1.00 81.04  ? 30   ARG D NE    1 
ATOM   2298  C  CZ    . ARG D 4 33  ? 3.984   -11.507 21.122 1.00 81.97  ? 30   ARG D CZ    1 
ATOM   2299  N  NH1   . ARG D 4 33  ? 2.856   -11.318 20.444 1.00 83.03  ? 30   ARG D NH1   1 
ATOM   2300  N  NH2   . ARG D 4 33  ? 4.579   -10.468 21.690 1.00 82.28  ? 30   ARG D NH2   1 
ATOM   2301  N  N     . LYS D 4 34  ? 5.221   -15.915 25.366 1.00 73.14  ? 31   LYS D N     1 
ATOM   2302  C  CA    . LYS D 4 34  ? 4.194   -15.848 26.402 1.00 71.27  ? 31   LYS D CA    1 
ATOM   2303  C  C     . LYS D 4 34  ? 3.866   -14.418 26.840 1.00 69.59  ? 31   LYS D C     1 
ATOM   2304  O  O     . LYS D 4 34  ? 4.666   -13.738 27.488 1.00 69.32  ? 31   LYS D O     1 
ATOM   2305  C  CB    . LYS D 4 34  ? 4.525   -16.755 27.600 1.00 71.60  ? 31   LYS D CB    1 
ATOM   2306  C  CG    . LYS D 4 34  ? 5.951   -16.668 28.116 1.00 72.09  ? 31   LYS D CG    1 
ATOM   2307  C  CD    . LYS D 4 34  ? 6.186   -17.637 29.276 1.00 73.42  ? 31   LYS D CD    1 
ATOM   2308  C  CE    . LYS D 4 34  ? 7.660   -17.635 29.707 1.00 74.23  ? 31   LYS D CE    1 
ATOM   2309  N  NZ    . LYS D 4 34  ? 7.889   -18.304 31.024 1.00 74.34  ? 31   LYS D NZ    1 
ATOM   2310  N  N     . GLU D 4 35  ? 2.674   -13.977 26.458 1.00 67.41  ? 32   GLU D N     1 
ATOM   2311  C  CA    . GLU D 4 35  ? 2.168   -12.663 26.808 1.00 65.26  ? 32   GLU D CA    1 
ATOM   2312  C  C     . GLU D 4 35  ? 1.815   -12.558 28.289 1.00 63.41  ? 32   GLU D C     1 
ATOM   2313  O  O     . GLU D 4 35  ? 1.341   -13.530 28.888 1.00 63.36  ? 32   GLU D O     1 
ATOM   2314  C  CB    . GLU D 4 35  ? 0.903   -12.368 26.006 1.00 65.68  ? 32   GLU D CB    1 
ATOM   2315  C  CG    . GLU D 4 35  ? 1.082   -12.285 24.507 1.00 66.55  ? 32   GLU D CG    1 
ATOM   2316  C  CD    . GLU D 4 35  ? -0.179  -11.801 23.827 1.00 68.35  ? 32   GLU D CD    1 
ATOM   2317  O  OE1   . GLU D 4 35  ? -1.281  -12.215 24.266 1.00 69.23  ? 32   GLU D OE1   1 
ATOM   2318  O  OE2   . GLU D 4 35  ? -0.075  -10.999 22.865 1.00 68.44  ? 32   GLU D OE2   1 
ATOM   2319  N  N     . SER D 4 36  ? 2.038   -11.373 28.865 1.00 60.79  ? 33   SER D N     1 
ATOM   2320  C  CA    . SER D 4 36  ? 1.489   -11.025 30.174 1.00 58.15  ? 33   SER D CA    1 
ATOM   2321  C  C     . SER D 4 36  ? 1.159   -9.542  30.257 1.00 56.44  ? 33   SER D C     1 
ATOM   2322  O  O     . SER D 4 36  ? 1.580   -8.753  29.422 1.00 55.98  ? 33   SER D O     1 
ATOM   2323  C  CB    . SER D 4 36  ? 2.418   -11.446 31.314 1.00 58.30  ? 33   SER D CB    1 
ATOM   2324  O  OG    . SER D 4 36  ? 3.474   -10.535 31.501 1.00 57.60  ? 33   SER D OG    1 
ATOM   2325  N  N     . TYR D 4 37  ? 0.389   -9.170  31.266 1.00 54.10  ? 34   TYR D N     1 
ATOM   2326  C  CA    . TYR D 4 37  ? 0.052   -7.780  31.481 1.00 51.93  ? 34   TYR D CA    1 
ATOM   2327  C  C     . TYR D 4 37  ? 1.140   -7.021  32.237 1.00 50.80  ? 34   TYR D C     1 
ATOM   2328  O  O     . TYR D 4 37  ? 0.940   -5.877  32.608 1.00 50.66  ? 34   TYR D O     1 
ATOM   2329  C  CB    . TYR D 4 37  ? -1.263  -7.685  32.240 1.00 51.59  ? 34   TYR D CB    1 
ATOM   2330  C  CG    . TYR D 4 37  ? -2.458  -8.054  31.418 1.00 50.82  ? 34   TYR D CG    1 
ATOM   2331  C  CD1   . TYR D 4 37  ? -3.010  -9.337  31.480 1.00 49.93  ? 34   TYR D CD1   1 
ATOM   2332  C  CD2   . TYR D 4 37  ? -3.053  -7.120  30.577 1.00 50.35  ? 34   TYR D CD2   1 
ATOM   2333  C  CE1   . TYR D 4 37  ? -4.134  -9.676  30.719 1.00 48.87  ? 34   TYR D CE1   1 
ATOM   2334  C  CE2   . TYR D 4 37  ? -4.169  -7.449  29.812 1.00 50.20  ? 34   TYR D CE2   1 
ATOM   2335  C  CZ    . TYR D 4 37  ? -4.701  -8.725  29.889 1.00 49.79  ? 34   TYR D CZ    1 
ATOM   2336  O  OH    . TYR D 4 37  ? -5.805  -9.032  29.131 1.00 51.20  ? 34   TYR D OH    1 
ATOM   2337  N  N     . ALA D 4 38  ? 2.292   -7.654  32.439 1.00 49.70  ? 35   ALA D N     1 
ATOM   2338  C  CA    . ALA D 4 38  ? 3.358   -7.119  33.284 1.00 49.00  ? 35   ALA D CA    1 
ATOM   2339  C  C     . ALA D 4 38  ? 3.730   -5.663  33.026 1.00 48.22  ? 35   ALA D C     1 
ATOM   2340  O  O     . ALA D 4 38  ? 3.705   -4.839  33.945 1.00 48.43  ? 35   ALA D O     1 
ATOM   2341  C  CB    . ALA D 4 38  ? 4.607   -8.015  33.244 1.00 48.74  ? 35   ALA D CB    1 
ATOM   2342  N  N     . ILE D 4 39  ? 4.061   -5.335  31.788 1.00 47.48  ? 36   ILE D N     1 
ATOM   2343  C  CA    . ILE D 4 39  ? 4.569   -3.997  31.491 1.00 46.80  ? 36   ILE D CA    1 
ATOM   2344  C  C     . ILE D 4 39  ? 3.501   -2.927  31.748 1.00 46.46  ? 36   ILE D C     1 
ATOM   2345  O  O     . ILE D 4 39  ? 3.813   -1.816  32.193 1.00 45.98  ? 36   ILE D O     1 
ATOM   2346  C  CB    . ILE D 4 39  ? 5.189   -3.889  30.068 1.00 46.96  ? 36   ILE D CB    1 
ATOM   2347  C  CG1   . ILE D 4 39  ? 4.152   -4.181  28.989 1.00 47.29  ? 36   ILE D CG1   1 
ATOM   2348  C  CG2   . ILE D 4 39  ? 6.415   -4.814  29.932 1.00 46.08  ? 36   ILE D CG2   1 
ATOM   2349  C  CD1   . ILE D 4 39  ? 4.571   -3.710  27.607 1.00 48.47  ? 36   ILE D CD1   1 
ATOM   2350  N  N     . TYR D 4 40  ? 2.247   -3.290  31.500 1.00 45.72  ? 37   TYR D N     1 
ATOM   2351  C  CA    . TYR D 4 40  ? 1.114   -2.411  31.753 1.00 45.39  ? 37   TYR D CA    1 
ATOM   2352  C  C     . TYR D 4 40  ? 0.842   -2.236  33.235 1.00 44.69  ? 37   TYR D C     1 
ATOM   2353  O  O     . TYR D 4 40  ? 0.495   -1.142  33.678 1.00 45.04  ? 37   TYR D O     1 
ATOM   2354  C  CB    . TYR D 4 40  ? -0.120  -2.929  31.021 1.00 45.74  ? 37   TYR D CB    1 
ATOM   2355  C  CG    . TYR D 4 40  ? 0.196   -3.234  29.583 1.00 47.88  ? 37   TYR D CG    1 
ATOM   2356  C  CD1   . TYR D 4 40  ? 0.238   -4.551  29.116 1.00 50.60  ? 37   TYR D CD1   1 
ATOM   2357  C  CD2   . TYR D 4 40  ? 0.510   -2.205  28.696 1.00 49.74  ? 37   TYR D CD2   1 
ATOM   2358  C  CE1   . TYR D 4 40  ? 0.552   -4.825  27.781 1.00 52.96  ? 37   TYR D CE1   1 
ATOM   2359  C  CE2   . TYR D 4 40  ? 0.830   -2.465  27.382 1.00 52.16  ? 37   TYR D CE2   1 
ATOM   2360  C  CZ    . TYR D 4 40  ? 0.848   -3.769  26.925 1.00 53.68  ? 37   TYR D CZ    1 
ATOM   2361  O  OH    . TYR D 4 40  ? 1.167   -4.003  25.608 1.00 57.34  ? 37   TYR D OH    1 
ATOM   2362  N  N     . VAL D 4 41  ? 1.017   -3.309  34.001 1.00 43.51  ? 38   VAL D N     1 
ATOM   2363  C  CA    . VAL D 4 41  ? 0.866   -3.251  35.450 1.00 42.20  ? 38   VAL D CA    1 
ATOM   2364  C  C     . VAL D 4 41  ? 1.950   -2.346  36.013 1.00 42.32  ? 38   VAL D C     1 
ATOM   2365  O  O     . VAL D 4 41  ? 1.677   -1.526  36.890 1.00 41.60  ? 38   VAL D O     1 
ATOM   2366  C  CB    . VAL D 4 41  ? 0.908   -4.682  36.107 1.00 41.79  ? 38   VAL D CB    1 
ATOM   2367  C  CG1   . VAL D 4 41  ? 1.058   -4.604  37.616 1.00 39.10  ? 38   VAL D CG1   1 
ATOM   2368  C  CG2   . VAL D 4 41  ? -0.350  -5.473  35.741 1.00 40.53  ? 38   VAL D CG2   1 
ATOM   2369  N  N     . TYR D 4 42  ? 3.171   -2.513  35.495 1.00 42.52  ? 39   TYR D N     1 
ATOM   2370  C  CA    . TYR D 4 42  ? 4.322   -1.713  35.897 1.00 43.09  ? 39   TYR D CA    1 
ATOM   2371  C  C     . TYR D 4 42  ? 4.125   -0.224  35.558 1.00 42.71  ? 39   TYR D C     1 
ATOM   2372  O  O     . TYR D 4 42  ? 4.397   0.638   36.386 1.00 42.70  ? 39   TYR D O     1 
ATOM   2373  C  CB    . TYR D 4 42  ? 5.606   -2.267  35.263 1.00 43.69  ? 39   TYR D CB    1 
ATOM   2374  C  CG    . TYR D 4 42  ? 6.864   -1.682  35.848 1.00 46.66  ? 39   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D 4 42  ? 7.414   -2.196  37.027 1.00 50.16  ? 39   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D 4 42  ? 7.500   -0.600  35.236 1.00 50.07  ? 39   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D 4 42  ? 8.580   -1.633  37.596 1.00 52.75  ? 39   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D 4 42  ? 8.667   -0.039  35.780 1.00 52.53  ? 39   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D 4 42  ? 9.203   -0.559  36.959 1.00 53.76  ? 39   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D 4 42  ? 10.355  0.002   37.495 1.00 56.20  ? 39   TYR D OH    1 
ATOM   2381  N  N     . LYS D 4 43  ? 3.627   0.070   34.360 1.00 42.49  ? 40   LYS D N     1 
ATOM   2382  C  CA    . LYS D 4 43  ? 3.289   1.445   33.987 1.00 42.72  ? 40   LYS D CA    1 
ATOM   2383  C  C     . LYS D 4 43  ? 2.372   2.056   35.022 1.00 42.15  ? 40   LYS D C     1 
ATOM   2384  O  O     . LYS D 4 43  ? 2.655   3.127   35.550 1.00 43.12  ? 40   LYS D O     1 
ATOM   2385  C  CB    . LYS D 4 43  ? 2.633   1.523   32.605 1.00 42.39  ? 40   LYS D CB    1 
ATOM   2386  C  CG    . LYS D 4 43  ? 3.615   1.584   31.470 1.00 44.74  ? 40   LYS D CG    1 
ATOM   2387  C  CD    . LYS D 4 43  ? 2.970   1.272   30.116 1.00 47.03  ? 40   LYS D CD    1 
ATOM   2388  C  CE    . LYS D 4 43  ? 4.007   1.394   29.010 1.00 47.97  ? 40   LYS D CE    1 
ATOM   2389  N  NZ    . LYS D 4 43  ? 3.497   0.918   27.690 1.00 52.09  ? 40   LYS D NZ    1 
ATOM   2390  N  N     . VAL D 4 44  ? 1.287   1.350   35.323 1.00 41.56  ? 41   VAL D N     1 
ATOM   2391  C  CA    . VAL D 4 44  ? 0.255   1.830   36.246 1.00 40.25  ? 41   VAL D CA    1 
ATOM   2392  C  C     . VAL D 4 44  ? 0.826   1.948   37.643 1.00 40.01  ? 41   VAL D C     1 
ATOM   2393  O  O     . VAL D 4 44  ? 0.486   2.873   38.381 1.00 41.07  ? 41   VAL D O     1 
ATOM   2394  C  CB    . VAL D 4 44  ? -0.987  0.902   36.233 1.00 40.14  ? 41   VAL D CB    1 
ATOM   2395  C  CG1   . VAL D 4 44  ? -2.041  1.346   37.261 1.00 39.30  ? 41   VAL D CG1   1 
ATOM   2396  C  CG2   . VAL D 4 44  ? -1.592  0.853   34.846 1.00 39.01  ? 41   VAL D CG2   1 
ATOM   2397  N  N     . LEU D 4 45  ? 1.721   1.034   37.997 1.00 39.25  ? 42   LEU D N     1 
ATOM   2398  C  CA    . LEU D 4 45  ? 2.411   1.117   39.278 1.00 38.85  ? 42   LEU D CA    1 
ATOM   2399  C  C     . LEU D 4 45  ? 3.249   2.406   39.420 1.00 38.94  ? 42   LEU D C     1 
ATOM   2400  O  O     . LEU D 4 45  ? 3.299   3.004   40.511 1.00 38.84  ? 42   LEU D O     1 
ATOM   2401  C  CB    . LEU D 4 45  ? 3.277   -0.120  39.509 1.00 38.17  ? 42   LEU D CB    1 
ATOM   2402  C  CG    . LEU D 4 45  ? 4.248   -0.111  40.688 1.00 36.93  ? 42   LEU D CG    1 
ATOM   2403  C  CD1   . LEU D 4 45  ? 3.519   -0.022  42.025 1.00 35.47  ? 42   LEU D CD1   1 
ATOM   2404  C  CD2   . LEU D 4 45  ? 5.166   -1.310  40.629 1.00 36.91  ? 42   LEU D CD2   1 
ATOM   2405  N  N     . LYS D 4 46  ? 3.893   2.825   38.331 1.00 38.58  ? 43   LYS D N     1 
ATOM   2406  C  CA    . LYS D 4 46  ? 4.767   4.005   38.381 1.00 38.81  ? 43   LYS D CA    1 
ATOM   2407  C  C     . LYS D 4 46  ? 3.957   5.265   38.553 1.00 38.23  ? 43   LYS D C     1 
ATOM   2408  O  O     . LYS D 4 46  ? 4.354   6.147   39.314 1.00 38.77  ? 43   LYS D O     1 
ATOM   2409  C  CB    . LYS D 4 46  ? 5.702   4.088   37.170 1.00 38.91  ? 43   LYS D CB    1 
ATOM   2410  C  CG    . LYS D 4 46  ? 6.875   3.101   37.268 1.00 40.08  ? 43   LYS D CG    1 
ATOM   2411  C  CD    . LYS D 4 46  ? 7.619   3.314   38.578 1.00 41.29  ? 43   LYS D CD    1 
ATOM   2412  C  CE    . LYS D 4 46  ? 8.183   2.027   39.123 1.00 42.73  ? 43   LYS D CE    1 
ATOM   2413  N  NZ    . LYS D 4 46  ? 9.116   2.308   40.248 1.00 42.50  ? 43   LYS D NZ    1 
ATOM   2414  N  N     . GLN D 4 47  ? 2.796   5.307   37.897 1.00 37.38  ? 44   GLN D N     1 
ATOM   2415  C  CA    . GLN D 4 47  ? 1.820   6.388   38.063 1.00 36.63  ? 44   GLN D CA    1 
ATOM   2416  C  C     . GLN D 4 47  ? 1.385   6.624   39.517 1.00 36.17  ? 44   GLN D C     1 
ATOM   2417  O  O     . GLN D 4 47  ? 1.279   7.771   39.962 1.00 35.51  ? 44   GLN D O     1 
ATOM   2418  C  CB    . GLN D 4 47  ? 0.573   6.122   37.222 1.00 36.76  ? 44   GLN D CB    1 
ATOM   2419  C  CG    . GLN D 4 47  ? 0.781   6.126   35.723 1.00 38.49  ? 44   GLN D CG    1 
ATOM   2420  C  CD    . GLN D 4 47  ? -0.526  5.972   34.943 1.00 41.89  ? 44   GLN D CD    1 
ATOM   2421  O  OE1   . GLN D 4 47  ? -1.370  5.103   35.244 1.00 43.15  ? 44   GLN D OE1   1 
ATOM   2422  N  NE2   . GLN D 4 47  ? -0.691  6.805   33.920 1.00 42.18  ? 44   GLN D NE2   1 
ATOM   2423  N  N     . VAL D 4 48  ? 1.137   5.542   40.255 1.00 36.00  ? 45   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4 48  ? 0.544   5.663   41.589 1.00 35.61  ? 45   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4 48  ? 1.570   5.709   42.710 1.00 35.60  ? 45   VAL D C     1 
ATOM   2426  O  O     . VAL D 4 48  ? 1.338   6.321   43.750 1.00 35.11  ? 45   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4 48  ? -0.543  4.582   41.858 1.00 35.85  ? 45   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4 48  ? -1.594  4.602   40.767 1.00 35.40  ? 45   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4 48  ? 0.068   3.167   42.003 1.00 35.90  ? 45   VAL D CG2   1 
ATOM   2430  N  N     . HIS D 4 49  ? 2.700   5.049   42.508 1.00 36.80  ? 46   HIS D N     1 
ATOM   2431  C  CA    . HIS D 4 49  ? 3.762   5.014   43.520 1.00 37.63  ? 46   HIS D CA    1 
ATOM   2432  C  C     . HIS D 4 49  ? 5.096   5.004   42.769 1.00 38.29  ? 46   HIS D C     1 
ATOM   2433  O  O     . HIS D 4 49  ? 5.685   3.940   42.542 1.00 37.83  ? 46   HIS D O     1 
ATOM   2434  C  CB    . HIS D 4 49  ? 3.659   3.792   44.420 1.00 37.26  ? 46   HIS D CB    1 
ATOM   2435  C  CG    . HIS D 4 49  ? 2.487   3.791   45.344 1.00 38.26  ? 46   HIS D CG    1 
ATOM   2436  N  ND1   . HIS D 4 49  ? 2.401   4.612   46.447 1.00 39.05  ? 46   HIS D ND1   1 
ATOM   2437  C  CD2   . HIS D 4 49  ? 1.378   3.012   45.370 1.00 39.18  ? 46   HIS D CD2   1 
ATOM   2438  C  CE1   . HIS D 4 49  ? 1.284   4.354   47.103 1.00 38.65  ? 46   HIS D CE1   1 
ATOM   2439  N  NE2   . HIS D 4 49  ? 0.641   3.392   46.465 1.00 39.84  ? 46   HIS D NE2   1 
ATOM   2440  N  N     . PRO D 4 50  ? 5.574   6.201   42.377 1.00 39.21  ? 47   PRO D N     1 
ATOM   2441  C  CA    . PRO D 4 50  ? 6.735   6.313   41.473 1.00 39.25  ? 47   PRO D CA    1 
ATOM   2442  C  C     . PRO D 4 50  ? 8.011   5.685   42.022 1.00 39.52  ? 47   PRO D C     1 
ATOM   2443  O  O     . PRO D 4 50  ? 8.851   5.290   41.239 1.00 39.96  ? 47   PRO D O     1 
ATOM   2444  C  CB    . PRO D 4 50  ? 6.905   7.834   41.277 1.00 39.08  ? 47   PRO D CB    1 
ATOM   2445  C  CG    . PRO D 4 50  ? 5.618   8.455   41.750 1.00 39.25  ? 47   PRO D CG    1 
ATOM   2446  C  CD    . PRO D 4 50  ? 5.046   7.522   42.787 1.00 38.87  ? 47   PRO D CD    1 
ATOM   2447  N  N     . ASP D 4 51  ? 8.144   5.576   43.340 1.00 40.19  ? 48   ASP D N     1 
ATOM   2448  C  CA    . ASP D 4 51  ? 9.374   5.057   43.953 1.00 41.29  ? 48   ASP D CA    1 
ATOM   2449  C  C     . ASP D 4 51  ? 9.273   3.605   44.478 1.00 41.22  ? 48   ASP D C     1 
ATOM   2450  O  O     . ASP D 4 51  ? 10.172  3.130   45.181 1.00 41.24  ? 48   ASP D O     1 
ATOM   2451  C  CB    . ASP D 4 51  ? 9.827   5.993   45.091 1.00 41.61  ? 48   ASP D CB    1 
ATOM   2452  C  CG    . ASP D 4 51  ? 10.272  7.368   44.586 1.00 44.32  ? 48   ASP D CG    1 
ATOM   2453  O  OD1   . ASP D 4 51  ? 10.820  7.452   43.450 1.00 46.11  ? 48   ASP D OD1   1 
ATOM   2454  O  OD2   . ASP D 4 51  ? 10.069  8.365   45.331 1.00 45.87  ? 48   ASP D OD2   1 
ATOM   2455  N  N     . THR D 4 52  ? 8.184   2.916   44.129 1.00 40.91  ? 49   THR D N     1 
ATOM   2456  C  CA    . THR D 4 52  ? 7.908   1.576   44.620 1.00 40.19  ? 49   THR D CA    1 
ATOM   2457  C  C     . THR D 4 52  ? 8.123   0.554   43.509 1.00 39.56  ? 49   THR D C     1 
ATOM   2458  O  O     . THR D 4 52  ? 7.729   0.778   42.361 1.00 39.22  ? 49   THR D O     1 
ATOM   2459  C  CB    . THR D 4 52  ? 6.457   1.498   45.140 1.00 40.52  ? 49   THR D CB    1 
ATOM   2460  O  OG1   . THR D 4 52  ? 6.270   2.480   46.154 1.00 40.79  ? 49   THR D OG1   1 
ATOM   2461  C  CG2   . THR D 4 52  ? 6.118   0.109   45.738 1.00 41.54  ? 49   THR D CG2   1 
ATOM   2462  N  N     . GLY D 4 53  ? 8.753   -0.566  43.848 1.00 39.44  ? 50   GLY D N     1 
ATOM   2463  C  CA    . GLY D 4 53  ? 8.883   -1.682  42.909 1.00 39.24  ? 50   GLY D CA    1 
ATOM   2464  C  C     . GLY D 4 53  ? 7.877   -2.815  43.155 1.00 39.53  ? 50   GLY D C     1 
ATOM   2465  O  O     . GLY D 4 53  ? 7.038   -2.755  44.067 1.00 39.39  ? 50   GLY D O     1 
ATOM   2466  N  N     . ILE D 4 54  ? 7.974   -3.862  42.343 1.00 39.45  ? 51   ILE D N     1 
ATOM   2467  C  CA    . ILE D 4 54  ? 7.142   -5.053  42.514 1.00 39.16  ? 51   ILE D CA    1 
ATOM   2468  C  C     . ILE D 4 54  ? 7.996   -6.315  42.276 1.00 39.30  ? 51   ILE D C     1 
ATOM   2469  O  O     . ILE D 4 54  ? 8.690   -6.404  41.270 1.00 39.17  ? 51   ILE D O     1 
ATOM   2470  C  CB    . ILE D 4 54  ? 5.865   -4.998  41.596 1.00 38.69  ? 51   ILE D CB    1 
ATOM   2471  C  CG1   . ILE D 4 54  ? 4.890   -6.142  41.922 1.00 37.94  ? 51   ILE D CG1   1 
ATOM   2472  C  CG2   . ILE D 4 54  ? 6.254   -4.990  40.137 1.00 38.03  ? 51   ILE D CG2   1 
ATOM   2473  C  CD1   . ILE D 4 54  ? 3.448   -5.988  41.381 1.00 35.38  ? 51   ILE D CD1   1 
ATOM   2474  N  N     . SER D 4 55  ? 7.955   -7.266  43.214 1.00 39.33  ? 52   SER D N     1 
ATOM   2475  C  CA    . SER D 4 55  ? 8.641   -8.569  43.051 1.00 39.61  ? 52   SER D CA    1 
ATOM   2476  C  C     . SER D 4 55  ? 8.018   -9.338  41.881 1.00 39.78  ? 52   SER D C     1 
ATOM   2477  O  O     . SER D 4 55  ? 6.880   -9.049  41.489 1.00 39.43  ? 52   SER D O     1 
ATOM   2478  C  CB    . SER D 4 55  ? 8.517   -9.406  44.318 1.00 39.12  ? 52   SER D CB    1 
ATOM   2479  O  OG    . SER D 4 55  ? 7.254   -10.076 44.327 1.00 40.26  ? 52   SER D OG    1 
ATOM   2480  N  N     . SER D 4 56  ? 8.739   -10.308 41.320 1.00 39.86  ? 53   SER D N     1 
ATOM   2481  C  CA    . SER D 4 56  ? 8.167   -11.067 40.210 1.00 40.92  ? 53   SER D CA    1 
ATOM   2482  C  C     . SER D 4 56  ? 6.955   -11.882 40.656 1.00 40.44  ? 53   SER D C     1 
ATOM   2483  O  O     . SER D 4 56  ? 6.025   -12.078 39.874 1.00 40.02  ? 53   SER D O     1 
ATOM   2484  C  CB    . SER D 4 56  ? 9.193   -11.961 39.507 1.00 40.97  ? 53   SER D CB    1 
ATOM   2485  O  OG    . SER D 4 56  ? 10.012  -12.606 40.461 1.00 45.08  ? 53   SER D OG    1 
ATOM   2486  N  N     . LYS D 4 57  ? 6.957   -12.337 41.908 1.00 40.32  ? 54   LYS D N     1 
ATOM   2487  C  CA    . LYS D 4 57  ? 5.845   -13.131 42.413 1.00 40.31  ? 54   LYS D CA    1 
ATOM   2488  C  C     . LYS D 4 57  ? 4.593   -12.265 42.537 1.00 39.89  ? 54   LYS D C     1 
ATOM   2489  O  O     . LYS D 4 57  ? 3.507   -12.680 42.125 1.00 39.97  ? 54   LYS D O     1 
ATOM   2490  C  CB    . LYS D 4 57  ? 6.187   -13.786 43.745 1.00 40.80  ? 54   LYS D CB    1 
ATOM   2491  C  CG    . LYS D 4 57  ? 7.091   -15.019 43.651 1.00 44.28  ? 54   LYS D CG    1 
ATOM   2492  C  CD    . LYS D 4 57  ? 7.620   -15.384 45.055 1.00 50.48  ? 54   LYS D CD    1 
ATOM   2493  C  CE    . LYS D 4 57  ? 8.835   -16.347 45.018 1.00 53.85  ? 54   LYS D CE    1 
ATOM   2494  N  NZ    . LYS D 4 57  ? 9.716   -16.190 46.262 1.00 54.99  ? 54   LYS D NZ    1 
ATOM   2495  N  N     . ALA D 4 58  ? 4.748   -11.053 43.083 1.00 38.86  ? 55   ALA D N     1 
ATOM   2496  C  CA    . ALA D 4 58  ? 3.635   -10.115 43.163 1.00 36.75  ? 55   ALA D CA    1 
ATOM   2497  C  C     . ALA D 4 58  ? 3.175   -9.781  41.771 1.00 36.07  ? 55   ALA D C     1 
ATOM   2498  O  O     . ALA D 4 58  ? 1.982   -9.672  41.527 1.00 35.89  ? 55   ALA D O     1 
ATOM   2499  C  CB    . ALA D 4 58  ? 4.034   -8.866  43.907 1.00 37.03  ? 55   ALA D CB    1 
ATOM   2500  N  N     . MET D 4 59  ? 4.108   -9.626  40.836 1.00 35.50  ? 56   MET D N     1 
ATOM   2501  C  CA    . MET D 4 59  ? 3.705   -9.388  39.461 1.00 35.53  ? 56   MET D CA    1 
ATOM   2502  C  C     . MET D 4 59  ? 2.891   -10.569 38.924 1.00 35.66  ? 56   MET D C     1 
ATOM   2503  O  O     . MET D 4 59  ? 1.876   -10.380 38.235 1.00 35.90  ? 56   MET D O     1 
ATOM   2504  C  CB    . MET D 4 59  ? 4.894   -9.091  38.553 1.00 35.69  ? 56   MET D CB    1 
ATOM   2505  C  CG    . MET D 4 59  ? 4.490   -8.744  37.118 1.00 36.97  ? 56   MET D CG    1 
ATOM   2506  S  SD    . MET D 4 59  ? 3.439   -7.247  37.071 1.00 42.46  ? 56   MET D SD    1 
ATOM   2507  C  CE    . MET D 4 59  ? 4.698   -5.959  37.019 1.00 40.54  ? 56   MET D CE    1 
ATOM   2508  N  N     . SER D 4 60  ? 3.317   -11.783 39.249 1.00 35.14  ? 57   SER D N     1 
ATOM   2509  C  CA    . SER D 4 60  ? 2.619   -12.961 38.761 1.00 35.12  ? 57   SER D CA    1 
ATOM   2510  C  C     . SER D 4 60  ? 1.177   -12.971 39.281 1.00 35.02  ? 57   SER D C     1 
ATOM   2511  O  O     . SER D 4 60  ? 0.235   -13.197 38.520 1.00 34.63  ? 57   SER D O     1 
ATOM   2512  C  CB    . SER D 4 60  ? 3.360   -14.234 39.157 1.00 35.42  ? 57   SER D CB    1 
ATOM   2513  O  OG    . SER D 4 60  ? 2.787   -15.330 38.488 1.00 36.03  ? 57   SER D OG    1 
ATOM   2514  N  N     . ILE D 4 61  ? 1.013   -12.675 40.565 1.00 34.80  ? 58   ILE D N     1 
ATOM   2515  C  CA    . ILE D 4 61  ? -0.306  -12.471 41.147 1.00 35.15  ? 58   ILE D CA    1 
ATOM   2516  C  C     . ILE D 4 61  ? -1.101  -11.345 40.462 1.00 35.61  ? 58   ILE D C     1 
ATOM   2517  O  O     . ILE D 4 61  ? -2.319  -11.487 40.196 1.00 35.03  ? 58   ILE D O     1 
ATOM   2518  C  CB    . ILE D 4 61  ? -0.223  -12.214 42.669 1.00 35.40  ? 58   ILE D CB    1 
ATOM   2519  C  CG1   . ILE D 4 61  ? 0.266   -13.478 43.376 1.00 35.18  ? 58   ILE D CG1   1 
ATOM   2520  C  CG2   . ILE D 4 61  ? -1.602  -11.795 43.217 1.00 34.36  ? 58   ILE D CG2   1 
ATOM   2521  C  CD1   . ILE D 4 61  ? 0.903   -13.207 44.711 1.00 37.75  ? 58   ILE D CD1   1 
ATOM   2522  N  N     . MET D 4 62  ? -0.429  -10.236 40.151 1.00 35.67  ? 59   MET D N     1 
ATOM   2523  C  CA    . MET D 4 62  ? -1.135  -9.147  39.467 1.00 35.47  ? 59   MET D CA    1 
ATOM   2524  C  C     . MET D 4 62  ? -1.590  -9.612  38.108 1.00 35.19  ? 59   MET D C     1 
ATOM   2525  O  O     . MET D 4 62  ? -2.709  -9.312  37.677 1.00 34.85  ? 59   MET D O     1 
ATOM   2526  C  CB    . MET D 4 62  ? -0.285  -7.874  39.354 1.00 35.52  ? 59   MET D CB    1 
ATOM   2527  C  CG    . MET D 4 62  ? -0.180  -7.093  40.641 1.00 35.50  ? 59   MET D CG    1 
ATOM   2528  S  SD    . MET D 4 62  ? -1.775  -6.746  41.400 1.00 37.95  ? 59   MET D SD    1 
ATOM   2529  C  CE    . MET D 4 62  ? -2.609  -5.927  40.054 1.00 36.47  ? 59   MET D CE    1 
ATOM   2530  N  N     . ASN D 4 63  ? -0.728  -10.367 37.440 1.00 35.36  ? 60   ASN D N     1 
ATOM   2531  C  CA    . ASN D 4 63  ? -1.100  -10.928 36.141 1.00 36.46  ? 60   ASN D CA    1 
ATOM   2532  C  C     . ASN D 4 63  ? -2.289  -11.885 36.196 1.00 36.10  ? 60   ASN D C     1 
ATOM   2533  O  O     . ASN D 4 63  ? -3.156  -11.861 35.321 1.00 35.62  ? 60   ASN D O     1 
ATOM   2534  C  CB    . ASN D 4 63  ? 0.069   -11.627 35.479 1.00 36.81  ? 60   ASN D CB    1 
ATOM   2535  C  CG    . ASN D 4 63  ? -0.183  -11.863 34.020 1.00 39.46  ? 60   ASN D CG    1 
ATOM   2536  O  OD1   . ASN D 4 63  ? -0.748  -11.006 33.336 1.00 41.27  ? 60   ASN D OD1   1 
ATOM   2537  N  ND2   . ASN D 4 63  ? 0.213   -13.037 33.525 1.00 42.15  ? 60   ASN D ND2   1 
ATOM   2538  N  N     . SER D 4 64  ? -2.321  -12.724 37.235 1.00 36.26  ? 61   SER D N     1 
ATOM   2539  C  CA    . SER D 4 64  ? -3.441  -13.640 37.448 1.00 36.32  ? 61   SER D CA    1 
ATOM   2540  C  C     . SER D 4 64  ? -4.741  -12.885 37.747 1.00 36.21  ? 61   SER D C     1 
ATOM   2541  O  O     . SER D 4 64  ? -5.813  -13.267 37.280 1.00 35.74  ? 61   SER D O     1 
ATOM   2542  C  CB    . SER D 4 64  ? -3.123  -14.593 38.588 1.00 36.31  ? 61   SER D CB    1 
ATOM   2543  O  OG    . SER D 4 64  ? -2.327  -15.669 38.118 1.00 39.23  ? 61   SER D OG    1 
ATOM   2544  N  N     . PHE D 4 65  ? -4.637  -11.806 38.520 1.00 36.31  ? 62   PHE D N     1 
ATOM   2545  C  CA    . PHE D 4 65  ? -5.805  -11.003 38.866 1.00 36.36  ? 62   PHE D CA    1 
ATOM   2546  C  C     . PHE D 4 65  ? -6.434  -10.388 37.624 1.00 36.57  ? 62   PHE D C     1 
ATOM   2547  O  O     . PHE D 4 65  ? -7.666  -10.423 37.464 1.00 36.69  ? 62   PHE D O     1 
ATOM   2548  C  CB    . PHE D 4 65  ? -5.442  -9.936  39.906 1.00 36.44  ? 62   PHE D CB    1 
ATOM   2549  C  CG    . PHE D 4 65  ? -6.469  -8.853  40.060 1.00 36.95  ? 62   PHE D CG    1 
ATOM   2550  C  CD1   . PHE D 4 65  ? -7.683  -9.109  40.692 1.00 38.20  ? 62   PHE D CD1   1 
ATOM   2551  C  CD2   . PHE D 4 65  ? -6.214  -7.566  39.588 1.00 38.11  ? 62   PHE D CD2   1 
ATOM   2552  C  CE1   . PHE D 4 65  ? -8.644  -8.108  40.843 1.00 39.18  ? 62   PHE D CE1   1 
ATOM   2553  C  CE2   . PHE D 4 65  ? -7.166  -6.546  39.732 1.00 40.15  ? 62   PHE D CE2   1 
ATOM   2554  C  CZ    . PHE D 4 65  ? -8.389  -6.821  40.364 1.00 39.90  ? 62   PHE D CZ    1 
ATOM   2555  N  N     . VAL D 4 66  ? -5.603  -9.861  36.725 1.00 36.58  ? 63   VAL D N     1 
ATOM   2556  C  CA    . VAL D 4 66  ? -6.135  -9.215  35.519 1.00 36.58  ? 63   VAL D CA    1 
ATOM   2557  C  C     . VAL D 4 66  ? -6.830  -10.259 34.638 1.00 36.58  ? 63   VAL D C     1 
ATOM   2558  O  O     . VAL D 4 66  ? -7.944  -10.035 34.154 1.00 36.62  ? 63   VAL D O     1 
ATOM   2559  C  CB    . VAL D 4 66  ? -5.050  -8.439  34.696 1.00 36.43  ? 63   VAL D CB    1 
ATOM   2560  C  CG1   . VAL D 4 66  ? -5.697  -7.706  33.552 1.00 37.26  ? 63   VAL D CG1   1 
ATOM   2561  C  CG2   . VAL D 4 66  ? -4.267  -7.444  35.567 1.00 36.27  ? 63   VAL D CG2   1 
ATOM   2562  N  N     . ASN D 4 67  ? -6.166  -11.394 34.420 1.00 36.78  ? 64   ASN D N     1 
ATOM   2563  C  CA    . ASN D 4 67  ? -6.748  -12.475 33.617 1.00 36.62  ? 64   ASN D CA    1 
ATOM   2564  C  C     . ASN D 4 67  ? -8.055  -12.972 34.238 1.00 35.77  ? 64   ASN D C     1 
ATOM   2565  O  O     . ASN D 4 67  ? -9.050  -13.179 33.553 1.00 35.57  ? 64   ASN D O     1 
ATOM   2566  C  CB    . ASN D 4 67  ? -5.761  -13.634 33.467 1.00 36.86  ? 64   ASN D CB    1 
ATOM   2567  C  CG    . ASN D 4 67  ? -4.535  -13.264 32.635 1.00 38.71  ? 64   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D 4 67  ? -4.642  -12.702 31.546 1.00 39.82  ? 64   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D 4 67  ? -3.356  -13.600 33.148 1.00 42.43  ? 64   ASN D ND2   1 
ATOM   2570  N  N     . ASP D 4 68  ? -8.050  -13.151 35.546 1.00 35.07  ? 65   ASP D N     1 
ATOM   2571  C  CA    . ASP D 4 68  ? -9.249  -13.590 36.248 1.00 34.67  ? 65   ASP D CA    1 
ATOM   2572  C  C     . ASP D 4 68  ? -10.433 -12.615 36.044 1.00 34.42  ? 65   ASP D C     1 
ATOM   2573  O  O     . ASP D 4 68  ? -11.495 -13.007 35.546 1.00 34.49  ? 65   ASP D O     1 
ATOM   2574  C  CB    . ASP D 4 68  ? -8.917  -13.833 37.723 1.00 34.35  ? 65   ASP D CB    1 
ATOM   2575  C  CG    . ASP D 4 68  ? -10.128 -14.228 38.550 1.00 36.56  ? 65   ASP D CG    1 
ATOM   2576  O  OD1   . ASP D 4 68  ? -11.148 -14.690 37.970 1.00 40.72  ? 65   ASP D OD1   1 
ATOM   2577  O  OD2   . ASP D 4 68  ? -10.076 -14.062 39.790 1.00 33.71  ? 65   ASP D OD2   1 
ATOM   2578  N  N     . VAL D 4 69  ? -10.253 -11.343 36.394 1.00 34.62  ? 66   VAL D N     1 
ATOM   2579  C  CA    . VAL D 4 69  ? -11.310 -10.330 36.174 1.00 34.10  ? 66   VAL D CA    1 
ATOM   2580  C  C     . VAL D 4 69  ? -11.744 -10.246 34.708 1.00 34.41  ? 66   VAL D C     1 
ATOM   2581  O  O     . VAL D 4 69  ? -12.951 -10.203 34.404 1.00 33.59  ? 66   VAL D O     1 
ATOM   2582  C  CB    . VAL D 4 69  ? -10.924 -8.934  36.750 1.00 34.33  ? 66   VAL D CB    1 
ATOM   2583  C  CG1   . VAL D 4 69  ? -11.942 -7.880  36.371 1.00 33.73  ? 66   VAL D CG1   1 
ATOM   2584  C  CG2   . VAL D 4 69  ? -10.842 -9.006  38.249 1.00 32.75  ? 66   VAL D CG2   1 
ATOM   2585  N  N     . PHE D 4 70  ? -10.774 -10.261 33.801 1.00 34.92  ? 67   PHE D N     1 
ATOM   2586  C  CA    . PHE D 4 70  ? -11.101 -10.332 32.377 1.00 36.67  ? 67   PHE D CA    1 
ATOM   2587  C  C     . PHE D 4 70  ? -12.132 -11.446 32.121 1.00 37.47  ? 67   PHE D C     1 
ATOM   2588  O  O     . PHE D 4 70  ? -13.219 -11.175 31.599 1.00 38.11  ? 67   PHE D O     1 
ATOM   2589  C  CB    . PHE D 4 70  ? -9.842  -10.545 31.530 1.00 36.92  ? 67   PHE D CB    1 
ATOM   2590  C  CG    . PHE D 4 70  ? -10.106 -10.656 30.050 1.00 37.55  ? 67   PHE D CG    1 
ATOM   2591  C  CD1   . PHE D 4 70  ? -9.872  -9.589  29.206 1.00 39.24  ? 67   PHE D CD1   1 
ATOM   2592  C  CD2   . PHE D 4 70  ? -10.543 -11.849 29.496 1.00 40.09  ? 67   PHE D CD2   1 
ATOM   2593  C  CE1   . PHE D 4 70  ? -10.106 -9.693  27.831 1.00 39.53  ? 67   PHE D CE1   1 
ATOM   2594  C  CE2   . PHE D 4 70  ? -10.787 -11.960 28.118 1.00 40.40  ? 67   PHE D CE2   1 
ATOM   2595  C  CZ    . PHE D 4 70  ? -10.573 -10.870 27.295 1.00 39.32  ? 67   PHE D CZ    1 
ATOM   2596  N  N     . GLU D 4 71  ? -11.792 -12.679 32.511 1.00 37.99  ? 68   GLU D N     1 
ATOM   2597  C  CA    . GLU D 4 71  ? -12.633 -13.861 32.276 1.00 38.72  ? 68   GLU D CA    1 
ATOM   2598  C  C     . GLU D 4 71  ? -14.010 -13.727 32.895 1.00 37.90  ? 68   GLU D C     1 
ATOM   2599  O  O     . GLU D 4 71  ? -15.008 -14.074 32.284 1.00 37.35  ? 68   GLU D O     1 
ATOM   2600  C  CB    . GLU D 4 71  ? -11.961 -15.128 32.810 1.00 39.50  ? 68   GLU D CB    1 
ATOM   2601  C  CG    . GLU D 4 71  ? -10.899 -15.746 31.889 1.00 45.42  ? 68   GLU D CG    1 
ATOM   2602  C  CD    . GLU D 4 71  ? -9.923  -16.673 32.659 1.00 53.42  ? 68   GLU D CD    1 
ATOM   2603  O  OE1   . GLU D 4 71  ? -10.368 -17.452 33.543 1.00 55.29  ? 68   GLU D OE1   1 
ATOM   2604  O  OE2   . GLU D 4 71  ? -8.699  -16.608 32.388 1.00 57.36  ? 68   GLU D OE2   1 
ATOM   2605  N  N     . ARG D 4 72  ? -14.074 -13.206 34.112 1.00 37.52  ? 69   ARG D N     1 
ATOM   2606  C  CA    . ARG D 4 72  ? -15.374 -13.017 34.735 1.00 37.11  ? 69   ARG D CA    1 
ATOM   2607  C  C     . ARG D 4 72  ? -16.243 -11.967 34.046 1.00 37.52  ? 69   ARG D C     1 
ATOM   2608  O  O     . ARG D 4 72  ? -17.469 -12.130 33.983 1.00 38.26  ? 69   ARG D O     1 
ATOM   2609  C  CB    . ARG D 4 72  ? -15.239 -12.668 36.201 1.00 36.62  ? 69   ARG D CB    1 
ATOM   2610  C  CG    . ARG D 4 72  ? -14.484 -13.663 37.013 1.00 36.37  ? 69   ARG D CG    1 
ATOM   2611  C  CD    . ARG D 4 72  ? -14.762 -13.396 38.482 1.00 36.35  ? 69   ARG D CD    1 
ATOM   2612  N  NE    . ARG D 4 72  ? -13.553 -13.419 39.286 1.00 35.36  ? 69   ARG D NE    1 
ATOM   2613  C  CZ    . ARG D 4 72  ? -13.505 -13.067 40.567 1.00 36.85  ? 69   ARG D CZ    1 
ATOM   2614  N  NH1   . ARG D 4 72  ? -14.606 -12.659 41.195 1.00 33.83  ? 69   ARG D NH1   1 
ATOM   2615  N  NH2   . ARG D 4 72  ? -12.342 -13.120 41.226 1.00 37.63  ? 69   ARG D NH2   1 
ATOM   2616  N  N     . ILE D 4 73  ? -15.645 -10.892 33.533 1.00 37.53  ? 70   ILE D N     1 
ATOM   2617  C  CA    . ILE D 4 73  ? -16.462 -9.866  32.862 1.00 37.54  ? 70   ILE D CA    1 
ATOM   2618  C  C     . ILE D 4 73  ? -16.915 -10.350 31.485 1.00 37.93  ? 70   ILE D C     1 
ATOM   2619  O  O     . ILE D 4 73  ? -18.101 -10.257 31.136 1.00 37.94  ? 70   ILE D O     1 
ATOM   2620  C  CB    . ILE D 4 73  ? -15.779 -8.469  32.813 1.00 37.15  ? 70   ILE D CB    1 
ATOM   2621  C  CG1   . ILE D 4 73  ? -15.837 -7.841  34.213 1.00 36.36  ? 70   ILE D CG1   1 
ATOM   2622  C  CG2   . ILE D 4 73  ? -16.472 -7.566  31.757 1.00 37.12  ? 70   ILE D CG2   1 
ATOM   2623  C  CD1   . ILE D 4 73  ? -14.868 -6.696  34.482 1.00 36.90  ? 70   ILE D CD1   1 
ATOM   2624  N  N     . ALA D 4 74  ? -15.978 -10.899 30.722 1.00 38.39  ? 71   ALA D N     1 
ATOM   2625  C  CA    . ALA D 4 74  ? -16.307 -11.415 29.391 1.00 39.17  ? 71   ALA D CA    1 
ATOM   2626  C  C     . ALA D 4 74  ? -17.406 -12.487 29.464 1.00 39.29  ? 71   ALA D C     1 
ATOM   2627  O  O     . ALA D 4 74  ? -18.333 -12.485 28.655 1.00 39.28  ? 71   ALA D O     1 
ATOM   2628  C  CB    . ALA D 4 74  ? -15.056 -11.943 28.698 1.00 38.93  ? 71   ALA D CB    1 
ATOM   2629  N  N     . GLY D 4 75  ? -17.303 -13.370 30.455 1.00 39.68  ? 72   GLY D N     1 
ATOM   2630  C  CA    . GLY D 4 75  ? -18.299 -14.407 30.698 1.00 40.57  ? 72   GLY D CA    1 
ATOM   2631  C  C     . GLY D 4 75  ? -19.694 -13.885 30.988 1.00 41.54  ? 72   GLY D C     1 
ATOM   2632  O  O     . GLY D 4 75  ? -20.652 -14.297 30.336 1.00 41.17  ? 72   GLY D O     1 
ATOM   2633  N  N     . GLU D 4 76  ? -19.823 -12.984 31.965 1.00 42.80  ? 73   GLU D N     1 
ATOM   2634  C  CA    . GLU D 4 76  ? -21.121 -12.329 32.222 1.00 44.09  ? 73   GLU D CA    1 
ATOM   2635  C  C     . GLU D 4 76  ? -21.643 -11.673 30.961 1.00 44.19  ? 73   GLU D C     1 
ATOM   2636  O  O     . GLU D 4 76  ? -22.839 -11.733 30.678 1.00 44.55  ? 73   GLU D O     1 
ATOM   2637  C  CB    . GLU D 4 76  ? -21.021 -11.232 33.288 1.00 44.39  ? 73   GLU D CB    1 
ATOM   2638  C  CG    . GLU D 4 76  ? -20.836 -11.691 34.698 1.00 47.05  ? 73   GLU D CG    1 
ATOM   2639  C  CD    . GLU D 4 76  ? -22.021 -12.468 35.266 1.00 51.43  ? 73   GLU D CD    1 
ATOM   2640  O  OE1   . GLU D 4 76  ? -23.062 -12.658 34.568 1.00 52.47  ? 73   GLU D OE1   1 
ATOM   2641  O  OE2   . GLU D 4 76  ? -21.885 -12.888 36.440 1.00 52.31  ? 73   GLU D OE2   1 
ATOM   2642  N  N     . ALA D 4 77  ? -20.746 -11.028 30.217 1.00 44.51  ? 74   ALA D N     1 
ATOM   2643  C  CA    . ALA D 4 77  ? -21.137 -10.339 28.996 1.00 45.18  ? 74   ALA D CA    1 
ATOM   2644  C  C     . ALA D 4 77  ? -21.652 -11.367 28.017 1.00 45.72  ? 74   ALA D C     1 
ATOM   2645  O  O     . ALA D 4 77  ? -22.679 -11.161 27.390 1.00 46.19  ? 74   ALA D O     1 
ATOM   2646  C  CB    . ALA D 4 77  ? -19.962 -9.561  28.405 1.00 44.85  ? 74   ALA D CB    1 
ATOM   2647  N  N     . SER D 4 78  ? -20.933 -12.483 27.903 1.00 46.70  ? 75   SER D N     1 
ATOM   2648  C  CA    . SER D 4 78  ? -21.311 -13.570 27.007 1.00 47.61  ? 75   SER D CA    1 
ATOM   2649  C  C     . SER D 4 78  ? -22.732 -14.038 27.294 1.00 48.09  ? 75   SER D C     1 
ATOM   2650  O  O     . SER D 4 78  ? -23.566 -14.101 26.385 1.00 48.47  ? 75   SER D O     1 
ATOM   2651  C  CB    . SER D 4 78  ? -20.341 -14.738 27.153 1.00 47.76  ? 75   SER D CB    1 
ATOM   2652  O  OG    . SER D 4 78  ? -20.575 -15.708 26.150 1.00 48.53  ? 75   SER D OG    1 
ATOM   2653  N  N     . ARG D 4 79  ? -22.995 -14.330 28.565 1.00 48.65  ? 76   ARG D N     1 
ATOM   2654  C  CA    . ARG D 4 79  ? -24.292 -14.798 29.029 1.00 49.71  ? 76   ARG D CA    1 
ATOM   2655  C  C     . ARG D 4 79  ? -25.360 -13.767 28.733 1.00 50.35  ? 76   ARG D C     1 
ATOM   2656  O  O     . ARG D 4 79  ? -26.377 -14.055 28.087 1.00 50.42  ? 76   ARG D O     1 
ATOM   2657  C  CB    . ARG D 4 79  ? -24.247 -15.074 30.537 1.00 49.77  ? 76   ARG D CB    1 
ATOM   2658  C  CG    . ARG D 4 79  ? -24.179 -16.545 30.898 1.00 49.64  ? 76   ARG D CG    1 
ATOM   2659  C  CD    . ARG D 4 79  ? -23.781 -16.752 32.361 1.00 50.65  ? 76   ARG D CD    1 
ATOM   2660  N  NE    . ARG D 4 79  ? -22.369 -17.117 32.454 1.00 50.97  ? 76   ARG D NE    1 
ATOM   2661  C  CZ    . ARG D 4 79  ? -21.471 -16.506 33.217 1.00 50.70  ? 76   ARG D CZ    1 
ATOM   2662  N  NH1   . ARG D 4 79  ? -21.832 -15.497 34.006 1.00 52.40  ? 76   ARG D NH1   1 
ATOM   2663  N  NH2   . ARG D 4 79  ? -20.211 -16.919 33.198 1.00 49.20  ? 76   ARG D NH2   1 
ATOM   2664  N  N     . LEU D 4 80  ? -25.098 -12.552 29.193 1.00 51.03  ? 77   LEU D N     1 
ATOM   2665  C  CA    . LEU D 4 80  ? -26.013 -11.449 29.004 1.00 51.79  ? 77   LEU D CA    1 
ATOM   2666  C  C     . LEU D 4 80  ? -26.467 -11.312 27.550 1.00 52.13  ? 77   LEU D C     1 
ATOM   2667  O  O     . LEU D 4 80  ? -27.662 -11.180 27.281 1.00 52.03  ? 77   LEU D O     1 
ATOM   2668  C  CB    . LEU D 4 80  ? -25.369 -10.166 29.504 1.00 51.44  ? 77   LEU D CB    1 
ATOM   2669  C  CG    . LEU D 4 80  ? -26.263 -8.939  29.548 1.00 52.00  ? 77   LEU D CG    1 
ATOM   2670  C  CD1   . LEU D 4 80  ? -27.361 -9.048  30.603 1.00 50.90  ? 77   LEU D CD1   1 
ATOM   2671  C  CD2   . LEU D 4 80  ? -25.359 -7.776  29.828 1.00 53.52  ? 77   LEU D CD2   1 
ATOM   2672  N  N     . ALA D 4 81  ? -25.514 -11.369 26.626 1.00 52.92  ? 78   ALA D N     1 
ATOM   2673  C  CA    . ALA D 4 81  ? -25.807 -11.292 25.202 1.00 54.31  ? 78   ALA D CA    1 
ATOM   2674  C  C     . ALA D 4 81  ? -26.724 -12.429 24.744 1.00 55.43  ? 78   ALA D C     1 
ATOM   2675  O  O     . ALA D 4 81  ? -27.721 -12.201 24.037 1.00 56.02  ? 78   ALA D O     1 
ATOM   2676  C  CB    . ALA D 4 81  ? -24.521 -11.293 24.404 1.00 54.11  ? 78   ALA D CB    1 
ATOM   2677  N  N     . HIS D 4 82  ? -26.394 -13.648 25.161 1.00 56.29  ? 79   HIS D N     1 
ATOM   2678  C  CA    . HIS D 4 82  ? -27.203 -14.803 24.824 1.00 56.96  ? 79   HIS D CA    1 
ATOM   2679  C  C     . HIS D 4 82  ? -28.633 -14.642 25.344 1.00 57.02  ? 79   HIS D C     1 
ATOM   2680  O  O     . HIS D 4 82  ? -29.589 -14.848 24.595 1.00 56.86  ? 79   HIS D O     1 
ATOM   2681  C  CB    . HIS D 4 82  ? -26.554 -16.080 25.359 1.00 57.55  ? 79   HIS D CB    1 
ATOM   2682  C  CG    . HIS D 4 82  ? -27.318 -17.321 25.026 1.00 59.38  ? 79   HIS D CG    1 
ATOM   2683  N  ND1   . HIS D 4 82  ? -27.395 -17.824 23.739 1.00 61.47  ? 79   HIS D ND1   1 
ATOM   2684  C  CD2   . HIS D 4 82  ? -28.056 -18.145 25.809 1.00 61.11  ? 79   HIS D CD2   1 
ATOM   2685  C  CE1   . HIS D 4 82  ? -28.150 -18.906 23.743 1.00 63.15  ? 79   HIS D CE1   1 
ATOM   2686  N  NE2   . HIS D 4 82  ? -28.558 -19.127 24.988 1.00 63.77  ? 79   HIS D NE2   1 
ATOM   2687  N  N     . TYR D 4 83  ? -28.772 -14.242 26.610 1.00 57.23  ? 80   TYR D N     1 
ATOM   2688  C  CA    . TYR D 4 83  ? -30.087 -14.058 27.232 1.00 57.89  ? 80   TYR D CA    1 
ATOM   2689  C  C     . TYR D 4 83  ? -30.982 -13.072 26.465 1.00 58.34  ? 80   TYR D C     1 
ATOM   2690  O  O     . TYR D 4 83  ? -32.214 -13.127 26.564 1.00 58.32  ? 80   TYR D O     1 
ATOM   2691  C  CB    . TYR D 4 83  ? -29.963 -13.580 28.685 1.00 57.91  ? 80   TYR D CB    1 
ATOM   2692  C  CG    . TYR D 4 83  ? -29.204 -14.487 29.648 1.00 59.13  ? 80   TYR D CG    1 
ATOM   2693  C  CD1   . TYR D 4 83  ? -28.620 -13.953 30.803 1.00 60.15  ? 80   TYR D CD1   1 
ATOM   2694  C  CD2   . TYR D 4 83  ? -29.062 -15.864 29.415 1.00 59.60  ? 80   TYR D CD2   1 
ATOM   2695  C  CE1   . TYR D 4 83  ? -27.924 -14.757 31.709 1.00 59.98  ? 80   TYR D CE1   1 
ATOM   2696  C  CE2   . TYR D 4 83  ? -28.360 -16.679 30.315 1.00 60.32  ? 80   TYR D CE2   1 
ATOM   2697  C  CZ    . TYR D 4 83  ? -27.795 -16.114 31.461 1.00 60.93  ? 80   TYR D CZ    1 
ATOM   2698  O  OH    . TYR D 4 83  ? -27.100 -16.902 32.362 1.00 61.10  ? 80   TYR D OH    1 
ATOM   2699  N  N     . ASN D 4 84  ? -30.366 -12.166 25.710 1.00 58.49  ? 81   ASN D N     1 
ATOM   2700  C  CA    . ASN D 4 84  ? -31.132 -11.167 24.970 1.00 58.67  ? 81   ASN D CA    1 
ATOM   2701  C  C     . ASN D 4 84  ? -31.089 -11.406 23.472 1.00 58.98  ? 81   ASN D C     1 
ATOM   2702  O  O     . ASN D 4 84  ? -31.402 -10.510 22.683 1.00 59.43  ? 81   ASN D O     1 
ATOM   2703  C  CB    . ASN D 4 84  ? -30.655 -9.752  25.320 1.00 58.56  ? 81   ASN D CB    1 
ATOM   2704  C  CG    . ASN D 4 84  ? -30.960 -9.385  26.750 1.00 57.69  ? 81   ASN D CG    1 
ATOM   2705  O  OD1   . ASN D 4 84  ? -32.061 -8.932  27.065 1.00 57.91  ? 81   ASN D OD1   1 
ATOM   2706  N  ND2   . ASN D 4 84  ? -29.992 -9.595  27.633 1.00 56.25  ? 81   ASN D ND2   1 
ATOM   2707  N  N     . LYS D 4 85  ? -30.706 -12.624 23.088 1.00 59.28  ? 82   LYS D N     1 
ATOM   2708  C  CA    . LYS D 4 85  ? -30.678 -13.045 21.684 1.00 59.41  ? 82   LYS D CA    1 
ATOM   2709  C  C     . LYS D 4 85  ? -29.825 -12.114 20.826 1.00 59.00  ? 82   LYS D C     1 
ATOM   2710  O  O     . LYS D 4 85  ? -30.208 -11.758 19.715 1.00 59.34  ? 82   LYS D O     1 
ATOM   2711  C  CB    . LYS D 4 85  ? -32.101 -13.163 21.121 1.00 59.59  ? 82   LYS D CB    1 
ATOM   2712  C  CG    . LYS D 4 85  ? -32.947 -14.250 21.767 1.00 61.49  ? 82   LYS D CG    1 
ATOM   2713  C  CD    . LYS D 4 85  ? -34.420 -13.845 21.790 1.00 64.48  ? 82   LYS D CD    1 
ATOM   2714  C  CE    . LYS D 4 85  ? -35.286 -14.912 22.458 1.00 66.44  ? 82   LYS D CE    1 
ATOM   2715  N  NZ    . LYS D 4 85  ? -35.668 -16.013 21.512 1.00 67.76  ? 82   LYS D NZ    1 
ATOM   2716  N  N     . ARG D 4 86  ? -28.668 -11.733 21.358 1.00 58.60  ? 83   ARG D N     1 
ATOM   2717  C  CA    . ARG D 4 86  ? -27.733 -10.857 20.673 1.00 58.26  ? 83   ARG D CA    1 
ATOM   2718  C  C     . ARG D 4 86  ? -26.458 -11.614 20.364 1.00 57.49  ? 83   ARG D C     1 
ATOM   2719  O  O     . ARG D 4 86  ? -25.997 -12.420 21.173 1.00 58.06  ? 83   ARG D O     1 
ATOM   2720  C  CB    . ARG D 4 86  ? -27.396 -9.648  21.554 1.00 58.85  ? 83   ARG D CB    1 
ATOM   2721  C  CG    . ARG D 4 86  ? -28.592 -8.794  21.949 1.00 60.32  ? 83   ARG D CG    1 
ATOM   2722  C  CD    . ARG D 4 86  ? -29.011 -7.870  20.828 1.00 63.39  ? 83   ARG D CD    1 
ATOM   2723  N  NE    . ARG D 4 86  ? -30.212 -7.124  21.190 1.00 65.74  ? 83   ARG D NE    1 
ATOM   2724  C  CZ    . ARG D 4 86  ? -31.427 -7.374  20.710 1.00 66.68  ? 83   ARG D CZ    1 
ATOM   2725  N  NH1   . ARG D 4 86  ? -31.618 -8.349  19.827 1.00 67.68  ? 83   ARG D NH1   1 
ATOM   2726  N  NH2   . ARG D 4 86  ? -32.453 -6.638  21.114 1.00 67.99  ? 83   ARG D NH2   1 
ATOM   2727  N  N     . SER D 4 87  ? -25.880 -11.343 19.202 1.00 56.28  ? 84   SER D N     1 
ATOM   2728  C  CA    . SER D 4 87  ? -24.668 -12.020 18.770 1.00 54.85  ? 84   SER D CA    1 
ATOM   2729  C  C     . SER D 4 87  ? -23.439 -11.127 18.934 1.00 54.05  ? 84   SER D C     1 
ATOM   2730  O  O     . SER D 4 87  ? -22.308 -11.529 18.603 1.00 53.71  ? 84   SER D O     1 
ATOM   2731  C  CB    . SER D 4 87  ? -24.819 -12.436 17.311 1.00 54.98  ? 84   SER D CB    1 
ATOM   2732  O  OG    . SER D 4 87  ? -25.238 -11.333 16.538 1.00 54.65  ? 84   SER D OG    1 
ATOM   2733  N  N     . THR D 4 88  ? -23.667 -9.917  19.438 1.00 52.86  ? 85   THR D N     1 
ATOM   2734  C  CA    . THR D 4 88  ? -22.597 -8.928  19.573 1.00 52.11  ? 85   THR D CA    1 
ATOM   2735  C  C     . THR D 4 88  ? -22.369 -8.548  21.032 1.00 51.04  ? 85   THR D C     1 
ATOM   2736  O  O     . THR D 4 88  ? -23.315 -8.224  21.752 1.00 50.81  ? 85   THR D O     1 
ATOM   2737  C  CB    . THR D 4 88  ? -22.895 -7.625  18.767 1.00 52.23  ? 85   THR D CB    1 
ATOM   2738  O  OG1   . THR D 4 88  ? -23.652 -7.930  17.588 1.00 53.22  ? 85   THR D OG1   1 
ATOM   2739  C  CG2   . THR D 4 88  ? -21.604 -6.924  18.380 1.00 51.68  ? 85   THR D CG2   1 
ATOM   2740  N  N     . ILE D 4 89  ? -21.113 -8.599  21.462 1.00 50.03  ? 86   ILE D N     1 
ATOM   2741  C  CA    . ILE D 4 89  ? -20.738 -8.046  22.765 1.00 49.20  ? 86   ILE D CA    1 
ATOM   2742  C  C     . ILE D 4 89  ? -20.262 -6.605  22.589 1.00 48.71  ? 86   ILE D C     1 
ATOM   2743  O  O     . ILE D 4 89  ? -19.211 -6.346  21.988 1.00 48.41  ? 86   ILE D O     1 
ATOM   2744  C  CB    . ILE D 4 89  ? -19.657 -8.870  23.482 1.00 48.81  ? 86   ILE D CB    1 
ATOM   2745  C  CG1   . ILE D 4 89  ? -20.261 -10.159 24.037 1.00 49.17  ? 86   ILE D CG1   1 
ATOM   2746  C  CG2   . ILE D 4 89  ? -19.080 -8.074  24.642 1.00 48.96  ? 86   ILE D CG2   1 
ATOM   2747  C  CD1   . ILE D 4 89  ? -19.220 -11.241 24.298 1.00 48.23  ? 86   ILE D CD1   1 
ATOM   2748  N  N     . THR D 4 90  ? -21.058 -5.676  23.101 1.00 47.94  ? 87   THR D N     1 
ATOM   2749  C  CA    . THR D 4 90  ? -20.742 -4.263  23.005 1.00 47.64  ? 87   THR D CA    1 
ATOM   2750  C  C     . THR D 4 90  ? -20.395 -3.718  24.387 1.00 47.25  ? 87   THR D C     1 
ATOM   2751  O  O     . THR D 4 90  ? -20.670 -4.356  25.410 1.00 47.43  ? 87   THR D O     1 
ATOM   2752  C  CB    . THR D 4 90  ? -21.946 -3.449  22.441 1.00 47.78  ? 87   THR D CB    1 
ATOM   2753  O  OG1   . THR D 4 90  ? -22.967 -3.330  23.445 1.00 47.93  ? 87   THR D OG1   1 
ATOM   2754  C  CG2   . THR D 4 90  ? -22.531 -4.105  21.194 1.00 47.22  ? 87   THR D CG2   1 
ATOM   2755  N  N     . SER D 4 91  ? -19.839 -2.515  24.413 1.00 46.75  ? 88   SER D N     1 
ATOM   2756  C  CA    . SER D 4 91  ? -19.536 -1.824  25.659 1.00 46.21  ? 88   SER D CA    1 
ATOM   2757  C  C     . SER D 4 91  ? -20.734 -1.778  26.598 1.00 45.83  ? 88   SER D C     1 
ATOM   2758  O  O     . SER D 4 91  ? -20.560 -1.711  27.812 1.00 46.09  ? 88   SER D O     1 
ATOM   2759  C  CB    . SER D 4 91  ? -18.974 -0.418  25.383 1.00 46.23  ? 88   SER D CB    1 
ATOM   2760  O  OG    . SER D 4 91  ? -20.002 0.537   25.210 1.00 46.88  ? 88   SER D OG    1 
ATOM   2761  N  N     . ARG D 4 92  ? -21.945 -1.851  26.049 1.00 45.62  ? 89   ARG D N     1 
ATOM   2762  C  CA    . ARG D 4 92  ? -23.154 -1.921  26.875 1.00 45.53  ? 89   ARG D CA    1 
ATOM   2763  C  C     . ARG D 4 92  ? -23.261 -3.250  27.650 1.00 45.17  ? 89   ARG D C     1 
ATOM   2764  O  O     . ARG D 4 92  ? -23.613 -3.257  28.828 1.00 45.16  ? 89   ARG D O     1 
ATOM   2765  C  CB    . ARG D 4 92  ? -24.399 -1.696  26.027 1.00 45.93  ? 89   ARG D CB    1 
ATOM   2766  C  CG    . ARG D 4 92  ? -25.671 -1.570  26.850 1.00 48.57  ? 89   ARG D CG    1 
ATOM   2767  C  CD    . ARG D 4 92  ? -26.831 -1.019  26.025 1.00 52.65  ? 89   ARG D CD    1 
ATOM   2768  N  NE    . ARG D 4 92  ? -27.986 -0.729  26.879 1.00 55.30  ? 89   ARG D NE    1 
ATOM   2769  C  CZ    . ARG D 4 92  ? -28.907 -1.628  27.214 1.00 56.12  ? 89   ARG D CZ    1 
ATOM   2770  N  NH1   . ARG D 4 92  ? -28.811 -2.877  26.765 1.00 55.91  ? 89   ARG D NH1   1 
ATOM   2771  N  NH2   . ARG D 4 92  ? -29.920 -1.282  28.001 1.00 56.20  ? 89   ARG D NH2   1 
ATOM   2772  N  N     . GLU D 4 93  ? -22.975 -4.370  26.982 1.00 44.43  ? 90   GLU D N     1 
ATOM   2773  C  CA    . GLU D 4 93  ? -22.902 -5.664  27.659 1.00 43.84  ? 90   GLU D CA    1 
ATOM   2774  C  C     . GLU D 4 93  ? -21.815 -5.634  28.743 1.00 42.89  ? 90   GLU D C     1 
ATOM   2775  O  O     . GLU D 4 93  ? -22.052 -6.040  29.887 1.00 42.79  ? 90   GLU D O     1 
ATOM   2776  C  CB    . GLU D 4 93  ? -22.657 -6.806  26.658 1.00 43.82  ? 90   GLU D CB    1 
ATOM   2777  C  CG    . GLU D 4 93  ? -23.910 -7.283  25.913 1.00 45.48  ? 90   GLU D CG    1 
ATOM   2778  C  CD    . GLU D 4 93  ? -24.606 -6.166  25.135 1.00 47.08  ? 90   GLU D CD    1 
ATOM   2779  O  OE1   . GLU D 4 93  ? -25.806 -5.926  25.358 1.00 47.97  ? 90   GLU D OE1   1 
ATOM   2780  O  OE2   . GLU D 4 93  ? -23.945 -5.517  24.310 1.00 48.85  ? 90   GLU D OE2   1 
ATOM   2781  N  N     . ILE D 4 94  ? -20.641 -5.116  28.397 1.00 41.75  ? 91   ILE D N     1 
ATOM   2782  C  CA    . ILE D 4 94  ? -19.538 -5.030  29.360 1.00 41.00  ? 91   ILE D CA    1 
ATOM   2783  C  C     . ILE D 4 94  ? -19.942 -4.223  30.587 1.00 41.30  ? 91   ILE D C     1 
ATOM   2784  O  O     . ILE D 4 94  ? -19.549 -4.546  31.715 1.00 41.76  ? 91   ILE D O     1 
ATOM   2785  C  CB    . ILE D 4 94  ? -18.285 -4.384  28.740 1.00 40.44  ? 91   ILE D CB    1 
ATOM   2786  C  CG1   . ILE D 4 94  ? -17.892 -5.090  27.434 1.00 40.07  ? 91   ILE D CG1   1 
ATOM   2787  C  CG2   . ILE D 4 94  ? -17.132 -4.322  29.757 1.00 39.25  ? 91   ILE D CG2   1 
ATOM   2788  C  CD1   . ILE D 4 94  ? -17.283 -6.497  27.584 1.00 38.87  ? 91   ILE D CD1   1 
ATOM   2789  N  N     . GLN D 4 95  ? -20.744 -3.183  30.366 1.00 41.43  ? 92   GLN D N     1 
ATOM   2790  C  CA    . GLN D 4 95  ? -21.166 -2.297  31.440 1.00 41.20  ? 92   GLN D CA    1 
ATOM   2791  C  C     . GLN D 4 95  ? -22.083 -3.023  32.399 1.00 40.52  ? 92   GLN D C     1 
ATOM   2792  O  O     . GLN D 4 95  ? -21.862 -2.972  33.603 1.00 40.79  ? 92   GLN D O     1 
ATOM   2793  C  CB    . GLN D 4 95  ? -21.848 -1.038  30.869 1.00 41.78  ? 92   GLN D CB    1 
ATOM   2794  C  CG    . GLN D 4 95  ? -22.358 -0.065  31.931 1.00 43.23  ? 92   GLN D CG    1 
ATOM   2795  C  CD    . GLN D 4 95  ? -22.599 1.332   31.381 1.00 45.82  ? 92   GLN D CD    1 
ATOM   2796  O  OE1   . GLN D 4 95  ? -23.738 1.784   31.295 1.00 48.21  ? 92   GLN D OE1   1 
ATOM   2797  N  NE2   . GLN D 4 95  ? -21.534 2.015   31.007 1.00 43.85  ? 92   GLN D NE2   1 
ATOM   2798  N  N     . THR D 4 96  ? -23.112 -3.690  31.880 1.00 40.13  ? 93   THR D N     1 
ATOM   2799  C  CA    . THR D 4 96  ? -23.987 -4.484  32.739 1.00 40.11  ? 93   THR D CA    1 
ATOM   2800  C  C     . THR D 4 96  ? -23.176 -5.579  33.479 1.00 39.68  ? 93   THR D C     1 
ATOM   2801  O  O     . THR D 4 96  ? -23.400 -5.827  34.655 1.00 39.13  ? 93   THR D O     1 
ATOM   2802  C  CB    . THR D 4 96  ? -25.155 -5.108  31.954 1.00 40.26  ? 93   THR D CB    1 
ATOM   2803  O  OG1   . THR D 4 96  ? -25.827 -4.088  31.200 1.00 41.13  ? 93   THR D OG1   1 
ATOM   2804  C  CG2   . THR D 4 96  ? -26.149 -5.783  32.910 1.00 39.17  ? 93   THR D CG2   1 
ATOM   2805  N  N     . ALA D 4 97  ? -22.218 -6.194  32.792 1.00 39.36  ? 94   ALA D N     1 
ATOM   2806  C  CA    . ALA D 4 97  ? -21.383 -7.234  33.395 1.00 39.42  ? 94   ALA D CA    1 
ATOM   2807  C  C     . ALA D 4 97  ? -20.614 -6.677  34.579 1.00 39.91  ? 94   ALA D C     1 
ATOM   2808  O  O     . ALA D 4 97  ? -20.533 -7.310  35.636 1.00 40.05  ? 94   ALA D O     1 
ATOM   2809  C  CB    . ALA D 4 97  ? -20.425 -7.815  32.371 1.00 39.68  ? 94   ALA D CB    1 
ATOM   2810  N  N     . VAL D 4 98  ? -20.067 -5.475  34.407 1.00 40.06  ? 95   VAL D N     1 
ATOM   2811  C  CA    . VAL D 4 98  ? -19.357 -4.784  35.485 1.00 39.97  ? 95   VAL D CA    1 
ATOM   2812  C  C     . VAL D 4 98  ? -20.273 -4.517  36.684 1.00 40.22  ? 95   VAL D C     1 
ATOM   2813  O  O     . VAL D 4 98  ? -19.891 -4.758  37.832 1.00 39.67  ? 95   VAL D O     1 
ATOM   2814  C  CB    . VAL D 4 98  ? -18.689 -3.492  34.951 1.00 40.24  ? 95   VAL D CB    1 
ATOM   2815  C  CG1   . VAL D 4 98  ? -18.362 -2.516  36.076 1.00 39.65  ? 95   VAL D CG1   1 
ATOM   2816  C  CG2   . VAL D 4 98  ? -17.419 -3.844  34.128 1.00 39.83  ? 95   VAL D CG2   1 
ATOM   2817  N  N     . ARG D 4 99  ? -21.493 -4.058  36.417 1.00 41.01  ? 96   ARG D N     1 
ATOM   2818  C  CA    . ARG D 4 99  ? -22.471 -3.824  37.487 1.00 41.71  ? 96   ARG D CA    1 
ATOM   2819  C  C     . ARG D 4 99  ? -22.855 -5.113  38.190 1.00 41.13  ? 96   ARG D C     1 
ATOM   2820  O  O     . ARG D 4 99  ? -23.075 -5.106  39.399 1.00 41.36  ? 96   ARG D O     1 
ATOM   2821  C  CB    . ARG D 4 99  ? -23.720 -3.105  36.956 1.00 42.42  ? 96   ARG D CB    1 
ATOM   2822  C  CG    . ARG D 4 99  ? -23.522 -1.602  36.796 1.00 45.72  ? 96   ARG D CG    1 
ATOM   2823  C  CD    . ARG D 4 99  ? -24.686 -0.895  36.097 1.00 50.18  ? 96   ARG D CD    1 
ATOM   2824  N  NE    . ARG D 4 99  ? -24.471 0.556   36.104 1.00 55.19  ? 96   ARG D NE    1 
ATOM   2825  C  CZ    . ARG D 4 99  ? -24.945 1.416   35.196 1.00 57.61  ? 96   ARG D CZ    1 
ATOM   2826  N  NH1   . ARG D 4 99  ? -25.684 0.998   34.162 1.00 56.60  ? 96   ARG D NH1   1 
ATOM   2827  N  NH2   . ARG D 4 99  ? -24.663 2.712   35.322 1.00 58.48  ? 96   ARG D NH2   1 
ATOM   2828  N  N     . LEU D 4 100 ? -22.932 -6.213  37.438 1.00 40.67  ? 97   LEU D N     1 
ATOM   2829  C  CA    . LEU D 4 100 ? -23.250 -7.514  38.026 1.00 40.78  ? 97   LEU D CA    1 
ATOM   2830  C  C     . LEU D 4 100 ? -22.083 -8.028  38.858 1.00 41.38  ? 97   LEU D C     1 
ATOM   2831  O  O     . LEU D 4 100 ? -22.280 -8.539  39.939 1.00 41.47  ? 97   LEU D O     1 
ATOM   2832  C  CB    . LEU D 4 100 ? -23.656 -8.530  36.951 1.00 40.11  ? 97   LEU D CB    1 
ATOM   2833  C  CG    . LEU D 4 100 ? -25.019 -8.272  36.289 1.00 38.99  ? 97   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D 4 100 ? -25.156 -9.014  34.980 1.00 37.18  ? 97   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D 4 100 ? -26.177 -8.594  37.217 1.00 38.34  ? 97   LEU D CD2   1 
ATOM   2836  N  N     . LEU D 4 101 ? -20.865 -7.829  38.372 1.00 42.16  ? 98   LEU D N     1 
ATOM   2837  C  CA    . LEU D 4 101 ? -19.699 -8.433  38.982 1.00 43.00  ? 98   LEU D CA    1 
ATOM   2838  C  C     . LEU D 4 101 ? -19.089 -7.671  40.159 1.00 43.24  ? 98   LEU D C     1 
ATOM   2839  O  O     . LEU D 4 101 ? -18.741 -8.275  41.164 1.00 43.54  ? 98   LEU D O     1 
ATOM   2840  C  CB    . LEU D 4 101 ? -18.641 -8.690  37.920 1.00 43.31  ? 98   LEU D CB    1 
ATOM   2841  C  CG    . LEU D 4 101 ? -17.430 -9.480  38.410 1.00 45.67  ? 98   LEU D CG    1 
ATOM   2842  C  CD1   . LEU D 4 101 ? -17.764 -10.997 38.516 1.00 46.89  ? 98   LEU D CD1   1 
ATOM   2843  C  CD2   . LEU D 4 101 ? -16.221 -9.231  37.503 1.00 46.18  ? 98   LEU D CD2   1 
ATOM   2844  N  N     . LEU D 4 102 ? -18.950 -6.354  40.049 1.00 43.57  ? 99   LEU D N     1 
ATOM   2845  C  CA    . LEU D 4 102 ? -18.211 -5.605  41.062 1.00 43.78  ? 99   LEU D CA    1 
ATOM   2846  C  C     . LEU D 4 102 ? -19.108 -5.093  42.180 1.00 44.20  ? 99   LEU D C     1 
ATOM   2847  O  O     . LEU D 4 102 ? -20.271 -4.788  41.936 1.00 44.55  ? 99   LEU D O     1 
ATOM   2848  C  CB    . LEU D 4 102 ? -17.436 -4.451  40.428 1.00 43.65  ? 99   LEU D CB    1 
ATOM   2849  C  CG    . LEU D 4 102 ? -16.467 -4.725  39.274 1.00 43.95  ? 99   LEU D CG    1 
ATOM   2850  C  CD1   . LEU D 4 102 ? -15.702 -3.449  38.980 1.00 43.78  ? 99   LEU D CD1   1 
ATOM   2851  C  CD2   . LEU D 4 102 ? -15.492 -5.835  39.589 1.00 43.40  ? 99   LEU D CD2   1 
ATOM   2852  N  N     . PRO D 4 103 ? -18.581 -5.018  43.421 1.00 44.66  ? 100  PRO D N     1 
ATOM   2853  C  CA    . PRO D 4 103 ? -19.429 -4.499  44.500 1.00 45.20  ? 100  PRO D CA    1 
ATOM   2854  C  C     . PRO D 4 103 ? -19.601 -2.984  44.429 1.00 46.00  ? 100  PRO D C     1 
ATOM   2855  O  O     . PRO D 4 103 ? -18.699 -2.277  43.960 1.00 46.21  ? 100  PRO D O     1 
ATOM   2856  C  CB    . PRO D 4 103 ? -18.678 -4.888  45.772 1.00 44.96  ? 100  PRO D CB    1 
ATOM   2857  C  CG    . PRO D 4 103 ? -17.254 -5.109  45.344 1.00 44.91  ? 100  PRO D CG    1 
ATOM   2858  C  CD    . PRO D 4 103 ? -17.310 -5.576  43.924 1.00 44.65  ? 100  PRO D CD    1 
ATOM   2859  N  N     . GLY D 4 104 ? -20.767 -2.522  44.881 1.00 46.70  ? 101  GLY D N     1 
ATOM   2860  C  CA    . GLY D 4 104 ? -21.133 -1.102  44.991 1.00 47.01  ? 101  GLY D CA    1 
ATOM   2861  C  C     . GLY D 4 104 ? -20.184 -0.051  44.456 1.00 47.59  ? 101  GLY D C     1 
ATOM   2862  O  O     . GLY D 4 104 ? -20.314 0.396   43.321 1.00 47.69  ? 101  GLY D O     1 
ATOM   2863  N  N     . GLU D 4 105 ? -19.219 0.347   45.272 1.00 47.98  ? 102  GLU D N     1 
ATOM   2864  C  CA    . GLU D 4 105 ? -18.385 1.485   44.932 1.00 48.51  ? 102  GLU D CA    1 
ATOM   2865  C  C     . GLU D 4 105 ? -17.342 1.198   43.854 1.00 48.17  ? 102  GLU D C     1 
ATOM   2866  O  O     . GLU D 4 105 ? -16.970 2.099   43.102 1.00 48.77  ? 102  GLU D O     1 
ATOM   2867  C  CB    . GLU D 4 105 ? -17.736 2.078   46.185 1.00 48.87  ? 102  GLU D CB    1 
ATOM   2868  C  CG    . GLU D 4 105 ? -17.552 3.584   46.139 1.00 52.28  ? 102  GLU D CG    1 
ATOM   2869  C  CD    . GLU D 4 105 ? -18.887 4.349   46.082 1.00 57.34  ? 102  GLU D CD    1 
ATOM   2870  O  OE1   . GLU D 4 105 ? -19.891 3.888   46.679 1.00 58.32  ? 102  GLU D OE1   1 
ATOM   2871  O  OE2   . GLU D 4 105 ? -18.930 5.419   45.435 1.00 59.92  ? 102  GLU D OE2   1 
ATOM   2872  N  N     . LEU D 4 106 ? -16.853 -0.033  43.763 1.00 47.87  ? 103  LEU D N     1 
ATOM   2873  C  CA    . LEU D 4 106 ? -15.923 -0.349  42.671 1.00 47.37  ? 103  LEU D CA    1 
ATOM   2874  C  C     . LEU D 4 106 ? -16.655 -0.336  41.344 1.00 47.12  ? 103  LEU D C     1 
ATOM   2875  O  O     . LEU D 4 106 ? -16.073 0.036   40.334 1.00 46.62  ? 103  LEU D O     1 
ATOM   2876  C  CB    . LEU D 4 106 ? -15.229 -1.705  42.861 1.00 47.12  ? 103  LEU D CB    1 
ATOM   2877  C  CG    . LEU D 4 106 ? -14.115 -1.853  43.903 1.00 46.60  ? 103  LEU D CG    1 
ATOM   2878  C  CD1   . LEU D 4 106 ? -13.703 -3.321  43.959 1.00 45.21  ? 103  LEU D CD1   1 
ATOM   2879  C  CD2   . LEU D 4 106 ? -12.922 -0.976  43.595 1.00 44.21  ? 103  LEU D CD2   1 
ATOM   2880  N  N     . ALA D 4 107 ? -17.925 -0.750  41.356 1.00 47.08  ? 104  ALA D N     1 
ATOM   2881  C  CA    . ALA D 4 107 ? -18.724 -0.795  40.137 1.00 47.57  ? 104  ALA D CA    1 
ATOM   2882  C  C     . ALA D 4 107 ? -18.952 0.631   39.622 1.00 48.04  ? 104  ALA D C     1 
ATOM   2883  O  O     . ALA D 4 107 ? -18.576 0.958   38.494 1.00 47.83  ? 104  ALA D O     1 
ATOM   2884  C  CB    . ALA D 4 107 ? -20.032 -1.529  40.368 1.00 46.99  ? 104  ALA D CB    1 
ATOM   2885  N  N     . LYS D 4 108 ? -19.519 1.477   40.478 1.00 49.19  ? 105  LYS D N     1 
ATOM   2886  C  CA    . LYS D 4 108 ? -19.718 2.905   40.200 1.00 50.03  ? 105  LYS D CA    1 
ATOM   2887  C  C     . LYS D 4 108 ? -18.488 3.533   39.524 1.00 49.72  ? 105  LYS D C     1 
ATOM   2888  O  O     . LYS D 4 108 ? -18.593 4.099   38.433 1.00 50.03  ? 105  LYS D O     1 
ATOM   2889  C  CB    . LYS D 4 108 ? -20.086 3.628   41.500 1.00 50.31  ? 105  LYS D CB    1 
ATOM   2890  C  CG    . LYS D 4 108 ? -20.438 5.105   41.352 1.00 53.64  ? 105  LYS D CG    1 
ATOM   2891  C  CD    . LYS D 4 108 ? -20.662 5.787   42.719 1.00 58.12  ? 105  LYS D CD    1 
ATOM   2892  C  CE    . LYS D 4 108 ? -21.974 5.346   43.391 1.00 60.08  ? 105  LYS D CE    1 
ATOM   2893  N  NZ    . LYS D 4 108 ? -22.101 5.835   44.815 1.00 62.09  ? 105  LYS D NZ    1 
ATOM   2894  N  N     . HIS D 4 109 ? -17.322 3.392   40.139 1.00 49.32  ? 106  HIS D N     1 
ATOM   2895  C  CA    . HIS D 4 109 ? -16.090 3.956   39.573 1.00 49.17  ? 106  HIS D CA    1 
ATOM   2896  C  C     . HIS D 4 109 ? -15.586 3.288   38.313 1.00 48.94  ? 106  HIS D C     1 
ATOM   2897  O  O     . HIS D 4 109 ? -15.044 3.966   37.436 1.00 48.90  ? 106  HIS D O     1 
ATOM   2898  C  CB    . HIS D 4 109 ? -14.969 3.941   40.596 1.00 49.36  ? 106  HIS D CB    1 
ATOM   2899  C  CG    . HIS D 4 109 ? -15.026 5.077   41.558 1.00 51.43  ? 106  HIS D CG    1 
ATOM   2900  N  ND1   . HIS D 4 109 ? -15.754 5.023   42.726 1.00 53.56  ? 106  HIS D ND1   1 
ATOM   2901  C  CD2   . HIS D 4 109 ? -14.465 6.307   41.517 1.00 52.70  ? 106  HIS D CD2   1 
ATOM   2902  C  CE1   . HIS D 4 109 ? -15.617 6.164   43.376 1.00 54.52  ? 106  HIS D CE1   1 
ATOM   2903  N  NE2   . HIS D 4 109 ? -14.842 6.961   42.662 1.00 53.90  ? 106  HIS D NE2   1 
ATOM   2904  N  N     . ALA D 4 110 ? -15.726 1.961   38.232 1.00 48.54  ? 107  ALA D N     1 
ATOM   2905  C  CA    . ALA D 4 110 ? -15.325 1.226   37.026 1.00 48.00  ? 107  ALA D CA    1 
ATOM   2906  C  C     . ALA D 4 110 ? -16.158 1.699   35.855 1.00 47.43  ? 107  ALA D C     1 
ATOM   2907  O  O     . ALA D 4 110 ? -15.620 1.966   34.792 1.00 47.02  ? 107  ALA D O     1 
ATOM   2908  C  CB    . ALA D 4 110 ? -15.468 -0.287  37.216 1.00 47.85  ? 107  ALA D CB    1 
ATOM   2909  N  N     . VAL D 4 111 ? -17.465 1.810   36.082 1.00 47.70  ? 108  VAL D N     1 
ATOM   2910  C  CA    . VAL D 4 111 ? -18.426 2.325   35.102 1.00 48.54  ? 108  VAL D CA    1 
ATOM   2911  C  C     . VAL D 4 111 ? -18.079 3.706   34.536 1.00 49.17  ? 108  VAL D C     1 
ATOM   2912  O  O     . VAL D 4 111 ? -18.144 3.908   33.321 1.00 49.05  ? 108  VAL D O     1 
ATOM   2913  C  CB    . VAL D 4 111 ? -19.860 2.334   35.675 1.00 48.51  ? 108  VAL D CB    1 
ATOM   2914  C  CG1   . VAL D 4 111 ? -20.808 3.137   34.776 1.00 47.55  ? 108  VAL D CG1   1 
ATOM   2915  C  CG2   . VAL D 4 111 ? -20.353 0.904   35.832 1.00 48.47  ? 108  VAL D CG2   1 
ATOM   2916  N  N     . SER D 4 112 ? -17.711 4.649   35.404 1.00 50.14  ? 109  SER D N     1 
ATOM   2917  C  CA    . SER D 4 112 ? -17.261 5.976   34.931 1.00 51.42  ? 109  SER D CA    1 
ATOM   2918  C  C     . SER D 4 112 ? -15.987 5.867   34.099 1.00 51.72  ? 109  SER D C     1 
ATOM   2919  O  O     . SER D 4 112 ? -15.881 6.486   33.039 1.00 52.31  ? 109  SER D O     1 
ATOM   2920  C  CB    . SER D 4 112 ? -17.034 6.963   36.086 1.00 51.28  ? 109  SER D CB    1 
ATOM   2921  O  OG    . SER D 4 112 ? -18.169 7.022   36.933 1.00 53.42  ? 109  SER D OG    1 
ATOM   2922  N  N     . GLU D 4 113 ? -15.022 5.087   34.571 1.00 51.76  ? 110  GLU D N     1 
ATOM   2923  C  CA    . GLU D 4 113 ? -13.754 4.951   33.850 1.00 52.56  ? 110  GLU D CA    1 
ATOM   2924  C  C     . GLU D 4 113 ? -13.944 4.364   32.452 1.00 52.25  ? 110  GLU D C     1 
ATOM   2925  O  O     . GLU D 4 113 ? -13.280 4.771   31.498 1.00 52.21  ? 110  GLU D O     1 
ATOM   2926  C  CB    . GLU D 4 113 ? -12.760 4.113   34.654 1.00 52.71  ? 110  GLU D CB    1 
ATOM   2927  C  CG    . GLU D 4 113 ? -12.032 4.897   35.723 1.00 55.79  ? 110  GLU D CG    1 
ATOM   2928  C  CD    . GLU D 4 113 ? -10.689 5.391   35.239 1.00 60.81  ? 110  GLU D CD    1 
ATOM   2929  O  OE1   . GLU D 4 113 ? -10.516 6.628   35.130 1.00 62.45  ? 110  GLU D OE1   1 
ATOM   2930  O  OE2   . GLU D 4 113 ? -9.812  4.538   34.941 1.00 63.03  ? 110  GLU D OE2   1 
ATOM   2931  N  N     . GLY D 4 114 ? -14.862 3.411   32.340 1.00 52.22  ? 111  GLY D N     1 
ATOM   2932  C  CA    . GLY D 4 114 ? -15.119 2.740   31.080 1.00 52.22  ? 111  GLY D CA    1 
ATOM   2933  C  C     . GLY D 4 114 ? -15.907 3.596   30.112 1.00 52.06  ? 111  GLY D C     1 
ATOM   2934  O  O     . GLY D 4 114 ? -15.591 3.637   28.929 1.00 51.58  ? 111  GLY D O     1 
ATOM   2935  N  N     . THR D 4 115 ? -16.948 4.260   30.615 1.00 52.56  ? 112  THR D N     1 
ATOM   2936  C  CA    . THR D 4 115 ? -17.710 5.231   29.822 1.00 53.11  ? 112  THR D CA    1 
ATOM   2937  C  C     . THR D 4 115 ? -16.762 6.301   29.276 1.00 53.50  ? 112  THR D C     1 
ATOM   2938  O  O     . THR D 4 115 ? -16.731 6.565   28.076 1.00 53.62  ? 112  THR D O     1 
ATOM   2939  C  CB    . THR D 4 115 ? -18.817 5.916   30.651 1.00 53.08  ? 112  THR D CB    1 
ATOM   2940  O  OG1   . THR D 4 115 ? -19.668 4.926   31.243 1.00 52.60  ? 112  THR D OG1   1 
ATOM   2941  C  CG2   . THR D 4 115 ? -19.653 6.832   29.770 1.00 53.10  ? 112  THR D CG2   1 
ATOM   2942  N  N     . LYS D 4 116 ? -15.970 6.879   30.170 1.00 53.83  ? 113  LYS D N     1 
ATOM   2943  C  CA    . LYS D 4 116 ? -14.991 7.902   29.824 1.00 54.70  ? 113  LYS D CA    1 
ATOM   2944  C  C     . LYS D 4 116 ? -14.042 7.455   28.719 1.00 54.65  ? 113  LYS D C     1 
ATOM   2945  O  O     . LYS D 4 116 ? -13.790 8.205   27.782 1.00 55.29  ? 113  LYS D O     1 
ATOM   2946  C  CB    . LYS D 4 116 ? -14.221 8.320   31.091 1.00 55.14  ? 113  LYS D CB    1 
ATOM   2947  C  CG    . LYS D 4 116 ? -13.048 9.263   30.934 1.00 55.75  ? 113  LYS D CG    1 
ATOM   2948  C  CD    . LYS D 4 116 ? -12.522 9.580   32.347 1.00 59.42  ? 113  LYS D CD    1 
ATOM   2949  C  CE    . LYS D 4 116 ? -11.216 10.372  32.348 1.00 61.46  ? 113  LYS D CE    1 
ATOM   2950  N  NZ    . LYS D 4 116 ? -10.080 9.656   31.688 1.00 62.26  ? 113  LYS D NZ    1 
ATOM   2951  N  N     . ALA D 4 117 ? -13.520 6.241   28.820 1.00 54.72  ? 114  ALA D N     1 
ATOM   2952  C  CA    . ALA D 4 117 ? -12.579 5.739   27.822 1.00 54.78  ? 114  ALA D CA    1 
ATOM   2953  C  C     . ALA D 4 117 ? -13.242 5.550   26.466 1.00 55.07  ? 114  ALA D C     1 
ATOM   2954  O  O     . ALA D 4 117 ? -12.606 5.755   25.433 1.00 54.80  ? 114  ALA D O     1 
ATOM   2955  C  CB    . ALA D 4 117 ? -11.955 4.448   28.281 1.00 54.70  ? 114  ALA D CB    1 
ATOM   2956  N  N     . VAL D 4 118 ? -14.512 5.149   26.471 1.00 55.63  ? 115  VAL D N     1 
ATOM   2957  C  CA    . VAL D 4 118 ? -15.240 4.912   25.223 1.00 56.27  ? 115  VAL D CA    1 
ATOM   2958  C  C     . VAL D 4 118 ? -15.610 6.248   24.578 1.00 57.02  ? 115  VAL D C     1 
ATOM   2959  O  O     . VAL D 4 118 ? -15.275 6.490   23.424 1.00 57.06  ? 115  VAL D O     1 
ATOM   2960  C  CB    . VAL D 4 118 ? -16.475 3.985   25.420 1.00 56.20  ? 115  VAL D CB    1 
ATOM   2961  C  CG1   . VAL D 4 118 ? -17.373 3.973   24.177 1.00 55.76  ? 115  VAL D CG1   1 
ATOM   2962  C  CG2   . VAL D 4 118 ? -16.025 2.566   25.768 1.00 55.58  ? 115  VAL D CG2   1 
ATOM   2963  N  N     . THR D 4 119 ? -16.282 7.112   25.336 1.00 58.02  ? 116  THR D N     1 
ATOM   2964  C  CA    . THR D 4 119 ? -16.541 8.483   24.905 1.00 59.01  ? 116  THR D CA    1 
ATOM   2965  C  C     . THR D 4 119 ? -15.276 9.127   24.308 1.00 59.62  ? 116  THR D C     1 
ATOM   2966  O  O     . THR D 4 119 ? -15.296 9.584   23.168 1.00 59.53  ? 116  THR D O     1 
ATOM   2967  C  CB    . THR D 4 119 ? -17.114 9.354   26.046 1.00 59.05  ? 116  THR D CB    1 
ATOM   2968  O  OG1   . THR D 4 119 ? -18.278 8.727   26.612 1.00 59.02  ? 116  THR D OG1   1 
ATOM   2969  C  CG2   . THR D 4 119 ? -17.513 10.700  25.508 1.00 59.37  ? 116  THR D CG2   1 
ATOM   2970  N  N     . LYS D 4 120 ? -14.173 9.128   25.052 1.00 60.58  ? 117  LYS D N     1 
ATOM   2971  C  CA    . LYS D 4 120 ? -12.919 9.667   24.522 1.00 61.52  ? 117  LYS D CA    1 
ATOM   2972  C  C     . LYS D 4 120 ? -12.531 8.977   23.223 1.00 62.26  ? 117  LYS D C     1 
ATOM   2973  O  O     . LYS D 4 120 ? -12.167 9.634   22.249 1.00 62.59  ? 117  LYS D O     1 
ATOM   2974  C  CB    . LYS D 4 120 ? -11.772 9.575   25.541 1.00 61.54  ? 117  LYS D CB    1 
ATOM   2975  C  CG    . LYS D 4 120 ? -10.385 9.853   24.940 1.00 61.76  ? 117  LYS D CG    1 
ATOM   2976  C  CD    . LYS D 4 120 ? -9.363  10.321  25.977 1.00 62.98  ? 117  LYS D CD    1 
ATOM   2977  C  CE    . LYS D 4 120 ? -8.012  10.634  25.312 1.00 63.34  ? 117  LYS D CE    1 
ATOM   2978  N  NZ    . LYS D 4 120 ? -7.155  11.566  26.113 1.00 63.74  ? 117  LYS D NZ    1 
ATOM   2979  N  N     . TYR D 4 121 ? -12.626 7.652   23.210 1.00 63.28  ? 118  TYR D N     1 
ATOM   2980  C  CA    . TYR D 4 121 ? -12.219 6.857   22.059 1.00 64.01  ? 118  TYR D CA    1 
ATOM   2981  C  C     . TYR D 4 121 ? -13.027 7.152   20.790 1.00 65.05  ? 118  TYR D C     1 
ATOM   2982  O  O     . TYR D 4 121 ? -12.472 7.181   19.688 1.00 64.39  ? 118  TYR D O     1 
ATOM   2983  C  CB    . TYR D 4 121 ? -12.311 5.371   22.393 1.00 63.94  ? 118  TYR D CB    1 
ATOM   2984  C  CG    . TYR D 4 121 ? -11.964 4.488   21.231 1.00 62.58  ? 118  TYR D CG    1 
ATOM   2985  C  CD1   . TYR D 4 121 ? -10.645 4.150   20.974 1.00 61.83  ? 118  TYR D CD1   1 
ATOM   2986  C  CD2   . TYR D 4 121 ? -12.958 4.004   20.375 1.00 62.26  ? 118  TYR D CD2   1 
ATOM   2987  C  CE1   . TYR D 4 121 ? -10.310 3.341   19.900 1.00 62.45  ? 118  TYR D CE1   1 
ATOM   2988  C  CE2   . TYR D 4 121 ? -12.637 3.204   19.290 1.00 62.40  ? 118  TYR D CE2   1 
ATOM   2989  C  CZ    . TYR D 4 121 ? -11.307 2.875   19.065 1.00 62.96  ? 118  TYR D CZ    1 
ATOM   2990  O  OH    . TYR D 4 121 ? -10.966 2.079   18.002 1.00 64.71  ? 118  TYR D OH    1 
ATOM   2991  N  N     . THR D 4 122 ? -14.337 7.337   20.961 1.00 66.70  ? 119  THR D N     1 
ATOM   2992  C  CA    . THR D 4 122 ? -15.254 7.632   19.860 1.00 68.60  ? 119  THR D CA    1 
ATOM   2993  C  C     . THR D 4 122 ? -14.859 8.935   19.147 1.00 69.82  ? 119  THR D C     1 
ATOM   2994  O  O     . THR D 4 122 ? -14.869 9.002   17.915 1.00 69.86  ? 119  THR D O     1 
ATOM   2995  C  CB    . THR D 4 122 ? -16.717 7.720   20.370 1.00 68.55  ? 119  THR D CB    1 
ATOM   2996  O  OG1   . THR D 4 122 ? -17.047 6.522   21.083 1.00 69.12  ? 119  THR D OG1   1 
ATOM   2997  C  CG2   . THR D 4 122 ? -17.702 7.894   19.219 1.00 69.02  ? 119  THR D CG2   1 
ATOM   2998  N  N     . SER D 4 123 ? -14.484 9.953   19.921 1.00 71.50  ? 120  SER D N     1 
ATOM   2999  C  CA    . SER D 4 123 ? -14.129 11.259  19.360 1.00 73.23  ? 120  SER D CA    1 
ATOM   3000  C  C     . SER D 4 123 ? -12.735 11.305  18.721 1.00 74.27  ? 120  SER D C     1 
ATOM   3001  O  O     . SER D 4 123 ? -12.391 12.291  18.060 1.00 74.71  ? 120  SER D O     1 
ATOM   3002  C  CB    . SER D 4 123 ? -14.244 12.351  20.427 1.00 73.17  ? 120  SER D CB    1 
ATOM   3003  O  OG    . SER D 4 123 ? -13.037 12.451  21.167 1.00 73.26  ? 120  SER D OG    1 
ATOM   3004  N  N     . ALA D 4 124 ? -11.948 10.246  18.895 1.00 75.35  ? 121  ALA D N     1 
ATOM   3005  C  CA    . ALA D 4 124 ? -10.527 10.291  18.547 1.00 76.71  ? 121  ALA D CA    1 
ATOM   3006  C  C     . ALA D 4 124 ? -10.077 9.585   17.250 1.00 77.81  ? 121  ALA D C     1 
ATOM   3007  O  O     . ALA D 4 124 ? -8.926  9.145   17.157 1.00 78.14  ? 121  ALA D O     1 
ATOM   3008  C  CB    . ALA D 4 124 ? -9.679  9.829   19.741 1.00 76.69  ? 121  ALA D CB    1 
ATOM   3009  N  N     . LYS D 4 125 ? -10.959 9.485   16.252 1.00 79.04  ? 122  LYS D N     1 
ATOM   3010  C  CA    . LYS D 4 125 ? -10.540 9.042   14.906 1.00 80.15  ? 122  LYS D CA    1 
ATOM   3011  C  C     . LYS D 4 125 ? -11.286 9.760   13.766 1.00 80.55  ? 122  LYS D C     1 
ATOM   3012  O  O     . LYS D 4 125 ? -10.837 10.811  13.286 1.00 80.85  ? 122  LYS D O     1 
ATOM   3013  C  CB    . LYS D 4 125 ? -10.628 7.515   14.739 1.00 80.39  ? 122  LYS D CB    1 
ATOM   3014  C  CG    . LYS D 4 125 ? -9.878  7.008   13.499 1.00 81.55  ? 122  LYS D CG    1 
ATOM   3015  C  CD    . LYS D 4 125 ? -10.108 5.523   13.209 1.00 83.06  ? 122  LYS D CD    1 
ATOM   3016  C  CE    . LYS D 4 125 ? -9.360  5.118   11.935 1.00 83.77  ? 122  LYS D CE    1 
ATOM   3017  N  NZ    . LYS D 4 125 ? -9.614  3.711   11.507 1.00 84.65  ? 122  LYS D NZ    1 
ATOM   3018  O  OXT   . LYS D 4 125 ? -12.337 9.305   13.284 1.00 80.85  ? 122  LYS D OXT   1 
ATOM   3019  N  N     . PRO E 1 38  ? 13.992  -22.679 88.067 1.00 70.92  ? 38   PRO E N     1 
ATOM   3020  C  CA    . PRO E 1 38  ? 13.754  -22.911 86.645 1.00 70.74  ? 38   PRO E CA    1 
ATOM   3021  C  C     . PRO E 1 38  ? 12.473  -22.217 86.184 1.00 70.53  ? 38   PRO E C     1 
ATOM   3022  O  O     . PRO E 1 38  ? 11.411  -22.397 86.786 1.00 70.80  ? 38   PRO E O     1 
ATOM   3023  C  CB    . PRO E 1 38  ? 13.613  -24.440 86.543 1.00 70.82  ? 38   PRO E CB    1 
ATOM   3024  C  CG    . PRO E 1 38  ? 13.984  -24.990 87.938 1.00 71.23  ? 38   PRO E CG    1 
ATOM   3025  C  CD    . PRO E 1 38  ? 13.669  -23.871 88.876 1.00 71.08  ? 38   PRO E CD    1 
ATOM   3026  N  N     . HIS E 1 39  ? 12.586  -21.438 85.114 1.00 69.75  ? 39   HIS E N     1 
ATOM   3027  C  CA    . HIS E 1 39  ? 11.512  -20.563 84.656 1.00 68.83  ? 39   HIS E CA    1 
ATOM   3028  C  C     . HIS E 1 39  ? 10.446  -21.277 83.816 1.00 67.54  ? 39   HIS E C     1 
ATOM   3029  O  O     . HIS E 1 39  ? 10.771  -22.174 83.022 1.00 67.79  ? 39   HIS E O     1 
ATOM   3030  C  CB    . HIS E 1 39  ? 12.117  -19.416 83.849 1.00 69.44  ? 39   HIS E CB    1 
ATOM   3031  C  CG    . HIS E 1 39  ? 11.102  -18.493 83.255 1.00 71.01  ? 39   HIS E CG    1 
ATOM   3032  N  ND1   . HIS E 1 39  ? 10.530  -18.715 82.018 1.00 72.59  ? 39   HIS E ND1   1 
ATOM   3033  C  CD2   . HIS E 1 39  ? 10.554  -17.347 83.728 1.00 72.52  ? 39   HIS E CD2   1 
ATOM   3034  C  CE1   . HIS E 1 39  ? 9.675   -17.742 81.753 1.00 73.03  ? 39   HIS E CE1   1 
ATOM   3035  N  NE2   . HIS E 1 39  ? 9.672   -16.899 82.773 1.00 73.21  ? 39   HIS E NE2   1 
ATOM   3036  N  N     . ARG E 1 40  ? 9.186   -20.854 83.983 1.00 65.39  ? 40   ARG E N     1 
ATOM   3037  C  CA    . ARG E 1 40  ? 8.050   -21.414 83.227 1.00 63.28  ? 40   ARG E CA    1 
ATOM   3038  C  C     . ARG E 1 40  ? 6.998   -20.390 82.818 1.00 61.63  ? 40   ARG E C     1 
ATOM   3039  O  O     . ARG E 1 40  ? 6.441   -19.682 83.664 1.00 61.23  ? 40   ARG E O     1 
ATOM   3040  C  CB    . ARG E 1 40  ? 7.349   -22.539 84.002 1.00 63.24  ? 40   ARG E CB    1 
ATOM   3041  C  CG    . ARG E 1 40  ? 7.961   -23.901 83.792 1.00 63.28  ? 40   ARG E CG    1 
ATOM   3042  C  CD    . ARG E 1 40  ? 6.922   -25.015 83.837 1.00 62.84  ? 40   ARG E CD    1 
ATOM   3043  N  NE    . ARG E 1 40  ? 7.529   -26.251 83.355 1.00 63.66  ? 40   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E 1 40  ? 7.073   -26.995 82.354 1.00 64.13  ? 40   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E 1 40  ? 5.956   -26.666 81.709 1.00 61.97  ? 40   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E 1 40  ? 7.737   -28.099 82.019 1.00 66.04  ? 40   ARG E NH2   1 
ATOM   3047  N  N     . TYR E 1 41  ? 6.707   -20.339 81.520 1.00 59.51  ? 41   TYR E N     1 
ATOM   3048  C  CA    . TYR E 1 41  ? 5.510   -19.637 81.056 1.00 57.53  ? 41   TYR E CA    1 
ATOM   3049  C  C     . TYR E 1 41  ? 4.251   -20.450 81.342 1.00 56.29  ? 41   TYR E C     1 
ATOM   3050  O  O     . TYR E 1 41  ? 4.257   -21.682 81.298 1.00 56.02  ? 41   TYR E O     1 
ATOM   3051  C  CB    . TYR E 1 41  ? 5.603   -19.272 79.573 1.00 57.45  ? 41   TYR E CB    1 
ATOM   3052  C  CG    . TYR E 1 41  ? 6.663   -18.239 79.283 1.00 56.48  ? 41   TYR E CG    1 
ATOM   3053  C  CD1   . TYR E 1 41  ? 7.839   -18.582 78.622 1.00 56.32  ? 41   TYR E CD1   1 
ATOM   3054  C  CD2   . TYR E 1 41  ? 6.504   -16.920 79.703 1.00 56.52  ? 41   TYR E CD2   1 
ATOM   3055  C  CE1   . TYR E 1 41  ? 8.821   -17.634 78.368 1.00 55.63  ? 41   TYR E CE1   1 
ATOM   3056  C  CE2   . TYR E 1 41  ? 7.477   -15.966 79.459 1.00 55.46  ? 41   TYR E CE2   1 
ATOM   3057  C  CZ    . TYR E 1 41  ? 8.632   -16.329 78.792 1.00 55.37  ? 41   TYR E CZ    1 
ATOM   3058  O  OH    . TYR E 1 41  ? 9.594   -15.377 78.554 1.00 54.69  ? 41   TYR E OH    1 
ATOM   3059  N  N     . ARG E 1 42  ? 3.183   -19.734 81.661 1.00 54.99  ? 42   ARG E N     1 
ATOM   3060  C  CA    . ARG E 1 42  ? 1.886   -20.320 81.985 1.00 53.91  ? 42   ARG E CA    1 
ATOM   3061  C  C     . ARG E 1 42  ? 1.144   -20.827 80.748 1.00 52.45  ? 42   ARG E C     1 
ATOM   3062  O  O     . ARG E 1 42  ? 1.220   -20.210 79.688 1.00 52.05  ? 42   ARG E O     1 
ATOM   3063  C  CB    . ARG E 1 42  ? 1.045   -19.290 82.724 1.00 54.06  ? 42   ARG E CB    1 
ATOM   3064  C  CG    . ARG E 1 42  ? 1.588   -18.990 84.120 1.00 56.78  ? 42   ARG E CG    1 
ATOM   3065  C  CD    . ARG E 1 42  ? 0.946   -17.776 84.743 1.00 59.51  ? 42   ARG E CD    1 
ATOM   3066  N  NE    . ARG E 1 42  ? -0.487  -17.739 84.466 1.00 63.01  ? 42   ARG E NE    1 
ATOM   3067  C  CZ    . ARG E 1 42  ? -1.373  -17.031 85.160 1.00 64.98  ? 42   ARG E CZ    1 
ATOM   3068  N  NH1   . ARG E 1 42  ? -0.982  -16.298 86.197 1.00 66.38  ? 42   ARG E NH1   1 
ATOM   3069  N  NH2   . ARG E 1 42  ? -2.658  -17.068 84.823 1.00 65.72  ? 42   ARG E NH2   1 
ATOM   3070  N  N     . PRO E 1 43  ? 0.424   -21.958 80.875 1.00 51.30  ? 43   PRO E N     1 
ATOM   3071  C  CA    . PRO E 1 43  ? -0.223  -22.486 79.682 1.00 50.25  ? 43   PRO E CA    1 
ATOM   3072  C  C     . PRO E 1 43  ? -1.136  -21.458 79.021 1.00 49.09  ? 43   PRO E C     1 
ATOM   3073  O  O     . PRO E 1 43  ? -2.024  -20.903 79.657 1.00 48.88  ? 43   PRO E O     1 
ATOM   3074  C  CB    . PRO E 1 43  ? -1.011  -23.698 80.198 1.00 50.23  ? 43   PRO E CB    1 
ATOM   3075  C  CG    . PRO E 1 43  ? -0.984  -23.620 81.656 1.00 50.86  ? 43   PRO E CG    1 
ATOM   3076  C  CD    . PRO E 1 43  ? 0.216   -22.832 82.043 1.00 51.33  ? 43   PRO E CD    1 
ATOM   3077  N  N     . GLY E 1 44  ? -0.886  -21.197 77.747 1.00 48.03  ? 44   GLY E N     1 
ATOM   3078  C  CA    . GLY E 1 44  ? -1.634  -20.191 77.024 1.00 46.95  ? 44   GLY E CA    1 
ATOM   3079  C  C     . GLY E 1 44  ? -0.756  -19.061 76.550 1.00 46.40  ? 44   GLY E C     1 
ATOM   3080  O  O     . GLY E 1 44  ? -1.036  -18.445 75.533 1.00 46.66  ? 44   GLY E O     1 
ATOM   3081  N  N     . THR E 1 45  ? 0.315   -18.787 77.286 1.00 46.11  ? 45   THR E N     1 
ATOM   3082  C  CA    . THR E 1 45  ? 1.181   -17.645 76.987 1.00 44.92  ? 45   THR E CA    1 
ATOM   3083  C  C     . THR E 1 45  ? 2.015   -17.878 75.732 1.00 44.28  ? 45   THR E C     1 
ATOM   3084  O  O     . THR E 1 45  ? 2.015   -17.032 74.840 1.00 44.53  ? 45   THR E O     1 
ATOM   3085  C  CB    . THR E 1 45  ? 2.064   -17.254 78.203 1.00 45.27  ? 45   THR E CB    1 
ATOM   3086  O  OG1   . THR E 1 45  ? 1.223   -16.949 79.327 1.00 44.80  ? 45   THR E OG1   1 
ATOM   3087  C  CG2   . THR E 1 45  ? 2.939   -16.044 77.895 1.00 44.23  ? 45   THR E CG2   1 
ATOM   3088  N  N     . VAL E 1 46  ? 2.707   -19.016 75.644 1.00 43.24  ? 46   VAL E N     1 
ATOM   3089  C  CA    . VAL E 1 46  ? 3.496   -19.325 74.447 1.00 41.68  ? 46   VAL E CA    1 
ATOM   3090  C  C     . VAL E 1 46  ? 2.548   -19.494 73.253 1.00 41.03  ? 46   VAL E C     1 
ATOM   3091  O  O     . VAL E 1 46  ? 2.873   -19.087 72.130 1.00 41.10  ? 46   VAL E O     1 
ATOM   3092  C  CB    . VAL E 1 46  ? 4.385   -20.589 74.626 1.00 41.89  ? 46   VAL E CB    1 
ATOM   3093  C  CG1   . VAL E 1 46  ? 5.405   -20.716 73.478 1.00 40.17  ? 46   VAL E CG1   1 
ATOM   3094  C  CG2   . VAL E 1 46  ? 5.089   -20.556 75.978 1.00 41.91  ? 46   VAL E CG2   1 
ATOM   3095  N  N     . ALA E 1 47  ? 1.369   -20.062 73.504 1.00 39.93  ? 47   ALA E N     1 
ATOM   3096  C  CA    . ALA E 1 47  ? 0.355   -20.223 72.461 1.00 39.24  ? 47   ALA E CA    1 
ATOM   3097  C  C     . ALA E 1 47  ? -0.006  -18.888 71.794 1.00 39.33  ? 47   ALA E C     1 
ATOM   3098  O  O     . ALA E 1 47  ? 0.000   -18.792 70.560 1.00 38.90  ? 47   ALA E O     1 
ATOM   3099  C  CB    . ALA E 1 47  ? -0.891  -20.922 73.004 1.00 38.84  ? 47   ALA E CB    1 
ATOM   3100  N  N     . LEU E 1 48  ? -0.296  -17.862 72.601 1.00 39.45  ? 48   LEU E N     1 
ATOM   3101  C  CA    . LEU E 1 48  ? -0.563  -16.510 72.070 1.00 40.07  ? 48   LEU E CA    1 
ATOM   3102  C  C     . LEU E 1 48  ? 0.638   -15.897 71.356 1.00 40.45  ? 48   LEU E C     1 
ATOM   3103  O  O     . LEU E 1 48  ? 0.464   -15.249 70.324 1.00 40.87  ? 48   LEU E O     1 
ATOM   3104  C  CB    . LEU E 1 48  ? -1.090  -15.553 73.142 1.00 39.83  ? 48   LEU E CB    1 
ATOM   3105  C  CG    . LEU E 1 48  ? -2.474  -15.880 73.706 1.00 40.87  ? 48   LEU E CG    1 
ATOM   3106  C  CD1   . LEU E 1 48  ? -2.710  -15.193 75.054 1.00 39.02  ? 48   LEU E CD1   1 
ATOM   3107  C  CD2   . LEU E 1 48  ? -3.599  -15.581 72.687 1.00 39.35  ? 48   LEU E CD2   1 
ATOM   3108  N  N     . ARG E 1 49  ? 1.841   -16.101 71.894 1.00 40.75  ? 49   ARG E N     1 
ATOM   3109  C  CA    . ARG E 1 49  ? 3.081   -15.712 71.215 1.00 41.12  ? 49   ARG E CA    1 
ATOM   3110  C  C     . ARG E 1 49  ? 3.136   -16.352 69.825 1.00 41.32  ? 49   ARG E C     1 
ATOM   3111  O  O     . ARG E 1 49  ? 3.407   -15.671 68.823 1.00 41.76  ? 49   ARG E O     1 
ATOM   3112  C  CB    . ARG E 1 49  ? 4.296   -16.172 72.036 1.00 42.10  ? 49   ARG E CB    1 
ATOM   3113  C  CG    . ARG E 1 49  ? 5.520   -15.264 71.963 1.00 44.06  ? 49   ARG E CG    1 
ATOM   3114  C  CD    . ARG E 1 49  ? 6.868   -16.018 72.081 1.00 47.68  ? 49   ARG E CD    1 
ATOM   3115  N  NE    . ARG E 1 49  ? 7.257   -16.540 73.404 1.00 49.57  ? 49   ARG E NE    1 
ATOM   3116  C  CZ    . ARG E 1 49  ? 6.749   -16.176 74.579 1.00 50.82  ? 49   ARG E CZ    1 
ATOM   3117  N  NH1   . ARG E 1 49  ? 5.805   -15.242 74.663 1.00 51.11  ? 49   ARG E NH1   1 
ATOM   3118  N  NH2   . ARG E 1 49  ? 7.207   -16.745 75.685 1.00 50.03  ? 49   ARG E NH2   1 
ATOM   3119  N  N     . GLU E 1 50  ? 2.872   -17.661 69.752 1.00 40.79  ? 50   GLU E N     1 
ATOM   3120  C  CA    . GLU E 1 50  ? 2.926   -18.374 68.465 1.00 40.00  ? 50   GLU E CA    1 
ATOM   3121  C  C     . GLU E 1 50  ? 1.883   -17.850 67.476 1.00 38.86  ? 50   GLU E C     1 
ATOM   3122  O  O     . GLU E 1 50  ? 2.166   -17.714 66.287 1.00 38.74  ? 50   GLU E O     1 
ATOM   3123  C  CB    . GLU E 1 50  ? 2.787   -19.892 68.655 1.00 40.43  ? 50   GLU E CB    1 
ATOM   3124  C  CG    . GLU E 1 50  ? 4.037   -20.610 69.165 1.00 41.46  ? 50   GLU E CG    1 
ATOM   3125  C  CD    . GLU E 1 50  ? 3.736   -22.035 69.566 1.00 46.07  ? 50   GLU E CD    1 
ATOM   3126  O  OE1   . GLU E 1 50  ? 4.465   -22.606 70.418 1.00 49.51  ? 50   GLU E OE1   1 
ATOM   3127  O  OE2   . GLU E 1 50  ? 2.743   -22.594 69.040 1.00 48.13  ? 50   GLU E OE2   1 
ATOM   3128  N  N     . ILE E 1 51  ? 0.682   -17.554 67.963 1.00 38.08  ? 51   ILE E N     1 
ATOM   3129  C  CA    . ILE E 1 51  ? -0.362  -16.949 67.119 1.00 37.46  ? 51   ILE E CA    1 
ATOM   3130  C  C     . ILE E 1 51  ? 0.116   -15.624 66.482 1.00 37.69  ? 51   ILE E C     1 
ATOM   3131  O  O     . ILE E 1 51  ? -0.018  -15.431 65.277 1.00 37.35  ? 51   ILE E O     1 
ATOM   3132  C  CB    . ILE E 1 51  ? -1.673  -16.654 67.899 1.00 37.02  ? 51   ILE E CB    1 
ATOM   3133  C  CG1   . ILE E 1 51  ? -2.276  -17.938 68.488 1.00 36.57  ? 51   ILE E CG1   1 
ATOM   3134  C  CG2   . ILE E 1 51  ? -2.652  -15.897 66.994 1.00 36.79  ? 51   ILE E CG2   1 
ATOM   3135  C  CD1   . ILE E 1 51  ? -3.707  -17.796 69.063 1.00 34.37  ? 51   ILE E CD1   1 
ATOM   3136  N  N     . ARG E 1 52  ? 0.682   -14.722 67.285 1.00 37.77  ? 52   ARG E N     1 
ATOM   3137  C  CA    . ARG E 1 52  ? 1.211   -13.469 66.739 1.00 38.65  ? 52   ARG E CA    1 
ATOM   3138  C  C     . ARG E 1 52  ? 2.336   -13.757 65.761 1.00 38.35  ? 52   ARG E C     1 
ATOM   3139  O  O     . ARG E 1 52  ? 2.444   -13.098 64.726 1.00 38.54  ? 52   ARG E O     1 
ATOM   3140  C  CB    . ARG E 1 52  ? 1.694   -12.495 67.835 1.00 38.88  ? 52   ARG E CB    1 
ATOM   3141  C  CG    . ARG E 1 52  ? 0.611   -12.088 68.843 1.00 42.18  ? 52   ARG E CG    1 
ATOM   3142  C  CD    . ARG E 1 52  ? 1.150   -11.212 69.982 1.00 45.86  ? 52   ARG E CD    1 
ATOM   3143  N  NE    . ARG E 1 52  ? 0.568   -11.573 71.284 1.00 49.24  ? 52   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E 1 52  ? -0.647  -11.215 71.696 1.00 50.28  ? 52   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E 1 52  ? -1.433  -10.494 70.915 1.00 52.34  ? 52   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E 1 52  ? -1.085  -11.577 72.894 1.00 51.29  ? 52   ARG E NH2   1 
ATOM   3147  N  N     . ARG E 1 53  ? 3.181   -14.732 66.078 1.00 38.07  ? 53   ARG E N     1 
ATOM   3148  C  CA    . ARG E 1 53  ? 4.302   -15.008 65.204 1.00 38.24  ? 53   ARG E CA    1 
ATOM   3149  C  C     . ARG E 1 53  ? 3.783   -15.506 63.861 1.00 38.03  ? 53   ARG E C     1 
ATOM   3150  O  O     . ARG E 1 53  ? 4.167   -14.988 62.809 1.00 38.67  ? 53   ARG E O     1 
ATOM   3151  C  CB    . ARG E 1 53  ? 5.273   -16.013 65.838 1.00 38.85  ? 53   ARG E CB    1 
ATOM   3152  C  CG    . ARG E 1 53  ? 6.465   -16.347 64.962 1.00 40.40  ? 53   ARG E CG    1 
ATOM   3153  C  CD    . ARG E 1 53  ? 7.243   -17.562 65.477 1.00 44.31  ? 53   ARG E CD    1 
ATOM   3154  N  NE    . ARG E 1 53  ? 8.184   -18.012 64.452 1.00 46.72  ? 53   ARG E NE    1 
ATOM   3155  C  CZ    . ARG E 1 53  ? 8.991   -19.067 64.555 1.00 48.24  ? 53   ARG E CZ    1 
ATOM   3156  N  NH1   . ARG E 1 53  ? 8.999   -19.824 65.659 1.00 48.35  ? 53   ARG E NH1   1 
ATOM   3157  N  NH2   . ARG E 1 53  ? 9.798   -19.360 63.542 1.00 46.57  ? 53   ARG E NH2   1 
ATOM   3158  N  N     . TYR E 1 54  ? 2.900   -16.499 63.876 1.00 37.03  ? 54   TYR E N     1 
ATOM   3159  C  CA    . TYR E 1 54  ? 2.482   -17.085 62.602 1.00 36.30  ? 54   TYR E CA    1 
ATOM   3160  C  C     . TYR E 1 54  ? 1.478   -16.232 61.814 1.00 36.07  ? 54   TYR E C     1 
ATOM   3161  O  O     . TYR E 1 54  ? 1.397   -16.337 60.582 1.00 35.05  ? 54   TYR E O     1 
ATOM   3162  C  CB    . TYR E 1 54  ? 2.033   -18.552 62.771 1.00 35.61  ? 54   TYR E CB    1 
ATOM   3163  C  CG    . TYR E 1 54  ? 3.178   -19.429 63.216 1.00 34.00  ? 54   TYR E CG    1 
ATOM   3164  C  CD1   . TYR E 1 54  ? 3.148   -20.070 64.448 1.00 32.36  ? 54   TYR E CD1   1 
ATOM   3165  C  CD2   . TYR E 1 54  ? 4.306   -19.588 62.420 1.00 31.21  ? 54   TYR E CD2   1 
ATOM   3166  C  CE1   . TYR E 1 54  ? 4.185   -20.852 64.866 1.00 32.03  ? 54   TYR E CE1   1 
ATOM   3167  C  CE2   . TYR E 1 54  ? 5.357   -20.378 62.838 1.00 31.57  ? 54   TYR E CE2   1 
ATOM   3168  C  CZ    . TYR E 1 54  ? 5.287   -21.000 64.063 1.00 32.81  ? 54   TYR E CZ    1 
ATOM   3169  O  OH    . TYR E 1 54  ? 6.326   -21.783 64.492 1.00 36.52  ? 54   TYR E OH    1 
ATOM   3170  N  N     . GLN E 1 55  ? 0.740   -15.384 62.518 1.00 36.38  ? 55   GLN E N     1 
ATOM   3171  C  CA    . GLN E 1 55  ? -0.162  -14.452 61.834 1.00 37.62  ? 55   GLN E CA    1 
ATOM   3172  C  C     . GLN E 1 55  ? 0.592   -13.326 61.139 1.00 38.24  ? 55   GLN E C     1 
ATOM   3173  O  O     . GLN E 1 55  ? 0.074   -12.721 60.214 1.00 38.90  ? 55   GLN E O     1 
ATOM   3174  C  CB    . GLN E 1 55  ? -1.266  -13.932 62.756 1.00 37.24  ? 55   GLN E CB    1 
ATOM   3175  C  CG    . GLN E 1 55  ? -2.392  -14.941 62.896 1.00 37.13  ? 55   GLN E CG    1 
ATOM   3176  C  CD    . GLN E 1 55  ? -3.604  -14.424 63.649 1.00 37.16  ? 55   GLN E CD    1 
ATOM   3177  O  OE1   . GLN E 1 55  ? -3.559  -13.371 64.292 1.00 35.73  ? 55   GLN E OE1   1 
ATOM   3178  N  NE2   . GLN E 1 55  ? -4.705  -15.190 63.586 1.00 34.73  ? 55   GLN E NE2   1 
ATOM   3179  N  N     . LYS E 1 56  ? 1.839   -13.114 61.544 1.00 38.99  ? 56   LYS E N     1 
ATOM   3180  C  CA    . LYS E 1 56  ? 2.707   -12.073 61.010 1.00 39.83  ? 56   LYS E CA    1 
ATOM   3181  C  C     . LYS E 1 56  ? 3.395   -12.522 59.731 1.00 39.24  ? 56   LYS E C     1 
ATOM   3182  O  O     . LYS E 1 56  ? 3.656   -11.708 58.839 1.00 39.83  ? 56   LYS E O     1 
ATOM   3183  C  CB    . LYS E 1 56  ? 3.782   -11.754 62.067 1.00 41.03  ? 56   LYS E CB    1 
ATOM   3184  C  CG    . LYS E 1 56  ? 4.510   -10.425 61.954 1.00 43.73  ? 56   LYS E CG    1 
ATOM   3185  C  CD    . LYS E 1 56  ? 5.160   -10.108 63.327 1.00 49.45  ? 56   LYS E CD    1 
ATOM   3186  C  CE    . LYS E 1 56  ? 5.816   -8.720  63.341 1.00 54.35  ? 56   LYS E CE    1 
ATOM   3187  N  NZ    . LYS E 1 56  ? 5.791   -8.114  64.737 1.00 56.95  ? 56   LYS E NZ    1 
ATOM   3188  N  N     . SER E 1 57  ? 3.725   -13.806 59.641 1.00 38.21  ? 57   SER E N     1 
ATOM   3189  C  CA    . SER E 1 57  ? 4.583   -14.270 58.549 1.00 36.91  ? 57   SER E CA    1 
ATOM   3190  C  C     . SER E 1 57  ? 3.810   -15.015 57.486 1.00 36.45  ? 57   SER E C     1 
ATOM   3191  O  O     . SER E 1 57  ? 2.647   -15.379 57.700 1.00 36.42  ? 57   SER E O     1 
ATOM   3192  C  CB    . SER E 1 57  ? 5.712   -15.142 59.078 1.00 36.94  ? 57   SER E CB    1 
ATOM   3193  O  OG    . SER E 1 57  ? 5.195   -16.230 59.823 1.00 37.35  ? 57   SER E OG    1 
ATOM   3194  N  N     . THR E 1 58  ? 4.460   -15.253 56.343 1.00 35.63  ? 58   THR E N     1 
ATOM   3195  C  CA    . THR E 1 58  ? 3.810   -15.936 55.233 1.00 35.27  ? 58   THR E CA    1 
ATOM   3196  C  C     . THR E 1 58  ? 4.417   -17.290 54.785 1.00 35.41  ? 58   THR E C     1 
ATOM   3197  O  O     . THR E 1 58  ? 3.897   -17.896 53.834 1.00 34.89  ? 58   THR E O     1 
ATOM   3198  C  CB    . THR E 1 58  ? 3.736   -15.039 53.989 1.00 35.14  ? 58   THR E CB    1 
ATOM   3199  O  OG1   . THR E 1 58  ? 5.033   -14.938 53.401 1.00 34.24  ? 58   THR E OG1   1 
ATOM   3200  C  CG2   . THR E 1 58  ? 3.198   -13.639 54.334 1.00 36.44  ? 58   THR E CG2   1 
ATOM   3201  N  N     . GLU E 1 59  ? 5.501   -17.761 55.413 1.00 35.23  ? 59   GLU E N     1 
ATOM   3202  C  CA    . GLU E 1 59  ? 6.106   -19.012 54.941 1.00 36.12  ? 59   GLU E CA    1 
ATOM   3203  C  C     . GLU E 1 59  ? 5.180   -20.232 55.119 1.00 35.54  ? 59   GLU E C     1 
ATOM   3204  O  O     . GLU E 1 59  ? 4.354   -20.270 56.031 1.00 35.38  ? 59   GLU E O     1 
ATOM   3205  C  CB    . GLU E 1 59  ? 7.514   -19.263 55.505 1.00 36.39  ? 59   GLU E CB    1 
ATOM   3206  C  CG    . GLU E 1 59  ? 7.824   -18.613 56.843 1.00 41.95  ? 59   GLU E CG    1 
ATOM   3207  C  CD    . GLU E 1 59  ? 7.163   -19.327 57.990 1.00 47.64  ? 59   GLU E CD    1 
ATOM   3208  O  OE1   . GLU E 1 59  ? 6.727   -20.471 57.762 1.00 52.20  ? 59   GLU E OE1   1 
ATOM   3209  O  OE2   . GLU E 1 59  ? 7.069   -18.760 59.106 1.00 49.44  ? 59   GLU E OE2   1 
ATOM   3210  N  N     . LEU E 1 60  ? 5.288   -21.192 54.203 1.00 35.11  ? 60   LEU E N     1 
ATOM   3211  C  CA    . LEU E 1 60  ? 4.619   -22.481 54.366 1.00 35.32  ? 60   LEU E CA    1 
ATOM   3212  C  C     . LEU E 1 60  ? 5.014   -23.159 55.671 1.00 35.26  ? 60   LEU E C     1 
ATOM   3213  O  O     . LEU E 1 60  ? 6.178   -23.080 56.114 1.00 35.87  ? 60   LEU E O     1 
ATOM   3214  C  CB    . LEU E 1 60  ? 4.888   -23.396 53.182 1.00 35.84  ? 60   LEU E CB    1 
ATOM   3215  C  CG    . LEU E 1 60  ? 4.283   -22.875 51.879 1.00 36.77  ? 60   LEU E CG    1 
ATOM   3216  C  CD1   . LEU E 1 60  ? 4.623   -23.819 50.790 1.00 37.77  ? 60   LEU E CD1   1 
ATOM   3217  C  CD2   . LEU E 1 60  ? 2.767   -22.699 51.980 1.00 38.90  ? 60   LEU E CD2   1 
ATOM   3218  N  N     . LEU E 1 61  ? 4.031   -23.793 56.294 1.00 34.72  ? 61   LEU E N     1 
ATOM   3219  C  CA    . LEU E 1 61  ? 4.173   -24.278 57.652 1.00 35.24  ? 61   LEU E CA    1 
ATOM   3220  C  C     . LEU E 1 61  ? 4.382   -25.795 57.756 1.00 35.34  ? 61   LEU E C     1 
ATOM   3221  O  O     . LEU E 1 61  ? 4.822   -26.287 58.794 1.00 35.44  ? 61   LEU E O     1 
ATOM   3222  C  CB    . LEU E 1 61  ? 2.987   -23.802 58.507 1.00 34.93  ? 61   LEU E CB    1 
ATOM   3223  C  CG    . LEU E 1 61  ? 2.865   -22.272 58.637 1.00 34.90  ? 61   LEU E CG    1 
ATOM   3224  C  CD1   . LEU E 1 61  ? 1.533   -21.869 59.236 1.00 32.22  ? 61   LEU E CD1   1 
ATOM   3225  C  CD2   . LEU E 1 61  ? 4.055   -21.643 59.422 1.00 34.00  ? 61   LEU E CD2   1 
ATOM   3226  N  N     . ILE E 1 62  ? 4.075   -26.503 56.673 1.00 35.51  ? 62   ILE E N     1 
ATOM   3227  C  CA    . ILE E 1 62  ? 4.317   -27.935 56.518 1.00 36.32  ? 62   ILE E CA    1 
ATOM   3228  C  C     . ILE E 1 62  ? 5.655   -28.095 55.806 1.00 36.48  ? 62   ILE E C     1 
ATOM   3229  O  O     . ILE E 1 62  ? 5.915   -27.367 54.858 1.00 36.82  ? 62   ILE E O     1 
ATOM   3230  C  CB    . ILE E 1 62  ? 3.187   -28.609 55.641 1.00 36.16  ? 62   ILE E CB    1 
ATOM   3231  C  CG1   . ILE E 1 62  ? 1.802   -28.353 56.251 1.00 37.00  ? 62   ILE E CG1   1 
ATOM   3232  C  CG2   . ILE E 1 62  ? 3.422   -30.115 55.475 1.00 35.61  ? 62   ILE E CG2   1 
ATOM   3233  C  CD1   . ILE E 1 62  ? 0.610   -28.873 55.430 1.00 37.09  ? 62   ILE E CD1   1 
ATOM   3234  N  N     . ARG E 1 63  ? 6.492   -29.029 56.259 1.00 37.16  ? 63   ARG E N     1 
ATOM   3235  C  CA    . ARG E 1 63  ? 7.811   -29.269 55.657 1.00 37.98  ? 63   ARG E CA    1 
ATOM   3236  C  C     . ARG E 1 63  ? 7.625   -29.731 54.208 1.00 38.15  ? 63   ARG E C     1 
ATOM   3237  O  O     . ARG E 1 63  ? 6.673   -30.450 53.903 1.00 38.45  ? 63   ARG E O     1 
ATOM   3238  C  CB    . ARG E 1 63  ? 8.578   -30.327 56.460 1.00 38.55  ? 63   ARG E CB    1 
ATOM   3239  C  CG    . ARG E 1 63  ? 8.906   -29.982 57.922 1.00 39.60  ? 63   ARG E CG    1 
ATOM   3240  C  CD    . ARG E 1 63  ? 10.129  -29.054 58.031 1.00 45.79  ? 63   ARG E CD    1 
ATOM   3241  N  NE    . ARG E 1 63  ? 9.735   -27.680 58.368 1.00 50.11  ? 63   ARG E NE    1 
ATOM   3242  C  CZ    . ARG E 1 63  ? 9.903   -26.617 57.580 1.00 52.37  ? 63   ARG E CZ    1 
ATOM   3243  N  NH1   . ARG E 1 63  ? 10.496  -26.741 56.390 1.00 54.32  ? 63   ARG E NH1   1 
ATOM   3244  N  NH2   . ARG E 1 63  ? 9.484   -25.420 57.988 1.00 50.96  ? 63   ARG E NH2   1 
ATOM   3245  N  N     . LYS E 1 64  ? 8.516   -29.315 53.315 1.00 38.24  ? 64   LYS E N     1 
ATOM   3246  C  CA    . LYS E 1 64  ? 8.316   -29.548 51.884 1.00 38.98  ? 64   LYS E CA    1 
ATOM   3247  C  C     . LYS E 1 64  ? 8.278   -31.016 51.452 1.00 38.59  ? 64   LYS E C     1 
ATOM   3248  O  O     . LYS E 1 64  ? 7.292   -31.450 50.861 1.00 38.41  ? 64   LYS E O     1 
ATOM   3249  C  CB    . LYS E 1 64  ? 9.334   -28.781 51.039 1.00 39.22  ? 64   LYS E CB    1 
ATOM   3250  C  CG    . LYS E 1 64  ? 8.944   -27.348 50.763 1.00 42.66  ? 64   LYS E CG    1 
ATOM   3251  C  CD    . LYS E 1 64  ? 9.797   -26.769 49.624 1.00 48.49  ? 64   LYS E CD    1 
ATOM   3252  C  CE    . LYS E 1 64  ? 10.026  -25.248 49.799 1.00 50.66  ? 64   LYS E CE    1 
ATOM   3253  N  NZ    . LYS E 1 64  ? 8.986   -24.577 50.649 1.00 50.93  ? 64   LYS E NZ    1 
ATOM   3254  N  N     . LEU E 1 65  ? 9.346   -31.764 51.736 1.00 38.12  ? 65   LEU E N     1 
ATOM   3255  C  CA    . LEU E 1 65  ? 9.449   -33.163 51.295 1.00 37.48  ? 65   LEU E CA    1 
ATOM   3256  C  C     . LEU E 1 65  ? 8.285   -34.053 51.756 1.00 36.39  ? 65   LEU E C     1 
ATOM   3257  O  O     . LEU E 1 65  ? 7.703   -34.747 50.946 1.00 36.52  ? 65   LEU E O     1 
ATOM   3258  C  CB    . LEU E 1 65  ? 10.796  -33.776 51.698 1.00 37.77  ? 65   LEU E CB    1 
ATOM   3259  C  CG    . LEU E 1 65  ? 11.120  -35.193 51.211 1.00 37.58  ? 65   LEU E CG    1 
ATOM   3260  C  CD1   . LEU E 1 65  ? 10.989  -35.318 49.696 1.00 37.42  ? 65   LEU E CD1   1 
ATOM   3261  C  CD2   . LEU E 1 65  ? 12.546  -35.522 51.654 1.00 38.20  ? 65   LEU E CD2   1 
ATOM   3262  N  N     . PRO E 1 66  ? 7.954   -34.043 53.054 1.00 35.69  ? 66   PRO E N     1 
ATOM   3263  C  CA    . PRO E 1 66  ? 6.815   -34.818 53.526 1.00 35.45  ? 66   PRO E CA    1 
ATOM   3264  C  C     . PRO E 1 66  ? 5.537   -34.502 52.752 1.00 35.09  ? 66   PRO E C     1 
ATOM   3265  O  O     . PRO E 1 66  ? 4.796   -35.404 52.377 1.00 34.65  ? 66   PRO E O     1 
ATOM   3266  C  CB    . PRO E 1 66  ? 6.665   -34.354 54.973 1.00 35.74  ? 66   PRO E CB    1 
ATOM   3267  C  CG    . PRO E 1 66  ? 8.036   -34.006 55.375 1.00 35.77  ? 66   PRO E CG    1 
ATOM   3268  C  CD    . PRO E 1 66  ? 8.653   -33.379 54.168 1.00 35.97  ? 66   PRO E CD    1 
ATOM   3269  N  N     . PHE E 1 67  ? 5.296   -33.221 52.493 1.00 35.11  ? 67   PHE E N     1 
ATOM   3270  C  CA    . PHE E 1 67  ? 4.134   -32.838 51.708 1.00 34.60  ? 67   PHE E CA    1 
ATOM   3271  C  C     . PHE E 1 67  ? 4.205   -33.421 50.299 1.00 34.56  ? 67   PHE E C     1 
ATOM   3272  O  O     . PHE E 1 67  ? 3.222   -33.963 49.805 1.00 33.97  ? 67   PHE E O     1 
ATOM   3273  C  CB    . PHE E 1 67  ? 3.949   -31.313 51.664 1.00 33.67  ? 67   PHE E CB    1 
ATOM   3274  C  CG    . PHE E 1 67  ? 2.685   -30.905 50.987 1.00 31.07  ? 67   PHE E CG    1 
ATOM   3275  C  CD1   . PHE E 1 67  ? 1.474   -30.865 51.688 1.00 29.80  ? 67   PHE E CD1   1 
ATOM   3276  C  CD2   . PHE E 1 67  ? 2.684   -30.629 49.638 1.00 27.98  ? 67   PHE E CD2   1 
ATOM   3277  C  CE1   . PHE E 1 67  ? 0.281   -30.521 51.036 1.00 28.91  ? 67   PHE E CE1   1 
ATOM   3278  C  CE2   . PHE E 1 67  ? 1.527   -30.289 48.990 1.00 27.80  ? 67   PHE E CE2   1 
ATOM   3279  C  CZ    . PHE E 1 67  ? 0.310   -30.216 49.692 1.00 28.03  ? 67   PHE E CZ    1 
ATOM   3280  N  N     . GLN E 1 68  ? 5.370   -33.291 49.676 1.00 35.46  ? 68   GLN E N     1 
ATOM   3281  C  CA    . GLN E 1 68  ? 5.630   -33.800 48.325 1.00 37.52  ? 68   GLN E CA    1 
ATOM   3282  C  C     . GLN E 1 68  ? 5.390   -35.324 48.224 1.00 37.69  ? 68   GLN E C     1 
ATOM   3283  O  O     . GLN E 1 68  ? 4.841   -35.811 47.231 1.00 38.12  ? 68   GLN E O     1 
ATOM   3284  C  CB    . GLN E 1 68  ? 7.048   -33.424 47.873 1.00 37.38  ? 68   GLN E CB    1 
ATOM   3285  C  CG    . GLN E 1 68  ? 7.172   -33.186 46.371 1.00 42.51  ? 68   GLN E CG    1 
ATOM   3286  C  CD    . GLN E 1 68  ? 8.612   -32.889 45.884 1.00 49.13  ? 68   GLN E CD    1 
ATOM   3287  O  OE1   . GLN E 1 68  ? 9.611   -33.249 46.538 1.00 50.43  ? 68   GLN E OE1   1 
ATOM   3288  N  NE2   . GLN E 1 68  ? 8.714   -32.244 44.710 1.00 49.86  ? 68   GLN E NE2   1 
ATOM   3289  N  N     . ARG E 1 69  ? 5.753   -36.060 49.270 1.00 37.94  ? 69   ARG E N     1 
ATOM   3290  C  CA    . ARG E 1 69  ? 5.507   -37.510 49.317 1.00 38.81  ? 69   ARG E CA    1 
ATOM   3291  C  C     . ARG E 1 69  ? 4.019   -37.859 49.388 1.00 38.65  ? 69   ARG E C     1 
ATOM   3292  O  O     . ARG E 1 69  ? 3.548   -38.764 48.676 1.00 39.49  ? 69   ARG E O     1 
ATOM   3293  C  CB    . ARG E 1 69  ? 6.224   -38.139 50.510 1.00 38.97  ? 69   ARG E CB    1 
ATOM   3294  C  CG    . ARG E 1 69  ? 7.647   -38.544 50.242 1.00 39.59  ? 69   ARG E CG    1 
ATOM   3295  C  CD    . ARG E 1 69  ? 8.128   -39.473 51.368 1.00 40.60  ? 69   ARG E CD    1 
ATOM   3296  N  NE    . ARG E 1 69  ? 9.097   -38.818 52.246 1.00 43.65  ? 69   ARG E NE    1 
ATOM   3297  C  CZ    . ARG E 1 69  ? 8.884   -38.457 53.508 1.00 42.87  ? 69   ARG E CZ    1 
ATOM   3298  N  NH1   . ARG E 1 69  ? 7.729   -38.677 54.109 1.00 44.13  ? 69   ARG E NH1   1 
ATOM   3299  N  NH2   . ARG E 1 69  ? 9.855   -37.886 54.180 1.00 42.17  ? 69   ARG E NH2   1 
ATOM   3300  N  N     . LEU E 1 70  ? 3.294   -37.150 50.250 1.00 37.56  ? 70   LEU E N     1 
ATOM   3301  C  CA    . LEU E 1 70  ? 1.843   -37.286 50.349 1.00 37.30  ? 70   LEU E CA    1 
ATOM   3302  C  C     . LEU E 1 70  ? 1.139   -37.039 49.017 1.00 37.05  ? 70   LEU E C     1 
ATOM   3303  O  O     . LEU E 1 70  ? 0.277   -37.821 48.610 1.00 37.44  ? 70   LEU E O     1 
ATOM   3304  C  CB    . LEU E 1 70  ? 1.290   -36.354 51.428 1.00 37.17  ? 70   LEU E CB    1 
ATOM   3305  C  CG    . LEU E 1 70  ? -0.209  -36.490 51.724 1.00 37.87  ? 70   LEU E CG    1 
ATOM   3306  C  CD1   . LEU E 1 70  ? -0.590  -37.943 52.119 1.00 36.98  ? 70   LEU E CD1   1 
ATOM   3307  C  CD2   . LEU E 1 70  ? -0.624  -35.496 52.791 1.00 35.64  ? 70   LEU E CD2   1 
ATOM   3308  N  N     . VAL E 1 71  ? 1.525   -35.970 48.326 1.00 36.47  ? 71   VAL E N     1 
ATOM   3309  C  CA    . VAL E 1 71  ? 0.976   -35.679 47.008 1.00 35.75  ? 71   VAL E CA    1 
ATOM   3310  C  C     . VAL E 1 71  ? 1.214   -36.857 46.068 1.00 35.89  ? 71   VAL E C     1 
ATOM   3311  O  O     . VAL E 1 71  ? 0.270   -37.358 45.443 1.00 35.61  ? 71   VAL E O     1 
ATOM   3312  C  CB    . VAL E 1 71  ? 1.542   -34.357 46.419 1.00 35.22  ? 71   VAL E CB    1 
ATOM   3313  C  CG1   . VAL E 1 71  ? 1.171   -34.214 44.953 1.00 33.54  ? 71   VAL E CG1   1 
ATOM   3314  C  CG2   . VAL E 1 71  ? 1.035   -33.177 47.228 1.00 34.01  ? 71   VAL E CG2   1 
ATOM   3315  N  N     . ARG E 1 72  ? 2.470   -37.300 45.985 1.00 35.95  ? 72   ARG E N     1 
ATOM   3316  C  CA    . ARG E 1 72  ? 2.842   -38.420 45.100 1.00 36.10  ? 72   ARG E CA    1 
ATOM   3317  C  C     . ARG E 1 72  ? 2.116   -39.716 45.452 1.00 35.71  ? 72   ARG E C     1 
ATOM   3318  O  O     . ARG E 1 72  ? 1.637   -40.412 44.566 1.00 35.68  ? 72   ARG E O     1 
ATOM   3319  C  CB    . ARG E 1 72  ? 4.357   -38.634 45.070 1.00 36.06  ? 72   ARG E CB    1 
ATOM   3320  C  CG    . ARG E 1 72  ? 5.093   -37.509 44.368 1.00 37.99  ? 72   ARG E CG    1 
ATOM   3321  C  CD    . ARG E 1 72  ? 6.588   -37.665 44.467 1.00 41.29  ? 72   ARG E CD    1 
ATOM   3322  N  NE    . ARG E 1 72  ? 7.289   -36.427 44.135 1.00 44.40  ? 72   ARG E NE    1 
ATOM   3323  C  CZ    . ARG E 1 72  ? 7.544   -35.996 42.900 1.00 45.52  ? 72   ARG E CZ    1 
ATOM   3324  N  NH1   . ARG E 1 72  ? 7.150   -36.689 41.836 1.00 46.68  ? 72   ARG E NH1   1 
ATOM   3325  N  NH2   . ARG E 1 72  ? 8.187   -34.851 42.732 1.00 45.49  ? 72   ARG E NH2   1 
ATOM   3326  N  N     . GLU E 1 73  ? 2.024   -40.027 46.740 1.00 35.64  ? 73   GLU E N     1 
ATOM   3327  C  CA    . GLU E 1 73  ? 1.251   -41.175 47.177 1.00 35.87  ? 73   GLU E CA    1 
ATOM   3328  C  C     . GLU E 1 73  ? -0.201  -41.116 46.721 1.00 36.59  ? 73   GLU E C     1 
ATOM   3329  O  O     . GLU E 1 73  ? -0.705  -42.082 46.165 1.00 37.47  ? 73   GLU E O     1 
ATOM   3330  C  CB    . GLU E 1 73  ? 1.313   -41.337 48.699 1.00 36.06  ? 73   GLU E CB    1 
ATOM   3331  C  CG    . GLU E 1 73  ? 0.621   -42.615 49.210 1.00 34.77  ? 73   GLU E CG    1 
ATOM   3332  C  CD    . GLU E 1 73  ? 0.510   -42.665 50.711 1.00 35.25  ? 73   GLU E CD    1 
ATOM   3333  O  OE1   . GLU E 1 73  ? 1.537   -42.467 51.381 1.00 33.43  ? 73   GLU E OE1   1 
ATOM   3334  O  OE2   . GLU E 1 73  ? -0.611  -42.907 51.236 1.00 38.02  ? 73   GLU E OE2   1 
ATOM   3335  N  N     . ILE E 1 74  ? -0.877  -39.993 46.957 1.00 37.08  ? 74   ILE E N     1 
ATOM   3336  C  CA    . ILE E 1 74  ? -2.287  -39.846 46.561 1.00 37.08  ? 74   ILE E CA    1 
ATOM   3337  C  C     . ILE E 1 74  ? -2.452  -39.931 45.045 1.00 37.13  ? 74   ILE E C     1 
ATOM   3338  O  O     . ILE E 1 74  ? -3.362  -40.610 44.568 1.00 37.50  ? 74   ILE E O     1 
ATOM   3339  C  CB    . ILE E 1 74  ? -2.936  -38.535 47.142 1.00 37.07  ? 74   ILE E CB    1 
ATOM   3340  C  CG1   . ILE E 1 74  ? -3.071  -38.651 48.661 1.00 36.75  ? 74   ILE E CG1   1 
ATOM   3341  C  CG2   . ILE E 1 74  ? -4.317  -38.282 46.560 1.00 36.69  ? 74   ILE E CG2   1 
ATOM   3342  C  CD1   . ILE E 1 74  ? -3.132  -37.312 49.397 1.00 35.75  ? 74   ILE E CD1   1 
ATOM   3343  N  N     . ALA E 1 75  ? -1.588  -39.245 44.297 1.00 37.22  ? 75   ALA E N     1 
ATOM   3344  C  CA    . ALA E 1 75  ? -1.692  -39.210 42.840 1.00 37.77  ? 75   ALA E CA    1 
ATOM   3345  C  C     . ALA E 1 75  ? -1.494  -40.600 42.243 1.00 38.49  ? 75   ALA E C     1 
ATOM   3346  O  O     . ALA E 1 75  ? -2.183  -41.007 41.310 1.00 38.93  ? 75   ALA E O     1 
ATOM   3347  C  CB    . ALA E 1 75  ? -0.687  -38.231 42.256 1.00 37.56  ? 75   ALA E CB    1 
ATOM   3348  N  N     . GLN E 1 76  ? -0.553  -41.328 42.819 1.00 39.50  ? 76   GLN E N     1 
ATOM   3349  C  CA    . GLN E 1 76  ? -0.167  -42.642 42.337 1.00 40.54  ? 76   GLN E CA    1 
ATOM   3350  C  C     . GLN E 1 76  ? -1.312  -43.638 42.447 1.00 40.73  ? 76   GLN E C     1 
ATOM   3351  O  O     . GLN E 1 76  ? -1.546  -44.413 41.533 1.00 41.45  ? 76   GLN E O     1 
ATOM   3352  C  CB    . GLN E 1 76  ? 1.033   -43.134 43.117 1.00 40.34  ? 76   GLN E CB    1 
ATOM   3353  C  CG    . GLN E 1 76  ? 1.709   -44.337 42.504 1.00 41.81  ? 76   GLN E CG    1 
ATOM   3354  C  CD    . GLN E 1 76  ? 2.900   -44.769 43.330 1.00 43.03  ? 76   GLN E CD    1 
ATOM   3355  O  OE1   . GLN E 1 76  ? 2.781   -45.026 44.532 1.00 41.64  ? 76   GLN E OE1   1 
ATOM   3356  N  NE2   . GLN E 1 76  ? 4.062   -44.833 42.693 1.00 44.94  ? 76   GLN E NE2   1 
ATOM   3357  N  N     . ASP E 1 77  ? -2.032  -43.591 43.557 1.00 41.08  ? 77   ASP E N     1 
ATOM   3358  C  CA    . ASP E 1 77  ? -3.291  -44.292 43.689 1.00 41.51  ? 77   ASP E CA    1 
ATOM   3359  C  C     . ASP E 1 77  ? -4.367  -43.945 42.649 1.00 42.48  ? 77   ASP E C     1 
ATOM   3360  O  O     . ASP E 1 77  ? -5.280  -44.743 42.463 1.00 42.99  ? 77   ASP E O     1 
ATOM   3361  C  CB    . ASP E 1 77  ? -3.850  -44.085 45.093 1.00 41.20  ? 77   ASP E CB    1 
ATOM   3362  C  CG    . ASP E 1 77  ? -3.025  -44.789 46.159 1.00 41.50  ? 77   ASP E CG    1 
ATOM   3363  O  OD1   . ASP E 1 77  ? -2.274  -45.725 45.831 1.00 38.33  ? 77   ASP E OD1   1 
ATOM   3364  O  OD2   . ASP E 1 77  ? -3.143  -44.429 47.350 1.00 43.52  ? 77   ASP E OD2   1 
ATOM   3365  N  N     . PHE E 1 78  ? -4.298  -42.773 42.004 1.00 43.13  ? 78   PHE E N     1 
ATOM   3366  C  CA    . PHE E 1 78  ? -5.197  -42.489 40.888 1.00 44.26  ? 78   PHE E CA    1 
ATOM   3367  C  C     . PHE E 1 78  ? -4.608  -42.975 39.578 1.00 44.80  ? 78   PHE E C     1 
ATOM   3368  O  O     . PHE E 1 78  ? -5.332  -43.489 38.731 1.00 45.22  ? 78   PHE E O     1 
ATOM   3369  C  CB    . PHE E 1 78  ? -5.565  -40.996 40.779 1.00 44.52  ? 78   PHE E CB    1 
ATOM   3370  C  CG    . PHE E 1 78  ? -6.578  -40.547 41.797 1.00 45.72  ? 78   PHE E CG    1 
ATOM   3371  C  CD1   . PHE E 1 78  ? -6.243  -39.592 42.764 1.00 46.01  ? 78   PHE E CD1   1 
ATOM   3372  C  CD2   . PHE E 1 78  ? -7.867  -41.079 41.803 1.00 46.75  ? 78   PHE E CD2   1 
ATOM   3373  C  CE1   . PHE E 1 78  ? -7.169  -39.181 43.730 1.00 44.51  ? 78   PHE E CE1   1 
ATOM   3374  C  CE2   . PHE E 1 78  ? -8.814  -40.659 42.772 1.00 46.67  ? 78   PHE E CE2   1 
ATOM   3375  C  CZ    . PHE E 1 78  ? -8.455  -39.708 43.731 1.00 45.69  ? 78   PHE E CZ    1 
ATOM   3376  N  N     . LYS E 1 79  ? -3.300  -42.801 39.411 1.00 45.78  ? 79   LYS E N     1 
ATOM   3377  C  CA    . LYS E 1 79  ? -2.646  -43.092 38.150 1.00 46.89  ? 79   LYS E CA    1 
ATOM   3378  C  C     . LYS E 1 79  ? -1.132  -43.264 38.349 1.00 47.62  ? 79   LYS E C     1 
ATOM   3379  O  O     . LYS E 1 79  ? -0.450  -42.373 38.874 1.00 47.98  ? 79   LYS E O     1 
ATOM   3380  C  CB    . LYS E 1 79  ? -2.918  -41.950 37.164 1.00 46.92  ? 79   LYS E CB    1 
ATOM   3381  C  CG    . LYS E 1 79  ? -3.112  -42.373 35.735 1.00 47.99  ? 79   LYS E CG    1 
ATOM   3382  C  CD    . LYS E 1 79  ? -1.791  -42.559 35.003 1.00 50.11  ? 79   LYS E CD    1 
ATOM   3383  C  CE    . LYS E 1 79  ? -2.015  -43.339 33.718 1.00 50.54  ? 79   LYS E CE    1 
ATOM   3384  N  NZ    . LYS E 1 79  ? -0.799  -44.139 33.421 1.00 52.09  ? 79   LYS E NZ    1 
ATOM   3385  N  N     . THR E 1 80  ? -0.612  -44.404 37.902 1.00 48.00  ? 80   THR E N     1 
ATOM   3386  C  CA    . THR E 1 80  ? 0.808   -44.725 38.030 1.00 48.58  ? 80   THR E CA    1 
ATOM   3387  C  C     . THR E 1 80  ? 1.680   -43.961 37.040 1.00 48.95  ? 80   THR E C     1 
ATOM   3388  O  O     . THR E 1 80  ? 1.199   -43.489 36.001 1.00 49.42  ? 80   THR E O     1 
ATOM   3389  C  CB    . THR E 1 80  ? 1.069   -46.238 37.799 1.00 49.02  ? 80   THR E CB    1 
ATOM   3390  O  OG1   . THR E 1 80  ? 0.546   -46.637 36.518 1.00 48.37  ? 80   THR E OG1   1 
ATOM   3391  C  CG2   . THR E 1 80  ? 0.448   -47.079 38.912 1.00 48.29  ? 80   THR E CG2   1 
ATOM   3392  N  N     . ASP E 1 81  ? 2.965   -43.857 37.375 1.00 49.26  ? 81   ASP E N     1 
ATOM   3393  C  CA    . ASP E 1 81  ? 3.993   -43.285 36.496 1.00 50.04  ? 81   ASP E CA    1 
ATOM   3394  C  C     . ASP E 1 81  ? 3.769   -41.808 36.163 1.00 49.43  ? 81   ASP E C     1 
ATOM   3395  O  O     . ASP E 1 81  ? 4.072   -41.367 35.060 1.00 50.08  ? 81   ASP E O     1 
ATOM   3396  C  CB    . ASP E 1 81  ? 4.119   -44.110 35.205 1.00 50.77  ? 81   ASP E CB    1 
ATOM   3397  C  CG    . ASP E 1 81  ? 4.069   -45.611 35.463 1.00 54.32  ? 81   ASP E CG    1 
ATOM   3398  O  OD1   . ASP E 1 81  ? 3.038   -46.242 35.097 1.00 56.62  ? 81   ASP E OD1   1 
ATOM   3399  O  OD2   . ASP E 1 81  ? 5.046   -46.151 36.057 1.00 56.66  ? 81   ASP E OD2   1 
ATOM   3400  N  N     . LEU E 1 82  ? 3.231   -41.051 37.115 1.00 48.96  ? 82   LEU E N     1 
ATOM   3401  C  CA    . LEU E 1 82  ? 3.079   -39.610 36.951 1.00 48.21  ? 82   LEU E CA    1 
ATOM   3402  C  C     . LEU E 1 82  ? 4.309   -38.884 37.465 1.00 47.84  ? 82   LEU E C     1 
ATOM   3403  O  O     . LEU E 1 82  ? 4.936   -39.302 38.437 1.00 47.44  ? 82   LEU E O     1 
ATOM   3404  C  CB    . LEU E 1 82  ? 1.833   -39.089 37.676 1.00 47.98  ? 82   LEU E CB    1 
ATOM   3405  C  CG    . LEU E 1 82  ? 0.453   -39.428 37.097 1.00 47.79  ? 82   LEU E CG    1 
ATOM   3406  C  CD1   . LEU E 1 82  ? -0.621  -39.131 38.134 1.00 46.35  ? 82   LEU E CD1   1 
ATOM   3407  C  CD2   . LEU E 1 82  ? 0.164   -38.712 35.774 1.00 46.13  ? 82   LEU E CD2   1 
ATOM   3408  N  N     . ARG E 1 83  ? 4.643   -37.798 36.784 1.00 47.41  ? 83   ARG E N     1 
ATOM   3409  C  CA    . ARG E 1 83  ? 5.643   -36.858 37.248 1.00 47.23  ? 83   ARG E CA    1 
ATOM   3410  C  C     . ARG E 1 83  ? 4.940   -35.562 37.692 1.00 46.30  ? 83   ARG E C     1 
ATOM   3411  O  O     . ARG E 1 83  ? 3.770   -35.335 37.355 1.00 45.54  ? 83   ARG E O     1 
ATOM   3412  C  CB    . ARG E 1 83  ? 6.642   -36.585 36.116 1.00 47.53  ? 83   ARG E CB    1 
ATOM   3413  C  CG    . ARG E 1 83  ? 7.531   -37.770 35.795 1.00 50.18  ? 83   ARG E CG    1 
ATOM   3414  C  CD    . ARG E 1 83  ? 8.103   -37.686 34.380 1.00 54.66  ? 83   ARG E CD    1 
ATOM   3415  N  NE    . ARG E 1 83  ? 9.451   -38.261 34.319 1.00 59.18  ? 83   ARG E NE    1 
ATOM   3416  C  CZ    . ARG E 1 83  ? 10.580  -37.550 34.277 1.00 60.69  ? 83   ARG E CZ    1 
ATOM   3417  N  NH1   . ARG E 1 83  ? 10.556  -36.219 34.271 1.00 62.30  ? 83   ARG E NH1   1 
ATOM   3418  N  NH2   . ARG E 1 83  ? 11.745  -38.176 34.231 1.00 62.34  ? 83   ARG E NH2   1 
ATOM   3419  N  N     . PHE E 1 84  ? 5.662   -34.719 38.436 1.00 45.47  ? 84   PHE E N     1 
ATOM   3420  C  CA    . PHE E 1 84  ? 5.150   -33.421 38.876 1.00 44.21  ? 84   PHE E CA    1 
ATOM   3421  C  C     . PHE E 1 84  ? 6.159   -32.324 38.646 1.00 43.84  ? 84   PHE E C     1 
ATOM   3422  O  O     . PHE E 1 84  ? 7.326   -32.467 39.019 1.00 44.14  ? 84   PHE E O     1 
ATOM   3423  C  CB    . PHE E 1 84  ? 4.840   -33.449 40.367 1.00 43.80  ? 84   PHE E CB    1 
ATOM   3424  C  CG    . PHE E 1 84  ? 3.549   -34.103 40.710 1.00 43.22  ? 84   PHE E CG    1 
ATOM   3425  C  CD1   . PHE E 1 84  ? 3.469   -35.489 40.879 1.00 43.21  ? 84   PHE E CD1   1 
ATOM   3426  C  CD2   . PHE E 1 84  ? 2.408   -33.338 40.910 1.00 43.23  ? 84   PHE E CD2   1 
ATOM   3427  C  CE1   . PHE E 1 84  ? 2.259   -36.099 41.230 1.00 41.36  ? 84   PHE E CE1   1 
ATOM   3428  C  CE2   . PHE E 1 84  ? 1.195   -33.935 41.257 1.00 42.21  ? 84   PHE E CE2   1 
ATOM   3429  C  CZ    . PHE E 1 84  ? 1.120   -35.314 41.415 1.00 41.57  ? 84   PHE E CZ    1 
ATOM   3430  N  N     . GLN E 1 85  ? 5.707   -31.214 38.062 1.00 43.17  ? 85   GLN E N     1 
ATOM   3431  C  CA    . GLN E 1 85  ? 6.509   -29.999 38.048 1.00 42.20  ? 85   GLN E CA    1 
ATOM   3432  C  C     . GLN E 1 85  ? 6.599   -29.580 39.495 1.00 41.57  ? 85   GLN E C     1 
ATOM   3433  O  O     . GLN E 1 85  ? 5.641   -29.765 40.238 1.00 41.65  ? 85   GLN E O     1 
ATOM   3434  C  CB    . GLN E 1 85  ? 5.824   -28.912 37.232 1.00 42.44  ? 85   GLN E CB    1 
ATOM   3435  C  CG    . GLN E 1 85  ? 5.646   -29.235 35.763 1.00 42.60  ? 85   GLN E CG    1 
ATOM   3436  C  CD    . GLN E 1 85  ? 5.144   -28.041 34.960 1.00 45.46  ? 85   GLN E CD    1 
ATOM   3437  O  OE1   . GLN E 1 85  ? 4.505   -27.132 35.499 1.00 46.01  ? 85   GLN E OE1   1 
ATOM   3438  N  NE2   . GLN E 1 85  ? 5.430   -28.041 33.658 1.00 46.62  ? 85   GLN E NE2   1 
ATOM   3439  N  N     . SER E 1 86  ? 7.734   -29.040 39.922 1.00 40.72  ? 86   SER E N     1 
ATOM   3440  C  CA    . SER E 1 86  ? 7.849   -28.652 41.321 1.00 40.36  ? 86   SER E CA    1 
ATOM   3441  C  C     . SER E 1 86  ? 6.843   -27.562 41.677 1.00 39.52  ? 86   SER E C     1 
ATOM   3442  O  O     . SER E 1 86  ? 6.303   -27.562 42.782 1.00 39.78  ? 86   SER E O     1 
ATOM   3443  C  CB    . SER E 1 86  ? 9.272   -28.253 41.693 1.00 40.20  ? 86   SER E CB    1 
ATOM   3444  O  OG    . SER E 1 86  ? 9.742   -27.245 40.830 1.00 43.87  ? 86   SER E OG    1 
ATOM   3445  N  N     . SER E 1 87  ? 6.566   -26.658 40.743 1.00 38.34  ? 87   SER E N     1 
ATOM   3446  C  CA    . SER E 1 87  ? 5.564   -25.619 40.985 1.00 37.97  ? 87   SER E CA    1 
ATOM   3447  C  C     . SER E 1 87  ? 4.130   -26.187 41.116 1.00 37.35  ? 87   SER E C     1 
ATOM   3448  O  O     . SER E 1 87  ? 3.278   -25.576 41.755 1.00 36.97  ? 87   SER E O     1 
ATOM   3449  C  CB    . SER E 1 87  ? 5.623   -24.527 39.928 1.00 37.51  ? 87   SER E CB    1 
ATOM   3450  O  OG    . SER E 1 87  ? 5.212   -25.042 38.666 1.00 41.90  ? 87   SER E OG    1 
ATOM   3451  N  N     . ALA E 1 88  ? 3.874   -27.362 40.540 1.00 36.86  ? 88   ALA E N     1 
ATOM   3452  C  CA    . ALA E 1 88  ? 2.602   -28.059 40.766 1.00 36.17  ? 88   ALA E CA    1 
ATOM   3453  C  C     . ALA E 1 88  ? 2.448   -28.476 42.215 1.00 36.11  ? 88   ALA E C     1 
ATOM   3454  O  O     . ALA E 1 88  ? 1.358   -28.349 42.800 1.00 36.79  ? 88   ALA E O     1 
ATOM   3455  C  CB    . ALA E 1 88  ? 2.481   -29.254 39.873 1.00 36.35  ? 88   ALA E CB    1 
ATOM   3456  N  N     . VAL E 1 89  ? 3.540   -28.943 42.813 1.00 35.79  ? 89   VAL E N     1 
ATOM   3457  C  CA    . VAL E 1 89  ? 3.509   -29.399 44.207 1.00 35.31  ? 89   VAL E CA    1 
ATOM   3458  C  C     . VAL E 1 89  ? 3.354   -28.217 45.130 1.00 35.40  ? 89   VAL E C     1 
ATOM   3459  O  O     . VAL E 1 89  ? 2.650   -28.304 46.135 1.00 35.65  ? 89   VAL E O     1 
ATOM   3460  C  CB    . VAL E 1 89  ? 4.767   -30.235 44.620 1.00 34.86  ? 89   VAL E CB    1 
ATOM   3461  C  CG1   . VAL E 1 89  ? 4.663   -30.694 46.052 1.00 34.32  ? 89   VAL E CG1   1 
ATOM   3462  C  CG2   . VAL E 1 89  ? 4.919   -31.439 43.746 1.00 34.79  ? 89   VAL E CG2   1 
ATOM   3463  N  N     . MET E 1 90  ? 4.013   -27.115 44.783 1.00 35.78  ? 90   MET E N     1 
ATOM   3464  C  CA    . MET E 1 90  ? 3.977   -25.909 45.597 1.00 35.72  ? 90   MET E CA    1 
ATOM   3465  C  C     . MET E 1 90  ? 2.579   -25.287 45.534 1.00 34.75  ? 90   MET E C     1 
ATOM   3466  O  O     . MET E 1 90  ? 2.064   -24.811 46.552 1.00 34.53  ? 90   MET E O     1 
ATOM   3467  C  CB    . MET E 1 90  ? 5.069   -24.929 45.168 1.00 36.49  ? 90   MET E CB    1 
ATOM   3468  C  CG    . MET E 1 90  ? 6.523   -25.447 45.370 1.00 40.01  ? 90   MET E CG    1 
ATOM   3469  S  SD    . MET E 1 90  ? 6.874   -26.080 47.043 1.00 49.79  ? 90   MET E SD    1 
ATOM   3470  C  CE    . MET E 1 90  ? 6.664   -24.589 48.029 1.00 49.07  ? 90   MET E CE    1 
ATOM   3471  N  N     . ALA E 1 91  ? 1.959   -25.345 44.355 1.00 33.30  ? 91   ALA E N     1 
ATOM   3472  C  CA    . ALA E 1 91  ? 0.600   -24.843 44.168 1.00 32.48  ? 91   ALA E CA    1 
ATOM   3473  C  C     . ALA E 1 91  ? -0.352  -25.565 45.109 1.00 31.87  ? 91   ALA E C     1 
ATOM   3474  O  O     . ALA E 1 91  ? -1.134  -24.935 45.820 1.00 31.81  ? 91   ALA E O     1 
ATOM   3475  C  CB    . ALA E 1 91  ? 0.145   -24.990 42.699 1.00 31.67  ? 91   ALA E CB    1 
ATOM   3476  N  N     . LEU E 1 92  ? -0.251  -26.895 45.132 1.00 31.64  ? 92   LEU E N     1 
ATOM   3477  C  CA    . LEU E 1 92  ? -1.074  -27.725 46.007 1.00 30.39  ? 92   LEU E CA    1 
ATOM   3478  C  C     . LEU E 1 92  ? -0.772  -27.420 47.442 1.00 30.14  ? 92   LEU E C     1 
ATOM   3479  O  O     . LEU E 1 92  ? -1.683  -27.420 48.276 1.00 30.86  ? 92   LEU E O     1 
ATOM   3480  C  CB    . LEU E 1 92  ? -0.857  -29.227 45.742 1.00 30.96  ? 92   LEU E CB    1 
ATOM   3481  C  CG    . LEU E 1 92  ? -1.356  -29.806 44.407 1.00 30.21  ? 92   LEU E CG    1 
ATOM   3482  C  CD1   . LEU E 1 92  ? -0.644  -31.088 44.003 1.00 32.15  ? 92   LEU E CD1   1 
ATOM   3483  C  CD2   . LEU E 1 92  ? -2.842  -30.006 44.410 1.00 28.43  ? 92   LEU E CD2   1 
ATOM   3484  N  N     . GLN E 1 93  ? 0.493   -27.142 47.754 1.00 29.34  ? 93   GLN E N     1 
ATOM   3485  C  CA    . GLN E 1 93  ? 0.817   -26.796 49.126 1.00 28.52  ? 93   GLN E CA    1 
ATOM   3486  C  C     . GLN E 1 93  ? 0.214   -25.474 49.562 1.00 28.90  ? 93   GLN E C     1 
ATOM   3487  O  O     . GLN E 1 93  ? -0.360  -25.410 50.655 1.00 28.95  ? 93   GLN E O     1 
ATOM   3488  C  CB    . GLN E 1 93  ? 2.319   -26.854 49.443 1.00 28.16  ? 93   GLN E CB    1 
ATOM   3489  C  CG    . GLN E 1 93  ? 2.540   -27.228 50.927 1.00 27.97  ? 93   GLN E CG    1 
ATOM   3490  C  CD    . GLN E 1 93  ? 3.982   -27.300 51.348 1.00 29.40  ? 93   GLN E CD    1 
ATOM   3491  O  OE1   . GLN E 1 93  ? 4.864   -27.648 50.562 1.00 29.20  ? 93   GLN E OE1   1 
ATOM   3492  N  NE2   . GLN E 1 93  ? 4.238   -26.962 52.607 1.00 30.30  ? 93   GLN E NE2   1 
ATOM   3493  N  N     . GLU E 1 94  ? 0.354   -24.430 48.730 1.00 28.53  ? 94   GLU E N     1 
ATOM   3494  C  CA    . GLU E 1 94  ? -0.211  -23.122 49.037 1.00 28.61  ? 94   GLU E CA    1 
ATOM   3495  C  C     . GLU E 1 94  ? -1.727  -23.266 49.207 1.00 28.09  ? 94   GLU E C     1 
ATOM   3496  O  O     . GLU E 1 94  ? -2.313  -22.706 50.136 1.00 28.10  ? 94   GLU E O     1 
ATOM   3497  C  CB    . GLU E 1 94  ? 0.108   -22.088 47.925 1.00 28.77  ? 94   GLU E CB    1 
ATOM   3498  C  CG    . GLU E 1 94  ? 1.567   -21.600 47.856 1.00 29.84  ? 94   GLU E CG    1 
ATOM   3499  C  CD    . GLU E 1 94  ? 1.980   -20.672 49.004 1.00 33.06  ? 94   GLU E CD    1 
ATOM   3500  O  OE1   . GLU E 1 94  ? 1.104   -20.065 49.677 1.00 32.36  ? 94   GLU E OE1   1 
ATOM   3501  O  OE2   . GLU E 1 94  ? 3.213   -20.533 49.215 1.00 35.30  ? 94   GLU E OE2   1 
ATOM   3502  N  N     . ALA E 1 95  ? -2.360  -24.029 48.324 1.00 27.32  ? 95   ALA E N     1 
ATOM   3503  C  CA    . ALA E 1 95  ? -3.820  -24.167 48.385 1.00 27.32  ? 95   ALA E CA    1 
ATOM   3504  C  C     . ALA E 1 95  ? -4.243  -24.915 49.636 1.00 27.39  ? 95   ALA E C     1 
ATOM   3505  O  O     . ALA E 1 95  ? -5.177  -24.507 50.299 1.00 28.17  ? 95   ALA E O     1 
ATOM   3506  C  CB    . ALA E 1 95  ? -4.364  -24.858 47.122 1.00 27.24  ? 95   ALA E CB    1 
ATOM   3507  N  N     . SER E 1 96  ? -3.529  -25.988 49.984 1.00 27.23  ? 96   SER E N     1 
ATOM   3508  C  CA    . SER E 1 96  ? -3.913  -26.825 51.127 1.00 27.63  ? 96   SER E CA    1 
ATOM   3509  C  C     . SER E 1 96  ? -3.692  -26.118 52.431 1.00 27.57  ? 96   SER E C     1 
ATOM   3510  O  O     . SER E 1 96  ? -4.547  -26.202 53.323 1.00 27.80  ? 96   SER E O     1 
ATOM   3511  C  CB    . SER E 1 96  ? -3.153  -28.179 51.174 1.00 27.40  ? 96   SER E CB    1 
ATOM   3512  O  OG    . SER E 1 96  ? -3.141  -28.827 49.915 1.00 27.71  ? 96   SER E OG    1 
ATOM   3513  N  N     . GLU E 1 97  ? -2.540  -25.460 52.560 1.00 27.66  ? 97   GLU E N     1 
ATOM   3514  C  CA    . GLU E 1 97  ? -2.289  -24.595 53.726 1.00 29.13  ? 97   GLU E CA    1 
ATOM   3515  C  C     . GLU E 1 97  ? -3.300  -23.447 53.853 1.00 28.45  ? 97   GLU E C     1 
ATOM   3516  O  O     . GLU E 1 97  ? -3.771  -23.163 54.945 1.00 30.10  ? 97   GLU E O     1 
ATOM   3517  C  CB    . GLU E 1 97  ? -0.825  -24.098 53.804 1.00 28.86  ? 97   GLU E CB    1 
ATOM   3518  C  CG    . GLU E 1 97  ? 0.207   -25.264 53.836 1.00 31.45  ? 97   GLU E CG    1 
ATOM   3519  C  CD    . GLU E 1 97  ? 1.542   -24.932 54.561 1.00 33.90  ? 97   GLU E CD    1 
ATOM   3520  O  OE1   . GLU E 1 97  ? 1.637   -23.904 55.282 1.00 34.31  ? 97   GLU E OE1   1 
ATOM   3521  O  OE2   . GLU E 1 97  ? 2.499   -25.727 54.421 1.00 33.50  ? 97   GLU E OE2   1 
ATOM   3522  N  N     . ALA E 1 98  ? -3.664  -22.784 52.777 1.00 28.08  ? 98   ALA E N     1 
ATOM   3523  C  CA    . ALA E 1 98  ? -4.661  -21.713 52.953 1.00 28.99  ? 98   ALA E CA    1 
ATOM   3524  C  C     . ALA E 1 98  ? -6.034  -22.299 53.272 1.00 29.06  ? 98   ALA E C     1 
ATOM   3525  O  O     . ALA E 1 98  ? -6.791  -21.726 54.052 1.00 30.03  ? 98   ALA E O     1 
ATOM   3526  C  CB    . ALA E 1 98  ? -4.718  -20.783 51.747 1.00 28.81  ? 98   ALA E CB    1 
ATOM   3527  N  N     . TYR E 1 99  ? -6.335  -23.480 52.741 1.00 29.50  ? 99   TYR E N     1 
ATOM   3528  C  CA    . TYR E 1 99  ? -7.593  -24.157 53.110 1.00 29.20  ? 99   TYR E CA    1 
ATOM   3529  C  C     . TYR E 1 99  ? -7.625  -24.558 54.587 1.00 29.43  ? 99   TYR E C     1 
ATOM   3530  O  O     . TYR E 1 99  ? -8.622  -24.318 55.290 1.00 30.08  ? 99   TYR E O     1 
ATOM   3531  C  CB    . TYR E 1 99  ? -7.865  -25.332 52.184 1.00 29.47  ? 99   TYR E CB    1 
ATOM   3532  C  CG    . TYR E 1 99  ? -8.980  -26.239 52.661 1.00 30.69  ? 99   TYR E CG    1 
ATOM   3533  C  CD1   . TYR E 1 99  ? -10.330 -25.956 52.366 1.00 30.03  ? 99   TYR E CD1   1 
ATOM   3534  C  CD2   . TYR E 1 99  ? -8.688  -27.388 53.391 1.00 28.40  ? 99   TYR E CD2   1 
ATOM   3535  C  CE1   . TYR E 1 99  ? -11.350 -26.787 52.834 1.00 29.41  ? 99   TYR E CE1   1 
ATOM   3536  C  CE2   . TYR E 1 99  ? -9.685  -28.222 53.846 1.00 29.68  ? 99   TYR E CE2   1 
ATOM   3537  C  CZ    . TYR E 1 99  ? -11.012 -27.927 53.570 1.00 30.38  ? 99   TYR E CZ    1 
ATOM   3538  O  OH    . TYR E 1 99  ? -11.975 -28.789 54.047 1.00 29.03  ? 99   TYR E OH    1 
ATOM   3539  N  N     . LEU E 1 100 ? -6.519  -25.101 55.094 1.00 29.43  ? 100  LEU E N     1 
ATOM   3540  C  CA    . LEU E 1 100 ? -6.485  -25.519 56.489 1.00 29.31  ? 100  LEU E CA    1 
ATOM   3541  C  C     . LEU E 1 100 ? -6.517  -24.372 57.493 1.00 29.03  ? 100  LEU E C     1 
ATOM   3542  O  O     . LEU E 1 100 ? -7.220  -24.447 58.507 1.00 29.24  ? 100  LEU E O     1 
ATOM   3543  C  CB    . LEU E 1 100 ? -5.322  -26.476 56.760 1.00 29.77  ? 100  LEU E CB    1 
ATOM   3544  C  CG    . LEU E 1 100 ? -5.340  -27.892 56.124 1.00 31.00  ? 100  LEU E CG    1 
ATOM   3545  C  CD1   . LEU E 1 100 ? -4.028  -28.674 56.404 1.00 26.98  ? 100  LEU E CD1   1 
ATOM   3546  C  CD2   . LEU E 1 100 ? -6.584  -28.726 56.527 1.00 29.03  ? 100  LEU E CD2   1 
ATOM   3547  N  N     . VAL E 1 101 ? -5.767  -23.301 57.213 1.00 28.89  ? 101  VAL E N     1 
ATOM   3548  C  CA    . VAL E 1 101 ? -5.813  -22.071 58.047 1.00 27.57  ? 101  VAL E CA    1 
ATOM   3549  C  C     . VAL E 1 101 ? -7.249  -21.530 58.147 1.00 26.60  ? 101  VAL E C     1 
ATOM   3550  O  O     . VAL E 1 101 ? -7.760  -21.312 59.229 1.00 26.82  ? 101  VAL E O     1 
ATOM   3551  C  CB    . VAL E 1 101 ? -4.812  -21.012 57.539 1.00 27.83  ? 101  VAL E CB    1 
ATOM   3552  C  CG1   . VAL E 1 101 ? -4.971  -19.704 58.283 1.00 27.55  ? 101  VAL E CG1   1 
ATOM   3553  C  CG2   . VAL E 1 101 ? -3.355  -21.542 57.665 1.00 27.88  ? 101  VAL E CG2   1 
ATOM   3554  N  N     . ALA E 1 102 ? -7.921  -21.385 57.021 1.00 26.28  ? 102  ALA E N     1 
ATOM   3555  C  CA    . ALA E 1 102 ? -9.277  -20.834 57.007 1.00 26.27  ? 102  ALA E CA    1 
ATOM   3556  C  C     . ALA E 1 102 ? -10.285 -21.739 57.716 1.00 26.95  ? 102  ALA E C     1 
ATOM   3557  O  O     . ALA E 1 102 ? -11.170 -21.254 58.431 1.00 28.93  ? 102  ALA E O     1 
ATOM   3558  C  CB    . ALA E 1 102 ? -9.706  -20.512 55.574 1.00 24.90  ? 102  ALA E CB    1 
ATOM   3559  N  N     . LEU E 1 103 ? -10.131 -23.050 57.571 1.00 27.69  ? 103  LEU E N     1 
ATOM   3560  C  CA    . LEU E 1 103 ? -10.922 -24.022 58.325 1.00 27.55  ? 103  LEU E CA    1 
ATOM   3561  C  C     . LEU E 1 103 ? -10.669 -23.935 59.810 1.00 28.25  ? 103  LEU E C     1 
ATOM   3562  O  O     . LEU E 1 103 ? -11.617 -23.976 60.622 1.00 28.18  ? 103  LEU E O     1 
ATOM   3563  C  CB    . LEU E 1 103 ? -10.639 -25.447 57.833 1.00 27.95  ? 103  LEU E CB    1 
ATOM   3564  C  CG    . LEU E 1 103 ? -11.443 -26.555 58.505 1.00 28.06  ? 103  LEU E CG    1 
ATOM   3565  C  CD1   . LEU E 1 103 ? -12.917 -26.372 58.215 1.00 28.61  ? 103  LEU E CD1   1 
ATOM   3566  C  CD2   . LEU E 1 103 ? -10.982 -27.929 58.054 1.00 27.40  ? 103  LEU E CD2   1 
ATOM   3567  N  N     . PHE E 1 104 ? -9.405  -23.789 60.203 1.00 29.23  ? 104  PHE E N     1 
ATOM   3568  C  CA    . PHE E 1 104 ? -9.142  -23.625 61.629 1.00 30.55  ? 104  PHE E CA    1 
ATOM   3569  C  C     . PHE E 1 104 ? -9.801  -22.377 62.214 1.00 31.62  ? 104  PHE E C     1 
ATOM   3570  O  O     . PHE E 1 104 ? -10.212 -22.391 63.385 1.00 32.47  ? 104  PHE E O     1 
ATOM   3571  C  CB    . PHE E 1 104 ? -7.663  -23.667 61.967 1.00 30.64  ? 104  PHE E CB    1 
ATOM   3572  C  CG    . PHE E 1 104 ? -7.087  -25.062 62.033 1.00 31.26  ? 104  PHE E CG    1 
ATOM   3573  C  CD1   . PHE E 1 104 ? -6.000  -25.409 61.234 1.00 30.41  ? 104  PHE E CD1   1 
ATOM   3574  C  CD2   . PHE E 1 104 ? -7.600  -26.016 62.917 1.00 31.13  ? 104  PHE E CD2   1 
ATOM   3575  C  CE1   . PHE E 1 104 ? -5.448  -26.688 61.288 1.00 30.40  ? 104  PHE E CE1   1 
ATOM   3576  C  CE2   . PHE E 1 104 ? -7.027  -27.307 62.996 1.00 29.54  ? 104  PHE E CE2   1 
ATOM   3577  C  CZ    . PHE E 1 104 ? -5.961  -27.636 62.169 1.00 30.45  ? 104  PHE E CZ    1 
ATOM   3578  N  N     . GLU E 1 105 ? -9.924  -21.309 61.423 1.00 32.16  ? 105  GLU E N     1 
ATOM   3579  C  CA    . GLU E 1 105 ? -10.589 -20.091 61.923 1.00 33.21  ? 105  GLU E CA    1 
ATOM   3580  C  C     . GLU E 1 105 ? -12.066 -20.363 62.155 1.00 32.74  ? 105  GLU E C     1 
ATOM   3581  O  O     . GLU E 1 105 ? -12.597 -20.016 63.195 1.00 32.32  ? 105  GLU E O     1 
ATOM   3582  C  CB    . GLU E 1 105 ? -10.454 -18.900 60.952 1.00 33.63  ? 105  GLU E CB    1 
ATOM   3583  C  CG    . GLU E 1 105 ? -9.038  -18.482 60.631 1.00 36.10  ? 105  GLU E CG    1 
ATOM   3584  C  CD    . GLU E 1 105 ? -8.948  -17.702 59.330 1.00 42.45  ? 105  GLU E CD    1 
ATOM   3585  O  OE1   . GLU E 1 105 ? -10.021 -17.411 58.727 1.00 44.90  ? 105  GLU E OE1   1 
ATOM   3586  O  OE2   . GLU E 1 105 ? -7.808  -17.381 58.903 1.00 44.22  ? 105  GLU E OE2   1 
ATOM   3587  N  N     . ASP E 1 106 ? -12.722 -20.993 61.178 1.00 32.78  ? 106  ASP E N     1 
ATOM   3588  C  CA    . ASP E 1 106 ? -14.124 -21.385 61.329 1.00 32.43  ? 106  ASP E CA    1 
ATOM   3589  C  C     . ASP E 1 106 ? -14.312 -22.296 62.534 1.00 31.94  ? 106  ASP E C     1 
ATOM   3590  O  O     . ASP E 1 106 ? -15.299 -22.159 63.271 1.00 31.34  ? 106  ASP E O     1 
ATOM   3591  C  CB    . ASP E 1 106 ? -14.637 -22.064 60.063 1.00 33.18  ? 106  ASP E CB    1 
ATOM   3592  C  CG    . ASP E 1 106 ? -14.803 -21.100 58.906 1.00 34.42  ? 106  ASP E CG    1 
ATOM   3593  O  OD1   . ASP E 1 106 ? -14.510 -19.901 59.093 1.00 37.59  ? 106  ASP E OD1   1 
ATOM   3594  O  OD2   . ASP E 1 106 ? -15.227 -21.531 57.804 1.00 37.45  ? 106  ASP E OD2   1 
ATOM   3595  N  N     . THR E 1 107 ? -13.339 -23.196 62.741 1.00 31.37  ? 107  THR E N     1 
ATOM   3596  C  CA    . THR E 1 107 ? -13.400 -24.212 63.806 1.00 30.50  ? 107  THR E CA    1 
ATOM   3597  C  C     . THR E 1 107 ? -13.320 -23.515 65.137 1.00 30.50  ? 107  THR E C     1 
ATOM   3598  O  O     . THR E 1 107 ? -14.086 -23.827 66.067 1.00 30.81  ? 107  THR E O     1 
ATOM   3599  C  CB    . THR E 1 107 ? -12.248 -25.255 63.687 1.00 30.36  ? 107  THR E CB    1 
ATOM   3600  O  OG1   . THR E 1 107 ? -12.369 -25.975 62.463 1.00 29.76  ? 107  THR E OG1   1 
ATOM   3601  C  CG2   . THR E 1 107 ? -12.260 -26.231 64.822 1.00 28.23  ? 107  THR E CG2   1 
ATOM   3602  N  N     . ASN E 1 108 ? -12.397 -22.563 65.218 1.00 30.32  ? 108  ASN E N     1 
ATOM   3603  C  CA    . ASN E 1 108 ? -12.200 -21.760 66.427 1.00 30.56  ? 108  ASN E CA    1 
ATOM   3604  C  C     . ASN E 1 108 ? -13.483 -21.035 66.834 1.00 30.23  ? 108  ASN E C     1 
ATOM   3605  O  O     . ASN E 1 108 ? -13.836 -20.985 68.009 1.00 29.95  ? 108  ASN E O     1 
ATOM   3606  C  CB    . ASN E 1 108 ? -11.060 -20.768 66.223 1.00 30.40  ? 108  ASN E CB    1 
ATOM   3607  C  CG    . ASN E 1 108 ? -10.361 -20.431 67.509 1.00 32.16  ? 108  ASN E CG    1 
ATOM   3608  O  OD1   . ASN E 1 108 ? -10.466 -21.170 68.492 1.00 36.33  ? 108  ASN E OD1   1 
ATOM   3609  N  ND2   . ASN E 1 108 ? -9.666  -19.309 67.531 1.00 29.42  ? 108  ASN E ND2   1 
ATOM   3610  N  N     . LEU E 1 109 ? -14.193 -20.519 65.838 1.00 30.92  ? 109  LEU E N     1 
ATOM   3611  C  CA    . LEU E 1 109 ? -15.485 -19.853 66.052 1.00 31.68  ? 109  LEU E CA    1 
ATOM   3612  C  C     . LEU E 1 109 ? -16.546 -20.796 66.570 1.00 31.34  ? 109  LEU E C     1 
ATOM   3613  O  O     . LEU E 1 109 ? -17.317 -20.415 67.433 1.00 31.58  ? 109  LEU E O     1 
ATOM   3614  C  CB    . LEU E 1 109 ? -15.974 -19.167 64.776 1.00 31.28  ? 109  LEU E CB    1 
ATOM   3615  C  CG    . LEU E 1 109 ? -15.236 -17.900 64.355 1.00 32.69  ? 109  LEU E CG    1 
ATOM   3616  C  CD1   . LEU E 1 109 ? -15.835 -17.416 63.047 1.00 32.34  ? 109  LEU E CD1   1 
ATOM   3617  C  CD2   . LEU E 1 109 ? -15.266 -16.785 65.420 1.00 31.08  ? 109  LEU E CD2   1 
ATOM   3618  N  N     . CYS E 1 110 ? -16.567 -22.028 66.058 1.00 31.84  ? 110  CYS E N     1 
ATOM   3619  C  CA    . CYS E 1 110 ? -17.491 -23.047 66.555 1.00 31.95  ? 110  CYS E CA    1 
ATOM   3620  C  C     . CYS E 1 110 ? -17.208 -23.430 68.006 1.00 32.16  ? 110  CYS E C     1 
ATOM   3621  O  O     . CYS E 1 110 ? -18.146 -23.571 68.798 1.00 32.61  ? 110  CYS E O     1 
ATOM   3622  C  CB    . CYS E 1 110 ? -17.519 -24.278 65.642 1.00 32.01  ? 110  CYS E CB    1 
ATOM   3623  S  SG    . CYS E 1 110 ? -18.120 -23.928 63.989 1.00 32.67  ? 110  CYS E SG    1 
ATOM   3624  N  N     . ALA E 1 111 ? -15.934 -23.584 68.365 1.00 32.17  ? 111  ALA E N     1 
ATOM   3625  C  CA    . ALA E 1 111 ? -15.563 -23.833 69.772 1.00 32.42  ? 111  ALA E CA    1 
ATOM   3626  C  C     . ALA E 1 111 ? -16.021 -22.697 70.677 1.00 33.11  ? 111  ALA E C     1 
ATOM   3627  O  O     . ALA E 1 111 ? -16.615 -22.927 71.731 1.00 33.47  ? 111  ALA E O     1 
ATOM   3628  C  CB    . ALA E 1 111 ? -14.055 -24.028 69.920 1.00 32.20  ? 111  ALA E CB    1 
ATOM   3629  N  N     . ILE E 1 112 ? -15.735 -21.463 70.263 1.00 33.87  ? 112  ILE E N     1 
ATOM   3630  C  CA    . ILE E 1 112 ? -16.054 -20.277 71.065 1.00 34.06  ? 112  ILE E CA    1 
ATOM   3631  C  C     . ILE E 1 112 ? -17.555 -20.159 71.239 1.00 34.80  ? 112  ILE E C     1 
ATOM   3632  O  O     . ILE E 1 112 ? -18.030 -19.860 72.336 1.00 34.97  ? 112  ILE E O     1 
ATOM   3633  C  CB    . ILE E 1 112 ? -15.395 -18.976 70.489 1.00 33.86  ? 112  ILE E CB    1 
ATOM   3634  C  CG1   . ILE E 1 112 ? -13.894 -18.980 70.785 1.00 34.14  ? 112  ILE E CG1   1 
ATOM   3635  C  CG2   . ILE E 1 112 ? -15.962 -17.719 71.129 1.00 32.78  ? 112  ILE E CG2   1 
ATOM   3636  C  CD1   . ILE E 1 112 ? -13.062 -18.184 69.796 1.00 33.61  ? 112  ILE E CD1   1 
ATOM   3637  N  N     . HIS E 1 113 ? -18.301 -20.460 70.175 1.00 35.88  ? 113  HIS E N     1 
ATOM   3638  C  CA    . HIS E 1 113 ? -19.770 -20.526 70.242 1.00 36.69  ? 113  HIS E CA    1 
ATOM   3639  C  C     . HIS E 1 113 ? -20.232 -21.467 71.349 1.00 37.50  ? 113  HIS E C     1 
ATOM   3640  O  O     . HIS E 1 113 ? -21.264 -21.223 71.985 1.00 38.28  ? 113  HIS E O     1 
ATOM   3641  C  CB    . HIS E 1 113 ? -20.331 -20.992 68.906 1.00 36.18  ? 113  HIS E CB    1 
ATOM   3642  C  CG    . HIS E 1 113 ? -21.825 -20.959 68.827 1.00 36.85  ? 113  HIS E CG    1 
ATOM   3643  N  ND1   . HIS E 1 113 ? -22.540 -19.783 68.727 1.00 37.07  ? 113  HIS E ND1   1 
ATOM   3644  C  CD2   . HIS E 1 113 ? -22.737 -21.961 68.782 1.00 35.90  ? 113  HIS E CD2   1 
ATOM   3645  C  CE1   . HIS E 1 113 ? -23.830 -20.060 68.644 1.00 36.36  ? 113  HIS E CE1   1 
ATOM   3646  N  NE2   . HIS E 1 113 ? -23.977 -21.375 68.679 1.00 36.46  ? 113  HIS E NE2   1 
ATOM   3647  N  N     . ALA E 1 114 ? -19.465 -22.541 71.568 1.00 37.99  ? 114  ALA E N     1 
ATOM   3648  C  CA    . ALA E 1 114 ? -19.790 -23.536 72.587 1.00 38.39  ? 114  ALA E CA    1 
ATOM   3649  C  C     . ALA E 1 114 ? -19.249 -23.137 73.940 1.00 38.82  ? 114  ALA E C     1 
ATOM   3650  O  O     . ALA E 1 114 ? -19.323 -23.904 74.894 1.00 39.39  ? 114  ALA E O     1 
ATOM   3651  C  CB    . ALA E 1 114 ? -19.257 -24.884 72.186 1.00 38.58  ? 114  ALA E CB    1 
ATOM   3652  N  N     . LYS E 1 115 ? -18.711 -21.919 74.023 1.00 39.61  ? 115  LYS E N     1 
ATOM   3653  C  CA    . LYS E 1 115 ? -18.150 -21.368 75.266 1.00 39.54  ? 115  LYS E CA    1 
ATOM   3654  C  C     . LYS E 1 115 ? -16.872 -22.088 75.702 1.00 39.00  ? 115  LYS E C     1 
ATOM   3655  O  O     . LYS E 1 115 ? -16.548 -22.157 76.884 1.00 39.25  ? 115  LYS E O     1 
ATOM   3656  C  CB    . LYS E 1 115 ? -19.207 -21.363 76.374 1.00 40.06  ? 115  LYS E CB    1 
ATOM   3657  C  CG    . LYS E 1 115 ? -20.427 -20.488 76.044 1.00 42.63  ? 115  LYS E CG    1 
ATOM   3658  C  CD    . LYS E 1 115 ? -21.474 -20.580 77.143 1.00 47.13  ? 115  LYS E CD    1 
ATOM   3659  C  CE    . LYS E 1 115 ? -22.578 -19.542 76.945 1.00 50.88  ? 115  LYS E CE    1 
ATOM   3660  N  NZ    . LYS E 1 115 ? -23.312 -19.344 78.242 1.00 54.64  ? 115  LYS E NZ    1 
ATOM   3661  N  N     . ARG E 1 116 ? -16.153 -22.631 74.728 1.00 38.27  ? 116  ARG E N     1 
ATOM   3662  C  CA    . ARG E 1 116 ? -14.870 -23.266 74.972 1.00 37.71  ? 116  ARG E CA    1 
ATOM   3663  C  C     . ARG E 1 116 ? -13.777 -22.438 74.298 1.00 37.49  ? 116  ARG E C     1 
ATOM   3664  O  O     . ARG E 1 116 ? -14.067 -21.512 73.532 1.00 37.00  ? 116  ARG E O     1 
ATOM   3665  C  CB    . ARG E 1 116 ? -14.872 -24.689 74.403 1.00 37.65  ? 116  ARG E CB    1 
ATOM   3666  C  CG    . ARG E 1 116 ? -15.689 -25.715 75.196 1.00 36.56  ? 116  ARG E CG    1 
ATOM   3667  C  CD    . ARG E 1 116 ? -15.647 -27.085 74.504 1.00 35.95  ? 116  ARG E CD    1 
ATOM   3668  N  NE    . ARG E 1 116 ? -16.556 -27.209 73.348 1.00 35.69  ? 116  ARG E NE    1 
ATOM   3669  C  CZ    . ARG E 1 116 ? -16.191 -27.170 72.062 1.00 34.04  ? 116  ARG E CZ    1 
ATOM   3670  N  NH1   . ARG E 1 116 ? -14.922 -27.012 71.703 1.00 32.25  ? 116  ARG E NH1   1 
ATOM   3671  N  NH2   . ARG E 1 116 ? -17.107 -27.320 71.118 1.00 32.32  ? 116  ARG E NH2   1 
ATOM   3672  N  N     . VAL E 1 117 ? -12.525 -22.784 74.579 1.00 37.58  ? 117  VAL E N     1 
ATOM   3673  C  CA    . VAL E 1 117 ? -11.362 -22.169 73.931 1.00 37.35  ? 117  VAL E CA    1 
ATOM   3674  C  C     . VAL E 1 117 ? -10.523 -23.255 73.258 1.00 37.39  ? 117  VAL E C     1 
ATOM   3675  O  O     . VAL E 1 117 ? -9.489  -22.988 72.651 1.00 37.71  ? 117  VAL E O     1 
ATOM   3676  C  CB    . VAL E 1 117 ? -10.507 -21.305 74.953 1.00 37.56  ? 117  VAL E CB    1 
ATOM   3677  C  CG1   . VAL E 1 117 ? -11.342 -20.166 75.511 1.00 36.47  ? 117  VAL E CG1   1 
ATOM   3678  C  CG2   . VAL E 1 117 ? -9.976  -22.141 76.100 1.00 36.54  ? 117  VAL E CG2   1 
ATOM   3679  N  N     . THR E 1 118 ? -10.988 -24.491 73.379 1.00 37.54  ? 118  THR E N     1 
ATOM   3680  C  CA    . THR E 1 118 ? -10.284 -25.659 72.864 1.00 37.07  ? 118  THR E CA    1 
ATOM   3681  C  C     . THR E 1 118 ? -11.036 -26.192 71.672 1.00 36.22  ? 118  THR E C     1 
ATOM   3682  O  O     . THR E 1 118 ? -12.201 -26.589 71.798 1.00 36.25  ? 118  THR E O     1 
ATOM   3683  C  CB    . THR E 1 118 ? -10.238 -26.754 73.937 1.00 37.18  ? 118  THR E CB    1 
ATOM   3684  O  OG1   . THR E 1 118 ? -9.796  -26.164 75.164 1.00 39.35  ? 118  THR E OG1   1 
ATOM   3685  C  CG2   . THR E 1 118 ? -9.304  -27.888 73.549 1.00 37.30  ? 118  THR E CG2   1 
ATOM   3686  N  N     . ILE E 1 119 ? -10.374 -26.207 70.520 1.00 35.28  ? 119  ILE E N     1 
ATOM   3687  C  CA    . ILE E 1 119 ? -10.967 -26.797 69.332 1.00 34.66  ? 119  ILE E CA    1 
ATOM   3688  C  C     . ILE E 1 119 ? -11.003 -28.328 69.403 1.00 34.87  ? 119  ILE E C     1 
ATOM   3689  O  O     . ILE E 1 119 ? -10.046 -28.981 69.830 1.00 35.00  ? 119  ILE E O     1 
ATOM   3690  C  CB    . ILE E 1 119 ? -10.294 -26.325 68.031 1.00 34.75  ? 119  ILE E CB    1 
ATOM   3691  C  CG1   . ILE E 1 119 ? -8.793  -26.682 67.976 1.00 32.65  ? 119  ILE E CG1   1 
ATOM   3692  C  CG2   . ILE E 1 119 ? -10.535 -24.839 67.821 1.00 34.78  ? 119  ILE E CG2   1 
ATOM   3693  C  CD1   . ILE E 1 119 ? -8.263  -26.700 66.554 1.00 29.33  ? 119  ILE E CD1   1 
ATOM   3694  N  N     . MET E 1 120 ? -12.129 -28.883 68.990 1.00 34.95  ? 120  MET E N     1 
ATOM   3695  C  CA    . MET E 1 120 ? -12.338 -30.319 69.007 1.00 34.85  ? 120  MET E CA    1 
ATOM   3696  C  C     . MET E 1 120 ? -12.843 -30.786 67.653 1.00 34.10  ? 120  MET E C     1 
ATOM   3697  O  O     . MET E 1 120 ? -13.291 -29.961 66.833 1.00 34.09  ? 120  MET E O     1 
ATOM   3698  C  CB    . MET E 1 120 ? -13.321 -30.660 70.115 1.00 35.71  ? 120  MET E CB    1 
ATOM   3699  C  CG    . MET E 1 120 ? -12.970 -29.986 71.426 1.00 37.36  ? 120  MET E CG    1 
ATOM   3700  S  SD    . MET E 1 120 ? -13.905 -30.545 72.839 1.00 45.14  ? 120  MET E SD    1 
ATOM   3701  C  CE    . MET E 1 120 ? -15.584 -30.334 72.289 1.00 45.26  ? 120  MET E CE    1 
ATOM   3702  N  N     . PRO E 1 121 ? -12.758 -32.103 67.389 1.00 33.88  ? 121  PRO E N     1 
ATOM   3703  C  CA    . PRO E 1 121 ? -13.334 -32.672 66.168 1.00 33.16  ? 121  PRO E CA    1 
ATOM   3704  C  C     . PRO E 1 121 ? -14.772 -32.229 65.887 1.00 33.21  ? 121  PRO E C     1 
ATOM   3705  O  O     . PRO E 1 121 ? -15.099 -31.979 64.720 1.00 33.92  ? 121  PRO E O     1 
ATOM   3706  C  CB    . PRO E 1 121 ? -13.256 -34.182 66.434 1.00 33.08  ? 121  PRO E CB    1 
ATOM   3707  C  CG    . PRO E 1 121 ? -11.987 -34.319 67.194 1.00 32.48  ? 121  PRO E CG    1 
ATOM   3708  C  CD    . PRO E 1 121 ? -12.013 -33.134 68.149 1.00 33.78  ? 121  PRO E CD    1 
ATOM   3709  N  N     . LYS E 1 122 ? -15.617 -32.115 66.914 1.00 33.14  ? 122  LYS E N     1 
ATOM   3710  C  CA    . LYS E 1 122 ? -17.003 -31.703 66.686 1.00 33.79  ? 122  LYS E CA    1 
ATOM   3711  C  C     . LYS E 1 122 ? -17.058 -30.272 66.095 1.00 33.86  ? 122  LYS E C     1 
ATOM   3712  O  O     . LYS E 1 122 ? -17.954 -29.964 65.316 1.00 34.69  ? 122  LYS E O     1 
ATOM   3713  C  CB    . LYS E 1 122 ? -17.928 -31.913 67.931 1.00 33.74  ? 122  LYS E CB    1 
ATOM   3714  C  CG    . LYS E 1 122 ? -17.685 -31.002 69.144 1.00 36.16  ? 122  LYS E CG    1 
ATOM   3715  C  CD    . LYS E 1 122 ? -18.009 -31.688 70.474 1.00 40.68  ? 122  LYS E CD    1 
ATOM   3716  C  CE    . LYS E 1 122 ? -19.442 -31.423 70.932 1.00 46.05  ? 122  LYS E CE    1 
ATOM   3717  N  NZ    . LYS E 1 122 ? -19.981 -32.532 71.810 1.00 47.78  ? 122  LYS E NZ    1 
ATOM   3718  N  N     . ASP E 1 123 ? -16.081 -29.429 66.433 1.00 33.15  ? 123  ASP E N     1 
ATOM   3719  C  CA    . ASP E 1 123 ? -16.010 -28.057 65.891 1.00 32.80  ? 123  ASP E CA    1 
ATOM   3720  C  C     . ASP E 1 123 ? -15.680 -28.073 64.398 1.00 32.59  ? 123  ASP E C     1 
ATOM   3721  O  O     . ASP E 1 123 ? -16.393 -27.478 63.606 1.00 32.25  ? 123  ASP E O     1 
ATOM   3722  C  CB    . ASP E 1 123 ? -15.005 -27.188 66.668 1.00 32.53  ? 123  ASP E CB    1 
ATOM   3723  C  CG    . ASP E 1 123 ? -15.331 -27.089 68.140 1.00 32.66  ? 123  ASP E CG    1 
ATOM   3724  O  OD1   . ASP E 1 123 ? -16.515 -26.870 68.471 1.00 32.61  ? 123  ASP E OD1   1 
ATOM   3725  O  OD2   . ASP E 1 123 ? -14.410 -27.231 68.975 1.00 32.70  ? 123  ASP E OD2   1 
ATOM   3726  N  N     . ILE E 1 124 ? -14.618 -28.788 64.017 1.00 32.62  ? 124  ILE E N     1 
ATOM   3727  C  CA    . ILE E 1 124 ? -14.305 -29.017 62.605 1.00 32.08  ? 124  ILE E CA    1 
ATOM   3728  C  C     . ILE E 1 124 ? -15.506 -29.590 61.833 1.00 32.37  ? 124  ILE E C     1 
ATOM   3729  O  O     . ILE E 1 124 ? -15.847 -29.110 60.765 1.00 32.67  ? 124  ILE E O     1 
ATOM   3730  C  CB    . ILE E 1 124 ? -13.105 -29.953 62.437 1.00 31.77  ? 124  ILE E CB    1 
ATOM   3731  C  CG1   . ILE E 1 124 ? -11.844 -29.334 63.051 1.00 32.35  ? 124  ILE E CG1   1 
ATOM   3732  C  CG2   . ILE E 1 124 ? -12.865 -30.258 60.963 1.00 30.74  ? 124  ILE E CG2   1 
ATOM   3733  C  CD1   . ILE E 1 124 ? -10.574 -30.190 62.876 1.00 33.65  ? 124  ILE E CD1   1 
ATOM   3734  N  N     . GLN E 1 125 ? -16.141 -30.616 62.386 1.00 32.69  ? 125  GLN E N     1 
ATOM   3735  C  CA    . GLN E 1 125 ? -17.296 -31.246 61.750 1.00 32.59  ? 125  GLN E CA    1 
ATOM   3736  C  C     . GLN E 1 125 ? -18.451 -30.249 61.562 1.00 32.20  ? 125  GLN E C     1 
ATOM   3737  O  O     . GLN E 1 125 ? -19.025 -30.157 60.493 1.00 32.16  ? 125  GLN E O     1 
ATOM   3738  C  CB    . GLN E 1 125 ? -17.721 -32.496 62.535 1.00 32.56  ? 125  GLN E CB    1 
ATOM   3739  C  CG    . GLN E 1 125 ? -16.760 -33.689 62.346 1.00 33.62  ? 125  GLN E CG    1 
ATOM   3740  C  CD    . GLN E 1 125 ? -16.654 -34.607 63.569 1.00 36.19  ? 125  GLN E CD    1 
ATOM   3741  O  OE1   . GLN E 1 125 ? -17.530 -34.632 64.445 1.00 38.08  ? 125  GLN E OE1   1 
ATOM   3742  N  NE2   . GLN E 1 125 ? -15.565 -35.361 63.633 1.00 36.05  ? 125  GLN E NE2   1 
ATOM   3743  N  N     . LEU E 1 126 ? -18.766 -29.473 62.581 1.00 32.06  ? 126  LEU E N     1 
ATOM   3744  C  CA    . LEU E 1 126 ? -19.763 -28.431 62.418 1.00 32.49  ? 126  LEU E CA    1 
ATOM   3745  C  C     . LEU E 1 126 ? -19.397 -27.434 61.297 1.00 32.73  ? 126  LEU E C     1 
ATOM   3746  O  O     . LEU E 1 126 ? -20.221 -27.124 60.417 1.00 32.54  ? 126  LEU E O     1 
ATOM   3747  C  CB    . LEU E 1 126 ? -20.005 -27.713 63.741 1.00 32.03  ? 126  LEU E CB    1 
ATOM   3748  C  CG    . LEU E 1 126 ? -21.162 -26.708 63.647 1.00 33.92  ? 126  LEU E CG    1 
ATOM   3749  C  CD1   . LEU E 1 126 ? -22.497 -27.391 63.416 1.00 31.99  ? 126  LEU E CD1   1 
ATOM   3750  C  CD2   . LEU E 1 126 ? -21.220 -25.824 64.888 1.00 33.64  ? 126  LEU E CD2   1 
ATOM   3751  N  N     . ALA E 1 127 ? -18.153 -26.966 61.310 1.00 32.88  ? 127  ALA E N     1 
ATOM   3752  C  CA    . ALA E 1 127 ? -17.700 -26.002 60.317 1.00 33.57  ? 127  ALA E CA    1 
ATOM   3753  C  C     . ALA E 1 127 ? -17.840 -26.538 58.900 1.00 34.21  ? 127  ALA E C     1 
ATOM   3754  O  O     . ALA E 1 127 ? -18.362 -25.852 58.015 1.00 33.99  ? 127  ALA E O     1 
ATOM   3755  C  CB    . ALA E 1 127 ? -16.267 -25.553 60.610 1.00 33.30  ? 127  ALA E CB    1 
ATOM   3756  N  N     . ARG E 1 128 ? -17.389 -27.777 58.689 1.00 35.33  ? 128  ARG E N     1 
ATOM   3757  C  CA    . ARG E 1 128 ? -17.519 -28.435 57.383 1.00 35.74  ? 128  ARG E CA    1 
ATOM   3758  C  C     . ARG E 1 128 ? -18.984 -28.685 56.978 1.00 36.33  ? 128  ARG E C     1 
ATOM   3759  O  O     . ARG E 1 128 ? -19.324 -28.571 55.797 1.00 35.87  ? 128  ARG E O     1 
ATOM   3760  C  CB    . ARG E 1 128 ? -16.693 -29.711 57.326 1.00 35.45  ? 128  ARG E CB    1 
ATOM   3761  C  CG    . ARG E 1 128 ? -15.199 -29.493 57.630 1.00 37.18  ? 128  ARG E CG    1 
ATOM   3762  C  CD    . ARG E 1 128 ? -14.310 -30.281 56.713 1.00 38.95  ? 128  ARG E CD    1 
ATOM   3763  N  NE    . ARG E 1 128 ? -14.658 -31.682 56.790 1.00 43.92  ? 128  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E 1 128 ? -14.735 -32.512 55.757 1.00 44.28  ? 128  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E 1 128 ? -14.475 -32.109 54.520 1.00 44.24  ? 128  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E 1 128 ? -15.087 -33.763 55.980 1.00 46.33  ? 128  ARG E NH2   1 
ATOM   3767  N  N     . ARG E 1 129 ? -19.847 -29.008 57.941 1.00 37.23  ? 129  ARG E N     1 
ATOM   3768  C  CA    . ARG E 1 129 ? -21.265 -29.198 57.639 1.00 39.32  ? 129  ARG E CA    1 
ATOM   3769  C  C     . ARG E 1 129 ? -21.898 -27.896 57.158 1.00 39.82  ? 129  ARG E C     1 
ATOM   3770  O  O     . ARG E 1 129 ? -22.529 -27.861 56.108 1.00 39.03  ? 129  ARG E O     1 
ATOM   3771  C  CB    . ARG E 1 129 ? -22.047 -29.775 58.824 1.00 39.69  ? 129  ARG E CB    1 
ATOM   3772  C  CG    . ARG E 1 129 ? -23.494 -30.180 58.460 1.00 43.26  ? 129  ARG E CG    1 
ATOM   3773  C  CD    . ARG E 1 129 ? -23.932 -31.465 59.199 1.00 49.54  ? 129  ARG E CD    1 
ATOM   3774  N  NE    . ARG E 1 129 ? -25.348 -31.779 58.965 1.00 54.33  ? 129  ARG E NE    1 
ATOM   3775  C  CZ    . ARG E 1 129 ? -26.149 -32.389 59.841 1.00 55.38  ? 129  ARG E CZ    1 
ATOM   3776  N  NH1   . ARG E 1 129 ? -25.690 -32.768 61.029 1.00 55.86  ? 129  ARG E NH1   1 
ATOM   3777  N  NH2   . ARG E 1 129 ? -27.422 -32.614 59.527 1.00 56.15  ? 129  ARG E NH2   1 
ATOM   3778  N  N     . ILE E 1 130 ? -21.689 -26.822 57.916 1.00 41.18  ? 130  ILE E N     1 
ATOM   3779  C  CA    . ILE E 1 130 ? -22.256 -25.529 57.555 1.00 42.58  ? 130  ILE E CA    1 
ATOM   3780  C  C     . ILE E 1 130 ? -21.696 -25.013 56.231 1.00 43.51  ? 130  ILE E C     1 
ATOM   3781  O  O     . ILE E 1 130 ? -22.459 -24.520 55.409 1.00 43.87  ? 130  ILE E O     1 
ATOM   3782  C  CB    . ILE E 1 130 ? -22.158 -24.508 58.711 1.00 42.97  ? 130  ILE E CB    1 
ATOM   3783  C  CG1   . ILE E 1 130 ? -22.946 -25.036 59.914 1.00 43.27  ? 130  ILE E CG1   1 
ATOM   3784  C  CG2   . ILE E 1 130 ? -22.706 -23.129 58.296 1.00 41.63  ? 130  ILE E CG2   1 
ATOM   3785  C  CD1   . ILE E 1 130 ? -22.705 -24.261 61.157 1.00 45.32  ? 130  ILE E CD1   1 
ATOM   3786  N  N     . ARG E 1 131 ? -20.387 -25.176 56.015 1.00 44.61  ? 131  ARG E N     1 
ATOM   3787  C  CA    . ARG E 1 131 ? -19.733 -24.850 54.735 1.00 45.51  ? 131  ARG E CA    1 
ATOM   3788  C  C     . ARG E 1 131 ? -20.259 -25.569 53.497 1.00 47.02  ? 131  ARG E C     1 
ATOM   3789  O  O     . ARG E 1 131 ? -20.001 -25.127 52.375 1.00 47.40  ? 131  ARG E O     1 
ATOM   3790  C  CB    . ARG E 1 131 ? -18.249 -25.152 54.810 1.00 45.14  ? 131  ARG E CB    1 
ATOM   3791  C  CG    . ARG E 1 131 ? -17.418 -24.093 55.438 1.00 43.27  ? 131  ARG E CG    1 
ATOM   3792  C  CD    . ARG E 1 131 ? -16.112 -24.720 55.816 1.00 40.17  ? 131  ARG E CD    1 
ATOM   3793  N  NE    . ARG E 1 131 ? -15.127 -23.707 56.139 1.00 39.18  ? 131  ARG E NE    1 
ATOM   3794  C  CZ    . ARG E 1 131 ? -13.930 -23.623 55.575 1.00 37.70  ? 131  ARG E CZ    1 
ATOM   3795  N  NH1   . ARG E 1 131 ? -13.558 -24.522 54.677 1.00 36.49  ? 131  ARG E NH1   1 
ATOM   3796  N  NH2   . ARG E 1 131 ? -13.096 -22.650 55.937 1.00 37.75  ? 131  ARG E NH2   1 
ATOM   3797  N  N     . GLY E 1 132 ? -20.950 -26.690 53.683 1.00 48.61  ? 132  GLY E N     1 
ATOM   3798  C  CA    . GLY E 1 132 ? -21.468 -27.443 52.544 1.00 50.81  ? 132  GLY E CA    1 
ATOM   3799  C  C     . GLY E 1 132 ? -20.504 -28.500 52.063 1.00 52.36  ? 132  GLY E C     1 
ATOM   3800  O  O     . GLY E 1 132 ? -20.765 -29.192 51.078 1.00 53.13  ? 132  GLY E O     1 
ATOM   3801  N  N     . GLU E 1 133 ? -19.386 -28.637 52.768 1.00 53.93  ? 133  GLU E N     1 
ATOM   3802  C  CA    . GLU E 1 133 ? -18.446 -29.727 52.522 1.00 55.14  ? 133  GLU E CA    1 
ATOM   3803  C  C     . GLU E 1 133 ? -19.121 -31.031 52.926 1.00 56.44  ? 133  GLU E C     1 
ATOM   3804  O  O     . GLU E 1 133 ? -18.618 -32.129 52.667 1.00 56.82  ? 133  GLU E O     1 
ATOM   3805  C  CB    . GLU E 1 133 ? -17.128 -29.469 53.255 1.00 54.50  ? 133  GLU E CB    1 
ATOM   3806  C  CG    . GLU E 1 133 ? -16.338 -28.353 52.585 1.00 53.39  ? 133  GLU E CG    1 
ATOM   3807  C  CD    . GLU E 1 133 ? -15.076 -27.912 53.336 1.00 52.04  ? 133  GLU E CD    1 
ATOM   3808  O  OE1   . GLU E 1 133 ? -14.359 -28.761 53.923 1.00 49.13  ? 133  GLU E OE1   1 
ATOM   3809  O  OE2   . GLU E 1 133 ? -14.791 -26.694 53.300 1.00 51.48  ? 133  GLU E OE2   1 
ATOM   3810  N  N     . ARG E 1 134 ? -20.275 -30.869 53.574 1.00 58.23  ? 134  ARG E N     1 
ATOM   3811  C  CA    . ARG E 1 134 ? -21.330 -31.887 53.665 1.00 59.69  ? 134  ARG E CA    1 
ATOM   3812  C  C     . ARG E 1 134 ? -22.719 -31.226 53.524 1.00 59.84  ? 134  ARG E C     1 
ATOM   3813  O  O     . ARG E 1 134 ? -23.299 -30.758 54.555 1.00 60.13  ? 134  ARG E O     1 
ATOM   3814  C  CB    . ARG E 1 134 ? -21.215 -32.676 54.964 1.00 60.09  ? 134  ARG E CB    1 
ATOM   3815  C  CG    . ARG E 1 134 ? -20.118 -33.744 54.922 1.00 62.28  ? 134  ARG E CG    1 
ATOM   3816  C  CD    . ARG E 1 134 ? -19.726 -34.168 56.319 1.00 64.68  ? 134  ARG E CD    1 
ATOM   3817  N  NE    . ARG E 1 134 ? -19.408 -32.992 57.124 1.00 66.63  ? 134  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E 1 134 ? -19.291 -32.987 58.450 1.00 67.76  ? 134  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E 1 134 ? -19.460 -34.102 59.161 1.00 68.83  ? 134  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E 1 134 ? -18.995 -31.857 59.064 1.00 67.26  ? 134  ARG E NH2   1 
ATOM   3821  N  N     . LYS F 2 16  ? 14.340  -48.748 33.618 1.00 89.11  ? 16   LYS F N     1 
ATOM   3822  C  CA    . LYS F 2 16  ? 14.315  -48.343 35.060 1.00 89.15  ? 16   LYS F CA    1 
ATOM   3823  C  C     . LYS F 2 16  ? 14.394  -49.550 35.995 1.00 88.81  ? 16   LYS F C     1 
ATOM   3824  O  O     . LYS F 2 16  ? 13.678  -50.550 35.802 1.00 88.94  ? 16   LYS F O     1 
ATOM   3825  C  CB    . LYS F 2 16  ? 13.064  -47.507 35.384 1.00 89.43  ? 16   LYS F CB    1 
ATOM   3826  C  CG    . LYS F 2 16  ? 11.725  -48.222 35.133 1.00 90.27  ? 16   LYS F CG    1 
ATOM   3827  C  CD    . LYS F 2 16  ? 10.608  -47.634 35.996 1.00 91.34  ? 16   LYS F CD    1 
ATOM   3828  C  CE    . LYS F 2 16  ? 9.382   -48.548 35.956 1.00 91.79  ? 16   LYS F CE    1 
ATOM   3829  N  NZ    . LYS F 2 16  ? 8.290   -48.032 36.856 1.00 92.10  ? 16   LYS F NZ    1 
ATOM   3830  N  N     . ARG F 2 17  ? 15.268  -49.446 37.002 1.00 88.19  ? 17   ARG F N     1 
ATOM   3831  C  CA    . ARG F 2 17  ? 15.429  -50.496 38.010 1.00 87.42  ? 17   ARG F CA    1 
ATOM   3832  C  C     . ARG F 2 17  ? 14.987  -50.043 39.408 1.00 86.48  ? 17   ARG F C     1 
ATOM   3833  O  O     . ARG F 2 17  ? 15.702  -49.291 40.090 1.00 86.46  ? 17   ARG F O     1 
ATOM   3834  C  CB    . ARG F 2 17  ? 16.871  -51.017 38.028 1.00 87.70  ? 17   ARG F CB    1 
ATOM   3835  C  CG    . ARG F 2 17  ? 17.148  -52.103 36.991 1.00 89.02  ? 17   ARG F CG    1 
ATOM   3836  C  CD    . ARG F 2 17  ? 18.631  -52.489 36.963 1.00 90.98  ? 17   ARG F CD    1 
ATOM   3837  N  NE    . ARG F 2 17  ? 18.869  -53.672 36.119 1.00 92.36  ? 17   ARG F NE    1 
ATOM   3838  C  CZ    . ARG F 2 17  ? 20.057  -54.258 35.946 1.00 93.00  ? 17   ARG F CZ    1 
ATOM   3839  N  NH1   . ARG F 2 17  ? 21.141  -53.779 36.557 1.00 92.63  ? 17   ARG F NH1   1 
ATOM   3840  N  NH2   . ARG F 2 17  ? 20.164  -55.331 35.157 1.00 93.01  ? 17   ARG F NH2   1 
ATOM   3841  N  N     . HIS F 2 18  ? 13.796  -50.507 39.804 1.00 85.20  ? 18   HIS F N     1 
ATOM   3842  C  CA    . HIS F 2 18  ? 13.195  -50.281 41.139 1.00 83.81  ? 18   HIS F CA    1 
ATOM   3843  C  C     . HIS F 2 18  ? 12.719  -48.851 41.391 1.00 82.15  ? 18   HIS F C     1 
ATOM   3844  O  O     . HIS F 2 18  ? 13.266  -47.896 40.833 1.00 82.22  ? 18   HIS F O     1 
ATOM   3845  C  CB    . HIS F 2 18  ? 14.126  -50.742 42.280 1.00 84.27  ? 18   HIS F CB    1 
ATOM   3846  C  CG    . HIS F 2 18  ? 14.374  -52.220 42.304 1.00 85.66  ? 18   HIS F CG    1 
ATOM   3847  N  ND1   . HIS F 2 18  ? 13.606  -53.094 43.052 1.00 87.35  ? 18   HIS F ND1   1 
ATOM   3848  C  CD2   . HIS F 2 18  ? 15.311  -52.977 41.681 1.00 86.57  ? 18   HIS F CD2   1 
ATOM   3849  C  CE1   . HIS F 2 18  ? 14.055  -54.326 42.883 1.00 87.78  ? 18   HIS F CE1   1 
ATOM   3850  N  NE2   . HIS F 2 18  ? 15.089  -54.282 42.055 1.00 87.89  ? 18   HIS F NE2   1 
ATOM   3851  N  N     . ARG F 2 19  ? 11.695  -48.730 42.237 1.00 79.89  ? 19   ARG F N     1 
ATOM   3852  C  CA    . ARG F 2 19  ? 11.168  -47.440 42.695 1.00 77.65  ? 19   ARG F CA    1 
ATOM   3853  C  C     . ARG F 2 19  ? 10.384  -47.624 44.005 1.00 75.23  ? 19   ARG F C     1 
ATOM   3854  O  O     . ARG F 2 19  ? 9.381   -48.339 44.039 1.00 75.12  ? 19   ARG F O     1 
ATOM   3855  C  CB    . ARG F 2 19  ? 10.297  -46.785 41.611 1.00 78.18  ? 19   ARG F CB    1 
ATOM   3856  C  CG    . ARG F 2 19  ? 10.230  -45.250 41.693 1.00 80.00  ? 19   ARG F CG    1 
ATOM   3857  C  CD    . ARG F 2 19  ? 8.906   -44.783 42.292 1.00 82.96  ? 19   ARG F CD    1 
ATOM   3858  N  NE    . ARG F 2 19  ? 8.927   -43.375 42.700 1.00 84.50  ? 19   ARG F NE    1 
ATOM   3859  C  CZ    . ARG F 2 19  ? 7.911   -42.759 43.314 1.00 85.57  ? 19   ARG F CZ    1 
ATOM   3860  N  NH1   . ARG F 2 19  ? 6.786   -43.424 43.587 1.00 85.73  ? 19   ARG F NH1   1 
ATOM   3861  N  NH2   . ARG F 2 19  ? 8.016   -41.477 43.654 1.00 85.72  ? 19   ARG F NH2   1 
ATOM   3862  N  N     . LYS F 2 20  ? 10.866  -46.976 45.066 1.00 71.85  ? 20   LYS F N     1 
ATOM   3863  C  CA    . LYS F 2 20  ? 10.358  -47.120 46.440 1.00 68.56  ? 20   LYS F CA    1 
ATOM   3864  C  C     . LYS F 2 20  ? 8.828   -47.033 46.613 1.00 65.66  ? 20   LYS F C     1 
ATOM   3865  O  O     . LYS F 2 20  ? 8.153   -46.268 45.924 1.00 65.66  ? 20   LYS F O     1 
ATOM   3866  C  CB    . LYS F 2 20  ? 11.058  -46.087 47.340 1.00 69.03  ? 20   LYS F CB    1 
ATOM   3867  C  CG    . LYS F 2 20  ? 10.785  -46.203 48.839 1.00 70.08  ? 20   LYS F CG    1 
ATOM   3868  C  CD    . LYS F 2 20  ? 11.120  -47.578 49.405 1.00 71.16  ? 20   LYS F CD    1 
ATOM   3869  C  CE    . LYS F 2 20  ? 11.021  -47.551 50.921 1.00 72.67  ? 20   LYS F CE    1 
ATOM   3870  N  NZ    . LYS F 2 20  ? 10.937  -48.917 51.490 1.00 74.24  ? 20   LYS F NZ    1 
ATOM   3871  N  N     . VAL F 2 21  ? 8.309   -47.826 47.548 1.00 61.83  ? 21   VAL F N     1 
ATOM   3872  C  CA    . VAL F 2 21  ? 6.883   -47.895 47.850 1.00 57.97  ? 21   VAL F CA    1 
ATOM   3873  C  C     . VAL F 2 21  ? 6.466   -46.731 48.762 1.00 55.63  ? 21   VAL F C     1 
ATOM   3874  O  O     . VAL F 2 21  ? 7.074   -46.498 49.810 1.00 55.10  ? 21   VAL F O     1 
ATOM   3875  C  CB    . VAL F 2 21  ? 6.513   -49.256 48.517 1.00 57.83  ? 21   VAL F CB    1 
ATOM   3876  C  CG1   . VAL F 2 21  ? 5.120   -49.224 49.118 1.00 57.08  ? 21   VAL F CG1   1 
ATOM   3877  C  CG2   . VAL F 2 21  ? 6.618   -50.391 47.521 1.00 58.07  ? 21   VAL F CG2   1 
ATOM   3878  N  N     . LEU F 2 22  ? 5.414   -46.023 48.355 1.00 52.62  ? 22   LEU F N     1 
ATOM   3879  C  CA    . LEU F 2 22  ? 4.886   -44.902 49.118 1.00 49.67  ? 22   LEU F CA    1 
ATOM   3880  C  C     . LEU F 2 22  ? 3.725   -45.331 49.994 1.00 47.93  ? 22   LEU F C     1 
ATOM   3881  O  O     . LEU F 2 22  ? 2.660   -45.670 49.506 1.00 47.05  ? 22   LEU F O     1 
ATOM   3882  C  CB    . LEU F 2 22  ? 4.450   -43.770 48.181 1.00 49.82  ? 22   LEU F CB    1 
ATOM   3883  C  CG    . LEU F 2 22  ? 5.524   -43.207 47.242 1.00 49.45  ? 22   LEU F CG    1 
ATOM   3884  C  CD1   . LEU F 2 22  ? 4.912   -42.240 46.236 1.00 49.00  ? 22   LEU F CD1   1 
ATOM   3885  C  CD2   . LEU F 2 22  ? 6.648   -42.542 48.033 1.00 48.58  ? 22   LEU F CD2   1 
ATOM   3886  N  N     . ARG F 2 23  ? 3.940   -45.312 51.302 1.00 46.15  ? 23   ARG F N     1 
ATOM   3887  C  CA    . ARG F 2 23  ? 2.877   -45.623 52.239 1.00 44.46  ? 23   ARG F CA    1 
ATOM   3888  C  C     . ARG F 2 23  ? 2.947   -44.763 53.479 1.00 43.58  ? 23   ARG F C     1 
ATOM   3889  O  O     . ARG F 2 23  ? 4.028   -44.379 53.919 1.00 43.11  ? 23   ARG F O     1 
ATOM   3890  C  CB    . ARG F 2 23  ? 2.878   -47.108 52.629 1.00 44.35  ? 23   ARG F CB    1 
ATOM   3891  C  CG    . ARG F 2 23  ? 4.229   -47.677 52.896 1.00 43.72  ? 23   ARG F CG    1 
ATOM   3892  C  CD    . ARG F 2 23  ? 4.219   -49.195 52.752 1.00 40.88  ? 23   ARG F CD    1 
ATOM   3893  N  NE    . ARG F 2 23  ? 3.878   -49.781 54.031 1.00 37.55  ? 23   ARG F NE    1 
ATOM   3894  C  CZ    . ARG F 2 23  ? 4.761   -50.024 54.993 1.00 35.12  ? 23   ARG F CZ    1 
ATOM   3895  N  NH1   . ARG F 2 23  ? 6.053   -49.793 54.811 1.00 33.85  ? 23   ARG F NH1   1 
ATOM   3896  N  NH2   . ARG F 2 23  ? 4.343   -50.514 56.135 1.00 33.51  ? 23   ARG F NH2   1 
ATOM   3897  N  N     . ASP F 2 24  ? 1.767   -44.470 54.028 1.00 42.29  ? 24   ASP F N     1 
ATOM   3898  C  CA    . ASP F 2 24  ? 1.620   -43.760 55.301 1.00 41.64  ? 24   ASP F CA    1 
ATOM   3899  C  C     . ASP F 2 24  ? 2.235   -42.343 55.359 1.00 40.62  ? 24   ASP F C     1 
ATOM   3900  O  O     . ASP F 2 24  ? 2.569   -41.830 56.418 1.00 39.82  ? 24   ASP F O     1 
ATOM   3901  C  CB    . ASP F 2 24  ? 2.143   -44.622 56.448 1.00 41.75  ? 24   ASP F CB    1 
ATOM   3902  C  CG    . ASP F 2 24  ? 1.333   -44.447 57.705 1.00 43.24  ? 24   ASP F CG    1 
ATOM   3903  O  OD1   . ASP F 2 24  ? 0.095   -44.221 57.594 1.00 46.74  ? 24   ASP F OD1   1 
ATOM   3904  O  OD2   . ASP F 2 24  ? 1.928   -44.541 58.797 1.00 42.55  ? 24   ASP F OD2   1 
ATOM   3905  N  N     . ASN F 2 25  ? 2.348   -41.707 54.208 1.00 40.14  ? 25   ASN F N     1 
ATOM   3906  C  CA    . ASN F 2 25  ? 2.916   -40.384 54.137 1.00 39.72  ? 25   ASN F CA    1 
ATOM   3907  C  C     . ASN F 2 25  ? 2.072   -39.284 54.794 1.00 40.12  ? 25   ASN F C     1 
ATOM   3908  O  O     . ASN F 2 25  ? 2.590   -38.223 55.118 1.00 40.41  ? 25   ASN F O     1 
ATOM   3909  C  CB    . ASN F 2 25  ? 3.246   -40.072 52.703 1.00 39.38  ? 25   ASN F CB    1 
ATOM   3910  C  CG    . ASN F 2 25  ? 4.401   -40.895 52.210 1.00 38.10  ? 25   ASN F CG    1 
ATOM   3911  O  OD1   . ASN F 2 25  ? 5.514   -40.702 52.657 1.00 38.21  ? 25   ASN F OD1   1 
ATOM   3912  N  ND2   . ASN F 2 25  ? 4.142   -41.834 51.308 1.00 36.93  ? 25   ASN F ND2   1 
ATOM   3913  N  N     . ILE F 2 26  ? 0.793   -39.564 55.036 1.00 40.45  ? 26   ILE F N     1 
ATOM   3914  C  CA    . ILE F 2 26  ? -0.064  -38.685 55.826 1.00 40.40  ? 26   ILE F CA    1 
ATOM   3915  C  C     . ILE F 2 26  ? 0.551   -38.325 57.182 1.00 40.52  ? 26   ILE F C     1 
ATOM   3916  O  O     . ILE F 2 26  ? 0.206   -37.293 57.768 1.00 40.86  ? 26   ILE F O     1 
ATOM   3917  C  CB    . ILE F 2 26  ? -1.497  -39.286 56.034 1.00 40.80  ? 26   ILE F CB    1 
ATOM   3918  C  CG1   . ILE F 2 26  ? -2.502  -38.212 56.479 1.00 40.47  ? 26   ILE F CG1   1 
ATOM   3919  C  CG2   . ILE F 2 26  ? -1.487  -40.402 57.077 1.00 39.59  ? 26   ILE F CG2   1 
ATOM   3920  C  CD1   . ILE F 2 26  ? -2.599  -37.025 55.577 1.00 40.24  ? 26   ILE F CD1   1 
ATOM   3921  N  N     . GLN F 2 27  ? 1.464   -39.153 57.674 1.00 40.14  ? 27   GLN F N     1 
ATOM   3922  C  CA    . GLN F 2 27  ? 2.034   -38.932 59.013 1.00 40.19  ? 27   GLN F CA    1 
ATOM   3923  C  C     . GLN F 2 27  ? 3.193   -37.958 58.942 1.00 40.30  ? 27   GLN F C     1 
ATOM   3924  O  O     . GLN F 2 27  ? 3.666   -37.459 59.962 1.00 41.09  ? 27   GLN F O     1 
ATOM   3925  C  CB    . GLN F 2 27  ? 2.445   -40.257 59.684 1.00 40.06  ? 27   GLN F CB    1 
ATOM   3926  C  CG    . GLN F 2 27  ? 1.259   -41.188 60.030 1.00 39.26  ? 27   GLN F CG    1 
ATOM   3927  C  CD    . GLN F 2 27  ? 0.321   -40.602 61.092 1.00 40.75  ? 27   GLN F CD    1 
ATOM   3928  O  OE1   . GLN F 2 27  ? 0.766   -39.949 62.041 1.00 43.55  ? 27   GLN F OE1   1 
ATOM   3929  N  NE2   . GLN F 2 27  ? -0.978  -40.837 60.938 1.00 39.15  ? 27   GLN F NE2   1 
ATOM   3930  N  N     . GLY F 2 28  ? 3.641   -37.670 57.728 1.00 40.31  ? 28   GLY F N     1 
ATOM   3931  C  CA    . GLY F 2 28  ? 4.613   -36.605 57.521 1.00 40.43  ? 28   GLY F CA    1 
ATOM   3932  C  C     . GLY F 2 28  ? 3.980   -35.250 57.814 1.00 40.87  ? 28   GLY F C     1 
ATOM   3933  O  O     . GLY F 2 28  ? 4.688   -34.240 57.868 1.00 40.79  ? 28   GLY F O     1 
ATOM   3934  N  N     . ILE F 2 29  ? 2.647   -35.227 57.974 1.00 40.28  ? 29   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2 29  ? 1.945   -34.036 58.449 1.00 39.72  ? 29   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2 29  ? 1.922   -34.120 59.965 1.00 39.31  ? 29   ILE F C     1 
ATOM   3937  O  O     . ILE F 2 29  ? 0.945   -34.599 60.575 1.00 39.13  ? 29   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2 29  ? 0.482   -33.910 57.912 1.00 39.93  ? 29   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2 29  ? 0.373   -34.256 56.418 1.00 39.78  ? 29   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2 29  ? -0.071  -32.528 58.181 1.00 40.27  ? 29   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2 29  ? 1.182   -33.384 55.476 1.00 38.68  ? 29   ILE F CD1   1 
ATOM   3942  N  N     . THR F 2 30  ? 3.000   -33.630 60.567 1.00 38.66  ? 30   THR F N     1 
ATOM   3943  C  CA    . THR F 2 30  ? 3.257   -33.834 61.981 1.00 38.45  ? 30   THR F CA    1 
ATOM   3944  C  C     . THR F 2 30  ? 2.367   -32.986 62.891 1.00 38.40  ? 30   THR F C     1 
ATOM   3945  O  O     . THR F 2 30  ? 1.712   -32.053 62.462 1.00 38.16  ? 30   THR F O     1 
ATOM   3946  C  CB    . THR F 2 30  ? 4.754   -33.580 62.321 1.00 38.46  ? 30   THR F CB    1 
ATOM   3947  O  OG1   . THR F 2 30  ? 5.063   -32.214 62.037 1.00 39.48  ? 30   THR F OG1   1 
ATOM   3948  C  CG2   . THR F 2 30  ? 5.686   -34.485 61.485 1.00 37.16  ? 30   THR F CG2   1 
ATOM   3949  N  N     . LYS F 2 31  ? 2.364   -33.339 64.163 1.00 38.72  ? 31   LYS F N     1 
ATOM   3950  C  CA    . LYS F 2 31  ? 1.682   -32.605 65.190 1.00 39.20  ? 31   LYS F CA    1 
ATOM   3951  C  C     . LYS F 2 31  ? 2.138   -31.124 65.234 1.00 39.16  ? 31   LYS F C     1 
ATOM   3952  O  O     . LYS F 2 31  ? 1.296   -30.236 65.197 1.00 39.19  ? 31   LYS F O     1 
ATOM   3953  C  CB    . LYS F 2 31  ? 1.897   -33.316 66.526 1.00 39.60  ? 31   LYS F CB    1 
ATOM   3954  C  CG    . LYS F 2 31  ? 1.118   -32.744 67.676 1.00 42.64  ? 31   LYS F CG    1 
ATOM   3955  C  CD    . LYS F 2 31  ? 1.328   -33.533 68.946 1.00 46.11  ? 31   LYS F CD    1 
ATOM   3956  C  CE    . LYS F 2 31  ? 1.027   -32.647 70.136 1.00 49.79  ? 31   LYS F CE    1 
ATOM   3957  N  NZ    . LYS F 2 31  ? 0.650   -33.403 71.372 1.00 54.11  ? 31   LYS F NZ    1 
ATOM   3958  N  N     . PRO F 2 32  ? 3.463   -30.855 65.284 1.00 38.93  ? 32   PRO F N     1 
ATOM   3959  C  CA    . PRO F 2 32  ? 3.896   -29.455 65.230 1.00 38.31  ? 32   PRO F CA    1 
ATOM   3960  C  C     . PRO F 2 32  ? 3.465   -28.687 63.965 1.00 38.43  ? 32   PRO F C     1 
ATOM   3961  O  O     . PRO F 2 32  ? 3.111   -27.502 64.061 1.00 38.65  ? 32   PRO F O     1 
ATOM   3962  C  CB    . PRO F 2 32  ? 5.427   -29.560 65.262 1.00 37.97  ? 32   PRO F CB    1 
ATOM   3963  C  CG    . PRO F 2 32  ? 5.692   -30.882 65.930 1.00 38.74  ? 32   PRO F CG    1 
ATOM   3964  C  CD    . PRO F 2 32  ? 4.611   -31.778 65.454 1.00 38.67  ? 32   PRO F CD    1 
ATOM   3965  N  N     . ALA F 2 33  ? 3.516   -29.320 62.793 1.00 37.17  ? 33   ALA F N     1 
ATOM   3966  C  CA    . ALA F 2 33  ? 3.088   -28.626 61.587 1.00 36.60  ? 33   ALA F CA    1 
ATOM   3967  C  C     . ALA F 2 33  ? 1.593   -28.246 61.652 1.00 36.87  ? 33   ALA F C     1 
ATOM   3968  O  O     . ALA F 2 33  ? 1.187   -27.160 61.212 1.00 37.26  ? 33   ALA F O     1 
ATOM   3969  C  CB    . ALA F 2 33  ? 3.380   -29.446 60.369 1.00 35.67  ? 33   ALA F CB    1 
ATOM   3970  N  N     . ILE F 2 34  ? 0.777   -29.142 62.195 1.00 36.35  ? 34   ILE F N     1 
ATOM   3971  C  CA    . ILE F 2 34  ? -0.653  -28.892 62.304 1.00 35.44  ? 34   ILE F CA    1 
ATOM   3972  C  C     . ILE F 2 34  ? -0.892  -27.790 63.316 1.00 35.80  ? 34   ILE F C     1 
ATOM   3973  O  O     . ILE F 2 34  ? -1.719  -26.898 63.093 1.00 35.67  ? 34   ILE F O     1 
ATOM   3974  C  CB    . ILE F 2 34  ? -1.438  -30.169 62.712 1.00 35.01  ? 34   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F 2 34  ? -1.286  -31.255 61.625 1.00 34.40  ? 34   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F 2 34  ? -2.904  -29.830 62.999 1.00 33.02  ? 34   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F 2 34  ? -1.619  -32.656 62.076 1.00 31.25  ? 34   ILE F CD1   1 
ATOM   3978  N  N     . ARG F 2 35  ? -0.185  -27.863 64.438 1.00 35.87  ? 35   ARG F N     1 
ATOM   3979  C  CA    . ARG F 2 35  ? -0.314  -26.858 65.472 1.00 36.38  ? 35   ARG F CA    1 
ATOM   3980  C  C     . ARG F 2 35  ? 0.003   -25.461 64.913 1.00 35.88  ? 35   ARG F C     1 
ATOM   3981  O  O     . ARG F 2 35  ? -0.759  -24.520 65.154 1.00 36.34  ? 35   ARG F O     1 
ATOM   3982  C  CB    . ARG F 2 35  ? 0.567   -27.184 66.661 1.00 36.76  ? 35   ARG F CB    1 
ATOM   3983  C  CG    . ARG F 2 35  ? 0.400   -26.211 67.791 1.00 41.86  ? 35   ARG F CG    1 
ATOM   3984  C  CD    . ARG F 2 35  ? 1.564   -26.272 68.775 1.00 47.80  ? 35   ARG F CD    1 
ATOM   3985  N  NE    . ARG F 2 35  ? 1.993   -27.653 68.938 1.00 52.49  ? 35   ARG F NE    1 
ATOM   3986  C  CZ    . ARG F 2 35  ? 1.273   -28.593 69.536 1.00 55.10  ? 35   ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F 2 35  ? 0.069   -28.300 70.046 1.00 54.23  ? 35   ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F 2 35  ? 1.776   -29.826 69.627 1.00 57.41  ? 35   ARG F NH2   1 
ATOM   3989  N  N     . ARG F 2 36  ? 1.081   -25.347 64.135 1.00 34.26  ? 36   ARG F N     1 
ATOM   3990  C  CA    . ARG F 2 36  ? 1.437   -24.102 63.479 1.00 33.12  ? 36   ARG F CA    1 
ATOM   3991  C  C     . ARG F 2 36  ? 0.295   -23.579 62.611 1.00 32.56  ? 36   ARG F C     1 
ATOM   3992  O  O     . ARG F 2 36  ? -0.058  -22.407 62.690 1.00 32.82  ? 36   ARG F O     1 
ATOM   3993  C  CB    . ARG F 2 36  ? 2.734   -24.225 62.652 1.00 32.86  ? 36   ARG F CB    1 
ATOM   3994  C  CG    . ARG F 2 36  ? 4.017   -24.371 63.476 1.00 32.30  ? 36   ARG F CG    1 
ATOM   3995  C  CD    . ARG F 2 36  ? 5.283   -24.223 62.629 1.00 33.14  ? 36   ARG F CD    1 
ATOM   3996  N  NE    . ARG F 2 36  ? 5.502   -25.311 61.658 1.00 34.73  ? 36   ARG F NE    1 
ATOM   3997  C  CZ    . ARG F 2 36  ? 6.169   -26.448 61.900 1.00 31.99  ? 36   ARG F CZ    1 
ATOM   3998  N  NH1   . ARG F 2 36  ? 6.702   -26.694 63.090 1.00 29.98  ? 36   ARG F NH1   1 
ATOM   3999  N  NH2   . ARG F 2 36  ? 6.304   -27.348 60.930 1.00 32.22  ? 36   ARG F NH2   1 
ATOM   4000  N  N     . LEU F 2 37  ? -0.259  -24.436 61.764 1.00 31.69  ? 37   LEU F N     1 
ATOM   4001  C  CA    . LEU F 2 37  ? -1.415  -24.076 60.951 1.00 30.78  ? 37   LEU F CA    1 
ATOM   4002  C  C     . LEU F 2 37  ? -2.590  -23.560 61.801 1.00 30.49  ? 37   LEU F C     1 
ATOM   4003  O  O     . LEU F 2 37  ? -3.244  -22.598 61.430 1.00 30.28  ? 37   LEU F O     1 
ATOM   4004  C  CB    . LEU F 2 37  ? -1.869  -25.248 60.082 1.00 30.67  ? 37   LEU F CB    1 
ATOM   4005  C  CG    . LEU F 2 37  ? -0.973  -25.687 58.912 1.00 30.95  ? 37   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F 2 37  ? -1.317  -27.080 58.432 1.00 29.67  ? 37   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F 2 37  ? -1.065  -24.743 57.760 1.00 31.17  ? 37   LEU F CD2   1 
ATOM   4008  N  N     . ALA F 2 38  ? -2.834  -24.172 62.952 1.00 30.24  ? 38   ALA F N     1 
ATOM   4009  C  CA    . ALA F 2 38  ? -3.919  -23.728 63.813 1.00 30.01  ? 38   ALA F CA    1 
ATOM   4010  C  C     . ALA F 2 38  ? -3.605  -22.345 64.390 1.00 30.00  ? 38   ALA F C     1 
ATOM   4011  O  O     . ALA F 2 38  ? -4.511  -21.531 64.580 1.00 29.76  ? 38   ALA F O     1 
ATOM   4012  C  CB    . ALA F 2 38  ? -4.183  -24.729 64.931 1.00 29.53  ? 38   ALA F CB    1 
ATOM   4013  N  N     . ARG F 2 39  ? -2.322  -22.100 64.667 1.00 29.67  ? 39   ARG F N     1 
ATOM   4014  C  CA    . ARG F 2 39  ? -1.872  -20.859 65.239 1.00 29.42  ? 39   ARG F CA    1 
ATOM   4015  C  C     . ARG F 2 39  ? -2.155  -19.759 64.227 1.00 29.50  ? 39   ARG F C     1 
ATOM   4016  O  O     . ARG F 2 39  ? -2.735  -18.722 64.559 1.00 29.18  ? 39   ARG F O     1 
ATOM   4017  C  CB    . ARG F 2 39  ? -0.370  -20.908 65.554 1.00 30.05  ? 39   ARG F CB    1 
ATOM   4018  C  CG    . ARG F 2 39  ? 0.033   -21.789 66.719 1.00 30.95  ? 39   ARG F CG    1 
ATOM   4019  C  CD    . ARG F 2 39  ? -0.613  -21.427 68.061 1.00 32.34  ? 39   ARG F CD    1 
ATOM   4020  N  NE    . ARG F 2 39  ? -0.031  -22.266 69.116 1.00 37.65  ? 39   ARG F NE    1 
ATOM   4021  C  CZ    . ARG F 2 39  ? -0.714  -23.034 69.953 1.00 38.95  ? 39   ARG F CZ    1 
ATOM   4022  N  NH1   . ARG F 2 39  ? -2.038  -23.060 69.912 1.00 41.45  ? 39   ARG F NH1   1 
ATOM   4023  N  NH2   . ARG F 2 39  ? -0.066  -23.759 70.853 1.00 40.91  ? 39   ARG F NH2   1 
ATOM   4024  N  N     . ARG F 2 40  ? -1.781  -19.999 62.978 1.00 28.87  ? 40   ARG F N     1 
ATOM   4025  C  CA    . ARG F 2 40  ? -2.062  -19.029 61.952 1.00 28.76  ? 40   ARG F CA    1 
ATOM   4026  C  C     . ARG F 2 40  ? -3.575  -18.760 61.819 1.00 29.17  ? 40   ARG F C     1 
ATOM   4027  O  O     . ARG F 2 40  ? -3.962  -17.653 61.458 1.00 29.82  ? 40   ARG F O     1 
ATOM   4028  C  CB    . ARG F 2 40  ? -1.417  -19.428 60.622 1.00 28.38  ? 40   ARG F CB    1 
ATOM   4029  C  CG    . ARG F 2 40  ? -1.491  -18.361 59.524 1.00 27.36  ? 40   ARG F CG    1 
ATOM   4030  C  CD    . ARG F 2 40  ? -0.500  -18.635 58.369 1.00 25.89  ? 40   ARG F CD    1 
ATOM   4031  N  NE    . ARG F 2 40  ? 0.872   -18.317 58.758 1.00 26.54  ? 40   ARG F NE    1 
ATOM   4032  C  CZ    . ARG F 2 40  ? 1.963   -18.599 58.044 1.00 24.57  ? 40   ARG F CZ    1 
ATOM   4033  N  NH1   . ARG F 2 40  ? 1.851   -19.246 56.918 1.00 22.70  ? 40   ARG F NH1   1 
ATOM   4034  N  NH2   . ARG F 2 40  ? 3.175   -18.246 58.478 1.00 24.10  ? 40   ARG F NH2   1 
ATOM   4035  N  N     . GLY F 2 41  ? -4.413  -19.746 62.153 1.00 29.04  ? 41   GLY F N     1 
ATOM   4036  C  CA    . GLY F 2 41  ? -5.863  -19.593 62.099 1.00 28.36  ? 41   GLY F CA    1 
ATOM   4037  C  C     . GLY F 2 41  ? -6.423  -19.047 63.385 1.00 28.65  ? 41   GLY F C     1 
ATOM   4038  O  O     . GLY F 2 41  ? -7.652  -18.998 63.554 1.00 28.85  ? 41   GLY F O     1 
ATOM   4039  N  N     . GLY F 2 42  ? -5.525  -18.677 64.308 1.00 28.55  ? 42   GLY F N     1 
ATOM   4040  C  CA    . GLY F 2 42  ? -5.894  -18.057 65.586 1.00 28.54  ? 42   GLY F CA    1 
ATOM   4041  C  C     . GLY F 2 42  ? -6.247  -18.965 66.752 1.00 29.12  ? 42   GLY F C     1 
ATOM   4042  O  O     . GLY F 2 42  ? -6.808  -18.510 67.749 1.00 28.62  ? 42   GLY F O     1 
ATOM   4043  N  N     . VAL F 2 43  ? -5.905  -20.248 66.653 1.00 29.89  ? 43   VAL F N     1 
ATOM   4044  C  CA    . VAL F 2 43  ? -6.308  -21.203 67.667 1.00 30.41  ? 43   VAL F CA    1 
ATOM   4045  C  C     . VAL F 2 43  ? -5.355  -21.164 68.826 1.00 31.00  ? 43   VAL F C     1 
ATOM   4046  O  O     . VAL F 2 43  ? -4.142  -21.159 68.641 1.00 30.81  ? 43   VAL F O     1 
ATOM   4047  C  CB    . VAL F 2 43  ? -6.413  -22.623 67.082 1.00 30.72  ? 43   VAL F CB    1 
ATOM   4048  C  CG1   . VAL F 2 43  ? -6.656  -23.652 68.182 1.00 28.85  ? 43   VAL F CG1   1 
ATOM   4049  C  CG2   . VAL F 2 43  ? -7.528  -22.651 66.025 1.00 30.94  ? 43   VAL F CG2   1 
ATOM   4050  N  N     . LYS F 2 44  ? -5.917  -21.147 70.027 1.00 32.32  ? 44   LYS F N     1 
ATOM   4051  C  CA    . LYS F 2 44  ? -5.122  -21.092 71.247 1.00 33.62  ? 44   LYS F CA    1 
ATOM   4052  C  C     . LYS F 2 44  ? -4.966  -22.443 71.951 1.00 34.04  ? 44   LYS F C     1 
ATOM   4053  O  O     . LYS F 2 44  ? -3.915  -22.699 72.533 1.00 34.86  ? 44   LYS F O     1 
ATOM   4054  C  CB    . LYS F 2 44  ? -5.695  -20.040 72.195 1.00 33.71  ? 44   LYS F CB    1 
ATOM   4055  C  CG    . LYS F 2 44  ? -4.840  -19.746 73.414 1.00 35.88  ? 44   LYS F CG    1 
ATOM   4056  C  CD    . LYS F 2 44  ? -5.624  -18.959 74.426 1.00 38.78  ? 44   LYS F CD    1 
ATOM   4057  C  CE    . LYS F 2 44  ? -4.791  -18.588 75.631 1.00 39.41  ? 44   LYS F CE    1 
ATOM   4058  N  NZ    . LYS F 2 44  ? -5.727  -18.302 76.762 1.00 41.48  ? 44   LYS F NZ    1 
ATOM   4059  N  N     . ARG F 2 45  ? -5.994  -23.294 71.910 1.00 34.37  ? 45   ARG F N     1 
ATOM   4060  C  CA    . ARG F 2 45  ? -5.936  -24.584 72.578 1.00 34.93  ? 45   ARG F CA    1 
ATOM   4061  C  C     . ARG F 2 45  ? -6.478  -25.705 71.688 1.00 35.07  ? 45   ARG F C     1 
ATOM   4062  O  O     . ARG F 2 45  ? -7.539  -25.557 71.057 1.00 35.04  ? 45   ARG F O     1 
ATOM   4063  C  CB    . ARG F 2 45  ? -6.669  -24.507 73.917 1.00 35.36  ? 45   ARG F CB    1 
ATOM   4064  C  CG    . ARG F 2 45  ? -6.072  -25.343 75.028 1.00 35.14  ? 45   ARG F CG    1 
ATOM   4065  C  CD    . ARG F 2 45  ? -6.850  -25.132 76.312 1.00 37.84  ? 45   ARG F CD    1 
ATOM   4066  N  NE    . ARG F 2 45  ? -6.466  -26.066 77.365 1.00 40.63  ? 45   ARG F NE    1 
ATOM   4067  C  CZ    . ARG F 2 45  ? -7.093  -27.210 77.622 1.00 42.53  ? 45   ARG F CZ    1 
ATOM   4068  N  NH1   . ARG F 2 45  ? -8.154  -27.575 76.908 1.00 41.46  ? 45   ARG F NH1   1 
ATOM   4069  N  NH2   . ARG F 2 45  ? -6.655  -27.989 78.610 1.00 44.43  ? 45   ARG F NH2   1 
ATOM   4070  N  N     . ILE F 2 46  ? -5.736  -26.816 71.656 1.00 35.10  ? 46   ILE F N     1 
ATOM   4071  C  CA    . ILE F 2 46  ? -5.943  -27.900 70.696 1.00 35.23  ? 46   ILE F CA    1 
ATOM   4072  C  C     . ILE F 2 46  ? -6.084  -29.242 71.411 1.00 36.17  ? 46   ILE F C     1 
ATOM   4073  O  O     . ILE F 2 46  ? -5.149  -29.722 72.093 1.00 36.61  ? 46   ILE F O     1 
ATOM   4074  C  CB    . ILE F 2 46  ? -4.765  -27.990 69.709 1.00 34.86  ? 46   ILE F CB    1 
ATOM   4075  C  CG1   . ILE F 2 46  ? -4.511  -26.627 69.044 1.00 34.01  ? 46   ILE F CG1   1 
ATOM   4076  C  CG2   . ILE F 2 46  ? -5.007  -29.074 68.684 1.00 35.01  ? 46   ILE F CG2   1 
ATOM   4077  C  CD1   . ILE F 2 46  ? -3.234  -26.556 68.184 1.00 31.93  ? 46   ILE F CD1   1 
ATOM   4078  N  N     . SER F 2 47  ? -7.259  -29.842 71.255 1.00 36.12  ? 47   SER F N     1 
ATOM   4079  C  CA    . SER F 2 47  ? -7.522  -31.176 71.777 1.00 35.94  ? 47   SER F CA    1 
ATOM   4080  C  C     . SER F 2 47  ? -6.638  -32.185 71.069 1.00 35.40  ? 47   SER F C     1 
ATOM   4081  O  O     . SER F 2 47  ? -6.343  -32.025 69.882 1.00 35.46  ? 47   SER F O     1 
ATOM   4082  C  CB    . SER F 2 47  ? -9.000  -31.523 71.587 1.00 35.91  ? 47   SER F CB    1 
ATOM   4083  O  OG    . SER F 2 47  ? -9.135  -32.794 71.001 1.00 38.48  ? 47   SER F OG    1 
ATOM   4084  N  N     . GLY F 2 48  ? -6.232  -33.229 71.791 1.00 34.97  ? 48   GLY F N     1 
ATOM   4085  C  CA    . GLY F 2 48  ? -5.402  -34.295 71.221 1.00 34.59  ? 48   GLY F CA    1 
ATOM   4086  C  C     . GLY F 2 48  ? -5.955  -35.017 69.990 1.00 34.44  ? 48   GLY F C     1 
ATOM   4087  O  O     . GLY F 2 48  ? -5.186  -35.558 69.195 1.00 34.32  ? 48   GLY F O     1 
ATOM   4088  N  N     . LEU F 2 49  ? -7.276  -35.021 69.815 1.00 33.96  ? 49   LEU F N     1 
ATOM   4089  C  CA    . LEU F 2 49  ? -7.875  -35.734 68.679 1.00 33.95  ? 49   LEU F CA    1 
ATOM   4090  C  C     . LEU F 2 49  ? -7.889  -34.938 67.363 1.00 33.15  ? 49   LEU F C     1 
ATOM   4091  O  O     . LEU F 2 49  ? -8.236  -35.478 66.306 1.00 32.86  ? 49   LEU F O     1 
ATOM   4092  C  CB    . LEU F 2 49  ? -9.277  -36.245 69.038 1.00 34.15  ? 49   LEU F CB    1 
ATOM   4093  C  CG    . LEU F 2 49  ? -9.388  -37.342 70.106 1.00 35.45  ? 49   LEU F CG    1 
ATOM   4094  C  CD1   . LEU F 2 49  ? -10.850 -37.512 70.478 1.00 37.02  ? 49   LEU F CD1   1 
ATOM   4095  C  CD2   . LEU F 2 49  ? -8.778  -38.673 69.651 1.00 35.12  ? 49   LEU F CD2   1 
ATOM   4096  N  N     . ILE F 2 50  ? -7.475  -33.668 67.437 1.00 32.69  ? 50   ILE F N     1 
ATOM   4097  C  CA    . ILE F 2 50  ? -7.499  -32.738 66.296 1.00 31.20  ? 50   ILE F CA    1 
ATOM   4098  C  C     . ILE F 2 50  ? -6.548  -33.187 65.203 1.00 31.23  ? 50   ILE F C     1 
ATOM   4099  O  O     . ILE F 2 50  ? -6.842  -33.029 64.012 1.00 31.17  ? 50   ILE F O     1 
ATOM   4100  C  CB    . ILE F 2 50  ? -7.139  -31.244 66.733 1.00 31.26  ? 50   ILE F CB    1 
ATOM   4101  C  CG1   . ILE F 2 50  ? -8.313  -30.520 67.411 1.00 30.46  ? 50   ILE F CG1   1 
ATOM   4102  C  CG2   . ILE F 2 50  ? -6.588  -30.402 65.562 1.00 28.50  ? 50   ILE F CG2   1 
ATOM   4103  C  CD1   . ILE F 2 50  ? -9.605  -30.400 66.591 1.00 30.79  ? 50   ILE F CD1   1 
ATOM   4104  N  N     . TYR F 2 51  ? -5.406  -33.739 65.604 1.00 30.89  ? 51   TYR F N     1 
ATOM   4105  C  CA    . TYR F 2 51  ? -4.365  -34.116 64.641 1.00 31.48  ? 51   TYR F CA    1 
ATOM   4106  C  C     . TYR F 2 51  ? -4.821  -35.177 63.642 1.00 31.57  ? 51   TYR F C     1 
ATOM   4107  O  O     . TYR F 2 51  ? -4.603  -35.011 62.449 1.00 31.42  ? 51   TYR F O     1 
ATOM   4108  C  CB    . TYR F 2 51  ? -3.048  -34.487 65.350 1.00 31.24  ? 51   TYR F CB    1 
ATOM   4109  C  CG    . TYR F 2 51  ? -2.698  -33.450 66.388 1.00 32.77  ? 51   TYR F CG    1 
ATOM   4110  C  CD1   . TYR F 2 51  ? -2.824  -33.719 67.754 1.00 32.75  ? 51   TYR F CD1   1 
ATOM   4111  C  CD2   . TYR F 2 51  ? -2.305  -32.160 65.995 1.00 33.28  ? 51   TYR F CD2   1 
ATOM   4112  C  CE1   . TYR F 2 51  ? -2.535  -32.726 68.711 1.00 33.85  ? 51   TYR F CE1   1 
ATOM   4113  C  CE2   . TYR F 2 51  ? -2.018  -31.177 66.924 1.00 33.80  ? 51   TYR F CE2   1 
ATOM   4114  C  CZ    . TYR F 2 51  ? -2.133  -31.462 68.276 1.00 35.22  ? 51   TYR F CZ    1 
ATOM   4115  O  OH    . TYR F 2 51  ? -1.843  -30.474 69.182 1.00 36.78  ? 51   TYR F OH    1 
ATOM   4116  N  N     . GLU F 2 52  ? -5.461  -36.247 64.107 1.00 32.41  ? 52   GLU F N     1 
ATOM   4117  C  CA    . GLU F 2 52  ? -5.976  -37.262 63.166 1.00 33.74  ? 52   GLU F CA    1 
ATOM   4118  C  C     . GLU F 2 52  ? -7.143  -36.711 62.336 1.00 32.93  ? 52   GLU F C     1 
ATOM   4119  O  O     . GLU F 2 52  ? -7.232  -36.973 61.142 1.00 33.11  ? 52   GLU F O     1 
ATOM   4120  C  CB    . GLU F 2 52  ? -6.368  -38.576 63.877 1.00 34.02  ? 52   GLU F CB    1 
ATOM   4121  C  CG    . GLU F 2 52  ? -5.179  -39.518 64.160 1.00 39.29  ? 52   GLU F CG    1 
ATOM   4122  C  CD    . GLU F 2 52  ? -4.350  -39.881 62.907 1.00 45.32  ? 52   GLU F CD    1 
ATOM   4123  O  OE1   . GLU F 2 52  ? -4.930  -40.299 61.866 1.00 48.65  ? 52   GLU F OE1   1 
ATOM   4124  O  OE2   . GLU F 2 52  ? -3.107  -39.767 62.968 1.00 45.39  ? 52   GLU F OE2   1 
ATOM   4125  N  N     . GLU F 2 53  ? -8.013  -35.925 62.960 1.00 32.14  ? 53   GLU F N     1 
ATOM   4126  C  CA    . GLU F 2 53  ? -9.136  -35.355 62.239 1.00 32.79  ? 53   GLU F CA    1 
ATOM   4127  C  C     . GLU F 2 53  ? -8.636  -34.471 61.088 1.00 32.46  ? 53   GLU F C     1 
ATOM   4128  O  O     . GLU F 2 53  ? -9.103  -34.593 59.947 1.00 32.87  ? 53   GLU F O     1 
ATOM   4129  C  CB    . GLU F 2 53  ? -10.033 -34.566 63.191 1.00 32.95  ? 53   GLU F CB    1 
ATOM   4130  C  CG    . GLU F 2 53  ? -11.358 -34.127 62.583 1.00 35.74  ? 53   GLU F CG    1 
ATOM   4131  C  CD    . GLU F 2 53  ? -12.444 -35.202 62.651 1.00 38.99  ? 53   GLU F CD    1 
ATOM   4132  O  OE1   . GLU F 2 53  ? -12.172 -36.323 63.141 1.00 41.02  ? 53   GLU F OE1   1 
ATOM   4133  O  OE2   . GLU F 2 53  ? -13.577 -34.925 62.202 1.00 40.71  ? 53   GLU F OE2   1 
ATOM   4134  N  N     . THR F 2 54  ? -7.646  -33.630 61.388 1.00 31.69  ? 54   THR F N     1 
ATOM   4135  C  CA    . THR F 2 54  ? -7.039  -32.752 60.389 1.00 31.50  ? 54   THR F CA    1 
ATOM   4136  C  C     . THR F 2 54  ? -6.383  -33.525 59.256 1.00 31.42  ? 54   THR F C     1 
ATOM   4137  O  O     . THR F 2 54  ? -6.576  -33.202 58.085 1.00 32.24  ? 54   THR F O     1 
ATOM   4138  C  CB    . THR F 2 54  ? -5.999  -31.757 61.017 1.00 31.94  ? 54   THR F CB    1 
ATOM   4139  O  OG1   . THR F 2 54  ? -6.628  -30.980 62.048 1.00 29.72  ? 54   THR F OG1   1 
ATOM   4140  C  CG2   . THR F 2 54  ? -5.426  -30.818 59.948 1.00 29.15  ? 54   THR F CG2   1 
ATOM   4141  N  N     . ARG F 2 55  ? -5.611  -34.547 59.594 1.00 31.32  ? 55   ARG F N     1 
ATOM   4142  C  CA    . ARG F 2 55  ? -5.018  -35.418 58.570 1.00 31.13  ? 55   ARG F CA    1 
ATOM   4143  C  C     . ARG F 2 55  ? -6.094  -35.950 57.633 1.00 30.49  ? 55   ARG F C     1 
ATOM   4144  O  O     . ARG F 2 55  ? -5.966  -35.848 56.406 1.00 30.76  ? 55   ARG F O     1 
ATOM   4145  C  CB    . ARG F 2 55  ? -4.216  -36.552 59.224 1.00 31.20  ? 55   ARG F CB    1 
ATOM   4146  C  CG    . ARG F 2 55  ? -2.918  -36.039 59.851 1.00 32.50  ? 55   ARG F CG    1 
ATOM   4147  C  CD    . ARG F 2 55  ? -2.025  -37.154 60.334 1.00 33.56  ? 55   ARG F CD    1 
ATOM   4148  N  NE    . ARG F 2 55  ? -0.960  -36.629 61.177 1.00 35.97  ? 55   ARG F NE    1 
ATOM   4149  C  CZ    . ARG F 2 55  ? -0.941  -36.686 62.508 1.00 35.75  ? 55   ARG F CZ    1 
ATOM   4150  N  NH1   . ARG F 2 55  ? -1.924  -37.267 63.172 1.00 33.00  ? 55   ARG F NH1   1 
ATOM   4151  N  NH2   . ARG F 2 55  ? 0.071   -36.151 63.174 1.00 36.33  ? 55   ARG F NH2   1 
ATOM   4152  N  N     . GLY F 2 56  ? -7.174  -36.470 58.212 1.00 29.59  ? 56   GLY F N     1 
ATOM   4153  C  CA    . GLY F 2 56  ? -8.287  -36.964 57.417 1.00 29.55  ? 56   GLY F CA    1 
ATOM   4154  C  C     . GLY F 2 56  ? -8.844  -35.900 56.501 1.00 29.40  ? 56   GLY F C     1 
ATOM   4155  O  O     . GLY F 2 56  ? -8.968  -36.137 55.306 1.00 30.21  ? 56   GLY F O     1 
ATOM   4156  N  N     . VAL F 2 57  ? -9.141  -34.717 57.054 1.00 28.89  ? 57   VAL F N     1 
ATOM   4157  C  CA    . VAL F 2 57  ? -9.675  -33.582 56.284 1.00 28.54  ? 57   VAL F CA    1 
ATOM   4158  C  C     . VAL F 2 57  ? -8.725  -33.189 55.145 1.00 28.56  ? 57   VAL F C     1 
ATOM   4159  O  O     . VAL F 2 57  ? -9.141  -32.977 54.003 1.00 28.64  ? 57   VAL F O     1 
ATOM   4160  C  CB    . VAL F 2 57  ? -9.988  -32.373 57.217 1.00 28.81  ? 57   VAL F CB    1 
ATOM   4161  C  CG1   . VAL F 2 57  ? -10.090 -31.075 56.441 1.00 28.45  ? 57   VAL F CG1   1 
ATOM   4162  C  CG2   . VAL F 2 57  ? -11.243 -32.620 58.055 1.00 28.57  ? 57   VAL F CG2   1 
ATOM   4163  N  N     . LEU F 2 58  ? -7.437  -33.135 55.428 1.00 28.78  ? 58   LEU F N     1 
ATOM   4164  C  CA    . LEU F 2 58  ? -6.473  -32.788 54.371 1.00 29.56  ? 58   LEU F CA    1 
ATOM   4165  C  C     . LEU F 2 58  ? -6.444  -33.816 53.237 1.00 30.73  ? 58   LEU F C     1 
ATOM   4166  O  O     . LEU F 2 58  ? -6.386  -33.454 52.053 1.00 31.50  ? 58   LEU F O     1 
ATOM   4167  C  CB    . LEU F 2 58  ? -5.078  -32.589 54.962 1.00 29.16  ? 58   LEU F CB    1 
ATOM   4168  C  CG    . LEU F 2 58  ? -3.907  -32.402 53.989 1.00 29.57  ? 58   LEU F CG    1 
ATOM   4169  C  CD1   . LEU F 2 58  ? -4.112  -31.214 53.042 1.00 26.38  ? 58   LEU F CD1   1 
ATOM   4170  C  CD2   . LEU F 2 58  ? -2.568  -32.262 54.757 1.00 29.09  ? 58   LEU F CD2   1 
ATOM   4171  N  N     . LYS F 2 59  ? -6.503  -35.099 53.588 1.00 31.69  ? 59   LYS F N     1 
ATOM   4172  C  CA    . LYS F 2 59  ? -6.549  -36.168 52.594 1.00 32.80  ? 59   LYS F CA    1 
ATOM   4173  C  C     . LYS F 2 59  ? -7.715  -36.023 51.631 1.00 32.52  ? 59   LYS F C     1 
ATOM   4174  O  O     . LYS F 2 59  ? -7.550  -36.155 50.414 1.00 32.33  ? 59   LYS F O     1 
ATOM   4175  C  CB    . LYS F 2 59  ? -6.614  -37.534 53.305 1.00 34.27  ? 59   LYS F CB    1 
ATOM   4176  C  CG    . LYS F 2 59  ? -6.650  -38.735 52.381 1.00 37.26  ? 59   LYS F CG    1 
ATOM   4177  C  CD    . LYS F 2 59  ? -6.082  -39.973 53.076 1.00 42.47  ? 59   LYS F CD    1 
ATOM   4178  C  CE    . LYS F 2 59  ? -6.645  -41.273 52.449 1.00 44.85  ? 59   LYS F CE    1 
ATOM   4179  N  NZ    . LYS F 2 59  ? -8.149  -41.434 52.627 1.00 44.64  ? 59   LYS F NZ    1 
ATOM   4180  N  N     . VAL F 2 60  ? -8.902  -35.759 52.170 1.00 32.71  ? 60   VAL F N     1 
ATOM   4181  C  CA    . VAL F 2 60  ? -10.079 -35.567 51.322 1.00 32.58  ? 60   VAL F CA    1 
ATOM   4182  C  C     . VAL F 2 60  ? -9.844  -34.378 50.400 1.00 32.90  ? 60   VAL F C     1 
ATOM   4183  O  O     . VAL F 2 60  ? -10.097 -34.457 49.190 1.00 33.74  ? 60   VAL F O     1 
ATOM   4184  C  CB    . VAL F 2 60  ? -11.373 -35.398 52.169 1.00 33.15  ? 60   VAL F CB    1 
ATOM   4185  C  CG1   . VAL F 2 60  ? -12.478 -34.720 51.380 1.00 31.63  ? 60   VAL F CG1   1 
ATOM   4186  C  CG2   . VAL F 2 60  ? -11.833 -36.781 52.712 1.00 32.34  ? 60   VAL F CG2   1 
ATOM   4187  N  N     . PHE F 2 61  ? -9.313  -33.294 50.960 1.00 32.31  ? 61   PHE F N     1 
ATOM   4188  C  CA    . PHE F 2 61  ? -9.044  -32.117 50.177 1.00 31.58  ? 61   PHE F CA    1 
ATOM   4189  C  C     . PHE F 2 61  ? -8.072  -32.434 49.045 1.00 31.90  ? 61   PHE F C     1 
ATOM   4190  O  O     . PHE F 2 61  ? -8.344  -32.110 47.896 1.00 32.26  ? 61   PHE F O     1 
ATOM   4191  C  CB    . PHE F 2 61  ? -8.530  -30.968 51.069 1.00 31.45  ? 61   PHE F CB    1 
ATOM   4192  C  CG    . PHE F 2 61  ? -8.192  -29.722 50.304 1.00 29.74  ? 61   PHE F CG    1 
ATOM   4193  C  CD1   . PHE F 2 61  ? -9.180  -28.792 50.034 1.00 26.18  ? 61   PHE F CD1   1 
ATOM   4194  C  CD2   . PHE F 2 61  ? -6.885  -29.488 49.830 1.00 29.86  ? 61   PHE F CD2   1 
ATOM   4195  C  CE1   . PHE F 2 61  ? -8.901  -27.632 49.337 1.00 27.76  ? 61   PHE F CE1   1 
ATOM   4196  C  CE2   . PHE F 2 61  ? -6.589  -28.299 49.112 1.00 30.40  ? 61   PHE F CE2   1 
ATOM   4197  C  CZ    . PHE F 2 61  ? -7.623  -27.376 48.868 1.00 28.97  ? 61   PHE F CZ    1 
ATOM   4198  N  N     . LEU F 2 62  ? -6.958  -33.091 49.347 1.00 32.19  ? 62   LEU F N     1 
ATOM   4199  C  CA    . LEU F 2 62  ? -5.984  -33.427 48.285 1.00 32.96  ? 62   LEU F CA    1 
ATOM   4200  C  C     . LEU F 2 62  ? -6.499  -34.409 47.229 1.00 33.75  ? 62   LEU F C     1 
ATOM   4201  O  O     . LEU F 2 62  ? -6.235  -34.245 46.030 1.00 34.15  ? 62   LEU F O     1 
ATOM   4202  C  CB    . LEU F 2 62  ? -4.693  -33.966 48.889 1.00 32.83  ? 62   LEU F CB    1 
ATOM   4203  C  CG    . LEU F 2 62  ? -3.746  -32.918 49.465 1.00 33.15  ? 62   LEU F CG    1 
ATOM   4204  C  CD1   . LEU F 2 62  ? -2.534  -33.598 50.121 1.00 30.26  ? 62   LEU F CD1   1 
ATOM   4205  C  CD2   . LEU F 2 62  ? -3.326  -31.930 48.356 1.00 30.71  ? 62   LEU F CD2   1 
ATOM   4206  N  N     . GLU F 2 63  ? -7.218  -35.438 47.667 1.00 34.13  ? 63   GLU F N     1 
ATOM   4207  C  CA    . GLU F 2 63  ? -7.790  -36.402 46.732 1.00 34.79  ? 63   GLU F CA    1 
ATOM   4208  C  C     . GLU F 2 63  ? -8.634  -35.703 45.695 1.00 34.27  ? 63   GLU F C     1 
ATOM   4209  O  O     . GLU F 2 63  ? -8.495  -35.963 44.494 1.00 33.89  ? 63   GLU F O     1 
ATOM   4210  C  CB    . GLU F 2 63  ? -8.663  -37.424 47.463 1.00 35.28  ? 63   GLU F CB    1 
ATOM   4211  C  CG    . GLU F 2 63  ? -7.898  -38.526 48.107 1.00 37.99  ? 63   GLU F CG    1 
ATOM   4212  C  CD    . GLU F 2 63  ? -8.675  -39.224 49.213 1.00 42.68  ? 63   GLU F CD    1 
ATOM   4213  O  OE1   . GLU F 2 63  ? -9.859  -38.878 49.460 1.00 42.62  ? 63   GLU F OE1   1 
ATOM   4214  O  OE2   . GLU F 2 63  ? -8.083  -40.137 49.838 1.00 46.21  ? 63   GLU F OE2   1 
ATOM   4215  N  N     . ASN F 2 64  ? -9.530  -34.831 46.169 1.00 34.67  ? 64   ASN F N     1 
ATOM   4216  C  CA    . ASN F 2 64  ? -10.409 -34.087 45.270 1.00 34.42  ? 64   ASN F CA    1 
ATOM   4217  C  C     . ASN F 2 64  ? -9.631  -33.238 44.293 1.00 33.80  ? 64   ASN F C     1 
ATOM   4218  O  O     . ASN F 2 64  ? -9.953  -33.231 43.123 1.00 34.33  ? 64   ASN F O     1 
ATOM   4219  C  CB    . ASN F 2 64  ? -11.450 -33.272 46.043 1.00 34.56  ? 64   ASN F CB    1 
ATOM   4220  C  CG    . ASN F 2 64  ? -12.416 -34.148 46.785 1.00 36.37  ? 64   ASN F CG    1 
ATOM   4221  O  OD1   . ASN F 2 64  ? -12.537 -35.330 46.484 1.00 41.43  ? 64   ASN F OD1   1 
ATOM   4222  N  ND2   . ASN F 2 64  ? -13.105 -33.592 47.760 1.00 39.44  ? 64   ASN F ND2   1 
ATOM   4223  N  N     . VAL F 2 65  ? -8.592  -32.550 44.754 1.00 33.61  ? 65   VAL F N     1 
ATOM   4224  C  CA    . VAL F 2 65  ? -7.880  -31.633 43.854 1.00 33.60  ? 65   VAL F CA    1 
ATOM   4225  C  C     . VAL F 2 65  ? -7.008  -32.416 42.909 1.00 33.14  ? 65   VAL F C     1 
ATOM   4226  O  O     . VAL F 2 65  ? -7.024  -32.172 41.708 1.00 32.57  ? 65   VAL F O     1 
ATOM   4227  C  CB    . VAL F 2 65  ? -7.030  -30.528 44.583 1.00 33.81  ? 65   VAL F CB    1 
ATOM   4228  C  CG1   . VAL F 2 65  ? -6.432  -29.544 43.543 1.00 33.55  ? 65   VAL F CG1   1 
ATOM   4229  C  CG2   . VAL F 2 65  ? -7.877  -29.767 45.545 1.00 33.32  ? 65   VAL F CG2   1 
ATOM   4230  N  N     . ILE F 2 66  ? -6.251  -33.364 43.456 1.00 33.65  ? 66   ILE F N     1 
ATOM   4231  C  CA    . ILE F 2 66  ? -5.391  -34.209 42.627 1.00 33.60  ? 66   ILE F CA    1 
ATOM   4232  C  C     . ILE F 2 66  ? -6.178  -34.989 41.563 1.00 34.11  ? 66   ILE F C     1 
ATOM   4233  O  O     . ILE F 2 66  ? -5.749  -35.061 40.412 1.00 34.22  ? 66   ILE F O     1 
ATOM   4234  C  CB    . ILE F 2 66  ? -4.498  -35.107 43.476 1.00 34.14  ? 66   ILE F CB    1 
ATOM   4235  C  CG1   . ILE F 2 66  ? -3.455  -34.234 44.203 1.00 33.28  ? 66   ILE F CG1   1 
ATOM   4236  C  CG2   . ILE F 2 66  ? -3.807  -36.152 42.594 1.00 33.52  ? 66   ILE F CG2   1 
ATOM   4237  C  CD1   . ILE F 2 66  ? -2.970  -34.784 45.506 1.00 32.90  ? 66   ILE F CD1   1 
ATOM   4238  N  N     . ARG F 2 67  ? -7.348  -35.514 41.920 1.00 34.38  ? 67   ARG F N     1 
ATOM   4239  C  CA    . ARG F 2 67  ? -8.189  -36.212 40.941 1.00 35.57  ? 67   ARG F CA    1 
ATOM   4240  C  C     . ARG F 2 67  ? -8.466  -35.354 39.701 1.00 34.90  ? 67   ARG F C     1 
ATOM   4241  O  O     . ARG F 2 67  ? -8.171  -35.774 38.586 1.00 35.01  ? 67   ARG F O     1 
ATOM   4242  C  CB    . ARG F 2 67  ? -9.499  -36.735 41.587 1.00 36.40  ? 67   ARG F CB    1 
ATOM   4243  C  CG    . ARG F 2 67  ? -10.444 -37.493 40.627 1.00 39.74  ? 67   ARG F CG    1 
ATOM   4244  C  CD    . ARG F 2 67  ? -11.819 -37.764 41.263 1.00 46.33  ? 67   ARG F CD    1 
ATOM   4245  N  NE    . ARG F 2 67  ? -11.699 -38.618 42.454 1.00 52.28  ? 67   ARG F NE    1 
ATOM   4246  C  CZ    . ARG F 2 67  ? -12.007 -38.256 43.708 1.00 54.26  ? 67   ARG F CZ    1 
ATOM   4247  N  NH1   . ARG F 2 67  ? -12.498 -37.042 43.977 1.00 53.59  ? 67   ARG F NH1   1 
ATOM   4248  N  NH2   . ARG F 2 67  ? -11.826 -39.120 44.707 1.00 53.65  ? 67   ARG F NH2   1 
ATOM   4249  N  N     . ASP F 2 68  ? -9.021  -34.153 39.897 1.00 34.90  ? 68   ASP F N     1 
ATOM   4250  C  CA    . ASP F 2 68  ? -9.282  -33.229 38.793 1.00 33.80  ? 68   ASP F CA    1 
ATOM   4251  C  C     . ASP F 2 68  ? -7.995  -32.807 38.092 1.00 33.40  ? 68   ASP F C     1 
ATOM   4252  O  O     . ASP F 2 68  ? -7.971  -32.743 36.871 1.00 33.69  ? 68   ASP F O     1 
ATOM   4253  C  CB    . ASP F 2 68  ? -10.074 -32.023 39.283 1.00 34.78  ? 68   ASP F CB    1 
ATOM   4254  C  CG    . ASP F 2 68  ? -11.508 -32.384 39.693 1.00 37.45  ? 68   ASP F CG    1 
ATOM   4255  O  OD1   . ASP F 2 68  ? -11.912 -33.567 39.572 1.00 40.46  ? 68   ASP F OD1   1 
ATOM   4256  O  OD2   . ASP F 2 68  ? -12.241 -31.479 40.132 1.00 39.86  ? 68   ASP F OD2   1 
ATOM   4257  N  N     . ALA F 2 69  ? -6.923  -32.547 38.849 1.00 32.61  ? 69   ALA F N     1 
ATOM   4258  C  CA    . ALA F 2 69  ? -5.637  -32.157 38.253 1.00 32.31  ? 69   ALA F CA    1 
ATOM   4259  C  C     . ALA F 2 69  ? -5.142  -33.247 37.310 1.00 32.58  ? 69   ALA F C     1 
ATOM   4260  O  O     . ALA F 2 69  ? -4.866  -32.991 36.135 1.00 32.30  ? 69   ALA F O     1 
ATOM   4261  C  CB    . ALA F 2 69  ? -4.590  -31.858 39.343 1.00 31.83  ? 69   ALA F CB    1 
ATOM   4262  N  N     . VAL F 2 70  ? -5.057  -34.471 37.836 1.00 33.07  ? 70   VAL F N     1 
ATOM   4263  C  CA    . VAL F 2 70  ? -4.699  -35.658 37.042 1.00 33.54  ? 70   VAL F CA    1 
ATOM   4264  C  C     . VAL F 2 70  ? -5.632  -35.867 35.842 1.00 34.08  ? 70   VAL F C     1 
ATOM   4265  O  O     . VAL F 2 70  ? -5.163  -36.195 34.747 1.00 34.51  ? 70   VAL F O     1 
ATOM   4266  C  CB    . VAL F 2 70  ? -4.587  -36.951 37.915 1.00 33.33  ? 70   VAL F CB    1 
ATOM   4267  C  CG1   . VAL F 2 70  ? -4.425  -38.183 37.040 1.00 33.20  ? 70   VAL F CG1   1 
ATOM   4268  C  CG2   . VAL F 2 70  ? -3.403  -36.841 38.877 1.00 32.45  ? 70   VAL F CG2   1 
ATOM   4269  N  N     . THR F 2 71  ? -6.935  -35.639 36.017 1.00 34.46  ? 71   THR F N     1 
ATOM   4270  C  CA    . THR F 2 71  ? -7.839  -35.701 34.863 1.00 34.80  ? 71   THR F CA    1 
ATOM   4271  C  C     . THR F 2 71  ? -7.415  -34.740 33.756 1.00 35.85  ? 71   THR F C     1 
ATOM   4272  O  O     . THR F 2 71  ? -7.329  -35.153 32.600 1.00 36.65  ? 71   THR F O     1 
ATOM   4273  C  CB    . THR F 2 71  ? -9.314  -35.467 35.234 1.00 34.59  ? 71   THR F CB    1 
ATOM   4274  O  OG1   . THR F 2 71  ? -9.681  -36.378 36.265 1.00 32.85  ? 71   THR F OG1   1 
ATOM   4275  C  CG2   . THR F 2 71  ? -10.213 -35.717 34.049 1.00 33.02  ? 71   THR F CG2   1 
ATOM   4276  N  N     . TYR F 2 72  ? -7.135  -33.473 34.098 1.00 36.61  ? 72   TYR F N     1 
ATOM   4277  C  CA    . TYR F 2 72  ? -6.592  -32.527 33.114 1.00 36.93  ? 72   TYR F CA    1 
ATOM   4278  C  C     . TYR F 2 72  ? -5.289  -33.028 32.472 1.00 37.85  ? 72   TYR F C     1 
ATOM   4279  O  O     . TYR F 2 72  ? -5.092  -32.891 31.258 1.00 37.81  ? 72   TYR F O     1 
ATOM   4280  C  CB    . TYR F 2 72  ? -6.374  -31.141 33.726 1.00 37.00  ? 72   TYR F CB    1 
ATOM   4281  C  CG    . TYR F 2 72  ? -7.650  -30.366 33.976 1.00 36.37  ? 72   TYR F CG    1 
ATOM   4282  C  CD1   . TYR F 2 72  ? -8.050  -30.054 35.269 1.00 37.07  ? 72   TYR F CD1   1 
ATOM   4283  C  CD2   . TYR F 2 72  ? -8.459  -29.959 32.927 1.00 35.94  ? 72   TYR F CD2   1 
ATOM   4284  C  CE1   . TYR F 2 72  ? -9.225  -29.363 35.505 1.00 35.97  ? 72   TYR F CE1   1 
ATOM   4285  C  CE2   . TYR F 2 72  ? -9.637  -29.271 33.154 1.00 36.70  ? 72   TYR F CE2   1 
ATOM   4286  C  CZ    . TYR F 2 72  ? -10.004 -28.971 34.441 1.00 37.09  ? 72   TYR F CZ    1 
ATOM   4287  O  OH    . TYR F 2 72  ? -11.164 -28.274 34.658 1.00 40.18  ? 72   TYR F OH    1 
ATOM   4288  N  N     . THR F 2 73  ? -4.402  -33.603 33.286 1.00 38.82  ? 73   THR F N     1 
ATOM   4289  C  CA    . THR F 2 73  ? -3.144  -34.162 32.784 1.00 39.97  ? 73   THR F CA    1 
ATOM   4290  C  C     . THR F 2 73  ? -3.410  -35.222 31.706 1.00 41.08  ? 73   THR F C     1 
ATOM   4291  O  O     . THR F 2 73  ? -2.872  -35.138 30.606 1.00 40.76  ? 73   THR F O     1 
ATOM   4292  C  CB    . THR F 2 73  ? -2.312  -34.797 33.911 1.00 39.82  ? 73   THR F CB    1 
ATOM   4293  O  OG1   . THR F 2 73  ? -2.190  -33.876 35.001 1.00 40.05  ? 73   THR F OG1   1 
ATOM   4294  C  CG2   . THR F 2 73  ? -0.932  -35.175 33.412 1.00 38.88  ? 73   THR F CG2   1 
ATOM   4295  N  N     . GLU F 2 74  ? -4.254  -36.200 32.024 1.00 42.37  ? 74   GLU F N     1 
ATOM   4296  C  CA    . GLU F 2 74  ? -4.554  -37.302 31.096 1.00 44.24  ? 74   GLU F CA    1 
ATOM   4297  C  C     . GLU F 2 74  ? -5.230  -36.820 29.833 1.00 44.40  ? 74   GLU F C     1 
ATOM   4298  O  O     . GLU F 2 74  ? -4.978  -37.363 28.745 1.00 44.14  ? 74   GLU F O     1 
ATOM   4299  C  CB    . GLU F 2 74  ? -5.459  -38.353 31.739 1.00 44.61  ? 74   GLU F CB    1 
ATOM   4300  C  CG    . GLU F 2 74  ? -4.771  -39.239 32.757 1.00 48.61  ? 74   GLU F CG    1 
ATOM   4301  C  CD    . GLU F 2 74  ? -5.753  -39.837 33.775 1.00 54.07  ? 74   GLU F CD    1 
ATOM   4302  O  OE1   . GLU F 2 74  ? -6.991  -39.722 33.591 1.00 56.32  ? 74   GLU F OE1   1 
ATOM   4303  O  OE2   . GLU F 2 74  ? -5.286  -40.417 34.776 1.00 56.35  ? 74   GLU F OE2   1 
ATOM   4304  N  N     . HIS F 2 75  ? -6.095  -35.811 29.973 1.00 44.78  ? 75   HIS F N     1 
ATOM   4305  C  CA    . HIS F 2 75  ? -6.808  -35.296 28.807 1.00 45.11  ? 75   HIS F CA    1 
ATOM   4306  C  C     . HIS F 2 75  ? -5.830  -34.677 27.829 1.00 45.54  ? 75   HIS F C     1 
ATOM   4307  O  O     . HIS F 2 75  ? -6.028  -34.759 26.617 1.00 46.21  ? 75   HIS F O     1 
ATOM   4308  C  CB    . HIS F 2 75  ? -7.884  -34.278 29.166 1.00 45.09  ? 75   HIS F CB    1 
ATOM   4309  C  CG    . HIS F 2 75  ? -8.614  -33.769 27.965 1.00 44.87  ? 75   HIS F CG    1 
ATOM   4310  N  ND1   . HIS F 2 75  ? -9.674  -34.444 27.403 1.00 43.21  ? 75   HIS F ND1   1 
ATOM   4311  C  CD2   . HIS F 2 75  ? -8.386  -32.695 27.174 1.00 44.88  ? 75   HIS F CD2   1 
ATOM   4312  C  CE1   . HIS F 2 75  ? -10.087 -33.791 26.333 1.00 44.68  ? 75   HIS F CE1   1 
ATOM   4313  N  NE2   . HIS F 2 75  ? -9.321  -32.727 26.169 1.00 45.36  ? 75   HIS F NE2   1 
ATOM   4314  N  N     . ALA F 2 76  ? -4.774  -34.072 28.370 1.00 45.64  ? 76   ALA F N     1 
ATOM   4315  C  CA    . ALA F 2 76  ? -3.751  -33.410 27.582 1.00 45.70  ? 76   ALA F CA    1 
ATOM   4316  C  C     . ALA F 2 76  ? -2.785  -34.427 26.997 1.00 45.89  ? 76   ALA F C     1 
ATOM   4317  O  O     . ALA F 2 76  ? -2.018  -34.102 26.089 1.00 46.07  ? 76   ALA F O     1 
ATOM   4318  C  CB    . ALA F 2 76  ? -3.006  -32.407 28.442 1.00 45.57  ? 76   ALA F CB    1 
ATOM   4319  N  N     . LYS F 2 77  ? -2.832  -35.650 27.528 1.00 46.17  ? 77   LYS F N     1 
ATOM   4320  C  CA    . LYS F 2 77  ? -1.926  -36.750 27.143 1.00 46.76  ? 77   LYS F CA    1 
ATOM   4321  C  C     . LYS F 2 77  ? -0.479  -36.531 27.596 1.00 46.59  ? 77   LYS F C     1 
ATOM   4322  O  O     . LYS F 2 77  ? 0.469   -36.851 26.866 1.00 47.03  ? 77   LYS F O     1 
ATOM   4323  C  CB    . LYS F 2 77  ? -1.981  -37.022 25.633 1.00 46.85  ? 77   LYS F CB    1 
ATOM   4324  C  CG    . LYS F 2 77  ? -3.229  -37.760 25.197 1.00 48.89  ? 77   LYS F CG    1 
ATOM   4325  C  CD    . LYS F 2 77  ? -3.570  -37.480 23.751 1.00 51.44  ? 77   LYS F CD    1 
ATOM   4326  C  CE    . LYS F 2 77  ? -4.897  -38.130 23.391 1.00 54.66  ? 77   LYS F CE    1 
ATOM   4327  N  NZ    . LYS F 2 77  ? -5.353  -37.746 22.005 1.00 57.49  ? 77   LYS F NZ    1 
ATOM   4328  N  N     . ARG F 2 78  ? -0.321  -35.980 28.793 1.00 45.92  ? 78   ARG F N     1 
ATOM   4329  C  CA    . ARG F 2 78  ? 0.982   -35.794 29.388 1.00 45.54  ? 78   ARG F CA    1 
ATOM   4330  C  C     . ARG F 2 78  ? 1.161   -36.833 30.478 1.00 45.42  ? 78   ARG F C     1 
ATOM   4331  O  O     . ARG F 2 78  ? 0.198   -37.462 30.909 1.00 45.10  ? 78   ARG F O     1 
ATOM   4332  C  CB    . ARG F 2 78  ? 1.127   -34.368 29.946 1.00 45.55  ? 78   ARG F CB    1 
ATOM   4333  C  CG    . ARG F 2 78  ? 1.427   -33.312 28.889 1.00 44.76  ? 78   ARG F CG    1 
ATOM   4334  C  CD    . ARG F 2 78  ? 1.538   -31.906 29.490 1.00 45.29  ? 78   ARG F CD    1 
ATOM   4335  N  NE    . ARG F 2 78  ? 0.239   -31.230 29.680 1.00 43.34  ? 78   ARG F NE    1 
ATOM   4336  C  CZ    . ARG F 2 78  ? -0.410  -31.149 30.843 1.00 42.31  ? 78   ARG F CZ    1 
ATOM   4337  N  NH1   . ARG F 2 78  ? 0.089   -31.720 31.943 1.00 38.73  ? 78   ARG F NH1   1 
ATOM   4338  N  NH2   . ARG F 2 78  ? -1.569  -30.496 30.906 1.00 41.60  ? 78   ARG F NH2   1 
ATOM   4339  N  N     . LYS F 2 79  ? 2.404   -37.024 30.902 1.00 45.92  ? 79   LYS F N     1 
ATOM   4340  C  CA    . LYS F 2 79  ? 2.723   -37.875 32.047 1.00 46.21  ? 79   LYS F CA    1 
ATOM   4341  C  C     . LYS F 2 79  ? 3.044   -36.990 33.250 1.00 45.34  ? 79   LYS F C     1 
ATOM   4342  O  O     . LYS F 2 79  ? 3.238   -37.476 34.371 1.00 45.56  ? 79   LYS F O     1 
ATOM   4343  C  CB    . LYS F 2 79  ? 3.922   -38.774 31.715 1.00 46.90  ? 79   LYS F CB    1 
ATOM   4344  C  CG    . LYS F 2 79  ? 3.702   -39.673 30.486 1.00 49.97  ? 79   LYS F CG    1 
ATOM   4345  C  CD    . LYS F 2 79  ? 4.615   -40.915 30.513 1.00 55.75  ? 79   LYS F CD    1 
ATOM   4346  C  CE    . LYS F 2 79  ? 4.716   -41.552 29.119 1.00 59.16  ? 79   LYS F CE    1 
ATOM   4347  N  NZ    . LYS F 2 79  ? 5.441   -42.871 29.151 1.00 62.02  ? 79   LYS F NZ    1 
ATOM   4348  N  N     . THR F 2 80  ? 3.105   -35.689 33.001 1.00 44.35  ? 80   THR F N     1 
ATOM   4349  C  CA    . THR F 2 80  ? 3.571   -34.729 33.989 1.00 43.63  ? 80   THR F CA    1 
ATOM   4350  C  C     . THR F 2 80  ? 2.435   -33.794 34.399 1.00 42.33  ? 80   THR F C     1 
ATOM   4351  O  O     . THR F 2 80  ? 1.780   -33.168 33.565 1.00 41.97  ? 80   THR F O     1 
ATOM   4352  C  CB    . THR F 2 80  ? 4.783   -33.935 33.449 1.00 43.98  ? 80   THR F CB    1 
ATOM   4353  O  OG1   . THR F 2 80  ? 5.697   -34.853 32.820 1.00 45.60  ? 80   THR F OG1   1 
ATOM   4354  C  CG2   . THR F 2 80  ? 5.506   -33.193 34.586 1.00 43.59  ? 80   THR F CG2   1 
ATOM   4355  N  N     . VAL F 2 81  ? 2.195   -33.733 35.697 1.00 41.21  ? 81   VAL F N     1 
ATOM   4356  C  CA    . VAL F 2 81  ? 1.189   -32.840 36.250 1.00 40.13  ? 81   VAL F CA    1 
ATOM   4357  C  C     . VAL F 2 81  ? 1.799   -31.438 36.333 1.00 39.32  ? 81   VAL F C     1 
ATOM   4358  O  O     . VAL F 2 81  ? 2.831   -31.243 36.981 1.00 38.67  ? 81   VAL F O     1 
ATOM   4359  C  CB    . VAL F 2 81  ? 0.714   -33.309 37.634 1.00 40.01  ? 81   VAL F CB    1 
ATOM   4360  C  CG1   . VAL F 2 81  ? -0.393  -32.388 38.156 1.00 40.35  ? 81   VAL F CG1   1 
ATOM   4361  C  CG2   . VAL F 2 81  ? 0.236   -34.778 37.584 1.00 38.65  ? 81   VAL F CG2   1 
ATOM   4362  N  N     . THR F 2 82  ? 1.178   -30.492 35.632 1.00 38.75  ? 82   THR F N     1 
ATOM   4363  C  CA    . THR F 2 82  ? 1.663   -29.112 35.572 1.00 39.03  ? 82   THR F CA    1 
ATOM   4364  C  C     . THR F 2 82  ? 1.017   -28.231 36.638 1.00 38.81  ? 82   THR F C     1 
ATOM   4365  O  O     . THR F 2 82  ? -0.096  -28.521 37.126 1.00 38.53  ? 82   THR F O     1 
ATOM   4366  C  CB    . THR F 2 82  ? 1.386   -28.466 34.196 1.00 39.00  ? 82   THR F CB    1 
ATOM   4367  O  OG1   . THR F 2 82  ? -0.027  -28.467 33.947 1.00 39.49  ? 82   THR F OG1   1 
ATOM   4368  C  CG2   . THR F 2 82  ? 2.093   -29.218 33.081 1.00 39.07  ? 82   THR F CG2   1 
ATOM   4369  N  N     . ALA F 2 83  ? 1.708   -27.139 36.973 1.00 38.46  ? 83   ALA F N     1 
ATOM   4370  C  CA    . ALA F 2 83  ? 1.128   -26.083 37.790 1.00 37.75  ? 83   ALA F CA    1 
ATOM   4371  C  C     . ALA F 2 83  ? -0.258  -25.718 37.245 1.00 37.60  ? 83   ALA F C     1 
ATOM   4372  O  O     . ALA F 2 83  ? -1.195  -25.497 38.015 1.00 37.68  ? 83   ALA F O     1 
ATOM   4373  C  CB    . ALA F 2 83  ? 2.023   -24.880 37.798 1.00 37.75  ? 83   ALA F CB    1 
ATOM   4374  N  N     . MET F 2 84  ? -0.387  -25.682 35.922 1.00 37.07  ? 84   MET F N     1 
ATOM   4375  C  CA    . MET F 2 84  ? -1.643  -25.294 35.299 1.00 37.46  ? 84   MET F CA    1 
ATOM   4376  C  C     . MET F 2 84  ? -2.760  -26.313 35.519 1.00 37.14  ? 84   MET F C     1 
ATOM   4377  O  O     . MET F 2 84  ? -3.906  -25.925 35.753 1.00 37.84  ? 84   MET F O     1 
ATOM   4378  C  CB    . MET F 2 84  ? -1.454  -24.944 33.815 1.00 37.65  ? 84   MET F CB    1 
ATOM   4379  C  CG    . MET F 2 84  ? -0.757  -23.563 33.592 1.00 40.39  ? 84   MET F CG    1 
ATOM   4380  S  SD    . MET F 2 84  ? -1.327  -22.162 34.648 1.00 45.75  ? 84   MET F SD    1 
ATOM   4381  C  CE    . MET F 2 84  ? -3.038  -22.001 34.110 1.00 45.39  ? 84   MET F CE    1 
ATOM   4382  N  N     . ASP F 2 85  ? -2.433  -27.605 35.466 1.00 36.40  ? 85   ASP F N     1 
ATOM   4383  C  CA    . ASP F 2 85  ? -3.388  -28.658 35.823 1.00 35.74  ? 85   ASP F CA    1 
ATOM   4384  C  C     . ASP F 2 85  ? -3.975  -28.442 37.213 1.00 34.43  ? 85   ASP F C     1 
ATOM   4385  O  O     . ASP F 2 85  ? -5.168  -28.579 37.397 1.00 34.20  ? 85   ASP F O     1 
ATOM   4386  C  CB    . ASP F 2 85  ? -2.746  -30.067 35.773 1.00 36.47  ? 85   ASP F CB    1 
ATOM   4387  C  CG    . ASP F 2 85  ? -2.341  -30.491 34.368 1.00 38.31  ? 85   ASP F CG    1 
ATOM   4388  O  OD1   . ASP F 2 85  ? -2.996  -30.062 33.380 1.00 39.66  ? 85   ASP F OD1   1 
ATOM   4389  O  OD2   . ASP F 2 85  ? -1.351  -31.247 34.260 1.00 37.98  ? 85   ASP F OD2   1 
ATOM   4390  N  N     . VAL F 2 86  ? -3.121  -28.130 38.180 1.00 33.44  ? 86   VAL F N     1 
ATOM   4391  C  CA    . VAL F 2 86  ? -3.538  -27.836 39.548 1.00 32.90  ? 86   VAL F CA    1 
ATOM   4392  C  C     . VAL F 2 86  ? -4.379  -26.547 39.643 1.00 33.20  ? 86   VAL F C     1 
ATOM   4393  O  O     . VAL F 2 86  ? -5.437  -26.526 40.293 1.00 32.60  ? 86   VAL F O     1 
ATOM   4394  C  CB    . VAL F 2 86  ? -2.323  -27.721 40.469 1.00 32.72  ? 86   VAL F CB    1 
ATOM   4395  C  CG1   . VAL F 2 86  ? -2.753  -27.361 41.882 1.00 31.45  ? 86   VAL F CG1   1 
ATOM   4396  C  CG2   . VAL F 2 86  ? -1.522  -29.045 40.451 1.00 32.59  ? 86   VAL F CG2   1 
ATOM   4397  N  N     . VAL F 2 87  ? -3.919  -25.493 38.975 1.00 33.36  ? 87   VAL F N     1 
ATOM   4398  C  CA    . VAL F 2 87  ? -4.623  -24.229 39.012 1.00 34.18  ? 87   VAL F CA    1 
ATOM   4399  C  C     . VAL F 2 87  ? -6.045  -24.392 38.449 1.00 35.19  ? 87   VAL F C     1 
ATOM   4400  O  O     . VAL F 2 87  ? -6.993  -23.924 39.060 1.00 35.22  ? 87   VAL F O     1 
ATOM   4401  C  CB    . VAL F 2 87  ? -3.784  -23.069 38.370 1.00 34.30  ? 87   VAL F CB    1 
ATOM   4402  C  CG1   . VAL F 2 87  ? -4.637  -21.831 38.127 1.00 32.12  ? 87   VAL F CG1   1 
ATOM   4403  C  CG2   . VAL F 2 87  ? -2.574  -22.724 39.273 1.00 32.69  ? 87   VAL F CG2   1 
ATOM   4404  N  N     . TYR F 2 88  ? -6.202  -25.118 37.344 1.00 36.21  ? 88   TYR F N     1 
ATOM   4405  C  CA    . TYR F 2 88  ? -7.541  -25.349 36.776 1.00 37.51  ? 88   TYR F CA    1 
ATOM   4406  C  C     . TYR F 2 88  ? -8.427  -26.222 37.636 1.00 37.21  ? 88   TYR F C     1 
ATOM   4407  O  O     . TYR F 2 88  ? -9.647  -26.010 37.683 1.00 37.21  ? 88   TYR F O     1 
ATOM   4408  C  CB    . TYR F 2 88  ? -7.483  -25.957 35.380 1.00 38.37  ? 88   TYR F CB    1 
ATOM   4409  C  CG    . TYR F 2 88  ? -6.770  -25.117 34.346 1.00 41.87  ? 88   TYR F CG    1 
ATOM   4410  C  CD1   . TYR F 2 88  ? -5.959  -25.725 33.396 1.00 43.89  ? 88   TYR F CD1   1 
ATOM   4411  C  CD2   . TYR F 2 88  ? -6.907  -23.718 34.311 1.00 45.41  ? 88   TYR F CD2   1 
ATOM   4412  C  CE1   . TYR F 2 88  ? -5.301  -24.989 32.426 1.00 45.97  ? 88   TYR F CE1   1 
ATOM   4413  C  CE2   . TYR F 2 88  ? -6.231  -22.956 33.342 1.00 47.46  ? 88   TYR F CE2   1 
ATOM   4414  C  CZ    . TYR F 2 88  ? -5.437  -23.617 32.398 1.00 47.92  ? 88   TYR F CZ    1 
ATOM   4415  O  OH    . TYR F 2 88  ? -4.763  -22.921 31.425 1.00 50.36  ? 88   TYR F OH    1 
ATOM   4416  N  N     . ALA F 2 89  ? -7.808  -27.191 38.314 1.00 36.91  ? 89   ALA F N     1 
ATOM   4417  C  CA    . ALA F 2 89  ? -8.507  -28.058 39.265 1.00 36.50  ? 89   ALA F CA    1 
ATOM   4418  C  C     . ALA F 2 89  ? -9.011  -27.245 40.438 1.00 36.38  ? 89   ALA F C     1 
ATOM   4419  O  O     . ALA F 2 89  ? -10.151 -27.406 40.862 1.00 36.12  ? 89   ALA F O     1 
ATOM   4420  C  CB    . ALA F 2 89  ? -7.586  -29.182 39.750 1.00 36.11  ? 89   ALA F CB    1 
ATOM   4421  N  N     . LEU F 2 90  ? -8.162  -26.361 40.961 1.00 36.78  ? 90   LEU F N     1 
ATOM   4422  C  CA    . LEU F 2 90  ? -8.595  -25.461 42.018 1.00 36.81  ? 90   LEU F CA    1 
ATOM   4423  C  C     . LEU F 2 90  ? -9.729  -24.539 41.545 1.00 37.88  ? 90   LEU F C     1 
ATOM   4424  O  O     . LEU F 2 90  ? -10.755 -24.427 42.222 1.00 37.80  ? 90   LEU F O     1 
ATOM   4425  C  CB    . LEU F 2 90  ? -7.420  -24.682 42.570 1.00 36.76  ? 90   LEU F CB    1 
ATOM   4426  C  CG    . LEU F 2 90  ? -6.338  -25.498 43.293 1.00 34.76  ? 90   LEU F CG    1 
ATOM   4427  C  CD1   . LEU F 2 90  ? -5.100  -24.633 43.357 1.00 32.09  ? 90   LEU F CD1   1 
ATOM   4428  C  CD2   . LEU F 2 90  ? -6.773  -25.956 44.699 1.00 30.66  ? 90   LEU F CD2   1 
ATOM   4429  N  N     . LYS F 2 91  ? -9.596  -23.926 40.375 1.00 38.72  ? 91   LYS F N     1 
ATOM   4430  C  CA    . LYS F 2 91  ? -10.672 -23.043 39.914 1.00 40.77  ? 91   LYS F CA    1 
ATOM   4431  C  C     . LYS F 2 91  ? -12.013 -23.785 39.857 1.00 41.60  ? 91   LYS F C     1 
ATOM   4432  O  O     . LYS F 2 91  ? -13.043 -23.266 40.308 1.00 41.94  ? 91   LYS F O     1 
ATOM   4433  C  CB    . LYS F 2 91  ? -10.345 -22.384 38.570 1.00 41.14  ? 91   LYS F CB    1 
ATOM   4434  C  CG    . LYS F 2 91  ? -11.320 -21.260 38.194 1.00 44.14  ? 91   LYS F CG    1 
ATOM   4435  C  CD    . LYS F 2 91  ? -10.859 -20.477 36.973 1.00 48.70  ? 91   LYS F CD    1 
ATOM   4436  C  CE    . LYS F 2 91  ? -10.098 -19.222 37.383 1.00 53.14  ? 91   LYS F CE    1 
ATOM   4437  N  NZ    . LYS F 2 91  ? -9.808  -18.336 36.192 1.00 55.25  ? 91   LYS F NZ    1 
ATOM   4438  N  N     . ARG F 2 92  ? -11.986 -25.007 39.322 1.00 42.29  ? 92   ARG F N     1 
ATOM   4439  C  CA    . ARG F 2 92  ? -13.178 -25.844 39.183 1.00 43.14  ? 92   ARG F CA    1 
ATOM   4440  C  C     . ARG F 2 92  ? -13.907 -26.032 40.488 1.00 42.71  ? 92   ARG F C     1 
ATOM   4441  O  O     . ARG F 2 92  ? -15.127 -26.112 40.520 1.00 43.29  ? 92   ARG F O     1 
ATOM   4442  C  CB    . ARG F 2 92  ? -12.799 -27.236 38.702 1.00 43.89  ? 92   ARG F CB    1 
ATOM   4443  C  CG    . ARG F 2 92  ? -12.996 -27.471 37.239 1.00 46.41  ? 92   ARG F CG    1 
ATOM   4444  C  CD    . ARG F 2 92  ? -13.280 -28.962 37.015 1.00 48.14  ? 92   ARG F CD    1 
ATOM   4445  N  NE    . ARG F 2 92  ? -14.715 -29.211 37.072 1.00 48.70  ? 92   ARG F NE    1 
ATOM   4446  C  CZ    . ARG F 2 92  ? -15.353 -29.785 38.090 1.00 50.38  ? 92   ARG F CZ    1 
ATOM   4447  N  NH1   . ARG F 2 92  ? -14.698 -30.212 39.164 1.00 47.91  ? 92   ARG F NH1   1 
ATOM   4448  N  NH2   . ARG F 2 92  ? -16.675 -29.938 38.023 1.00 52.69  ? 92   ARG F NH2   1 
ATOM   4449  N  N     . GLN F 2 93  ? -13.138 -26.134 41.558 1.00 42.09  ? 93   GLN F N     1 
ATOM   4450  C  CA    . GLN F 2 93  ? -13.673 -26.364 42.880 1.00 41.44  ? 93   GLN F CA    1 
ATOM   4451  C  C     . GLN F 2 93  ? -13.956 -25.112 43.680 1.00 40.05  ? 93   GLN F C     1 
ATOM   4452  O  O     . GLN F 2 93  ? -14.262 -25.200 44.867 1.00 39.93  ? 93   GLN F O     1 
ATOM   4453  C  CB    . GLN F 2 93  ? -12.707 -27.254 43.633 1.00 42.46  ? 93   GLN F CB    1 
ATOM   4454  C  CG    . GLN F 2 93  ? -12.989 -28.712 43.345 1.00 46.00  ? 93   GLN F CG    1 
ATOM   4455  C  CD    . GLN F 2 93  ? -11.756 -29.539 43.392 1.00 49.99  ? 93   GLN F CD    1 
ATOM   4456  O  OE1   . GLN F 2 93  ? -11.036 -29.531 44.393 1.00 51.61  ? 93   GLN F OE1   1 
ATOM   4457  N  NE2   . GLN F 2 93  ? -11.488 -30.274 42.306 1.00 51.24  ? 93   GLN F NE2   1 
ATOM   4458  N  N     . GLY F 2 94  ? -13.877 -23.951 43.020 1.00 39.13  ? 94   GLY F N     1 
ATOM   4459  C  CA    . GLY F 2 94  ? -14.106 -22.656 43.656 1.00 37.62  ? 94   GLY F CA    1 
ATOM   4460  C  C     . GLY F 2 94  ? -13.045 -22.266 44.681 1.00 37.37  ? 94   GLY F C     1 
ATOM   4461  O  O     . GLY F 2 94  ? -13.347 -21.539 45.631 1.00 37.53  ? 94   GLY F O     1 
ATOM   4462  N  N     . ARG F 2 95  ? -11.810 -22.753 44.500 1.00 36.59  ? 95   ARG F N     1 
ATOM   4463  C  CA    . ARG F 2 95  ? -10.676 -22.362 45.345 1.00 35.79  ? 95   ARG F CA    1 
ATOM   4464  C  C     . ARG F 2 95  ? -9.559  -21.785 44.458 1.00 34.97  ? 95   ARG F C     1 
ATOM   4465  O  O     . ARG F 2 95  ? -8.384  -22.209 44.546 1.00 35.04  ? 95   ARG F O     1 
ATOM   4466  C  CB    . ARG F 2 95  ? -10.122 -23.534 46.170 1.00 36.05  ? 95   ARG F CB    1 
ATOM   4467  C  CG    . ARG F 2 95  ? -11.121 -24.536 46.774 1.00 39.64  ? 95   ARG F CG    1 
ATOM   4468  C  CD    . ARG F 2 95  ? -11.364 -24.314 48.262 1.00 44.71  ? 95   ARG F CD    1 
ATOM   4469  N  NE    . ARG F 2 95  ? -10.309 -23.521 48.911 1.00 46.84  ? 95   ARG F NE    1 
ATOM   4470  C  CZ    . ARG F 2 95  ? -10.436 -22.896 50.086 1.00 47.49  ? 95   ARG F CZ    1 
ATOM   4471  N  NH1   . ARG F 2 95  ? -11.577 -22.954 50.767 1.00 48.37  ? 95   ARG F NH1   1 
ATOM   4472  N  NH2   . ARG F 2 95  ? -9.420  -22.197 50.578 1.00 46.93  ? 95   ARG F NH2   1 
ATOM   4473  N  N     . THR F 2 96  ? -9.927  -20.823 43.612 1.00 33.79  ? 96   THR F N     1 
ATOM   4474  C  CA    . THR F 2 96  ? -8.993  -20.064 42.753 1.00 32.83  ? 96   THR F CA    1 
ATOM   4475  C  C     . THR F 2 96  ? -7.699  -19.645 43.448 1.00 31.59  ? 96   THR F C     1 
ATOM   4476  O  O     . THR F 2 96  ? -7.708  -19.117 44.545 1.00 31.91  ? 96   THR F O     1 
ATOM   4477  C  CB    . THR F 2 96  ? -9.664  -18.824 42.182 1.00 32.46  ? 96   THR F CB    1 
ATOM   4478  O  OG1   . THR F 2 96  ? -10.869 -19.216 41.529 1.00 37.01  ? 96   THR F OG1   1 
ATOM   4479  C  CG2   . THR F 2 96  ? -8.794  -18.154 41.164 1.00 33.25  ? 96   THR F CG2   1 
ATOM   4480  N  N     . LEU F 2 97  ? -6.589  -19.909 42.790 1.00 30.72  ? 97   LEU F N     1 
ATOM   4481  C  CA    . LEU F 2 97  ? -5.271  -19.637 43.325 1.00 30.68  ? 97   LEU F CA    1 
ATOM   4482  C  C     . LEU F 2 97  ? -4.536  -18.674 42.413 1.00 30.49  ? 97   LEU F C     1 
ATOM   4483  O  O     . LEU F 2 97  ? -4.430  -18.930 41.208 1.00 29.67  ? 97   LEU F O     1 
ATOM   4484  C  CB    . LEU F 2 97  ? -4.452  -20.921 43.407 1.00 29.97  ? 97   LEU F CB    1 
ATOM   4485  C  CG    . LEU F 2 97  ? -3.050  -20.843 44.021 1.00 30.02  ? 97   LEU F CG    1 
ATOM   4486  C  CD1   . LEU F 2 97  ? -3.055  -20.320 45.470 1.00 28.89  ? 97   LEU F CD1   1 
ATOM   4487  C  CD2   . LEU F 2 97  ? -2.394  -22.218 43.975 1.00 27.49  ? 97   LEU F CD2   1 
ATOM   4488  N  N     . TYR F 2 98  ? -4.027  -17.583 42.987 1.00 30.09  ? 98   TYR F N     1 
ATOM   4489  C  CA    . TYR F 2 98  ? -3.149  -16.697 42.247 1.00 30.12  ? 98   TYR F CA    1 
ATOM   4490  C  C     . TYR F 2 98  ? -1.714  -16.981 42.649 1.00 30.68  ? 98   TYR F C     1 
ATOM   4491  O  O     . TYR F 2 98  ? -1.423  -17.148 43.839 1.00 31.07  ? 98   TYR F O     1 
ATOM   4492  C  CB    . TYR F 2 98  ? -3.447  -15.229 42.580 1.00 30.22  ? 98   TYR F CB    1 
ATOM   4493  C  CG    . TYR F 2 98  ? -4.770  -14.642 42.084 1.00 30.55  ? 98   TYR F CG    1 
ATOM   4494  C  CD1   . TYR F 2 98  ? -5.615  -15.329 41.185 1.00 29.83  ? 98   TYR F CD1   1 
ATOM   4495  C  CD2   . TYR F 2 98  ? -5.143  -13.365 42.494 1.00 29.20  ? 98   TYR F CD2   1 
ATOM   4496  C  CE1   . TYR F 2 98  ? -6.816  -14.744 40.745 1.00 30.52  ? 98   TYR F CE1   1 
ATOM   4497  C  CE2   . TYR F 2 98  ? -6.308  -12.782 42.072 1.00 29.94  ? 98   TYR F CE2   1 
ATOM   4498  C  CZ    . TYR F 2 98  ? -7.141  -13.454 41.206 1.00 31.00  ? 98   TYR F CZ    1 
ATOM   4499  O  OH    . TYR F 2 98  ? -8.291  -12.791 40.851 1.00 32.17  ? 98   TYR F OH    1 
ATOM   4500  N  N     . GLY F 2 99  ? -0.797  -17.002 41.693 1.00 31.44  ? 99   GLY F N     1 
ATOM   4501  C  CA    . GLY F 2 99  ? 0.628   -17.033 42.046 1.00 32.49  ? 99   GLY F CA    1 
ATOM   4502  C  C     . GLY F 2 99  ? 1.473   -18.045 41.291 1.00 33.67  ? 99   GLY F C     1 
ATOM   4503  O  O     . GLY F 2 99  ? 2.675   -18.186 41.553 1.00 34.74  ? 99   GLY F O     1 
ATOM   4504  N  N     . PHE F 2 100 ? 0.856   -18.750 40.352 1.00 33.92  ? 100  PHE F N     1 
ATOM   4505  C  CA    . PHE F 2 100 ? 1.503   -19.865 39.675 1.00 34.94  ? 100  PHE F CA    1 
ATOM   4506  C  C     . PHE F 2 100 ? 1.152   -19.889 38.196 1.00 35.97  ? 100  PHE F C     1 
ATOM   4507  O  O     . PHE F 2 100 ? 1.319   -20.907 37.551 1.00 37.04  ? 100  PHE F O     1 
ATOM   4508  C  CB    . PHE F 2 100 ? 1.154   -21.224 40.357 1.00 34.35  ? 100  PHE F CB    1 
ATOM   4509  C  CG    . PHE F 2 100 ? 1.729   -21.377 41.756 1.00 32.13  ? 100  PHE F CG    1 
ATOM   4510  C  CD1   . PHE F 2 100 ? 0.994   -21.009 42.875 1.00 31.03  ? 100  PHE F CD1   1 
ATOM   4511  C  CD2   . PHE F 2 100 ? 3.014   -21.886 41.946 1.00 31.50  ? 100  PHE F CD2   1 
ATOM   4512  C  CE1   . PHE F 2 100 ? 1.532   -21.133 44.175 1.00 30.95  ? 100  PHE F CE1   1 
ATOM   4513  C  CE2   . PHE F 2 100 ? 3.569   -22.013 43.234 1.00 30.21  ? 100  PHE F CE2   1 
ATOM   4514  C  CZ    . PHE F 2 100 ? 2.826   -21.630 44.348 1.00 30.21  ? 100  PHE F CZ    1 
ATOM   4515  N  N     . GLY F 2 101 ? 0.699   -18.764 37.653 1.00 36.70  ? 101  GLY F N     1 
ATOM   4516  C  CA    . GLY F 2 101 ? 0.323   -18.684 36.245 1.00 38.52  ? 101  GLY F CA    1 
ATOM   4517  C  C     . GLY F 2 101 ? -1.173  -18.824 36.025 1.00 40.21  ? 101  GLY F C     1 
ATOM   4518  O  O     . GLY F 2 101 ? -1.643  -18.998 34.888 1.00 40.31  ? 101  GLY F O     1 
ATOM   4519  N  N     . GLY F 2 102 ? -1.932  -18.723 37.108 1.00 41.66  ? 102  GLY F N     1 
ATOM   4520  C  CA    . GLY F 2 102 ? -3.361  -18.962 37.016 1.00 44.90  ? 102  GLY F CA    1 
ATOM   4521  C  C     . GLY F 2 102 ? -4.239  -17.954 37.736 1.00 46.09  ? 102  GLY F C     1 
ATOM   4522  O  O     . GLY F 2 102 ? -4.264  -16.788 37.307 1.00 47.53  ? 102  GLY F O     1 
ATOM   4523  O  OXT   . GLY F 2 102 ? -4.938  -18.284 38.715 1.00 46.16  ? 102  GLY F OXT   1 
ATOM   4524  N  N     . ALA G 3 14  ? -34.607 -40.659 4.587  1.00 84.04  ? 14   ALA G N     1 
ATOM   4525  C  CA    . ALA G 3 14  ? -33.960 -39.886 5.690  1.00 84.06  ? 14   ALA G CA    1 
ATOM   4526  C  C     . ALA G 3 14  ? -34.242 -40.488 7.064  1.00 83.95  ? 14   ALA G C     1 
ATOM   4527  O  O     . ALA G 3 14  ? -35.404 -40.677 7.448  1.00 84.11  ? 14   ALA G O     1 
ATOM   4528  C  CB    . ALA G 3 14  ? -34.395 -38.424 5.650  1.00 83.98  ? 14   ALA G CB    1 
ATOM   4529  N  N     . LYS G 3 15  ? -33.171 -40.785 7.801  1.00 83.72  ? 15   LYS G N     1 
ATOM   4530  C  CA    . LYS G 3 15  ? -33.299 -41.272 9.170  1.00 83.41  ? 15   LYS G CA    1 
ATOM   4531  C  C     . LYS G 3 15  ? -32.570 -40.357 10.159 1.00 82.93  ? 15   LYS G C     1 
ATOM   4532  O  O     . LYS G 3 15  ? -31.388 -40.039 9.972  1.00 83.06  ? 15   LYS G O     1 
ATOM   4533  C  CB    . LYS G 3 15  ? -32.790 -42.715 9.284  1.00 83.65  ? 15   LYS G CB    1 
ATOM   4534  C  CG    . LYS G 3 15  ? -33.544 -43.554 10.312 1.00 84.13  ? 15   LYS G CG    1 
ATOM   4535  C  CD    . LYS G 3 15  ? -34.928 -43.953 9.790  1.00 84.88  ? 15   LYS G CD    1 
ATOM   4536  C  CE    . LYS G 3 15  ? -35.971 -44.007 10.914 1.00 85.10  ? 15   LYS G CE    1 
ATOM   4537  N  NZ    . LYS G 3 15  ? -35.694 -45.068 11.931 1.00 84.72  ? 15   LYS G NZ    1 
ATOM   4538  N  N     . THR G 3 16  ? -33.286 -39.944 11.206 1.00 82.10  ? 16   THR G N     1 
ATOM   4539  C  CA    . THR G 3 16  ? -32.754 -39.040 12.236 1.00 81.30  ? 16   THR G CA    1 
ATOM   4540  C  C     . THR G 3 16  ? -31.533 -39.612 12.961 1.00 80.49  ? 16   THR G C     1 
ATOM   4541  O  O     . THR G 3 16  ? -31.397 -40.830 13.102 1.00 80.47  ? 16   THR G O     1 
ATOM   4542  C  CB    . THR G 3 16  ? -33.821 -38.683 13.306 1.00 81.37  ? 16   THR G CB    1 
ATOM   4543  O  OG1   . THR G 3 16  ? -34.096 -39.834 14.115 1.00 81.53  ? 16   THR G OG1   1 
ATOM   4544  C  CG2   . THR G 3 16  ? -35.116 -38.181 12.662 1.00 81.54  ? 16   THR G CG2   1 
ATOM   4545  N  N     . ARG G 3 17  ? -30.661 -38.723 13.429 1.00 79.52  ? 17   ARG G N     1 
ATOM   4546  C  CA    . ARG G 3 17  ? -29.475 -39.123 14.189 1.00 78.59  ? 17   ARG G CA    1 
ATOM   4547  C  C     . ARG G 3 17  ? -29.801 -39.740 15.557 1.00 77.77  ? 17   ARG G C     1 
ATOM   4548  O  O     . ARG G 3 17  ? -29.062 -40.604 16.036 1.00 77.57  ? 17   ARG G O     1 
ATOM   4549  C  CB    . ARG G 3 17  ? -28.499 -37.951 14.332 1.00 78.65  ? 17   ARG G CB    1 
ATOM   4550  C  CG    . ARG G 3 17  ? -27.650 -37.712 13.091 1.00 78.73  ? 17   ARG G CG    1 
ATOM   4551  C  CD    . ARG G 3 17  ? -26.535 -36.713 13.352 1.00 78.77  ? 17   ARG G CD    1 
ATOM   4552  N  NE    . ARG G 3 17  ? -27.009 -35.332 13.301 1.00 78.72  ? 17   ARG G NE    1 
ATOM   4553  C  CZ    . ARG G 3 17  ? -26.257 -34.267 13.568 1.00 78.75  ? 17   ARG G CZ    1 
ATOM   4554  N  NH1   . ARG G 3 17  ? -24.986 -34.418 13.917 1.00 78.45  ? 17   ARG G NH1   1 
ATOM   4555  N  NH2   . ARG G 3 17  ? -26.781 -33.049 13.491 1.00 78.97  ? 17   ARG G NH2   1 
ATOM   4556  N  N     . SER G 3 18  ? -30.903 -39.304 16.170 1.00 76.80  ? 18   SER G N     1 
ATOM   4557  C  CA    . SER G 3 18  ? -31.364 -39.884 17.433 1.00 75.97  ? 18   SER G CA    1 
ATOM   4558  C  C     . SER G 3 18  ? -31.627 -41.377 17.282 1.00 75.36  ? 18   SER G C     1 
ATOM   4559  O  O     . SER G 3 18  ? -31.103 -42.182 18.052 1.00 75.34  ? 18   SER G O     1 
ATOM   4560  C  CB    . SER G 3 18  ? -32.622 -39.178 17.941 1.00 76.08  ? 18   SER G CB    1 
ATOM   4561  O  OG    . SER G 3 18  ? -32.397 -37.792 18.111 1.00 76.58  ? 18   SER G OG    1 
ATOM   4562  N  N     . SER G 3 19  ? -32.427 -41.743 16.280 1.00 74.59  ? 19   SER G N     1 
ATOM   4563  C  CA    . SER G 3 19  ? -32.724 -43.152 15.996 1.00 73.70  ? 19   SER G CA    1 
ATOM   4564  C  C     . SER G 3 19  ? -31.460 -43.952 15.665 1.00 72.91  ? 19   SER G C     1 
ATOM   4565  O  O     . SER G 3 19  ? -31.303 -45.082 16.130 1.00 72.57  ? 19   SER G O     1 
ATOM   4566  C  CB    . SER G 3 19  ? -33.764 -43.280 14.881 1.00 73.78  ? 19   SER G CB    1 
ATOM   4567  O  OG    . SER G 3 19  ? -33.476 -42.402 13.805 1.00 74.10  ? 19   SER G OG    1 
ATOM   4568  N  N     . ARG G 3 20  ? -30.562 -43.353 14.881 1.00 72.05  ? 20   ARG G N     1 
ATOM   4569  C  CA    . ARG G 3 20  ? -29.250 -43.945 14.593 1.00 71.42  ? 20   ARG G CA    1 
ATOM   4570  C  C     . ARG G 3 20  ? -28.478 -44.258 15.873 1.00 70.72  ? 20   ARG G C     1 
ATOM   4571  O  O     . ARG G 3 20  ? -27.915 -45.343 16.011 1.00 70.74  ? 20   ARG G O     1 
ATOM   4572  C  CB    . ARG G 3 20  ? -28.392 -43.008 13.731 1.00 71.67  ? 20   ARG G CB    1 
ATOM   4573  C  CG    . ARG G 3 20  ? -28.829 -42.828 12.296 1.00 72.55  ? 20   ARG G CG    1 
ATOM   4574  C  CD    . ARG G 3 20  ? -27.653 -42.358 11.447 1.00 74.63  ? 20   ARG G CD    1 
ATOM   4575  N  NE    . ARG G 3 20  ? -28.077 -41.561 10.294 1.00 77.19  ? 20   ARG G NE    1 
ATOM   4576  C  CZ    . ARG G 3 20  ? -28.561 -42.064 9.158  1.00 78.85  ? 20   ARG G CZ    1 
ATOM   4577  N  NH1   . ARG G 3 20  ? -28.699 -43.380 9.000  1.00 79.03  ? 20   ARG G NH1   1 
ATOM   4578  N  NH2   . ARG G 3 20  ? -28.914 -41.245 8.172  1.00 79.77  ? 20   ARG G NH2   1 
ATOM   4579  N  N     . ALA G 3 21  ? -28.448 -43.292 16.795 1.00 69.77  ? 21   ALA G N     1 
ATOM   4580  C  CA    . ALA G 3 21  ? -27.676 -43.399 18.035 1.00 68.74  ? 21   ALA G CA    1 
ATOM   4581  C  C     . ALA G 3 21  ? -28.363 -44.266 19.077 1.00 68.02  ? 21   ALA G C     1 
ATOM   4582  O  O     . ALA G 3 21  ? -27.721 -44.740 20.012 1.00 68.02  ? 21   ALA G O     1 
ATOM   4583  C  CB    . ALA G 3 21  ? -27.395 -42.016 18.607 1.00 68.82  ? 21   ALA G CB    1 
ATOM   4584  N  N     . GLY G 3 22  ? -29.671 -44.453 18.920 1.00 67.14  ? 22   GLY G N     1 
ATOM   4585  C  CA    . GLY G 3 22  ? -30.450 -45.314 19.800 1.00 66.11  ? 22   GLY G CA    1 
ATOM   4586  C  C     . GLY G 3 22  ? -31.064 -44.537 20.939 1.00 65.56  ? 22   GLY G C     1 
ATOM   4587  O  O     . GLY G 3 22  ? -31.294 -45.084 22.020 1.00 65.53  ? 22   GLY G O     1 
ATOM   4588  N  N     . LEU G 3 23  ? -31.356 -43.263 20.688 1.00 64.73  ? 23   LEU G N     1 
ATOM   4589  C  CA    . LEU G 3 23  ? -31.695 -42.343 21.755 1.00 63.76  ? 23   LEU G CA    1 
ATOM   4590  C  C     . LEU G 3 23  ? -33.031 -41.662 21.526 1.00 63.56  ? 23   LEU G C     1 
ATOM   4591  O  O     . LEU G 3 23  ? -33.439 -41.453 20.379 1.00 63.79  ? 23   LEU G O     1 
ATOM   4592  C  CB    . LEU G 3 23  ? -30.592 -41.290 21.890 1.00 63.75  ? 23   LEU G CB    1 
ATOM   4593  C  CG    . LEU G 3 23  ? -29.133 -41.718 22.111 1.00 63.14  ? 23   LEU G CG    1 
ATOM   4594  C  CD1   . LEU G 3 23  ? -28.212 -40.513 22.027 1.00 63.04  ? 23   LEU G CD1   1 
ATOM   4595  C  CD2   . LEU G 3 23  ? -28.945 -42.434 23.439 1.00 61.96  ? 23   LEU G CD2   1 
ATOM   4596  N  N     . GLN G 3 24  ? -33.703 -41.317 22.624 1.00 63.06  ? 24   GLN G N     1 
ATOM   4597  C  CA    . GLN G 3 24  ? -34.919 -40.500 22.585 1.00 62.74  ? 24   GLN G CA    1 
ATOM   4598  C  C     . GLN G 3 24  ? -34.585 -39.014 22.492 1.00 62.34  ? 24   GLN G C     1 
ATOM   4599  O  O     . GLN G 3 24  ? -35.332 -38.231 21.893 1.00 62.59  ? 24   GLN G O     1 
ATOM   4600  C  CB    . GLN G 3 24  ? -35.778 -40.741 23.826 1.00 62.83  ? 24   GLN G CB    1 
ATOM   4601  C  CG    . GLN G 3 24  ? -36.145 -42.202 24.095 1.00 63.32  ? 24   GLN G CG    1 
ATOM   4602  C  CD    . GLN G 3 24  ? -36.792 -42.894 22.904 1.00 63.95  ? 24   GLN G CD    1 
ATOM   4603  O  OE1   . GLN G 3 24  ? -37.777 -42.411 22.342 1.00 64.82  ? 24   GLN G OE1   1 
ATOM   4604  N  NE2   . GLN G 3 24  ? -36.239 -44.035 22.520 1.00 63.82  ? 24   GLN G NE2   1 
ATOM   4605  N  N     . PHE G 3 25  ? -33.456 -38.635 23.086 1.00 61.56  ? 25   PHE G N     1 
ATOM   4606  C  CA    . PHE G 3 25  ? -33.027 -37.239 23.146 1.00 60.65  ? 25   PHE G CA    1 
ATOM   4607  C  C     . PHE G 3 25  ? -32.466 -36.769 21.807 1.00 60.13  ? 25   PHE G C     1 
ATOM   4608  O  O     . PHE G 3 25  ? -31.701 -37.497 21.171 1.00 60.17  ? 25   PHE G O     1 
ATOM   4609  C  CB    . PHE G 3 25  ? -32.011 -37.051 24.280 1.00 60.69  ? 25   PHE G CB    1 
ATOM   4610  C  CG    . PHE G 3 25  ? -32.635 -36.667 25.594 1.00 59.73  ? 25   PHE G CG    1 
ATOM   4611  C  CD1   . PHE G 3 25  ? -33.690 -37.405 26.126 1.00 58.39  ? 25   PHE G CD1   1 
ATOM   4612  C  CD2   . PHE G 3 25  ? -32.169 -35.559 26.298 1.00 59.00  ? 25   PHE G CD2   1 
ATOM   4613  C  CE1   . PHE G 3 25  ? -34.270 -37.050 27.335 1.00 57.81  ? 25   PHE G CE1   1 
ATOM   4614  C  CE2   . PHE G 3 25  ? -32.745 -35.194 27.507 1.00 58.16  ? 25   PHE G CE2   1 
ATOM   4615  C  CZ    . PHE G 3 25  ? -33.798 -35.941 28.029 1.00 57.88  ? 25   PHE G CZ    1 
ATOM   4616  N  N     . PRO G 3 26  ? -32.838 -35.543 21.382 1.00 59.58  ? 26   PRO G N     1 
ATOM   4617  C  CA    . PRO G 3 26  ? -32.588 -35.065 20.015 1.00 58.90  ? 26   PRO G CA    1 
ATOM   4618  C  C     . PRO G 3 26  ? -31.134 -34.680 19.741 1.00 58.30  ? 26   PRO G C     1 
ATOM   4619  O  O     . PRO G 3 26  ? -30.683 -33.608 20.149 1.00 58.71  ? 26   PRO G O     1 
ATOM   4620  C  CB    . PRO G 3 26  ? -33.488 -33.836 19.919 1.00 58.82  ? 26   PRO G CB    1 
ATOM   4621  C  CG    . PRO G 3 26  ? -33.503 -33.293 21.308 1.00 59.22  ? 26   PRO G CG    1 
ATOM   4622  C  CD    . PRO G 3 26  ? -33.432 -34.487 22.228 1.00 59.55  ? 26   PRO G CD    1 
ATOM   4623  N  N     . VAL G 3 27  ? -30.425 -35.539 19.024 1.00 57.46  ? 27   VAL G N     1 
ATOM   4624  C  CA    . VAL G 3 27  ? -29.043 -35.277 18.631 1.00 56.88  ? 27   VAL G CA    1 
ATOM   4625  C  C     . VAL G 3 27  ? -28.911 -34.008 17.794 1.00 56.86  ? 27   VAL G C     1 
ATOM   4626  O  O     . VAL G 3 27  ? -28.015 -33.201 18.037 1.00 57.29  ? 27   VAL G O     1 
ATOM   4627  C  CB    . VAL G 3 27  ? -28.445 -36.482 17.885 1.00 56.82  ? 27   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G 3 27  ? -26.957 -36.280 17.582 1.00 55.76  ? 27   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G 3 27  ? -28.654 -37.739 18.709 1.00 56.49  ? 27   VAL G CG2   1 
ATOM   4630  N  N     . GLY G 3 28  ? -29.811 -33.828 16.826 1.00 56.54  ? 28   GLY G N     1 
ATOM   4631  C  CA    . GLY G 3 28  ? -29.805 -32.635 15.982 1.00 55.97  ? 28   GLY G CA    1 
ATOM   4632  C  C     . GLY G 3 28  ? -29.847 -31.353 16.793 1.00 55.58  ? 28   GLY G C     1 
ATOM   4633  O  O     . GLY G 3 28  ? -29.010 -30.467 16.604 1.00 55.69  ? 28   GLY G O     1 
ATOM   4634  N  N     . ARG G 3 29  ? -30.816 -31.268 17.702 1.00 55.01  ? 29   ARG G N     1 
ATOM   4635  C  CA    . ARG G 3 29  ? -30.970 -30.108 18.576 1.00 54.79  ? 29   ARG G CA    1 
ATOM   4636  C  C     . ARG G 3 29  ? -29.733 -29.865 19.437 1.00 54.53  ? 29   ARG G C     1 
ATOM   4637  O  O     . ARG G 3 29  ? -29.272 -28.728 19.543 1.00 54.28  ? 29   ARG G O     1 
ATOM   4638  C  CB    . ARG G 3 29  ? -32.209 -30.261 19.453 1.00 54.63  ? 29   ARG G CB    1 
ATOM   4639  C  CG    . ARG G 3 29  ? -32.483 -29.072 20.330 1.00 55.30  ? 29   ARG G CG    1 
ATOM   4640  C  CD    . ARG G 3 29  ? -33.766 -29.256 21.118 1.00 57.03  ? 29   ARG G CD    1 
ATOM   4641  N  NE    . ARG G 3 29  ? -34.948 -29.005 20.298 1.00 58.86  ? 29   ARG G NE    1 
ATOM   4642  C  CZ    . ARG G 3 29  ? -36.199 -29.021 20.751 1.00 59.80  ? 29   ARG G CZ    1 
ATOM   4643  N  NH1   . ARG G 3 29  ? -36.456 -29.289 22.029 1.00 60.40  ? 29   ARG G NH1   1 
ATOM   4644  N  NH2   . ARG G 3 29  ? -37.199 -28.774 19.918 1.00 60.08  ? 29   ARG G NH2   1 
ATOM   4645  N  N     . VAL G 3 30  ? -29.199 -30.942 20.023 1.00 54.38  ? 30   VAL G N     1 
ATOM   4646  C  CA    . VAL G 3 30  ? -28.027 -30.869 20.890 1.00 54.18  ? 30   VAL G CA    1 
ATOM   4647  C  C     . VAL G 3 30  ? -26.830 -30.380 20.083 1.00 54.77  ? 30   VAL G C     1 
ATOM   4648  O  O     . VAL G 3 30  ? -26.044 -29.564 20.573 1.00 54.65  ? 30   VAL G O     1 
ATOM   4649  C  CB    . VAL G 3 30  ? -27.725 -32.229 21.602 1.00 54.02  ? 30   VAL G CB    1 
ATOM   4650  C  CG1   . VAL G 3 30  ? -26.364 -32.219 22.281 1.00 53.14  ? 30   VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G 3 30  ? -28.804 -32.560 22.621 1.00 53.21  ? 30   VAL G CG2   1 
ATOM   4652  N  N     . HIS G 3 31  ? -26.717 -30.855 18.843 1.00 55.39  ? 31   HIS G N     1 
ATOM   4653  C  CA    . HIS G 3 31  ? -25.647 -30.424 17.939 1.00 56.38  ? 31   HIS G CA    1 
ATOM   4654  C  C     . HIS G 3 31  ? -25.761 -28.935 17.649 1.00 56.61  ? 31   HIS G C     1 
ATOM   4655  O  O     . HIS G 3 31  ? -24.767 -28.199 17.693 1.00 56.79  ? 31   HIS G O     1 
ATOM   4656  C  CB    . HIS G 3 31  ? -25.688 -31.199 16.617 1.00 56.42  ? 31   HIS G CB    1 
ATOM   4657  C  CG    . HIS G 3 31  ? -24.409 -31.134 15.841 1.00 58.03  ? 31   HIS G CG    1 
ATOM   4658  N  ND1   . HIS G 3 31  ? -23.524 -30.079 15.946 1.00 60.50  ? 31   HIS G ND1   1 
ATOM   4659  C  CD2   . HIS G 3 31  ? -23.866 -31.991 14.943 1.00 58.65  ? 31   HIS G CD2   1 
ATOM   4660  C  CE1   . HIS G 3 31  ? -22.489 -30.294 15.153 1.00 60.17  ? 31   HIS G CE1   1 
ATOM   4661  N  NE2   . HIS G 3 31  ? -22.672 -31.446 14.532 1.00 58.98  ? 31   HIS G NE2   1 
ATOM   4662  N  N     . ARG G 3 32  ? -26.984 -28.511 17.355 1.00 56.92  ? 32   ARG G N     1 
ATOM   4663  C  CA    . ARG G 3 32  ? -27.284 -27.138 17.002 1.00 57.52  ? 32   ARG G CA    1 
ATOM   4664  C  C     . ARG G 3 32  ? -26.943 -26.229 18.176 1.00 57.59  ? 32   ARG G C     1 
ATOM   4665  O  O     . ARG G 3 32  ? -26.228 -25.234 18.019 1.00 57.65  ? 32   ARG G O     1 
ATOM   4666  C  CB    . ARG G 3 32  ? -28.766 -27.027 16.643 1.00 57.64  ? 32   ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3 32  ? -29.184 -25.716 16.025 1.00 58.51  ? 32   ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3 32  ? -30.678 -25.548 16.180 1.00 59.88  ? 32   ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3 32  ? -31.019 -25.156 17.544 1.00 61.11  ? 32   ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3 32  ? -32.202 -25.367 18.131 1.00 62.13  ? 32   ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3 32  ? -33.194 -25.995 17.499 1.00 62.90  ? 32   ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3 32  ? -32.390 -24.961 19.373 1.00 62.67  ? 32   ARG G NH2   1 
ATOM   4673  N  N     . LEU G 3 33  ? -27.446 -26.597 19.352 1.00 57.73  ? 33   LEU G N     1 
ATOM   4674  C  CA    . LEU G 3 33  ? -27.225 -25.831 20.572 1.00 57.84  ? 33   LEU G CA    1 
ATOM   4675  C  C     . LEU G 3 33  ? -25.748 -25.696 20.931 1.00 58.08  ? 33   LEU G C     1 
ATOM   4676  O  O     . LEU G 3 33  ? -25.334 -24.658 21.449 1.00 58.61  ? 33   LEU G O     1 
ATOM   4677  C  CB    . LEU G 3 33  ? -28.017 -26.422 21.739 1.00 57.56  ? 33   LEU G CB    1 
ATOM   4678  C  CG    . LEU G 3 33  ? -29.546 -26.284 21.735 1.00 57.25  ? 33   LEU G CG    1 
ATOM   4679  C  CD1   . LEU G 3 33  ? -30.159 -27.026 22.919 1.00 56.26  ? 33   LEU G CD1   1 
ATOM   4680  C  CD2   . LEU G 3 33  ? -30.010 -24.827 21.732 1.00 57.27  ? 33   LEU G CD2   1 
ATOM   4681  N  N     . LEU G 3 34  ? -24.953 -26.723 20.642 1.00 58.30  ? 34   LEU G N     1 
ATOM   4682  C  CA    . LEU G 3 34  ? -23.503 -26.633 20.841 1.00 58.77  ? 34   LEU G CA    1 
ATOM   4683  C  C     . LEU G 3 34  ? -22.851 -25.602 19.919 1.00 59.37  ? 34   LEU G C     1 
ATOM   4684  O  O     . LEU G 3 34  ? -21.955 -24.876 20.347 1.00 59.71  ? 34   LEU G O     1 
ATOM   4685  C  CB    . LEU G 3 34  ? -22.819 -27.999 20.686 1.00 58.34  ? 34   LEU G CB    1 
ATOM   4686  C  CG    . LEU G 3 34  ? -22.982 -29.032 21.813 1.00 57.86  ? 34   LEU G CG    1 
ATOM   4687  C  CD1   . LEU G 3 34  ? -22.615 -30.431 21.321 1.00 56.20  ? 34   LEU G CD1   1 
ATOM   4688  C  CD2   . LEU G 3 34  ? -22.182 -28.670 23.071 1.00 56.29  ? 34   LEU G CD2   1 
ATOM   4689  N  N     . ARG G 3 35  ? -23.311 -25.535 18.669 1.00 59.98  ? 35   ARG G N     1 
ATOM   4690  C  CA    . ARG G 3 35  ? -22.762 -24.605 17.673 1.00 60.84  ? 35   ARG G CA    1 
ATOM   4691  C  C     . ARG G 3 35  ? -22.994 -23.158 18.049 1.00 60.73  ? 35   ARG G C     1 
ATOM   4692  O  O     . ARG G 3 35  ? -22.085 -22.329 18.007 1.00 61.30  ? 35   ARG G O     1 
ATOM   4693  C  CB    . ARG G 3 35  ? -23.404 -24.838 16.305 1.00 61.09  ? 35   ARG G CB    1 
ATOM   4694  C  CG    . ARG G 3 35  ? -23.189 -26.211 15.737 1.00 63.00  ? 35   ARG G CG    1 
ATOM   4695  C  CD    . ARG G 3 35  ? -23.334 -26.188 14.238 1.00 66.60  ? 35   ARG G CD    1 
ATOM   4696  N  NE    . ARG G 3 35  ? -22.740 -27.373 13.623 1.00 69.38  ? 35   ARG G NE    1 
ATOM   4697  C  CZ    . ARG G 3 35  ? -21.430 -27.598 13.519 1.00 71.49  ? 35   ARG G CZ    1 
ATOM   4698  N  NH1   . ARG G 3 35  ? -20.544 -26.726 14.011 1.00 72.15  ? 35   ARG G NH1   1 
ATOM   4699  N  NH2   . ARG G 3 35  ? -21.004 -28.710 12.929 1.00 72.30  ? 35   ARG G NH2   1 
ATOM   4700  N  N     . LYS G 3 36  ? -24.230 -22.862 18.422 1.00 60.73  ? 36   LYS G N     1 
ATOM   4701  C  CA    . LYS G 3 36  ? -24.653 -21.492 18.630 1.00 60.51  ? 36   LYS G CA    1 
ATOM   4702  C  C     . LYS G 3 36  ? -24.463 -21.064 20.091 1.00 60.06  ? 36   LYS G C     1 
ATOM   4703  O  O     . LYS G 3 36  ? -24.901 -19.977 20.494 1.00 60.21  ? 36   LYS G O     1 
ATOM   4704  C  CB    . LYS G 3 36  ? -26.092 -21.317 18.124 1.00 60.88  ? 36   LYS G CB    1 
ATOM   4705  C  CG    . LYS G 3 36  ? -26.298 -21.977 16.756 1.00 61.81  ? 36   LYS G CG    1 
ATOM   4706  C  CD    . LYS G 3 36  ? -27.372 -21.328 15.883 1.00 64.55  ? 36   LYS G CD    1 
ATOM   4707  C  CE    . LYS G 3 36  ? -27.349 -21.981 14.479 1.00 66.25  ? 36   LYS G CE    1 
ATOM   4708  N  NZ    . LYS G 3 36  ? -28.678 -22.013 13.766 1.00 66.48  ? 36   LYS G NZ    1 
ATOM   4709  N  N     . GLY G 3 37  ? -23.760 -21.908 20.854 1.00 59.29  ? 37   GLY G N     1 
ATOM   4710  C  CA    . GLY G 3 37  ? -23.471 -21.661 22.264 1.00 58.16  ? 37   GLY G CA    1 
ATOM   4711  C  C     . GLY G 3 37  ? -22.104 -21.061 22.543 1.00 57.63  ? 37   GLY G C     1 
ATOM   4712  O  O     . GLY G 3 37  ? -21.717 -20.889 23.705 1.00 57.50  ? 37   GLY G O     1 
ATOM   4713  N  N     . ASN G 3 38  ? -21.372 -20.731 21.484 1.00 57.14  ? 38   ASN G N     1 
ATOM   4714  C  CA    . ASN G 3 38  ? -20.020 -20.180 21.621 1.00 56.75  ? 38   ASN G CA    1 
ATOM   4715  C  C     . ASN G 3 38  ? -19.200 -21.023 22.589 1.00 56.16  ? 38   ASN G C     1 
ATOM   4716  O  O     . ASN G 3 38  ? -18.661 -20.522 23.589 1.00 56.25  ? 38   ASN G O     1 
ATOM   4717  C  CB    . ASN G 3 38  ? -20.048 -18.713 22.094 1.00 57.07  ? 38   ASN G CB    1 
ATOM   4718  C  CG    . ASN G 3 38  ? -20.812 -17.807 21.152 1.00 57.14  ? 38   ASN G CG    1 
ATOM   4719  O  OD1   . ASN G 3 38  ? -21.920 -17.373 21.465 1.00 58.36  ? 38   ASN G OD1   1 
ATOM   4720  N  ND2   . ASN G 3 38  ? -20.232 -17.525 19.992 1.00 56.94  ? 38   ASN G ND2   1 
ATOM   4721  N  N     . TYR G 3 39  ? -19.124 -22.313 22.296 1.00 55.27  ? 39   TYR G N     1 
ATOM   4722  C  CA    . TYR G 3 39  ? -18.354 -23.208 23.129 1.00 54.51  ? 39   TYR G CA    1 
ATOM   4723  C  C     . TYR G 3 39  ? -16.963 -23.429 22.528 1.00 55.13  ? 39   TYR G C     1 
ATOM   4724  O  O     . TYR G 3 39  ? -15.967 -23.418 23.252 1.00 54.93  ? 39   TYR G O     1 
ATOM   4725  C  CB    . TYR G 3 39  ? -19.127 -24.501 23.371 1.00 53.71  ? 39   TYR G CB    1 
ATOM   4726  C  CG    . TYR G 3 39  ? -20.370 -24.325 24.226 1.00 50.43  ? 39   TYR G CG    1 
ATOM   4727  C  CD1   . TYR G 3 39  ? -21.624 -24.561 23.702 1.00 48.17  ? 39   TYR G CD1   1 
ATOM   4728  C  CD2   . TYR G 3 39  ? -20.283 -23.924 25.559 1.00 48.00  ? 39   TYR G CD2   1 
ATOM   4729  C  CE1   . TYR G 3 39  ? -22.770 -24.413 24.469 1.00 47.32  ? 39   TYR G CE1   1 
ATOM   4730  C  CE2   . TYR G 3 39  ? -21.415 -23.767 26.336 1.00 47.13  ? 39   TYR G CE2   1 
ATOM   4731  C  CZ    . TYR G 3 39  ? -22.668 -24.020 25.782 1.00 47.78  ? 39   TYR G CZ    1 
ATOM   4732  O  OH    . TYR G 3 39  ? -23.825 -23.883 26.531 1.00 46.38  ? 39   TYR G OH    1 
ATOM   4733  N  N     . ALA G 3 40  ? -16.909 -23.589 21.204 1.00 55.81  ? 40   ALA G N     1 
ATOM   4734  C  CA    . ALA G 3 40  ? -15.653 -23.589 20.437 1.00 56.75  ? 40   ALA G CA    1 
ATOM   4735  C  C     . ALA G 3 40  ? -15.929 -23.236 18.975 1.00 57.34  ? 40   ALA G C     1 
ATOM   4736  O  O     . ALA G 3 40  ? -17.083 -23.226 18.550 1.00 57.30  ? 40   ALA G O     1 
ATOM   4737  C  CB    . ALA G 3 40  ? -14.960 -24.941 20.530 1.00 56.81  ? 40   ALA G CB    1 
ATOM   4738  N  N     . GLU G 3 41  ? -14.879 -22.944 18.208 1.00 58.19  ? 41   GLU G N     1 
ATOM   4739  C  CA    . GLU G 3 41  ? -15.036 -22.687 16.771 1.00 59.30  ? 41   GLU G CA    1 
ATOM   4740  C  C     . GLU G 3 41  ? -15.661 -23.883 16.055 1.00 59.21  ? 41   GLU G C     1 
ATOM   4741  O  O     . GLU G 3 41  ? -16.418 -23.713 15.106 1.00 59.49  ? 41   GLU G O     1 
ATOM   4742  C  CB    . GLU G 3 41  ? -13.700 -22.324 16.095 1.00 59.75  ? 41   GLU G CB    1 
ATOM   4743  C  CG    . GLU G 3 41  ? -13.136 -20.938 16.450 1.00 63.10  ? 41   GLU G CG    1 
ATOM   4744  C  CD    . GLU G 3 41  ? -14.099 -19.793 16.134 1.00 68.12  ? 41   GLU G CD    1 
ATOM   4745  O  OE1   . GLU G 3 41  ? -14.536 -19.673 14.957 1.00 69.96  ? 41   GLU G OE1   1 
ATOM   4746  O  OE2   . GLU G 3 41  ? -14.416 -19.009 17.069 1.00 70.10  ? 41   GLU G OE2   1 
ATOM   4747  N  N     . ARG G 3 42  ? -15.352 -25.092 16.515 1.00 59.21  ? 42   ARG G N     1 
ATOM   4748  C  CA    . ARG G 3 42  ? -15.777 -26.303 15.817 1.00 59.06  ? 42   ARG G CA    1 
ATOM   4749  C  C     . ARG G 3 42  ? -16.390 -27.344 16.734 1.00 58.45  ? 42   ARG G C     1 
ATOM   4750  O  O     . ARG G 3 42  ? -16.010 -27.464 17.895 1.00 58.73  ? 42   ARG G O     1 
ATOM   4751  C  CB    . ARG G 3 42  ? -14.600 -26.935 15.075 1.00 59.60  ? 42   ARG G CB    1 
ATOM   4752  C  CG    . ARG G 3 42  ? -13.983 -26.060 14.010 1.00 60.98  ? 42   ARG G CG    1 
ATOM   4753  C  CD    . ARG G 3 42  ? -12.987 -26.851 13.193 1.00 65.31  ? 42   ARG G CD    1 
ATOM   4754  N  NE    . ARG G 3 42  ? -12.615 -26.126 11.983 1.00 69.72  ? 42   ARG G NE    1 
ATOM   4755  C  CZ    . ARG G 3 42  ? -12.281 -26.703 10.830 1.00 71.64  ? 42   ARG G CZ    1 
ATOM   4756  N  NH1   . ARG G 3 42  ? -12.268 -28.031 10.715 1.00 72.37  ? 42   ARG G NH1   1 
ATOM   4757  N  NH2   . ARG G 3 42  ? -11.957 -25.946 9.791  1.00 73.04  ? 42   ARG G NH2   1 
ATOM   4758  N  N     . VAL G 3 43  ? -17.326 -28.114 16.190 1.00 57.45  ? 43   VAL G N     1 
ATOM   4759  C  CA    . VAL G 3 43  ? -17.994 -29.161 16.944 1.00 56.42  ? 43   VAL G CA    1 
ATOM   4760  C  C     . VAL G 3 43  ? -17.929 -30.486 16.204 1.00 55.85  ? 43   VAL G C     1 
ATOM   4761  O  O     . VAL G 3 43  ? -18.475 -30.621 15.115 1.00 55.87  ? 43   VAL G O     1 
ATOM   4762  C  CB    . VAL G 3 43  ? -19.474 -28.810 17.215 1.00 56.58  ? 43   VAL G CB    1 
ATOM   4763  C  CG1   . VAL G 3 43  ? -20.121 -29.872 18.116 1.00 56.01  ? 43   VAL G CG1   1 
ATOM   4764  C  CG2   . VAL G 3 43  ? -19.599 -27.411 17.836 1.00 56.23  ? 43   VAL G CG2   1 
ATOM   4765  N  N     . GLY G 3 44  ? -17.272 -31.465 16.813 1.00 55.30  ? 44   GLY G N     1 
ATOM   4766  C  CA    . GLY G 3 44  ? -17.142 -32.806 16.241 1.00 54.46  ? 44   GLY G CA    1 
ATOM   4767  C  C     . GLY G 3 44  ? -18.457 -33.556 16.100 1.00 54.09  ? 44   GLY G C     1 
ATOM   4768  O  O     . GLY G 3 44  ? -19.407 -33.322 16.849 1.00 53.85  ? 44   GLY G O     1 
ATOM   4769  N  N     . ALA G 3 45  ? -18.497 -34.467 15.132 1.00 53.82  ? 45   ALA G N     1 
ATOM   4770  C  CA    . ALA G 3 45  ? -19.695 -35.244 14.800 1.00 53.48  ? 45   ALA G CA    1 
ATOM   4771  C  C     . ALA G 3 45  ? -20.260 -36.071 15.954 1.00 53.04  ? 45   ALA G C     1 
ATOM   4772  O  O     . ALA G 3 45  ? -21.473 -36.126 16.136 1.00 53.50  ? 45   ALA G O     1 
ATOM   4773  C  CB    . ALA G 3 45  ? -19.423 -36.142 13.599 1.00 53.68  ? 45   ALA G CB    1 
ATOM   4774  N  N     . GLY G 3 46  ? -19.389 -36.718 16.721 1.00 52.30  ? 46   GLY G N     1 
ATOM   4775  C  CA    . GLY G 3 46  ? -19.821 -37.568 17.835 1.00 51.49  ? 46   GLY G CA    1 
ATOM   4776  C  C     . GLY G 3 46  ? -20.187 -36.861 19.137 1.00 51.10  ? 46   GLY G C     1 
ATOM   4777  O  O     . GLY G 3 46  ? -20.934 -37.411 19.954 1.00 50.60  ? 46   GLY G O     1 
ATOM   4778  N  N     . ALA G 3 47  ? -19.663 -35.647 19.338 1.00 50.47  ? 47   ALA G N     1 
ATOM   4779  C  CA    . ALA G 3 47  ? -19.900 -34.896 20.574 1.00 49.52  ? 47   ALA G CA    1 
ATOM   4780  C  C     . ALA G 3 47  ? -21.385 -34.692 20.903 1.00 49.20  ? 47   ALA G C     1 
ATOM   4781  O  O     . ALA G 3 47  ? -21.781 -34.919 22.043 1.00 49.32  ? 47   ALA G O     1 
ATOM   4782  C  CB    . ALA G 3 47  ? -19.151 -33.561 20.558 1.00 49.79  ? 47   ALA G CB    1 
ATOM   4783  N  N     . PRO G 3 48  ? -22.218 -34.279 19.921 1.00 48.76  ? 48   PRO G N     1 
ATOM   4784  C  CA    . PRO G 3 48  ? -23.642 -34.137 20.244 1.00 48.54  ? 48   PRO G CA    1 
ATOM   4785  C  C     . PRO G 3 48  ? -24.295 -35.471 20.546 1.00 48.29  ? 48   PRO G C     1 
ATOM   4786  O  O     . PRO G 3 48  ? -25.236 -35.528 21.336 1.00 48.36  ? 48   PRO G O     1 
ATOM   4787  C  CB    . PRO G 3 48  ? -24.246 -33.559 18.962 1.00 48.38  ? 48   PRO G CB    1 
ATOM   4788  C  CG    . PRO G 3 48  ? -23.291 -33.894 17.900 1.00 48.19  ? 48   PRO G CG    1 
ATOM   4789  C  CD    . PRO G 3 48  ? -21.946 -33.847 18.539 1.00 49.15  ? 48   PRO G CD    1 
ATOM   4790  N  N     . VAL G 3 49  ? -23.799 -36.530 19.912 1.00 48.03  ? 49   VAL G N     1 
ATOM   4791  C  CA    . VAL G 3 49  ? -24.313 -37.879 20.144 1.00 47.68  ? 49   VAL G CA    1 
ATOM   4792  C  C     . VAL G 3 49  ? -24.026 -38.258 21.594 1.00 47.65  ? 49   VAL G C     1 
ATOM   4793  O  O     . VAL G 3 49  ? -24.933 -38.616 22.362 1.00 47.60  ? 49   VAL G O     1 
ATOM   4794  C  CB    . VAL G 3 49  ? -23.669 -38.923 19.186 1.00 47.66  ? 49   VAL G CB    1 
ATOM   4795  C  CG1   . VAL G 3 49  ? -24.126 -40.324 19.549 1.00 48.08  ? 49   VAL G CG1   1 
ATOM   4796  C  CG2   . VAL G 3 49  ? -23.994 -38.620 17.721 1.00 46.85  ? 49   VAL G CG2   1 
ATOM   4797  N  N     . TYR G 3 50  ? -22.758 -38.157 21.968 1.00 47.14  ? 50   TYR G N     1 
ATOM   4798  C  CA    . TYR G 3 50  ? -22.338 -38.434 23.334 1.00 46.95  ? 50   TYR G CA    1 
ATOM   4799  C  C     . TYR G 3 50  ? -23.143 -37.620 24.358 1.00 46.63  ? 50   TYR G C     1 
ATOM   4800  O  O     . TYR G 3 50  ? -23.700 -38.178 25.309 1.00 47.10  ? 50   TYR G O     1 
ATOM   4801  C  CB    . TYR G 3 50  ? -20.858 -38.106 23.471 1.00 46.98  ? 50   TYR G CB    1 
ATOM   4802  C  CG    . TYR G 3 50  ? -20.141 -38.827 24.585 1.00 47.75  ? 50   TYR G CG    1 
ATOM   4803  C  CD1   . TYR G 3 50  ? -19.107 -39.726 24.295 1.00 47.35  ? 50   TYR G CD1   1 
ATOM   4804  C  CD2   . TYR G 3 50  ? -20.454 -38.590 25.924 1.00 48.11  ? 50   TYR G CD2   1 
ATOM   4805  C  CE1   . TYR G 3 50  ? -18.423 -40.375 25.284 1.00 46.03  ? 50   TYR G CE1   1 
ATOM   4806  C  CE2   . TYR G 3 50  ? -19.761 -39.246 26.942 1.00 48.79  ? 50   TYR G CE2   1 
ATOM   4807  C  CZ    . TYR G 3 50  ? -18.751 -40.147 26.603 1.00 48.32  ? 50   TYR G CZ    1 
ATOM   4808  O  OH    . TYR G 3 50  ? -18.046 -40.805 27.587 1.00 48.34  ? 50   TYR G OH    1 
ATOM   4809  N  N     . LEU G 3 51  ? -23.209 -36.306 24.161 1.00 45.99  ? 51   LEU G N     1 
ATOM   4810  C  CA    . LEU G 3 51  ? -23.831 -35.437 25.147 1.00 45.20  ? 51   LEU G CA    1 
ATOM   4811  C  C     . LEU G 3 51  ? -25.307 -35.738 25.286 1.00 44.88  ? 51   LEU G C     1 
ATOM   4812  O  O     . LEU G 3 51  ? -25.813 -35.768 26.405 1.00 45.59  ? 51   LEU G O     1 
ATOM   4813  C  CB    . LEU G 3 51  ? -23.604 -33.950 24.832 1.00 45.35  ? 51   LEU G CB    1 
ATOM   4814  C  CG    . LEU G 3 51  ? -24.410 -32.924 25.652 1.00 44.82  ? 51   LEU G CG    1 
ATOM   4815  C  CD1   . LEU G 3 51  ? -24.179 -33.025 27.160 1.00 44.81  ? 51   LEU G CD1   1 
ATOM   4816  C  CD2   . LEU G 3 51  ? -24.097 -31.530 25.169 1.00 44.84  ? 51   LEU G CD2   1 
ATOM   4817  N  N     . ALA G 3 52  ? -25.994 -35.967 24.171 1.00 43.98  ? 52   ALA G N     1 
ATOM   4818  C  CA    . ALA G 3 52  ? -27.412 -36.309 24.223 1.00 43.26  ? 52   ALA G CA    1 
ATOM   4819  C  C     . ALA G 3 52  ? -27.634 -37.570 25.056 1.00 43.11  ? 52   ALA G C     1 
ATOM   4820  O  O     . ALA G 3 52  ? -28.517 -37.618 25.903 1.00 43.13  ? 52   ALA G O     1 
ATOM   4821  C  CB    . ALA G 3 52  ? -27.968 -36.480 22.823 1.00 43.46  ? 52   ALA G CB    1 
ATOM   4822  N  N     . ALA G 3 53  ? -26.809 -38.585 24.828 1.00 43.20  ? 53   ALA G N     1 
ATOM   4823  C  CA    . ALA G 3 53  ? -26.869 -39.829 25.597 1.00 43.21  ? 53   ALA G CA    1 
ATOM   4824  C  C     . ALA G 3 53  ? -26.716 -39.585 27.087 1.00 43.44  ? 53   ALA G C     1 
ATOM   4825  O  O     . ALA G 3 53  ? -27.472 -40.148 27.895 1.00 43.37  ? 53   ALA G O     1 
ATOM   4826  C  CB    . ALA G 3 53  ? -25.801 -40.795 25.127 1.00 43.28  ? 53   ALA G CB    1 
ATOM   4827  N  N     . VAL G 3 54  ? -25.739 -38.747 27.455 1.00 43.33  ? 54   VAL G N     1 
ATOM   4828  C  CA    . VAL G 3 54  ? -25.507 -38.444 28.871 1.00 42.63  ? 54   VAL G CA    1 
ATOM   4829  C  C     . VAL G 3 54  ? -26.728 -37.755 29.472 1.00 42.49  ? 54   VAL G C     1 
ATOM   4830  O  O     . VAL G 3 54  ? -27.136 -38.066 30.594 1.00 42.22  ? 54   VAL G O     1 
ATOM   4831  C  CB    . VAL G 3 54  ? -24.230 -37.601 29.076 1.00 43.09  ? 54   VAL G CB    1 
ATOM   4832  C  CG1   . VAL G 3 54  ? -24.192 -36.971 30.483 1.00 41.43  ? 54   VAL G CG1   1 
ATOM   4833  C  CG2   . VAL G 3 54  ? -22.989 -38.452 28.799 1.00 42.48  ? 54   VAL G CG2   1 
ATOM   4834  N  N     . LEU G 3 55  ? -27.320 -36.843 28.710 1.00 42.32  ? 55   LEU G N     1 
ATOM   4835  C  CA    . LEU G 3 55  ? -28.483 -36.095 29.173 1.00 42.65  ? 55   LEU G CA    1 
ATOM   4836  C  C     . LEU G 3 55  ? -29.684 -37.005 29.357 1.00 43.39  ? 55   LEU G C     1 
ATOM   4837  O  O     . LEU G 3 55  ? -30.408 -36.908 30.351 1.00 43.51  ? 55   LEU G O     1 
ATOM   4838  C  CB    . LEU G 3 55  ? -28.804 -34.946 28.209 1.00 42.07  ? 55   LEU G CB    1 
ATOM   4839  C  CG    . LEU G 3 55  ? -27.810 -33.777 28.206 1.00 40.91  ? 55   LEU G CG    1 
ATOM   4840  C  CD1   . LEU G 3 55  ? -28.032 -32.850 27.013 1.00 39.73  ? 55   LEU G CD1   1 
ATOM   4841  C  CD2   . LEU G 3 55  ? -27.885 -33.004 29.522 1.00 38.40  ? 55   LEU G CD2   1 
ATOM   4842  N  N     . GLU G 3 56  ? -29.882 -37.907 28.400 1.00 44.22  ? 56   GLU G N     1 
ATOM   4843  C  CA    . GLU G 3 56  ? -30.970 -38.877 28.462 1.00 44.63  ? 56   GLU G CA    1 
ATOM   4844  C  C     . GLU G 3 56  ? -30.789 -39.779 29.667 1.00 44.64  ? 56   GLU G C     1 
ATOM   4845  O  O     . GLU G 3 56  ? -31.731 -40.045 30.435 1.00 44.66  ? 56   GLU G O     1 
ATOM   4846  C  CB    . GLU G 3 56  ? -30.968 -39.719 27.197 1.00 45.03  ? 56   GLU G CB    1 
ATOM   4847  C  CG    . GLU G 3 56  ? -32.247 -40.503 26.952 1.00 47.00  ? 56   GLU G CG    1 
ATOM   4848  C  CD    . GLU G 3 56  ? -32.219 -41.225 25.616 1.00 49.34  ? 56   GLU G CD    1 
ATOM   4849  O  OE1   . GLU G 3 56  ? -31.921 -40.588 24.575 1.00 49.09  ? 56   GLU G OE1   1 
ATOM   4850  O  OE2   . GLU G 3 56  ? -32.489 -42.442 25.615 1.00 51.74  ? 56   GLU G OE2   1 
ATOM   4851  N  N     . TYR G 3 57  ? -29.566 -40.251 29.839 1.00 44.48  ? 57   TYR G N     1 
ATOM   4852  C  CA    . TYR G 3 57  ? -29.283 -41.138 30.950 1.00 44.84  ? 57   TYR G CA    1 
ATOM   4853  C  C     . TYR G 3 57  ? -29.632 -40.534 32.322 1.00 44.98  ? 57   TYR G C     1 
ATOM   4854  O  O     . TYR G 3 57  ? -30.290 -41.184 33.140 1.00 45.12  ? 57   TYR G O     1 
ATOM   4855  C  CB    . TYR G 3 57  ? -27.828 -41.596 30.918 1.00 44.74  ? 57   TYR G CB    1 
ATOM   4856  C  CG    . TYR G 3 57  ? -27.396 -42.131 32.244 1.00 45.47  ? 57   TYR G CG    1 
ATOM   4857  C  CD1   . TYR G 3 57  ? -27.873 -43.365 32.709 1.00 45.84  ? 57   TYR G CD1   1 
ATOM   4858  C  CD2   . TYR G 3 57  ? -26.534 -41.401 33.057 1.00 45.96  ? 57   TYR G CD2   1 
ATOM   4859  C  CE1   . TYR G 3 57  ? -27.495 -43.852 33.941 1.00 44.74  ? 57   TYR G CE1   1 
ATOM   4860  C  CE2   . TYR G 3 57  ? -26.148 -41.884 34.290 1.00 45.25  ? 57   TYR G CE2   1 
ATOM   4861  C  CZ    . TYR G 3 57  ? -26.637 -43.102 34.721 1.00 45.27  ? 57   TYR G CZ    1 
ATOM   4862  O  OH    . TYR G 3 57  ? -26.241 -43.571 35.936 1.00 46.72  ? 57   TYR G OH    1 
ATOM   4863  N  N     . LEU G 3 58  ? -29.192 -39.301 32.574 1.00 44.91  ? 58   LEU G N     1 
ATOM   4864  C  CA    . LEU G 3 58  ? -29.463 -38.664 33.867 1.00 44.85  ? 58   LEU G CA    1 
ATOM   4865  C  C     . LEU G 3 58  ? -30.946 -38.419 34.041 1.00 44.97  ? 58   LEU G C     1 
ATOM   4866  O  O     . LEU G 3 58  ? -31.476 -38.545 35.145 1.00 45.02  ? 58   LEU G O     1 
ATOM   4867  C  CB    . LEU G 3 58  ? -28.658 -37.369 34.060 1.00 44.53  ? 58   LEU G CB    1 
ATOM   4868  C  CG    . LEU G 3 58  ? -27.130 -37.527 34.022 1.00 44.30  ? 58   LEU G CG    1 
ATOM   4869  C  CD1   . LEU G 3 58  ? -26.445 -36.233 33.623 1.00 44.28  ? 58   LEU G CD1   1 
ATOM   4870  C  CD2   . LEU G 3 58  ? -26.569 -38.049 35.344 1.00 43.91  ? 58   LEU G CD2   1 
ATOM   4871  N  N     . THR G 3 59  ? -31.617 -38.084 32.947 1.00 45.18  ? 59   THR G N     1 
ATOM   4872  C  CA    . THR G 3 59  ? -33.066 -37.946 32.966 1.00 45.55  ? 59   THR G CA    1 
ATOM   4873  C  C     . THR G 3 59  ? -33.721 -39.259 33.422 1.00 45.86  ? 59   THR G C     1 
ATOM   4874  O  O     . THR G 3 59  ? -34.550 -39.269 34.339 1.00 45.70  ? 59   THR G O     1 
ATOM   4875  C  CB    . THR G 3 59  ? -33.602 -37.539 31.580 1.00 45.72  ? 59   THR G CB    1 
ATOM   4876  O  OG1   . THR G 3 59  ? -32.826 -36.437 31.082 1.00 45.30  ? 59   THR G OG1   1 
ATOM   4877  C  CG2   . THR G 3 59  ? -35.072 -37.149 31.664 1.00 44.94  ? 59   THR G CG2   1 
ATOM   4878  N  N     . ALA G 3 60  ? -33.337 -40.366 32.789 1.00 46.15  ? 60   ALA G N     1 
ATOM   4879  C  CA    . ALA G 3 60  ? -33.892 -41.672 33.157 1.00 46.51  ? 60   ALA G CA    1 
ATOM   4880  C  C     . ALA G 3 60  ? -33.659 -41.956 34.636 1.00 46.84  ? 60   ALA G C     1 
ATOM   4881  O  O     . ALA G 3 60  ? -34.589 -42.352 35.362 1.00 46.94  ? 60   ALA G O     1 
ATOM   4882  C  CB    . ALA G 3 60  ? -33.308 -42.789 32.289 1.00 46.35  ? 60   ALA G CB    1 
ATOM   4883  N  N     . GLU G 3 61  ? -32.427 -41.729 35.089 1.00 46.92  ? 61   GLU G N     1 
ATOM   4884  C  CA    . GLU G 3 61  ? -32.083 -41.943 36.497 1.00 47.09  ? 61   GLU G CA    1 
ATOM   4885  C  C     . GLU G 3 61  ? -33.018 -41.203 37.455 1.00 46.49  ? 61   GLU G C     1 
ATOM   4886  O  O     . GLU G 3 61  ? -33.561 -41.807 38.366 1.00 47.10  ? 61   GLU G O     1 
ATOM   4887  C  CB    . GLU G 3 61  ? -30.621 -41.584 36.760 1.00 47.49  ? 61   GLU G CB    1 
ATOM   4888  C  CG    . GLU G 3 61  ? -30.163 -41.808 38.183 1.00 50.70  ? 61   GLU G CG    1 
ATOM   4889  C  CD    . GLU G 3 61  ? -29.831 -43.272 38.521 1.00 54.91  ? 61   GLU G CD    1 
ATOM   4890  O  OE1   . GLU G 3 61  ? -29.998 -44.177 37.666 1.00 56.05  ? 61   GLU G OE1   1 
ATOM   4891  O  OE2   . GLU G 3 61  ? -29.385 -43.507 39.671 1.00 57.21  ? 61   GLU G OE2   1 
ATOM   4892  N  N     . ILE G 3 62  ? -33.216 -39.905 37.244 1.00 45.95  ? 62   ILE G N     1 
ATOM   4893  C  CA    . ILE G 3 62  ? -34.113 -39.109 38.089 1.00 45.21  ? 62   ILE G CA    1 
ATOM   4894  C  C     . ILE G 3 62  ? -35.569 -39.546 37.951 1.00 45.07  ? 62   ILE G C     1 
ATOM   4895  O  O     . ILE G 3 62  ? -36.275 -39.659 38.947 1.00 44.41  ? 62   ILE G O     1 
ATOM   4896  C  CB    . ILE G 3 62  ? -34.007 -37.589 37.798 1.00 45.30  ? 62   ILE G CB    1 
ATOM   4897  C  CG1   . ILE G 3 62  ? -32.597 -37.076 38.110 1.00 46.04  ? 62   ILE G CG1   1 
ATOM   4898  C  CG2   . ILE G 3 62  ? -35.027 -36.810 38.619 1.00 45.34  ? 62   ILE G CG2   1 
ATOM   4899  C  CD1   . ILE G 3 62  ? -32.500 -35.562 38.217 1.00 46.55  ? 62   ILE G CD1   1 
ATOM   4900  N  N     . LEU G 3 63  ? -36.020 -39.785 36.721 1.00 45.38  ? 63   LEU G N     1 
ATOM   4901  C  CA    . LEU G 3 63  ? -37.399 -40.225 36.496 1.00 45.80  ? 63   LEU G CA    1 
ATOM   4902  C  C     . LEU G 3 63  ? -37.680 -41.602 37.128 1.00 46.62  ? 63   LEU G C     1 
ATOM   4903  O  O     . LEU G 3 63  ? -38.727 -41.794 37.758 1.00 45.90  ? 63   LEU G O     1 
ATOM   4904  C  CB    . LEU G 3 63  ? -37.745 -40.194 35.008 1.00 45.60  ? 63   LEU G CB    1 
ATOM   4905  C  CG    . LEU G 3 63  ? -37.878 -38.793 34.404 1.00 45.00  ? 63   LEU G CG    1 
ATOM   4906  C  CD1   . LEU G 3 63  ? -38.178 -38.894 32.936 1.00 45.00  ? 63   LEU G CD1   1 
ATOM   4907  C  CD2   . LEU G 3 63  ? -38.944 -37.969 35.109 1.00 43.52  ? 63   LEU G CD2   1 
ATOM   4908  N  N     . GLU G 3 64  ? -36.727 -42.527 36.993 1.00 47.72  ? 64   GLU G N     1 
ATOM   4909  C  CA    . GLU G 3 64  ? -36.762 -43.801 37.725 1.00 49.71  ? 64   GLU G CA    1 
ATOM   4910  C  C     . GLU G 3 64  ? -37.064 -43.583 39.205 1.00 50.11  ? 64   GLU G C     1 
ATOM   4911  O  O     . GLU G 3 64  ? -38.089 -44.053 39.712 1.00 50.81  ? 64   GLU G O     1 
ATOM   4912  C  CB    . GLU G 3 64  ? -35.437 -44.557 37.554 1.00 50.21  ? 64   GLU G CB    1 
ATOM   4913  C  CG    . GLU G 3 64  ? -35.277 -45.816 38.407 1.00 54.40  ? 64   GLU G CG    1 
ATOM   4914  C  CD    . GLU G 3 64  ? -36.103 -47.006 37.913 1.00 60.18  ? 64   GLU G CD    1 
ATOM   4915  O  OE1   . GLU G 3 64  ? -36.153 -47.251 36.680 1.00 62.15  ? 64   GLU G OE1   1 
ATOM   4916  O  OE2   . GLU G 3 64  ? -36.694 -47.712 38.769 1.00 62.62  ? 64   GLU G OE2   1 
ATOM   4917  N  N     . LEU G 3 65  ? -36.195 -42.842 39.893 1.00 50.44  ? 65   LEU G N     1 
ATOM   4918  C  CA    . LEU G 3 65  ? -36.319 -42.673 41.346 1.00 50.34  ? 65   LEU G CA    1 
ATOM   4919  C  C     . LEU G 3 65  ? -37.510 -41.808 41.744 1.00 50.53  ? 65   LEU G C     1 
ATOM   4920  O  O     . LEU G 3 65  ? -38.058 -41.960 42.839 1.00 50.81  ? 65   LEU G O     1 
ATOM   4921  C  CB    . LEU G 3 65  ? -35.026 -42.111 41.940 1.00 50.48  ? 65   LEU G CB    1 
ATOM   4922  C  CG    . LEU G 3 65  ? -33.738 -42.920 41.728 1.00 50.49  ? 65   LEU G CG    1 
ATOM   4923  C  CD1   . LEU G 3 65  ? -32.520 -42.086 42.089 1.00 50.07  ? 65   LEU G CD1   1 
ATOM   4924  C  CD2   . LEU G 3 65  ? -33.744 -44.235 42.524 1.00 48.31  ? 65   LEU G CD2   1 
ATOM   4925  N  N     . ALA G 3 66  ? -37.914 -40.901 40.863 1.00 50.30  ? 66   ALA G N     1 
ATOM   4926  C  CA    . ALA G 3 66  ? -39.051 -40.038 41.155 1.00 50.39  ? 66   ALA G CA    1 
ATOM   4927  C  C     . ALA G 3 66  ? -40.363 -40.806 40.959 1.00 50.74  ? 66   ALA G C     1 
ATOM   4928  O  O     . ALA G 3 66  ? -41.335 -40.608 41.699 1.00 50.37  ? 66   ALA G O     1 
ATOM   4929  C  CB    . ALA G 3 66  ? -39.006 -38.782 40.295 1.00 49.93  ? 66   ALA G CB    1 
ATOM   4930  N  N     . GLY G 3 67  ? -40.379 -41.681 39.956 1.00 51.21  ? 67   GLY G N     1 
ATOM   4931  C  CA    . GLY G 3 67  ? -41.495 -42.596 39.748 1.00 51.97  ? 67   GLY G CA    1 
ATOM   4932  C  C     . GLY G 3 67  ? -41.730 -43.428 40.993 1.00 52.47  ? 67   GLY G C     1 
ATOM   4933  O  O     . GLY G 3 67  ? -42.863 -43.553 41.462 1.00 52.36  ? 67   GLY G O     1 
ATOM   4934  N  N     . ASN G 3 68  ? -40.649 -43.975 41.542 1.00 53.10  ? 68   ASN G N     1 
ATOM   4935  C  CA    . ASN G 3 68  ? -40.732 -44.775 42.763 1.00 54.04  ? 68   ASN G CA    1 
ATOM   4936  C  C     . ASN G 3 68  ? -41.327 -44.002 43.931 1.00 54.39  ? 68   ASN G C     1 
ATOM   4937  O  O     . ASN G 3 68  ? -42.229 -44.494 44.607 1.00 54.61  ? 68   ASN G O     1 
ATOM   4938  C  CB    . ASN G 3 68  ? -39.359 -45.338 43.157 1.00 53.87  ? 68   ASN G CB    1 
ATOM   4939  C  CG    . ASN G 3 68  ? -38.819 -46.315 42.145 1.00 54.53  ? 68   ASN G CG    1 
ATOM   4940  O  OD1   . ASN G 3 68  ? -39.556 -46.822 41.286 1.00 55.65  ? 68   ASN G OD1   1 
ATOM   4941  N  ND2   . ASN G 3 68  ? -37.517 -46.591 42.233 1.00 54.37  ? 68   ASN G ND2   1 
ATOM   4942  N  N     . ALA G 3 69  ? -40.811 -42.799 44.164 1.00 54.93  ? 69   ALA G N     1 
ATOM   4943  C  CA    . ALA G 3 69  ? -41.306 -41.932 45.233 1.00 55.62  ? 69   ALA G CA    1 
ATOM   4944  C  C     . ALA G 3 69  ? -42.788 -41.635 45.070 1.00 56.06  ? 69   ALA G C     1 
ATOM   4945  O  O     . ALA G 3 69  ? -43.512 -41.552 46.059 1.00 55.92  ? 69   ALA G O     1 
ATOM   4946  C  CB    . ALA G 3 69  ? -40.503 -40.634 45.289 1.00 55.48  ? 69   ALA G CB    1 
ATOM   4947  N  N     . ALA G 3 70  ? -43.228 -41.472 43.823 1.00 57.06  ? 70   ALA G N     1 
ATOM   4948  C  CA    . ALA G 3 70  ? -44.653 -41.367 43.508 1.00 58.38  ? 70   ALA G CA    1 
ATOM   4949  C  C     . ALA G 3 70  ? -45.398 -42.617 43.965 1.00 59.41  ? 70   ALA G C     1 
ATOM   4950  O  O     . ALA G 3 70  ? -46.396 -42.515 44.684 1.00 59.56  ? 70   ALA G O     1 
ATOM   4951  C  CB    . ALA G 3 70  ? -44.872 -41.126 42.020 1.00 57.92  ? 70   ALA G CB    1 
ATOM   4952  N  N     . ARG G 3 71  ? -44.891 -43.787 43.568 1.00 60.84  ? 71   ARG G N     1 
ATOM   4953  C  CA    . ARG G 3 71  ? -45.502 -45.068 43.923 1.00 62.58  ? 71   ARG G CA    1 
ATOM   4954  C  C     . ARG G 3 71  ? -45.641 -45.196 45.438 1.00 63.26  ? 71   ARG G C     1 
ATOM   4955  O  O     . ARG G 3 71  ? -46.721 -45.519 45.940 1.00 63.54  ? 71   ARG G O     1 
ATOM   4956  C  CB    . ARG G 3 71  ? -44.691 -46.238 43.352 1.00 63.09  ? 71   ARG G CB    1 
ATOM   4957  C  CG    . ARG G 3 71  ? -45.399 -47.591 43.382 1.00 65.24  ? 71   ARG G CG    1 
ATOM   4958  C  CD    . ARG G 3 71  ? -44.400 -48.751 43.341 1.00 69.41  ? 71   ARG G CD    1 
ATOM   4959  N  NE    . ARG G 3 71  ? -45.044 -50.030 43.682 1.00 72.90  ? 71   ARG G NE    1 
ATOM   4960  C  CZ    . ARG G 3 71  ? -44.402 -51.129 44.112 1.00 74.41  ? 71   ARG G CZ    1 
ATOM   4961  N  NH1   . ARG G 3 71  ? -43.079 -51.129 44.269 1.00 74.93  ? 71   ARG G NH1   1 
ATOM   4962  N  NH2   . ARG G 3 71  ? -45.088 -52.235 44.398 1.00 75.20  ? 71   ARG G NH2   1 
ATOM   4963  N  N     . ASP G 3 72  ? -44.557 -44.906 46.156 1.00 64.02  ? 72   ASP G N     1 
ATOM   4964  C  CA    . ASP G 3 72  ? -44.516 -45.028 47.615 1.00 64.84  ? 72   ASP G CA    1 
ATOM   4965  C  C     . ASP G 3 72  ? -45.570 -44.170 48.288 1.00 65.34  ? 72   ASP G C     1 
ATOM   4966  O  O     . ASP G 3 72  ? -46.056 -44.505 49.368 1.00 65.56  ? 72   ASP G O     1 
ATOM   4967  C  CB    . ASP G 3 72  ? -43.136 -44.638 48.161 1.00 64.96  ? 72   ASP G CB    1 
ATOM   4968  C  CG    . ASP G 3 72  ? -42.004 -45.465 47.561 1.00 66.28  ? 72   ASP G CG    1 
ATOM   4969  O  OD1   . ASP G 3 72  ? -42.135 -46.708 47.460 1.00 67.41  ? 72   ASP G OD1   1 
ATOM   4970  O  OD2   . ASP G 3 72  ? -40.974 -44.865 47.189 1.00 67.50  ? 72   ASP G OD2   1 
ATOM   4971  N  N     . ASN G 3 73  ? -45.918 -43.054 47.657 1.00 65.86  ? 73   ASN G N     1 
ATOM   4972  C  CA    . ASN G 3 73  ? -46.866 -42.125 48.252 1.00 66.37  ? 73   ASN G CA    1 
ATOM   4973  C  C     . ASN G 3 73  ? -48.300 -42.301 47.714 1.00 66.27  ? 73   ASN G C     1 
ATOM   4974  O  O     . ASN G 3 73  ? -49.159 -41.434 47.913 1.00 66.26  ? 73   ASN G O     1 
ATOM   4975  C  CB    . ASN G 3 73  ? -46.352 -40.683 48.123 1.00 66.63  ? 73   ASN G CB    1 
ATOM   4976  C  CG    . ASN G 3 73  ? -45.095 -40.425 48.973 1.00 68.13  ? 73   ASN G CG    1 
ATOM   4977  O  OD1   . ASN G 3 73  ? -45.173 -39.810 50.042 1.00 70.14  ? 73   ASN G OD1   1 
ATOM   4978  N  ND2   . ASN G 3 73  ? -43.940 -40.900 48.505 1.00 68.22  ? 73   ASN G ND2   1 
ATOM   4979  N  N     . LYS G 3 74  ? -48.538 -43.444 47.058 1.00 65.92  ? 74   LYS G N     1 
ATOM   4980  C  CA    . LYS G 3 74  ? -49.855 -43.844 46.527 1.00 65.85  ? 74   LYS G CA    1 
ATOM   4981  C  C     . LYS G 3 74  ? -50.321 -42.975 45.358 1.00 65.13  ? 74   LYS G C     1 
ATOM   4982  O  O     . LYS G 3 74  ? -51.496 -42.591 45.287 1.00 65.07  ? 74   LYS G O     1 
ATOM   4983  C  CB    . LYS G 3 74  ? -50.947 -43.853 47.622 1.00 66.25  ? 74   LYS G CB    1 
ATOM   4984  C  CG    . LYS G 3 74  ? -50.588 -44.527 48.944 1.00 68.03  ? 74   LYS G CG    1 
ATOM   4985  C  CD    . LYS G 3 74  ? -50.589 -46.052 48.839 1.00 70.80  ? 74   LYS G CD    1 
ATOM   4986  C  CE    . LYS G 3 74  ? -50.097 -46.673 50.148 1.00 71.90  ? 74   LYS G CE    1 
ATOM   4987  N  NZ    . LYS G 3 74  ? -49.442 -47.995 49.925 1.00 71.43  ? 74   LYS G NZ    1 
ATOM   4988  N  N     . LYS G 3 75  ? -49.409 -42.673 44.436 1.00 64.31  ? 75   LYS G N     1 
ATOM   4989  C  CA    . LYS G 3 75  ? -49.716 -41.754 43.333 1.00 63.26  ? 75   LYS G CA    1 
ATOM   4990  C  C     . LYS G 3 75  ? -49.130 -42.179 41.995 1.00 62.22  ? 75   LYS G C     1 
ATOM   4991  O  O     . LYS G 3 75  ? -48.141 -42.918 41.942 1.00 62.08  ? 75   LYS G O     1 
ATOM   4992  C  CB    . LYS G 3 75  ? -49.291 -40.325 43.693 1.00 63.46  ? 75   LYS G CB    1 
ATOM   4993  C  CG    . LYS G 3 75  ? -50.336 -39.575 44.520 1.00 64.36  ? 75   LYS G CG    1 
ATOM   4994  C  CD    . LYS G 3 75  ? -49.692 -38.575 45.453 1.00 66.01  ? 75   LYS G CD    1 
ATOM   4995  C  CE    . LYS G 3 75  ? -50.678 -37.508 45.873 1.00 67.25  ? 75   LYS G CE    1 
ATOM   4996  N  NZ    . LYS G 3 75  ? -50.055 -36.154 45.688 1.00 69.04  ? 75   LYS G NZ    1 
ATOM   4997  N  N     . THR G 3 76  ? -49.760 -41.706 40.920 1.00 61.11  ? 76   THR G N     1 
ATOM   4998  C  CA    . THR G 3 76  ? -49.368 -42.050 39.543 1.00 59.79  ? 76   THR G CA    1 
ATOM   4999  C  C     . THR G 3 76  ? -48.793 -40.852 38.787 1.00 58.41  ? 76   THR G C     1 
ATOM   5000  O  O     . THR G 3 76  ? -48.181 -41.011 37.733 1.00 58.14  ? 76   THR G O     1 
ATOM   5001  C  CB    . THR G 3 76  ? -50.564 -42.626 38.731 1.00 60.05  ? 76   THR G CB    1 
ATOM   5002  O  OG1   . THR G 3 76  ? -51.612 -41.649 38.643 1.00 60.87  ? 76   THR G OG1   1 
ATOM   5003  C  CG2   . THR G 3 76  ? -51.108 -43.899 39.385 1.00 60.36  ? 76   THR G CG2   1 
ATOM   5004  N  N     . ARG G 3 77  ? -49.001 -39.651 39.318 1.00 56.87  ? 77   ARG G N     1 
ATOM   5005  C  CA    . ARG G 3 77  ? -48.450 -38.456 38.689 1.00 55.59  ? 77   ARG G CA    1 
ATOM   5006  C  C     . ARG G 3 77  ? -47.247 -37.927 39.471 1.00 54.00  ? 77   ARG G C     1 
ATOM   5007  O  O     . ARG G 3 77  ? -47.363 -37.599 40.652 1.00 53.69  ? 77   ARG G O     1 
ATOM   5008  C  CB    . ARG G 3 77  ? -49.522 -37.376 38.555 1.00 55.84  ? 77   ARG G CB    1 
ATOM   5009  C  CG    . ARG G 3 77  ? -49.131 -36.208 37.673 1.00 56.95  ? 77   ARG G CG    1 
ATOM   5010  C  CD    . ARG G 3 77  ? -50.273 -35.237 37.598 1.00 59.56  ? 77   ARG G CD    1 
ATOM   5011  N  NE    . ARG G 3 77  ? -51.363 -35.746 36.763 1.00 61.30  ? 77   ARG G NE    1 
ATOM   5012  C  CZ    . ARG G 3 77  ? -52.649 -35.495 36.989 1.00 61.96  ? 77   ARG G CZ    1 
ATOM   5013  N  NH1   . ARG G 3 77  ? -53.018 -34.764 38.038 1.00 61.71  ? 77   ARG G NH1   1 
ATOM   5014  N  NH2   . ARG G 3 77  ? -53.565 -35.991 36.172 1.00 62.93  ? 77   ARG G NH2   1 
ATOM   5015  N  N     . ILE G 3 78  ? -46.101 -37.851 38.802 1.00 52.08  ? 78   ILE G N     1 
ATOM   5016  C  CA    . ILE G 3 78  ? -44.911 -37.230 39.383 1.00 50.80  ? 78   ILE G CA    1 
ATOM   5017  C  C     . ILE G 3 78  ? -45.111 -35.725 39.561 1.00 49.80  ? 78   ILE G C     1 
ATOM   5018  O  O     . ILE G 3 78  ? -45.417 -35.015 38.599 1.00 49.81  ? 78   ILE G O     1 
ATOM   5019  C  CB    . ILE G 3 78  ? -43.653 -37.482 38.526 1.00 50.43  ? 78   ILE G CB    1 
ATOM   5020  C  CG1   . ILE G 3 78  ? -43.220 -38.943 38.644 1.00 50.18  ? 78   ILE G CG1   1 
ATOM   5021  C  CG2   . ILE G 3 78  ? -42.527 -36.569 38.960 1.00 50.14  ? 78   ILE G CG2   1 
ATOM   5022  C  CD1   . ILE G 3 78  ? -42.206 -39.393 37.580 1.00 49.96  ? 78   ILE G CD1   1 
ATOM   5023  N  N     . ILE G 3 79  ? -44.969 -35.265 40.801 1.00 48.63  ? 79   ILE G N     1 
ATOM   5024  C  CA    . ILE G 3 79  ? -44.983 -33.841 41.118 1.00 47.94  ? 79   ILE G CA    1 
ATOM   5025  C  C     . ILE G 3 79  ? -43.587 -33.382 41.619 1.00 47.48  ? 79   ILE G C     1 
ATOM   5026  O  O     . ILE G 3 79  ? -42.686 -34.212 41.817 1.00 47.60  ? 79   ILE G O     1 
ATOM   5027  C  CB    . ILE G 3 79  ? -46.133 -33.483 42.108 1.00 48.05  ? 79   ILE G CB    1 
ATOM   5028  C  CG1   . ILE G 3 79  ? -45.933 -34.157 43.473 1.00 47.50  ? 79   ILE G CG1   1 
ATOM   5029  C  CG2   . ILE G 3 79  ? -47.496 -33.837 41.480 1.00 47.94  ? 79   ILE G CG2   1 
ATOM   5030  C  CD1   . ILE G 3 79  ? -46.834 -33.617 44.582 1.00 46.57  ? 79   ILE G CD1   1 
ATOM   5031  N  N     . PRO G 3 80  ? -43.384 -32.063 41.790 1.00 46.64  ? 80   PRO G N     1 
ATOM   5032  C  CA    . PRO G 3 80  ? -42.094 -31.588 42.293 1.00 45.79  ? 80   PRO G CA    1 
ATOM   5033  C  C     . PRO G 3 80  ? -41.667 -32.223 43.624 1.00 45.08  ? 80   PRO G C     1 
ATOM   5034  O  O     . PRO G 3 80  ? -40.479 -32.482 43.821 1.00 44.72  ? 80   PRO G O     1 
ATOM   5035  C  CB    . PRO G 3 80  ? -42.335 -30.092 42.465 1.00 45.97  ? 80   PRO G CB    1 
ATOM   5036  C  CG    . PRO G 3 80  ? -43.328 -29.772 41.408 1.00 45.69  ? 80   PRO G CG    1 
ATOM   5037  C  CD    . PRO G 3 80  ? -44.264 -30.935 41.421 1.00 46.72  ? 80   PRO G CD    1 
ATOM   5038  N  N     . ARG G 3 81  ? -42.625 -32.494 44.513 1.00 44.43  ? 81   ARG G N     1 
ATOM   5039  C  CA    . ARG G 3 81  ? -42.315 -33.176 45.767 1.00 43.55  ? 81   ARG G CA    1 
ATOM   5040  C  C     . ARG G 3 81  ? -41.528 -34.451 45.495 1.00 43.20  ? 81   ARG G C     1 
ATOM   5041  O  O     . ARG G 3 81  ? -40.510 -34.701 46.144 1.00 42.46  ? 81   ARG G O     1 
ATOM   5042  C  CB    . ARG G 3 81  ? -43.585 -33.484 46.569 1.00 43.54  ? 81   ARG G CB    1 
ATOM   5043  C  CG    . ARG G 3 81  ? -43.364 -34.246 47.891 1.00 43.82  ? 81   ARG G CG    1 
ATOM   5044  C  CD    . ARG G 3 81  ? -42.275 -33.621 48.767 1.00 42.57  ? 81   ARG G CD    1 
ATOM   5045  N  NE    . ARG G 3 81  ? -42.328 -34.112 50.141 1.00 43.29  ? 81   ARG G NE    1 
ATOM   5046  C  CZ    . ARG G 3 81  ? -41.490 -33.747 51.112 1.00 44.12  ? 81   ARG G CZ    1 
ATOM   5047  N  NH1   . ARG G 3 81  ? -40.499 -32.879 50.868 1.00 44.04  ? 81   ARG G NH1   1 
ATOM   5048  N  NH2   . ARG G 3 81  ? -41.639 -34.250 52.332 1.00 41.33  ? 81   ARG G NH2   1 
ATOM   5049  N  N     . HIS G 3 82  ? -41.989 -35.232 44.515 1.00 42.50  ? 82   HIS G N     1 
ATOM   5050  C  CA    . HIS G 3 82  ? -41.395 -36.527 44.237 1.00 42.01  ? 82   HIS G CA    1 
ATOM   5051  C  C     . HIS G 3 82  ? -39.997 -36.391 43.656 1.00 41.81  ? 82   HIS G C     1 
ATOM   5052  O  O     . HIS G 3 82  ? -39.119 -37.225 43.920 1.00 41.80  ? 82   HIS G O     1 
ATOM   5053  C  CB    . HIS G 3 82  ? -42.297 -37.383 43.336 1.00 41.46  ? 82   HIS G CB    1 
ATOM   5054  C  CG    . HIS G 3 82  ? -43.692 -37.524 43.852 1.00 41.45  ? 82   HIS G CG    1 
ATOM   5055  N  ND1   . HIS G 3 82  ? -44.796 -37.465 43.031 1.00 40.69  ? 82   HIS G ND1   1 
ATOM   5056  C  CD2   . HIS G 3 82  ? -44.168 -37.680 45.111 1.00 42.19  ? 82   HIS G CD2   1 
ATOM   5057  C  CE1   . HIS G 3 82  ? -45.891 -37.602 43.759 1.00 40.88  ? 82   HIS G CE1   1 
ATOM   5058  N  NE2   . HIS G 3 82  ? -45.538 -37.731 45.024 1.00 41.60  ? 82   HIS G NE2   1 
ATOM   5059  N  N     . LEU G 3 83  ? -39.796 -35.344 42.868 1.00 41.59  ? 83   LEU G N     1 
ATOM   5060  C  CA    . LEU G 3 83  ? -38.475 -35.046 42.303 1.00 41.28  ? 83   LEU G CA    1 
ATOM   5061  C  C     . LEU G 3 83  ? -37.490 -34.691 43.413 1.00 40.84  ? 83   LEU G C     1 
ATOM   5062  O  O     . LEU G 3 83  ? -36.356 -35.161 43.407 1.00 40.56  ? 83   LEU G O     1 
ATOM   5063  C  CB    . LEU G 3 83  ? -38.568 -33.899 41.301 1.00 41.57  ? 83   LEU G CB    1 
ATOM   5064  C  CG    . LEU G 3 83  ? -39.244 -34.205 39.957 1.00 41.80  ? 83   LEU G CG    1 
ATOM   5065  C  CD1   . LEU G 3 83  ? -39.453 -32.904 39.195 1.00 40.99  ? 83   LEU G CD1   1 
ATOM   5066  C  CD2   . LEU G 3 83  ? -38.433 -35.183 39.129 1.00 41.40  ? 83   LEU G CD2   1 
ATOM   5067  N  N     . GLN G 3 84  ? -37.950 -33.893 44.377 1.00 40.48  ? 84   GLN G N     1 
ATOM   5068  C  CA    . GLN G 3 84  ? -37.160 -33.552 45.561 1.00 40.56  ? 84   GLN G CA    1 
ATOM   5069  C  C     . GLN G 3 84  ? -36.768 -34.789 46.373 1.00 41.05  ? 84   GLN G C     1 
ATOM   5070  O  O     . GLN G 3 84  ? -35.570 -35.052 46.559 1.00 41.90  ? 84   GLN G O     1 
ATOM   5071  C  CB    . GLN G 3 84  ? -37.893 -32.531 46.436 1.00 39.91  ? 84   GLN G CB    1 
ATOM   5072  C  CG    . GLN G 3 84  ? -37.197 -32.176 47.745 1.00 38.96  ? 84   GLN G CG    1 
ATOM   5073  C  CD    . GLN G 3 84  ? -35.903 -31.337 47.583 1.00 39.11  ? 84   GLN G CD    1 
ATOM   5074  O  OE1   . GLN G 3 84  ? -35.258 -31.319 46.520 1.00 35.72  ? 84   GLN G OE1   1 
ATOM   5075  N  NE2   . GLN G 3 84  ? -35.503 -30.675 48.673 1.00 36.46  ? 84   GLN G NE2   1 
ATOM   5076  N  N     . LEU G 3 85  ? -37.758 -35.551 46.839 1.00 40.94  ? 85   LEU G N     1 
ATOM   5077  C  CA    . LEU G 3 85  ? -37.497 -36.816 47.542 1.00 40.89  ? 85   LEU G CA    1 
ATOM   5078  C  C     . LEU G 3 85  ? -36.501 -37.705 46.793 1.00 40.94  ? 85   LEU G C     1 
ATOM   5079  O  O     . LEU G 3 85  ? -35.613 -38.299 47.401 1.00 40.85  ? 85   LEU G O     1 
ATOM   5080  C  CB    . LEU G 3 85  ? -38.788 -37.598 47.780 1.00 40.71  ? 85   LEU G CB    1 
ATOM   5081  C  CG    . LEU G 3 85  ? -39.868 -37.058 48.730 1.00 40.82  ? 85   LEU G CG    1 
ATOM   5082  C  CD1   . LEU G 3 85  ? -41.033 -38.018 48.765 1.00 40.48  ? 85   LEU G CD1   1 
ATOM   5083  C  CD2   . LEU G 3 85  ? -39.352 -36.824 50.129 1.00 39.29  ? 85   LEU G CD2   1 
ATOM   5084  N  N     . ALA G 3 86  ? -36.639 -37.789 45.474 1.00 40.81  ? 86   ALA G N     1 
ATOM   5085  C  CA    . ALA G 3 86  ? -35.760 -38.641 44.691 1.00 41.00  ? 86   ALA G CA    1 
ATOM   5086  C  C     . ALA G 3 86  ? -34.318 -38.160 44.794 1.00 41.30  ? 86   ALA G C     1 
ATOM   5087  O  O     . ALA G 3 86  ? -33.403 -38.943 45.053 1.00 41.08  ? 86   ALA G O     1 
ATOM   5088  C  CB    . ALA G 3 86  ? -36.198 -38.677 43.238 1.00 40.74  ? 86   ALA G CB    1 
ATOM   5089  N  N     . VAL G 3 87  ? -34.136 -36.860 44.578 1.00 41.62  ? 87   VAL G N     1 
ATOM   5090  C  CA    . VAL G 3 87  ? -32.810 -36.255 44.535 1.00 41.49  ? 87   VAL G CA    1 
ATOM   5091  C  C     . VAL G 3 87  ? -32.107 -36.280 45.896 1.00 41.52  ? 87   VAL G C     1 
ATOM   5092  O  O     . VAL G 3 87  ? -30.952 -36.669 45.978 1.00 40.70  ? 87   VAL G O     1 
ATOM   5093  C  CB    . VAL G 3 87  ? -32.856 -34.818 43.936 1.00 41.27  ? 87   VAL G CB    1 
ATOM   5094  C  CG1   . VAL G 3 87  ? -31.574 -34.060 44.221 1.00 40.54  ? 87   VAL G CG1   1 
ATOM   5095  C  CG2   . VAL G 3 87  ? -33.092 -34.893 42.440 1.00 40.98  ? 87   VAL G CG2   1 
ATOM   5096  N  N     . ARG G 3 88  ? -32.800 -35.881 46.956 1.00 42.29  ? 88   ARG G N     1 
ATOM   5097  C  CA    . ARG G 3 88  ? -32.127 -35.751 48.253 1.00 43.44  ? 88   ARG G CA    1 
ATOM   5098  C  C     . ARG G 3 88  ? -31.907 -37.086 48.978 1.00 44.06  ? 88   ARG G C     1 
ATOM   5099  O  O     . ARG G 3 88  ? -31.041 -37.180 49.850 1.00 44.69  ? 88   ARG G O     1 
ATOM   5100  C  CB    . ARG G 3 88  ? -32.833 -34.719 49.151 1.00 43.40  ? 88   ARG G CB    1 
ATOM   5101  C  CG    . ARG G 3 88  ? -33.612 -33.643 48.371 1.00 43.48  ? 88   ARG G CG    1 
ATOM   5102  C  CD    . ARG G 3 88  ? -32.889 -32.279 48.078 1.00 42.73  ? 88   ARG G CD    1 
ATOM   5103  N  NE    . ARG G 3 88  ? -31.548 -32.346 47.516 1.00 41.19  ? 88   ARG G NE    1 
ATOM   5104  C  CZ    . ARG G 3 88  ? -31.015 -31.467 46.655 1.00 39.48  ? 88   ARG G CZ    1 
ATOM   5105  N  NH1   . ARG G 3 88  ? -31.700 -30.441 46.176 1.00 35.58  ? 88   ARG G NH1   1 
ATOM   5106  N  NH2   . ARG G 3 88  ? -29.766 -31.644 46.246 1.00 39.69  ? 88   ARG G NH2   1 
ATOM   5107  N  N     . ASN G 3 89  ? -32.659 -38.123 48.604 1.00 44.49  ? 89   ASN G N     1 
ATOM   5108  C  CA    . ASN G 3 89  ? -32.458 -39.451 49.187 1.00 44.87  ? 89   ASN G CA    1 
ATOM   5109  C  C     . ASN G 3 89  ? -31.384 -40.247 48.464 1.00 45.45  ? 89   ASN G C     1 
ATOM   5110  O  O     . ASN G 3 89  ? -31.101 -41.380 48.840 1.00 45.69  ? 89   ASN G O     1 
ATOM   5111  C  CB    . ASN G 3 89  ? -33.770 -40.245 49.232 1.00 44.62  ? 89   ASN G CB    1 
ATOM   5112  C  CG    . ASN G 3 89  ? -34.666 -39.840 50.390 1.00 44.26  ? 89   ASN G CG    1 
ATOM   5113  O  OD1   . ASN G 3 89  ? -34.239 -39.779 51.548 1.00 43.69  ? 89   ASN G OD1   1 
ATOM   5114  N  ND2   . ASN G 3 89  ? -35.925 -39.578 50.085 1.00 45.39  ? 89   ASN G ND2   1 
ATOM   5115  N  N     . ASP G 3 90  ? -30.800 -39.655 47.421 1.00 46.03  ? 90   ASP G N     1 
ATOM   5116  C  CA    . ASP G 3 90  ? -29.750 -40.296 46.648 1.00 46.66  ? 90   ASP G CA    1 
ATOM   5117  C  C     . ASP G 3 90  ? -28.459 -39.505 46.799 1.00 47.22  ? 90   ASP G C     1 
ATOM   5118  O  O     . ASP G 3 90  ? -28.374 -38.348 46.393 1.00 47.15  ? 90   ASP G O     1 
ATOM   5119  C  CB    . ASP G 3 90  ? -30.139 -40.391 45.173 1.00 46.94  ? 90   ASP G CB    1 
ATOM   5120  C  CG    . ASP G 3 90  ? -29.125 -41.165 44.353 1.00 48.78  ? 90   ASP G CG    1 
ATOM   5121  O  OD1   . ASP G 3 90  ? -29.202 -42.420 44.332 1.00 52.51  ? 90   ASP G OD1   1 
ATOM   5122  O  OD2   . ASP G 3 90  ? -28.252 -40.522 43.726 1.00 49.86  ? 90   ASP G OD2   1 
ATOM   5123  N  N     . GLU G 3 91  ? -27.445 -40.144 47.368 1.00 47.64  ? 91   GLU G N     1 
ATOM   5124  C  CA    . GLU G 3 91  ? -26.195 -39.474 47.672 1.00 48.02  ? 91   GLU G CA    1 
ATOM   5125  C  C     . GLU G 3 91  ? -25.574 -38.768 46.459 1.00 47.44  ? 91   GLU G C     1 
ATOM   5126  O  O     . GLU G 3 91  ? -25.088 -37.647 46.573 1.00 47.40  ? 91   GLU G O     1 
ATOM   5127  C  CB    . GLU G 3 91  ? -25.204 -40.463 48.275 1.00 48.60  ? 91   GLU G CB    1 
ATOM   5128  C  CG    . GLU G 3 91  ? -24.250 -39.827 49.279 1.00 52.69  ? 91   GLU G CG    1 
ATOM   5129  C  CD    . GLU G 3 91  ? -22.974 -40.634 49.441 1.00 58.37  ? 91   GLU G CD    1 
ATOM   5130  O  OE1   . GLU G 3 91  ? -22.226 -40.757 48.447 1.00 60.99  ? 91   GLU G OE1   1 
ATOM   5131  O  OE2   . GLU G 3 91  ? -22.713 -41.149 50.554 1.00 61.41  ? 91   GLU G OE2   1 
ATOM   5132  N  N     . GLU G 3 92  ? -25.599 -39.417 45.300 1.00 46.80  ? 92   GLU G N     1 
ATOM   5133  C  CA    . GLU G 3 92  ? -24.940 -38.863 44.126 1.00 46.06  ? 92   GLU G CA    1 
ATOM   5134  C  C     . GLU G 3 92  ? -25.755 -37.752 43.441 1.00 45.01  ? 92   GLU G C     1 
ATOM   5135  O  O     . GLU G 3 92  ? -25.222 -36.690 43.113 1.00 44.42  ? 92   GLU G O     1 
ATOM   5136  C  CB    . GLU G 3 92  ? -24.515 -39.974 43.161 1.00 46.17  ? 92   GLU G CB    1 
ATOM   5137  C  CG    . GLU G 3 92  ? -23.297 -40.737 43.672 1.00 48.37  ? 92   GLU G CG    1 
ATOM   5138  C  CD    . GLU G 3 92  ? -22.723 -41.724 42.671 1.00 52.49  ? 92   GLU G CD    1 
ATOM   5139  O  OE1   . GLU G 3 92  ? -23.320 -41.906 41.582 1.00 54.56  ? 92   GLU G OE1   1 
ATOM   5140  O  OE2   . GLU G 3 92  ? -21.651 -42.316 42.977 1.00 54.54  ? 92   GLU G OE2   1 
ATOM   5141  N  N     . LEU G 3 93  ? -27.047 -37.991 43.253 1.00 43.78  ? 93   LEU G N     1 
ATOM   5142  C  CA    . LEU G 3 93  ? -27.925 -36.966 42.682 1.00 42.80  ? 93   LEU G CA    1 
ATOM   5143  C  C     . LEU G 3 93  ? -27.970 -35.732 43.589 1.00 42.06  ? 93   LEU G C     1 
ATOM   5144  O  O     . LEU G 3 93  ? -28.035 -34.597 43.108 1.00 41.20  ? 93   LEU G O     1 
ATOM   5145  C  CB    . LEU G 3 93  ? -29.338 -37.512 42.446 1.00 42.30  ? 93   LEU G CB    1 
ATOM   5146  C  CG    . LEU G 3 93  ? -29.543 -38.454 41.263 1.00 41.70  ? 93   LEU G CG    1 
ATOM   5147  C  CD1   . LEU G 3 93  ? -30.988 -38.932 41.223 1.00 42.35  ? 93   LEU G CD1   1 
ATOM   5148  C  CD2   . LEU G 3 93  ? -29.158 -37.782 39.934 1.00 41.94  ? 93   LEU G CD2   1 
ATOM   5149  N  N     . ASN G 3 94  ? -27.916 -35.977 44.899 1.00 41.29  ? 94   ASN G N     1 
ATOM   5150  C  CA    . ASN G 3 94  ? -27.896 -34.909 45.871 1.00 40.57  ? 94   ASN G CA    1 
ATOM   5151  C  C     . ASN G 3 94  ? -26.638 -34.065 45.758 1.00 40.59  ? 94   ASN G C     1 
ATOM   5152  O  O     . ASN G 3 94  ? -26.712 -32.839 45.851 1.00 40.38  ? 94   ASN G O     1 
ATOM   5153  C  CB    . ASN G 3 94  ? -28.046 -35.443 47.287 1.00 40.39  ? 94   ASN G CB    1 
ATOM   5154  C  CG    . ASN G 3 94  ? -28.123 -34.333 48.318 1.00 40.57  ? 94   ASN G CG    1 
ATOM   5155  O  OD1   . ASN G 3 94  ? -29.000 -33.457 48.244 1.00 41.29  ? 94   ASN G OD1   1 
ATOM   5156  N  ND2   . ASN G 3 94  ? -27.203 -34.348 49.272 1.00 36.53  ? 94   ASN G ND2   1 
ATOM   5157  N  N     . LYS G 3 95  ? -25.491 -34.712 45.564 1.00 40.21  ? 95   LYS G N     1 
ATOM   5158  C  CA    . LYS G 3 95  ? -24.240 -33.984 45.398 1.00 39.91  ? 95   LYS G CA    1 
ATOM   5159  C  C     . LYS G 3 95  ? -24.268 -33.163 44.112 1.00 39.20  ? 95   LYS G C     1 
ATOM   5160  O  O     . LYS G 3 95  ? -23.898 -31.997 44.119 1.00 39.25  ? 95   LYS G O     1 
ATOM   5161  C  CB    . LYS G 3 95  ? -23.047 -34.939 45.408 1.00 40.27  ? 95   LYS G CB    1 
ATOM   5162  C  CG    . LYS G 3 95  ? -21.691 -34.258 45.472 1.00 43.22  ? 95   LYS G CG    1 
ATOM   5163  C  CD    . LYS G 3 95  ? -20.579 -35.312 45.457 1.00 48.64  ? 95   LYS G CD    1 
ATOM   5164  C  CE    . LYS G 3 95  ? -19.195 -34.709 45.610 1.00 51.20  ? 95   LYS G CE    1 
ATOM   5165  N  NZ    . LYS G 3 95  ? -18.185 -35.812 45.719 1.00 53.11  ? 95   LYS G NZ    1 
ATOM   5166  N  N     . LEU G 3 96  ? -24.706 -33.770 43.011 1.00 38.50  ? 96   LEU G N     1 
ATOM   5167  C  CA    . LEU G 3 96  ? -24.770 -33.072 41.729 1.00 38.06  ? 96   LEU G CA    1 
ATOM   5168  C  C     . LEU G 3 96  ? -25.677 -31.844 41.789 1.00 37.74  ? 96   LEU G C     1 
ATOM   5169  O  O     . LEU G 3 96  ? -25.429 -30.842 41.128 1.00 38.12  ? 96   LEU G O     1 
ATOM   5170  C  CB    . LEU G 3 96  ? -25.269 -33.998 40.624 1.00 37.63  ? 96   LEU G CB    1 
ATOM   5171  C  CG    . LEU G 3 96  ? -25.221 -33.400 39.216 1.00 37.48  ? 96   LEU G CG    1 
ATOM   5172  C  CD1   . LEU G 3 96  ? -23.783 -33.349 38.679 1.00 35.96  ? 96   LEU G CD1   1 
ATOM   5173  C  CD2   . LEU G 3 96  ? -26.141 -34.210 38.308 1.00 37.08  ? 96   LEU G CD2   1 
ATOM   5174  N  N     . LEU G 3 97  ? -26.740 -31.954 42.568 1.00 37.34  ? 97   LEU G N     1 
ATOM   5175  C  CA    . LEU G 3 97  ? -27.714 -30.892 42.700 1.00 36.83  ? 97   LEU G CA    1 
ATOM   5176  C  C     . LEU G 3 97  ? -27.572 -30.185 44.042 1.00 36.68  ? 97   LEU G C     1 
ATOM   5177  O  O     . LEU G 3 97  ? -28.505 -29.552 44.522 1.00 36.07  ? 97   LEU G O     1 
ATOM   5178  C  CB    . LEU G 3 97  ? -29.133 -31.452 42.495 1.00 36.81  ? 97   LEU G CB    1 
ATOM   5179  C  CG    . LEU G 3 97  ? -29.435 -32.038 41.102 1.00 36.35  ? 97   LEU G CG    1 
ATOM   5180  C  CD1   . LEU G 3 97  ? -30.945 -32.137 40.881 1.00 36.62  ? 97   LEU G CD1   1 
ATOM   5181  C  CD2   . LEU G 3 97  ? -28.787 -31.224 39.983 1.00 34.00  ? 97   LEU G CD2   1 
ATOM   5182  N  N     . GLY G 3 98  ? -26.381 -30.285 44.631 1.00 36.90  ? 98   GLY G N     1 
ATOM   5183  C  CA    . GLY G 3 98  ? -26.101 -29.734 45.950 1.00 37.19  ? 98   GLY G CA    1 
ATOM   5184  C  C     . GLY G 3 98  ? -26.314 -28.235 46.097 1.00 37.92  ? 98   GLY G C     1 
ATOM   5185  O  O     . GLY G 3 98  ? -26.571 -27.744 47.195 1.00 37.59  ? 98   GLY G O     1 
ATOM   5186  N  N     . ARG G 3 99  ? -26.229 -27.507 44.991 1.00 38.74  ? 99   ARG G N     1 
ATOM   5187  C  CA    . ARG G 3 99  ? -26.511 -26.067 44.999 1.00 39.57  ? 99   ARG G CA    1 
ATOM   5188  C  C     . ARG G 3 99  ? -27.754 -25.684 44.154 1.00 39.08  ? 99   ARG G C     1 
ATOM   5189  O  O     . ARG G 3 99  ? -27.831 -24.596 43.588 1.00 39.32  ? 99   ARG G O     1 
ATOM   5190  C  CB    . ARG G 3 99  ? -25.247 -25.297 44.586 1.00 40.14  ? 99   ARG G CB    1 
ATOM   5191  C  CG    . ARG G 3 99  ? -24.161 -25.303 45.701 1.00 44.63  ? 99   ARG G CG    1 
ATOM   5192  C  CD    . ARG G 3 99  ? -22.748 -25.272 45.118 1.00 52.43  ? 99   ARG G CD    1 
ATOM   5193  N  NE    . ARG G 3 99  ? -21.711 -25.347 46.163 1.00 59.54  ? 99   ARG G NE    1 
ATOM   5194  C  CZ    . ARG G 3 99  ? -20.404 -25.531 45.935 1.00 61.21  ? 99   ARG G CZ    1 
ATOM   5195  N  NH1   . ARG G 3 99  ? -19.947 -25.659 44.693 1.00 61.81  ? 99   ARG G NH1   1 
ATOM   5196  N  NH2   . ARG G 3 99  ? -19.548 -25.588 46.952 1.00 61.30  ? 99   ARG G NH2   1 
ATOM   5197  N  N     . VAL G 3 100 ? -28.729 -26.585 44.092 1.00 38.01  ? 100  VAL G N     1 
ATOM   5198  C  CA    . VAL G 3 100 ? -29.941 -26.371 43.316 1.00 37.02  ? 100  VAL G CA    1 
ATOM   5199  C  C     . VAL G 3 100 ? -31.177 -26.446 44.201 1.00 36.71  ? 100  VAL G C     1 
ATOM   5200  O  O     . VAL G 3 100 ? -31.229 -27.213 45.157 1.00 36.99  ? 100  VAL G O     1 
ATOM   5201  C  CB    . VAL G 3 100 ? -30.061 -27.378 42.121 1.00 36.94  ? 100  VAL G CB    1 
ATOM   5202  C  CG1   . VAL G 3 100 ? -31.518 -27.477 41.624 1.00 37.14  ? 100  VAL G CG1   1 
ATOM   5203  C  CG2   . VAL G 3 100 ? -29.163 -26.961 40.977 1.00 34.87  ? 100  VAL G CG2   1 
ATOM   5204  N  N     . THR G 3 101 ? -32.159 -25.625 43.872 1.00 36.84  ? 101  THR G N     1 
ATOM   5205  C  CA    . THR G 3 101 ? -33.422 -25.574 44.585 1.00 37.31  ? 101  THR G CA    1 
ATOM   5206  C  C     . THR G 3 101 ? -34.528 -26.016 43.635 1.00 37.37  ? 101  THR G C     1 
ATOM   5207  O  O     . THR G 3 101 ? -34.697 -25.453 42.558 1.00 36.83  ? 101  THR G O     1 
ATOM   5208  C  CB    . THR G 3 101 ? -33.727 -24.159 45.087 1.00 37.16  ? 101  THR G CB    1 
ATOM   5209  O  OG1   . THR G 3 101 ? -32.739 -23.767 46.046 1.00 39.04  ? 101  THR G OG1   1 
ATOM   5210  C  CG2   . THR G 3 101 ? -35.116 -24.100 45.741 1.00 37.40  ? 101  THR G CG2   1 
ATOM   5211  N  N     . ILE G 3 102 ? -35.250 -27.049 44.038 1.00 37.98  ? 102  ILE G N     1 
ATOM   5212  C  CA    . ILE G 3 102 ? -36.394 -27.547 43.300 1.00 38.63  ? 102  ILE G CA    1 
ATOM   5213  C  C     . ILE G 3 102 ? -37.598 -26.851 43.911 1.00 38.62  ? 102  ILE G C     1 
ATOM   5214  O  O     . ILE G 3 102 ? -37.911 -27.065 45.077 1.00 38.98  ? 102  ILE G O     1 
ATOM   5215  C  CB    . ILE G 3 102 ? -36.492 -29.097 43.427 1.00 39.01  ? 102  ILE G CB    1 
ATOM   5216  C  CG1   . ILE G 3 102 ? -35.310 -29.756 42.708 1.00 39.58  ? 102  ILE G CG1   1 
ATOM   5217  C  CG2   . ILE G 3 102 ? -37.824 -29.632 42.907 1.00 39.69  ? 102  ILE G CG2   1 
ATOM   5218  C  CD1   . ILE G 3 102 ? -35.141 -31.238 42.992 1.00 40.30  ? 102  ILE G CD1   1 
ATOM   5219  N  N     . ALA G 3 103 ? -38.226 -25.970 43.138 1.00 39.06  ? 103  ALA G N     1 
ATOM   5220  C  CA    . ALA G 3 103 ? -39.435 -25.256 43.573 1.00 40.12  ? 103  ALA G CA    1 
ATOM   5221  C  C     . ALA G 3 103 ? -40.548 -26.217 43.998 1.00 40.46  ? 103  ALA G C     1 
ATOM   5222  O  O     . ALA G 3 103 ? -40.786 -27.216 43.337 1.00 40.72  ? 103  ALA G O     1 
ATOM   5223  C  CB    . ALA G 3 103 ? -39.923 -24.344 42.470 1.00 39.66  ? 103  ALA G CB    1 
ATOM   5224  N  N     . GLN G 3 104 ? -41.211 -25.919 45.109 1.00 41.58  ? 104  GLN G N     1 
ATOM   5225  C  CA    . GLN G 3 104 ? -42.273 -26.784 45.648 1.00 42.85  ? 104  GLN G CA    1 
ATOM   5226  C  C     . GLN G 3 104 ? -41.771 -28.179 45.991 1.00 42.57  ? 104  GLN G C     1 
ATOM   5227  O  O     . GLN G 3 104 ? -42.532 -29.134 45.901 1.00 43.18  ? 104  GLN G O     1 
ATOM   5228  C  CB    . GLN G 3 104 ? -43.465 -26.894 44.676 1.00 43.42  ? 104  GLN G CB    1 
ATOM   5229  C  CG    . GLN G 3 104 ? -44.363 -25.668 44.630 1.00 46.74  ? 104  GLN G CG    1 
ATOM   5230  C  CD    . GLN G 3 104 ? -45.068 -25.427 45.951 1.00 52.35  ? 104  GLN G CD    1 
ATOM   5231  O  OE1   . GLN G 3 104 ? -45.937 -26.219 46.376 1.00 53.97  ? 104  GLN G OE1   1 
ATOM   5232  N  NE2   . GLN G 3 104 ? -44.691 -24.337 46.624 1.00 53.14  ? 104  GLN G NE2   1 
ATOM   5233  N  N     . GLY G 3 105 ? -40.499 -28.293 46.376 1.00 42.14  ? 105  GLY G N     1 
ATOM   5234  C  CA    . GLY G 3 105 ? -39.927 -29.568 46.790 1.00 41.41  ? 105  GLY G CA    1 
ATOM   5235  C  C     . GLY G 3 105 ? -40.048 -29.902 48.268 1.00 41.32  ? 105  GLY G C     1 
ATOM   5236  O  O     . GLY G 3 105 ? -40.123 -31.083 48.643 1.00 41.97  ? 105  GLY G O     1 
ATOM   5237  N  N     . GLY G 3 106 ? -40.056 -28.881 49.117 1.00 40.94  ? 106  GLY G N     1 
ATOM   5238  C  CA    . GLY G 3 106 ? -39.992 -29.088 50.560 1.00 41.17  ? 106  GLY G CA    1 
ATOM   5239  C  C     . GLY G 3 106 ? -38.679 -29.751 50.943 1.00 41.61  ? 106  GLY G C     1 
ATOM   5240  O  O     . GLY G 3 106 ? -37.701 -29.723 50.185 1.00 41.59  ? 106  GLY G O     1 
ATOM   5241  N  N     . VAL G 3 107 ? -38.668 -30.379 52.111 1.00 41.91  ? 107  VAL G N     1 
ATOM   5242  C  CA    . VAL G 3 107 ? -37.465 -30.952 52.663 1.00 41.81  ? 107  VAL G CA    1 
ATOM   5243  C  C     . VAL G 3 107 ? -37.714 -32.390 53.074 1.00 42.85  ? 107  VAL G C     1 
ATOM   5244  O  O     . VAL G 3 107 ? -38.865 -32.842 53.126 1.00 43.28  ? 107  VAL G O     1 
ATOM   5245  C  CB    . VAL G 3 107 ? -37.011 -30.133 53.883 1.00 41.84  ? 107  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G 3 107 ? -36.716 -28.700 53.473 1.00 39.45  ? 107  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G 3 107 ? -38.063 -30.185 55.009 1.00 41.65  ? 107  VAL G CG2   1 
ATOM   5248  N  N     . LEU G 3 108 ? -36.640 -33.111 53.375 1.00 43.78  ? 108  LEU G N     1 
ATOM   5249  C  CA    . LEU G 3 108 ? -36.763 -34.444 53.933 1.00 44.38  ? 108  LEU G CA    1 
ATOM   5250  C  C     . LEU G 3 108 ? -37.273 -34.363 55.367 1.00 45.90  ? 108  LEU G C     1 
ATOM   5251  O  O     . LEU G 3 108 ? -36.894 -33.456 56.099 1.00 46.45  ? 108  LEU G O     1 
ATOM   5252  C  CB    . LEU G 3 108 ? -35.417 -35.149 53.903 1.00 43.92  ? 108  LEU G CB    1 
ATOM   5253  C  CG    . LEU G 3 108 ? -34.768 -35.489 52.562 1.00 42.48  ? 108  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G 3 108 ? -33.602 -36.439 52.827 1.00 40.68  ? 108  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G 3 108 ? -35.765 -36.091 51.587 1.00 39.81  ? 108  LEU G CD2   1 
ATOM   5256  N  N     . PRO G 3 109 ? -38.153 -35.296 55.774 1.00 47.36  ? 109  PRO G N     1 
ATOM   5257  C  CA    . PRO G 3 109 ? -38.485 -35.362 57.195 1.00 48.49  ? 109  PRO G CA    1 
ATOM   5258  C  C     . PRO G 3 109 ? -37.243 -35.740 57.998 1.00 49.64  ? 109  PRO G C     1 
ATOM   5259  O  O     . PRO G 3 109 ? -36.644 -36.788 57.751 1.00 49.88  ? 109  PRO G O     1 
ATOM   5260  C  CB    . PRO G 3 109 ? -39.537 -36.470 57.250 1.00 48.19  ? 109  PRO G CB    1 
ATOM   5261  C  CG    . PRO G 3 109 ? -40.205 -36.375 55.912 1.00 48.01  ? 109  PRO G CG    1 
ATOM   5262  C  CD    . PRO G 3 109 ? -39.039 -36.164 54.977 1.00 47.62  ? 109  PRO G CD    1 
ATOM   5263  N  N     . ASN G 3 110 ? -36.858 -34.871 58.927 1.00 50.86  ? 110  ASN G N     1 
ATOM   5264  C  CA    . ASN G 3 110 ? -35.639 -35.044 59.705 1.00 52.43  ? 110  ASN G CA    1 
ATOM   5265  C  C     . ASN G 3 110 ? -35.654 -34.153 60.947 1.00 53.14  ? 110  ASN G C     1 
ATOM   5266  O  O     . ASN G 3 110 ? -35.613 -32.924 60.839 1.00 52.98  ? 110  ASN G O     1 
ATOM   5267  C  CB    . ASN G 3 110 ? -34.404 -34.734 58.840 1.00 52.79  ? 110  ASN G CB    1 
ATOM   5268  C  CG    . ASN G 3 110 ? -33.083 -35.075 59.534 1.00 54.14  ? 110  ASN G CG    1 
ATOM   5269  O  OD1   . ASN G 3 110 ? -33.059 -35.770 60.554 1.00 56.57  ? 110  ASN G OD1   1 
ATOM   5270  N  ND2   . ASN G 3 110 ? -31.978 -34.584 58.973 1.00 53.88  ? 110  ASN G ND2   1 
ATOM   5271  N  N     . ILE G 3 111 ? -35.721 -34.790 62.119 1.00 54.14  ? 111  ILE G N     1 
ATOM   5272  C  CA    . ILE G 3 111 ? -35.636 -34.102 63.407 1.00 54.81  ? 111  ILE G CA    1 
ATOM   5273  C  C     . ILE G 3 111 ? -34.408 -34.593 64.157 1.00 55.53  ? 111  ILE G C     1 
ATOM   5274  O  O     . ILE G 3 111 ? -34.179 -35.805 64.265 1.00 55.73  ? 111  ILE G O     1 
ATOM   5275  C  CB    . ILE G 3 111 ? -36.878 -34.364 64.299 1.00 54.90  ? 111  ILE G CB    1 
ATOM   5276  C  CG1   . ILE G 3 111 ? -38.178 -34.262 63.492 1.00 55.17  ? 111  ILE G CG1   1 
ATOM   5277  C  CG2   . ILE G 3 111 ? -36.897 -33.393 65.483 1.00 54.67  ? 111  ILE G CG2   1 
ATOM   5278  C  CD1   . ILE G 3 111 ? -39.383 -34.889 64.166 1.00 55.89  ? 111  ILE G CD1   1 
ATOM   5279  N  N     . GLN G 3 112 ? -33.629 -33.651 64.683 1.00 56.36  ? 112  GLN G N     1 
ATOM   5280  C  CA    . GLN G 3 112 ? -32.456 -33.974 65.497 1.00 57.22  ? 112  GLN G CA    1 
ATOM   5281  C  C     . GLN G 3 112 ? -32.881 -34.737 66.740 1.00 58.00  ? 112  GLN G C     1 
ATOM   5282  O  O     . GLN G 3 112 ? -33.835 -34.344 67.418 1.00 58.04  ? 112  GLN G O     1 
ATOM   5283  C  CB    . GLN G 3 112 ? -31.702 -32.704 65.897 1.00 57.17  ? 112  GLN G CB    1 
ATOM   5284  C  CG    . GLN G 3 112 ? -31.140 -31.918 64.725 1.00 56.73  ? 112  GLN G CG    1 
ATOM   5285  C  CD    . GLN G 3 112 ? -30.215 -32.747 63.862 1.00 56.27  ? 112  GLN G CD    1 
ATOM   5286  O  OE1   . GLN G 3 112 ? -29.159 -33.213 64.311 1.00 57.06  ? 112  GLN G OE1   1 
ATOM   5287  N  NE2   . GLN G 3 112 ? -30.606 -32.933 62.613 1.00 56.31  ? 112  GLN G NE2   1 
ATOM   5288  N  N     . SER G 3 113 ? -32.169 -35.822 67.032 1.00 59.07  ? 113  SER G N     1 
ATOM   5289  C  CA    . SER G 3 113 ? -32.544 -36.732 68.115 1.00 60.15  ? 113  SER G CA    1 
ATOM   5290  C  C     . SER G 3 113 ? -32.707 -36.025 69.459 1.00 60.74  ? 113  SER G C     1 
ATOM   5291  O  O     . SER G 3 113 ? -33.678 -36.266 70.171 1.00 60.94  ? 113  SER G O     1 
ATOM   5292  C  CB    . SER G 3 113 ? -31.550 -37.888 68.221 1.00 59.97  ? 113  SER G CB    1 
ATOM   5293  O  OG    . SER G 3 113 ? -30.238 -37.400 68.397 1.00 60.95  ? 113  SER G OG    1 
ATOM   5294  N  N     . VAL G 3 114 ? -31.783 -35.121 69.775 1.00 61.72  ? 114  VAL G N     1 
ATOM   5295  C  CA    . VAL G 3 114 ? -31.822 -34.366 71.036 1.00 62.40  ? 114  VAL G CA    1 
ATOM   5296  C  C     . VAL G 3 114 ? -33.124 -33.572 71.229 1.00 63.15  ? 114  VAL G C     1 
ATOM   5297  O  O     . VAL G 3 114 ? -33.465 -33.191 72.344 1.00 63.44  ? 114  VAL G O     1 
ATOM   5298  C  CB    . VAL G 3 114 ? -30.565 -33.452 71.199 1.00 62.21  ? 114  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3 114 ? -30.630 -32.260 70.260 1.00 61.80  ? 114  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3 114 ? -30.389 -32.997 72.648 1.00 61.39  ? 114  VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3 115 ? -33.854 -33.343 70.145 1.00 64.36  ? 115  LEU G N     1 
ATOM   5302  C  CA    . LEU G 3 115 ? -35.130 -32.622 70.211 1.00 65.70  ? 115  LEU G CA    1 
ATOM   5303  C  C     . LEU G 3 115 ? -36.340 -33.516 70.512 1.00 66.86  ? 115  LEU G C     1 
ATOM   5304  O  O     . LEU G 3 115 ? -37.424 -33.010 70.811 1.00 66.76  ? 115  LEU G O     1 
ATOM   5305  C  CB    . LEU G 3 115 ? -35.369 -31.822 68.921 1.00 65.55  ? 115  LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3 115 ? -34.344 -30.730 68.575 1.00 65.20  ? 115  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3 115 ? -34.547 -30.207 67.164 1.00 64.18  ? 115  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3 115 ? -34.377 -29.589 69.583 1.00 64.50  ? 115  LEU G CD2   1 
ATOM   5309  N  N     . LEU G 3 116 ? -36.150 -34.834 70.427 1.00 68.57  ? 116  LEU G N     1 
ATOM   5310  C  CA    . LEU G 3 116 ? -37.212 -35.793 70.724 1.00 70.29  ? 116  LEU G CA    1 
ATOM   5311  C  C     . LEU G 3 116 ? -37.561 -35.794 72.213 1.00 71.56  ? 116  LEU G C     1 
ATOM   5312  O  O     . LEU G 3 116 ? -36.666 -35.673 73.056 1.00 71.62  ? 116  LEU G O     1 
ATOM   5313  C  CB    . LEU G 3 116 ? -36.832 -37.207 70.253 1.00 70.21  ? 116  LEU G CB    1 
ATOM   5314  C  CG    . LEU G 3 116 ? -36.842 -37.488 68.743 1.00 70.57  ? 116  LEU G CG    1 
ATOM   5315  C  CD1   . LEU G 3 116 ? -36.576 -38.968 68.459 1.00 71.15  ? 116  LEU G CD1   1 
ATOM   5316  C  CD2   . LEU G 3 116 ? -38.141 -37.043 68.070 1.00 71.15  ? 116  LEU G CD2   1 
ATOM   5317  N  N     . PRO G 3 117 ? -38.868 -35.915 72.536 1.00 73.00  ? 117  PRO G N     1 
ATOM   5318  C  CA    . PRO G 3 117 ? -39.338 -35.956 73.924 1.00 74.09  ? 117  PRO G CA    1 
ATOM   5319  C  C     . PRO G 3 117 ? -38.731 -37.150 74.641 1.00 75.29  ? 117  PRO G C     1 
ATOM   5320  O  O     . PRO G 3 117 ? -38.517 -38.196 74.020 1.00 75.46  ? 117  PRO G O     1 
ATOM   5321  C  CB    . PRO G 3 117 ? -40.855 -36.143 73.781 1.00 74.01  ? 117  PRO G CB    1 
ATOM   5322  C  CG    . PRO G 3 117 ? -41.044 -36.751 72.435 1.00 73.67  ? 117  PRO G CG    1 
ATOM   5323  C  CD    . PRO G 3 117 ? -39.976 -36.119 71.584 1.00 73.17  ? 117  PRO G CD    1 
ATOM   5324  N  N     . LYS G 3 118 ? -38.451 -36.989 75.930 1.00 76.76  ? 118  LYS G N     1 
ATOM   5325  C  CA    . LYS G 3 118 ? -37.728 -38.010 76.684 1.00 78.42  ? 118  LYS G CA    1 
ATOM   5326  C  C     . LYS G 3 118 ? -38.657 -39.120 77.180 1.00 79.24  ? 118  LYS G C     1 
ATOM   5327  O  O     . LYS G 3 118 ? -39.522 -38.896 78.034 1.00 79.63  ? 118  LYS G O     1 
ATOM   5328  C  CB    . LYS G 3 118 ? -36.888 -37.369 77.800 1.00 78.52  ? 118  LYS G CB    1 
ATOM   5329  C  CG    . LYS G 3 118 ? -35.719 -36.560 77.226 1.00 79.55  ? 118  LYS G CG    1 
ATOM   5330  C  CD    . LYS G 3 118 ? -35.088 -35.595 78.219 1.00 80.90  ? 118  LYS G CD    1 
ATOM   5331  C  CE    . LYS G 3 118 ? -33.971 -34.787 77.530 1.00 81.12  ? 118  LYS G CE    1 
ATOM   5332  N  NZ    . LYS G 3 118 ? -33.326 -33.800 78.446 1.00 81.92  ? 118  LYS G NZ    1 
ATOM   5333  N  N     . LYS G 3 119 ? -38.463 -40.313 76.616 1.00 80.14  ? 119  LYS G N     1 
ATOM   5334  C  CA    . LYS G 3 119 ? -39.366 -41.458 76.793 1.00 80.96  ? 119  LYS G CA    1 
ATOM   5335  C  C     . LYS G 3 119 ? -39.357 -42.033 78.212 1.00 81.14  ? 119  LYS G C     1 
ATOM   5336  O  O     . LYS G 3 119 ? -40.399 -42.453 78.729 1.00 81.36  ? 119  LYS G O     1 
ATOM   5337  C  CB    . LYS G 3 119 ? -39.032 -42.560 75.777 1.00 81.19  ? 119  LYS G CB    1 
ATOM   5338  C  CG    . LYS G 3 119 ? -39.034 -42.086 74.312 1.00 82.26  ? 119  LYS G CG    1 
ATOM   5339  C  CD    . LYS G 3 119 ? -38.673 -43.209 73.334 1.00 83.41  ? 119  LYS G CD    1 
ATOM   5340  C  CE    . LYS G 3 119 ? -39.908 -44.012 72.921 1.00 83.99  ? 119  LYS G CE    1 
ATOM   5341  N  NZ    . LYS G 3 119 ? -39.650 -44.834 71.704 1.00 83.81  ? 119  LYS G NZ    1 
ATOM   5342  N  N     . LYS H 4 31  ? -46.496 -16.256 20.369 1.00 77.39  ? 28   LYS H N     1 
ATOM   5343  C  CA    . LYS H 4 31  ? -46.405 -16.833 18.994 1.00 77.41  ? 28   LYS H CA    1 
ATOM   5344  C  C     . LYS H 4 31  ? -45.047 -17.474 18.702 1.00 77.14  ? 28   LYS H C     1 
ATOM   5345  O  O     . LYS H 4 31  ? -44.996 -18.559 18.111 1.00 77.19  ? 28   LYS H O     1 
ATOM   5346  C  CB    . LYS H 4 31  ? -46.731 -15.773 17.928 1.00 77.53  ? 28   LYS H CB    1 
ATOM   5347  C  CG    . LYS H 4 31  ? -46.563 -16.261 16.484 1.00 78.13  ? 28   LYS H CG    1 
ATOM   5348  C  CD    . LYS H 4 31  ? -46.632 -15.119 15.481 1.00 78.95  ? 28   LYS H CD    1 
ATOM   5349  C  CE    . LYS H 4 31  ? -48.072 -14.800 15.082 1.00 79.46  ? 28   LYS H CE    1 
ATOM   5350  N  NZ    . LYS H 4 31  ? -48.199 -13.450 14.446 1.00 79.64  ? 28   LYS H NZ    1 
ATOM   5351  N  N     . THR H 4 32  ? -43.959 -16.803 19.101 1.00 76.89  ? 29   THR H N     1 
ATOM   5352  C  CA    . THR H 4 32  ? -42.605 -17.272 18.774 1.00 76.74  ? 29   THR H CA    1 
ATOM   5353  C  C     . THR H 4 32  ? -42.331 -18.638 19.402 1.00 76.43  ? 29   THR H C     1 
ATOM   5354  O  O     . THR H 4 32  ? -42.818 -18.932 20.496 1.00 76.55  ? 29   THR H O     1 
ATOM   5355  C  CB    . THR H 4 32  ? -41.493 -16.233 19.138 1.00 76.92  ? 29   THR H CB    1 
ATOM   5356  O  OG1   . THR H 4 32  ? -40.329 -16.467 18.330 1.00 76.89  ? 29   THR H OG1   1 
ATOM   5357  C  CG2   . THR H 4 32  ? -41.104 -16.302 20.624 1.00 77.06  ? 29   THR H CG2   1 
ATOM   5358  N  N     . ARG H 4 33  ? -41.575 -19.470 18.688 1.00 76.02  ? 30   ARG H N     1 
ATOM   5359  C  CA    . ARG H 4 33  ? -41.308 -20.854 19.105 1.00 75.57  ? 30   ARG H CA    1 
ATOM   5360  C  C     . ARG H 4 33  ? -40.617 -20.966 20.459 1.00 74.72  ? 30   ARG H C     1 
ATOM   5361  O  O     . ARG H 4 33  ? -39.526 -20.418 20.657 1.00 75.01  ? 30   ARG H O     1 
ATOM   5362  C  CB    . ARG H 4 33  ? -40.469 -21.584 18.054 1.00 75.84  ? 30   ARG H CB    1 
ATOM   5363  C  CG    . ARG H 4 33  ? -41.286 -22.354 17.031 1.00 77.18  ? 30   ARG H CG    1 
ATOM   5364  C  CD    . ARG H 4 33  ? -40.397 -22.889 15.918 1.00 79.62  ? 30   ARG H CD    1 
ATOM   5365  N  NE    . ARG H 4 33  ? -39.608 -24.058 16.319 1.00 80.89  ? 30   ARG H NE    1 
ATOM   5366  C  CZ    . ARG H 4 33  ? -39.976 -25.323 16.109 1.00 82.07  ? 30   ARG H CZ    1 
ATOM   5367  N  NH1   . ARG H 4 33  ? -41.130 -25.599 15.508 1.00 83.05  ? 30   ARG H NH1   1 
ATOM   5368  N  NH2   . ARG H 4 33  ? -39.190 -26.318 16.505 1.00 82.87  ? 30   ARG H NH2   1 
ATOM   5369  N  N     . LYS H 4 34  ? -41.261 -21.681 21.381 1.00 73.43  ? 31   LYS H N     1 
ATOM   5370  C  CA    . LYS H 4 34  ? -40.673 -21.963 22.683 1.00 72.34  ? 31   LYS H CA    1 
ATOM   5371  C  C     . LYS H 4 34  ? -40.273 -23.438 22.761 1.00 71.08  ? 31   LYS H C     1 
ATOM   5372  O  O     . LYS H 4 34  ? -41.099 -24.293 23.085 1.00 71.14  ? 31   LYS H O     1 
ATOM   5373  C  CB    . LYS H 4 34  ? -41.649 -21.598 23.813 1.00 72.54  ? 31   LYS H CB    1 
ATOM   5374  C  CG    . LYS H 4 34  ? -41.077 -20.634 24.865 1.00 73.61  ? 31   LYS H CG    1 
ATOM   5375  C  CD    . LYS H 4 34  ? -39.939 -21.256 25.698 1.00 75.02  ? 31   LYS H CD    1 
ATOM   5376  C  CE    . LYS H 4 34  ? -39.341 -20.236 26.678 1.00 75.81  ? 31   LYS H CE    1 
ATOM   5377  N  NZ    . LYS H 4 34  ? -38.402 -19.257 26.008 1.00 75.78  ? 31   LYS H NZ    1 
ATOM   5378  N  N     . GLU H 4 35  ? -39.013 -23.728 22.434 1.00 69.46  ? 32   GLU H N     1 
ATOM   5379  C  CA    . GLU H 4 35  ? -38.477 -25.092 22.512 1.00 67.84  ? 32   GLU H CA    1 
ATOM   5380  C  C     . GLU H 4 35  ? -38.266 -25.556 23.954 1.00 66.34  ? 32   GLU H C     1 
ATOM   5381  O  O     . GLU H 4 35  ? -38.034 -24.750 24.862 1.00 66.17  ? 32   GLU H O     1 
ATOM   5382  C  CB    . GLU H 4 35  ? -37.151 -25.202 21.765 1.00 68.05  ? 32   GLU H CB    1 
ATOM   5383  C  CG    . GLU H 4 35  ? -37.261 -25.362 20.264 1.00 69.28  ? 32   GLU H CG    1 
ATOM   5384  C  CD    . GLU H 4 35  ? -35.902 -25.605 19.624 1.00 71.70  ? 32   GLU H CD    1 
ATOM   5385  O  OE1   . GLU H 4 35  ? -35.851 -26.195 18.522 1.00 72.44  ? 32   GLU H OE1   1 
ATOM   5386  O  OE2   . GLU H 4 35  ? -34.876 -25.213 20.233 1.00 72.43  ? 32   GLU H OE2   1 
ATOM   5387  N  N     . SER H 4 36  ? -38.306 -26.870 24.135 1.00 64.44  ? 33   SER H N     1 
ATOM   5388  C  CA    . SER H 4 36  ? -38.289 -27.499 25.442 1.00 62.65  ? 33   SER H CA    1 
ATOM   5389  C  C     . SER H 4 36  ? -37.890 -28.949 25.236 1.00 61.42  ? 33   SER H C     1 
ATOM   5390  O  O     . SER H 4 36  ? -38.037 -29.472 24.131 1.00 61.26  ? 33   SER H O     1 
ATOM   5391  C  CB    . SER H 4 36  ? -39.693 -27.417 26.052 1.00 62.84  ? 33   SER H CB    1 
ATOM   5392  O  OG    . SER H 4 36  ? -39.862 -28.326 27.123 1.00 62.88  ? 33   SER H OG    1 
ATOM   5393  N  N     . TYR H 4 37  ? -37.379 -29.591 26.286 1.00 59.91  ? 34   TYR H N     1 
ATOM   5394  C  CA    . TYR H 4 37  ? -37.076 -31.027 26.242 1.00 58.40  ? 34   TYR H CA    1 
ATOM   5395  C  C     . TYR H 4 37  ? -38.273 -31.873 26.663 1.00 58.22  ? 34   TYR H C     1 
ATOM   5396  O  O     . TYR H 4 37  ? -38.160 -33.090 26.754 1.00 57.82  ? 34   TYR H O     1 
ATOM   5397  C  CB    . TYR H 4 37  ? -35.893 -31.371 27.152 1.00 58.18  ? 34   TYR H CB    1 
ATOM   5398  C  CG    . TYR H 4 37  ? -34.548 -30.878 26.682 1.00 56.11  ? 34   TYR H CG    1 
ATOM   5399  C  CD1   . TYR H 4 37  ? -34.010 -29.692 27.178 1.00 54.15  ? 34   TYR H CD1   1 
ATOM   5400  C  CD2   . TYR H 4 37  ? -33.802 -31.609 25.757 1.00 53.98  ? 34   TYR H CD2   1 
ATOM   5401  C  CE1   . TYR H 4 37  ? -32.769 -29.240 26.758 1.00 52.81  ? 34   TYR H CE1   1 
ATOM   5402  C  CE2   . TYR H 4 37  ? -32.564 -31.165 25.325 1.00 53.36  ? 34   TYR H CE2   1 
ATOM   5403  C  CZ    . TYR H 4 37  ? -32.055 -29.980 25.831 1.00 53.01  ? 34   TYR H CZ    1 
ATOM   5404  O  OH    . TYR H 4 37  ? -30.821 -29.548 25.405 1.00 53.73  ? 34   TYR H OH    1 
ATOM   5405  N  N     . ALA H 4 38  ? -39.413 -31.230 26.915 1.00 58.25  ? 35   ALA H N     1 
ATOM   5406  C  CA    . ALA H 4 38  ? -40.605 -31.905 27.442 1.00 58.67  ? 35   ALA H CA    1 
ATOM   5407  C  C     . ALA H 4 38  ? -40.965 -33.216 26.739 1.00 59.04  ? 35   ALA H C     1 
ATOM   5408  O  O     . ALA H 4 38  ? -41.092 -34.245 27.399 1.00 59.16  ? 35   ALA H O     1 
ATOM   5409  C  CB    . ALA H 4 38  ? -41.807 -30.955 27.466 1.00 58.70  ? 35   ALA H CB    1 
ATOM   5410  N  N     . ILE H 4 39  ? -41.119 -33.199 25.414 1.00 59.37  ? 36   ILE H N     1 
ATOM   5411  C  CA    . ILE H 4 39  ? -41.521 -34.428 24.707 1.00 59.81  ? 36   ILE H CA    1 
ATOM   5412  C  C     . ILE H 4 39  ? -40.527 -35.577 24.900 1.00 59.76  ? 36   ILE H C     1 
ATOM   5413  O  O     . ILE H 4 39  ? -40.933 -36.728 25.086 1.00 60.19  ? 36   ILE H O     1 
ATOM   5414  C  CB    . ILE H 4 39  ? -41.816 -34.223 23.187 1.00 59.86  ? 36   ILE H CB    1 
ATOM   5415  C  CG1   . ILE H 4 39  ? -40.642 -33.540 22.485 1.00 60.14  ? 36   ILE H CG1   1 
ATOM   5416  C  CG2   . ILE H 4 39  ? -43.134 -33.468 22.982 1.00 59.88  ? 36   ILE H CG2   1 
ATOM   5417  C  CD1   . ILE H 4 39  ? -40.686 -33.668 20.978 1.00 62.07  ? 36   ILE H CD1   1 
ATOM   5418  N  N     . TYR H 4 40  ? -39.237 -35.260 24.868 1.00 59.43  ? 37   TYR H N     1 
ATOM   5419  C  CA    . TYR H 4 40  ? -38.185 -36.270 25.008 1.00 59.05  ? 37   TYR H CA    1 
ATOM   5420  C  C     . TYR H 4 40  ? -38.081 -36.776 26.441 1.00 58.84  ? 37   TYR H C     1 
ATOM   5421  O  O     . TYR H 4 40  ? -37.742 -37.937 26.664 1.00 59.13  ? 37   TYR H O     1 
ATOM   5422  C  CB    . TYR H 4 40  ? -36.833 -35.725 24.559 1.00 58.81  ? 37   TYR H CB    1 
ATOM   5423  C  CG    . TYR H 4 40  ? -36.878 -34.996 23.239 1.00 59.76  ? 37   TYR H CG    1 
ATOM   5424  C  CD1   . TYR H 4 40  ? -36.984 -33.608 23.192 1.00 60.01  ? 37   TYR H CD1   1 
ATOM   5425  C  CD2   . TYR H 4 40  ? -36.828 -35.689 22.036 1.00 59.67  ? 37   TYR H CD2   1 
ATOM   5426  C  CE1   . TYR H 4 40  ? -37.033 -32.935 21.983 1.00 60.33  ? 37   TYR H CE1   1 
ATOM   5427  C  CE2   . TYR H 4 40  ? -36.864 -35.021 20.827 1.00 60.44  ? 37   TYR H CE2   1 
ATOM   5428  C  CZ    . TYR H 4 40  ? -36.971 -33.644 20.806 1.00 60.41  ? 37   TYR H CZ    1 
ATOM   5429  O  OH    . TYR H 4 40  ? -37.008 -32.966 19.603 1.00 62.47  ? 37   TYR H OH    1 
ATOM   5430  N  N     . VAL H 4 41  ? -38.367 -35.909 27.408 1.00 58.23  ? 38   VAL H N     1 
ATOM   5431  C  CA    . VAL H 4 41  ? -38.442 -36.330 28.796 1.00 57.90  ? 38   VAL H CA    1 
ATOM   5432  C  C     . VAL H 4 41  ? -39.657 -37.241 29.007 1.00 58.20  ? 38   VAL H C     1 
ATOM   5433  O  O     . VAL H 4 41  ? -39.564 -38.245 29.718 1.00 57.89  ? 38   VAL H O     1 
ATOM   5434  C  CB    . VAL H 4 41  ? -38.476 -35.119 29.752 1.00 57.84  ? 38   VAL H CB    1 
ATOM   5435  C  CG1   . VAL H 4 41  ? -38.903 -35.527 31.156 1.00 57.22  ? 38   VAL H CG1   1 
ATOM   5436  C  CG2   . VAL H 4 41  ? -37.117 -34.443 29.785 1.00 57.45  ? 38   VAL H CG2   1 
ATOM   5437  N  N     . TYR H 4 42  ? -40.781 -36.901 28.372 1.00 58.56  ? 39   TYR H N     1 
ATOM   5438  C  CA    . TYR H 4 42  ? -41.999 -37.706 28.481 1.00 58.89  ? 39   TYR H CA    1 
ATOM   5439  C  C     . TYR H 4 42  ? -41.799 -39.083 27.851 1.00 58.58  ? 39   TYR H C     1 
ATOM   5440  O  O     . TYR H 4 42  ? -42.282 -40.087 28.374 1.00 58.51  ? 39   TYR H O     1 
ATOM   5441  C  CB    . TYR H 4 42  ? -43.206 -36.988 27.866 1.00 59.29  ? 39   TYR H CB    1 
ATOM   5442  C  CG    . TYR H 4 42  ? -44.542 -37.581 28.274 1.00 61.29  ? 39   TYR H CG    1 
ATOM   5443  C  CD1   . TYR H 4 42  ? -45.210 -37.133 29.417 1.00 63.15  ? 39   TYR H CD1   1 
ATOM   5444  C  CD2   . TYR H 4 42  ? -45.139 -38.590 27.514 1.00 63.39  ? 39   TYR H CD2   1 
ATOM   5445  C  CE1   . TYR H 4 42  ? -46.438 -37.681 29.797 1.00 65.44  ? 39   TYR H CE1   1 
ATOM   5446  C  CE2   . TYR H 4 42  ? -46.362 -39.139 27.879 1.00 65.04  ? 39   TYR H CE2   1 
ATOM   5447  C  CZ    . TYR H 4 42  ? -47.006 -38.683 29.017 1.00 66.17  ? 39   TYR H CZ    1 
ATOM   5448  O  OH    . TYR H 4 42  ? -48.220 -39.230 29.371 1.00 68.42  ? 39   TYR H OH    1 
ATOM   5449  N  N     . LYS H 4 43  ? -41.065 -39.132 26.745 1.00 58.43  ? 40   LYS H N     1 
ATOM   5450  C  CA    . LYS H 4 43  ? -40.730 -40.406 26.120 1.00 58.50  ? 40   LYS H CA    1 
ATOM   5451  C  C     . LYS H 4 43  ? -39.941 -41.291 27.067 1.00 58.35  ? 40   LYS H C     1 
ATOM   5452  O  O     . LYS H 4 43  ? -40.255 -42.469 27.221 1.00 58.31  ? 40   LYS H O     1 
ATOM   5453  C  CB    . LYS H 4 43  ? -39.950 -40.202 24.822 1.00 58.66  ? 40   LYS H CB    1 
ATOM   5454  C  CG    . LYS H 4 43  ? -40.812 -39.874 23.623 1.00 59.78  ? 40   LYS H CG    1 
ATOM   5455  C  CD    . LYS H 4 43  ? -39.931 -39.492 22.445 1.00 62.60  ? 40   LYS H CD    1 
ATOM   5456  C  CE    . LYS H 4 43  ? -40.751 -39.085 21.219 1.00 64.17  ? 40   LYS H CE    1 
ATOM   5457  N  NZ    . LYS H 4 43  ? -39.836 -38.526 20.159 1.00 65.50  ? 40   LYS H NZ    1 
ATOM   5458  N  N     . VAL H 4 44  ? -38.924 -40.716 27.708 1.00 58.53  ? 41   VAL H N     1 
ATOM   5459  C  CA    . VAL H 4 44  ? -38.040 -41.468 28.608 1.00 58.19  ? 41   VAL H CA    1 
ATOM   5460  C  C     . VAL H 4 44  ? -38.787 -41.914 29.869 1.00 58.55  ? 41   VAL H C     1 
ATOM   5461  O  O     . VAL H 4 44  ? -38.551 -43.007 30.387 1.00 58.20  ? 41   VAL H O     1 
ATOM   5462  C  CB    . VAL H 4 44  ? -36.771 -40.670 28.953 1.00 58.06  ? 41   VAL H CB    1 
ATOM   5463  C  CG1   . VAL H 4 44  ? -35.829 -41.495 29.812 1.00 58.09  ? 41   VAL H CG1   1 
ATOM   5464  C  CG2   . VAL H 4 44  ? -36.057 -40.240 27.682 1.00 57.61  ? 41   VAL H CG2   1 
ATOM   5465  N  N     . LEU H 4 45  ? -39.702 -41.071 30.345 1.00 59.17  ? 42   LEU H N     1 
ATOM   5466  C  CA    . LEU H 4 45  ? -40.616 -41.454 31.418 1.00 59.54  ? 42   LEU H CA    1 
ATOM   5467  C  C     . LEU H 4 45  ? -41.380 -42.723 31.043 1.00 60.28  ? 42   LEU H C     1 
ATOM   5468  O  O     . LEU H 4 45  ? -41.458 -43.662 31.837 1.00 60.64  ? 42   LEU H O     1 
ATOM   5469  C  CB    . LEU H 4 45  ? -41.600 -40.326 31.716 1.00 59.17  ? 42   LEU H CB    1 
ATOM   5470  C  CG    . LEU H 4 45  ? -42.707 -40.580 32.743 1.00 58.71  ? 42   LEU H CG    1 
ATOM   5471  C  CD1   . LEU H 4 45  ? -42.160 -41.023 34.089 1.00 58.54  ? 42   LEU H CD1   1 
ATOM   5472  C  CD2   . LEU H 4 45  ? -43.558 -39.335 32.917 1.00 59.01  ? 42   LEU H CD2   1 
ATOM   5473  N  N     . LYS H 4 46  ? -41.934 -42.753 29.833 1.00 60.91  ? 43   LYS H N     1 
ATOM   5474  C  CA    . LYS H 4 46  ? -42.758 -43.885 29.411 1.00 61.39  ? 43   LYS H CA    1 
ATOM   5475  C  C     . LYS H 4 46  ? -41.960 -45.184 29.290 1.00 61.76  ? 43   LYS H C     1 
ATOM   5476  O  O     . LYS H 4 46  ? -42.479 -46.260 29.589 1.00 62.24  ? 43   LYS H O     1 
ATOM   5477  C  CB    . LYS H 4 46  ? -43.551 -43.563 28.138 1.00 61.36  ? 43   LYS H CB    1 
ATOM   5478  C  CG    . LYS H 4 46  ? -44.762 -42.647 28.382 1.00 61.61  ? 43   LYS H CG    1 
ATOM   5479  C  CD    . LYS H 4 46  ? -45.591 -43.141 29.567 1.00 62.48  ? 43   LYS H CD    1 
ATOM   5480  C  CE    . LYS H 4 46  ? -46.695 -42.168 29.940 1.00 63.96  ? 43   LYS H CE    1 
ATOM   5481  N  NZ    . LYS H 4 46  ? -47.258 -42.451 31.294 1.00 64.31  ? 43   LYS H NZ    1 
ATOM   5482  N  N     . GLN H 4 47  ? -40.690 -45.077 28.897 1.00 62.04  ? 44   GLN H N     1 
ATOM   5483  C  CA    . GLN H 4 47  ? -39.785 -46.233 28.862 1.00 62.10  ? 44   GLN H CA    1 
ATOM   5484  C  C     . GLN H 4 47  ? -39.432 -46.741 30.257 1.00 61.93  ? 44   GLN H C     1 
ATOM   5485  O  O     . GLN H 4 47  ? -39.077 -47.910 30.432 1.00 62.35  ? 44   GLN H O     1 
ATOM   5486  C  CB    . GLN H 4 47  ? -38.479 -45.887 28.145 1.00 62.28  ? 44   GLN H CB    1 
ATOM   5487  C  CG    . GLN H 4 47  ? -38.574 -45.768 26.643 1.00 63.75  ? 44   GLN H CG    1 
ATOM   5488  C  CD    . GLN H 4 47  ? -37.263 -46.130 25.942 1.00 65.90  ? 44   GLN H CD    1 
ATOM   5489  O  OE1   . GLN H 4 47  ? -36.167 -45.740 26.372 1.00 65.69  ? 44   GLN H OE1   1 
ATOM   5490  N  NE2   . GLN H 4 47  ? -37.376 -46.885 24.852 1.00 66.24  ? 44   GLN H NE2   1 
ATOM   5491  N  N     . VAL H 4 48  ? -39.518 -45.854 31.243 1.00 61.54  ? 45   VAL H N     1 
ATOM   5492  C  CA    . VAL H 4 48  ? -39.013 -46.119 32.591 1.00 60.69  ? 45   VAL H CA    1 
ATOM   5493  C  C     . VAL H 4 48  ? -40.156 -46.377 33.585 1.00 60.50  ? 45   VAL H C     1 
ATOM   5494  O  O     . VAL H 4 48  ? -40.005 -47.154 34.525 1.00 60.13  ? 45   VAL H O     1 
ATOM   5495  C  CB    . VAL H 4 48  ? -38.033 -44.964 33.028 1.00 60.89  ? 45   VAL H CB    1 
ATOM   5496  C  CG1   . VAL H 4 48  ? -38.394 -44.342 34.375 1.00 59.80  ? 45   VAL H CG1   1 
ATOM   5497  C  CG2   . VAL H 4 48  ? -36.579 -45.425 32.980 1.00 60.63  ? 45   VAL H CG2   1 
ATOM   5498  N  N     . HIS H 4 49  ? -41.289 -45.716 33.366 1.00 60.29  ? 46   HIS H N     1 
ATOM   5499  C  CA    . HIS H 4 49  ? -42.510 -45.966 34.117 1.00 60.56  ? 46   HIS H CA    1 
ATOM   5500  C  C     . HIS H 4 49  ? -43.674 -45.689 33.175 1.00 60.68  ? 46   HIS H C     1 
ATOM   5501  O  O     . HIS H 4 49  ? -44.154 -44.545 33.115 1.00 60.81  ? 46   HIS H O     1 
ATOM   5502  C  CB    . HIS H 4 49  ? -42.633 -45.034 35.322 1.00 60.71  ? 46   HIS H CB    1 
ATOM   5503  C  CG    . HIS H 4 49  ? -41.665 -45.310 36.433 1.00 60.88  ? 46   HIS H CG    1 
ATOM   5504  N  ND1   . HIS H 4 49  ? -41.895 -46.261 37.405 1.00 61.02  ? 46   HIS H ND1   1 
ATOM   5505  C  CD2   . HIS H 4 49  ? -40.498 -44.706 36.767 1.00 60.03  ? 46   HIS H CD2   1 
ATOM   5506  C  CE1   . HIS H 4 49  ? -40.895 -46.255 38.269 1.00 61.06  ? 46   HIS H CE1   1 
ATOM   5507  N  NE2   . HIS H 4 49  ? -40.035 -45.319 37.905 1.00 60.83  ? 46   HIS H NE2   1 
ATOM   5508  N  N     . PRO H 4 50  ? -44.140 -46.724 32.439 1.00 60.59  ? 47   PRO H N     1 
ATOM   5509  C  CA    . PRO H 4 50  ? -45.155 -46.516 31.397 1.00 60.39  ? 47   PRO H CA    1 
ATOM   5510  C  C     . PRO H 4 50  ? -46.513 -46.075 31.937 1.00 60.27  ? 47   PRO H C     1 
ATOM   5511  O  O     . PRO H 4 50  ? -47.277 -45.446 31.205 1.00 60.61  ? 47   PRO H O     1 
ATOM   5512  C  CB    . PRO H 4 50  ? -45.264 -47.889 30.714 1.00 60.63  ? 47   PRO H CB    1 
ATOM   5513  C  CG    . PRO H 4 50  ? -44.110 -48.707 31.236 1.00 60.32  ? 47   PRO H CG    1 
ATOM   5514  C  CD    . PRO H 4 50  ? -43.794 -48.149 32.584 1.00 60.56  ? 47   PRO H CD    1 
ATOM   5515  N  N     . ASP H 4 51  ? -46.798 -46.373 33.202 1.00 59.90  ? 48   ASP H N     1 
ATOM   5516  C  CA    . ASP H 4 51  ? -48.096 -46.037 33.788 1.00 60.05  ? 48   ASP H CA    1 
ATOM   5517  C  C     . ASP H 4 51  ? -48.082 -44.767 34.632 1.00 60.15  ? 48   ASP H C     1 
ATOM   5518  O  O     . ASP H 4 51  ? -49.131 -44.330 35.132 1.00 60.24  ? 48   ASP H O     1 
ATOM   5519  C  CB    . ASP H 4 51  ? -48.632 -47.210 34.612 1.00 60.35  ? 48   ASP H CB    1 
ATOM   5520  C  CG    . ASP H 4 51  ? -48.901 -48.432 33.764 1.00 60.98  ? 48   ASP H CG    1 
ATOM   5521  O  OD1   . ASP H 4 51  ? -49.669 -48.307 32.783 1.00 61.96  ? 48   ASP H OD1   1 
ATOM   5522  O  OD2   . ASP H 4 51  ? -48.338 -49.510 34.073 1.00 61.49  ? 48   ASP H OD2   1 
ATOM   5523  N  N     . THR H 4 52  ? -46.897 -44.175 34.781 1.00 59.90  ? 49   THR H N     1 
ATOM   5524  C  CA    . THR H 4 52  ? -46.731 -42.953 35.567 1.00 58.99  ? 49   THR H CA    1 
ATOM   5525  C  C     . THR H 4 52  ? -46.720 -41.716 34.681 1.00 58.38  ? 49   THR H C     1 
ATOM   5526  O  O     . THR H 4 52  ? -46.067 -41.700 33.630 1.00 58.18  ? 49   THR H O     1 
ATOM   5527  C  CB    . THR H 4 52  ? -45.443 -43.001 36.392 1.00 59.10  ? 49   THR H CB    1 
ATOM   5528  O  OG1   . THR H 4 52  ? -45.461 -44.175 37.206 1.00 60.02  ? 49   THR H OG1   1 
ATOM   5529  C  CG2   . THR H 4 52  ? -45.318 -41.781 37.297 1.00 58.54  ? 49   THR H CG2   1 
ATOM   5530  N  N     . GLY H 4 53  ? -47.459 -40.693 35.114 1.00 57.46  ? 50   GLY H N     1 
ATOM   5531  C  CA    . GLY H 4 53  ? -47.467 -39.391 34.455 1.00 56.63  ? 50   GLY H CA    1 
ATOM   5532  C  C     . GLY H 4 53  ? -46.610 -38.370 35.194 1.00 56.34  ? 50   GLY H C     1 
ATOM   5533  O  O     . GLY H 4 53  ? -45.872 -38.709 36.135 1.00 56.53  ? 50   GLY H O     1 
ATOM   5534  N  N     . ILE H 4 54  ? -46.713 -37.115 34.771 1.00 55.53  ? 51   ILE H N     1 
ATOM   5535  C  CA    . ILE H 4 54  ? -45.917 -36.035 35.336 1.00 55.03  ? 51   ILE H CA    1 
ATOM   5536  C  C     . ILE H 4 54  ? -46.677 -34.723 35.238 1.00 54.67  ? 51   ILE H C     1 
ATOM   5537  O  O     . ILE H 4 54  ? -47.239 -34.407 34.186 1.00 54.60  ? 51   ILE H O     1 
ATOM   5538  C  CB    . ILE H 4 54  ? -44.518 -35.916 34.639 1.00 55.35  ? 51   ILE H CB    1 
ATOM   5539  C  CG1   . ILE H 4 54  ? -43.638 -34.872 35.339 1.00 55.03  ? 51   ILE H CG1   1 
ATOM   5540  C  CG2   . ILE H 4 54  ? -44.653 -35.618 33.131 1.00 55.03  ? 51   ILE H CG2   1 
ATOM   5541  C  CD1   . ILE H 4 54  ? -42.147 -35.115 35.167 1.00 54.92  ? 51   ILE H CD1   1 
ATOM   5542  N  N     . SER H 4 55  ? -46.706 -33.971 36.337 1.00 53.97  ? 52   SER H N     1 
ATOM   5543  C  CA    . SER H 4 55  ? -47.355 -32.664 36.346 1.00 53.44  ? 52   SER H CA    1 
ATOM   5544  C  C     . SER H 4 55  ? -46.558 -31.658 35.520 1.00 53.18  ? 52   SER H C     1 
ATOM   5545  O  O     . SER H 4 55  ? -45.389 -31.893 35.186 1.00 53.00  ? 52   SER H O     1 
ATOM   5546  C  CB    . SER H 4 55  ? -47.519 -32.149 37.776 1.00 53.73  ? 52   SER H CB    1 
ATOM   5547  O  OG    . SER H 4 55  ? -46.345 -31.479 38.208 1.00 53.48  ? 52   SER H OG    1 
ATOM   5548  N  N     . SER H 4 56  ? -47.191 -30.540 35.184 1.00 52.80  ? 53   SER H N     1 
ATOM   5549  C  CA    . SER H 4 56  ? -46.512 -29.489 34.438 1.00 52.72  ? 53   SER H CA    1 
ATOM   5550  C  C     . SER H 4 56  ? -45.313 -28.942 35.181 1.00 52.16  ? 53   SER H C     1 
ATOM   5551  O  O     . SER H 4 56  ? -44.226 -28.813 34.611 1.00 52.12  ? 53   SER H O     1 
ATOM   5552  C  CB    . SER H 4 56  ? -47.461 -28.349 34.111 1.00 52.78  ? 53   SER H CB    1 
ATOM   5553  O  OG    . SER H 4 56  ? -48.000 -28.574 32.828 1.00 55.08  ? 53   SER H OG    1 
ATOM   5554  N  N     . LYS H 4 57  ? -45.517 -28.615 36.452 1.00 51.38  ? 54   LYS H N     1 
ATOM   5555  C  CA    . LYS H 4 57  ? -44.452 -28.058 37.255 1.00 51.09  ? 54   LYS H CA    1 
ATOM   5556  C  C     . LYS H 4 57  ? -43.248 -29.002 37.322 1.00 50.34  ? 54   LYS H C     1 
ATOM   5557  O  O     . LYS H 4 57  ? -42.101 -28.563 37.164 1.00 50.30  ? 54   LYS H O     1 
ATOM   5558  C  CB    . LYS H 4 57  ? -44.969 -27.672 38.636 1.00 51.26  ? 54   LYS H CB    1 
ATOM   5559  C  CG    . LYS H 4 57  ? -45.694 -26.333 38.618 1.00 54.22  ? 54   LYS H CG    1 
ATOM   5560  C  CD    . LYS H 4 57  ? -46.720 -26.202 39.753 1.00 58.57  ? 54   LYS H CD    1 
ATOM   5561  C  CE    . LYS H 4 57  ? -47.541 -24.917 39.590 1.00 59.94  ? 54   LYS H CE    1 
ATOM   5562  N  NZ    . LYS H 4 57  ? -48.944 -25.090 40.079 1.00 61.61  ? 54   LYS H NZ    1 
ATOM   5563  N  N     . ALA H 4 58  ? -43.509 -30.295 37.515 1.00 49.27  ? 55   ALA H N     1 
ATOM   5564  C  CA    . ALA H 4 58  ? -42.438 -31.281 37.559 1.00 48.19  ? 55   ALA H CA    1 
ATOM   5565  C  C     . ALA H 4 58  ? -41.700 -31.349 36.219 1.00 47.67  ? 55   ALA H C     1 
ATOM   5566  O  O     . ALA H 4 58  ? -40.471 -31.466 36.175 1.00 47.45  ? 55   ALA H O     1 
ATOM   5567  C  CB    . ALA H 4 58  ? -42.973 -32.634 37.967 1.00 48.15  ? 55   ALA H CB    1 
ATOM   5568  N  N     . MET H 4 59  ? -42.451 -31.248 35.132 1.00 46.65  ? 56   MET H N     1 
ATOM   5569  C  CA    . MET H 4 59  ? -41.863 -31.264 33.799 1.00 46.19  ? 56   MET H CA    1 
ATOM   5570  C  C     . MET H 4 59  ? -40.953 -30.050 33.567 1.00 45.82  ? 56   MET H C     1 
ATOM   5571  O  O     . MET H 4 59  ? -39.862 -30.156 32.976 1.00 45.18  ? 56   MET H O     1 
ATOM   5572  C  CB    . MET H 4 59  ? -42.962 -31.311 32.739 1.00 46.19  ? 56   MET H CB    1 
ATOM   5573  C  CG    . MET H 4 59  ? -42.444 -31.273 31.335 1.00 46.46  ? 56   MET H CG    1 
ATOM   5574  S  SD    . MET H 4 59  ? -41.330 -32.640 31.029 1.00 50.42  ? 56   MET H SD    1 
ATOM   5575  C  CE    . MET H 4 59  ? -42.463 -33.955 30.533 1.00 49.70  ? 56   MET H CE    1 
ATOM   5576  N  N     . SER H 4 60  ? -41.416 -28.898 34.037 1.00 45.20  ? 57   SER H N     1 
ATOM   5577  C  CA    . SER H 4 60  ? -40.649 -27.674 33.945 1.00 44.69  ? 57   SER H CA    1 
ATOM   5578  C  C     . SER H 4 60  ? -39.323 -27.805 34.705 1.00 44.56  ? 57   SER H C     1 
ATOM   5579  O  O     . SER H 4 60  ? -38.273 -27.385 34.208 1.00 44.34  ? 57   SER H O     1 
ATOM   5580  C  CB    . SER H 4 60  ? -41.472 -26.523 34.489 1.00 44.79  ? 57   SER H CB    1 
ATOM   5581  O  OG    . SER H 4 60  ? -40.825 -25.301 34.246 1.00 45.46  ? 57   SER H OG    1 
ATOM   5582  N  N     . ILE H 4 61  ? -39.373 -28.401 35.896 1.00 44.11  ? 58   ILE H N     1 
ATOM   5583  C  CA    . ILE H 4 61  ? -38.161 -28.718 36.650 1.00 43.84  ? 58   ILE H CA    1 
ATOM   5584  C  C     . ILE H 4 61  ? -37.223 -29.631 35.870 1.00 43.89  ? 58   ILE H C     1 
ATOM   5585  O  O     . ILE H 4 61  ? -36.022 -29.359 35.780 1.00 44.26  ? 58   ILE H O     1 
ATOM   5586  C  CB    . ILE H 4 61  ? -38.479 -29.346 38.010 1.00 44.01  ? 58   ILE H CB    1 
ATOM   5587  C  CG1   . ILE H 4 61  ? -39.052 -28.277 38.948 1.00 43.15  ? 58   ILE H CG1   1 
ATOM   5588  C  CG2   . ILE H 4 61  ? -37.229 -29.989 38.592 1.00 42.77  ? 58   ILE H CG2   1 
ATOM   5589  C  CD1   . ILE H 4 61  ? -39.922 -28.821 40.014 1.00 44.29  ? 58   ILE H CD1   1 
ATOM   5590  N  N     . MET H 4 62  ? -37.764 -30.698 35.292 1.00 43.42  ? 59   MET H N     1 
ATOM   5591  C  CA    . MET H 4 62  ? -36.944 -31.615 34.492 1.00 43.30  ? 59   MET H CA    1 
ATOM   5592  C  C     . MET H 4 62  ? -36.264 -30.921 33.330 1.00 43.27  ? 59   MET H C     1 
ATOM   5593  O  O     . MET H 4 62  ? -35.110 -31.216 32.998 1.00 43.42  ? 59   MET H O     1 
ATOM   5594  C  CB    . MET H 4 62  ? -37.767 -32.794 33.970 1.00 43.25  ? 59   MET H CB    1 
ATOM   5595  C  CG    . MET H 4 62  ? -38.194 -33.752 35.053 1.00 42.71  ? 59   MET H CG    1 
ATOM   5596  S  SD    . MET H 4 62  ? -36.781 -34.382 35.976 1.00 43.04  ? 59   MET H SD    1 
ATOM   5597  C  CE    . MET H 4 62  ? -35.904 -35.298 34.711 1.00 39.35  ? 59   MET H CE    1 
ATOM   5598  N  N     . ASN H 4 63  ? -36.994 -30.009 32.702 1.00 43.42  ? 60   ASN H N     1 
ATOM   5599  C  CA    . ASN H 4 63  ? -36.457 -29.215 31.612 1.00 43.42  ? 60   ASN H CA    1 
ATOM   5600  C  C     . ASN H 4 63  ? -35.291 -28.329 32.082 1.00 42.89  ? 60   ASN H C     1 
ATOM   5601  O  O     . ASN H 4 63  ? -34.273 -28.220 31.396 1.00 42.27  ? 60   ASN H O     1 
ATOM   5602  C  CB    . ASN H 4 63  ? -37.566 -28.359 31.001 1.00 43.94  ? 60   ASN H CB    1 
ATOM   5603  C  CG    . ASN H 4 63  ? -37.194 -27.823 29.639 1.00 46.02  ? 60   ASN H CG    1 
ATOM   5604  O  OD1   . ASN H 4 63  ? -36.676 -28.557 28.787 1.00 48.43  ? 60   ASN H OD1   1 
ATOM   5605  N  ND2   . ASN H 4 63  ? -37.443 -26.536 29.422 1.00 47.24  ? 60   ASN H ND2   1 
ATOM   5606  N  N     . SER H 4 64  ? -35.452 -27.703 33.250 1.00 42.34  ? 61   SER H N     1 
ATOM   5607  C  CA    . SER H 4 64  ? -34.383 -26.910 33.855 1.00 42.18  ? 61   SER H CA    1 
ATOM   5608  C  C     . SER H 4 64  ? -33.163 -27.791 34.107 1.00 41.73  ? 61   SER H C     1 
ATOM   5609  O  O     . SER H 4 64  ? -32.052 -27.461 33.686 1.00 41.21  ? 61   SER H O     1 
ATOM   5610  C  CB    . SER H 4 64  ? -34.844 -26.286 35.163 1.00 42.21  ? 61   SER H CB    1 
ATOM   5611  O  OG    . SER H 4 64  ? -35.891 -25.372 34.933 1.00 43.99  ? 61   SER H OG    1 
ATOM   5612  N  N     . PHE H 4 65  ? -33.391 -28.934 34.753 1.00 41.40  ? 62   PHE H N     1 
ATOM   5613  C  CA    . PHE H 4 65  ? -32.334 -29.910 34.963 1.00 41.12  ? 62   PHE H CA    1 
ATOM   5614  C  C     . PHE H 4 65  ? -31.536 -30.221 33.698 1.00 41.10  ? 62   PHE H C     1 
ATOM   5615  O  O     . PHE H 4 65  ? -30.308 -30.137 33.712 1.00 41.13  ? 62   PHE H O     1 
ATOM   5616  C  CB    . PHE H 4 65  ? -32.879 -31.187 35.572 1.00 41.18  ? 62   PHE H CB    1 
ATOM   5617  C  CG    . PHE H 4 65  ? -31.866 -32.283 35.658 1.00 41.17  ? 62   PHE H CG    1 
ATOM   5618  C  CD1   . PHE H 4 65  ? -30.879 -32.256 36.646 1.00 41.20  ? 62   PHE H CD1   1 
ATOM   5619  C  CD2   . PHE H 4 65  ? -31.889 -33.340 34.745 1.00 40.26  ? 62   PHE H CD2   1 
ATOM   5620  C  CE1   . PHE H 4 65  ? -29.933 -33.266 36.737 1.00 41.63  ? 62   PHE H CE1   1 
ATOM   5621  C  CE2   . PHE H 4 65  ? -30.955 -34.357 34.824 1.00 41.05  ? 62   PHE H CE2   1 
ATOM   5622  C  CZ    . PHE H 4 65  ? -29.963 -34.324 35.826 1.00 41.87  ? 62   PHE H CZ    1 
ATOM   5623  N  N     . VAL H 4 66  ? -32.228 -30.546 32.608 1.00 41.30  ? 63   VAL H N     1 
ATOM   5624  C  CA    . VAL H 4 66  ? -31.556 -30.881 31.348 1.00 41.20  ? 63   VAL H CA    1 
ATOM   5625  C  C     . VAL H 4 66  ? -30.749 -29.697 30.809 1.00 41.72  ? 63   VAL H C     1 
ATOM   5626  O  O     . VAL H 4 66  ? -29.572 -29.858 30.446 1.00 41.81  ? 63   VAL H O     1 
ATOM   5627  C  CB    . VAL H 4 66  ? -32.534 -31.423 30.278 1.00 41.12  ? 63   VAL H CB    1 
ATOM   5628  C  CG1   . VAL H 4 66  ? -31.798 -31.697 28.974 1.00 41.09  ? 63   VAL H CG1   1 
ATOM   5629  C  CG2   . VAL H 4 66  ? -33.183 -32.721 30.753 1.00 41.21  ? 63   VAL H CG2   1 
ATOM   5630  N  N     . ASN H 4 67  ? -31.369 -28.511 30.791 1.00 41.61  ? 64   ASN H N     1 
ATOM   5631  C  CA    . ASN H 4 67  ? -30.669 -27.272 30.445 1.00 41.52  ? 64   ASN H CA    1 
ATOM   5632  C  C     . ASN H 4 67  ? -29.449 -26.998 31.332 1.00 41.20  ? 64   ASN H C     1 
ATOM   5633  O  O     . ASN H 4 67  ? -28.378 -26.677 30.828 1.00 41.13  ? 64   ASN H O     1 
ATOM   5634  C  CB    . ASN H 4 67  ? -31.630 -26.078 30.476 1.00 41.75  ? 64   ASN H CB    1 
ATOM   5635  C  CG    . ASN H 4 67  ? -32.572 -26.046 29.280 1.00 43.50  ? 64   ASN H CG    1 
ATOM   5636  O  OD1   . ASN H 4 67  ? -32.170 -26.276 28.137 1.00 44.65  ? 64   ASN H OD1   1 
ATOM   5637  N  ND2   . ASN H 4 67  ? -33.843 -25.756 29.544 1.00 46.11  ? 64   ASN H ND2   1 
ATOM   5638  N  N     . ASP H 4 68  ? -29.610 -27.133 32.644 1.00 40.83  ? 65   ASP H N     1 
ATOM   5639  C  CA    . ASP H 4 68  ? -28.503 -26.924 33.562 1.00 40.96  ? 65   ASP H CA    1 
ATOM   5640  C  C     . ASP H 4 68  ? -27.349 -27.912 33.260 1.00 40.76  ? 65   ASP H C     1 
ATOM   5641  O  O     . ASP H 4 68  ? -26.211 -27.494 33.034 1.00 40.44  ? 65   ASP H O     1 
ATOM   5642  C  CB    . ASP H 4 68  ? -29.005 -26.998 35.015 1.00 41.28  ? 65   ASP H CB    1 
ATOM   5643  C  CG    . ASP H 4 68  ? -27.898 -26.820 36.043 1.00 42.69  ? 65   ASP H CG    1 
ATOM   5644  O  OD1   . ASP H 4 68  ? -26.797 -26.350 35.669 1.00 45.76  ? 65   ASP H OD1   1 
ATOM   5645  O  OD2   . ASP H 4 68  ? -28.128 -27.163 37.231 1.00 41.62  ? 65   ASP H OD2   1 
ATOM   5646  N  N     . VAL H 4 69  ? -27.638 -29.209 33.201 1.00 40.75  ? 66   VAL H N     1 
ATOM   5647  C  CA    . VAL H 4 69  ? -26.567 -30.199 32.964 1.00 40.58  ? 66   VAL H CA    1 
ATOM   5648  C  C     . VAL H 4 69  ? -25.882 -30.014 31.609 1.00 40.46  ? 66   VAL H C     1 
ATOM   5649  O  O     . VAL H 4 69  ? -24.656 -30.086 31.517 1.00 40.34  ? 66   VAL H O     1 
ATOM   5650  C  CB    . VAL H 4 69  ? -27.052 -31.640 33.133 1.00 40.38  ? 66   VAL H CB    1 
ATOM   5651  C  CG1   . VAL H 4 69  ? -25.899 -32.611 32.932 1.00 41.19  ? 66   VAL H CG1   1 
ATOM   5652  C  CG2   . VAL H 4 69  ? -27.614 -31.816 34.517 1.00 40.90  ? 66   VAL H CG2   1 
ATOM   5653  N  N     . PHE H 4 70  ? -26.674 -29.750 30.571 1.00 40.32  ? 67   PHE H N     1 
ATOM   5654  C  CA    . PHE H 4 70  ? -26.129 -29.347 29.279 1.00 40.63  ? 67   PHE H CA    1 
ATOM   5655  C  C     . PHE H 4 70  ? -25.053 -28.255 29.450 1.00 40.77  ? 67   PHE H C     1 
ATOM   5656  O  O     . PHE H 4 70  ? -23.903 -28.446 29.044 1.00 40.42  ? 67   PHE H O     1 
ATOM   5657  C  CB    . PHE H 4 70  ? -27.249 -28.880 28.333 1.00 40.17  ? 67   PHE H CB    1 
ATOM   5658  C  CG    . PHE H 4 70  ? -26.763 -28.449 26.972 1.00 40.56  ? 67   PHE H CG    1 
ATOM   5659  C  CD1   . PHE H 4 70  ? -26.864 -29.297 25.872 1.00 41.08  ? 67   PHE H CD1   1 
ATOM   5660  C  CD2   . PHE H 4 70  ? -26.215 -27.183 26.788 1.00 41.35  ? 67   PHE H CD2   1 
ATOM   5661  C  CE1   . PHE H 4 70  ? -26.407 -28.898 24.607 1.00 42.14  ? 67   PHE H CE1   1 
ATOM   5662  C  CE2   . PHE H 4 70  ? -25.756 -26.768 25.537 1.00 42.36  ? 67   PHE H CE2   1 
ATOM   5663  C  CZ    . PHE H 4 70  ? -25.847 -27.630 24.440 1.00 42.63  ? 67   PHE H CZ    1 
ATOM   5664  N  N     . GLU H 4 71  ? -25.437 -27.133 30.065 1.00 41.23  ? 68   GLU H N     1 
ATOM   5665  C  CA    . GLU H 4 71  ? -24.563 -25.960 30.201 1.00 41.74  ? 68   GLU H CA    1 
ATOM   5666  C  C     . GLU H 4 71  ? -23.275 -26.276 30.963 1.00 41.02  ? 68   GLU H C     1 
ATOM   5667  O  O     . GLU H 4 71  ? -22.187 -25.946 30.499 1.00 40.58  ? 68   GLU H O     1 
ATOM   5668  C  CB    . GLU H 4 71  ? -25.307 -24.781 30.840 1.00 41.98  ? 68   GLU H CB    1 
ATOM   5669  C  CG    . GLU H 4 71  ? -26.138 -23.984 29.835 1.00 47.01  ? 68   GLU H CG    1 
ATOM   5670  C  CD    . GLU H 4 71  ? -27.113 -22.976 30.477 1.00 53.03  ? 68   GLU H CD    1 
ATOM   5671  O  OE1   . GLU H 4 71  ? -27.492 -23.137 31.674 1.00 53.98  ? 68   GLU H OE1   1 
ATOM   5672  O  OE2   . GLU H 4 71  ? -27.506 -22.018 29.763 1.00 55.36  ? 68   GLU H OE2   1 
ATOM   5673  N  N     . ARG H 4 72  ? -23.411 -26.938 32.111 1.00 40.40  ? 69   ARG H N     1 
ATOM   5674  C  CA    . ARG H 4 72  ? -22.261 -27.417 32.867 1.00 40.64  ? 69   ARG H CA    1 
ATOM   5675  C  C     . ARG H 4 72  ? -21.307 -28.293 32.037 1.00 40.23  ? 69   ARG H C     1 
ATOM   5676  O  O     . ARG H 4 72  ? -20.096 -28.089 32.056 1.00 39.95  ? 69   ARG H O     1 
ATOM   5677  C  CB    . ARG H 4 72  ? -22.722 -28.199 34.096 1.00 41.13  ? 69   ARG H CB    1 
ATOM   5678  C  CG    . ARG H 4 72  ? -23.316 -27.355 35.183 1.00 42.91  ? 69   ARG H CG    1 
ATOM   5679  C  CD    . ARG H 4 72  ? -23.357 -28.167 36.462 1.00 45.36  ? 69   ARG H CD    1 
ATOM   5680  N  NE    . ARG H 4 72  ? -24.701 -28.266 37.039 1.00 47.82  ? 69   ARG H NE    1 
ATOM   5681  C  CZ    . ARG H 4 72  ? -24.962 -28.830 38.220 1.00 50.17  ? 69   ARG H CZ    1 
ATOM   5682  N  NH1   . ARG H 4 72  ? -23.986 -29.367 38.949 1.00 49.09  ? 69   ARG H NH1   1 
ATOM   5683  N  NH2   . ARG H 4 72  ? -26.212 -28.872 38.678 1.00 53.53  ? 69   ARG H NH2   1 
ATOM   5684  N  N     . ILE H 4 73  ? -21.853 -29.267 31.310 1.00 39.98  ? 70   ILE H N     1 
ATOM   5685  C  CA    . ILE H 4 73  ? -21.012 -30.166 30.516 1.00 39.31  ? 70   ILE H CA    1 
ATOM   5686  C  C     . ILE H 4 73  ? -20.368 -29.455 29.329 1.00 39.01  ? 70   ILE H C     1 
ATOM   5687  O  O     . ILE H 4 73  ? -19.160 -29.569 29.126 1.00 38.61  ? 70   ILE H O     1 
ATOM   5688  C  CB    . ILE H 4 73  ? -21.760 -31.443 30.081 1.00 39.13  ? 70   ILE H CB    1 
ATOM   5689  C  CG1   . ILE H 4 73  ? -22.140 -32.255 31.314 1.00 38.60  ? 70   ILE H CG1   1 
ATOM   5690  C  CG2   . ILE H 4 73  ? -20.899 -32.293 29.125 1.00 39.39  ? 70   ILE H CG2   1 
ATOM   5691  C  CD1   . ILE H 4 73  ? -22.903 -33.503 31.002 1.00 38.93  ? 70   ILE H CD1   1 
ATOM   5692  N  N     . ALA H 4 74  ? -21.163 -28.723 28.553 1.00 38.82  ? 71   ALA H N     1 
ATOM   5693  C  CA    . ALA H 4 74  ? -20.607 -27.956 27.436 1.00 39.15  ? 71   ALA H CA    1 
ATOM   5694  C  C     . ALA H 4 74  ? -19.588 -26.921 27.916 1.00 39.56  ? 71   ALA H C     1 
ATOM   5695  O  O     . ALA H 4 74  ? -18.550 -26.708 27.273 1.00 39.65  ? 71   ALA H O     1 
ATOM   5696  C  CB    . ALA H 4 74  ? -21.706 -27.281 26.656 1.00 39.07  ? 71   ALA H CB    1 
ATOM   5697  N  N     . GLY H 4 75  ? -19.876 -26.284 29.048 1.00 39.53  ? 72   GLY H N     1 
ATOM   5698  C  CA    . GLY H 4 75  ? -18.964 -25.291 29.585 1.00 40.72  ? 72   GLY H CA    1 
ATOM   5699  C  C     . GLY H 4 75  ? -17.594 -25.891 29.868 1.00 41.41  ? 72   GLY H C     1 
ATOM   5700  O  O     . GLY H 4 75  ? -16.574 -25.377 29.405 1.00 41.44  ? 72   GLY H O     1 
ATOM   5701  N  N     . GLU H 4 76  ? -17.573 -26.986 30.619 1.00 41.78  ? 73   GLU H N     1 
ATOM   5702  C  CA    . GLU H 4 76  ? -16.325 -27.658 30.944 1.00 42.98  ? 73   GLU H CA    1 
ATOM   5703  C  C     . GLU H 4 76  ? -15.598 -28.102 29.680 1.00 42.79  ? 73   GLU H C     1 
ATOM   5704  O  O     . GLU H 4 76  ? -14.380 -27.899 29.549 1.00 43.35  ? 73   GLU H O     1 
ATOM   5705  C  CB    . GLU H 4 76  ? -16.568 -28.843 31.884 1.00 43.39  ? 73   GLU H CB    1 
ATOM   5706  C  CG    . GLU H 4 76  ? -15.297 -29.495 32.358 1.00 46.02  ? 73   GLU H CG    1 
ATOM   5707  C  CD    . GLU H 4 76  ? -14.504 -28.599 33.293 1.00 51.37  ? 73   GLU H CD    1 
ATOM   5708  O  OE1   . GLU H 4 76  ? -13.345 -28.261 32.956 1.00 51.03  ? 73   GLU H OE1   1 
ATOM   5709  O  OE2   . GLU H 4 76  ? -15.051 -28.238 34.370 1.00 54.92  ? 73   GLU H OE2   1 
ATOM   5710  N  N     . ALA H 4 77  ? -16.346 -28.678 28.746 1.00 42.48  ? 74   ALA H N     1 
ATOM   5711  C  CA    . ALA H 4 77  ? -15.786 -29.127 27.477 1.00 42.81  ? 74   ALA H CA    1 
ATOM   5712  C  C     . ALA H 4 77  ? -15.118 -27.981 26.744 1.00 43.14  ? 74   ALA H C     1 
ATOM   5713  O  O     . ALA H 4 77  ? -14.047 -28.155 26.158 1.00 42.99  ? 74   ALA H O     1 
ATOM   5714  C  CB    . ALA H 4 77  ? -16.865 -29.739 26.609 1.00 42.80  ? 74   ALA H CB    1 
ATOM   5715  N  N     . SER H 4 78  ? -15.767 -26.814 26.772 1.00 43.56  ? 75   SER H N     1 
ATOM   5716  C  CA    . SER H 4 78  ? -15.190 -25.586 26.225 1.00 43.76  ? 75   SER H CA    1 
ATOM   5717  C  C     . SER H 4 78  ? -13.843 -25.274 26.855 1.00 44.27  ? 75   SER H C     1 
ATOM   5718  O  O     . SER H 4 78  ? -12.857 -25.083 26.150 1.00 44.21  ? 75   SER H O     1 
ATOM   5719  C  CB    . SER H 4 78  ? -16.136 -24.407 26.436 1.00 43.97  ? 75   SER H CB    1 
ATOM   5720  O  OG    . SER H 4 78  ? -15.649 -23.236 25.804 1.00 43.01  ? 75   SER H OG    1 
ATOM   5721  N  N     . ARG H 4 79  ? -13.796 -25.222 28.181 1.00 45.04  ? 76   ARG H N     1 
ATOM   5722  C  CA    . ARG H 4 79  ? -12.539 -24.959 28.858 1.00 46.07  ? 76   ARG H CA    1 
ATOM   5723  C  C     . ARG H 4 79  ? -11.440 -25.966 28.456 1.00 46.65  ? 76   ARG H C     1 
ATOM   5724  O  O     . ARG H 4 79  ? -10.330 -25.571 28.105 1.00 46.51  ? 76   ARG H O     1 
ATOM   5725  C  CB    . ARG H 4 79  ? -12.745 -24.893 30.374 1.00 46.30  ? 76   ARG H CB    1 
ATOM   5726  C  CG    . ARG H 4 79  ? -13.440 -23.611 30.837 1.00 47.02  ? 76   ARG H CG    1 
ATOM   5727  C  CD    . ARG H 4 79  ? -13.887 -23.669 32.312 1.00 48.45  ? 76   ARG H CD    1 
ATOM   5728  N  NE    . ARG H 4 79  ? -15.287 -23.245 32.420 1.00 49.81  ? 76   ARG H NE    1 
ATOM   5729  C  CZ    . ARG H 4 79  ? -16.283 -24.008 32.872 1.00 50.73  ? 76   ARG H CZ    1 
ATOM   5730  N  NH1   . ARG H 4 79  ? -16.050 -25.239 33.317 1.00 51.23  ? 76   ARG H NH1   1 
ATOM   5731  N  NH2   . ARG H 4 79  ? -17.516 -23.521 32.913 1.00 51.95  ? 76   ARG H NH2   1 
ATOM   5732  N  N     . LEU H 4 80  ? -11.762 -27.255 28.471 1.00 47.44  ? 77   LEU H N     1 
ATOM   5733  C  CA    . LEU H 4 80  ? -10.786 -28.287 28.101 1.00 48.74  ? 77   LEU H CA    1 
ATOM   5734  C  C     . LEU H 4 80  ? -10.149 -28.076 26.737 1.00 49.41  ? 77   LEU H C     1 
ATOM   5735  O  O     . LEU H 4 80  ? -8.919  -28.164 26.599 1.00 49.86  ? 77   LEU H O     1 
ATOM   5736  C  CB    . LEU H 4 80  ? -11.417 -29.675 28.117 1.00 48.59  ? 77   LEU H CB    1 
ATOM   5737  C  CG    . LEU H 4 80  ? -11.474 -30.342 29.483 1.00 48.66  ? 77   LEU H CG    1 
ATOM   5738  C  CD1   . LEU H 4 80  ? -12.587 -31.366 29.435 1.00 48.54  ? 77   LEU H CD1   1 
ATOM   5739  C  CD2   . LEU H 4 80  ? -10.113 -30.962 29.870 1.00 47.61  ? 77   LEU H CD2   1 
ATOM   5740  N  N     . ALA H 4 81  ? -10.987 -27.818 25.735 1.00 49.64  ? 78   ALA H N     1 
ATOM   5741  C  CA    . ALA H 4 81  ? -10.500 -27.561 24.388 1.00 50.29  ? 78   ALA H CA    1 
ATOM   5742  C  C     . ALA H 4 81  ? -9.594  -26.342 24.380 1.00 51.25  ? 78   ALA H C     1 
ATOM   5743  O  O     . ALA H 4 81  ? -8.483  -26.400 23.854 1.00 51.47  ? 78   ALA H O     1 
ATOM   5744  C  CB    . ALA H 4 81  ? -11.641 -27.381 23.429 1.00 49.89  ? 78   ALA H CB    1 
ATOM   5745  N  N     . HIS H 4 82  ? -10.055 -25.247 24.980 1.00 52.18  ? 79   HIS H N     1 
ATOM   5746  C  CA    . HIS H 4 82  ? -9.222  -24.062 25.094 1.00 53.56  ? 79   HIS H CA    1 
ATOM   5747  C  C     . HIS H 4 82  ? -7.863  -24.339 25.782 1.00 53.81  ? 79   HIS H C     1 
ATOM   5748  O  O     . HIS H 4 82  ? -6.821  -23.994 25.226 1.00 53.76  ? 79   HIS H O     1 
ATOM   5749  C  CB    . HIS H 4 82  ? -9.980  -22.913 25.761 1.00 53.91  ? 79   HIS H CB    1 
ATOM   5750  C  CG    . HIS H 4 82  ? -9.162  -21.672 25.890 1.00 57.06  ? 79   HIS H CG    1 
ATOM   5751  N  ND1   . HIS H 4 82  ? -8.853  -20.874 24.808 1.00 59.46  ? 79   HIS H ND1   1 
ATOM   5752  C  CD2   . HIS H 4 82  ? -8.537  -21.125 26.957 1.00 60.00  ? 79   HIS H CD2   1 
ATOM   5753  C  CE1   . HIS H 4 82  ? -8.083  -19.881 25.206 1.00 61.81  ? 79   HIS H CE1   1 
ATOM   5754  N  NE2   . HIS H 4 82  ? -7.880  -20.007 26.507 1.00 62.97  ? 79   HIS H NE2   1 
ATOM   5755  N  N     . TYR H 4 83  ? -7.876  -24.992 26.951 1.00 54.31  ? 80   TYR H N     1 
ATOM   5756  C  CA    . TYR H 4 83  ? -6.648  -25.307 27.703 1.00 54.95  ? 80   TYR H CA    1 
ATOM   5757  C  C     . TYR H 4 83  ? -5.598  -26.008 26.853 1.00 55.16  ? 80   TYR H C     1 
ATOM   5758  O  O     . TYR H 4 83  ? -4.396  -25.831 27.059 1.00 55.40  ? 80   TYR H O     1 
ATOM   5759  C  CB    . TYR H 4 83  ? -6.940  -26.186 28.925 1.00 54.99  ? 80   TYR H CB    1 
ATOM   5760  C  CG    . TYR H 4 83  ? -7.819  -25.553 29.992 1.00 57.20  ? 80   TYR H CG    1 
ATOM   5761  C  CD1   . TYR H 4 83  ? -7.938  -24.160 30.104 1.00 58.73  ? 80   TYR H CD1   1 
ATOM   5762  C  CD2   . TYR H 4 83  ? -8.508  -26.347 30.910 1.00 58.23  ? 80   TYR H CD2   1 
ATOM   5763  C  CE1   . TYR H 4 83  ? -8.734  -23.587 31.078 1.00 59.77  ? 80   TYR H CE1   1 
ATOM   5764  C  CE2   . TYR H 4 83  ? -9.307  -25.776 31.892 1.00 59.49  ? 80   TYR H CE2   1 
ATOM   5765  C  CZ    . TYR H 4 83  ? -9.414  -24.399 31.965 1.00 60.17  ? 80   TYR H CZ    1 
ATOM   5766  O  OH    . TYR H 4 83  ? -10.198 -23.821 32.936 1.00 62.38  ? 80   TYR H OH    1 
ATOM   5767  N  N     . ASN H 4 84  ? -6.066  -26.804 25.899 1.00 55.09  ? 81   ASN H N     1 
ATOM   5768  C  CA    . ASN H 4 84  ? -5.190  -27.621 25.080 1.00 55.18  ? 81   ASN H CA    1 
ATOM   5769  C  C     . ASN H 4 84  ? -4.992  -27.094 23.667 1.00 55.54  ? 81   ASN H C     1 
ATOM   5770  O  O     . ASN H 4 84  ? -4.554  -27.835 22.783 1.00 55.39  ? 81   ASN H O     1 
ATOM   5771  C  CB    . ASN H 4 84  ? -5.706  -29.056 25.059 1.00 54.86  ? 81   ASN H CB    1 
ATOM   5772  C  CG    . ASN H 4 84  ? -5.595  -29.714 26.415 1.00 54.91  ? 81   ASN H CG    1 
ATOM   5773  O  OD1   . ASN H 4 84  ? -4.512  -30.173 26.815 1.00 54.65  ? 81   ASN H OD1   1 
ATOM   5774  N  ND2   . ASN H 4 84  ? -6.704  -29.731 27.153 1.00 52.31  ? 81   ASN H ND2   1 
ATOM   5775  N  N     . LYS H 4 85  ? -5.301  -25.813 23.470 1.00 55.99  ? 82   LYS H N     1 
ATOM   5776  C  CA    . LYS H 4 85  ? -5.146  -25.162 22.175 1.00 56.76  ? 82   LYS H CA    1 
ATOM   5777  C  C     . LYS H 4 85  ? -5.771  -26.012 21.055 1.00 56.99  ? 82   LYS H C     1 
ATOM   5778  O  O     . LYS H 4 85  ? -5.122  -26.308 20.048 1.00 56.87  ? 82   LYS H O     1 
ATOM   5779  C  CB    . LYS H 4 85  ? -3.666  -24.862 21.896 1.00 56.85  ? 82   LYS H CB    1 
ATOM   5780  C  CG    . LYS H 4 85  ? -3.047  -23.841 22.857 1.00 58.86  ? 82   LYS H CG    1 
ATOM   5781  C  CD    . LYS H 4 85  ? -1.563  -23.611 22.600 1.00 60.65  ? 82   LYS H CD    1 
ATOM   5782  C  CE    . LYS H 4 85  ? -0.690  -24.449 23.539 1.00 62.75  ? 82   LYS H CE    1 
ATOM   5783  N  NZ    . LYS H 4 85  ? 0.717   -23.940 23.546 1.00 64.64  ? 82   LYS H NZ    1 
ATOM   5784  N  N     . ARG H 4 86  ? -7.022  -26.424 21.267 1.00 57.08  ? 83   ARG H N     1 
ATOM   5785  C  CA    . ARG H 4 86  ? -7.812  -27.103 20.248 1.00 57.28  ? 83   ARG H CA    1 
ATOM   5786  C  C     . ARG H 4 86  ? -9.025  -26.262 19.876 1.00 57.16  ? 83   ARG H C     1 
ATOM   5787  O  O     . ARG H 4 86  ? -9.576  -25.526 20.705 1.00 57.44  ? 83   ARG H O     1 
ATOM   5788  C  CB    . ARG H 4 86  ? -8.279  -28.480 20.719 1.00 57.81  ? 83   ARG H CB    1 
ATOM   5789  C  CG    . ARG H 4 86  ? -7.174  -29.448 21.099 1.00 59.90  ? 83   ARG H CG    1 
ATOM   5790  C  CD    . ARG H 4 86  ? -6.485  -30.054 19.891 1.00 62.67  ? 83   ARG H CD    1 
ATOM   5791  N  NE    . ARG H 4 86  ? -5.285  -30.787 20.299 1.00 65.92  ? 83   ARG H NE    1 
ATOM   5792  C  CZ    . ARG H 4 86  ? -4.035  -30.342 20.155 1.00 67.77  ? 83   ARG H CZ    1 
ATOM   5793  N  NH1   . ARG H 4 86  ? -3.793  -29.159 19.594 1.00 68.90  ? 83   ARG H NH1   1 
ATOM   5794  N  NH2   . ARG H 4 86  ? -3.015  -31.086 20.567 1.00 68.30  ? 83   ARG H NH2   1 
ATOM   5795  N  N     . SER H 4 87  ? -9.445  -26.395 18.625 1.00 56.94  ? 84   SER H N     1 
ATOM   5796  C  CA    . SER H 4 87  ? -10.499 -25.574 18.054 1.00 56.73  ? 84   SER H CA    1 
ATOM   5797  C  C     . SER H 4 87  ? -11.817 -26.332 18.024 1.00 56.42  ? 84   SER H C     1 
ATOM   5798  O  O     . SER H 4 87  ? -12.864 -25.765 17.678 1.00 56.42  ? 84   SER H O     1 
ATOM   5799  C  CB    . SER H 4 87  ? -10.111 -25.155 16.631 1.00 57.16  ? 84   SER H CB    1 
ATOM   5800  O  OG    . SER H 4 87  ? -8.708  -24.930 16.520 1.00 58.00  ? 84   SER H OG    1 
ATOM   5801  N  N     . THR H 4 88  ? -11.762 -27.612 18.393 1.00 55.93  ? 85   THR H N     1 
ATOM   5802  C  CA    . THR H 4 88  ? -12.921 -28.504 18.294 1.00 55.23  ? 85   THR H CA    1 
ATOM   5803  C  C     . THR H 4 88  ? -13.317 -29.107 19.633 1.00 54.90  ? 85   THR H C     1 
ATOM   5804  O  O     . THR H 4 88  ? -12.470 -29.581 20.391 1.00 55.08  ? 85   THR H O     1 
ATOM   5805  C  CB    . THR H 4 88  ? -12.652 -29.694 17.327 1.00 55.30  ? 85   THR H CB    1 
ATOM   5806  O  OG1   . THR H 4 88  ? -11.827 -29.265 16.242 1.00 54.63  ? 85   THR H OG1   1 
ATOM   5807  C  CG2   . THR H 4 88  ? -13.961 -30.270 16.782 1.00 54.60  ? 85   THR H CG2   1 
ATOM   5808  N  N     . ILE H 4 89  ? -14.616 -29.098 19.905 1.00 54.47  ? 86   ILE H N     1 
ATOM   5809  C  CA    . ILE H 4 89  ? -15.178 -29.881 20.997 1.00 54.07  ? 86   ILE H CA    1 
ATOM   5810  C  C     . ILE H 4 89  ? -15.571 -31.267 20.473 1.00 53.95  ? 86   ILE H C     1 
ATOM   5811  O  O     . ILE H 4 89  ? -16.534 -31.425 19.714 1.00 53.84  ? 86   ILE H O     1 
ATOM   5812  C  CB    . ILE H 4 89  ? -16.365 -29.159 21.678 1.00 53.87  ? 86   ILE H CB    1 
ATOM   5813  C  CG1   . ILE H 4 89  ? -15.825 -28.066 22.612 1.00 53.80  ? 86   ILE H CG1   1 
ATOM   5814  C  CG2   . ILE H 4 89  ? -17.216 -30.147 22.476 1.00 53.87  ? 86   ILE H CG2   1 
ATOM   5815  C  CD1   . ILE H 4 89  ? -16.842 -27.010 23.022 1.00 53.65  ? 86   ILE H CD1   1 
ATOM   5816  N  N     . THR H 4 90  ? -14.793 -32.268 20.865 1.00 53.72  ? 87   THR H N     1 
ATOM   5817  C  CA    . THR H 4 90  ? -15.064 -33.642 20.462 1.00 53.57  ? 87   THR H CA    1 
ATOM   5818  C  C     . THR H 4 90  ? -15.635 -34.390 21.657 1.00 53.00  ? 87   THR H C     1 
ATOM   5819  O  O     . THR H 4 90  ? -15.582 -33.890 22.781 1.00 53.45  ? 87   THR H O     1 
ATOM   5820  C  CB    . THR H 4 90  ? -13.786 -34.377 19.993 1.00 53.48  ? 87   THR H CB    1 
ATOM   5821  O  OG1   . THR H 4 90  ? -12.995 -34.726 21.135 1.00 54.51  ? 87   THR H OG1   1 
ATOM   5822  C  CG2   . THR H 4 90  ? -12.963 -33.528 19.040 1.00 53.57  ? 87   THR H CG2   1 
ATOM   5823  N  N     . SER H 4 91  ? -16.158 -35.589 21.412 1.00 52.00  ? 88   SER H N     1 
ATOM   5824  C  CA    . SER H 4 91  ? -16.672 -36.475 22.455 1.00 51.05  ? 88   SER H CA    1 
ATOM   5825  C  C     . SER H 4 91  ? -15.616 -36.800 23.510 1.00 50.62  ? 88   SER H C     1 
ATOM   5826  O  O     . SER H 4 91  ? -15.938 -37.138 24.648 1.00 50.74  ? 88   SER H O     1 
ATOM   5827  C  CB    . SER H 4 91  ? -17.189 -37.767 21.832 1.00 51.18  ? 88   SER H CB    1 
ATOM   5828  O  OG    . SER H 4 91  ? -16.155 -38.413 21.100 1.00 52.66  ? 88   SER H OG    1 
ATOM   5829  N  N     . ARG H 4 92  ? -14.349 -36.691 23.148 1.00 49.75  ? 89   ARG H N     1 
ATOM   5830  C  CA    . ARG H 4 92  ? -13.304 -36.811 24.146 1.00 49.14  ? 89   ARG H CA    1 
ATOM   5831  C  C     . ARG H 4 92  ? -13.412 -35.700 25.216 1.00 48.34  ? 89   ARG H C     1 
ATOM   5832  O  O     . ARG H 4 92  ? -13.222 -35.956 26.417 1.00 47.88  ? 89   ARG H O     1 
ATOM   5833  C  CB    . ARG H 4 92  ? -11.934 -36.792 23.480 1.00 49.36  ? 89   ARG H CB    1 
ATOM   5834  C  CG    . ARG H 4 92  ? -10.916 -37.549 24.270 1.00 51.30  ? 89   ARG H CG    1 
ATOM   5835  C  CD    . ARG H 4 92  ? -9.563  -37.517 23.604 1.00 55.06  ? 89   ARG H CD    1 
ATOM   5836  N  NE    . ARG H 4 92  ? -8.560  -37.988 24.552 1.00 57.84  ? 89   ARG H NE    1 
ATOM   5837  C  CZ    . ARG H 4 92  ? -7.807  -37.189 25.296 1.00 58.44  ? 89   ARG H CZ    1 
ATOM   5838  N  NH1   . ARG H 4 92  ? -7.922  -35.868 25.188 1.00 59.59  ? 89   ARG H NH1   1 
ATOM   5839  N  NH2   . ARG H 4 92  ? -6.931  -37.714 26.139 1.00 59.59  ? 89   ARG H NH2   1 
ATOM   5840  N  N     . GLU H 4 93  ? -13.712 -34.475 24.774 1.00 47.11  ? 90   GLU H N     1 
ATOM   5841  C  CA    . GLU H 4 93  ? -13.923 -33.356 25.697 1.00 46.20  ? 90   GLU H CA    1 
ATOM   5842  C  C     . GLU H 4 93  ? -15.203 -33.537 26.500 1.00 45.18  ? 90   GLU H C     1 
ATOM   5843  O  O     . GLU H 4 93  ? -15.226 -33.232 27.690 1.00 44.76  ? 90   GLU H O     1 
ATOM   5844  C  CB    . GLU H 4 93  ? -13.933 -32.002 24.970 1.00 46.32  ? 90   GLU H CB    1 
ATOM   5845  C  CG    . GLU H 4 93  ? -12.546 -31.464 24.643 1.00 47.41  ? 90   GLU H CG    1 
ATOM   5846  C  CD    . GLU H 4 93  ? -11.841 -32.265 23.566 1.00 51.20  ? 90   GLU H CD    1 
ATOM   5847  O  OE1   . GLU H 4 93  ? -12.520 -32.681 22.591 1.00 51.67  ? 90   GLU H OE1   1 
ATOM   5848  O  OE2   . GLU H 4 93  ? -10.612 -32.477 23.696 1.00 51.74  ? 90   GLU H OE2   1 
ATOM   5849  N  N     . ILE H 4 94  ? -16.260 -34.040 25.861 1.00 44.18  ? 91   ILE H N     1 
ATOM   5850  C  CA    . ILE H 4 94  ? -17.515 -34.333 26.576 1.00 43.48  ? 91   ILE H CA    1 
ATOM   5851  C  C     . ILE H 4 94  ? -17.268 -35.369 27.650 1.00 43.13  ? 91   ILE H C     1 
ATOM   5852  O  O     . ILE H 4 94  ? -17.774 -35.247 28.770 1.00 42.84  ? 91   ILE H O     1 
ATOM   5853  C  CB    . ILE H 4 94  ? -18.666 -34.817 25.634 1.00 43.59  ? 91   ILE H CB    1 
ATOM   5854  C  CG1   . ILE H 4 94  ? -18.904 -33.815 24.488 1.00 44.22  ? 91   ILE H CG1   1 
ATOM   5855  C  CG2   . ILE H 4 94  ? -19.961 -35.058 26.416 1.00 41.43  ? 91   ILE H CG2   1 
ATOM   5856  C  CD1   . ILE H 4 94  ? -19.436 -32.439 24.937 1.00 43.63  ? 91   ILE H CD1   1 
ATOM   5857  N  N     . GLN H 4 95  ? -16.462 -36.376 27.314 1.00 42.77  ? 92   GLN H N     1 
ATOM   5858  C  CA    . GLN H 4 95  ? -16.160 -37.464 28.249 1.00 42.25  ? 92   GLN H CA    1 
ATOM   5859  C  C     . GLN H 4 95  ? -15.358 -36.953 29.461 1.00 41.64  ? 92   GLN H C     1 
ATOM   5860  O  O     . GLN H 4 95  ? -15.751 -37.200 30.600 1.00 41.22  ? 92   GLN H O     1 
ATOM   5861  C  CB    . GLN H 4 95  ? -15.460 -38.637 27.538 1.00 42.13  ? 92   GLN H CB    1 
ATOM   5862  C  CG    . GLN H 4 95  ? -14.965 -39.738 28.472 1.00 43.09  ? 92   GLN H CG    1 
ATOM   5863  C  CD    . GLN H 4 95  ? -14.597 -41.030 27.736 1.00 45.13  ? 92   GLN H CD    1 
ATOM   5864  O  OE1   . GLN H 4 95  ? -13.414 -41.371 27.604 1.00 44.71  ? 92   GLN H OE1   1 
ATOM   5865  N  NE2   . GLN H 4 95  ? -15.614 -41.740 27.242 1.00 44.52  ? 92   GLN H NE2   1 
ATOM   5866  N  N     . THR H 4 96  ? -14.269 -36.226 29.221 1.00 40.89  ? 93   THR H N     1 
ATOM   5867  C  CA    . THR H 4 96  ? -13.514 -35.647 30.325 1.00 41.34  ? 93   THR H CA    1 
ATOM   5868  C  C     . THR H 4 96  ? -14.376 -34.688 31.188 1.00 41.51  ? 93   THR H C     1 
ATOM   5869  O  O     . THR H 4 96  ? -14.321 -34.750 32.424 1.00 41.09  ? 93   THR H O     1 
ATOM   5870  C  CB    . THR H 4 96  ? -12.253 -34.950 29.846 1.00 41.44  ? 93   THR H CB    1 
ATOM   5871  O  OG1   . THR H 4 96  ? -11.473 -35.863 29.067 1.00 42.65  ? 93   THR H OG1   1 
ATOM   5872  C  CG2   . THR H 4 96  ? -11.433 -34.474 31.030 1.00 41.20  ? 93   THR H CG2   1 
ATOM   5873  N  N     . ALA H 4 97  ? -15.178 -33.840 30.536 1.00 41.49  ? 94   ALA H N     1 
ATOM   5874  C  CA    . ALA H 4 97  ? -16.137 -32.981 31.224 1.00 41.97  ? 94   ALA H CA    1 
ATOM   5875  C  C     . ALA H 4 97  ? -17.053 -33.766 32.154 1.00 42.67  ? 94   ALA H C     1 
ATOM   5876  O  O     . ALA H 4 97  ? -17.295 -33.353 33.304 1.00 43.00  ? 94   ALA H O     1 
ATOM   5877  C  CB    . ALA H 4 97  ? -16.971 -32.196 30.233 1.00 42.22  ? 94   ALA H CB    1 
ATOM   5878  N  N     . VAL H 4 98  ? -17.561 -34.900 31.671 1.00 42.83  ? 95   VAL H N     1 
ATOM   5879  C  CA    . VAL H 4 98  ? -18.477 -35.702 32.482 1.00 42.34  ? 95   VAL H CA    1 
ATOM   5880  C  C     . VAL H 4 98  ? -17.725 -36.241 33.697 1.00 42.56  ? 95   VAL H C     1 
ATOM   5881  O  O     . VAL H 4 98  ? -18.238 -36.196 34.813 1.00 42.69  ? 95   VAL H O     1 
ATOM   5882  C  CB    . VAL H 4 98  ? -19.142 -36.838 31.653 1.00 42.42  ? 95   VAL H CB    1 
ATOM   5883  C  CG1   . VAL H 4 98  ? -19.641 -37.973 32.551 1.00 41.90  ? 95   VAL H CG1   1 
ATOM   5884  C  CG2   . VAL H 4 98  ? -20.283 -36.286 30.796 1.00 41.92  ? 95   VAL H CG2   1 
ATOM   5885  N  N     . ARG H 4 99  ? -16.498 -36.720 33.483 1.00 42.90  ? 96   ARG H N     1 
ATOM   5886  C  CA    . ARG H 4 99  ? -15.681 -37.257 34.574 1.00 43.12  ? 96   ARG H CA    1 
ATOM   5887  C  C     . ARG H 4 99  ? -15.420 -36.180 35.619 1.00 42.67  ? 96   ARG H C     1 
ATOM   5888  O  O     . ARG H 4 99  ? -15.405 -36.458 36.814 1.00 42.82  ? 96   ARG H O     1 
ATOM   5889  C  CB    . ARG H 4 99  ? -14.360 -37.848 34.048 1.00 43.48  ? 96   ARG H CB    1 
ATOM   5890  C  CG    . ARG H 4 99  ? -14.493 -39.258 33.450 1.00 46.53  ? 96   ARG H CG    1 
ATOM   5891  C  CD    . ARG H 4 99  ? -13.134 -39.973 33.292 1.00 51.59  ? 96   ARG H CD    1 
ATOM   5892  N  NE    . ARG H 4 99  ? -13.315 -41.366 32.866 1.00 55.47  ? 96   ARG H NE    1 
ATOM   5893  C  CZ    . ARG H 4 99  ? -12.941 -41.872 31.683 1.00 57.53  ? 96   ARG H CZ    1 
ATOM   5894  N  NH1   . ARG H 4 99  ? -12.323 -41.115 30.769 1.00 57.22  ? 96   ARG H NH1   1 
ATOM   5895  N  NH2   . ARG H 4 99  ? -13.175 -43.159 31.418 1.00 57.37  ? 96   ARG H NH2   1 
ATOM   5896  N  N     . LEU H 4 100 ? -15.211 -34.948 35.165 1.00 42.00  ? 97   LEU H N     1 
ATOM   5897  C  CA    . LEU H 4 100 ? -14.935 -33.850 36.077 1.00 41.39  ? 97   LEU H CA    1 
ATOM   5898  C  C     . LEU H 4 100 ? -16.171 -33.415 36.863 1.00 41.56  ? 97   LEU H C     1 
ATOM   5899  O  O     . LEU H 4 100 ? -16.052 -32.969 37.987 1.00 41.32  ? 97   LEU H O     1 
ATOM   5900  C  CB    . LEU H 4 100 ? -14.339 -32.659 35.315 1.00 41.20  ? 97   LEU H CB    1 
ATOM   5901  C  CG    . LEU H 4 100 ? -12.889 -32.790 34.832 1.00 39.51  ? 97   LEU H CG    1 
ATOM   5902  C  CD1   . LEU H 4 100 ? -12.574 -31.698 33.839 1.00 38.17  ? 97   LEU H CD1   1 
ATOM   5903  C  CD2   . LEU H 4 100 ? -11.919 -32.759 35.998 1.00 37.25  ? 97   LEU H CD2   1 
ATOM   5904  N  N     . LEU H 4 101 ? -17.351 -33.559 36.269 1.00 42.08  ? 98   LEU H N     1 
ATOM   5905  C  CA    . LEU H 4 101 ? -18.578 -33.015 36.842 1.00 42.43  ? 98   LEU H CA    1 
ATOM   5906  C  C     . LEU H 4 101 ? -19.458 -34.013 37.572 1.00 42.97  ? 98   LEU H C     1 
ATOM   5907  O  O     . LEU H 4 101 ? -20.115 -33.652 38.535 1.00 43.01  ? 98   LEU H O     1 
ATOM   5908  C  CB    . LEU H 4 101 ? -19.404 -32.327 35.762 1.00 42.40  ? 98   LEU H CB    1 
ATOM   5909  C  CG    . LEU H 4 101 ? -18.886 -30.971 35.276 1.00 42.35  ? 98   LEU H CG    1 
ATOM   5910  C  CD1   . LEU H 4 101 ? -19.275 -30.797 33.829 1.00 41.49  ? 98   LEU H CD1   1 
ATOM   5911  C  CD2   . LEU H 4 101 ? -19.415 -29.813 36.130 1.00 38.70  ? 98   LEU H CD2   1 
ATOM   5912  N  N     . LEU H 4 102 ? -19.494 -35.267 37.130 1.00 43.63  ? 99   LEU H N     1 
ATOM   5913  C  CA    . LEU H 4 102 ? -20.356 -36.222 37.819 1.00 44.02  ? 99   LEU H CA    1 
ATOM   5914  C  C     . LEU H 4 102 ? -19.623 -36.982 38.932 1.00 44.54  ? 99   LEU H C     1 
ATOM   5915  O  O     . LEU H 4 102 ? -18.426 -37.267 38.827 1.00 44.66  ? 99   LEU H O     1 
ATOM   5916  C  CB    . LEU H 4 102 ? -21.075 -37.164 36.836 1.00 43.96  ? 99   LEU H CB    1 
ATOM   5917  C  CG    . LEU H 4 102 ? -21.827 -36.608 35.604 1.00 43.57  ? 99   LEU H CG    1 
ATOM   5918  C  CD1   . LEU H 4 102 ? -22.743 -37.692 35.034 1.00 41.78  ? 99   LEU H CD1   1 
ATOM   5919  C  CD2   . LEU H 4 102 ? -22.627 -35.329 35.852 1.00 40.31  ? 99   LEU H CD2   1 
ATOM   5920  N  N     . PRO H 4 103 ? -20.334 -37.265 40.031 1.00 45.25  ? 100  PRO H N     1 
ATOM   5921  C  CA    . PRO H 4 103 ? -19.801 -38.139 41.071 1.00 46.10  ? 100  PRO H CA    1 
ATOM   5922  C  C     . PRO H 4 103 ? -19.596 -39.553 40.550 1.00 46.71  ? 100  PRO H C     1 
ATOM   5923  O  O     . PRO H 4 103 ? -20.316 -39.986 39.647 1.00 46.73  ? 100  PRO H O     1 
ATOM   5924  C  CB    . PRO H 4 103 ? -20.911 -38.146 42.133 1.00 46.09  ? 100  PRO H CB    1 
ATOM   5925  C  CG    . PRO H 4 103 ? -21.684 -36.917 41.897 1.00 45.21  ? 100  PRO H CG    1 
ATOM   5926  C  CD    . PRO H 4 103 ? -21.626 -36.667 40.423 1.00 45.16  ? 100  PRO H CD    1 
ATOM   5927  N  N     . GLY H 4 104 ? -18.609 -40.236 41.131 1.00 47.61  ? 101  GLY H N     1 
ATOM   5928  C  CA    . GLY H 4 104 ? -18.223 -41.614 40.802 1.00 48.60  ? 101  GLY H CA    1 
ATOM   5929  C  C     . GLY H 4 104 ? -19.150 -42.433 39.932 1.00 48.98  ? 101  GLY H C     1 
ATOM   5930  O  O     . GLY H 4 104 ? -18.959 -42.487 38.716 1.00 49.13  ? 101  GLY H O     1 
ATOM   5931  N  N     . GLU H 4 105 ? -20.154 -43.058 40.548 1.00 49.69  ? 102  GLU H N     1 
ATOM   5932  C  CA    . GLU H 4 105 ? -21.006 -44.034 39.841 1.00 51.00  ? 102  GLU H CA    1 
ATOM   5933  C  C     . GLU H 4 105 ? -21.815 -43.405 38.718 1.00 50.79  ? 102  GLU H C     1 
ATOM   5934  O  O     . GLU H 4 105 ? -22.002 -44.005 37.654 1.00 51.21  ? 102  GLU H O     1 
ATOM   5935  C  CB    . GLU H 4 105 ? -21.930 -44.786 40.802 1.00 51.35  ? 102  GLU H CB    1 
ATOM   5936  C  CG    . GLU H 4 105 ? -21.203 -45.653 41.844 1.00 54.95  ? 102  GLU H CG    1 
ATOM   5937  C  CD    . GLU H 4 105 ? -20.372 -46.783 41.228 1.00 58.49  ? 102  GLU H CD    1 
ATOM   5938  O  OE1   . GLU H 4 105 ? -20.840 -47.431 40.262 1.00 59.54  ? 102  GLU H OE1   1 
ATOM   5939  O  OE2   . GLU H 4 105 ? -19.248 -47.025 41.728 1.00 60.33  ? 102  GLU H OE2   1 
ATOM   5940  N  N     . LEU H 4 106 ? -22.280 -42.189 38.962 1.00 50.71  ? 103  LEU H N     1 
ATOM   5941  C  CA    . LEU H 4 106 ? -23.021 -41.421 37.979 1.00 50.83  ? 103  LEU H CA    1 
ATOM   5942  C  C     . LEU H 4 106 ? -22.161 -41.158 36.745 1.00 50.68  ? 103  LEU H C     1 
ATOM   5943  O  O     . LEU H 4 106 ? -22.627 -41.295 35.610 1.00 50.83  ? 103  LEU H O     1 
ATOM   5944  C  CB    . LEU H 4 106 ? -23.485 -40.113 38.615 1.00 50.72  ? 103  LEU H CB    1 
ATOM   5945  C  CG    . LEU H 4 106 ? -24.933 -39.646 38.463 1.00 51.20  ? 103  LEU H CG    1 
ATOM   5946  C  CD1   . LEU H 4 106 ? -25.941 -40.798 38.292 1.00 49.96  ? 103  LEU H CD1   1 
ATOM   5947  C  CD2   . LEU H 4 106 ? -25.311 -38.758 39.652 1.00 50.61  ? 103  LEU H CD2   1 
ATOM   5948  N  N     . ALA H 4 107 ? -20.900 -40.805 36.976 1.00 50.81  ? 104  ALA H N     1 
ATOM   5949  C  CA    . ALA H 4 107 ? -19.934 -40.603 35.899 1.00 51.04  ? 104  ALA H CA    1 
ATOM   5950  C  C     . ALA H 4 107 ? -19.746 -41.871 35.074 1.00 51.35  ? 104  ALA H C     1 
ATOM   5951  O  O     . ALA H 4 107 ? -19.779 -41.826 33.836 1.00 51.33  ? 104  ALA H O     1 
ATOM   5952  C  CB    . ALA H 4 107 ? -18.592 -40.122 36.461 1.00 50.73  ? 104  ALA H CB    1 
ATOM   5953  N  N     . LYS H 4 108 ? -19.566 -42.997 35.772 1.00 51.81  ? 105  LYS H N     1 
ATOM   5954  C  CA    . LYS H 4 108 ? -19.275 -44.284 35.145 1.00 52.18  ? 105  LYS H CA    1 
ATOM   5955  C  C     . LYS H 4 108 ? -20.336 -44.679 34.120 1.00 51.79  ? 105  LYS H C     1 
ATOM   5956  O  O     . LYS H 4 108 ? -20.004 -45.025 32.987 1.00 51.74  ? 105  LYS H O     1 
ATOM   5957  C  CB    . LYS H 4 108 ? -19.089 -45.374 36.208 1.00 52.65  ? 105  LYS H CB    1 
ATOM   5958  C  CG    . LYS H 4 108 ? -17.726 -45.314 36.901 1.00 55.22  ? 105  LYS H CG    1 
ATOM   5959  C  CD    . LYS H 4 108 ? -17.395 -46.611 37.658 1.00 58.81  ? 105  LYS H CD    1 
ATOM   5960  C  CE    . LYS H 4 108 ? -16.212 -46.416 38.611 1.00 59.59  ? 105  LYS H CE    1 
ATOM   5961  N  NZ    . LYS H 4 108 ? -16.547 -45.460 39.714 1.00 62.09  ? 105  LYS H NZ    1 
ATOM   5962  N  N     . HIS H 4 109 ? -21.604 -44.597 34.508 1.00 51.61  ? 106  HIS H N     1 
ATOM   5963  C  CA    . HIS H 4 109 ? -22.693 -44.933 33.598 1.00 52.03  ? 106  HIS H CA    1 
ATOM   5964  C  C     . HIS H 4 109 ? -22.877 -43.948 32.471 1.00 51.72  ? 106  HIS H C     1 
ATOM   5965  O  O     . HIS H 4 109 ? -23.103 -44.350 31.327 1.00 52.02  ? 106  HIS H O     1 
ATOM   5966  C  CB    . HIS H 4 109 ? -23.991 -45.074 34.354 1.00 52.35  ? 106  HIS H CB    1 
ATOM   5967  C  CG    . HIS H 4 109 ? -23.999 -46.235 35.282 1.00 54.92  ? 106  HIS H CG    1 
ATOM   5968  N  ND1   . HIS H 4 109 ? -25.034 -46.473 36.164 1.00 57.90  ? 106  HIS H ND1   1 
ATOM   5969  C  CD2   . HIS H 4 109 ? -23.090 -47.223 35.475 1.00 55.67  ? 106  HIS H CD2   1 
ATOM   5970  C  CE1   . HIS H 4 109 ? -24.766 -47.564 36.854 1.00 57.12  ? 106  HIS H CE1   1 
ATOM   5971  N  NE2   . HIS H 4 109 ? -23.591 -48.034 36.459 1.00 55.80  ? 106  HIS H NE2   1 
ATOM   5972  N  N     . ALA H 4 110 ? -22.777 -42.661 32.800 1.00 51.21  ? 107  ALA H N     1 
ATOM   5973  C  CA    . ALA H 4 110 ? -22.877 -41.608 31.806 1.00 50.64  ? 107  ALA H CA    1 
ATOM   5974  C  C     . ALA H 4 110 ? -21.859 -41.834 30.705 1.00 50.16  ? 107  ALA H C     1 
ATOM   5975  O  O     . ALA H 4 110 ? -22.191 -41.729 29.521 1.00 49.64  ? 107  ALA H O     1 
ATOM   5976  C  CB    . ALA H 4 110 ? -22.689 -40.245 32.450 1.00 50.52  ? 107  ALA H CB    1 
ATOM   5977  N  N     . VAL H 4 111 ? -20.632 -42.165 31.116 1.00 50.12  ? 108  VAL H N     1 
ATOM   5978  C  CA    . VAL H 4 111 ? -19.513 -42.445 30.206 1.00 50.30  ? 108  VAL H CA    1 
ATOM   5979  C  C     . VAL H 4 111 ? -19.798 -43.651 29.315 1.00 50.90  ? 108  VAL H C     1 
ATOM   5980  O  O     . VAL H 4 111 ? -19.505 -43.627 28.109 1.00 50.71  ? 108  VAL H O     1 
ATOM   5981  C  CB    . VAL H 4 111 ? -18.196 -42.658 30.996 1.00 50.00  ? 108  VAL H CB    1 
ATOM   5982  C  CG1   . VAL H 4 111 ? -17.137 -43.350 30.153 1.00 49.45  ? 108  VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H 4 111 ? -17.691 -41.330 31.496 1.00 49.22  ? 108  VAL H CG2   1 
ATOM   5984  N  N     . SER H 4 112 ? -20.380 -44.693 29.905 1.00 51.48  ? 109  SER H N     1 
ATOM   5985  C  CA    . SER H 4 112 ? -20.662 -45.899 29.148 1.00 52.82  ? 109  SER H CA    1 
ATOM   5986  C  C     . SER H 4 112 ? -21.889 -45.699 28.264 1.00 53.17  ? 109  SER H C     1 
ATOM   5987  O  O     . SER H 4 112 ? -21.879 -46.113 27.105 1.00 53.60  ? 109  SER H O     1 
ATOM   5988  C  CB    . SER H 4 112 ? -20.764 -47.130 30.055 1.00 53.02  ? 109  SER H CB    1 
ATOM   5989  O  OG    . SER H 4 112 ? -22.037 -47.237 30.665 1.00 54.54  ? 109  SER H OG    1 
ATOM   5990  N  N     . GLU H 4 113 ? -22.914 -45.018 28.777 1.00 53.84  ? 110  GLU H N     1 
ATOM   5991  C  CA    . GLU H 4 113 ? -24.057 -44.618 27.936 1.00 54.47  ? 110  GLU H CA    1 
ATOM   5992  C  C     . GLU H 4 113 ? -23.640 -43.786 26.735 1.00 55.09  ? 110  GLU H C     1 
ATOM   5993  O  O     . GLU H 4 113 ? -24.231 -43.905 25.663 1.00 55.26  ? 110  GLU H O     1 
ATOM   5994  C  CB    . GLU H 4 113 ? -25.104 -43.835 28.719 1.00 54.20  ? 110  GLU H CB    1 
ATOM   5995  C  CG    . GLU H 4 113 ? -26.030 -44.660 29.607 1.00 55.29  ? 110  GLU H CG    1 
ATOM   5996  C  CD    . GLU H 4 113 ? -26.742 -45.798 28.885 1.00 56.76  ? 110  GLU H CD    1 
ATOM   5997  O  OE1   . GLU H 4 113 ? -26.997 -45.705 27.656 1.00 58.07  ? 110  GLU H OE1   1 
ATOM   5998  O  OE2   . GLU H 4 113 ? -27.046 -46.798 29.565 1.00 57.31  ? 110  GLU H OE2   1 
ATOM   5999  N  N     . GLY H 4 114 ? -22.628 -42.941 26.927 1.00 55.82  ? 111  GLY H N     1 
ATOM   6000  C  CA    . GLY H 4 114 ? -22.175 -42.020 25.894 1.00 56.74  ? 111  GLY H CA    1 
ATOM   6001  C  C     . GLY H 4 114 ? -21.339 -42.714 24.842 1.00 57.46  ? 111  GLY H C     1 
ATOM   6002  O  O     . GLY H 4 114 ? -21.545 -42.514 23.644 1.00 57.14  ? 111  GLY H O     1 
ATOM   6003  N  N     . THR H 4 115 ? -20.389 -43.522 25.304 1.00 58.40  ? 112  THR H N     1 
ATOM   6004  C  CA    . THR H 4 115 ? -19.570 -44.362 24.439 1.00 59.63  ? 112  THR H CA    1 
ATOM   6005  C  C     . THR H 4 115 ? -20.460 -45.302 23.610 1.00 60.50  ? 112  THR H C     1 
ATOM   6006  O  O     . THR H 4 115 ? -20.272 -45.445 22.396 1.00 60.41  ? 112  THR H O     1 
ATOM   6007  C  CB    . THR H 4 115 ? -18.556 -45.178 25.270 1.00 59.54  ? 112  THR H CB    1 
ATOM   6008  O  OG1   . THR H 4 115 ? -17.761 -44.278 26.056 1.00 60.03  ? 112  THR H OG1   1 
ATOM   6009  C  CG2   . THR H 4 115 ? -17.643 -45.998 24.368 1.00 59.34  ? 112  THR H CG2   1 
ATOM   6010  N  N     . LYS H 4 116 ? -21.442 -45.903 24.281 1.00 61.48  ? 113  LYS H N     1 
ATOM   6011  C  CA    . LYS H 4 116 ? -22.386 -46.824 23.667 1.00 62.70  ? 113  LYS H CA    1 
ATOM   6012  C  C     . LYS H 4 116 ? -23.167 -46.162 22.538 1.00 63.33  ? 113  LYS H C     1 
ATOM   6013  O  O     . LYS H 4 116 ? -23.357 -46.759 21.474 1.00 63.69  ? 113  LYS H O     1 
ATOM   6014  C  CB    . LYS H 4 116 ? -23.349 -47.370 24.726 1.00 62.81  ? 113  LYS H CB    1 
ATOM   6015  C  CG    . LYS H 4 116 ? -24.029 -48.690 24.349 1.00 63.87  ? 113  LYS H CG    1 
ATOM   6016  C  CD    . LYS H 4 116 ? -25.023 -49.124 25.418 1.00 64.74  ? 113  LYS H CD    1 
ATOM   6017  C  CE    . LYS H 4 116 ? -26.431 -48.647 25.083 1.00 66.29  ? 113  LYS H CE    1 
ATOM   6018  N  NZ    . LYS H 4 116 ? -27.430 -49.069 26.103 1.00 67.19  ? 113  LYS H NZ    1 
ATOM   6019  N  N     . ALA H 4 117 ? -23.608 -44.929 22.769 1.00 64.07  ? 114  ALA H N     1 
ATOM   6020  C  CA    . ALA H 4 117 ? -24.365 -44.185 21.768 1.00 64.83  ? 114  ALA H CA    1 
ATOM   6021  C  C     . ALA H 4 117 ? -23.519 -43.788 20.561 1.00 65.51  ? 114  ALA H C     1 
ATOM   6022  O  O     . ALA H 4 117 ? -24.032 -43.728 19.442 1.00 65.44  ? 114  ALA H O     1 
ATOM   6023  C  CB    . ALA H 4 117 ? -25.029 -42.970 22.388 1.00 64.57  ? 114  ALA H CB    1 
ATOM   6024  N  N     . VAL H 4 118 ? -22.232 -43.523 20.791 1.00 66.66  ? 115  VAL H N     1 
ATOM   6025  C  CA    . VAL H 4 118 ? -21.318 -43.124 19.714 1.00 67.90  ? 115  VAL H CA    1 
ATOM   6026  C  C     . VAL H 4 118 ? -20.967 -44.324 18.827 1.00 68.90  ? 115  VAL H C     1 
ATOM   6027  O  O     . VAL H 4 118 ? -20.814 -44.181 17.609 1.00 69.13  ? 115  VAL H O     1 
ATOM   6028  C  CB    . VAL H 4 118 ? -20.045 -42.405 20.257 1.00 67.80  ? 115  VAL H CB    1 
ATOM   6029  C  CG1   . VAL H 4 118 ? -19.002 -42.188 19.158 1.00 67.64  ? 115  VAL H CG1   1 
ATOM   6030  C  CG2   . VAL H 4 118 ? -20.418 -41.065 20.879 1.00 67.89  ? 115  VAL H CG2   1 
ATOM   6031  N  N     . THR H 4 119 ? -20.863 -45.502 19.442 1.00 70.17  ? 116  THR H N     1 
ATOM   6032  C  CA    . THR H 4 119 ? -20.623 -46.740 18.707 1.00 71.61  ? 116  THR H CA    1 
ATOM   6033  C  C     . THR H 4 119 ? -21.797 -47.041 17.770 1.00 72.65  ? 116  THR H C     1 
ATOM   6034  O  O     . THR H 4 119 ? -21.614 -47.117 16.553 1.00 73.02  ? 116  THR H O     1 
ATOM   6035  C  CB    . THR H 4 119 ? -20.341 -47.922 19.655 1.00 71.41  ? 116  THR H CB    1 
ATOM   6036  O  OG1   . THR H 4 119 ? -19.105 -47.692 20.345 1.00 71.50  ? 116  THR H OG1   1 
ATOM   6037  C  CG2   . THR H 4 119 ? -20.221 -49.219 18.872 1.00 71.86  ? 116  THR H CG2   1 
ATOM   6038  N  N     . LYS H 4 120 ? -22.994 -47.174 18.339 1.00 73.90  ? 117  LYS H N     1 
ATOM   6039  C  CA    . LYS H 4 120 ? -24.222 -47.390 17.570 1.00 75.21  ? 117  LYS H CA    1 
ATOM   6040  C  C     . LYS H 4 120 ? -24.383 -46.395 16.418 1.00 76.03  ? 117  LYS H C     1 
ATOM   6041  O  O     . LYS H 4 120 ? -24.876 -46.756 15.349 1.00 76.36  ? 117  LYS H O     1 
ATOM   6042  C  CB    . LYS H 4 120 ? -25.445 -47.324 18.486 1.00 75.17  ? 117  LYS H CB    1 
ATOM   6043  C  CG    . LYS H 4 120 ? -26.583 -48.249 18.070 1.00 76.11  ? 117  LYS H CG    1 
ATOM   6044  C  CD    . LYS H 4 120 ? -27.735 -48.211 19.072 1.00 77.18  ? 117  LYS H CD    1 
ATOM   6045  C  CE    . LYS H 4 120 ? -28.374 -49.602 19.262 1.00 78.69  ? 117  LYS H CE    1 
ATOM   6046  N  NZ    . LYS H 4 120 ? -29.002 -50.181 18.015 1.00 78.30  ? 117  LYS H NZ    1 
ATOM   6047  N  N     . TYR H 4 121 ? -23.959 -45.153 16.639 1.00 77.02  ? 118  TYR H N     1 
ATOM   6048  C  CA    . TYR H 4 121 ? -24.066 -44.105 15.627 1.00 77.98  ? 118  TYR H CA    1 
ATOM   6049  C  C     . TYR H 4 121 ? -23.051 -44.295 14.495 1.00 79.03  ? 118  TYR H C     1 
ATOM   6050  O  O     . TYR H 4 121 ? -23.350 -44.001 13.336 1.00 79.20  ? 118  TYR H O     1 
ATOM   6051  C  CB    . TYR H 4 121 ? -23.936 -42.711 16.269 1.00 77.60  ? 118  TYR H CB    1 
ATOM   6052  C  CG    . TYR H 4 121 ? -23.903 -41.555 15.284 1.00 76.50  ? 118  TYR H CG    1 
ATOM   6053  C  CD1   . TYR H 4 121 ? -25.078 -41.042 14.739 1.00 75.39  ? 118  TYR H CD1   1 
ATOM   6054  C  CD2   . TYR H 4 121 ? -22.690 -40.979 14.897 1.00 75.74  ? 118  TYR H CD2   1 
ATOM   6055  C  CE1   . TYR H 4 121 ? -25.047 -39.988 13.832 1.00 75.65  ? 118  TYR H CE1   1 
ATOM   6056  C  CE2   . TYR H 4 121 ? -22.646 -39.923 13.993 1.00 75.48  ? 118  TYR H CE2   1 
ATOM   6057  C  CZ    . TYR H 4 121 ? -23.827 -39.430 13.463 1.00 75.82  ? 118  TYR H CZ    1 
ATOM   6058  O  OH    . TYR H 4 121 ? -23.786 -38.381 12.564 1.00 75.92  ? 118  TYR H OH    1 
ATOM   6059  N  N     . THR H 4 122 ? -21.858 -44.776 14.837 1.00 80.48  ? 119  THR H N     1 
ATOM   6060  C  CA    . THR H 4 122 ? -20.804 -45.021 13.852 1.00 81.96  ? 119  THR H CA    1 
ATOM   6061  C  C     . THR H 4 122 ? -21.169 -46.198 12.946 1.00 83.01  ? 119  THR H C     1 
ATOM   6062  O  O     . THR H 4 122 ? -21.231 -46.058 11.723 1.00 83.21  ? 119  THR H O     1 
ATOM   6063  C  CB    . THR H 4 122 ? -19.436 -45.272 14.535 1.00 81.85  ? 119  THR H CB    1 
ATOM   6064  O  OG1   . THR H 4 122 ? -19.044 -44.082 15.247 1.00 82.05  ? 119  THR H OG1   1 
ATOM   6065  C  CG2   . THR H 4 122 ? -18.351 -45.599 13.490 1.00 82.25  ? 119  THR H CG2   1 
ATOM   6066  N  N     . SER H 4 123 ? -21.434 -47.346 13.561 1.00 84.37  ? 120  SER H N     1 
ATOM   6067  C  CA    . SER H 4 123 ? -21.745 -48.569 12.835 1.00 85.62  ? 120  SER H CA    1 
ATOM   6068  C  C     . SER H 4 123 ? -23.205 -48.597 12.363 1.00 86.59  ? 120  SER H C     1 
ATOM   6069  O  O     . SER H 4 123 ? -23.905 -49.599 12.536 1.00 86.92  ? 120  SER H O     1 
ATOM   6070  C  CB    . SER H 4 123 ? -21.419 -49.787 13.707 1.00 85.61  ? 120  SER H CB    1 
ATOM   6071  O  OG    . SER H 4 123 ? -20.156 -49.637 14.338 1.00 85.59  ? 120  SER H OG    1 
ATOM   6072  N  N     . ALA H 4 124 ? -23.656 -47.492 11.768 1.00 87.63  ? 121  ALA H N     1 
ATOM   6073  C  CA    . ALA H 4 124 ? -25.013 -47.395 11.221 1.00 88.66  ? 121  ALA H CA    1 
ATOM   6074  C  C     . ALA H 4 124 ? -25.042 -46.563 9.937  1.00 89.43  ? 121  ALA H C     1 
ATOM   6075  O  O     . ALA H 4 124 ? -24.720 -45.369 9.953  1.00 89.57  ? 121  ALA H O     1 
ATOM   6076  C  CB    . ALA H 4 124 ? -25.979 -46.825 12.262 1.00 88.55  ? 121  ALA H CB    1 
ATOM   6077  N  N     . LYS H 4 125 ? -25.421 -47.210 8.832  1.00 90.31  ? 122  LYS H N     1 
ATOM   6078  C  CA    . LYS H 4 125 ? -25.500 -46.557 7.518  1.00 91.16  ? 122  LYS H CA    1 
ATOM   6079  C  C     . LYS H 4 125 ? -26.473 -45.372 7.520  1.00 91.45  ? 122  LYS H C     1 
ATOM   6080  O  O     . LYS H 4 125 ? -26.051 -44.207 7.591  1.00 91.61  ? 122  LYS H O     1 
ATOM   6081  C  CB    . LYS H 4 125 ? -25.863 -47.567 6.413  1.00 91.36  ? 122  LYS H CB    1 
ATOM   6082  C  CG    . LYS H 4 125 ? -26.984 -48.547 6.778  1.00 92.34  ? 122  LYS H CG    1 
ATOM   6083  C  CD    . LYS H 4 125 ? -27.527 -49.280 5.551  1.00 93.65  ? 122  LYS H CD    1 
ATOM   6084  C  CE    . LYS H 4 125 ? -28.667 -50.224 5.944  1.00 93.97  ? 122  LYS H CE    1 
ATOM   6085  N  NZ    . LYS H 4 125 ? -29.265 -50.921 4.763  1.00 94.17  ? 122  LYS H NZ    1 
ATOM   6086  O  OXT   . LYS H 4 125 ? -27.697 -45.545 7.469  1.00 91.63  ? 122  LYS H OXT   1 
ATOM   6087  O  "O5'" . DA  I 5 1   ? 2.223   -0.249  94.623 1.00 127.89 ? -72  DA  I "O5'" 1 
ATOM   6088  C  "C5'" . DA  I 5 1   ? 3.304   -0.371  93.706 1.00 127.80 ? -72  DA  I "C5'" 1 
ATOM   6089  C  "C4'" . DA  I 5 1   ? 4.467   -1.132  94.334 1.00 127.77 ? -72  DA  I "C4'" 1 
ATOM   6090  O  "O4'" . DA  I 5 1   ? 4.070   -2.510  94.589 1.00 128.04 ? -72  DA  I "O4'" 1 
ATOM   6091  C  "C3'" . DA  I 5 1   ? 5.731   -1.184  93.475 1.00 127.51 ? -72  DA  I "C3'" 1 
ATOM   6092  O  "O3'" . DA  I 5 1   ? 6.888   -0.909  94.278 1.00 126.96 ? -72  DA  I "O3'" 1 
ATOM   6093  C  "C2'" . DA  I 5 1   ? 5.710   -2.607  92.924 1.00 127.94 ? -72  DA  I "C2'" 1 
ATOM   6094  C  "C1'" . DA  I 5 1   ? 5.026   -3.393  94.035 1.00 128.26 ? -72  DA  I "C1'" 1 
ATOM   6095  N  N9    . DA  I 5 1   ? 4.383   -4.603  93.525 1.00 128.58 ? -72  DA  I N9    1 
ATOM   6096  C  C8    . DA  I 5 1   ? 3.208   -4.686  92.824 1.00 128.81 ? -72  DA  I C8    1 
ATOM   6097  N  N7    . DA  I 5 1   ? 2.877   -5.909  92.480 1.00 128.91 ? -72  DA  I N7    1 
ATOM   6098  C  C5    . DA  I 5 1   ? 3.909   -6.686  92.987 1.00 128.79 ? -72  DA  I C5    1 
ATOM   6099  C  C6    . DA  I 5 1   ? 4.157   -8.079  92.962 1.00 128.83 ? -72  DA  I C6    1 
ATOM   6100  N  N6    . DA  I 5 1   ? 3.339   -8.963  92.378 1.00 128.69 ? -72  DA  I N6    1 
ATOM   6101  N  N1    . DA  I 5 1   ? 5.286   -8.532  93.564 1.00 128.93 ? -72  DA  I N1    1 
ATOM   6102  C  C2    . DA  I 5 1   ? 6.108   -7.649  94.151 1.00 128.86 ? -72  DA  I C2    1 
ATOM   6103  N  N3    . DA  I 5 1   ? 5.979   -6.321  94.236 1.00 128.82 ? -72  DA  I N3    1 
ATOM   6104  C  C4    . DA  I 5 1   ? 4.850   -5.897  93.631 1.00 128.69 ? -72  DA  I C4    1 
ATOM   6105  P  P     . DT  I 5 2   ? 8.392   -1.324  93.884 1.00 126.74 ? -71  DT  I P     1 
ATOM   6106  O  OP1   . DT  I 5 2   ? 9.287   -0.321  94.509 1.00 126.97 ? -71  DT  I OP1   1 
ATOM   6107  O  OP2   . DT  I 5 2   ? 8.499   -1.560  92.422 1.00 126.71 ? -71  DT  I OP2   1 
ATOM   6108  O  "O5'" . DT  I 5 2   ? 8.564   -2.733  94.636 1.00 125.93 ? -71  DT  I "O5'" 1 
ATOM   6109  C  "C5'" . DT  I 5 2   ? 9.698   -2.984  95.474 1.00 124.87 ? -71  DT  I "C5'" 1 
ATOM   6110  C  "C4'" . DT  I 5 2   ? 10.623  -4.019  94.851 1.00 123.88 ? -71  DT  I "C4'" 1 
ATOM   6111  O  "O4'" . DT  I 5 2   ? 9.819   -5.095  94.305 1.00 123.93 ? -71  DT  I "O4'" 1 
ATOM   6112  C  "C3'" . DT  I 5 2   ? 11.499  -3.496  93.713 1.00 122.94 ? -71  DT  I "C3'" 1 
ATOM   6113  O  "O3'" . DT  I 5 2   ? 12.898  -3.553  94.079 1.00 121.31 ? -71  DT  I "O3'" 1 
ATOM   6114  C  "C2'" . DT  I 5 2   ? 11.064  -4.275  92.466 1.00 123.42 ? -71  DT  I "C2'" 1 
ATOM   6115  C  "C1'" . DT  I 5 2   ? 10.316  -5.480  93.040 1.00 123.91 ? -71  DT  I "C1'" 1 
ATOM   6116  N  N1    . DT  I 5 2   ? 9.163   -6.006  92.217 1.00 124.21 ? -71  DT  I N1    1 
ATOM   6117  C  C2    . DT  I 5 2   ? 8.951   -7.374  92.146 1.00 124.39 ? -71  DT  I C2    1 
ATOM   6118  O  O2    . DT  I 5 2   ? 9.645   -8.207  92.708 1.00 124.45 ? -71  DT  I O2    1 
ATOM   6119  N  N3    . DT  I 5 2   ? 7.876   -7.750  91.374 1.00 124.44 ? -71  DT  I N3    1 
ATOM   6120  C  C4    . DT  I 5 2   ? 7.005   -6.921  90.686 1.00 124.50 ? -71  DT  I C4    1 
ATOM   6121  O  O4    . DT  I 5 2   ? 6.074   -7.366  90.021 1.00 124.52 ? -71  DT  I O4    1 
ATOM   6122  C  C5    . DT  I 5 2   ? 7.278   -5.506  90.799 1.00 124.58 ? -71  DT  I C5    1 
ATOM   6123  C  C7    . DT  I 5 2   ? 6.408   -4.506  90.091 1.00 124.58 ? -71  DT  I C7    1 
ATOM   6124  C  C6    . DT  I 5 2   ? 8.325   -5.123  91.550 1.00 124.41 ? -71  DT  I C6    1 
ATOM   6125  P  P     . DC  I 5 3   ? 14.028  -4.535  93.483 1.00 120.34 ? -70  DC  I P     1 
ATOM   6126  O  OP1   . DC  I 5 3   ? 15.235  -4.326  94.313 1.00 120.68 ? -70  DC  I OP1   1 
ATOM   6127  O  OP2   . DC  I 5 3   ? 14.125  -4.322  92.020 1.00 120.46 ? -70  DC  I OP2   1 
ATOM   6128  O  "O5'" . DC  I 5 3   ? 13.478  -6.020  93.748 1.00 119.14 ? -70  DC  I "O5'" 1 
ATOM   6129  C  "C5'" . DC  I 5 3   ? 14.372  -7.094  94.091 1.00 116.80 ? -70  DC  I "C5'" 1 
ATOM   6130  C  "C4'" . DC  I 5 3   ? 14.351  -8.243  93.085 1.00 114.95 ? -70  DC  I "C4'" 1 
ATOM   6131  O  "O4'" . DC  I 5 3   ? 13.064  -8.339  92.407 1.00 114.68 ? -70  DC  I "O4'" 1 
ATOM   6132  C  "C3'" . DC  I 5 3   ? 15.407  -8.181  91.983 1.00 113.45 ? -70  DC  I "C3'" 1 
ATOM   6133  O  "O3'" . DC  I 5 3   ? 15.998  -9.478  91.834 1.00 111.36 ? -70  DC  I "O3'" 1 
ATOM   6134  C  "C2'" . DC  I 5 3   ? 14.597  -7.763  90.756 1.00 113.51 ? -70  DC  I "C2'" 1 
ATOM   6135  C  "C1'" . DC  I 5 3   ? 13.296  -8.520  91.022 1.00 113.86 ? -70  DC  I "C1'" 1 
ATOM   6136  N  N1    . DC  I 5 3   ? 12.086  -8.070  90.240 1.00 113.41 ? -70  DC  I N1    1 
ATOM   6137  C  C2    . DC  I 5 3   ? 11.116  -9.010  89.833 1.00 112.85 ? -70  DC  I C2    1 
ATOM   6138  O  O2    . DC  I 5 3   ? 11.255  -10.209 90.109 1.00 112.54 ? -70  DC  I O2    1 
ATOM   6139  N  N3    . DC  I 5 3   ? 10.035  -8.572  89.132 1.00 112.60 ? -70  DC  I N3    1 
ATOM   6140  C  C4    . DC  I 5 3   ? 9.898   -7.274  88.839 1.00 112.60 ? -70  DC  I C4    1 
ATOM   6141  N  N4    . DC  I 5 3   ? 8.818   -6.893  88.148 1.00 112.38 ? -70  DC  I N4    1 
ATOM   6142  C  C5    . DC  I 5 3   ? 10.866  -6.304  89.245 1.00 112.83 ? -70  DC  I C5    1 
ATOM   6143  C  C6    . DC  I 5 3   ? 11.929  -6.743  89.933 1.00 113.06 ? -70  DC  I C6    1 
ATOM   6144  P  P     . DA  I 5 4   ? 17.269  -9.732  90.887 1.00 109.98 ? -69  DA  I P     1 
ATOM   6145  O  OP1   . DA  I 5 4   ? 18.468  -9.368  91.678 1.00 110.39 ? -69  DA  I OP1   1 
ATOM   6146  O  OP2   . DA  I 5 4   ? 17.036  -9.095  89.566 1.00 109.85 ? -69  DA  I OP2   1 
ATOM   6147  O  "O5'" . DA  I 5 4   ? 17.292  -11.318 90.648 1.00 108.15 ? -69  DA  I "O5'" 1 
ATOM   6148  C  "C5'" . DA  I 5 4   ? 16.097  -12.106 90.632 1.00 105.16 ? -69  DA  I "C5'" 1 
ATOM   6149  C  "C4'" . DA  I 5 4   ? 15.638  -12.510 89.234 1.00 102.69 ? -69  DA  I "C4'" 1 
ATOM   6150  O  "O4'" . DA  I 5 4   ? 14.641  -11.578 88.747 1.00 101.83 ? -69  DA  I "O4'" 1 
ATOM   6151  C  "C3'" . DA  I 5 4   ? 16.682  -12.621 88.120 1.00 101.32 ? -69  DA  I "C3'" 1 
ATOM   6152  O  "O3'" . DA  I 5 4   ? 16.466  -13.841 87.425 1.00 99.60  ? -69  DA  I "O3'" 1 
ATOM   6153  C  "C2'" . DA  I 5 4   ? 16.367  -11.435 87.213 1.00 101.17 ? -69  DA  I "C2'" 1 
ATOM   6154  C  "C1'" . DA  I 5 4   ? 14.852  -11.420 87.360 1.00 101.03 ? -69  DA  I "C1'" 1 
ATOM   6155  N  N9    . DA  I 5 4   ? 14.147  -10.209 86.960 1.00 100.38 ? -69  DA  I N9    1 
ATOM   6156  C  C8    . DA  I 5 4   ? 14.571  -8.909  87.032 1.00 100.34 ? -69  DA  I C8    1 
ATOM   6157  N  N7    . DA  I 5 4   ? 13.685  -8.043  86.603 1.00 100.19 ? -69  DA  I N7    1 
ATOM   6158  C  C5    . DA  I 5 4   ? 12.605  -8.829  86.230 1.00 100.05 ? -69  DA  I C5    1 
ATOM   6159  C  C6    . DA  I 5 4   ? 11.334  -8.526  85.692 1.00 99.86  ? -69  DA  I C6    1 
ATOM   6160  N  N6    . DA  I 5 4   ? 10.921  -7.284  85.424 1.00 99.76  ? -69  DA  I N6    1 
ATOM   6161  N  N1    . DA  I 5 4   ? 10.491  -9.554  85.437 1.00 99.66  ? -69  DA  I N1    1 
ATOM   6162  C  C2    . DA  I 5 4   ? 10.895  -10.806 85.701 1.00 99.81  ? -69  DA  I C2    1 
ATOM   6163  N  N3    . DA  I 5 4   ? 12.060  -11.214 86.206 1.00 99.85  ? -69  DA  I N3    1 
ATOM   6164  C  C4    . DA  I 5 4   ? 12.875  -10.168 86.449 1.00 100.08 ? -69  DA  I C4    1 
ATOM   6165  P  P     . DA  I 5 5   ? 17.688  -14.720 86.880 1.00 98.59  ? -68  DA  I P     1 
ATOM   6166  O  OP1   . DA  I 5 5   ? 18.086  -15.634 87.979 1.00 98.63  ? -68  DA  I OP1   1 
ATOM   6167  O  OP2   . DA  I 5 5   ? 18.672  -13.797 86.261 1.00 98.46  ? -68  DA  I OP2   1 
ATOM   6168  O  "O5'" . DA  I 5 5   ? 17.020  -15.576 85.698 1.00 97.55  ? -68  DA  I "O5'" 1 
ATOM   6169  C  "C5'" . DA  I 5 5   ? 15.845  -16.383 85.920 1.00 95.65  ? -68  DA  I "C5'" 1 
ATOM   6170  C  "C4'" . DA  I 5 5   ? 14.915  -16.404 84.705 1.00 94.07  ? -68  DA  I "C4'" 1 
ATOM   6171  O  "O4'" . DA  I 5 5   ? 14.225  -15.136 84.555 1.00 93.38  ? -68  DA  I "O4'" 1 
ATOM   6172  C  "C3'" . DA  I 5 5   ? 15.554  -16.699 83.347 1.00 93.10  ? -68  DA  I "C3'" 1 
ATOM   6173  O  "O3'" . DA  I 5 5   ? 14.734  -17.626 82.630 1.00 92.12  ? -68  DA  I "O3'" 1 
ATOM   6174  C  "C2'" . DA  I 5 5   ? 15.612  -15.335 82.658 1.00 92.62  ? -68  DA  I "C2'" 1 
ATOM   6175  C  "C1'" . DA  I 5 5   ? 14.375  -14.655 83.236 1.00 92.76  ? -68  DA  I "C1'" 1 
ATOM   6176  N  N9    . DA  I 5 5   ? 14.474  -13.204 83.321 1.00 92.62  ? -68  DA  I N9    1 
ATOM   6177  C  C8    . DA  I 5 5   ? 15.548  -12.486 83.774 1.00 92.82  ? -68  DA  I C8    1 
ATOM   6178  N  N7    . DA  I 5 5   ? 15.359  -11.189 83.746 1.00 93.20  ? -68  DA  I N7    1 
ATOM   6179  C  C5    . DA  I 5 5   ? 14.068  -11.043 83.249 1.00 92.65  ? -68  DA  I C5    1 
ATOM   6180  C  C6    . DA  I 5 5   ? 13.265  -9.906  82.974 1.00 92.51  ? -68  DA  I C6    1 
ATOM   6181  N  N6    . DA  I 5 5   ? 13.676  -8.654  83.185 1.00 92.30  ? -68  DA  I N6    1 
ATOM   6182  N  N1    . DA  I 5 5   ? 12.017  -10.105 82.476 1.00 92.27  ? -68  DA  I N1    1 
ATOM   6183  C  C2    . DA  I 5 5   ? 11.602  -11.364 82.265 1.00 92.14  ? -68  DA  I C2    1 
ATOM   6184  N  N3    . DA  I 5 5   ? 12.264  -12.506 82.486 1.00 92.49  ? -68  DA  I N3    1 
ATOM   6185  C  C4    . DA  I 5 5   ? 13.504  -12.279 82.981 1.00 92.61  ? -68  DA  I C4    1 
ATOM   6186  P  P     . DT  I 5 6   ? 15.291  -18.485 81.391 1.00 91.07  ? -67  DT  I P     1 
ATOM   6187  O  OP1   . DT  I 5 6   ? 14.827  -19.876 81.575 1.00 90.72  ? -67  DT  I OP1   1 
ATOM   6188  O  OP2   . DT  I 5 6   ? 16.733  -18.194 81.211 1.00 91.18  ? -67  DT  I OP2   1 
ATOM   6189  O  "O5'" . DT  I 5 6   ? 14.544  -17.862 80.117 1.00 90.08  ? -67  DT  I "O5'" 1 
ATOM   6190  C  "C5'" . DT  I 5 6   ? 13.191  -17.393 80.149 1.00 87.62  ? -67  DT  I "C5'" 1 
ATOM   6191  C  "C4'" . DT  I 5 6   ? 12.909  -16.411 79.016 1.00 86.11  ? -67  DT  I "C4'" 1 
ATOM   6192  O  "O4'" . DT  I 5 6   ? 12.995  -15.050 79.518 1.00 85.75  ? -67  DT  I "O4'" 1 
ATOM   6193  C  "C3'" . DT  I 5 6   ? 13.841  -16.447 77.801 1.00 85.57  ? -67  DT  I "C3'" 1 
ATOM   6194  O  "O3'" . DT  I 5 6   ? 13.129  -16.084 76.638 1.00 84.78  ? -67  DT  I "O3'" 1 
ATOM   6195  C  "C2'" . DT  I 5 6   ? 14.805  -15.309 78.094 1.00 85.67  ? -67  DT  I "C2'" 1 
ATOM   6196  C  "C1'" . DT  I 5 6   ? 13.747  -14.315 78.569 1.00 85.51  ? -67  DT  I "C1'" 1 
ATOM   6197  N  N1    . DT  I 5 6   ? 14.267  -13.044 79.154 1.00 85.62  ? -67  DT  I N1    1 
ATOM   6198  C  C2    . DT  I 5 6   ? 13.450  -11.926 79.151 1.00 85.16  ? -67  DT  I C2    1 
ATOM   6199  O  O2    . DT  I 5 6   ? 12.316  -11.913 78.705 1.00 84.75  ? -67  DT  I O2    1 
ATOM   6200  N  N3    . DT  I 5 6   ? 14.018  -10.804 79.698 1.00 85.01  ? -67  DT  I N3    1 
ATOM   6201  C  C4    . DT  I 5 6   ? 15.292  -10.691 80.230 1.00 85.29  ? -67  DT  I C4    1 
ATOM   6202  O  O4    . DT  I 5 6   ? 15.691  -9.630  80.693 1.00 85.36  ? -67  DT  I O4    1 
ATOM   6203  C  C5    . DT  I 5 6   ? 16.100  -11.895 80.202 1.00 85.53  ? -67  DT  I C5    1 
ATOM   6204  C  C7    . DT  I 5 6   ? 17.500  -11.915 80.743 1.00 85.56  ? -67  DT  I C7    1 
ATOM   6205  C  C6    . DT  I 5 6   ? 15.554  -12.997 79.671 1.00 85.77  ? -67  DT  I C6    1 
ATOM   6206  P  P     . DA  I 5 7   ? 12.771  -17.120 75.477 1.00 83.40  ? -66  DA  I P     1 
ATOM   6207  O  OP1   . DA  I 5 7   ? 12.086  -18.278 76.097 1.00 83.16  ? -66  DA  I OP1   1 
ATOM   6208  O  OP2   . DA  I 5 7   ? 13.958  -17.319 74.612 1.00 83.05  ? -66  DA  I OP2   1 
ATOM   6209  O  "O5'" . DA  I 5 7   ? 11.692  -16.266 74.674 1.00 82.37  ? -66  DA  I "O5'" 1 
ATOM   6210  C  "C5'" . DA  I 5 7   ? 10.532  -15.820 75.380 1.00 82.00  ? -66  DA  I "C5'" 1 
ATOM   6211  C  "C4'" . DA  I 5 7   ? 10.069  -14.431 74.955 1.00 81.44  ? -66  DA  I "C4'" 1 
ATOM   6212  O  "O4'" . DA  I 5 7   ? 10.864  -13.396 75.588 1.00 80.81  ? -66  DA  I "O4'" 1 
ATOM   6213  C  "C3'" . DA  I 5 7   ? 10.119  -14.143 73.460 1.00 81.44  ? -66  DA  I "C3'" 1 
ATOM   6214  O  "O3'" . DA  I 5 7   ? 8.899   -13.479 73.110 1.00 81.86  ? -66  DA  I "O3'" 1 
ATOM   6215  C  "C2'" . DA  I 5 7   ? 11.374  -13.280 73.315 1.00 80.97  ? -66  DA  I "C2'" 1 
ATOM   6216  C  "C1'" . DA  I 5 7   ? 11.333  -12.487 74.613 1.00 80.58  ? -66  DA  I "C1'" 1 
ATOM   6217  N  N9    . DA  I 5 7   ? 12.619  -11.973 75.074 1.00 80.05  ? -66  DA  I N9    1 
ATOM   6218  C  C8    . DA  I 5 7   ? 13.767  -12.687 75.277 1.00 80.12  ? -66  DA  I C8    1 
ATOM   6219  N  N7    . DA  I 5 7   ? 14.769  -11.961 75.712 1.00 80.47  ? -66  DA  I N7    1 
ATOM   6220  C  C5    . DA  I 5 7   ? 14.244  -10.682 75.805 1.00 80.08  ? -66  DA  I C5    1 
ATOM   6221  C  C6    . DA  I 5 7   ? 14.799  -9.443  76.208 1.00 79.59  ? -66  DA  I C6    1 
ATOM   6222  N  N6    . DA  I 5 7   ? 16.066  -9.301  76.608 1.00 79.05  ? -66  DA  I N6    1 
ATOM   6223  N  N1    . DA  I 5 7   ? 14.000  -8.351  76.187 1.00 79.62  ? -66  DA  I N1    1 
ATOM   6224  C  C2    . DA  I 5 7   ? 12.730  -8.495  75.780 1.00 79.72  ? -66  DA  I C2    1 
ATOM   6225  N  N3    . DA  I 5 7   ? 12.097  -9.606  75.387 1.00 79.81  ? -66  DA  I N3    1 
ATOM   6226  C  C4    . DA  I 5 7   ? 12.914  -10.674 75.419 1.00 79.72  ? -66  DA  I C4    1 
ATOM   6227  P  P     . DT  I 5 8   ? 8.594   -12.927 71.635 1.00 82.05  ? -65  DT  I P     1 
ATOM   6228  O  OP1   . DT  I 5 8   ? 7.142   -12.686 71.527 1.00 81.61  ? -65  DT  I OP1   1 
ATOM   6229  O  OP2   . DT  I 5 8   ? 9.303   -13.767 70.643 1.00 82.26  ? -65  DT  I OP2   1 
ATOM   6230  O  "O5'" . DT  I 5 8   ? 9.270   -11.490 71.683 1.00 83.84  ? -65  DT  I "O5'" 1 
ATOM   6231  C  "C5'" . DT  I 5 8   ? 8.732   -10.530 72.585 1.00 85.80  ? -65  DT  I "C5'" 1 
ATOM   6232  C  "C4'" . DT  I 5 8   ? 9.200   -9.140  72.217 1.00 87.31  ? -65  DT  I "C4'" 1 
ATOM   6233  O  "O4'" . DT  I 5 8   ? 10.527  -8.936  72.761 1.00 87.38  ? -65  DT  I "O4'" 1 
ATOM   6234  C  "C3'" . DT  I 5 8   ? 9.292   -8.874  70.719 1.00 88.37  ? -65  DT  I "C3'" 1 
ATOM   6235  O  "O3'" . DT  I 5 8   ? 8.635   -7.637  70.464 1.00 90.56  ? -65  DT  I "O3'" 1 
ATOM   6236  C  "C2'" . DT  I 5 8   ? 10.798  -8.845  70.442 1.00 87.79  ? -65  DT  I "C2'" 1 
ATOM   6237  C  "C1'" . DT  I 5 8   ? 11.357  -8.365  71.778 1.00 86.88  ? -65  DT  I "C1'" 1 
ATOM   6238  N  N1    . DT  I 5 8   ? 12.750  -8.780  72.105 1.00 86.32  ? -65  DT  I N1    1 
ATOM   6239  C  C2    . DT  I 5 8   ? 13.601  -7.845  72.664 1.00 86.52  ? -65  DT  I C2    1 
ATOM   6240  O  O2    . DT  I 5 8   ? 13.275  -6.689  72.896 1.00 86.68  ? -65  DT  I O2    1 
ATOM   6241  N  N3    . DT  I 5 8   ? 14.866  -8.315  72.944 1.00 86.32  ? -65  DT  I N3    1 
ATOM   6242  C  C4    . DT  I 5 8   ? 15.352  -9.598  72.726 1.00 86.14  ? -65  DT  I C4    1 
ATOM   6243  O  O4    . DT  I 5 8   ? 16.506  -9.915  73.013 1.00 85.55  ? -65  DT  I O4    1 
ATOM   6244  C  C5    . DT  I 5 8   ? 14.405  -10.527 72.142 1.00 86.39  ? -65  DT  I C5    1 
ATOM   6245  C  C7    . DT  I 5 8   ? 14.801  -11.950 71.856 1.00 86.36  ? -65  DT  I C7    1 
ATOM   6246  C  C6    . DT  I 5 8   ? 13.167  -10.080 71.867 1.00 86.22  ? -65  DT  I C6    1 
ATOM   6247  P  P     . DC  I 5 9   ? 8.251   -7.112  68.993 1.00 92.63  ? -64  DC  I P     1 
ATOM   6248  O  OP1   . DC  I 5 9   ? 6.847   -6.639  69.046 1.00 92.07  ? -64  DC  I OP1   1 
ATOM   6249  O  OP2   . DC  I 5 9   ? 8.673   -8.085  67.957 1.00 92.16  ? -64  DC  I OP2   1 
ATOM   6250  O  "O5'" . DC  I 5 9   ? 9.216   -5.851  68.859 1.00 94.40  ? -64  DC  I "O5'" 1 
ATOM   6251  C  "C5'" . DC  I 5 9   ? 9.255   -4.876  69.900 1.00 97.36  ? -64  DC  I "C5'" 1 
ATOM   6252  C  "C4'" . DC  I 5 9   ? 10.509  -4.037  69.764 1.00 99.52  ? -64  DC  I "C4'" 1 
ATOM   6253  O  "O4'" . DC  I 5 9   ? 11.651  -4.782  70.262 1.00 99.78  ? -64  DC  I "O4'" 1 
ATOM   6254  C  "C3'" . DC  I 5 9   ? 10.826  -3.637  68.326 1.00 100.96 ? -64  DC  I "C3'" 1 
ATOM   6255  O  "O3'" . DC  I 5 9   ? 10.858  -2.219  68.204 1.00 103.50 ? -64  DC  I "O3'" 1 
ATOM   6256  C  "C2'" . DC  I 5 9   ? 12.188  -4.263  68.034 1.00 100.57 ? -64  DC  I "C2'" 1 
ATOM   6257  C  "C1'" . DC  I 5 9   ? 12.760  -4.502  69.432 1.00 99.86  ? -64  DC  I "C1'" 1 
ATOM   6258  N  N1    . DC  I 5 9   ? 13.698  -5.659  69.498 1.00 99.58  ? -64  DC  I N1    1 
ATOM   6259  C  C2    . DC  I 5 9   ? 14.955  -5.517  70.110 1.00 99.77  ? -64  DC  I C2    1 
ATOM   6260  O  O2    . DC  I 5 9   ? 15.284  -4.429  70.600 1.00 100.46 ? -64  DC  I O2    1 
ATOM   6261  N  N3    . DC  I 5 9   ? 15.788  -6.591  70.151 1.00 99.52  ? -64  DC  I N3    1 
ATOM   6262  C  C4    . DC  I 5 9   ? 15.405  -7.756  69.615 1.00 99.08  ? -64  DC  I C4    1 
ATOM   6263  N  N4    . DC  I 5 9   ? 16.253  -8.785  69.676 1.00 98.75  ? -64  DC  I N4    1 
ATOM   6264  C  C5    . DC  I 5 9   ? 14.133  -7.917  68.986 1.00 99.17  ? -64  DC  I C5    1 
ATOM   6265  C  C6    . DC  I 5 9   ? 13.323  -6.856  68.952 1.00 99.10  ? -64  DC  I C6    1 
ATOM   6266  P  P     . DC  I 5 10  ? 10.108  -1.471  66.999 1.00 105.14 ? -63  DC  I P     1 
ATOM   6267  O  OP1   . DC  I 5 10  ? 9.253   -0.417  67.604 1.00 105.00 ? -63  DC  I OP1   1 
ATOM   6268  O  OP2   . DC  I 5 10  ? 9.515   -2.483  66.085 1.00 104.86 ? -63  DC  I OP2   1 
ATOM   6269  O  "O5'" . DC  I 5 10  ? 11.311  -0.763  66.209 1.00 106.42 ? -63  DC  I "O5'" 1 
ATOM   6270  C  "C5'" . DC  I 5 10  ? 12.506  -1.552  65.911 1.00 108.56 ? -63  DC  I "C5'" 1 
ATOM   6271  C  "C4'" . DC  I 5 10  ? 13.692  -0.704  66.335 1.00 110.42 ? -63  DC  I "C4'" 1 
ATOM   6272  O  "O4'" . DC  I 5 10  ? 14.548  -1.437  67.257 1.00 110.72 ? -63  DC  I "O4'" 1 
ATOM   6273  C  "C3'" . DC  I 5 10  ? 14.557  -0.257  65.164 1.00 111.84 ? -63  DC  I "C3'" 1 
ATOM   6274  O  "O3'" . DC  I 5 10  ? 14.947  1.099   65.350 1.00 113.91 ? -63  DC  I "O3'" 1 
ATOM   6275  C  "C2'" . DC  I 5 10  ? 15.747  -1.215  65.213 1.00 111.62 ? -63  DC  I "C2'" 1 
ATOM   6276  C  "C1'" . DC  I 5 10  ? 15.815  -1.681  66.669 1.00 111.22 ? -63  DC  I "C1'" 1 
ATOM   6277  N  N1    . DC  I 5 10  ? 16.161  -3.141  66.778 1.00 111.45 ? -63  DC  I N1    1 
ATOM   6278  C  C2    . DC  I 5 10  ? 17.372  -3.541  67.394 1.00 111.47 ? -63  DC  I C2    1 
ATOM   6279  O  O2    . DC  I 5 10  ? 18.156  -2.695  67.862 1.00 111.49 ? -63  DC  I O2    1 
ATOM   6280  N  N3    . DC  I 5 10  ? 17.656  -4.870  67.468 1.00 111.36 ? -63  DC  I N3    1 
ATOM   6281  C  C4    . DC  I 5 10  ? 16.802  -5.772  66.960 1.00 111.40 ? -63  DC  I C4    1 
ATOM   6282  N  N4    . DC  I 5 10  ? 17.137  -7.063  67.059 1.00 111.35 ? -63  DC  I N4    1 
ATOM   6283  C  C5    . DC  I 5 10  ? 15.569  -5.390  66.327 1.00 111.32 ? -63  DC  I C5    1 
ATOM   6284  C  C6    . DC  I 5 10  ? 15.295  -4.080  66.259 1.00 111.27 ? -63  DC  I C6    1 
ATOM   6285  P  P     . DA  I 5 11  ? 15.605  1.978   64.176 1.00 115.08 ? -62  DA  I P     1 
ATOM   6286  O  OP1   . DA  I 5 11  ? 14.605  3.001   63.799 1.00 114.81 ? -62  DA  I OP1   1 
ATOM   6287  O  OP2   . DA  I 5 11  ? 16.180  1.098   63.132 1.00 114.82 ? -62  DA  I OP2   1 
ATOM   6288  O  "O5'" . DA  I 5 11  ? 16.826  2.681   64.945 1.00 115.96 ? -62  DA  I "O5'" 1 
ATOM   6289  C  "C5'" . DA  I 5 11  ? 17.575  1.980   65.956 1.00 117.16 ? -62  DA  I "C5'" 1 
ATOM   6290  C  "C4'" . DA  I 5 11  ? 19.012  1.685   65.538 1.00 118.04 ? -62  DA  I "C4'" 1 
ATOM   6291  O  "O4'" . DA  I 5 11  ? 19.287  0.268   65.695 1.00 118.28 ? -62  DA  I "O4'" 1 
ATOM   6292  C  "C3'" . DA  I 5 11  ? 19.379  2.051   64.101 1.00 118.86 ? -62  DA  I "C3'" 1 
ATOM   6293  O  "O3'" . DA  I 5 11  ? 20.596  2.795   64.060 1.00 119.92 ? -62  DA  I "O3'" 1 
ATOM   6294  C  "C2'" . DA  I 5 11  ? 19.513  0.705   63.396 1.00 118.85 ? -62  DA  I "C2'" 1 
ATOM   6295  C  "C1'" . DA  I 5 11  ? 19.899  -0.244  64.525 1.00 118.54 ? -62  DA  I "C1'" 1 
ATOM   6296  N  N9    . DA  I 5 11  ? 19.443  -1.617  64.288 1.00 118.54 ? -62  DA  I N9    1 
ATOM   6297  C  C8    . DA  I 5 11  ? 18.213  -1.999  63.828 1.00 118.42 ? -62  DA  I C8    1 
ATOM   6298  N  N7    . DA  I 5 11  ? 18.060  -3.296  63.700 1.00 118.66 ? -62  DA  I N7    1 
ATOM   6299  C  C5    . DA  I 5 11  ? 19.283  -3.806  64.097 1.00 118.81 ? -62  DA  I C5    1 
ATOM   6300  C  C6    . DA  I 5 11  ? 19.777  -5.128  64.185 1.00 118.87 ? -62  DA  I C6    1 
ATOM   6301  N  N6    . DA  I 5 11  ? 19.047  -6.210  63.863 1.00 118.77 ? -62  DA  I N6    1 
ATOM   6302  N  N1    . DA  I 5 11  ? 21.051  -5.303  64.617 1.00 118.71 ? -62  DA  I N1    1 
ATOM   6303  C  C2    . DA  I 5 11  ? 21.780  -4.224  64.939 1.00 118.56 ? -62  DA  I C2    1 
ATOM   6304  N  N3    . DA  I 5 11  ? 21.422  -2.937  64.893 1.00 118.60 ? -62  DA  I N3    1 
ATOM   6305  C  C4    . DA  I 5 11  ? 20.153  -2.788  64.460 1.00 118.63 ? -62  DA  I C4    1 
ATOM   6306  P  P     . DC  I 5 12  ? 21.115  3.480   62.702 1.00 120.99 ? -61  DC  I P     1 
ATOM   6307  O  OP1   . DC  I 5 12  ? 21.775  4.749   63.094 1.00 121.04 ? -61  DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I 5 12  ? 20.015  3.516   61.701 1.00 120.52 ? -61  DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I 5 12  ? 22.228  2.431   62.213 1.00 121.25 ? -61  DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I 5 12  ? 23.416  2.243   62.990 1.00 121.80 ? -61  DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I 5 12  ? 24.086  0.907   62.714 1.00 122.26 ? -61  DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I 5 12  ? 23.125  -0.178  62.822 1.00 122.36 ? -61  DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I 5 12  ? 24.747  0.777   61.340 1.00 122.53 ? -61  DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I 5 12  ? 26.152  0.519   61.532 1.00 122.84 ? -61  DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I 5 12  ? 23.966  -0.354  60.664 1.00 122.43 ? -61  DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I 5 12  ? 23.458  -1.158  61.856 1.00 122.18 ? -61  DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I 5 12  ? 22.265  -2.052  61.554 1.00 122.09 ? -61  DC  I N1    1 
ATOM   6318  C  C2    . DC  I 5 12  ? 22.387  -3.461  61.667 1.00 122.09 ? -61  DC  I C2    1 
ATOM   6319  O  O2    . DC  I 5 12  ? 23.468  -3.970  62.021 1.00 122.55 ? -61  DC  I O2    1 
ATOM   6320  N  N3    . DC  I 5 12  ? 21.301  -4.248  61.387 1.00 121.89 ? -61  DC  I N3    1 
ATOM   6321  C  C4    . DC  I 5 12  ? 20.136  -3.688  61.004 1.00 121.70 ? -61  DC  I C4    1 
ATOM   6322  N  N4    . DC  I 5 12  ? 19.096  -4.504  60.740 1.00 121.30 ? -61  DC  I N4    1 
ATOM   6323  C  C5    . DC  I 5 12  ? 19.987  -2.263  60.881 1.00 121.60 ? -61  DC  I C5    1 
ATOM   6324  C  C6    . DC  I 5 12  ? 21.063  -1.498  61.159 1.00 121.82 ? -61  DC  I C6    1 
ATOM   6325  P  P     . DC  I 5 13  ? 27.090  -0.339  60.545 1.00 122.98 ? -60  DC  I P     1 
ATOM   6326  O  OP1   . DC  I 5 13  ? 28.491  -0.064  60.936 1.00 122.65 ? -60  DC  I OP1   1 
ATOM   6327  O  OP2   . DC  I 5 13  ? 26.665  -0.087  59.148 1.00 122.62 ? -60  DC  I OP2   1 
ATOM   6328  O  "O5'" . DC  I 5 13  ? 26.724  -1.854  60.936 1.00 123.47 ? -60  DC  I "O5'" 1 
ATOM   6329  C  "C5'" . DC  I 5 13  ? 27.731  -2.863  61.111 1.00 123.85 ? -60  DC  I "C5'" 1 
ATOM   6330  C  "C4'" . DC  I 5 13  ? 27.674  -3.929  60.022 1.00 124.15 ? -60  DC  I "C4'" 1 
ATOM   6331  O  "O4'" . DC  I 5 13  ? 26.314  -4.426  59.888 1.00 124.14 ? -60  DC  I "O4'" 1 
ATOM   6332  C  "C3'" . DC  I 5 13  ? 28.107  -3.461  58.631 1.00 124.25 ? -60  DC  I "C3'" 1 
ATOM   6333  O  "O3'" . DC  I 5 13  ? 29.103  -4.329  58.084 1.00 124.52 ? -60  DC  I "O3'" 1 
ATOM   6334  C  "C2'" . DC  I 5 13  ? 26.824  -3.489  57.801 1.00 124.17 ? -60  DC  I "C2'" 1 
ATOM   6335  C  "C1'" . DC  I 5 13  ? 25.989  -4.548  58.517 1.00 123.97 ? -60  DC  I "C1'" 1 
ATOM   6336  N  N1    . DC  I 5 13  ? 24.494  -4.409  58.328 1.00 123.70 ? -60  DC  I N1    1 
ATOM   6337  C  C2    . DC  I 5 13  ? 23.703  -5.559  58.125 1.00 123.53 ? -60  DC  I C2    1 
ATOM   6338  O  O2    . DC  I 5 13  ? 24.237  -6.678  58.110 1.00 123.55 ? -60  DC  I O2    1 
ATOM   6339  N  N3    . DC  I 5 13  ? 22.358  -5.415  57.956 1.00 123.39 ? -60  DC  I N3    1 
ATOM   6340  C  C4    . DC  I 5 13  ? 21.801  -4.194  57.979 1.00 123.17 ? -60  DC  I C4    1 
ATOM   6341  N  N4    . DC  I 5 13  ? 20.477  -4.103  57.806 1.00 122.79 ? -60  DC  I N4    1 
ATOM   6342  C  C5    . DC  I 5 13  ? 22.582  -3.012  58.180 1.00 123.30 ? -60  DC  I C5    1 
ATOM   6343  C  C6    . DC  I 5 13  ? 23.906  -3.166  58.348 1.00 123.50 ? -60  DC  I C6    1 
ATOM   6344  P  P     . DT  I 5 14  ? 30.131  -3.824  56.955 1.00 125.03 ? -59  DT  I P     1 
ATOM   6345  O  OP1   . DT  I 5 14  ? 31.452  -3.634  57.598 1.00 125.23 ? -59  DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I 5 14  ? 29.520  -2.706  56.197 1.00 124.86 ? -59  DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I 5 14  ? 30.231  -5.078  55.968 1.00 124.78 ? -59  DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I 5 14  ? 30.686  -6.343  56.454 1.00 124.58 ? -59  DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I 5 14  ? 29.970  -7.472  55.732 1.00 124.48 ? -59  DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I 5 14  ? 28.530  -7.363  55.921 1.00 124.52 ? -59  DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I 5 14  ? 30.223  -7.515  54.225 1.00 124.33 ? -59  DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I 5 14  ? 30.756  -8.787  53.851 1.00 123.92 ? -59  DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I 5 14  ? 28.847  -7.257  53.604 1.00 124.47 ? -59  DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I 5 14  ? 27.886  -7.696  54.704 1.00 124.47 ? -59  DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I 5 14  ? 26.533  -7.030  54.632 1.00 124.42 ? -59  DT  I N1    1 
ATOM   6356  C  C2    . DT  I 5 14  ? 25.379  -7.805  54.686 1.00 124.49 ? -59  DT  I C2    1 
ATOM   6357  O  O2    . DT  I 5 14  ? 25.383  -9.020  54.797 1.00 124.60 ? -59  DT  I O2    1 
ATOM   6358  N  N3    . DT  I 5 14  ? 24.196  -7.095  54.609 1.00 124.40 ? -59  DT  I N3    1 
ATOM   6359  C  C4    . DT  I 5 14  ? 24.052  -5.720  54.485 1.00 124.32 ? -59  DT  I C4    1 
ATOM   6360  O  O4    . DT  I 5 14  ? 22.941  -5.190  54.423 1.00 124.06 ? -59  DT  I O4    1 
ATOM   6361  C  C5    . DT  I 5 14  ? 25.296  -4.968  54.428 1.00 124.32 ? -59  DT  I C5    1 
ATOM   6362  C  C7    . DT  I 5 14  ? 25.287  -3.471  54.292 1.00 124.17 ? -59  DT  I C7    1 
ATOM   6363  C  C6    . DT  I 5 14  ? 26.455  -5.650  54.504 1.00 124.35 ? -59  DT  I C6    1 
ATOM   6364  P  P     . DG  I 5 15  ? 31.116  -9.132  52.323 1.00 123.62 ? -58  DG  I P     1 
ATOM   6365  O  OP1   . DG  I 5 15  ? 32.349  -9.958  52.322 1.00 123.62 ? -58  DG  I OP1   1 
ATOM   6366  O  OP2   . DG  I 5 15  ? 31.064  -7.892  51.509 1.00 123.67 ? -58  DG  I OP2   1 
ATOM   6367  O  "O5'" . DG  I 5 15  ? 29.871  -10.032 51.881 1.00 122.27 ? -58  DG  I "O5'" 1 
ATOM   6368  C  "C5'" . DG  I 5 15  ? 29.590  -11.260 52.541 1.00 120.87 ? -58  DG  I "C5'" 1 
ATOM   6369  C  "C4'" . DG  I 5 15  ? 28.323  -11.873 51.974 1.00 119.69 ? -58  DG  I "C4'" 1 
ATOM   6370  O  "O4'" . DG  I 5 15  ? 27.219  -10.942 52.102 1.00 119.52 ? -58  DG  I "O4'" 1 
ATOM   6371  C  "C3'" . DG  I 5 15  ? 28.393  -12.263 50.502 1.00 118.91 ? -58  DG  I "C3'" 1 
ATOM   6372  O  "O3'" . DG  I 5 15  ? 27.812  -13.553 50.358 1.00 117.83 ? -58  DG  I "O3'" 1 
ATOM   6373  C  "C2'" . DG  I 5 15  ? 27.597  -11.173 49.780 1.00 118.97 ? -58  DG  I "C2'" 1 
ATOM   6374  C  "C1'" . DG  I 5 15  ? 26.597  -10.733 50.848 1.00 119.05 ? -58  DG  I "C1'" 1 
ATOM   6375  N  N9    . DG  I 5 15  ? 26.205  -9.324  50.800 1.00 118.59 ? -58  DG  I N9    1 
ATOM   6376  C  C8    . DG  I 5 15  ? 27.035  -8.233  50.671 1.00 118.50 ? -58  DG  I C8    1 
ATOM   6377  N  N7    . DG  I 5 15  ? 26.404  -7.092  50.669 1.00 118.16 ? -58  DG  I N7    1 
ATOM   6378  C  C5    . DG  I 5 15  ? 25.068  -7.442  50.810 1.00 117.96 ? -58  DG  I C5    1 
ATOM   6379  C  C6    . DG  I 5 15  ? 23.912  -6.626  50.873 1.00 117.57 ? -58  DG  I C6    1 
ATOM   6380  O  O6    . DG  I 5 15  ? 23.846  -5.393  50.816 1.00 117.50 ? -58  DG  I O6    1 
ATOM   6381  N  N1    . DG  I 5 15  ? 22.744  -7.371  51.019 1.00 117.28 ? -58  DG  I N1    1 
ATOM   6382  C  C2    . DG  I 5 15  ? 22.704  -8.745  51.095 1.00 117.50 ? -58  DG  I C2    1 
ATOM   6383  N  N2    . DG  I 5 15  ? 21.493  -9.297  51.232 1.00 117.40 ? -58  DG  I N2    1 
ATOM   6384  N  N3    . DG  I 5 15  ? 23.779  -9.525  51.037 1.00 117.87 ? -58  DG  I N3    1 
ATOM   6385  C  C4    . DG  I 5 15  ? 24.927  -8.812  50.895 1.00 118.21 ? -58  DG  I C4    1 
ATOM   6386  P  P     . DC  I 5 16  ? 27.973  -14.395 49.007 1.00 117.05 ? -57  DC  I P     1 
ATOM   6387  O  OP1   . DC  I 5 16  ? 28.007  -15.833 49.367 1.00 116.88 ? -57  DC  I OP1   1 
ATOM   6388  O  OP2   . DC  I 5 16  ? 29.069  -13.801 48.200 1.00 117.00 ? -57  DC  I OP2   1 
ATOM   6389  O  "O5'" . DC  I 5 16  ? 26.599  -14.086 48.245 1.00 115.80 ? -57  DC  I "O5'" 1 
ATOM   6390  C  "C5'" . DC  I 5 16  ? 25.343  -14.275 48.902 1.00 113.72 ? -57  DC  I "C5'" 1 
ATOM   6391  C  "C4'" . DC  I 5 16  ? 24.214  -13.594 48.142 1.00 112.06 ? -57  DC  I "C4'" 1 
ATOM   6392  O  "O4'" . DC  I 5 16  ? 24.235  -12.164 48.388 1.00 111.54 ? -57  DC  I "O4'" 1 
ATOM   6393  C  "C3'" . DC  I 5 16  ? 24.276  -13.774 46.625 1.00 111.09 ? -57  DC  I "C3'" 1 
ATOM   6394  O  "O3'" . DC  I 5 16  ? 23.059  -14.340 46.179 1.00 109.85 ? -57  DC  I "O3'" 1 
ATOM   6395  C  "C2'" . DC  I 5 16  ? 24.483  -12.365 46.071 1.00 111.12 ? -57  DC  I "C2'" 1 
ATOM   6396  C  "C1'" . DC  I 5 16  ? 23.897  -11.504 47.186 1.00 111.15 ? -57  DC  I "C1'" 1 
ATOM   6397  N  N1    . DC  I 5 16  ? 24.404  -10.088 47.253 1.00 110.96 ? -57  DC  I N1    1 
ATOM   6398  C  C2    . DC  I 5 16  ? 23.525  -9.061  47.639 1.00 110.68 ? -57  DC  I C2    1 
ATOM   6399  O  O2    . DC  I 5 16  ? 22.352  -9.335  47.912 1.00 110.29 ? -57  DC  I O2    1 
ATOM   6400  N  N3    . DC  I 5 16  ? 23.985  -7.783  47.701 1.00 110.84 ? -57  DC  I N3    1 
ATOM   6401  C  C4    . DC  I 5 16  ? 25.260  -7.511  47.400 1.00 110.90 ? -57  DC  I C4    1 
ATOM   6402  N  N4    . DC  I 5 16  ? 25.661  -6.236  47.478 1.00 110.81 ? -57  DC  I N4    1 
ATOM   6403  C  C5    . DC  I 5 16  ? 26.175  -8.538  47.006 1.00 110.85 ? -57  DC  I C5    1 
ATOM   6404  C  C6    . DC  I 5 16  ? 25.709  -9.795  46.949 1.00 110.89 ? -57  DC  I C6    1 
ATOM   6405  P  P     . DA  I 5 17  ? 22.987  -15.899 45.842 1.00 108.85 ? -56  DA  I P     1 
ATOM   6406  O  OP1   . DA  I 5 17  ? 23.501  -16.651 47.007 1.00 108.79 ? -56  DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I 5 17  ? 23.590  -16.087 44.504 1.00 108.81 ? -56  DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I 5 17  ? 21.419  -16.177 45.699 1.00 108.27 ? -56  DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I 5 17  ? 20.518  -15.969 46.788 1.00 107.57 ? -56  DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I 5 17  ? 19.427  -14.974 46.411 1.00 106.99 ? -56  DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I 5 17  ? 20.018  -13.681 46.115 1.00 107.15 ? -56  DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I 5 17  ? 18.580  -15.330 45.194 1.00 106.33 ? -56  DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I 5 17  ? 17.232  -14.934 45.413 1.00 105.13 ? -56  DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I 5 17  ? 19.219  -14.523 44.065 1.00 106.77 ? -56  DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I 5 17  ? 19.662  -13.266 44.809 1.00 107.26 ? -56  DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I 5 17  ? 20.811  -12.564 44.235 1.00 107.60 ? -56  DA  I N9    1 
ATOM   6417  C  C8    . DA  I 5 17  ? 21.843  -13.100 43.507 1.00 107.79 ? -56  DA  I C8    1 
ATOM   6418  N  N7    . DA  I 5 17  ? 22.742  -12.220 43.128 1.00 108.04 ? -56  DA  I N7    1 
ATOM   6419  C  C5    . DA  I 5 17  ? 22.270  -11.022 43.646 1.00 107.69 ? -56  DA  I C5    1 
ATOM   6420  C  C6    . DA  I 5 17  ? 22.766  -9.702  43.600 1.00 107.55 ? -56  DA  I C6    1 
ATOM   6421  N  N6    . DA  I 5 17  ? 23.901  -9.378  42.972 1.00 107.72 ? -56  DA  I N6    1 
ATOM   6422  N  N1    . DA  I 5 17  ? 22.054  -8.727  44.218 1.00 107.22 ? -56  DA  I N1    1 
ATOM   6423  C  C2    . DA  I 5 17  ? 20.918  -9.059  44.847 1.00 107.04 ? -56  DA  I C2    1 
ATOM   6424  N  N3    . DA  I 5 17  ? 20.354  -10.264 44.959 1.00 107.34 ? -56  DA  I N3    1 
ATOM   6425  C  C4    . DA  I 5 17  ? 21.082  -11.214 44.333 1.00 107.60 ? -56  DA  I C4    1 
ATOM   6426  P  P     . DG  I 5 18  ? 16.023  -15.634 44.627 1.00 104.46 ? -55  DG  I P     1 
ATOM   6427  O  OP1   . DG  I 5 18  ? 15.248  -16.403 45.625 1.00 104.74 ? -55  DG  I OP1   1 
ATOM   6428  O  OP2   . DG  I 5 18  ? 16.571  -16.301 43.421 1.00 104.33 ? -55  DG  I OP2   1 
ATOM   6429  O  "O5'" . DG  I 5 18  ? 15.100  -14.435 44.110 1.00 102.97 ? -55  DG  I "O5'" 1 
ATOM   6430  C  "C5'" . DG  I 5 18  ? 14.995  -13.213 44.823 1.00 101.11 ? -55  DG  I "C5'" 1 
ATOM   6431  C  "C4'" . DG  I 5 18  ? 15.364  -12.042 43.929 1.00 99.72  ? -55  DG  I "C4'" 1 
ATOM   6432  O  "O4'" . DG  I 5 18  ? 16.745  -12.125 43.503 1.00 99.48  ? -55  DG  I "O4'" 1 
ATOM   6433  C  "C3'" . DG  I 5 18  ? 14.562  -11.910 42.633 1.00 98.96  ? -55  DG  I "C3'" 1 
ATOM   6434  O  "O3'" . DG  I 5 18  ? 13.769  -10.742 42.738 1.00 97.74  ? -55  DG  I "O3'" 1 
ATOM   6435  C  "C2'" . DG  I 5 18  ? 15.620  -11.748 41.536 1.00 98.96  ? -55  DG  I "C2'" 1 
ATOM   6436  C  "C1'" . DG  I 5 18  ? 16.809  -11.286 42.370 1.00 99.36  ? -55  DG  I "C1'" 1 
ATOM   6437  N  N9    . DG  I 5 18  ? 18.120  -11.395 41.733 1.00 99.70  ? -55  DG  I N9    1 
ATOM   6438  C  C8    . DG  I 5 18  ? 18.704  -12.519 41.201 1.00 99.95  ? -55  DG  I C8    1 
ATOM   6439  N  N7    . DG  I 5 18  ? 19.890  -12.303 40.706 1.00 100.17 ? -55  DG  I N7    1 
ATOM   6440  C  C5    . DG  I 5 18  ? 20.108  -10.950 40.921 1.00 100.10 ? -55  DG  I C5    1 
ATOM   6441  C  C6    . DG  I 5 18  ? 21.227  -10.143 40.593 1.00 100.37 ? -55  DG  I C6    1 
ATOM   6442  O  O6    . DG  I 5 18  ? 22.272  -10.495 40.027 1.00 100.76 ? -55  DG  I O6    1 
ATOM   6443  N  N1    . DG  I 5 18  ? 21.054  -8.810  40.983 1.00 100.20 ? -55  DG  I N1    1 
ATOM   6444  C  C2    . DG  I 5 18  ? 19.928  -8.326  41.617 1.00 100.16 ? -55  DG  I C2    1 
ATOM   6445  N  N2    . DG  I 5 18  ? 19.927  -7.023  41.925 1.00 100.11 ? -55  DG  I N2    1 
ATOM   6446  N  N3    . DG  I 5 18  ? 18.873  -9.074  41.930 1.00 100.02 ? -55  DG  I N3    1 
ATOM   6447  C  C4    . DG  I 5 18  ? 19.028  -10.374 41.554 1.00 99.99  ? -55  DG  I C4    1 
ATOM   6448  P  P     . DA  I 5 19  ? 12.392  -10.570 41.950 1.00 96.38  ? -54  DA  I P     1 
ATOM   6449  O  OP1   . DA  I 5 19  ? 11.316  -10.724 42.949 1.00 96.22  ? -54  DA  I OP1   1 
ATOM   6450  O  OP2   . DA  I 5 19  ? 12.398  -11.402 40.724 1.00 96.45  ? -54  DA  I OP2   1 
ATOM   6451  O  "O5'" . DA  I 5 19  ? 12.480  -9.044  41.481 1.00 96.73  ? -54  DA  I "O5'" 1 
ATOM   6452  C  "C5'" . DA  I 5 19  ? 13.087  -8.071  42.328 1.00 97.64  ? -54  DA  I "C5'" 1 
ATOM   6453  C  "C4'" . DA  I 5 19  ? 13.971  -7.093  41.568 1.00 98.47  ? -54  DA  I "C4'" 1 
ATOM   6454  O  "O4'" . DA  I 5 19  ? 15.245  -7.710  41.245 1.00 98.45  ? -54  DA  I "O4'" 1 
ATOM   6455  C  "C3'" . DA  I 5 19  ? 13.393  -6.560  40.256 1.00 99.12  ? -54  DA  I "C3'" 1 
ATOM   6456  O  "O3'" . DA  I 5 19  ? 13.351  -5.137  40.259 1.00 100.28 ? -54  DA  I "O3'" 1 
ATOM   6457  C  "C2'" . DA  I 5 19  ? 14.359  -7.086  39.196 1.00 98.87  ? -54  DA  I "C2'" 1 
ATOM   6458  C  "C1'" . DA  I 5 19  ? 15.650  -7.203  39.995 1.00 98.70  ? -54  DA  I "C1'" 1 
ATOM   6459  N  N9    . DA  I 5 19  ? 16.639  -8.087  39.379 1.00 98.76  ? -54  DA  I N9    1 
ATOM   6460  C  C8    . DA  I 5 19  ? 16.506  -9.417  39.084 1.00 98.71  ? -54  DA  I C8    1 
ATOM   6461  N  N7    . DA  I 5 19  ? 17.565  -9.948  38.522 1.00 98.66  ? -54  DA  I N7    1 
ATOM   6462  C  C5    . DA  I 5 19  ? 18.455  -8.889  38.439 1.00 99.10  ? -54  DA  I C5    1 
ATOM   6463  C  C6    . DA  I 5 19  ? 19.774  -8.782  37.933 1.00 99.27  ? -54  DA  I C6    1 
ATOM   6464  N  N6    . DA  I 5 19  ? 20.445  -9.809  37.400 1.00 99.26  ? -54  DA  I N6    1 
ATOM   6465  N  N1    . DA  I 5 19  ? 20.382  -7.574  38.003 1.00 99.31  ? -54  DA  I N1    1 
ATOM   6466  C  C2    . DA  I 5 19  ? 19.713  -6.540  38.538 1.00 99.23  ? -54  DA  I C2    1 
ATOM   6467  N  N3    . DA  I 5 19  ? 18.476  -6.518  39.041 1.00 99.05  ? -54  DA  I N3    1 
ATOM   6468  C  C4    . DA  I 5 19  ? 17.897  -7.733  38.960 1.00 98.89  ? -54  DA  I C4    1 
ATOM   6469  P  P     . DT  I 5 20  ? 12.277  -4.351  39.362 1.00 101.45 ? -53  DT  I P     1 
ATOM   6470  O  OP1   . DT  I 5 20  ? 11.172  -3.945  40.260 1.00 101.46 ? -53  DT  I OP1   1 
ATOM   6471  O  OP2   . DT  I 5 20  ? 11.971  -5.173  38.153 1.00 101.27 ? -53  DT  I OP2   1 
ATOM   6472  O  "O5'" . DT  I 5 20  ? 13.049  -3.040  38.845 1.00 103.38 ? -53  DT  I "O5'" 1 
ATOM   6473  C  "C5'" . DT  I 5 20  ? 14.330  -2.655  39.363 1.00 106.74 ? -53  DT  I "C5'" 1 
ATOM   6474  C  "C4'" . DT  I 5 20  ? 15.432  -2.637  38.304 1.00 109.08 ? -53  DT  I "C4'" 1 
ATOM   6475  O  "O4'" . DT  I 5 20  ? 15.956  -3.963  38.025 1.00 109.63 ? -53  DT  I "O4'" 1 
ATOM   6476  C  "C3'" . DT  I 5 20  ? 15.071  -2.031  36.941 1.00 110.50 ? -53  DT  I "C3'" 1 
ATOM   6477  O  "O3'" . DT  I 5 20  ? 15.749  -0.766  36.803 1.00 112.49 ? -53  DT  I "O3'" 1 
ATOM   6478  C  "C2'" . DT  I 5 20  ? 15.544  -3.088  35.928 1.00 110.37 ? -53  DT  I "C2'" 1 
ATOM   6479  C  "C1'" . DT  I 5 20  ? 16.574  -3.850  36.758 1.00 110.34 ? -53  DT  I "C1'" 1 
ATOM   6480  N  N1    . DT  I 5 20  ? 16.982  -5.192  36.192 1.00 110.80 ? -53  DT  I N1    1 
ATOM   6481  C  C2    . DT  I 5 20  ? 18.265  -5.354  35.689 1.00 110.97 ? -53  DT  I C2    1 
ATOM   6482  O  O2    . DT  I 5 20  ? 19.109  -4.473  35.670 1.00 111.07 ? -53  DT  I O2    1 
ATOM   6483  N  N3    . DT  I 5 20  ? 18.539  -6.610  35.196 1.00 111.03 ? -53  DT  I N3    1 
ATOM   6484  C  C4    . DT  I 5 20  ? 17.684  -7.700  35.152 1.00 111.06 ? -53  DT  I C4    1 
ATOM   6485  O  O4    . DT  I 5 20  ? 18.045  -8.779  34.684 1.00 111.10 ? -53  DT  I O4    1 
ATOM   6486  C  C5    . DT  I 5 20  ? 16.357  -7.468  35.692 1.00 111.03 ? -53  DT  I C5    1 
ATOM   6487  C  C7    . DT  I 5 20  ? 15.324  -8.560  35.712 1.00 110.76 ? -53  DT  I C7    1 
ATOM   6488  C  C6    . DT  I 5 20  ? 16.078  -6.244  36.175 1.00 110.89 ? -53  DT  I C6    1 
ATOM   6489  P  P     . DA  I 5 21  ? 15.758  0.109   35.456 1.00 113.99 ? -52  DA  I P     1 
ATOM   6490  O  OP1   . DA  I 5 21  ? 16.111  1.491   35.854 1.00 114.23 ? -52  DA  I OP1   1 
ATOM   6491  O  OP2   . DA  I 5 21  ? 14.505  -0.130  34.699 1.00 114.00 ? -52  DA  I OP2   1 
ATOM   6492  O  "O5'" . DA  I 5 21  ? 16.968  -0.539  34.634 1.00 115.60 ? -52  DA  I "O5'" 1 
ATOM   6493  C  "C5'" . DA  I 5 21  ? 18.316  -0.377  35.071 1.00 118.47 ? -52  DA  I "C5'" 1 
ATOM   6494  C  "C4'" . DA  I 5 21  ? 19.283  -0.561  33.913 1.00 120.70 ? -52  DA  I "C4'" 1 
ATOM   6495  O  "O4'" . DA  I 5 21  ? 19.540  -1.975  33.700 1.00 121.31 ? -52  DA  I "O4'" 1 
ATOM   6496  C  "C3'" . DA  I 5 21  ? 18.797  -0.008  32.574 1.00 122.00 ? -52  DA  I "C3'" 1 
ATOM   6497  O  "O3'" . DA  I 5 21  ? 19.851  0.756   31.982 1.00 123.83 ? -52  DA  I "O3'" 1 
ATOM   6498  C  "C2'" . DA  I 5 21  ? 18.437  -1.262  31.772 1.00 121.90 ? -52  DA  I "C2'" 1 
ATOM   6499  C  "C1'" . DA  I 5 21  ? 19.441  -2.273  32.321 1.00 121.76 ? -52  DA  I "C1'" 1 
ATOM   6500  N  N9    . DA  I 5 21  ? 19.072  -3.687  32.174 1.00 121.86 ? -52  DA  I N9    1 
ATOM   6501  C  C8    . DA  I 5 21  ? 17.909  -4.290  32.579 1.00 121.83 ? -52  DA  I C8    1 
ATOM   6502  N  N7    . DA  I 5 21  ? 17.855  -5.578  32.326 1.00 121.75 ? -52  DA  I N7    1 
ATOM   6503  C  C5    . DA  I 5 21  ? 19.068  -5.845  31.712 1.00 121.75 ? -52  DA  I C5    1 
ATOM   6504  C  C6    . DA  I 5 21  ? 19.637  -7.034  31.196 1.00 121.79 ? -52  DA  I C6    1 
ATOM   6505  N  N6    . DA  I 5 21  ? 19.017  -8.218  31.222 1.00 121.58 ? -52  DA  I N6    1 
ATOM   6506  N  N1    . DA  I 5 21  ? 20.871  -6.960  30.645 1.00 121.91 ? -52  DA  I N1    1 
ATOM   6507  C  C2    . DA  I 5 21  ? 21.496  -5.771  30.611 1.00 121.91 ? -52  DA  I C2    1 
ATOM   6508  N  N3    . DA  I 5 21  ? 21.064  -4.591  31.068 1.00 121.81 ? -52  DA  I N3    1 
ATOM   6509  C  C4    . DA  I 5 21  ? 19.833  -4.692  31.612 1.00 121.77 ? -52  DA  I C4    1 
ATOM   6510  P  P     . DC  I 5 22  ? 19.592  1.888   30.874 1.00 125.35 ? -51  DC  I P     1 
ATOM   6511  O  OP1   . DC  I 5 22  ? 20.127  3.168   31.390 1.00 125.10 ? -51  DC  I OP1   1 
ATOM   6512  O  OP2   . DC  I 5 22  ? 18.187  1.814   30.406 1.00 125.13 ? -51  DC  I OP2   1 
ATOM   6513  O  "O5'" . DC  I 5 22  ? 20.538  1.387   29.688 1.00 126.62 ? -51  DC  I "O5'" 1 
ATOM   6514  C  "C5'" . DC  I 5 22  ? 20.339  0.090   29.160 1.00 128.63 ? -51  DC  I "C5'" 1 
ATOM   6515  C  "C4'" . DC  I 5 22  ? 21.278  -0.180  28.005 1.00 130.35 ? -51  DC  I "C4'" 1 
ATOM   6516  O  "O4'" . DC  I 5 22  ? 21.515  -1.607  27.917 1.00 130.89 ? -51  DC  I "O4'" 1 
ATOM   6517  C  "C3'" . DC  I 5 22  ? 20.734  0.250   26.648 1.00 131.32 ? -51  DC  I "C3'" 1 
ATOM   6518  O  "O3'" . DC  I 5 22  ? 21.826  0.815   25.879 1.00 132.36 ? -51  DC  I "O3'" 1 
ATOM   6519  C  "C2'" . DC  I 5 22  ? 20.072  -1.024  26.109 1.00 131.32 ? -51  DC  I "C2'" 1 
ATOM   6520  C  "C1'" . DC  I 5 22  ? 20.813  -2.161  26.818 1.00 131.39 ? -51  DC  I "C1'" 1 
ATOM   6521  N  N1    . DC  I 5 22  ? 19.950  -3.286  27.336 1.00 131.79 ? -51  DC  I N1    1 
ATOM   6522  C  C2    . DC  I 5 22  ? 20.396  -4.623  27.217 1.00 131.96 ? -51  DC  I C2    1 
ATOM   6523  O  O2    . DC  I 5 22  ? 21.492  -4.872  26.684 1.00 131.92 ? -51  DC  I O2    1 
ATOM   6524  N  N3    . DC  I 5 22  ? 19.604  -5.627  27.695 1.00 132.03 ? -51  DC  I N3    1 
ATOM   6525  C  C4    . DC  I 5 22  ? 18.424  -5.342  28.267 1.00 132.11 ? -51  DC  I C4    1 
ATOM   6526  N  N4    . DC  I 5 22  ? 17.687  -6.367  28.721 1.00 131.98 ? -51  DC  I N4    1 
ATOM   6527  C  C5    . DC  I 5 22  ? 17.952  -3.995  28.397 1.00 131.92 ? -51  DC  I C5    1 
ATOM   6528  C  C6    . DC  I 5 22  ? 18.740  -3.012  27.926 1.00 131.74 ? -51  DC  I C6    1 
ATOM   6529  P  P     . DT  I 5 23  ? 22.332  0.340   24.430 1.00 133.38 ? -50  DT  I P     1 
ATOM   6530  O  OP1   . DT  I 5 23  ? 23.410  1.280   24.042 1.00 133.44 ? -50  DT  I OP1   1 
ATOM   6531  O  OP2   . DT  I 5 23  ? 21.157  0.187   23.537 1.00 133.44 ? -50  DT  I OP2   1 
ATOM   6532  O  "O5'" . DT  I 5 23  ? 22.966  -1.111  24.705 1.00 133.65 ? -50  DT  I "O5'" 1 
ATOM   6533  C  "C5'" . DT  I 5 23  ? 24.152  -1.562  24.055 1.00 134.18 ? -50  DT  I "C5'" 1 
ATOM   6534  C  "C4'" . DT  I 5 23  ? 23.842  -2.624  23.012 1.00 134.73 ? -50  DT  I "C4'" 1 
ATOM   6535  O  "O4'" . DT  I 5 23  ? 22.781  -3.502  23.476 1.00 134.65 ? -50  DT  I "O4'" 1 
ATOM   6536  C  "C3'" . DT  I 5 23  ? 23.402  -2.082  21.652 1.00 135.20 ? -50  DT  I "C3'" 1 
ATOM   6537  O  "O3'" . DT  I 5 23  ? 24.189  -2.715  20.631 1.00 136.15 ? -50  DT  I "O3'" 1 
ATOM   6538  C  "C2'" . DT  I 5 23  ? 21.913  -2.432  21.576 1.00 134.95 ? -50  DT  I "C2'" 1 
ATOM   6539  C  "C1'" . DT  I 5 23  ? 21.818  -3.678  22.453 1.00 134.59 ? -50  DT  I "C1'" 1 
ATOM   6540  N  N1    . DT  I 5 23  ? 20.471  -3.924  23.092 1.00 134.36 ? -50  DT  I N1    1 
ATOM   6541  C  C2    . DT  I 5 23  ? 20.208  -5.155  23.673 1.00 134.21 ? -50  DT  I C2    1 
ATOM   6542  O  O2    . DT  I 5 23  ? 21.007  -6.077  23.705 1.00 134.18 ? -50  DT  I O2    1 
ATOM   6543  N  N3    . DT  I 5 23  ? 18.953  -5.275  24.228 1.00 134.03 ? -50  DT  I N3    1 
ATOM   6544  C  C4    . DT  I 5 23  ? 17.952  -4.314  24.266 1.00 133.97 ? -50  DT  I C4    1 
ATOM   6545  O  O4    . DT  I 5 23  ? 16.864  -4.540  24.793 1.00 133.68 ? -50  DT  I O4    1 
ATOM   6546  C  C5    . DT  I 5 23  ? 18.287  -3.050  23.642 1.00 134.05 ? -50  DT  I C5    1 
ATOM   6547  C  C7    . DT  I 5 23  ? 17.302  -1.915  23.603 1.00 133.99 ? -50  DT  I C7    1 
ATOM   6548  C  C6    . DT  I 5 23  ? 19.509  -2.923  23.096 1.00 134.26 ? -50  DT  I C6    1 
ATOM   6549  P  P     . DA  I 5 24  ? 23.942  -2.515  19.052 1.00 136.85 ? -49  DA  I P     1 
ATOM   6550  O  OP1   . DA  I 5 24  ? 25.254  -2.706  18.383 1.00 136.76 ? -49  DA  I OP1   1 
ATOM   6551  O  OP2   . DA  I 5 24  ? 23.185  -1.257  18.824 1.00 136.77 ? -49  DA  I OP2   1 
ATOM   6552  O  "O5'" . DA  I 5 24  ? 22.978  -3.747  18.682 1.00 137.09 ? -49  DA  I "O5'" 1 
ATOM   6553  C  "C5'" . DA  I 5 24  ? 23.422  -5.099  18.861 1.00 137.55 ? -49  DA  I "C5'" 1 
ATOM   6554  C  "C4'" . DA  I 5 24  ? 22.313  -6.098  18.563 1.00 137.96 ? -49  DA  I "C4'" 1 
ATOM   6555  O  "O4'" . DA  I 5 24  ? 21.276  -6.017  19.586 1.00 138.28 ? -49  DA  I "O4'" 1 
ATOM   6556  C  "C3'" . DA  I 5 24  ? 21.615  -5.923  17.211 1.00 137.96 ? -49  DA  I "C3'" 1 
ATOM   6557  O  "O3'" . DA  I 5 24  ? 21.701  -7.141  16.454 1.00 137.50 ? -49  DA  I "O3'" 1 
ATOM   6558  C  "C2'" . DA  I 5 24  ? 20.170  -5.573  17.582 1.00 138.27 ? -49  DA  I "C2'" 1 
ATOM   6559  C  "C1'" . DA  I 5 24  ? 20.032  -6.239  18.950 1.00 138.52 ? -49  DA  I "C1'" 1 
ATOM   6560  N  N9    . DA  I 5 24  ? 18.930  -5.743  19.787 1.00 138.79 ? -49  DA  I N9    1 
ATOM   6561  C  C8    . DA  I 5 24  ? 18.538  -4.443  19.977 1.00 138.83 ? -49  DA  I C8    1 
ATOM   6562  N  N7    . DA  I 5 24  ? 17.507  -4.306  20.785 1.00 138.93 ? -49  DA  I N7    1 
ATOM   6563  C  C5    . DA  I 5 24  ? 17.195  -5.605  21.158 1.00 139.05 ? -49  DA  I C5    1 
ATOM   6564  C  C6    . DA  I 5 24  ? 16.195  -6.150  22.008 1.00 139.12 ? -49  DA  I C6    1 
ATOM   6565  N  N6    . DA  I 5 24  ? 15.287  -5.413  22.664 1.00 139.07 ? -49  DA  I N6    1 
ATOM   6566  N  N1    . DA  I 5 24  ? 16.162  -7.495  22.162 1.00 139.18 ? -49  DA  I N1    1 
ATOM   6567  C  C2    . DA  I 5 24  ? 17.068  -8.243  21.506 1.00 139.23 ? -49  DA  I C2    1 
ATOM   6568  N  N3    . DA  I 5 24  ? 18.049  -7.845  20.686 1.00 139.10 ? -49  DA  I N3    1 
ATOM   6569  C  C4    . DA  I 5 24  ? 18.063  -6.503  20.549 1.00 138.95 ? -49  DA  I C4    1 
ATOM   6570  P  P     . DC  I 5 25  ? 21.414  -7.189  14.875 1.00 136.86 ? -48  DC  I P     1 
ATOM   6571  O  OP1   . DC  I 5 25  ? 22.455  -8.047  14.263 1.00 136.77 ? -48  DC  I OP1   1 
ATOM   6572  O  OP2   . DC  I 5 25  ? 21.218  -5.805  14.381 1.00 136.86 ? -48  DC  I OP2   1 
ATOM   6573  O  "O5'" . DC  I 5 25  ? 19.997  -7.934  14.789 1.00 136.19 ? -48  DC  I "O5'" 1 
ATOM   6574  C  "C5'" . DC  I 5 25  ? 19.871  -9.308  15.148 1.00 135.05 ? -48  DC  I "C5'" 1 
ATOM   6575  C  "C4'" . DC  I 5 25  ? 18.458  -9.632  15.601 1.00 134.15 ? -48  DC  I "C4'" 1 
ATOM   6576  O  "O4'" . DC  I 5 25  ? 18.001  -8.681  16.606 1.00 133.99 ? -48  DC  I "O4'" 1 
ATOM   6577  C  "C3'" . DC  I 5 25  ? 17.391  -9.627  14.505 1.00 133.46 ? -48  DC  I "C3'" 1 
ATOM   6578  O  "O3'" . DC  I 5 25  ? 16.773  -10.915 14.439 1.00 132.47 ? -48  DC  I "O3'" 1 
ATOM   6579  C  "C2'" . DC  I 5 25  ? 16.395  -8.559  14.964 1.00 133.65 ? -48  DC  I "C2'" 1 
ATOM   6580  C  "C1'" . DC  I 5 25  ? 16.596  -8.654  16.475 1.00 133.94 ? -48  DC  I "C1'" 1 
ATOM   6581  N  N1    . DC  I 5 25  ? 15.956  -7.587  17.333 1.00 133.95 ? -48  DC  I N1    1 
ATOM   6582  C  C2    . DC  I 5 25  ? 14.970  -7.945  18.277 1.00 133.84 ? -48  DC  I C2    1 
ATOM   6583  O  O2    . DC  I 5 25  ? 14.627  -9.128  18.405 1.00 133.76 ? -48  DC  I O2    1 
ATOM   6584  N  N3    . DC  I 5 25  ? 14.403  -6.975  19.041 1.00 133.88 ? -48  DC  I N3    1 
ATOM   6585  C  C4    . DC  I 5 25  ? 14.778  -5.699  18.901 1.00 134.03 ? -48  DC  I C4    1 
ATOM   6586  N  N4    . DC  I 5 25  ? 14.187  -4.784  19.679 1.00 133.90 ? -48  DC  I N4    1 
ATOM   6587  C  C5    . DC  I 5 25  ? 15.774  -5.311  17.950 1.00 134.05 ? -48  DC  I C5    1 
ATOM   6588  C  C6    . DC  I 5 25  ? 16.330  -6.275  17.199 1.00 133.96 ? -48  DC  I C6    1 
ATOM   6589  P  P     . DC  I 5 26  ? 16.180  -11.471 13.056 1.00 131.57 ? -47  DC  I P     1 
ATOM   6590  O  OP1   . DC  I 5 26  ? 17.333  -11.975 12.277 1.00 131.35 ? -47  DC  I OP1   1 
ATOM   6591  O  OP2   . DC  I 5 26  ? 15.306  -10.424 12.475 1.00 131.59 ? -47  DC  I OP2   1 
ATOM   6592  O  "O5'" . DC  I 5 26  ? 15.250  -12.722 13.452 1.00 130.47 ? -47  DC  I "O5'" 1 
ATOM   6593  C  "C5'" . DC  I 5 26  ? 14.615  -12.844 14.731 1.00 128.72 ? -47  DC  I "C5'" 1 
ATOM   6594  C  "C4'" . DC  I 5 26  ? 13.148  -12.428 14.722 1.00 127.40 ? -47  DC  I "C4'" 1 
ATOM   6595  O  "O4'" . DC  I 5 26  ? 13.008  -11.200 15.479 1.00 127.02 ? -47  DC  I "O4'" 1 
ATOM   6596  C  "C3'" . DC  I 5 26  ? 12.503  -12.166 13.356 1.00 126.62 ? -47  DC  I "C3'" 1 
ATOM   6597  O  "O3'" . DC  I 5 26  ? 11.333  -12.975 13.206 1.00 125.64 ? -47  DC  I "O3'" 1 
ATOM   6598  C  "C2'" . DC  I 5 26  ? 12.152  -10.674 13.370 1.00 126.56 ? -47  DC  I "C2'" 1 
ATOM   6599  C  "C1'" . DC  I 5 26  ? 12.001  -10.414 14.869 1.00 126.61 ? -47  DC  I "C1'" 1 
ATOM   6600  N  N1    . DC  I 5 26  ? 12.180  -8.993  15.327 1.00 126.40 ? -47  DC  I N1    1 
ATOM   6601  C  C2    . DC  I 5 26  ? 11.792  -8.648  16.635 1.00 126.12 ? -47  DC  I C2    1 
ATOM   6602  O  O2    . DC  I 5 26  ? 11.313  -9.512  17.380 1.00 126.06 ? -47  DC  I O2    1 
ATOM   6603  N  N3    . DC  I 5 26  ? 11.951  -7.368  17.061 1.00 126.07 ? -47  DC  I N3    1 
ATOM   6604  C  C4    . DC  I 5 26  ? 12.475  -6.452  16.239 1.00 126.19 ? -47  DC  I C4    1 
ATOM   6605  N  N4    . DC  I 5 26  ? 12.607  -5.207  16.705 1.00 126.12 ? -47  DC  I N4    1 
ATOM   6606  C  C5    . DC  I 5 26  ? 12.878  -6.774  14.902 1.00 126.29 ? -47  DC  I C5    1 
ATOM   6607  C  C6    . DC  I 5 26  ? 12.716  -8.042  14.495 1.00 126.35 ? -47  DC  I C6    1 
ATOM   6608  P  P     . DA  I 5 27  ? 11.319  -14.220 12.193 1.00 124.67 ? -46  DA  I P     1 
ATOM   6609  O  OP1   . DA  I 5 27  ? 12.639  -14.885 12.272 1.00 124.73 ? -46  DA  I OP1   1 
ATOM   6610  O  OP2   . DA  I 5 27  ? 10.803  -13.736 10.890 1.00 124.51 ? -46  DA  I OP2   1 
ATOM   6611  O  "O5'" . DA  I 5 27  ? 10.219  -15.208 12.811 1.00 123.72 ? -46  DA  I "O5'" 1 
ATOM   6612  C  "C5'" . DA  I 5 27  ? 10.191  -15.509 14.210 1.00 121.89 ? -46  DA  I "C5'" 1 
ATOM   6613  C  "C4'" . DA  I 5 27  ? 8.884   -15.052 14.843 1.00 120.35 ? -46  DA  I "C4'" 1 
ATOM   6614  O  "O4'" . DA  I 5 27  ? 8.913   -13.622 15.085 1.00 119.99 ? -46  DA  I "O4'" 1 
ATOM   6615  C  "C3'" . DA  I 5 27  ? 7.620   -15.325 14.035 1.00 119.49 ? -46  DA  I "C3'" 1 
ATOM   6616  O  "O3'" . DA  I 5 27  ? 6.634   -15.806 14.925 1.00 118.32 ? -46  DA  I "O3'" 1 
ATOM   6617  C  "C2'" . DA  I 5 27  ? 7.244   -13.961 13.454 1.00 119.59 ? -46  DA  I "C2'" 1 
ATOM   6618  C  "C1'" . DA  I 5 27  ? 7.772   -13.002 14.517 1.00 119.83 ? -46  DA  I "C1'" 1 
ATOM   6619  N  N9    . DA  I 5 27  ? 8.189   -11.691 14.016 1.00 119.94 ? -46  DA  I N9    1 
ATOM   6620  C  C8    . DA  I 5 27  ? 8.565   -11.362 12.741 1.00 120.00 ? -46  DA  I C8    1 
ATOM   6621  N  N7    . DA  I 5 27  ? 8.892   -10.101 12.589 1.00 119.98 ? -46  DA  I N7    1 
ATOM   6622  C  C5    . DA  I 5 27  ? 8.725   -9.563  13.851 1.00 119.86 ? -46  DA  I C5    1 
ATOM   6623  C  C6    . DA  I 5 27  ? 8.913   -8.263  14.362 1.00 119.90 ? -46  DA  I C6    1 
ATOM   6624  N  N6    . DA  I 5 27  ? 9.325   -7.232  13.620 1.00 120.11 ? -46  DA  I N6    1 
ATOM   6625  N  N1    . DA  I 5 27  ? 8.655   -8.056  15.672 1.00 120.05 ? -46  DA  I N1    1 
ATOM   6626  C  C2    . DA  I 5 27  ? 8.237   -9.089  16.418 1.00 120.06 ? -46  DA  I C2    1 
ATOM   6627  N  N3    . DA  I 5 27  ? 8.028   -10.353 16.050 1.00 119.97 ? -46  DA  I N3    1 
ATOM   6628  C  C4    . DA  I 5 27  ? 8.293   -10.528 14.743 1.00 119.89 ? -46  DA  I C4    1 
ATOM   6629  P  P     . DA  I 5 28  ? 5.297   -16.522 14.417 1.00 117.62 ? -45  DA  I P     1 
ATOM   6630  O  OP1   . DA  I 5 28  ? 5.318   -17.894 14.969 1.00 117.60 ? -45  DA  I OP1   1 
ATOM   6631  O  OP2   . DA  I 5 28  ? 5.120   -16.308 12.960 1.00 117.31 ? -45  DA  I OP2   1 
ATOM   6632  O  "O5'" . DA  I 5 28  ? 4.155   -15.686 15.166 1.00 116.76 ? -45  DA  I "O5'" 1 
ATOM   6633  C  "C5'" . DA  I 5 28  ? 4.367   -15.176 16.486 1.00 114.84 ? -45  DA  I "C5'" 1 
ATOM   6634  C  "C4'" . DA  I 5 28  ? 3.864   -13.746 16.626 1.00 113.24 ? -45  DA  I "C4'" 1 
ATOM   6635  O  "O4'" . DA  I 5 28  ? 4.647   -12.843 15.797 1.00 112.86 ? -45  DA  I "O4'" 1 
ATOM   6636  C  "C3'" . DA  I 5 28  ? 2.405   -13.530 16.219 1.00 112.24 ? -45  DA  I "C3'" 1 
ATOM   6637  O  "O3'" . DA  I 5 28  ? 1.718   -12.830 17.242 1.00 110.52 ? -45  DA  I "O3'" 1 
ATOM   6638  C  "C2'" . DA  I 5 28  ? 2.506   -12.674 14.960 1.00 112.48 ? -45  DA  I "C2'" 1 
ATOM   6639  C  "C1'" . DA  I 5 28  ? 3.745   -11.864 15.320 1.00 112.75 ? -45  DA  I "C1'" 1 
ATOM   6640  N  N9    . DA  I 5 28  ? 4.310   -11.079 14.219 1.00 112.69 ? -45  DA  I N9    1 
ATOM   6641  C  C8    . DA  I 5 28  ? 4.439   -11.455 12.908 1.00 112.76 ? -45  DA  I C8    1 
ATOM   6642  N  N7    . DA  I 5 28  ? 4.977   -10.536 12.140 1.00 113.00 ? -45  DA  I N7    1 
ATOM   6643  C  C5    . DA  I 5 28  ? 5.218   -9.478  13.003 1.00 112.88 ? -45  DA  I C5    1 
ATOM   6644  C  C6    . DA  I 5 28  ? 5.779   -8.194  12.811 1.00 112.74 ? -45  DA  I C6    1 
ATOM   6645  N  N6    . DA  I 5 28  ? 6.215   -7.747  11.627 1.00 112.77 ? -45  DA  I N6    1 
ATOM   6646  N  N1    . DA  I 5 28  ? 5.876   -7.378  13.886 1.00 112.64 ? -45  DA  I N1    1 
ATOM   6647  C  C2    . DA  I 5 28  ? 5.439   -7.820  15.075 1.00 112.44 ? -45  DA  I C2    1 
ATOM   6648  N  N3    . DA  I 5 28  ? 4.895   -9.002  15.377 1.00 112.57 ? -45  DA  I N3    1 
ATOM   6649  C  C4    . DA  I 5 28  ? 4.810   -9.795  14.291 1.00 112.72 ? -45  DA  I C4    1 
ATOM   6650  P  P     . DA  I 5 29  ? 0.486   -13.520 17.976 1.00 109.08 ? -44  DA  I P     1 
ATOM   6651  O  OP1   . DA  I 5 29  ? 1.051   -14.467 18.961 1.00 109.11 ? -44  DA  I OP1   1 
ATOM   6652  O  OP2   . DA  I 5 29  ? -0.476  -13.984 16.950 1.00 109.20 ? -44  DA  I OP2   1 
ATOM   6653  O  "O5'" . DA  I 5 29  ? -0.178  -12.300 18.758 1.00 108.57 ? -44  DA  I "O5'" 1 
ATOM   6654  C  "C5'" . DA  I 5 29  ? -0.747  -11.239 18.020 1.00 107.72 ? -44  DA  I "C5'" 1 
ATOM   6655  C  "C4'" . DA  I 5 29  ? 0.025   -9.962  18.277 1.00 106.89 ? -44  DA  I "C4'" 1 
ATOM   6656  O  "O4'" . DA  I 5 29  ? 1.081   -9.834  17.293 1.00 107.04 ? -44  DA  I "O4'" 1 
ATOM   6657  C  "C3'" . DA  I 5 29  ? -0.851  -8.724  18.172 1.00 106.57 ? -44  DA  I "C3'" 1 
ATOM   6658  O  "O3'" . DA  I 5 29  ? -0.751  -7.961  19.358 1.00 105.67 ? -44  DA  I "O3'" 1 
ATOM   6659  C  "C2'" . DA  I 5 29  ? -0.323  -7.949  16.969 1.00 107.21 ? -44  DA  I "C2'" 1 
ATOM   6660  C  "C1'" . DA  I 5 29  ? 1.038   -8.563  16.671 1.00 107.32 ? -44  DA  I "C1'" 1 
ATOM   6661  N  N9    . DA  I 5 29  ? 1.287   -8.699  15.232 1.00 107.61 ? -44  DA  I N9    1 
ATOM   6662  C  C8    . DA  I 5 29  ? 0.943   -9.752  14.426 1.00 107.61 ? -44  DA  I C8    1 
ATOM   6663  N  N7    . DA  I 5 29  ? 1.293   -9.605  13.171 1.00 107.52 ? -44  DA  I N7    1 
ATOM   6664  C  C5    . DA  I 5 29  ? 1.901   -8.361  13.144 1.00 107.63 ? -44  DA  I C5    1 
ATOM   6665  C  C6    . DA  I 5 29  ? 2.494   -7.611  12.104 1.00 107.66 ? -44  DA  I C6    1 
ATOM   6666  N  N6    . DA  I 5 29  ? 2.561   -8.037  10.841 1.00 107.84 ? -44  DA  I N6    1 
ATOM   6667  N  N1    . DA  I 5 29  ? 3.013   -6.399  12.408 1.00 107.82 ? -44  DA  I N1    1 
ATOM   6668  C  C2    . DA  I 5 29  ? 2.942   -5.968  13.676 1.00 107.77 ? -44  DA  I C2    1 
ATOM   6669  N  N3    . DA  I 5 29  ? 2.414   -6.586  14.737 1.00 107.62 ? -44  DA  I N3    1 
ATOM   6670  C  C4    . DA  I 5 29  ? 1.906   -7.787  14.404 1.00 107.53 ? -44  DA  I C4    1 
ATOM   6671  P  P     . DA  I 5 30  ? -2.042  -7.214  19.927 1.00 104.89 ? -43  DA  I P     1 
ATOM   6672  O  OP1   . DA  I 5 30  ? -1.741  -6.866  21.335 1.00 104.79 ? -43  DA  I OP1   1 
ATOM   6673  O  OP2   . DA  I 5 30  ? -3.236  -8.019  19.575 1.00 104.91 ? -43  DA  I OP2   1 
ATOM   6674  O  "O5'" . DA  I 5 30  ? -2.147  -5.887  19.050 1.00 104.48 ? -43  DA  I "O5'" 1 
ATOM   6675  C  "C5'" . DA  I 5 30  ? -1.141  -4.891  19.113 1.00 103.99 ? -43  DA  I "C5'" 1 
ATOM   6676  C  "C4'" . DA  I 5 30  ? -1.286  -3.960  17.929 1.00 103.37 ? -43  DA  I "C4'" 1 
ATOM   6677  O  "O4'" . DA  I 5 30  ? -0.797  -4.639  16.754 1.00 102.89 ? -43  DA  I "O4'" 1 
ATOM   6678  C  "C3'" . DA  I 5 30  ? -2.722  -3.546  17.624 1.00 103.23 ? -43  DA  I "C3'" 1 
ATOM   6679  O  "O3'" . DA  I 5 30  ? -2.870  -2.180  17.987 1.00 103.61 ? -43  DA  I "O3'" 1 
ATOM   6680  C  "C2'" . DA  I 5 30  ? -2.893  -3.821  16.127 1.00 102.99 ? -43  DA  I "C2'" 1 
ATOM   6681  C  "C1'" . DA  I 5 30  ? -1.480  -4.129  15.638 1.00 102.65 ? -43  DA  I "C1'" 1 
ATOM   6682  N  N9    . DA  I 5 30  ? -1.405  -5.129  14.570 1.00 102.19 ? -43  DA  I N9    1 
ATOM   6683  C  C8    . DA  I 5 30  ? -1.984  -6.369  14.556 1.00 101.97 ? -43  DA  I C8    1 
ATOM   6684  N  N7    . DA  I 5 30  ? -1.744  -7.056  13.466 1.00 101.75 ? -43  DA  I N7    1 
ATOM   6685  C  C5    . DA  I 5 30  ? -0.955  -6.210  12.707 1.00 101.46 ? -43  DA  I C5    1 
ATOM   6686  C  C6    . DA  I 5 30  ? -0.367  -6.344  11.432 1.00 101.13 ? -43  DA  I C6    1 
ATOM   6687  N  N6    . DA  I 5 30  ? -0.491  -7.436  10.677 1.00 101.16 ? -43  DA  I N6    1 
ATOM   6688  N  N1    . DA  I 5 30  ? 0.368   -5.315  10.959 1.00 101.17 ? -43  DA  I N1    1 
ATOM   6689  C  C2    . DA  I 5 30  ? 0.502   -4.214  11.712 1.00 101.32 ? -43  DA  I C2    1 
ATOM   6690  N  N3    . DA  I 5 30  ? -0.006  -3.970  12.922 1.00 101.63 ? -43  DA  I N3    1 
ATOM   6691  C  C4    . DA  I 5 30  ? -0.731  -5.017  13.371 1.00 101.79 ? -43  DA  I C4    1 
ATOM   6692  P  P     . DG  I 5 31  ? -4.159  -1.299  17.640 1.00 104.39 ? -42  DG  I P     1 
ATOM   6693  O  OP1   . DG  I 5 31  ? -4.273  -0.275  18.702 1.00 104.85 ? -42  DG  I OP1   1 
ATOM   6694  O  OP2   . DG  I 5 31  ? -5.316  -2.182  17.355 1.00 104.52 ? -42  DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  I 5 31  ? -3.712  -0.597  16.272 1.00 105.86 ? -42  DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  I 5 31  ? -2.414  0.006   16.135 1.00 107.82 ? -42  DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  I 5 31  ? -2.084  0.298   14.673 1.00 109.29 ? -42  DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  I 5 31  ? -1.863  -0.956  13.974 1.00 109.41 ? -42  DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  I 5 31  ? -3.196  1.033   13.917 1.00 110.28 ? -42  DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  I 5 31  ? -2.773  2.338   13.511 1.00 111.49 ? -42  DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  I 5 31  ? -3.532  0.143   12.718 1.00 110.16 ? -42  DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  I 5 31  ? -2.369  -0.846  12.656 1.00 109.94 ? -42  DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  I 5 31  ? -2.795  -2.166  12.195 1.00 110.21 ? -42  DG  I N9    1 
ATOM   6704  C  C8    . DG  I 5 31  ? -3.477  -3.114  12.918 1.00 110.26 ? -42  DG  I C8    1 
ATOM   6705  N  N7    . DG  I 5 31  ? -3.730  -4.205  12.256 1.00 110.40 ? -42  DG  I N7    1 
ATOM   6706  C  C5    . DG  I 5 31  ? -3.189  -3.964  11.001 1.00 110.72 ? -42  DG  I C5    1 
ATOM   6707  C  C6    . DG  I 5 31  ? -3.160  -4.790  9.850  1.00 110.92 ? -42  DG  I C6    1 
ATOM   6708  O  O6    . DG  I 5 31  ? -3.625  -5.931  9.722  1.00 111.04 ? -42  DG  I O6    1 
ATOM   6709  N  N1    . DG  I 5 31  ? -2.512  -4.175  8.776  1.00 111.16 ? -42  DG  I N1    1 
ATOM   6710  C  C2    . DG  I 5 31  ? -1.961  -2.913  8.811  1.00 111.18 ? -42  DG  I C2    1 
ATOM   6711  N  N2    . DG  I 5 31  ? -1.376  -2.483  7.681  1.00 111.23 ? -42  DG  I N2    1 
ATOM   6712  N  N3    . DG  I 5 31  ? -1.983  -2.128  9.886  1.00 111.03 ? -42  DG  I N3    1 
ATOM   6713  C  C4    . DG  I 5 31  ? -2.610  -2.713  10.943 1.00 110.62 ? -42  DG  I C4    1 
ATOM   6714  P  P     . DT  I 5 32  ? -3.859  3.399   12.993 1.00 112.59 ? -41  DT  I P     1 
ATOM   6715  O  OP1   . DT  I 5 32  ? -3.359  4.752   13.314 1.00 112.55 ? -41  DT  I OP1   1 
ATOM   6716  O  OP2   . DT  I 5 32  ? -5.195  2.981   13.475 1.00 112.41 ? -41  DT  I OP2   1 
ATOM   6717  O  "O5'" . DT  I 5 32  ? -3.849  3.183   11.406 1.00 114.11 ? -41  DT  I "O5'" 1 
ATOM   6718  C  "C5'" . DT  I 5 32  ? -2.640  3.241   10.639 1.00 116.09 ? -41  DT  I "C5'" 1 
ATOM   6719  C  "C4'" . DT  I 5 32  ? -2.880  2.731   9.225  1.00 117.62 ? -41  DT  I "C4'" 1 
ATOM   6720  O  "O4'" . DT  I 5 32  ? -3.123  1.305   9.275  1.00 117.74 ? -41  DT  I "O4'" 1 
ATOM   6721  C  "C3'" . DT  I 5 32  ? -4.095  3.339   8.521  1.00 118.63 ? -41  DT  I "C3'" 1 
ATOM   6722  O  "O3'" . DT  I 5 32  ? -3.678  4.185   7.446  1.00 120.19 ? -41  DT  I "O3'" 1 
ATOM   6723  C  "C2'" . DT  I 5 32  ? -4.923  2.148   8.020  1.00 118.24 ? -41  DT  I "C2'" 1 
ATOM   6724  C  "C1'" . DT  I 5 32  ? -3.989  0.959   8.213  1.00 117.93 ? -41  DT  I "C1'" 1 
ATOM   6725  N  N1    . DT  I 5 32  ? -4.694  -0.317  8.556  1.00 117.90 ? -41  DT  I N1    1 
ATOM   6726  C  C2    . DT  I 5 32  ? -4.610  -1.394  7.691  1.00 117.93 ? -41  DT  I C2    1 
ATOM   6727  O  O2    . DT  I 5 32  ? -3.990  -1.377  6.642  1.00 118.27 ? -41  DT  I O2    1 
ATOM   6728  N  N3    . DT  I 5 32  ? -5.290  -2.514  8.102  1.00 117.95 ? -41  DT  I N3    1 
ATOM   6729  C  C4    . DT  I 5 32  ? -6.030  -2.666  9.265  1.00 117.89 ? -41  DT  I C4    1 
ATOM   6730  O  O4    . DT  I 5 32  ? -6.600  -3.717  9.537  1.00 117.78 ? -41  DT  I O4    1 
ATOM   6731  C  C5    . DT  I 5 32  ? -6.079  -1.504  10.126 1.00 117.98 ? -41  DT  I C5    1 
ATOM   6732  C  C7    . DT  I 5 32  ? -6.848  -1.534  11.417 1.00 117.99 ? -41  DT  I C7    1 
ATOM   6733  C  C6    . DT  I 5 32  ? -5.418  -0.403  9.734  1.00 117.99 ? -41  DT  I C6    1 
ATOM   6734  P  P     . DG  I 5 33  ? -4.730  5.196   6.775  1.00 121.84 ? -40  DG  I P     1 
ATOM   6735  O  OP1   . DG  I 5 33  ? -3.938  6.269   6.110  1.00 121.83 ? -40  DG  I OP1   1 
ATOM   6736  O  OP2   . DG  I 5 33  ? -5.759  5.571   7.783  1.00 121.64 ? -40  DG  I OP2   1 
ATOM   6737  O  "O5'" . DG  I 5 33  ? -5.447  4.273   5.672  1.00 122.86 ? -40  DG  I "O5'" 1 
ATOM   6738  C  "C5'" . DG  I 5 33  ? -4.731  3.769   4.536  1.00 124.17 ? -40  DG  I "C5'" 1 
ATOM   6739  C  "C4'" . DG  I 5 33  ? -5.605  2.848   3.694  1.00 125.14 ? -40  DG  I "C4'" 1 
ATOM   6740  O  "O4'" . DG  I 5 33  ? -5.732  1.571   4.372  1.00 125.05 ? -40  DG  I "O4'" 1 
ATOM   6741  C  "C3'" . DG  I 5 33  ? -7.030  3.348   3.432  1.00 125.89 ? -40  DG  I "C3'" 1 
ATOM   6742  O  "O3'" . DG  I 5 33  ? -7.305  3.434   2.030  1.00 127.13 ? -40  DG  I "O3'" 1 
ATOM   6743  C  "C2'" . DG  I 5 33  ? -7.924  2.311   4.109  1.00 125.59 ? -40  DG  I "C2'" 1 
ATOM   6744  C  "C1'" . DG  I 5 33  ? -7.033  1.077   4.141  1.00 125.11 ? -40  DG  I "C1'" 1 
ATOM   6745  N  N9    . DG  I 5 33  ? -7.418  0.133   5.190  1.00 124.74 ? -40  DG  I N9    1 
ATOM   6746  C  C8    . DG  I 5 33  ? -7.606  0.399   6.526  1.00 124.52 ? -40  DG  I C8    1 
ATOM   6747  N  N7    . DG  I 5 33  ? -7.959  -0.644  7.223  1.00 124.36 ? -40  DG  I N7    1 
ATOM   6748  C  C5    . DG  I 5 33  ? -8.013  -1.670  6.290  1.00 124.40 ? -40  DG  I C5    1 
ATOM   6749  C  C6    . DG  I 5 33  ? -8.342  -3.040  6.452  1.00 124.32 ? -40  DG  I C6    1 
ATOM   6750  O  O6    . DG  I 5 33  ? -8.660  -3.631  7.490  1.00 124.22 ? -40  DG  I O6    1 
ATOM   6751  N  N1    . DG  I 5 33  ? -8.279  -3.746  5.251  1.00 124.37 ? -40  DG  I N1    1 
ATOM   6752  C  C2    . DG  I 5 33  ? -7.939  -3.190  4.038  1.00 124.40 ? -40  DG  I C2    1 
ATOM   6753  N  N2    . DG  I 5 33  ? -7.929  -4.016  2.985  1.00 124.56 ? -40  DG  I N2    1 
ATOM   6754  N  N3    . DG  I 5 33  ? -7.630  -1.909  3.871  1.00 124.51 ? -40  DG  I N3    1 
ATOM   6755  C  C4    . DG  I 5 33  ? -7.687  -1.208  5.033  1.00 124.54 ? -40  DG  I C4    1 
ATOM   6756  P  P     . DT  I 5 34  ? -8.629  4.154   1.466  1.00 128.26 ? -39  DT  I P     1 
ATOM   6757  O  OP1   . DT  I 5 34  ? -8.198  5.129   0.439  1.00 128.39 ? -39  DT  I OP1   1 
ATOM   6758  O  OP2   . DT  I 5 34  ? -9.489  4.619   2.585  1.00 128.31 ? -39  DT  I OP2   1 
ATOM   6759  O  "O5'" . DT  I 5 34  ? -9.381  2.935   0.749  1.00 128.69 ? -39  DT  I "O5'" 1 
ATOM   6760  C  "C5'" . DT  I 5 34  ? -8.631  2.058   -0.177 1.00 129.43 ? -39  DT  I "C5'" 1 
ATOM   6761  C  "C4'" . DT  I 5 34  ? -9.424  0.726   -0.280 1.00 129.81 ? -39  DT  I "C4'" 1 
ATOM   6762  O  "O4'" . DT  I 5 34  ? -9.365  0.039   0.999  1.00 130.10 ? -39  DT  I "O4'" 1 
ATOM   6763  C  "C3'" . DT  I 5 34  ? -10.913 0.913   -0.618 1.00 130.02 ? -39  DT  I "C3'" 1 
ATOM   6764  O  "O3'" . DT  I 5 34  ? -11.294 0.170   -1.781 1.00 129.65 ? -39  DT  I "O3'" 1 
ATOM   6765  C  "C2'" . DT  I 5 34  ? -11.647 0.418   0.627  1.00 130.32 ? -39  DT  I "C2'" 1 
ATOM   6766  C  "C1'" . DT  I 5 34  ? -10.633 -0.551  1.240  1.00 130.56 ? -39  DT  I "C1'" 1 
ATOM   6767  N  N1    . DT  I 5 34  ? -10.839 -0.781  2.717  1.00 131.04 ? -39  DT  I N1    1 
ATOM   6768  C  C2    . DT  I 5 34  ? -10.919 -2.077  3.204  1.00 131.15 ? -39  DT  I C2    1 
ATOM   6769  O  O2    . DT  I 5 34  ? -10.823 -3.077  2.515  1.00 131.21 ? -39  DT  I O2    1 
ATOM   6770  N  N3    . DT  I 5 34  ? -11.112 -2.168  4.560  1.00 131.39 ? -39  DT  I N3    1 
ATOM   6771  C  C4    . DT  I 5 34  ? -11.240 -1.124  5.461  1.00 131.64 ? -39  DT  I C4    1 
ATOM   6772  O  O4    . DT  I 5 34  ? -11.412 -1.327  6.659  1.00 132.02 ? -39  DT  I O4    1 
ATOM   6773  C  C5    . DT  I 5 34  ? -11.152 0.205   4.894  1.00 131.61 ? -39  DT  I C5    1 
ATOM   6774  C  C7    . DT  I 5 34  ? -11.271 1.426   5.764  1.00 131.62 ? -39  DT  I C7    1 
ATOM   6775  C  C6    . DT  I 5 34  ? -10.960 0.307   3.569  1.00 131.43 ? -39  DT  I C6    1 
ATOM   6776  P  P     . DA  I 5 35  ? -12.617 0.527   -2.622 1.00 129.07 ? -38  DA  I P     1 
ATOM   6777  O  OP1   . DA  I 5 35  ? -12.173 0.765   -4.024 1.00 129.26 ? -38  DA  I OP1   1 
ATOM   6778  O  OP2   . DA  I 5 35  ? -13.400 1.580   -1.906 1.00 128.82 ? -38  DA  I OP2   1 
ATOM   6779  O  "O5'" . DA  I 5 35  ? -13.462 -0.850  -2.566 1.00 128.64 ? -38  DA  I "O5'" 1 
ATOM   6780  C  "C5'" . DA  I 5 35  ? -12.808 -2.090  -3.042 1.00 127.86 ? -38  DA  I "C5'" 1 
ATOM   6781  C  "C4'" . DA  I 5 35  ? -13.402 -3.313  -2.348 1.00 127.24 ? -38  DA  I "C4'" 1 
ATOM   6782  O  "O4'" . DA  I 5 35  ? -13.229 -3.200  -0.903 1.00 127.18 ? -38  DA  I "O4'" 1 
ATOM   6783  C  "C3'" . DA  I 5 35  ? -14.899 -3.532  -2.590 1.00 126.69 ? -38  DA  I "C3'" 1 
ATOM   6784  O  "O3'" . DA  I 5 35  ? -15.136 -4.894  -2.990 1.00 125.69 ? -38  DA  I "O3'" 1 
ATOM   6785  C  "C2'" . DA  I 5 35  ? -15.517 -3.206  -1.228 1.00 126.85 ? -38  DA  I "C2'" 1 
ATOM   6786  C  "C1'" . DA  I 5 35  ? -14.411 -3.671  -0.288 1.00 126.91 ? -38  DA  I "C1'" 1 
ATOM   6787  N  N9    . DA  I 5 35  ? -14.546 -3.181  1.089  1.00 126.73 ? -38  DA  I N9    1 
ATOM   6788  C  C8    . DA  I 5 35  ? -14.288 -1.918  1.562  1.00 126.64 ? -38  DA  I C8    1 
ATOM   6789  N  N7    . DA  I 5 35  ? -14.508 -1.773  2.850  1.00 126.35 ? -38  DA  I N7    1 
ATOM   6790  C  C5    . DA  I 5 35  ? -14.943 -3.028  3.252  1.00 126.38 ? -38  DA  I C5    1 
ATOM   6791  C  C6    . DA  I 5 35  ? -15.340 -3.547  4.505  1.00 126.24 ? -38  DA  I C6    1 
ATOM   6792  N  N6    . DA  I 5 35  ? -15.359 -2.815  5.623  1.00 126.26 ? -38  DA  I N6    1 
ATOM   6793  N  N1    . DA  I 5 35  ? -15.719 -4.847  4.569  1.00 126.15 ? -38  DA  I N1    1 
ATOM   6794  C  C2    . DA  I 5 35  ? -15.700 -5.583  3.447  1.00 126.22 ? -38  DA  I C2    1 
ATOM   6795  N  N3    . DA  I 5 35  ? -15.344 -5.207  2.216  1.00 126.26 ? -38  DA  I N3    1 
ATOM   6796  C  C4    . DA  I 5 35  ? -14.972 -3.909  2.182  1.00 126.43 ? -38  DA  I C4    1 
ATOM   6797  P  P     . DT  I 5 36  ? -16.609 -5.479  -3.260 1.00 124.82 ? -37  DT  I P     1 
ATOM   6798  O  OP1   . DT  I 5 36  ? -16.456 -6.635  -4.173 1.00 124.74 ? -37  DT  I OP1   1 
ATOM   6799  O  OP2   . DT  I 5 36  ? -17.515 -4.362  -3.636 1.00 124.69 ? -37  DT  I OP2   1 
ATOM   6800  O  "O5'" . DT  I 5 36  ? -17.079 -6.009  -1.815 1.00 124.16 ? -37  DT  I "O5'" 1 
ATOM   6801  C  "C5'" . DT  I 5 36  ? -16.799 -7.354  -1.380 1.00 122.86 ? -37  DT  I "C5'" 1 
ATOM   6802  C  "C4'" . DT  I 5 36  ? -17.766 -7.804  -0.291 1.00 121.86 ? -37  DT  I "C4'" 1 
ATOM   6803  O  "O4'" . DT  I 5 36  ? -17.578 -6.999  0.908  1.00 122.00 ? -37  DT  I "O4'" 1 
ATOM   6804  C  "C3'" . DT  I 5 36  ? -19.254 -7.732  -0.649 1.00 120.94 ? -37  DT  I "C3'" 1 
ATOM   6805  O  "O3'" . DT  I 5 36  ? -19.881 -8.989  -0.337 1.00 119.26 ? -37  DT  I "O3'" 1 
ATOM   6806  C  "C2'" . DT  I 5 36  ? -19.770 -6.562  0.193  1.00 121.37 ? -37  DT  I "C2'" 1 
ATOM   6807  C  "C1'" . DT  I 5 36  ? -18.839 -6.585  1.403  1.00 121.87 ? -37  DT  I "C1'" 1 
ATOM   6808  N  N1    . DT  I 5 36  ? -18.717 -5.265  2.132  1.00 121.90 ? -37  DT  I N1    1 
ATOM   6809  C  C2    . DT  I 5 36  ? -18.953 -5.205  3.500  1.00 121.96 ? -37  DT  I C2    1 
ATOM   6810  O  O2    . DT  I 5 36  ? -19.261 -6.165  4.190  1.00 121.96 ? -37  DT  I O2    1 
ATOM   6811  N  N3    . DT  I 5 36  ? -18.810 -3.951  4.052  1.00 122.07 ? -37  DT  I N3    1 
ATOM   6812  C  C4    . DT  I 5 36  ? -18.465 -2.776  3.396  1.00 122.12 ? -37  DT  I C4    1 
ATOM   6813  O  O4    . DT  I 5 36  ? -18.365 -1.705  3.991  1.00 121.97 ? -37  DT  I O4    1 
ATOM   6814  C  C5    . DT  I 5 36  ? -18.236 -2.906  1.972  1.00 122.10 ? -37  DT  I C5    1 
ATOM   6815  C  C7    . DT  I 5 36  ? -17.857 -1.711  1.143  1.00 122.20 ? -37  DT  I C7    1 
ATOM   6816  C  C6    . DT  I 5 36  ? -18.371 -4.124  1.420  1.00 121.94 ? -37  DT  I C6    1 
ATOM   6817  P  P     . DT  I 5 37  ? -21.471 -9.222  -0.219 1.00 118.03 ? -36  DT  I P     1 
ATOM   6818  O  OP1   . DT  I 5 37  ? -21.750 -10.597 -0.692 1.00 117.86 ? -36  DT  I OP1   1 
ATOM   6819  O  OP2   . DT  I 5 37  ? -22.211 -8.086  -0.816 1.00 118.08 ? -36  DT  I OP2   1 
ATOM   6820  O  "O5'" . DT  I 5 37  ? -21.704 -9.169  1.363  1.00 116.49 ? -36  DT  I "O5'" 1 
ATOM   6821  C  "C5'" . DT  I 5 37  ? -21.131 -10.166 2.214  1.00 113.55 ? -36  DT  I "C5'" 1 
ATOM   6822  C  "C4'" . DT  I 5 37  ? -21.592 -9.981  3.648  1.00 111.12 ? -36  DT  I "C4'" 1 
ATOM   6823  O  "O4'" . DT  I 5 37  ? -21.322 -8.623  4.079  1.00 110.89 ? -36  DT  I "O4'" 1 
ATOM   6824  C  "C3'" . DT  I 5 37  ? -23.079 -10.220 3.886  1.00 109.46 ? -36  DT  I "C3'" 1 
ATOM   6825  O  "O3'" . DT  I 5 37  ? -23.205 -10.994 5.067  1.00 106.58 ? -36  DT  I "O3'" 1 
ATOM   6826  C  "C2'" . DT  I 5 37  ? -23.666 -8.815  4.043  1.00 110.00 ? -36  DT  I "C2'" 1 
ATOM   6827  C  "C1'" . DT  I 5 37  ? -22.486 -8.068  4.660  1.00 110.82 ? -36  DT  I "C1'" 1 
ATOM   6828  N  N1    . DT  I 5 37  ? -22.444 -6.585  4.444  1.00 111.25 ? -36  DT  I N1    1 
ATOM   6829  C  C2    . DT  I 5 37  ? -22.381 -5.750  5.549  1.00 111.67 ? -36  DT  I C2    1 
ATOM   6830  O  O2    . DT  I 5 37  ? -22.374 -6.144  6.705  1.00 111.88 ? -36  DT  I O2    1 
ATOM   6831  N  N3    . DT  I 5 37  ? -22.334 -4.409  5.249  1.00 112.06 ? -36  DT  I N3    1 
ATOM   6832  C  C4    . DT  I 5 37  ? -22.336 -3.832  3.988  1.00 112.17 ? -36  DT  I C4    1 
ATOM   6833  O  O4    . DT  I 5 37  ? -22.290 -2.613  3.842  1.00 112.65 ? -36  DT  I O4    1 
ATOM   6834  C  C5    . DT  I 5 37  ? -22.398 -4.759  2.874  1.00 111.93 ? -36  DT  I C5    1 
ATOM   6835  C  C7    . DT  I 5 37  ? -22.410 -4.257  1.455  1.00 111.77 ? -36  DT  I C7    1 
ATOM   6836  C  C6    . DT  I 5 37  ? -22.445 -6.073  3.153  1.00 111.60 ? -36  DT  I C6    1 
ATOM   6837  P  P     . DT  I 5 38  ? -24.529 -11.820 5.421  1.00 104.69 ? -35  DT  I P     1 
ATOM   6838  O  OP1   . DT  I 5 38  ? -24.096 -13.179 5.813  1.00 104.31 ? -35  DT  I OP1   1 
ATOM   6839  O  OP2   . DT  I 5 38  ? -25.528 -11.655 4.338  1.00 104.81 ? -35  DT  I OP2   1 
ATOM   6840  O  "O5'" . DT  I 5 38  ? -25.098 -11.059 6.712  1.00 102.63 ? -35  DT  I "O5'" 1 
ATOM   6841  C  "C5'" . DT  I 5 38  ? -24.251 -10.708 7.808  1.00 99.00  ? -35  DT  I "C5'" 1 
ATOM   6842  C  "C4'" . DT  I 5 38  ? -24.860 -9.589  8.635  1.00 96.32  ? -35  DT  I "C4'" 1 
ATOM   6843  O  "O4'" . DT  I 5 38  ? -24.659 -8.312  7.977  1.00 95.82  ? -35  DT  I "O4'" 1 
ATOM   6844  C  "C3'" . DT  I 5 38  ? -26.364 -9.701  8.893  1.00 94.66  ? -35  DT  I "C3'" 1 
ATOM   6845  O  "O3'" . DT  I 5 38  ? -26.597 -9.687  10.292 1.00 91.86  ? -35  DT  I "O3'" 1 
ATOM   6846  C  "C2'" . DT  I 5 38  ? -26.952 -8.451  8.238  1.00 95.25  ? -35  DT  I "C2'" 1 
ATOM   6847  C  "C1'" . DT  I 5 38  ? -25.765 -7.501  8.307  1.00 96.05  ? -35  DT  I "C1'" 1 
ATOM   6848  N  N1    . DT  I 5 38  ? -25.839 -6.317  7.389  1.00 96.80  ? -35  DT  I N1    1 
ATOM   6849  C  C2    . DT  I 5 38  ? -25.968 -5.039  7.923  1.00 96.96  ? -35  DT  I C2    1 
ATOM   6850  O  O2    . DT  I 5 38  ? -26.028 -4.789  9.119  1.00 96.69  ? -35  DT  I O2    1 
ATOM   6851  N  N3    . DT  I 5 38  ? -26.029 -4.036  6.987  1.00 97.21  ? -35  DT  I N3    1 
ATOM   6852  C  C4    . DT  I 5 38  ? -25.973 -4.172  5.605  1.00 97.25  ? -35  DT  I C4    1 
ATOM   6853  O  O4    . DT  I 5 38  ? -26.037 -3.194  4.864  1.00 97.36  ? -35  DT  I O4    1 
ATOM   6854  C  C5    . DT  I 5 38  ? -25.840 -5.532  5.113  1.00 97.34  ? -35  DT  I C5    1 
ATOM   6855  C  C7    . DT  I 5 38  ? -25.768 -5.843  3.619  1.00 97.81  ? -35  DT  I C7    1 
ATOM   6856  C  C6    . DT  I 5 38  ? -25.780 -6.520  6.016  1.00 97.06  ? -35  DT  I C6    1 
ATOM   6857  P  P     . DG  I 5 39  ? -26.836 -11.020 11.148 1.00 89.09  ? -34  DG  I P     1 
ATOM   6858  O  OP1   . DG  I 5 39  ? -25.790 -12.016 10.829 1.00 88.42  ? -34  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I 5 39  ? -28.271 -11.382 11.054 1.00 88.96  ? -34  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I 5 39  ? -26.558 -10.479 12.630 1.00 87.70  ? -34  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I 5 39  ? -25.341 -9.800  12.933 1.00 84.97  ? -34  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I 5 39  ? -25.570 -8.587  13.823 1.00 83.39  ? -34  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I 5 39  ? -26.023 -7.459  13.035 1.00 83.37  ? -34  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I 5 39  ? -26.591 -8.746  14.942 1.00 82.17  ? -34  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I 5 39  ? -26.107 -8.087  16.113 1.00 79.35  ? -34  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I 5 39  ? -27.862 -8.107  14.379 1.00 83.22  ? -34  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I 5 39  ? -27.310 -7.039  13.443 1.00 84.20  ? -34  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I 5 39  ? -28.086 -6.839  12.222 1.00 85.95  ? -34  DG  I N9    1 
ATOM   6869  C  C8    . DG  I 5 39  ? -28.809 -7.773  11.509 1.00 86.52  ? -34  DG  I C8    1 
ATOM   6870  N  N7    . DG  I 5 39  ? -29.390 -7.288  10.443 1.00 87.02  ? -34  DG  I N7    1 
ATOM   6871  C  C5    . DG  I 5 39  ? -29.020 -5.949  10.445 1.00 87.09  ? -34  DG  I C5    1 
ATOM   6872  C  C6    . DG  I 5 39  ? -29.345 -4.913  9.536  1.00 87.39  ? -34  DG  I C6    1 
ATOM   6873  O  O6    . DG  I 5 39  ? -30.051 -4.995  8.520  1.00 87.90  ? -34  DG  I O6    1 
ATOM   6874  N  N1    . DG  I 5 39  ? -28.770 -3.692  9.910  1.00 87.21  ? -34  DG  I N1    1 
ATOM   6875  C  C2    . DG  I 5 39  ? -27.975 -3.499  11.023 1.00 86.71  ? -34  DG  I C2    1 
ATOM   6876  N  N2    . DG  I 5 39  ? -27.497 -2.264  11.235 1.00 86.31  ? -34  DG  I N2    1 
ATOM   6877  N  N3    . DG  I 5 39  ? -27.663 -4.464  11.879 1.00 86.60  ? -34  DG  I N3    1 
ATOM   6878  C  C4    . DG  I 5 39  ? -28.218 -5.655  11.531 1.00 86.76  ? -34  DG  I C4    1 
ATOM   6879  P  P     . DG  I 5 40  ? -26.933 -8.100  17.481 1.00 78.32  ? -33  DG  I P     1 
ATOM   6880  O  OP1   . DG  I 5 40  ? -25.938 -7.950  18.565 1.00 78.72  ? -33  DG  I OP1   1 
ATOM   6881  O  OP2   . DG  I 5 40  ? -27.869 -9.248  17.505 1.00 77.20  ? -33  DG  I OP2   1 
ATOM   6882  O  "O5'" . DG  I 5 40  ? -27.825 -6.777  17.379 1.00 79.31  ? -33  DG  I "O5'" 1 
ATOM   6883  C  "C5'" . DG  I 5 40  ? -27.275 -5.463  17.453 1.00 80.94  ? -33  DG  I "C5'" 1 
ATOM   6884  C  "C4'" . DG  I 5 40  ? -28.367 -4.447  17.159 1.00 82.64  ? -33  DG  I "C4'" 1 
ATOM   6885  O  "O4'" . DG  I 5 40  ? -28.858 -4.684  15.817 1.00 83.48  ? -33  DG  I "O4'" 1 
ATOM   6886  C  "C3'" . DG  I 5 40  ? -29.598 -4.516  18.063 1.00 83.64  ? -33  DG  I "C3'" 1 
ATOM   6887  O  "O3'" . DG  I 5 40  ? -30.053 -3.210  18.390 1.00 84.81  ? -33  DG  I "O3'" 1 
ATOM   6888  C  "C2'" . DG  I 5 40  ? -30.625 -5.239  17.201 1.00 84.22  ? -33  DG  I "C2'" 1 
ATOM   6889  C  "C1'" . DG  I 5 40  ? -30.265 -4.642  15.848 1.00 84.45  ? -33  DG  I "C1'" 1 
ATOM   6890  N  N9    . DG  I 5 40  ? -30.843 -5.298  14.671 1.00 85.87  ? -33  DG  I N9    1 
ATOM   6891  C  C8    . DG  I 5 40  ? -31.235 -6.610  14.515 1.00 86.60  ? -33  DG  I C8    1 
ATOM   6892  N  N7    . DG  I 5 40  ? -31.727 -6.878  13.334 1.00 86.63  ? -33  DG  I N7    1 
ATOM   6893  C  C5    . DG  I 5 40  ? -31.664 -5.665  12.660 1.00 86.85  ? -33  DG  I C5    1 
ATOM   6894  C  C6    . DG  I 5 40  ? -32.058 -5.322  11.337 1.00 87.19  ? -33  DG  I C6    1 
ATOM   6895  O  O6    . DG  I 5 40  ? -32.553 -6.050  10.460 1.00 87.60  ? -33  DG  I O6    1 
ATOM   6896  N  N1    . DG  I 5 40  ? -31.816 -3.974  11.059 1.00 86.86  ? -33  DG  I N1    1 
ATOM   6897  C  C2    . DG  I 5 40  ? -31.265 -3.073  11.944 1.00 86.61  ? -33  DG  I C2    1 
ATOM   6898  N  N2    . DG  I 5 40  ? -31.109 -1.820  11.507 1.00 86.74  ? -33  DG  I N2    1 
ATOM   6899  N  N3    . DG  I 5 40  ? -30.899 -3.376  13.182 1.00 86.53  ? -33  DG  I N3    1 
ATOM   6900  C  C4    . DG  I 5 40  ? -31.124 -4.685  13.472 1.00 86.50  ? -33  DG  I C4    1 
ATOM   6901  P  P     . DA  I 5 41  ? -30.015 -2.668  19.896 1.00 86.30  ? -32  DA  I P     1 
ATOM   6902  O  OP1   . DA  I 5 41  ? -28.660 -2.916  20.441 1.00 85.69  ? -32  DA  I OP1   1 
ATOM   6903  O  OP2   . DA  I 5 41  ? -31.218 -3.192  20.587 1.00 85.59  ? -32  DA  I OP2   1 
ATOM   6904  O  "O5'" . DA  I 5 41  ? -30.171 -1.081  19.735 1.00 87.77  ? -32  DA  I "O5'" 1 
ATOM   6905  C  "C5'" . DA  I 5 41  ? -29.471 -0.355  18.712 1.00 89.74  ? -32  DA  I "C5'" 1 
ATOM   6906  C  "C4'" . DA  I 5 41  ? -30.433 0.503   17.904 1.00 91.16  ? -32  DA  I "C4'" 1 
ATOM   6907  O  "O4'" . DA  I 5 41  ? -30.929 -0.261  16.774 1.00 91.40  ? -32  DA  I "O4'" 1 
ATOM   6908  C  "C3'" . DA  I 5 41  ? -31.647 0.995   18.696 1.00 92.28  ? -32  DA  I "C3'" 1 
ATOM   6909  O  "O3'" . DA  I 5 41  ? -31.561 2.428   18.879 1.00 93.72  ? -32  DA  I "O3'" 1 
ATOM   6910  C  "C2'" . DA  I 5 41  ? -32.872 0.441   17.955 1.00 91.95  ? -32  DA  I "C2'" 1 
ATOM   6911  C  "C1'" . DA  I 5 41  ? -32.331 -0.115  16.637 1.00 91.76  ? -32  DA  I "C1'" 1 
ATOM   6912  N  N9    . DA  I 5 41  ? -32.879 -1.420  16.245 1.00 92.04  ? -32  DA  I N9    1 
ATOM   6913  C  C8    . DA  I 5 41  ? -32.969 -2.546  17.024 1.00 92.24  ? -32  DA  I C8    1 
ATOM   6914  N  N7    . DA  I 5 41  ? -33.499 -3.585  16.423 1.00 91.96  ? -32  DA  I N7    1 
ATOM   6915  C  C5    . DA  I 5 41  ? -33.779 -3.115  15.155 1.00 92.05  ? -32  DA  I C5    1 
ATOM   6916  C  C6    . DA  I 5 41  ? -34.351 -3.736  14.027 1.00 92.10  ? -32  DA  I C6    1 
ATOM   6917  N  N6    . DA  I 5 41  ? -34.749 -5.011  14.034 1.00 92.60  ? -32  DA  I N6    1 
ATOM   6918  N  N1    . DA  I 5 41  ? -34.499 -2.997  12.903 1.00 91.98  ? -32  DA  I N1    1 
ATOM   6919  C  C2    . DA  I 5 41  ? -34.095 -1.716  12.918 1.00 92.37  ? -32  DA  I C2    1 
ATOM   6920  N  N3    . DA  I 5 41  ? -33.537 -1.022  13.915 1.00 92.41  ? -32  DA  I N3    1 
ATOM   6921  C  C4    . DA  I 5 41  ? -33.404 -1.784  15.021 1.00 92.21  ? -32  DA  I C4    1 
ATOM   6922  P  P     . DA  I 5 42  ? -32.683 3.513   18.527 1.00 95.03  ? -31  DA  I P     1 
ATOM   6923  O  OP1   . DA  I 5 42  ? -32.089 4.820   18.878 1.00 95.26  ? -31  DA  I OP1   1 
ATOM   6924  O  OP2   . DA  I 5 42  ? -33.979 3.122   19.135 1.00 95.15  ? -31  DA  I OP2   1 
ATOM   6925  O  "O5'" . DA  I 5 42  ? -32.794 3.396   16.932 1.00 96.65  ? -31  DA  I "O5'" 1 
ATOM   6926  C  "C5'" . DA  I 5 42  ? -33.392 4.429   16.159 1.00 99.10  ? -31  DA  I "C5'" 1 
ATOM   6927  C  "C4'" . DA  I 5 42  ? -34.734 4.019   15.568 1.00 101.02 ? -31  DA  I "C4'" 1 
ATOM   6928  O  "O4'" . DA  I 5 42  ? -34.838 2.575   15.425 1.00 101.16 ? -31  DA  I "O4'" 1 
ATOM   6929  C  "C3'" . DA  I 5 42  ? -35.959 4.460   16.372 1.00 102.18 ? -31  DA  I "C3'" 1 
ATOM   6930  O  "O3'" . DA  I 5 42  ? -36.757 5.330   15.559 1.00 103.94 ? -31  DA  I "O3'" 1 
ATOM   6931  C  "C2'" . DA  I 5 42  ? -36.682 3.148   16.686 1.00 102.32 ? -31  DA  I "C2'" 1 
ATOM   6932  C  "C1'" . DA  I 5 42  ? -36.204 2.244   15.557 1.00 101.99 ? -31  DA  I "C1'" 1 
ATOM   6933  N  N9    . DA  I 5 42  ? -36.359 0.810   15.811 1.00 102.15 ? -31  DA  I N9    1 
ATOM   6934  C  C8    . DA  I 5 42  ? -36.061 0.136   16.962 1.00 102.22 ? -31  DA  I C8    1 
ATOM   6935  N  N7    . DA  I 5 42  ? -36.296 -1.154  16.909 1.00 102.45 ? -31  DA  I N7    1 
ATOM   6936  C  C5    . DA  I 5 42  ? -36.790 -1.346  15.632 1.00 102.38 ? -31  DA  I C5    1 
ATOM   6937  C  C6    . DA  I 5 42  ? -37.233 -2.499  14.947 1.00 102.35 ? -31  DA  I C6    1 
ATOM   6938  N  N6    . DA  I 5 42  ? -37.246 -3.720  15.491 1.00 102.35 ? -31  DA  I N6    1 
ATOM   6939  N  N1    . DA  I 5 42  ? -37.667 -2.350  13.676 1.00 102.46 ? -31  DA  I N1    1 
ATOM   6940  C  C2    . DA  I 5 42  ? -37.656 -1.124  13.132 1.00 102.62 ? -31  DA  I C2    1 
ATOM   6941  N  N3    . DA  I 5 42  ? -37.263 0.032   13.675 1.00 102.48 ? -31  DA  I N3    1 
ATOM   6942  C  C4    . DA  I 5 42  ? -36.836 -0.145  14.940 1.00 102.37 ? -31  DA  I C4    1 
ATOM   6943  P  P     . DA  I 5 43  ? -37.995 6.195   16.116 1.00 105.37 ? -30  DA  I P     1 
ATOM   6944  O  OP1   . DA  I 5 43  ? -37.498 7.576   16.296 1.00 105.63 ? -30  DA  I OP1   1 
ATOM   6945  O  OP2   . DA  I 5 43  ? -38.640 5.482   17.248 1.00 105.31 ? -30  DA  I OP2   1 
ATOM   6946  O  "O5'" . DA  I 5 43  ? -39.016 6.187   14.882 1.00 105.41 ? -30  DA  I "O5'" 1 
ATOM   6947  C  "C5'" . DA  I 5 43  ? -38.997 5.129   13.926 1.00 105.53 ? -30  DA  I "C5'" 1 
ATOM   6948  C  "C4'" . DA  I 5 43  ? -40.376 4.533   13.694 1.00 105.92 ? -30  DA  I "C4'" 1 
ATOM   6949  O  "O4'" . DA  I 5 43  ? -40.284 3.093   13.829 1.00 105.95 ? -30  DA  I "O4'" 1 
ATOM   6950  C  "C3'" . DA  I 5 43  ? -41.507 4.980   14.619 1.00 106.11 ? -30  DA  I "C3'" 1 
ATOM   6951  O  "O3'" . DA  I 5 43  ? -42.686 5.175   13.826 1.00 106.55 ? -30  DA  I "O3'" 1 
ATOM   6952  C  "C2'" . DA  I 5 43  ? -41.646 3.810   15.595 1.00 106.03 ? -30  DA  I "C2'" 1 
ATOM   6953  C  "C1'" . DA  I 5 43  ? -41.281 2.624   14.708 1.00 106.16 ? -30  DA  I "C1'" 1 
ATOM   6954  N  N9    . DA  I 5 43  ? -40.745 1.472   15.435 1.00 106.87 ? -30  DA  I N9    1 
ATOM   6955  C  C8    . DA  I 5 43  ? -39.902 1.487   16.517 1.00 106.92 ? -30  DA  I C8    1 
ATOM   6956  N  N7    . DA  I 5 43  ? -39.585 0.295   16.967 1.00 106.88 ? -30  DA  I N7    1 
ATOM   6957  C  C5    . DA  I 5 43  ? -40.262 -0.566  16.120 1.00 107.00 ? -30  DA  I C5    1 
ATOM   6958  C  C6    . DA  I 5 43  ? -40.344 -1.975  16.063 1.00 107.10 ? -30  DA  I C6    1 
ATOM   6959  N  N6    . DA  I 5 43  ? -39.701 -2.773  16.921 1.00 107.05 ? -30  DA  I N6    1 
ATOM   6960  N  N1    . DA  I 5 43  ? -41.110 -2.531  15.093 1.00 107.18 ? -30  DA  I N1    1 
ATOM   6961  C  C2    . DA  I 5 43  ? -41.754 -1.722  14.235 1.00 107.27 ? -30  DA  I C2    1 
ATOM   6962  N  N3    . DA  I 5 43  ? -41.756 -0.386  14.191 1.00 107.29 ? -30  DA  I N3    1 
ATOM   6963  C  C4    . DA  I 5 43  ? -40.983 0.139   15.167 1.00 107.06 ? -30  DA  I C4    1 
ATOM   6964  P  P     . DC  I 5 44  ? -44.077 5.696   14.437 1.00 107.08 ? -29  DC  I P     1 
ATOM   6965  O  OP1   . DC  I 5 44  ? -44.562 6.801   13.574 1.00 107.34 ? -29  DC  I OP1   1 
ATOM   6966  O  OP2   . DC  I 5 44  ? -43.945 5.927   15.894 1.00 107.10 ? -29  DC  I OP2   1 
ATOM   6967  O  "O5'" . DC  I 5 44  ? -45.013 4.413   14.234 1.00 107.37 ? -29  DC  I "O5'" 1 
ATOM   6968  C  "C5'" . DC  I 5 44  ? -45.235 3.860   12.932 1.00 108.39 ? -29  DC  I "C5'" 1 
ATOM   6969  C  "C4'" . DC  I 5 44  ? -45.895 2.497   13.058 1.00 109.25 ? -29  DC  I "C4'" 1 
ATOM   6970  O  "O4'" . DC  I 5 44  ? -44.961 1.602   13.721 1.00 109.28 ? -29  DC  I "O4'" 1 
ATOM   6971  C  "C3'" . DC  I 5 44  ? -47.184 2.469   13.893 1.00 109.83 ? -29  DC  I "C3'" 1 
ATOM   6972  O  "O3'" . DC  I 5 44  ? -48.224 1.710   13.244 1.00 110.48 ? -29  DC  I "O3'" 1 
ATOM   6973  C  "C2'" . DC  I 5 44  ? -46.728 1.820   15.198 1.00 109.77 ? -29  DC  I "C2'" 1 
ATOM   6974  C  "C1'" . DC  I 5 44  ? -45.695 0.846   14.657 1.00 109.48 ? -29  DC  I "C1'" 1 
ATOM   6975  N  N1    . DC  I 5 44  ? -44.821 0.280   15.721 1.00 109.48 ? -29  DC  I N1    1 
ATOM   6976  C  C2    . DC  I 5 44  ? -44.731 -1.116  15.849 1.00 109.56 ? -29  DC  I C2    1 
ATOM   6977  O  O2    . DC  I 5 44  ? -45.364 -1.846  15.072 1.00 109.71 ? -29  DC  I O2    1 
ATOM   6978  N  N3    . DC  I 5 44  ? -43.942 -1.634  16.824 1.00 109.53 ? -29  DC  I N3    1 
ATOM   6979  C  C4    . DC  I 5 44  ? -43.275 -0.818  17.647 1.00 109.76 ? -29  DC  I C4    1 
ATOM   6980  N  N4    . DC  I 5 44  ? -42.513 -1.382  18.589 1.00 110.04 ? -29  DC  I N4    1 
ATOM   6981  C  C5    . DC  I 5 44  ? -43.358 0.607   17.540 1.00 109.73 ? -29  DC  I C5    1 
ATOM   6982  C  C6    . DC  I 5 44  ? -44.137 1.108   16.573 1.00 109.58 ? -29  DC  I C6    1 
ATOM   6983  P  P     . DT  I 5 45  ? -49.527 1.156   14.013 1.00 111.35 ? -28  DT  I P     1 
ATOM   6984  O  OP1   . DT  I 5 45  ? -50.666 1.250   13.066 1.00 111.27 ? -28  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I 5 45  ? -49.657 1.782   15.353 1.00 111.06 ? -28  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I 5 45  ? -49.119 -0.380  14.229 1.00 111.44 ? -28  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I 5 45  ? -49.978 -1.449  13.812 1.00 111.78 ? -28  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I 5 45  ? -50.251 -2.396  14.978 1.00 111.79 ? -28  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I 5 45  ? -49.064 -2.532  15.814 1.00 112.02 ? -28  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I 5 45  ? -51.388 -1.989  15.918 1.00 111.50 ? -28  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I 5 45  ? -52.116 -3.145  16.275 1.00 111.05 ? -28  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I 5 45  ? -50.658 -1.439  17.138 1.00 111.83 ? -28  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I 5 45  ? -49.473 -2.413  17.171 1.00 111.84 ? -28  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I 5 45  ? -48.299 -2.017  18.021 1.00 111.77 ? -28  DT  I N1    1 
ATOM   6995  C  C2    . DT  I 5 45  ? -47.470 -3.015  18.500 1.00 111.51 ? -28  DT  I C2    1 
ATOM   6996  O  O2    . DT  I 5 45  ? -47.636 -4.205  18.272 1.00 111.26 ? -28  DT  I O2    1 
ATOM   6997  N  N3    . DT  I 5 45  ? -46.422 -2.564  19.267 1.00 111.54 ? -28  DT  I N3    1 
ATOM   6998  C  C4    . DT  I 5 45  ? -46.119 -1.252  19.598 1.00 111.84 ? -28  DT  I C4    1 
ATOM   6999  O  O4    . DT  I 5 45  ? -45.148 -0.967  20.296 1.00 111.75 ? -28  DT  I O4    1 
ATOM   7000  C  C5    . DT  I 5 45  ? -47.026 -0.257  19.064 1.00 111.97 ? -28  DT  I C5    1 
ATOM   7001  C  C7    . DT  I 5 45  ? -46.815 1.205   19.345 1.00 112.14 ? -28  DT  I C7    1 
ATOM   7002  C  C6    . DT  I 5 45  ? -48.056 -0.681  18.312 1.00 111.86 ? -28  DT  I C6    1 
ATOM   7003  P  P     . DG  I 5 46  ? -53.500 -3.506  15.565 1.00 110.72 ? -27  DG  I P     1 
ATOM   7004  O  OP1   . DG  I 5 46  ? -53.457 -3.008  14.170 1.00 110.57 ? -27  DG  I OP1   1 
ATOM   7005  O  OP2   . DG  I 5 46  ? -54.583 -3.070  16.480 1.00 110.40 ? -27  DG  I OP2   1 
ATOM   7006  O  "O5'" . DG  I 5 46  ? -53.487 -5.112  15.534 1.00 109.78 ? -27  DG  I "O5'" 1 
ATOM   7007  C  "C5'" . DG  I 5 46  ? -52.276 -5.883  15.438 1.00 108.06 ? -27  DG  I "C5'" 1 
ATOM   7008  C  "C4'" . DG  I 5 46  ? -52.191 -6.979  16.502 1.00 107.01 ? -27  DG  I "C4'" 1 
ATOM   7009  O  "O4'" . DG  I 5 46  ? -51.223 -6.597  17.515 1.00 106.70 ? -27  DG  I "O4'" 1 
ATOM   7010  C  "C3'" . DG  I 5 46  ? -53.466 -7.328  17.280 1.00 106.39 ? -27  DG  I "C3'" 1 
ATOM   7011  O  "O3'" . DG  I 5 46  ? -53.473 -8.720  17.612 1.00 105.30 ? -27  DG  I "O3'" 1 
ATOM   7012  C  "C2'" . DG  I 5 46  ? -53.345 -6.468  18.539 1.00 106.38 ? -27  DG  I "C2'" 1 
ATOM   7013  C  "C1'" . DG  I 5 46  ? -51.844 -6.561  18.789 1.00 106.44 ? -27  DG  I "C1'" 1 
ATOM   7014  N  N9    . DG  I 5 46  ? -51.267 -5.450  19.542 1.00 106.19 ? -27  DG  I N9    1 
ATOM   7015  C  C8    . DG  I 5 46  ? -51.624 -4.120  19.510 1.00 106.17 ? -27  DG  I C8    1 
ATOM   7016  N  N7    . DG  I 5 46  ? -50.910 -3.367  20.302 1.00 105.98 ? -27  DG  I N7    1 
ATOM   7017  C  C5    . DG  I 5 46  ? -50.019 -4.254  20.893 1.00 105.75 ? -27  DG  I C5    1 
ATOM   7018  C  C6    . DG  I 5 46  ? -48.994 -4.023  21.841 1.00 105.40 ? -27  DG  I C6    1 
ATOM   7019  O  O6    . DG  I 5 46  ? -48.663 -2.949  22.361 1.00 105.02 ? -27  DG  I O6    1 
ATOM   7020  N  N1    . DG  I 5 46  ? -48.327 -5.204  22.177 1.00 105.58 ? -27  DG  I N1    1 
ATOM   7021  C  C2    . DG  I 5 46  ? -48.611 -6.451  21.661 1.00 105.71 ? -27  DG  I C2    1 
ATOM   7022  N  N2    . DG  I 5 46  ? -47.867 -7.477  22.098 1.00 106.00 ? -27  DG  I N2    1 
ATOM   7023  N  N3    . DG  I 5 46  ? -49.567 -6.679  20.773 1.00 105.84 ? -27  DG  I N3    1 
ATOM   7024  C  C4    . DG  I 5 46  ? -50.227 -5.540  20.435 1.00 106.00 ? -27  DG  I C4    1 
ATOM   7025  P  P     . DC  I 5 47  ? -54.802 -9.502  18.062 1.00 104.71 ? -26  DC  I P     1 
ATOM   7026  O  OP1   . DC  I 5 47  ? -54.963 -10.618 17.089 1.00 104.46 ? -26  DC  I OP1   1 
ATOM   7027  O  OP2   . DC  I 5 47  ? -55.912 -8.530  18.287 1.00 104.60 ? -26  DC  I OP2   1 
ATOM   7028  O  "O5'" . DC  I 5 47  ? -54.430 -10.132 19.506 1.00 104.00 ? -26  DC  I "O5'" 1 
ATOM   7029  C  "C5'" . DC  I 5 47  ? -53.099 -10.622 19.790 1.00 102.43 ? -26  DC  I "C5'" 1 
ATOM   7030  C  "C4'" . DC  I 5 47  ? -52.803 -10.547 21.280 1.00 101.05 ? -26  DC  I "C4'" 1 
ATOM   7031  O  "O4'" . DC  I 5 47  ? -52.477 -9.178  21.630 1.00 101.12 ? -26  DC  I "O4'" 1 
ATOM   7032  C  "C3'" . DC  I 5 47  ? -53.956 -10.966 22.195 1.00 100.32 ? -26  DC  I "C3'" 1 
ATOM   7033  O  "O3'" . DC  I 5 47  ? -53.519 -11.911 23.160 1.00 98.35  ? -26  DC  I "O3'" 1 
ATOM   7034  C  "C2'" . DC  I 5 47  ? -54.408 -9.674  22.869 1.00 101.02 ? -26  DC  I "C2'" 1 
ATOM   7035  C  "C1'" . DC  I 5 47  ? -53.134 -8.835  22.835 1.00 101.44 ? -26  DC  I "C1'" 1 
ATOM   7036  N  N1    . DC  I 5 47  ? -53.363 -7.350  22.877 1.00 101.77 ? -26  DC  I N1    1 
ATOM   7037  C  C2    . DC  I 5 47  ? -52.295 -6.485  23.173 1.00 102.01 ? -26  DC  I C2    1 
ATOM   7038  O  O2    . DC  I 5 47  ? -51.165 -6.951  23.393 1.00 102.02 ? -26  DC  I O2    1 
ATOM   7039  N  N3    . DC  I 5 47  ? -52.531 -5.144  23.209 1.00 102.16 ? -26  DC  I N3    1 
ATOM   7040  C  C4    . DC  I 5 47  ? -53.757 -4.663  22.968 1.00 102.46 ? -26  DC  I C4    1 
ATOM   7041  N  N4    . DC  I 5 47  ? -53.940 -3.339  23.017 1.00 102.49 ? -26  DC  I N4    1 
ATOM   7042  C  C5    . DC  I 5 47  ? -54.857 -5.525  22.669 1.00 102.82 ? -26  DC  I C5    1 
ATOM   7043  C  C6    . DC  I 5 47  ? -54.614 -6.843  22.635 1.00 102.29 ? -26  DC  I C6    1 
ATOM   7044  P  P     . DT  I 5 48  ? -53.812 -13.471 22.933 1.00 96.75  ? -25  DT  I P     1 
ATOM   7045  O  OP1   . DT  I 5 48  ? -53.043 -13.915 21.735 1.00 96.36  ? -25  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I 5 48  ? -55.287 -13.674 23.018 1.00 96.85  ? -25  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I 5 48  ? -53.157 -14.149 24.232 1.00 94.74  ? -25  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I 5 48  ? -53.094 -13.421 25.446 1.00 90.99  ? -25  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I 5 48  ? -51.650 -13.086 25.797 1.00 87.79  ? -25  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I 5 48  ? -51.401 -11.679 25.545 1.00 87.69  ? -25  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I 5 48  ? -51.321 -13.290 27.271 1.00 85.54  ? -25  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I 5 48  ? -49.947 -13.624 27.457 1.00 81.71  ? -25  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I 5 48  ? -51.654 -11.942 27.895 1.00 86.28  ? -25  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I 5 48  ? -51.400 -10.951 26.762 1.00 87.52  ? -25  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I 5 48  ? -52.431 -9.857  26.731 1.00 88.37  ? -25  DT  I N1    1 
ATOM   7056  C  C2    . DT  I 5 48  ? -52.042 -8.554  26.973 1.00 88.79  ? -25  DT  I C2    1 
ATOM   7057  O  O2    . DT  I 5 48  ? -50.893 -8.221  27.203 1.00 89.03  ? -25  DT  I O2    1 
ATOM   7058  N  N3    . DT  I 5 48  ? -53.060 -7.634  26.931 1.00 89.10  ? -25  DT  I N3    1 
ATOM   7059  C  C4    . DT  I 5 48  ? -54.400 -7.879  26.684 1.00 89.87  ? -25  DT  I C4    1 
ATOM   7060  O  O4    . DT  I 5 48  ? -55.223 -6.968  26.673 1.00 90.42  ? -25  DT  I O4    1 
ATOM   7061  C  C5    . DT  I 5 48  ? -54.749 -9.267  26.442 1.00 90.03  ? -25  DT  I C5    1 
ATOM   7062  C  C7    . DT  I 5 48  ? -56.167 -9.689  26.156 1.00 90.15  ? -25  DT  I C7    1 
ATOM   7063  C  C6    . DT  I 5 48  ? -53.759 -10.170 26.480 1.00 89.30  ? -25  DT  I C6    1 
ATOM   7064  P  P     . DC  I 5 49  ? -49.483 -14.531 28.696 1.00 78.04  ? -24  DC  I P     1 
ATOM   7065  O  OP1   . DC  I 5 49  ? -48.149 -15.064 28.361 1.00 76.50  ? -24  DC  I OP1   1 
ATOM   7066  O  OP2   . DC  I 5 49  ? -50.595 -15.450 29.029 1.00 77.54  ? -24  DC  I OP2   1 
ATOM   7067  O  "O5'" . DC  I 5 49  ? -49.341 -13.509 29.923 1.00 76.49  ? -24  DC  I "O5'" 1 
ATOM   7068  C  "C5'" . DC  I 5 49  ? -48.622 -12.273 29.831 1.00 74.29  ? -24  DC  I "C5'" 1 
ATOM   7069  C  "C4'" . DC  I 5 49  ? -49.078 -11.306 30.917 1.00 73.21  ? -24  DC  I "C4'" 1 
ATOM   7070  O  "O4'" . DC  I 5 49  ? -50.250 -10.575 30.461 1.00 74.84  ? -24  DC  I "O4'" 1 
ATOM   7071  C  "C3'" . DC  I 5 49  ? -49.488 -11.932 32.251 1.00 71.75  ? -24  DC  I "C3'" 1 
ATOM   7072  O  "O3'" . DC  I 5 49  ? -49.176 -11.057 33.311 1.00 68.44  ? -24  DC  I "O3'" 1 
ATOM   7073  C  "C2'" . DC  I 5 49  ? -51.002 -12.014 32.125 1.00 74.23  ? -24  DC  I "C2'" 1 
ATOM   7074  C  "C1'" . DC  I 5 49  ? -51.223 -10.646 31.482 1.00 76.12  ? -24  DC  I "C1'" 1 
ATOM   7075  N  N1    . DC  I 5 49  ? -52.604 -10.355 30.966 1.00 78.69  ? -24  DC  I N1    1 
ATOM   7076  C  C2    . DC  I 5 49  ? -53.015 -9.018  30.826 1.00 79.98  ? -24  DC  I C2    1 
ATOM   7077  O  O2    . DC  I 5 49  ? -52.237 -8.102  31.123 1.00 81.02  ? -24  DC  I O2    1 
ATOM   7078  N  N3    . DC  I 5 49  ? -54.271 -8.762  30.372 1.00 80.62  ? -24  DC  I N3    1 
ATOM   7079  C  C4    . DC  I 5 49  ? -55.099 -9.767  30.062 1.00 81.03  ? -24  DC  I C4    1 
ATOM   7080  N  N4    . DC  I 5 49  ? -56.322 -9.460  29.619 1.00 81.81  ? -24  DC  I N4    1 
ATOM   7081  C  C5    . DC  I 5 49  ? -54.707 -11.136 30.198 1.00 80.81  ? -24  DC  I C5    1 
ATOM   7082  C  C6    . DC  I 5 49  ? -53.467 -11.378 30.651 1.00 80.01  ? -24  DC  I C6    1 
ATOM   7083  P  P     . DC  I 5 50  ? -47.832 -11.205 34.159 1.00 66.17  ? -23  DC  I P     1 
ATOM   7084  O  OP1   . DC  I 5 50  ? -46.703 -11.200 33.207 1.00 64.35  ? -23  DC  I OP1   1 
ATOM   7085  O  OP2   . DC  I 5 50  ? -48.013 -12.331 35.100 1.00 66.86  ? -23  DC  I OP2   1 
ATOM   7086  O  "O5'" . DC  I 5 50  ? -47.815 -9.858  35.021 1.00 65.99  ? -23  DC  I "O5'" 1 
ATOM   7087  C  "C5'" . DC  I 5 50  ? -47.376 -8.630  34.440 1.00 66.09  ? -23  DC  I "C5'" 1 
ATOM   7088  C  "C4'" . DC  I 5 50  ? -48.274 -7.487  34.862 1.00 67.05  ? -23  DC  I "C4'" 1 
ATOM   7089  O  "O4'" . DC  I 5 50  ? -49.554 -7.646  34.213 1.00 67.77  ? -23  DC  I "O4'" 1 
ATOM   7090  C  "C3'" . DC  I 5 50  ? -48.560 -7.422  36.357 1.00 67.86  ? -23  DC  I "C3'" 1 
ATOM   7091  O  "O3'" . DC  I 5 50  ? -48.120 -6.173  36.844 1.00 68.37  ? -23  DC  I "O3'" 1 
ATOM   7092  C  "C2'" . DC  I 5 50  ? -50.075 -7.593  36.493 1.00 68.31  ? -23  DC  I "C2'" 1 
ATOM   7093  C  "C1'" . DC  I 5 50  ? -50.575 -7.251  35.095 1.00 68.70  ? -23  DC  I "C1'" 1 
ATOM   7094  N  N1    . DC  I 5 50  ? -51.804 -7.954  34.640 1.00 69.74  ? -23  DC  I N1    1 
ATOM   7095  C  C2    . DC  I 5 50  ? -52.884 -7.208  34.128 1.00 70.14  ? -23  DC  I C2    1 
ATOM   7096  O  O2    . DC  I 5 50  ? -52.808 -5.977  34.083 1.00 69.79  ? -23  DC  I O2    1 
ATOM   7097  N  N3    . DC  I 5 50  ? -53.999 -7.863  33.704 1.00 70.60  ? -23  DC  I N3    1 
ATOM   7098  C  C4    . DC  I 5 50  ? -54.054 -9.199  33.767 1.00 71.18  ? -23  DC  I C4    1 
ATOM   7099  N  N4    . DC  I 5 50  ? -55.168 -9.802  33.335 1.00 72.02  ? -23  DC  I N4    1 
ATOM   7100  C  C5    . DC  I 5 50  ? -52.964 -9.976  34.278 1.00 71.22  ? -23  DC  I C5    1 
ATOM   7101  C  C6    . DC  I 5 50  ? -51.867 -9.322  34.692 1.00 70.44  ? -23  DC  I C6    1 
ATOM   7102  P  P     . DA  I 5 51  ? -47.842 -5.979  38.395 1.00 69.72  ? -22  DA  I P     1 
ATOM   7103  O  OP1   . DA  I 5 51  ? -46.470 -5.469  38.549 1.00 69.67  ? -22  DA  I OP1   1 
ATOM   7104  O  OP2   . DA  I 5 51  ? -48.237 -7.220  39.092 1.00 70.94  ? -22  DA  I OP2   1 
ATOM   7105  O  "O5'" . DA  I 5 51  ? -48.880 -4.835  38.837 1.00 73.60  ? -22  DA  I "O5'" 1 
ATOM   7106  C  "C5'" . DA  I 5 51  ? -49.038 -3.626  38.074 1.00 77.01  ? -22  DA  I "C5'" 1 
ATOM   7107  C  "C4'" . DA  I 5 51  ? -50.232 -2.782  38.520 1.00 79.22  ? -22  DA  I "C4'" 1 
ATOM   7108  O  "O4'" . DA  I 5 51  ? -51.457 -3.306  37.951 1.00 79.51  ? -22  DA  I "O4'" 1 
ATOM   7109  C  "C3'" . DA  I 5 51  ? -50.479 -2.641  40.020 1.00 80.76  ? -22  DA  I "C3'" 1 
ATOM   7110  O  "O3'" . DA  I 5 51  ? -50.826 -1.277  40.292 1.00 83.18  ? -22  DA  I "O3'" 1 
ATOM   7111  C  "C2'" . DA  I 5 51  ? -51.612 -3.634  40.285 1.00 81.01  ? -22  DA  I "C2'" 1 
ATOM   7112  C  "C1'" . DA  I 5 51  ? -52.377 -3.650  38.964 1.00 81.11  ? -22  DA  I "C1'" 1 
ATOM   7113  N  N9    . DA  I 5 51  ? -52.912 -4.952  38.573 1.00 82.58  ? -22  DA  I N9    1 
ATOM   7114  C  C8    . DA  I 5 51  ? -52.304 -6.167  38.723 1.00 83.22  ? -22  DA  I C8    1 
ATOM   7115  N  N7    . DA  I 5 51  ? -53.009 -7.172  38.266 1.00 83.95  ? -22  DA  I N7    1 
ATOM   7116  C  C5    . DA  I 5 51  ? -54.157 -6.581  37.774 1.00 83.77  ? -22  DA  I C5    1 
ATOM   7117  C  C6    . DA  I 5 51  ? -55.311 -7.113  37.154 1.00 84.43  ? -22  DA  I C6    1 
ATOM   7118  N  N6    . DA  I 5 51  ? -55.487 -8.421  36.920 1.00 83.98  ? -22  DA  I N6    1 
ATOM   7119  N  N1    . DA  I 5 51  ? -56.282 -6.244  36.782 1.00 84.65  ? -22  DA  I N1    1 
ATOM   7120  C  C2    . DA  I 5 51  ? -56.106 -4.932  37.012 1.00 84.37  ? -22  DA  I C2    1 
ATOM   7121  N  N3    . DA  I 5 51  ? -55.069 -4.317  37.590 1.00 84.14  ? -22  DA  I N3    1 
ATOM   7122  C  C4    . DA  I 5 51  ? -54.116 -5.206  37.951 1.00 83.58  ? -22  DA  I C4    1 
ATOM   7123  P  P     . DT  I 5 52  ? -51.412 -0.749  41.695 1.00 85.57  ? -21  DT  I P     1 
ATOM   7124  O  OP1   . DT  I 5 52  ? -51.057 0.680   41.806 1.00 85.64  ? -21  DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I 5 52  ? -51.023 -1.673  42.783 1.00 85.09  ? -21  DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I 5 52  ? -53.001 -0.870  41.507 1.00 87.71  ? -21  DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I 5 52  ? -53.700 -0.273  40.414 1.00 90.50  ? -21  DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I 5 52  ? -55.170 -0.653  40.496 1.00 93.13  ? -21  DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I 5 52  ? -55.332 -2.008  40.010 1.00 93.30  ? -21  DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I 5 52  ? -55.775 -0.616  41.902 1.00 94.88  ? -21  DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I 5 52  ? -56.757 0.432   42.023 1.00 97.68  ? -21  DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I 5 52  ? -56.374 -2.008  42.117 1.00 94.17  ? -21  DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I 5 52  ? -56.387 -2.617  40.720 1.00 93.62  ? -21  DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I 5 52  ? -56.190 -4.101  40.706 1.00 93.62  ? -21  DT  I N1    1 
ATOM   7135  C  C2    . DT  I 5 52  ? -57.114 -4.902  40.055 1.00 93.56  ? -21  DT  I C2    1 
ATOM   7136  O  O2    . DT  I 5 52  ? -58.096 -4.472  39.472 1.00 93.52  ? -21  DT  I O2    1 
ATOM   7137  N  N3    . DT  I 5 52  ? -56.837 -6.249  40.104 1.00 93.66  ? -21  DT  I N3    1 
ATOM   7138  C  C4    . DT  I 5 52  ? -55.758 -6.863  40.729 1.00 93.60  ? -21  DT  I C4    1 
ATOM   7139  O  O4    . DT  I 5 52  ? -55.605 -8.083  40.711 1.00 93.89  ? -21  DT  I O4    1 
ATOM   7140  C  C5    . DT  I 5 52  ? -54.832 -5.970  41.393 1.00 93.37  ? -21  DT  I C5    1 
ATOM   7141  C  C7    . DT  I 5 52  ? -53.623 -6.504  42.109 1.00 93.14  ? -21  DT  I C7    1 
ATOM   7142  C  C6    . DT  I 5 52  ? -55.090 -4.654  41.347 1.00 93.57  ? -21  DT  I C6    1 
ATOM   7143  P  P     . DC  I 5 53  ? -57.397 0.854   43.441 1.00 100.03 ? -20  DC  I P     1 
ATOM   7144  O  OP1   . DC  I 5 53  ? -57.775 2.282   43.341 1.00 100.61 ? -20  DC  I OP1   1 
ATOM   7145  O  OP2   . DC  I 5 53  ? -56.506 0.427   44.547 1.00 99.99  ? -20  DC  I OP2   1 
ATOM   7146  O  "O5'" . DC  I 5 53  ? -58.721 -0.042  43.511 1.00 101.16 ? -20  DC  I "O5'" 1 
ATOM   7147  C  "C5'" . DC  I 5 53  ? -59.671 -0.052  42.445 1.00 103.62 ? -20  DC  I "C5'" 1 
ATOM   7148  C  "C4'" . DC  I 5 53  ? -60.676 -1.175  42.649 1.00 105.69 ? -20  DC  I "C4'" 1 
ATOM   7149  O  "O4'" . DC  I 5 53  ? -60.003 -2.445  42.443 1.00 105.97 ? -20  DC  I "O4'" 1 
ATOM   7150  C  "C3'" . DC  I 5 53  ? -61.297 -1.248  44.047 1.00 107.21 ? -20  DC  I "C3'" 1 
ATOM   7151  O  "O3'" . DC  I 5 53  ? -62.689 -1.532  43.954 1.00 109.46 ? -20  DC  I "O3'" 1 
ATOM   7152  C  "C2'" . DC  I 5 53  ? -60.542 -2.393  44.720 1.00 106.91 ? -20  DC  I "C2'" 1 
ATOM   7153  C  "C1'" . DC  I 5 53  ? -60.346 -3.305  43.512 1.00 106.57 ? -20  DC  I "C1'" 1 
ATOM   7154  N  N1    . DC  I 5 53  ? -59.321 -4.395  43.669 1.00 106.52 ? -20  DC  I N1    1 
ATOM   7155  C  C2    . DC  I 5 53  ? -59.568 -5.627  43.044 1.00 106.44 ? -20  DC  I C2    1 
ATOM   7156  O  O2    . DC  I 5 53  ? -60.605 -5.774  42.383 1.00 106.60 ? -20  DC  I O2    1 
ATOM   7157  N  N3    . DC  I 5 53  ? -58.659 -6.628  43.179 1.00 106.47 ? -20  DC  I N3    1 
ATOM   7158  C  C4    . DC  I 5 53  ? -57.547 -6.436  43.902 1.00 106.26 ? -20  DC  I C4    1 
ATOM   7159  N  N4    . DC  I 5 53  ? -56.692 -7.458  43.998 1.00 106.01 ? -20  DC  I N4    1 
ATOM   7160  C  C5    . DC  I 5 53  ? -57.271 -5.191  44.553 1.00 106.11 ? -20  DC  I C5    1 
ATOM   7161  C  C6    . DC  I 5 53  ? -58.177 -4.210  44.410 1.00 106.51 ? -20  DC  I C6    1 
ATOM   7162  P  P     . DA  I 5 54  ? -63.660 -1.217  45.190 1.00 111.50 ? -19  DA  I P     1 
ATOM   7163  O  OP1   . DA  I 5 54  ? -63.658 0.255   45.360 1.00 111.53 ? -19  DA  I OP1   1 
ATOM   7164  O  OP2   . DA  I 5 54  ? -63.286 -2.076  46.340 1.00 111.45 ? -19  DA  I OP2   1 
ATOM   7165  O  "O5'" . DA  I 5 54  ? -65.094 -1.709  44.663 1.00 112.27 ? -19  DA  I "O5'" 1 
ATOM   7166  C  "C5'" . DA  I 5 54  ? -65.205 -2.791  43.732 1.00 113.90 ? -19  DA  I "C5'" 1 
ATOM   7167  C  "C4'" . DA  I 5 54  ? -66.161 -3.891  44.187 1.00 115.28 ? -19  DA  I "C4'" 1 
ATOM   7168  O  "O4'" . DA  I 5 54  ? -65.450 -5.156  44.265 1.00 115.85 ? -19  DA  I "O4'" 1 
ATOM   7169  C  "C3'" . DA  I 5 54  ? -66.857 -3.743  45.538 1.00 115.79 ? -19  DA  I "C3'" 1 
ATOM   7170  O  "O3'" . DA  I 5 54  ? -68.146 -4.375  45.449 1.00 116.23 ? -19  DA  I "O3'" 1 
ATOM   7171  C  "C2'" . DA  I 5 54  ? -65.886 -4.450  46.489 1.00 116.09 ? -19  DA  I "C2'" 1 
ATOM   7172  C  "C1'" . DA  I 5 54  ? -65.318 -5.569  45.616 1.00 116.43 ? -19  DA  I "C1'" 1 
ATOM   7173  N  N9    . DA  I 5 54  ? -63.906 -5.868  45.875 1.00 117.20 ? -19  DA  I N9    1 
ATOM   7174  C  C8    . DA  I 5 54  ? -62.992 -5.079  46.529 1.00 117.15 ? -19  DA  I C8    1 
ATOM   7175  N  N7    . DA  I 5 54  ? -61.792 -5.598  46.616 1.00 117.06 ? -19  DA  I N7    1 
ATOM   7176  C  C5    . DA  I 5 54  ? -61.924 -6.819  45.975 1.00 117.29 ? -19  DA  I C5    1 
ATOM   7177  C  C6    . DA  I 5 54  ? -61.005 -7.861  45.727 1.00 117.39 ? -19  DA  I C6    1 
ATOM   7178  N  N6    . DA  I 5 54  ? -59.728 -7.804  46.121 1.00 117.32 ? -19  DA  I N6    1 
ATOM   7179  N  N1    . DA  I 5 54  ? -61.451 -8.955  45.058 1.00 117.44 ? -19  DA  I N1    1 
ATOM   7180  C  C2    . DA  I 5 54  ? -62.735 -9.005  44.666 1.00 117.49 ? -19  DA  I C2    1 
ATOM   7181  N  N3    . DA  I 5 54  ? -63.691 -8.087  44.843 1.00 117.58 ? -19  DA  I N3    1 
ATOM   7182  C  C4    . DA  I 5 54  ? -63.219 -7.008  45.510 1.00 117.46 ? -19  DA  I C4    1 
ATOM   7183  P  P     . DA  I 5 55  ? -68.974 -4.963  46.699 1.00 116.87 ? -18  DA  I P     1 
ATOM   7184  O  OP1   . DA  I 5 55  ? -70.401 -5.018  46.292 1.00 117.02 ? -18  DA  I OP1   1 
ATOM   7185  O  OP2   . DA  I 5 55  ? -68.600 -4.238  47.937 1.00 116.55 ? -18  DA  I OP2   1 
ATOM   7186  O  "O5'" . DA  I 5 55  ? -68.413 -6.459  46.810 1.00 116.98 ? -18  DA  I "O5'" 1 
ATOM   7187  C  "C5'" . DA  I 5 55  ? -68.726 -7.432  45.808 1.00 117.41 ? -18  DA  I "C5'" 1 
ATOM   7188  C  "C4'" . DA  I 5 55  ? -68.324 -8.823  46.273 1.00 117.68 ? -18  DA  I "C4'" 1 
ATOM   7189  O  "O4'" . DA  I 5 55  ? -66.894 -8.861  46.519 1.00 118.16 ? -18  DA  I "O4'" 1 
ATOM   7190  C  "C3'" . DA  I 5 55  ? -68.988 -9.303  47.560 1.00 117.79 ? -18  DA  I "C3'" 1 
ATOM   7191  O  "O3'" . DA  I 5 55  ? -69.323 -10.685 47.429 1.00 117.58 ? -18  DA  I "O3'" 1 
ATOM   7192  C  "C2'" . DA  I 5 55  ? -67.925 -9.058  48.633 1.00 117.81 ? -18  DA  I "C2'" 1 
ATOM   7193  C  "C1'" . DA  I 5 55  ? -66.634 -9.279  47.847 1.00 117.99 ? -18  DA  I "C1'" 1 
ATOM   7194  N  N9    . DA  I 5 55  ? -65.469 -8.549  48.360 1.00 117.83 ? -18  DA  I N9    1 
ATOM   7195  C  C8    . DA  I 5 55  ? -65.435 -7.298  48.918 1.00 117.64 ? -18  DA  I C8    1 
ATOM   7196  N  N7    . DA  I 5 55  ? -64.235 -6.909  49.287 1.00 117.37 ? -18  DA  I N7    1 
ATOM   7197  C  C5    . DA  I 5 55  ? -63.419 -7.976  48.947 1.00 117.21 ? -18  DA  I C5    1 
ATOM   7198  C  C6    . DA  I 5 55  ? -62.027 -8.201  49.075 1.00 116.87 ? -18  DA  I C6    1 
ATOM   7199  N  N6    . DA  I 5 55  ? -61.175 -7.318  49.604 1.00 116.54 ? -18  DA  I N6    1 
ATOM   7200  N  N1    . DA  I 5 55  ? -61.534 -9.380  48.636 1.00 116.65 ? -18  DA  I N1    1 
ATOM   7201  C  C2    . DA  I 5 55  ? -62.376 -10.274 48.101 1.00 116.96 ? -18  DA  I C2    1 
ATOM   7202  N  N3    . DA  I 5 55  ? -63.697 -10.179 47.929 1.00 117.40 ? -18  DA  I N3    1 
ATOM   7203  C  C4    . DA  I 5 55  ? -64.164 -8.996  48.376 1.00 117.51 ? -18  DA  I C4    1 
ATOM   7204  P  P     . DA  I 5 56  ? -70.295 -11.436 48.466 1.00 117.56 ? -17  DA  I P     1 
ATOM   7205  O  OP1   . DA  I 5 56  ? -71.392 -12.046 47.678 1.00 117.81 ? -17  DA  I OP1   1 
ATOM   7206  O  OP2   . DA  I 5 56  ? -70.631 -10.520 49.587 1.00 117.39 ? -17  DA  I OP2   1 
ATOM   7207  O  "O5'" . DA  I 5 56  ? -69.347 -12.604 49.033 1.00 116.64 ? -17  DA  I "O5'" 1 
ATOM   7208  C  "C5'" . DA  I 5 56  ? -68.622 -13.467 48.138 1.00 115.04 ? -17  DA  I "C5'" 1 
ATOM   7209  C  "C4'" . DA  I 5 56  ? -67.291 -13.938 48.722 1.00 113.75 ? -17  DA  I "C4'" 1 
ATOM   7210  O  "O4'" . DA  I 5 56  ? -66.402 -12.807 48.929 1.00 113.62 ? -17  DA  I "O4'" 1 
ATOM   7211  C  "C3'" . DA  I 5 56  ? -67.376 -14.667 50.066 1.00 112.67 ? -17  DA  I "C3'" 1 
ATOM   7212  O  "O3'" . DA  I 5 56  ? -67.141 -16.073 49.879 1.00 110.84 ? -17  DA  I "O3'" 1 
ATOM   7213  C  "C2'" . DA  I 5 56  ? -66.319 -13.997 50.953 1.00 112.88 ? -17  DA  I "C2'" 1 
ATOM   7214  C  "C1'" . DA  I 5 56  ? -65.517 -13.129 49.984 1.00 113.25 ? -17  DA  I "C1'" 1 
ATOM   7215  N  N9    . DA  I 5 56  ? -65.018 -11.903 50.614 1.00 113.25 ? -17  DA  I N9    1 
ATOM   7216  C  C8    . DA  I 5 56  ? -65.746 -10.799 50.962 1.00 113.22 ? -17  DA  I C8    1 
ATOM   7217  N  N7    . DA  I 5 56  ? -65.042 -9.842  51.517 1.00 113.13 ? -17  DA  I N7    1 
ATOM   7218  C  C5    . DA  I 5 56  ? -63.757 -10.352 51.543 1.00 113.19 ? -17  DA  I C5    1 
ATOM   7219  C  C6    . DA  I 5 56  ? -62.531 -9.826  52.013 1.00 113.15 ? -17  DA  I C6    1 
ATOM   7220  N  N6    . DA  I 5 56  ? -62.412 -8.616  52.568 1.00 113.03 ? -17  DA  I N6    1 
ATOM   7221  N  N1    . DA  I 5 56  ? -61.424 -10.592 51.890 1.00 113.20 ? -17  DA  I N1    1 
ATOM   7222  C  C2    . DA  I 5 56  ? -61.539 -11.805 51.331 1.00 113.23 ? -17  DA  I C2    1 
ATOM   7223  N  N3    . DA  I 5 56  ? -62.634 -12.407 50.858 1.00 113.32 ? -17  DA  I N3    1 
ATOM   7224  C  C4    . DA  I 5 56  ? -63.722 -11.623 50.992 1.00 113.24 ? -17  DA  I C4    1 
ATOM   7225  P  P     . DA  I 5 57  ? -67.154 -17.142 51.081 1.00 109.35 ? -16  DA  I P     1 
ATOM   7226  O  OP1   . DA  I 5 57  ? -67.448 -18.470 50.496 1.00 109.49 ? -16  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I 5 57  ? -67.997 -16.636 52.190 1.00 109.32 ? -16  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I 5 57  ? -65.628 -17.121 51.573 1.00 108.05 ? -16  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I 5 57  ? -64.559 -17.375 50.647 1.00 105.54 ? -16  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I 5 57  ? -63.193 -17.366 51.320 1.00 103.47 ? -16  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I 5 57  ? -62.804 -16.000 51.643 1.00 102.82 ? -16  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I 5 57  ? -63.080 -18.179 52.609 1.00 102.19 ? -16  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I 5 57  ? -61.895 -18.972 52.553 1.00 100.57 ? -16  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I 5 57  ? -63.021 -17.120 53.711 1.00 102.25 ? -16  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I 5 57  ? -62.377 -15.935 52.996 1.00 102.65 ? -16  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I 5 57  ? -62.737 -14.616 53.525 1.00 102.68 ? -16  DA  I N9    1 
ATOM   7237  C  C8    . DA  I 5 57  ? -63.991 -14.073 53.616 1.00 102.80 ? -16  DA  I C8    1 
ATOM   7238  N  N7    . DA  I 5 57  ? -64.012 -12.863 54.127 1.00 103.03 ? -16  DA  I N7    1 
ATOM   7239  C  C5    . DA  I 5 57  ? -62.680 -12.589 54.389 1.00 102.67 ? -16  DA  I C5    1 
ATOM   7240  C  C6    . DA  I 5 57  ? -62.023 -11.462 54.933 1.00 102.54 ? -16  DA  I C6    1 
ATOM   7241  N  N6    . DA  I 5 57  ? -62.659 -10.359 55.335 1.00 102.35 ? -16  DA  I N6    1 
ATOM   7242  N  N1    . DA  I 5 57  ? -60.679 -11.512 55.060 1.00 102.55 ? -16  DA  I N1    1 
ATOM   7243  C  C2    . DA  I 5 57  ? -60.031 -12.614 54.659 1.00 102.38 ? -16  DA  I C2    1 
ATOM   7244  N  N3    . DA  I 5 57  ? -60.538 -13.729 54.133 1.00 102.57 ? -16  DA  I N3    1 
ATOM   7245  C  C4    . DA  I 5 57  ? -61.880 -13.658 54.023 1.00 102.66 ? -16  DA  I C4    1 
ATOM   7246  P  P     . DG  I 5 58  ? -61.691 -20.311 53.412 1.00 99.12  ? -15  DG  I P     1 
ATOM   7247  O  OP1   . DG  I 5 58  ? -61.563 -21.434 52.458 1.00 98.61  ? -15  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I 5 58  ? -62.709 -20.357 54.490 1.00 99.03  ? -15  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I 5 58  ? -60.263 -20.098 54.109 1.00 97.90  ? -15  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I 5 58  ? -59.620 -18.824 54.115 1.00 95.70  ? -15  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I 5 58  ? -58.961 -18.486 55.448 1.00 94.18  ? -15  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I 5 58  ? -59.467 -17.207 55.912 1.00 93.72  ? -15  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I 5 58  ? -59.156 -19.440 56.627 1.00 93.30  ? -15  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I 5 58  ? -58.035 -19.330 57.509 1.00 91.54  ? -15  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I 5 58  ? -60.398 -18.859 57.292 1.00 93.97  ? -15  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I 5 58  ? -60.071 -17.370 57.181 1.00 94.00  ? -15  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I 5 58  ? -61.202 -16.442 57.252 1.00 94.53  ? -15  DG  I N9    1 
ATOM   7258  C  C8    . DG  I 5 58  ? -62.547 -16.701 57.076 1.00 94.38  ? -15  DG  I C8    1 
ATOM   7259  N  N7    . DG  I 5 58  ? -63.301 -15.643 57.199 1.00 94.29  ? -15  DG  I N7    1 
ATOM   7260  C  C5    . DG  I 5 58  ? -62.402 -14.620 57.475 1.00 94.35  ? -15  DG  I C5    1 
ATOM   7261  C  C6    . DG  I 5 58  ? -62.627 -13.242 57.712 1.00 94.62  ? -15  DG  I C6    1 
ATOM   7262  O  O6    . DG  I 5 58  ? -63.710 -12.640 57.721 1.00 95.41  ? -15  DG  I O6    1 
ATOM   7263  N  N1    . DG  I 5 58  ? -61.437 -12.545 57.955 1.00 94.40  ? -15  DG  I N1    1 
ATOM   7264  C  C2    . DG  I 5 58  ? -60.180 -13.120 57.969 1.00 93.99  ? -15  DG  I C2    1 
ATOM   7265  N  N2    . DG  I 5 58  ? -59.146 -12.306 58.216 1.00 93.49  ? -15  DG  I N2    1 
ATOM   7266  N  N3    . DG  I 5 58  ? -59.956 -14.410 57.750 1.00 93.59  ? -15  DG  I N3    1 
ATOM   7267  C  C4    . DG  I 5 58  ? -61.106 -15.095 57.511 1.00 94.27  ? -15  DG  I C4    1 
ATOM   7268  P  P     . DG  I 5 59  ? -56.793 -20.356 57.490 1.00 89.62  ? -14  DG  I P     1 
ATOM   7269  O  OP1   . DG  I 5 59  ? -56.602 -20.860 56.102 1.00 89.52  ? -14  DG  I OP1   1 
ATOM   7270  O  OP2   . DG  I 5 59  ? -56.962 -21.322 58.611 1.00 89.13  ? -14  DG  I OP2   1 
ATOM   7271  O  "O5'" . DG  I 5 59  ? -55.566 -19.394 57.848 1.00 87.75  ? -14  DG  I "O5'" 1 
ATOM   7272  C  "C5'" . DG  I 5 59  ? -55.104 -18.429 56.902 1.00 85.51  ? -14  DG  I "C5'" 1 
ATOM   7273  C  "C4'" . DG  I 5 59  ? -54.352 -17.283 57.569 1.00 83.96  ? -14  DG  I "C4'" 1 
ATOM   7274  O  "O4'" . DG  I 5 59  ? -55.268 -16.360 58.216 1.00 84.78  ? -14  DG  I "O4'" 1 
ATOM   7275  C  "C3'" . DG  I 5 59  ? -53.361 -17.620 58.671 1.00 82.26  ? -14  DG  I "C3'" 1 
ATOM   7276  O  "O3'" . DG  I 5 59  ? -52.419 -16.550 58.728 1.00 79.07  ? -14  DG  I "O3'" 1 
ATOM   7277  C  "C2'" . DG  I 5 59  ? -54.261 -17.638 59.904 1.00 83.35  ? -14  DG  I "C2'" 1 
ATOM   7278  C  "C1'" . DG  I 5 59  ? -55.160 -16.438 59.627 1.00 84.83  ? -14  DG  I "C1'" 1 
ATOM   7279  N  N9    . DG  I 5 59  ? -56.544 -16.536 60.070 1.00 86.25  ? -14  DG  I N9    1 
ATOM   7280  C  C8    . DG  I 5 59  ? -57.344 -17.652 60.036 1.00 86.96  ? -14  DG  I C8    1 
ATOM   7281  N  N7    . DG  I 5 59  ? -58.553 -17.435 60.470 1.00 87.88  ? -14  DG  I N7    1 
ATOM   7282  C  C5    . DG  I 5 59  ? -58.561 -16.085 60.804 1.00 87.72  ? -14  DG  I C5    1 
ATOM   7283  C  C6    . DG  I 5 59  ? -59.607 -15.278 61.327 1.00 87.90  ? -14  DG  I C6    1 
ATOM   7284  O  O6    . DG  I 5 59  ? -60.767 -15.628 61.594 1.00 87.94  ? -14  DG  I O6    1 
ATOM   7285  N  N1    . DG  I 5 59  ? -59.204 -13.953 61.527 1.00 87.65  ? -14  DG  I N1    1 
ATOM   7286  C  C2    . DG  I 5 59  ? -57.938 -13.472 61.248 1.00 87.48  ? -14  DG  I C2    1 
ATOM   7287  N  N2    . DG  I 5 59  ? -57.718 -12.172 61.494 1.00 86.93  ? -14  DG  I N2    1 
ATOM   7288  N  N3    . DG  I 5 59  ? -56.952 -14.220 60.753 1.00 87.15  ? -14  DG  I N3    1 
ATOM   7289  C  C4    . DG  I 5 59  ? -57.330 -15.512 60.557 1.00 87.05  ? -14  DG  I C4    1 
ATOM   7290  P  P     . DC  I 5 60  ? -51.034 -16.642 59.526 1.00 75.61  ? -13  DC  I P     1 
ATOM   7291  O  OP1   . DC  I 5 60  ? -49.986 -16.362 58.528 1.00 75.40  ? -13  DC  I OP1   1 
ATOM   7292  O  OP2   . DC  I 5 60  ? -50.998 -17.886 60.328 1.00 75.53  ? -13  DC  I OP2   1 
ATOM   7293  O  "O5'" . DC  I 5 60  ? -51.104 -15.427 60.568 1.00 75.37  ? -13  DC  I "O5'" 1 
ATOM   7294  C  "C5'" . DC  I 5 60  ? -51.390 -14.087 60.149 1.00 74.81  ? -13  DC  I "C5'" 1 
ATOM   7295  C  "C4'" . DC  I 5 60  ? -51.928 -13.242 61.296 1.00 74.64  ? -13  DC  I "C4'" 1 
ATOM   7296  O  "O4'" . DC  I 5 60  ? -53.234 -13.728 61.704 1.00 74.61  ? -13  DC  I "O4'" 1 
ATOM   7297  C  "C3'" . DC  I 5 60  ? -51.084 -13.220 62.569 1.00 74.63  ? -13  DC  I "C3'" 1 
ATOM   7298  O  "O3'" . DC  I 5 60  ? -51.109 -11.925 63.120 1.00 74.40  ? -13  DC  I "O3'" 1 
ATOM   7299  C  "C2'" . DC  I 5 60  ? -51.796 -14.207 63.495 1.00 74.68  ? -13  DC  I "C2'" 1 
ATOM   7300  C  "C1'" . DC  I 5 60  ? -53.249 -13.970 63.100 1.00 74.57  ? -13  DC  I "C1'" 1 
ATOM   7301  N  N1    . DC  I 5 60  ? -54.207 -15.093 63.351 1.00 74.79  ? -13  DC  I N1    1 
ATOM   7302  C  C2    . DC  I 5 60  ? -55.489 -14.805 63.853 1.00 74.73  ? -13  DC  I C2    1 
ATOM   7303  O  O2    . DC  I 5 60  ? -55.785 -13.626 64.091 1.00 74.05  ? -13  DC  I O2    1 
ATOM   7304  N  N3    . DC  I 5 60  ? -56.362 -15.832 64.065 1.00 74.62  ? -13  DC  I N3    1 
ATOM   7305  C  C4    . DC  I 5 60  ? -55.999 -17.094 63.793 1.00 75.51  ? -13  DC  I C4    1 
ATOM   7306  N  N4    . DC  I 5 60  ? -56.871 -18.090 64.008 1.00 75.88  ? -13  DC  I N4    1 
ATOM   7307  C  C5    . DC  I 5 60  ? -54.700 -17.401 63.282 1.00 75.41  ? -13  DC  I C5    1 
ATOM   7308  C  C6    . DC  I 5 60  ? -53.851 -16.383 63.074 1.00 74.90  ? -13  DC  I C6    1 
ATOM   7309  P  P     . DA  I 5 61  ? -49.758 -11.152 63.459 1.00 74.82  ? -12  DA  I P     1 
ATOM   7310  O  OP1   . DA  I 5 61  ? -49.349 -10.387 62.267 1.00 74.55  ? -12  DA  I OP1   1 
ATOM   7311  O  OP2   . DA  I 5 61  ? -48.822 -12.095 64.095 1.00 75.56  ? -12  DA  I OP2   1 
ATOM   7312  O  "O5'" . DA  I 5 61  ? -50.202 -10.128 64.600 1.00 76.84  ? -12  DA  I "O5'" 1 
ATOM   7313  C  "C5'" . DA  I 5 61  ? -51.067 -9.033  64.315 1.00 79.06  ? -12  DA  I "C5'" 1 
ATOM   7314  C  "C4'" . DA  I 5 61  ? -51.978 -8.794  65.503 1.00 80.72  ? -12  DA  I "C4'" 1 
ATOM   7315  O  "O4'" . DA  I 5 61  ? -52.838 -9.945  65.702 1.00 81.11  ? -12  DA  I "O4'" 1 
ATOM   7316  C  "C3'" . DA  I 5 61  ? -51.255 -8.562  66.822 1.00 82.12  ? -12  DA  I "C3'" 1 
ATOM   7317  O  "O3'" . DA  I 5 61  ? -51.822 -7.411  67.410 1.00 84.61  ? -12  DA  I "O3'" 1 
ATOM   7318  C  "C2'" . DA  I 5 61  ? -51.513 -9.827  67.645 1.00 81.72  ? -12  DA  I "C2'" 1 
ATOM   7319  C  "C1'" . DA  I 5 61  ? -52.824 -10.337 67.057 1.00 81.47  ? -12  DA  I "C1'" 1 
ATOM   7320  N  N9    . DA  I 5 61  ? -53.000 -11.784 67.048 1.00 82.28  ? -12  DA  I N9    1 
ATOM   7321  C  C8    . DA  I 5 61  ? -52.077 -12.751 66.749 1.00 81.73  ? -12  DA  I C8    1 
ATOM   7322  N  N7    . DA  I 5 61  ? -52.549 -13.973 66.815 1.00 81.92  ? -12  DA  I N7    1 
ATOM   7323  C  C5    . DA  I 5 61  ? -53.874 -13.796 67.170 1.00 83.00  ? -12  DA  I C5    1 
ATOM   7324  C  C6    . DA  I 5 61  ? -54.933 -14.699 67.405 1.00 83.87  ? -12  DA  I C6    1 
ATOM   7325  N  N6    . DA  I 5 61  ? -54.809 -16.027 67.308 1.00 84.24  ? -12  DA  I N6    1 
ATOM   7326  N  N1    . DA  I 5 61  ? -56.136 -14.183 67.749 1.00 84.59  ? -12  DA  I N1    1 
ATOM   7327  C  C2    . DA  I 5 61  ? -56.279 -12.853 67.848 1.00 84.12  ? -12  DA  I C2    1 
ATOM   7328  N  N3    . DA  I 5 61  ? -55.362 -11.907 67.655 1.00 83.34  ? -12  DA  I N3    1 
ATOM   7329  C  C4    . DA  I 5 61  ? -54.173 -12.450 67.317 1.00 83.18  ? -12  DA  I C4    1 
ATOM   7330  P  P     . DT  I 5 62  ? -51.068 -6.556  68.530 1.00 86.57  ? -11  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5 62  ? -51.520 -5.155  68.370 1.00 86.48  ? -11  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5 62  ? -49.616 -6.863  68.508 1.00 86.14  ? -11  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5 62  ? -51.676 -7.140  69.896 1.00 88.32  ? -11  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5 62  ? -53.091 -7.194  70.098 1.00 90.87  ? -11  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5 62  ? -53.491 -8.228  71.138 1.00 92.95  ? -11  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5 62  ? -53.587 -9.533  70.523 1.00 93.38  ? -11  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5 62  ? -52.533 -8.440  72.304 1.00 94.17  ? -11  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5 62  ? -52.859 -7.520  73.346 1.00 96.21  ? -11  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5 62  ? -52.813 -9.888  72.718 1.00 94.17  ? -11  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5 62  ? -53.633 -10.475 71.569 1.00 94.10  ? -11  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5 62  ? -53.127 -11.785 71.056 1.00 94.58  ? -11  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5 62  ? -54.022 -12.807 70.782 1.00 94.99  ? -11  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5 62  ? -55.230 -12.722 70.931 1.00 95.64  ? -11  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5 62  ? -53.441 -13.962 70.321 1.00 95.03  ? -11  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5 62  ? -52.093 -14.193 70.106 1.00 94.74  ? -11  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5 62  ? -51.688 -15.271 69.685 1.00 95.27  ? -11  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5 62  ? -51.213 -13.086 70.410 1.00 94.64  ? -11  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5 62  ? -49.727 -13.203 70.224 1.00 94.41  ? -11  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5 62  ? -51.766 -11.953 70.862 1.00 94.48  ? -11  DT  I C6    1 
ATOM   7350  P  P     . DG  I 5 63  ? -51.907 -7.219  74.608 1.00 98.09  ? -10  DG  I P     1 
ATOM   7351  O  OP1   . DG  I 5 63  ? -51.680 -5.759  74.611 1.00 97.96  ? -10  DG  I OP1   1 
ATOM   7352  O  OP2   . DG  I 5 63  ? -50.739 -8.128  74.604 1.00 98.12  ? -10  DG  I OP2   1 
ATOM   7353  O  "O5'" . DG  I 5 63  ? -52.803 -7.578  75.889 1.00 98.73  ? -10  DG  I "O5'" 1 
ATOM   7354  C  "C5'" . DG  I 5 63  ? -53.792 -8.611  75.855 1.00 100.05 ? -10  DG  I "C5'" 1 
ATOM   7355  C  "C4'" . DG  I 5 63  ? -53.870 -9.395  77.161 1.00 101.19 ? -10  DG  I "C4'" 1 
ATOM   7356  O  "O4'" . DG  I 5 63  ? -53.696 -10.813 76.887 1.00 101.62 ? -10  DG  I "O4'" 1 
ATOM   7357  C  "C3'" . DG  I 5 63  ? -52.844 -9.072  78.250 1.00 101.67 ? -10  DG  I "C3'" 1 
ATOM   7358  O  "O3'" . DG  I 5 63  ? -53.496 -9.259  79.528 1.00 101.98 ? -10  DG  I "O3'" 1 
ATOM   7359  C  "C2'" . DG  I 5 63  ? -51.699 -10.039 77.927 1.00 101.62 ? -10  DG  I "C2'" 1 
ATOM   7360  C  "C1'" . DG  I 5 63  ? -52.428 -11.252 77.351 1.00 101.58 ? -10  DG  I "C1'" 1 
ATOM   7361  N  N9    . DG  I 5 63  ? -51.747 -11.951 76.256 1.00 101.47 ? -10  DG  I N9    1 
ATOM   7362  C  C8    . DG  I 5 63  ? -50.810 -11.455 75.375 1.00 101.33 ? -10  DG  I C8    1 
ATOM   7363  N  N7    . DG  I 5 63  ? -50.393 -12.332 74.503 1.00 101.18 ? -10  DG  I N7    1 
ATOM   7364  C  C5    . DG  I 5 63  ? -51.096 -13.486 74.819 1.00 101.40 ? -10  DG  I C5    1 
ATOM   7365  C  C6    . DG  I 5 63  ? -51.068 -14.774 74.223 1.00 101.61 ? -10  DG  I C6    1 
ATOM   7366  O  O6    . DG  I 5 63  ? -50.391 -15.162 73.261 1.00 101.56 ? -10  DG  I O6    1 
ATOM   7367  N  N1    . DG  I 5 63  ? -51.942 -15.664 74.853 1.00 102.00 ? -10  DG  I N1    1 
ATOM   7368  C  C2    . DG  I 5 63  ? -52.745 -15.345 75.927 1.00 101.74 ? -10  DG  I C2    1 
ATOM   7369  N  N2    . DG  I 5 63  ? -53.524 -16.325 76.405 1.00 101.79 ? -10  DG  I N2    1 
ATOM   7370  N  N3    . DG  I 5 63  ? -52.781 -14.145 76.494 1.00 101.47 ? -10  DG  I N3    1 
ATOM   7371  C  C4    . DG  I 5 63  ? -51.935 -13.266 75.894 1.00 101.46 ? -10  DG  I C4    1 
ATOM   7372  P  P     . DT  I 5 64  ? -52.814 -9.779  80.889 1.00 102.24 ? -9   DT  I P     1 
ATOM   7373  O  OP1   . DT  I 5 64  ? -53.731 -9.405  81.990 1.00 102.44 ? -9   DT  I OP1   1 
ATOM   7374  O  OP2   . DT  I 5 64  ? -51.396 -9.342  80.942 1.00 102.07 ? -9   DT  I OP2   1 
ATOM   7375  O  "O5'" . DT  I 5 64  ? -52.865 -11.373 80.725 1.00 101.77 ? -9   DT  I "O5'" 1 
ATOM   7376  C  "C5'" . DT  I 5 64  ? -54.125 -12.040 80.545 1.00 101.49 ? -9   DT  I "C5'" 1 
ATOM   7377  C  "C4'" . DT  I 5 64  ? -54.063 -13.484 81.023 1.00 101.25 ? -9   DT  I "C4'" 1 
ATOM   7378  O  "O4'" . DT  I 5 64  ? -53.440 -14.312 79.997 1.00 101.06 ? -9   DT  I "O4'" 1 
ATOM   7379  C  "C3'" . DT  I 5 64  ? -53.266 -13.693 82.310 1.00 101.17 ? -9   DT  I "C3'" 1 
ATOM   7380  O  "O3'" . DT  I 5 64  ? -53.989 -14.516 83.235 1.00 100.56 ? -9   DT  I "O3'" 1 
ATOM   7381  C  "C2'" . DT  I 5 64  ? -51.949 -14.326 81.848 1.00 101.25 ? -9   DT  I "C2'" 1 
ATOM   7382  C  "C1'" . DT  I 5 64  ? -52.287 -14.962 80.503 1.00 100.85 ? -9   DT  I "C1'" 1 
ATOM   7383  N  N1    . DT  I 5 64  ? -51.171 -14.895 79.484 1.00 100.60 ? -9   DT  I N1    1 
ATOM   7384  C  C2    . DT  I 5 64  ? -50.856 -16.024 78.750 1.00 100.49 ? -9   DT  I C2    1 
ATOM   7385  O  O2    . DT  I 5 64  ? -51.434 -17.092 78.873 1.00 100.70 ? -9   DT  I O2    1 
ATOM   7386  N  N3    . DT  I 5 64  ? -49.826 -15.856 77.852 1.00 100.30 ? -9   DT  I N3    1 
ATOM   7387  C  C4    . DT  I 5 64  ? -49.089 -14.706 77.614 1.00 100.11 ? -9   DT  I C4    1 
ATOM   7388  O  O4    . DT  I 5 64  ? -48.186 -14.671 76.782 1.00 99.69  ? -9   DT  I O4    1 
ATOM   7389  C  C5    . DT  I 5 64  ? -49.464 -13.562 78.413 1.00 100.04 ? -9   DT  I C5    1 
ATOM   7390  C  C7    . DT  I 5 64  ? -48.747 -12.253 78.257 1.00 99.64  ? -9   DT  I C7    1 
ATOM   7391  C  C6    . DT  I 5 64  ? -50.468 -13.712 79.293 1.00 100.47 ? -9   DT  I C6    1 
ATOM   7392  P  P     . DT  I 5 65  ? -53.344 -14.933 84.648 1.00 100.72 ? -8   DT  I P     1 
ATOM   7393  O  OP1   . DT  I 5 65  ? -54.462 -15.272 85.564 1.00 100.65 ? -8   DT  I OP1   1 
ATOM   7394  O  OP2   . DT  I 5 65  ? -52.332 -13.919 85.042 1.00 100.27 ? -8   DT  I OP2   1 
ATOM   7395  O  "O5'" . DT  I 5 65  ? -52.549 -16.274 84.288 1.00 99.15  ? -8   DT  I "O5'" 1 
ATOM   7396  C  "C5'" . DT  I 5 65  ? -53.247 -17.410 83.789 1.00 97.55  ? -8   DT  I "C5'" 1 
ATOM   7397  C  "C4'" . DT  I 5 65  ? -52.259 -18.517 83.473 1.00 96.25  ? -8   DT  I "C4'" 1 
ATOM   7398  O  "O4'" . DT  I 5 65  ? -51.409 -18.104 82.372 1.00 95.50  ? -8   DT  I "O4'" 1 
ATOM   7399  C  "C3'" . DT  I 5 65  ? -51.330 -18.886 84.630 1.00 95.22  ? -8   DT  I "C3'" 1 
ATOM   7400  O  "O3'" . DT  I 5 65  ? -51.499 -20.265 84.957 1.00 93.65  ? -8   DT  I "O3'" 1 
ATOM   7401  C  "C2'" . DT  I 5 65  ? -49.923 -18.563 84.115 1.00 95.41  ? -8   DT  I "C2'" 1 
ATOM   7402  C  "C1'" . DT  I 5 65  ? -50.112 -18.612 82.601 1.00 95.01  ? -8   DT  I "C1'" 1 
ATOM   7403  N  N1    . DT  I 5 65  ? -49.139 -17.819 81.772 1.00 94.37  ? -8   DT  I N1    1 
ATOM   7404  C  C2    . DT  I 5 65  ? -48.625 -18.380 80.610 1.00 94.10  ? -8   DT  I C2    1 
ATOM   7405  O  O2    . DT  I 5 65  ? -48.897 -19.498 80.205 1.00 94.37  ? -8   DT  I O2    1 
ATOM   7406  N  N3    . DT  I 5 65  ? -47.754 -17.577 79.917 1.00 93.54  ? -8   DT  I N3    1 
ATOM   7407  C  C4    . DT  I 5 65  ? -47.351 -16.298 80.249 1.00 93.36  ? -8   DT  I C4    1 
ATOM   7408  O  O4    . DT  I 5 65  ? -46.562 -15.677 79.543 1.00 92.57  ? -8   DT  I O4    1 
ATOM   7409  C  C5    . DT  I 5 65  ? -47.925 -15.764 81.470 1.00 93.69  ? -8   DT  I C5    1 
ATOM   7410  C  C7    . DT  I 5 65  ? -47.572 -14.384 81.946 1.00 93.35  ? -8   DT  I C7    1 
ATOM   7411  C  C6    . DT  I 5 65  ? -48.780 -16.538 82.161 1.00 93.80  ? -8   DT  I C6    1 
ATOM   7412  P  P     . DC  I 5 66  ? -50.902 -20.857 86.318 1.00 93.05  ? -7   DC  I P     1 
ATOM   7413  O  OP1   . DC  I 5 66  ? -51.859 -21.853 86.854 1.00 92.88  ? -7   DC  I OP1   1 
ATOM   7414  O  OP2   . DC  I 5 66  ? -50.443 -19.723 87.153 1.00 93.12  ? -7   DC  I OP2   1 
ATOM   7415  O  "O5'" . DC  I 5 66  ? -49.579 -21.611 85.832 1.00 91.39  ? -7   DC  I "O5'" 1 
ATOM   7416  C  "C5'" . DC  I 5 66  ? -49.629 -22.714 84.926 1.00 88.87  ? -7   DC  I "C5'" 1 
ATOM   7417  C  "C4'" . DC  I 5 66  ? -48.258 -22.923 84.306 1.00 86.54  ? -7   DC  I "C4'" 1 
ATOM   7418  O  "O4'" . DC  I 5 66  ? -47.819 -21.691 83.671 1.00 85.93  ? -7   DC  I "O4'" 1 
ATOM   7419  C  "C3'" . DC  I 5 66  ? -47.169 -23.306 85.308 1.00 85.00  ? -7   DC  I "C3'" 1 
ATOM   7420  O  "O3'" . DC  I 5 66  ? -46.450 -24.416 84.827 1.00 83.12  ? -7   DC  I "O3'" 1 
ATOM   7421  C  "C2'" . DC  I 5 66  ? -46.278 -22.073 85.382 1.00 84.91  ? -7   DC  I "C2'" 1 
ATOM   7422  C  "C1'" . DC  I 5 66  ? -46.453 -21.509 83.976 1.00 85.44  ? -7   DC  I "C1'" 1 
ATOM   7423  N  N1    . DC  I 5 66  ? -46.059 -20.066 83.819 1.00 85.27  ? -7   DC  I N1    1 
ATOM   7424  C  C2    . DC  I 5 66  ? -45.671 -19.579 82.555 1.00 84.85  ? -7   DC  I C2    1 
ATOM   7425  O  O2    . DC  I 5 66  ? -45.667 -20.335 81.576 1.00 84.43  ? -7   DC  I O2    1 
ATOM   7426  N  N3    . DC  I 5 66  ? -45.313 -18.274 82.439 1.00 84.49  ? -7   DC  I N3    1 
ATOM   7427  C  C4    . DC  I 5 66  ? -45.324 -17.478 83.512 1.00 84.61  ? -7   DC  I C4    1 
ATOM   7428  N  N4    . DC  I 5 66  ? -44.961 -16.206 83.345 1.00 85.23  ? -7   DC  I N4    1 
ATOM   7429  C  C5    . DC  I 5 66  ? -45.707 -17.946 84.803 1.00 84.65  ? -7   DC  I C5    1 
ATOM   7430  C  C6    . DC  I 5 66  ? -46.061 -19.233 84.907 1.00 85.14  ? -7   DC  I C6    1 
ATOM   7431  P  P     . DA  I 5 67  ? -46.669 -25.847 85.495 1.00 82.33  ? -6   DA  I P     1 
ATOM   7432  O  OP1   . DA  I 5 67  ? -48.125 -26.032 85.709 1.00 82.28  ? -6   DA  I OP1   1 
ATOM   7433  O  OP2   . DA  I 5 67  ? -45.722 -25.918 86.634 1.00 82.41  ? -6   DA  I OP2   1 
ATOM   7434  O  "O5'" . DA  I 5 67  ? -46.167 -26.871 84.358 1.00 80.29  ? -6   DA  I "O5'" 1 
ATOM   7435  C  "C5'" . DA  I 5 67  ? -46.562 -26.701 82.987 1.00 76.83  ? -6   DA  I "C5'" 1 
ATOM   7436  C  "C4'" . DA  I 5 67  ? -45.440 -26.877 81.962 1.00 73.72  ? -6   DA  I "C4'" 1 
ATOM   7437  O  "O4'" . DA  I 5 67  ? -44.757 -25.623 81.720 1.00 72.31  ? -6   DA  I "O4'" 1 
ATOM   7438  C  "C3'" . DA  I 5 67  ? -44.339 -27.882 82.268 1.00 72.54  ? -6   DA  I "C3'" 1 
ATOM   7439  O  "O3'" . DA  I 5 67  ? -43.953 -28.489 81.055 1.00 71.89  ? -6   DA  I "O3'" 1 
ATOM   7440  C  "C2'" . DA  I 5 67  ? -43.199 -27.034 82.822 1.00 72.09  ? -6   DA  I "C2'" 1 
ATOM   7441  C  "C1'" . DA  I 5 67  ? -43.393 -25.708 82.096 1.00 71.97  ? -6   DA  I "C1'" 1 
ATOM   7442  N  N9    . DA  I 5 67  ? -43.136 -24.548 82.936 1.00 71.24  ? -6   DA  I N9    1 
ATOM   7443  C  C8    . DA  I 5 67  ? -43.414 -24.438 84.266 1.00 71.72  ? -6   DA  I C8    1 
ATOM   7444  N  N7    . DA  I 5 67  ? -43.094 -23.277 84.784 1.00 71.78  ? -6   DA  I N7    1 
ATOM   7445  C  C5    . DA  I 5 67  ? -42.579 -22.578 83.720 1.00 71.05  ? -6   DA  I C5    1 
ATOM   7446  C  C6    . DA  I 5 67  ? -42.062 -21.276 83.619 1.00 71.72  ? -6   DA  I C6    1 
ATOM   7447  N  N6    . DA  I 5 67  ? -41.997 -20.447 84.665 1.00 72.46  ? -6   DA  I N6    1 
ATOM   7448  N  N1    . DA  I 5 67  ? -41.615 -20.860 82.410 1.00 71.40  ? -6   DA  I N1    1 
ATOM   7449  C  C2    . DA  I 5 67  ? -41.692 -21.704 81.370 1.00 70.55  ? -6   DA  I C2    1 
ATOM   7450  N  N3    . DA  I 5 67  ? -42.160 -22.955 81.353 1.00 71.05  ? -6   DA  I N3    1 
ATOM   7451  C  C4    . DA  I 5 67  ? -42.594 -23.340 82.569 1.00 71.10  ? -6   DA  I C4    1 
ATOM   7452  P  P     . DG  I 5 68  ? -42.916 -29.710 81.035 1.00 72.22  ? -5   DG  I P     1 
ATOM   7453  O  OP1   . DG  I 5 68  ? -43.291 -30.602 79.919 1.00 72.57  ? -5   DG  I OP1   1 
ATOM   7454  O  OP2   . DG  I 5 68  ? -42.745 -30.269 82.393 1.00 72.59  ? -5   DG  I OP2   1 
ATOM   7455  O  "O5'" . DG  I 5 68  ? -41.551 -28.986 80.686 1.00 71.16  ? -5   DG  I "O5'" 1 
ATOM   7456  C  "C5'" . DG  I 5 68  ? -41.418 -28.169 79.537 1.00 69.78  ? -5   DG  I "C5'" 1 
ATOM   7457  C  "C4'" . DG  I 5 68  ? -40.105 -27.414 79.626 1.00 68.93  ? -5   DG  I "C4'" 1 
ATOM   7458  O  "O4'" . DG  I 5 68  ? -40.260 -26.284 80.523 1.00 68.86  ? -5   DG  I "O4'" 1 
ATOM   7459  C  "C3'" . DG  I 5 68  ? -38.923 -28.219 80.177 1.00 68.30  ? -5   DG  I "C3'" 1 
ATOM   7460  O  "O3'" . DG  I 5 68  ? -37.729 -27.865 79.502 1.00 67.12  ? -5   DG  I "O3'" 1 
ATOM   7461  C  "C2'" . DG  I 5 68  ? -38.825 -27.748 81.620 1.00 67.61  ? -5   DG  I "C2'" 1 
ATOM   7462  C  "C1'" . DG  I 5 68  ? -39.136 -26.280 81.380 1.00 67.94  ? -5   DG  I "C1'" 1 
ATOM   7463  N  N9    . DG  I 5 68  ? -39.375 -25.520 82.603 1.00 67.78  ? -5   DG  I N9    1 
ATOM   7464  C  C8    . DG  I 5 68  ? -39.886 -25.982 83.793 1.00 67.92  ? -5   DG  I C8    1 
ATOM   7465  N  N7    . DG  I 5 68  ? -39.964 -25.066 84.714 1.00 68.11  ? -5   DG  I N7    1 
ATOM   7466  C  C5    . DG  I 5 68  ? -39.468 -23.928 84.102 1.00 67.93  ? -5   DG  I C5    1 
ATOM   7467  C  C6    . DG  I 5 68  ? -39.307 -22.615 84.613 1.00 68.13  ? -5   DG  I C6    1 
ATOM   7468  O  O6    . DG  I 5 68  ? -39.585 -22.201 85.743 1.00 68.63  ? -5   DG  I O6    1 
ATOM   7469  N  N1    . DG  I 5 68  ? -38.768 -21.741 83.669 1.00 67.37  ? -5   DG  I N1    1 
ATOM   7470  C  C2    . DG  I 5 68  ? -38.423 -22.106 82.388 1.00 67.27  ? -5   DG  I C2    1 
ATOM   7471  N  N2    . DG  I 5 68  ? -37.918 -21.131 81.624 1.00 67.14  ? -5   DG  I N2    1 
ATOM   7472  N  N3    . DG  I 5 68  ? -38.569 -23.333 81.890 1.00 66.79  ? -5   DG  I N3    1 
ATOM   7473  C  C4    . DG  I 5 68  ? -39.097 -24.190 82.801 1.00 67.57  ? -5   DG  I C4    1 
ATOM   7474  P  P     . DC  I 5 69  ? -37.119 -28.750 78.316 1.00 66.49  ? -4   DC  I P     1 
ATOM   7475  O  OP1   . DC  I 5 69  ? -38.202 -29.057 77.343 1.00 65.95  ? -4   DC  I OP1   1 
ATOM   7476  O  OP2   . DC  I 5 69  ? -36.295 -29.834 78.913 1.00 65.16  ? -4   DC  I OP2   1 
ATOM   7477  O  "O5'" . DC  I 5 69  ? -36.120 -27.671 77.675 1.00 64.22  ? -4   DC  I "O5'" 1 
ATOM   7478  C  "C5'" . DC  I 5 69  ? -36.676 -26.519 77.040 1.00 61.36  ? -4   DC  I "C5'" 1 
ATOM   7479  C  "C4'" . DC  I 5 69  ? -35.970 -25.255 77.486 1.00 58.87  ? -4   DC  I "C4'" 1 
ATOM   7480  O  "O4'" . DC  I 5 69  ? -36.331 -24.926 78.852 1.00 58.93  ? -4   DC  I "O4'" 1 
ATOM   7481  C  "C3'" . DC  I 5 69  ? -34.453 -25.359 77.453 1.00 56.67  ? -4   DC  I "C3'" 1 
ATOM   7482  O  "O3'" . DC  I 5 69  ? -33.892 -24.381 76.556 1.00 53.77  ? -4   DC  I "O3'" 1 
ATOM   7483  C  "C2'" . DC  I 5 69  ? -34.023 -25.118 78.899 1.00 57.56  ? -4   DC  I "C2'" 1 
ATOM   7484  C  "C1'" . DC  I 5 69  ? -35.205 -24.378 79.503 1.00 57.98  ? -4   DC  I "C1'" 1 
ATOM   7485  N  N1    . DC  I 5 69  ? -35.363 -24.603 80.972 1.00 58.02  ? -4   DC  I N1    1 
ATOM   7486  C  C2    . DC  I 5 69  ? -35.275 -23.531 81.875 1.00 58.56  ? -4   DC  I C2    1 
ATOM   7487  O  O2    . DC  I 5 69  ? -35.058 -22.387 81.475 1.00 59.24  ? -4   DC  I O2    1 
ATOM   7488  N  N3    . DC  I 5 69  ? -35.425 -23.768 83.197 1.00 59.26  ? -4   DC  I N3    1 
ATOM   7489  C  C4    . DC  I 5 69  ? -35.654 -25.008 83.634 1.00 59.79  ? -4   DC  I C4    1 
ATOM   7490  N  N4    . DC  I 5 69  ? -35.803 -25.179 84.953 1.00 60.94  ? -4   DC  I N4    1 
ATOM   7491  C  C5    . DC  I 5 69  ? -35.739 -26.122 82.742 1.00 59.33  ? -4   DC  I C5    1 
ATOM   7492  C  C6    . DC  I 5 69  ? -35.588 -25.873 81.435 1.00 58.71  ? -4   DC  I C6    1 
ATOM   7493  P  P     . DT  I 5 70  ? -32.317 -24.417 76.199 1.00 49.01  ? -3   DT  I P     1 
ATOM   7494  O  OP1   . DT  I 5 70  ? -32.177 -24.103 74.766 1.00 50.88  ? -3   DT  I OP1   1 
ATOM   7495  O  OP2   . DT  I 5 70  ? -31.709 -25.643 76.767 1.00 48.52  ? -3   DT  I OP2   1 
ATOM   7496  O  "O5'" . DT  I 5 70  ? -31.766 -23.177 77.006 1.00 49.57  ? -3   DT  I "O5'" 1 
ATOM   7497  C  "C5'" . DT  I 5 70  ? -32.216 -21.872 76.690 1.00 51.62  ? -3   DT  I "C5'" 1 
ATOM   7498  C  "C4'" . DT  I 5 70  ? -31.701 -20.900 77.727 1.00 53.71  ? -3   DT  I "C4'" 1 
ATOM   7499  O  "O4'" . DT  I 5 70  ? -32.087 -21.329 79.059 1.00 55.98  ? -3   DT  I "O4'" 1 
ATOM   7500  C  "C3'" . DT  I 5 70  ? -30.188 -20.797 77.760 1.00 55.19  ? -3   DT  I "C3'" 1 
ATOM   7501  O  "O3'" . DT  I 5 70  ? -29.883 -19.437 77.868 1.00 56.85  ? -3   DT  I "O3'" 1 
ATOM   7502  C  "C2'" . DT  I 5 70  ? -29.753 -21.577 79.000 1.00 55.67  ? -3   DT  I "C2'" 1 
ATOM   7503  C  "C1'" . DT  I 5 70  ? -30.958 -21.398 79.913 1.00 55.95  ? -3   DT  I "C1'" 1 
ATOM   7504  N  N1    . DT  I 5 70  ? -31.208 -22.483 80.915 1.00 56.67  ? -3   DT  I N1    1 
ATOM   7505  C  C2    . DT  I 5 70  ? -31.476 -22.123 82.225 1.00 57.48  ? -3   DT  I C2    1 
ATOM   7506  O  O2    . DT  I 5 70  ? -31.505 -20.960 82.607 1.00 58.12  ? -3   DT  I O2    1 
ATOM   7507  N  N3    . DT  I 5 70  ? -31.711 -23.176 83.077 1.00 56.72  ? -3   DT  I N3    1 
ATOM   7508  C  C4    . DT  I 5 70  ? -31.700 -24.520 82.764 1.00 57.75  ? -3   DT  I C4    1 
ATOM   7509  O  O4    . DT  I 5 70  ? -31.917 -25.388 83.605 1.00 58.34  ? -3   DT  I O4    1 
ATOM   7510  C  C5    . DT  I 5 70  ? -31.413 -24.830 81.378 1.00 58.41  ? -3   DT  I C5    1 
ATOM   7511  C  C7    . DT  I 5 70  ? -31.371 -26.258 80.914 1.00 58.24  ? -3   DT  I C7    1 
ATOM   7512  C  C6    . DT  I 5 70  ? -31.186 -23.810 80.529 1.00 57.48  ? -3   DT  I C6    1 
ATOM   7513  P  P     . DG  I 5 71  ? -28.432 -18.886 77.475 1.00 57.13  ? -2   DG  I P     1 
ATOM   7514  O  OP1   . DG  I 5 71  ? -28.633 -17.605 76.783 1.00 56.14  ? -2   DG  I OP1   1 
ATOM   7515  O  OP2   . DG  I 5 71  ? -27.652 -19.993 76.895 1.00 56.50  ? -2   DG  I OP2   1 
ATOM   7516  O  "O5'" . DG  I 5 71  ? -27.737 -18.554 78.870 1.00 59.48  ? -2   DG  I "O5'" 1 
ATOM   7517  C  "C5'" . DG  I 5 71  ? -28.237 -17.552 79.737 1.00 61.44  ? -2   DG  I "C5'" 1 
ATOM   7518  C  "C4'" . DG  I 5 71  ? -27.701 -17.829 81.127 1.00 63.12  ? -2   DG  I "C4'" 1 
ATOM   7519  O  "O4'" . DG  I 5 71  ? -28.142 -19.140 81.562 1.00 63.27  ? -2   DG  I "O4'" 1 
ATOM   7520  C  "C3'" . DG  I 5 71  ? -26.179 -17.858 81.222 1.00 64.99  ? -2   DG  I "C3'" 1 
ATOM   7521  O  "O3'" . DG  I 5 71  ? -25.818 -16.981 82.266 1.00 67.81  ? -2   DG  I "O3'" 1 
ATOM   7522  C  "C2'" . DG  I 5 71  ? -25.839 -19.316 81.550 1.00 64.15  ? -2   DG  I "C2'" 1 
ATOM   7523  C  "C1'" . DG  I 5 71  ? -27.098 -19.744 82.293 1.00 63.30  ? -2   DG  I "C1'" 1 
ATOM   7524  N  N9    . DG  I 5 71  ? -27.392 -21.171 82.332 1.00 63.20  ? -2   DG  I N9    1 
ATOM   7525  C  C8    . DG  I 5 71  ? -27.275 -22.087 81.318 1.00 63.22  ? -2   DG  I C8    1 
ATOM   7526  N  N7    . DG  I 5 71  ? -27.630 -23.295 81.652 1.00 63.05  ? -2   DG  I N7    1 
ATOM   7527  C  C5    . DG  I 5 71  ? -28.006 -23.172 82.982 1.00 63.61  ? -2   DG  I C5    1 
ATOM   7528  C  C6    . DG  I 5 71  ? -28.482 -24.145 83.894 1.00 63.93  ? -2   DG  I C6    1 
ATOM   7529  O  O6    . DG  I 5 71  ? -28.666 -25.351 83.686 1.00 64.37  ? -2   DG  I O6    1 
ATOM   7530  N  N1    . DG  I 5 71  ? -28.748 -23.611 85.157 1.00 63.66  ? -2   DG  I N1    1 
ATOM   7531  C  C2    . DG  I 5 71  ? -28.573 -22.290 85.492 1.00 63.72  ? -2   DG  I C2    1 
ATOM   7532  N  N2    . DG  I 5 71  ? -28.876 -21.936 86.747 1.00 63.73  ? -2   DG  I N2    1 
ATOM   7533  N  N3    . DG  I 5 71  ? -28.131 -21.368 84.646 1.00 64.26  ? -2   DG  I N3    1 
ATOM   7534  C  C4    . DG  I 5 71  ? -27.866 -21.874 83.414 1.00 63.61  ? -2   DG  I C4    1 
ATOM   7535  P  P     . DA  I 5 72  ? -24.337 -16.403 82.453 1.00 69.22  ? -1   DA  I P     1 
ATOM   7536  O  OP1   . DA  I 5 72  ? -24.327 -15.081 81.794 1.00 69.02  ? -1   DA  I OP1   1 
ATOM   7537  O  OP2   . DA  I 5 72  ? -23.330 -17.424 82.091 1.00 67.54  ? -1   DA  I OP2   1 
ATOM   7538  O  "O5'" . DA  I 5 72  ? -24.257 -16.181 84.041 1.00 70.19  ? -1   DA  I "O5'" 1 
ATOM   7539  C  "C5'" . DA  I 5 72  ? -25.446 -16.070 84.834 1.00 72.04  ? -1   DA  I "C5'" 1 
ATOM   7540  C  "C4'" . DA  I 5 72  ? -25.263 -16.690 86.211 1.00 73.24  ? -1   DA  I "C4'" 1 
ATOM   7541  O  "O4'" . DA  I 5 72  ? -25.699 -18.074 86.196 1.00 73.43  ? -1   DA  I "O4'" 1 
ATOM   7542  C  "C3'" . DA  I 5 72  ? -23.839 -16.690 86.763 1.00 74.13  ? -1   DA  I "C3'" 1 
ATOM   7543  O  "O3'" . DA  I 5 72  ? -23.871 -16.229 88.125 1.00 76.58  ? -1   DA  I "O3'" 1 
ATOM   7544  C  "C2'" . DA  I 5 72  ? -23.384 -18.144 86.623 1.00 73.08  ? -1   DA  I "C2'" 1 
ATOM   7545  C  "C1'" . DA  I 5 72  ? -24.695 -18.914 86.737 1.00 72.78  ? -1   DA  I "C1'" 1 
ATOM   7546  N  N9    . DA  I 5 72  ? -24.753 -20.177 86.000 1.00 72.07  ? -1   DA  I N9    1 
ATOM   7547  C  C8    . DA  I 5 72  ? -24.435 -20.380 84.685 1.00 71.55  ? -1   DA  I C8    1 
ATOM   7548  N  N7    . DA  I 5 72  ? -24.593 -21.617 84.283 1.00 71.65  ? -1   DA  I N7    1 
ATOM   7549  C  C5    . DA  I 5 72  ? -25.055 -22.277 85.406 1.00 71.60  ? -1   DA  I C5    1 
ATOM   7550  C  C6    . DA  I 5 72  ? -25.418 -23.619 85.639 1.00 71.37  ? -1   DA  I C6    1 
ATOM   7551  N  N6    . DA  I 5 72  ? -25.361 -24.568 84.701 1.00 71.04  ? -1   DA  I N6    1 
ATOM   7552  N  N1    . DA  I 5 72  ? -25.837 -23.953 86.881 1.00 71.46  ? -1   DA  I N1    1 
ATOM   7553  C  C2    . DA  I 5 72  ? -25.890 -23.002 87.823 1.00 71.92  ? -1   DA  I C2    1 
ATOM   7554  N  N3    . DA  I 5 72  ? -25.580 -21.707 87.722 1.00 71.92  ? -1   DA  I N3    1 
ATOM   7555  C  C4    . DA  I 5 72  ? -25.165 -21.402 86.477 1.00 72.04  ? -1   DA  I C4    1 
ATOM   7556  P  P     . DA  I 5 73  ? -22.534 -15.911 88.955 1.00 77.52  ? 0    DA  I P     1 
ATOM   7557  O  OP1   . DA  I 5 73  ? -22.851 -14.861 89.943 1.00 78.15  ? 0    DA  I OP1   1 
ATOM   7558  O  OP2   . DA  I 5 73  ? -21.409 -15.695 88.019 1.00 78.07  ? 0    DA  I OP2   1 
ATOM   7559  O  "O5'" . DA  I 5 73  ? -22.267 -17.287 89.720 1.00 78.19  ? 0    DA  I "O5'" 1 
ATOM   7560  C  "C5'" . DA  I 5 73  ? -23.301 -17.869 90.494 1.00 78.94  ? 0    DA  I "C5'" 1 
ATOM   7561  C  "C4'" . DA  I 5 73  ? -22.785 -19.097 91.216 1.00 79.67  ? 0    DA  I "C4'" 1 
ATOM   7562  O  "O4'" . DA  I 5 73  ? -23.063 -20.263 90.410 1.00 80.33  ? 0    DA  I "O4'" 1 
ATOM   7563  C  "C3'" . DA  I 5 73  ? -21.292 -19.122 91.531 1.00 80.12  ? 0    DA  I "C3'" 1 
ATOM   7564  O  "O3'" . DA  I 5 73  ? -21.179 -19.427 92.916 1.00 81.25  ? 0    DA  I "O3'" 1 
ATOM   7565  C  "C2'" . DA  I 5 73  ? -20.719 -20.220 90.635 1.00 80.33  ? 0    DA  I "C2'" 1 
ATOM   7566  C  "C1'" . DA  I 5 73  ? -21.930 -21.106 90.361 1.00 80.72  ? 0    DA  I "C1'" 1 
ATOM   7567  N  N9    . DA  I 5 73  ? -21.936 -21.729 89.037 1.00 81.29  ? 0    DA  I N9    1 
ATOM   7568  C  C8    . DA  I 5 73  ? -21.638 -21.139 87.834 1.00 81.04  ? 0    DA  I C8    1 
ATOM   7569  N  N7    . DA  I 5 73  ? -21.738 -21.947 86.806 1.00 81.37  ? 0    DA  I N7    1 
ATOM   7570  C  C5    . DA  I 5 73  ? -22.139 -23.147 87.372 1.00 81.78  ? 0    DA  I C5    1 
ATOM   7571  C  C6    . DA  I 5 73  ? -22.424 -24.414 86.820 1.00 82.42  ? 0    DA  I C6    1 
ATOM   7572  N  N6    . DA  I 5 73  ? -22.343 -24.673 85.512 1.00 82.95  ? 0    DA  I N6    1 
ATOM   7573  N  N1    . DA  I 5 73  ? -22.800 -25.406 87.661 1.00 82.84  ? 0    DA  I N1    1 
ATOM   7574  C  C2    . DA  I 5 73  ? -22.885 -25.144 88.976 1.00 82.88  ? 0    DA  I C2    1 
ATOM   7575  N  N3    . DA  I 5 73  ? -22.637 -23.994 89.609 1.00 82.21  ? 0    DA  I N3    1 
ATOM   7576  C  C4    . DA  I 5 73  ? -22.269 -23.030 88.745 1.00 81.58  ? 0    DA  I C4    1 
ATOM   7577  P  P     . DT  I 5 74  ? -19.790 -19.600 93.694 1.00 81.47  ? 1    DT  I P     1 
ATOM   7578  O  OP1   . DT  I 5 74  ? -20.059 -19.189 95.092 1.00 81.54  ? 1    DT  I OP1   1 
ATOM   7579  O  OP2   . DT  I 5 74  ? -18.678 -18.974 92.935 1.00 80.95  ? 1    DT  I OP2   1 
ATOM   7580  O  "O5'" . DT  I 5 74  ? -19.580 -21.178 93.627 1.00 80.70  ? 1    DT  I "O5'" 1 
ATOM   7581  C  "C5'" . DT  I 5 74  ? -20.587 -22.060 94.093 1.00 80.37  ? 1    DT  I "C5'" 1 
ATOM   7582  C  "C4'" . DT  I 5 74  ? -20.109 -23.482 93.892 1.00 80.50  ? 1    DT  I "C4'" 1 
ATOM   7583  O  "O4'" . DT  I 5 74  ? -20.319 -23.851 92.508 1.00 80.01  ? 1    DT  I "O4'" 1 
ATOM   7584  C  "C3'" . DT  I 5 74  ? -18.622 -23.689 94.175 1.00 81.16  ? 1    DT  I "C3'" 1 
ATOM   7585  O  "O3'" . DT  I 5 74  ? -18.467 -24.749 95.115 1.00 83.39  ? 1    DT  I "O3'" 1 
ATOM   7586  C  "C2'" . DT  I 5 74  ? -18.001 -23.997 92.809 1.00 80.15  ? 1    DT  I "C2'" 1 
ATOM   7587  C  "C1'" . DT  I 5 74  ? -19.193 -24.562 92.042 1.00 78.95  ? 1    DT  I "C1'" 1 
ATOM   7588  N  N1    . DT  I 5 74  ? -19.121 -24.470 90.541 1.00 77.14  ? 1    DT  I N1    1 
ATOM   7589  C  C2    . DT  I 5 74  ? -19.446 -25.583 89.786 1.00 76.42  ? 1    DT  I C2    1 
ATOM   7590  O  O2    . DT  I 5 74  ? -19.791 -26.651 90.268 1.00 76.27  ? 1    DT  I O2    1 
ATOM   7591  N  N3    . DT  I 5 74  ? -19.348 -25.404 88.427 1.00 75.87  ? 1    DT  I N3    1 
ATOM   7592  C  C4    . DT  I 5 74  ? -18.968 -24.248 87.760 1.00 75.89  ? 1    DT  I C4    1 
ATOM   7593  O  O4    . DT  I 5 74  ? -18.919 -24.197 86.532 1.00 75.77  ? 1    DT  I O4    1 
ATOM   7594  C  C5    . DT  I 5 74  ? -18.641 -23.120 88.608 1.00 75.84  ? 1    DT  I C5    1 
ATOM   7595  C  C7    . DT  I 5 74  ? -18.210 -21.805 88.019 1.00 75.61  ? 1    DT  I C7    1 
ATOM   7596  C  C6    . DT  I 5 74  ? -18.736 -23.285 89.936 1.00 76.24  ? 1    DT  I C6    1 
ATOM   7597  P  P     . DC  I 5 75  ? -17.038 -25.090 95.758 1.00 85.66  ? 2    DC  I P     1 
ATOM   7598  O  OP1   . DC  I 5 75  ? -17.271 -25.644 97.115 1.00 85.28  ? 2    DC  I OP1   1 
ATOM   7599  O  OP2   . DC  I 5 75  ? -16.143 -23.917 95.588 1.00 85.09  ? 2    DC  I OP2   1 
ATOM   7600  O  "O5'" . DC  I 5 75  ? -16.522 -26.269 94.806 1.00 86.15  ? 2    DC  I "O5'" 1 
ATOM   7601  C  "C5'" . DC  I 5 75  ? -17.239 -27.507 94.739 1.00 87.58  ? 2    DC  I "C5'" 1 
ATOM   7602  C  "C4'" . DC  I 5 75  ? -16.610 -28.421 93.707 1.00 88.09  ? 2    DC  I "C4'" 1 
ATOM   7603  O  "O4'" . DC  I 5 75  ? -16.841 -27.899 92.374 1.00 87.97  ? 2    DC  I "O4'" 1 
ATOM   7604  C  "C3'" . DC  I 5 75  ? -15.100 -28.552 93.839 1.00 88.61  ? 2    DC  I "C3'" 1 
ATOM   7605  O  "O3'" . DC  I 5 75  ? -14.791 -29.915 93.858 1.00 89.95  ? 2    DC  I "O3'" 1 
ATOM   7606  C  "C2'" . DC  I 5 75  ? -14.532 -27.866 92.598 1.00 88.16  ? 2    DC  I "C2'" 1 
ATOM   7607  C  "C1'" . DC  I 5 75  ? -15.668 -28.098 91.609 1.00 87.36  ? 2    DC  I "C1'" 1 
ATOM   7608  N  N1    . DC  I 5 75  ? -15.703 -27.198 90.405 1.00 86.22  ? 2    DC  I N1    1 
ATOM   7609  C  C2    . DC  I 5 75  ? -16.027 -27.733 89.140 1.00 85.38  ? 2    DC  I C2    1 
ATOM   7610  O  O2    . DC  I 5 75  ? -16.272 -28.945 89.011 1.00 84.70  ? 2    DC  I O2    1 
ATOM   7611  N  N3    . DC  I 5 75  ? -16.059 -26.891 88.072 1.00 84.83  ? 2    DC  I N3    1 
ATOM   7612  C  C4    . DC  I 5 75  ? -15.791 -25.588 88.225 1.00 84.36  ? 2    DC  I C4    1 
ATOM   7613  N  N4    . DC  I 5 75  ? -15.834 -24.808 87.142 1.00 84.23  ? 2    DC  I N4    1 
ATOM   7614  C  C5    . DC  I 5 75  ? -15.465 -25.027 89.497 1.00 84.71  ? 2    DC  I C5    1 
ATOM   7615  C  C6    . DC  I 5 75  ? -15.436 -25.859 90.546 1.00 85.41  ? 2    DC  I C6    1 
ATOM   7616  P  P     . DA  I 5 76  ? -13.741 -30.476 94.920 1.00 91.05  ? 3    DA  I P     1 
ATOM   7617  O  OP1   . DA  I 5 76  ? -14.444 -30.589 96.217 1.00 90.95  ? 3    DA  I OP1   1 
ATOM   7618  O  OP2   . DA  I 5 76  ? -12.492 -29.679 94.810 1.00 90.78  ? 3    DA  I OP2   1 
ATOM   7619  O  "O5'" . DA  I 5 76  ? -13.478 -31.953 94.354 1.00 90.56  ? 3    DA  I "O5'" 1 
ATOM   7620  C  "C5'" . DA  I 5 76  ? -14.585 -32.778 93.952 1.00 90.01  ? 3    DA  I "C5'" 1 
ATOM   7621  C  "C4'" . DA  I 5 76  ? -14.294 -33.553 92.670 1.00 89.55  ? 3    DA  I "C4'" 1 
ATOM   7622  O  "O4'" . DA  I 5 76  ? -14.373 -32.687 91.503 1.00 89.22  ? 3    DA  I "O4'" 1 
ATOM   7623  C  "C3'" . DA  I 5 76  ? -12.927 -34.232 92.608 1.00 89.56  ? 3    DA  I "C3'" 1 
ATOM   7624  O  "O3'" . DA  I 5 76  ? -13.126 -35.555 92.124 1.00 89.47  ? 3    DA  I "O3'" 1 
ATOM   7625  C  "C2'" . DA  I 5 76  ? -12.105 -33.356 91.657 1.00 89.05  ? 3    DA  I "C2'" 1 
ATOM   7626  C  "C1'" . DA  I 5 76  ? -13.183 -32.780 90.742 1.00 88.73  ? 3    DA  I "C1'" 1 
ATOM   7627  N  N9    . DA  I 5 76  ? -12.891 -31.452 90.209 1.00 87.70  ? 3    DA  I N9    1 
ATOM   7628  C  C8    . DA  I 5 76  ? -12.367 -30.378 90.872 1.00 87.51  ? 3    DA  I C8    1 
ATOM   7629  N  N7    . DA  I 5 76  ? -12.220 -29.308 90.125 1.00 87.04  ? 3    DA  I N7    1 
ATOM   7630  C  C5    . DA  I 5 76  ? -12.685 -29.706 88.883 1.00 87.15  ? 3    DA  I C5    1 
ATOM   7631  C  C6    . DA  I 5 76  ? -12.803 -29.036 87.643 1.00 86.80  ? 3    DA  I C6    1 
ATOM   7632  N  N6    . DA  I 5 76  ? -12.445 -27.764 87.451 1.00 86.31  ? 3    DA  I N6    1 
ATOM   7633  N  N1    . DA  I 5 76  ? -13.310 -29.729 86.600 1.00 86.89  ? 3    DA  I N1    1 
ATOM   7634  C  C2    . DA  I 5 76  ? -13.674 -31.008 86.781 1.00 87.09  ? 3    DA  I C2    1 
ATOM   7635  N  N3    . DA  I 5 76  ? -13.613 -31.743 87.893 1.00 87.38  ? 3    DA  I N3    1 
ATOM   7636  C  C4    . DA  I 5 76  ? -13.104 -31.028 88.918 1.00 87.56  ? 3    DA  I C4    1 
ATOM   7637  P  P     . DG  I 5 77  ? -11.915 -36.588 91.925 1.00 89.44  ? 4    DG  I P     1 
ATOM   7638  O  OP1   . DG  I 5 77  ? -12.438 -37.935 92.274 1.00 89.34  ? 4    DG  I OP1   1 
ATOM   7639  O  OP2   . DG  I 5 77  ? -10.664 -36.052 92.526 1.00 88.76  ? 4    DG  I OP2   1 
ATOM   7640  O  "O5'" . DG  I 5 77  ? -11.684 -36.547 90.350 1.00 86.52  ? 4    DG  I "O5'" 1 
ATOM   7641  C  "C5'" . DG  I 5 77  ? -12.755 -36.687 89.426 1.00 82.06  ? 4    DG  I "C5'" 1 
ATOM   7642  C  "C4'" . DG  I 5 77  ? -12.189 -36.351 88.065 1.00 78.69  ? 4    DG  I "C4'" 1 
ATOM   7643  O  "O4'" . DG  I 5 77  ? -11.862 -34.940 87.991 1.00 77.15  ? 4    DG  I "O4'" 1 
ATOM   7644  C  "C3'" . DG  I 5 77  ? -10.890 -37.079 87.765 1.00 76.97  ? 4    DG  I "C3'" 1 
ATOM   7645  O  "O3'" . DG  I 5 77  ? -11.011 -37.527 86.454 1.00 75.54  ? 4    DG  I "O3'" 1 
ATOM   7646  C  "C2'" . DG  I 5 77  ? -9.799  -36.012 87.921 1.00 76.42  ? 4    DG  I "C2'" 1 
ATOM   7647  C  "C1'" . DG  I 5 77  ? -10.564 -34.783 87.459 1.00 75.91  ? 4    DG  I "C1'" 1 
ATOM   7648  N  N9    . DG  I 5 77  ? -10.062 -33.474 87.878 1.00 75.37  ? 4    DG  I N9    1 
ATOM   7649  C  C8    . DG  I 5 77  ? -9.498  -33.102 89.075 1.00 75.18  ? 4    DG  I C8    1 
ATOM   7650  N  N7    . DG  I 5 77  ? -9.170  -31.838 89.128 1.00 74.86  ? 4    DG  I N7    1 
ATOM   7651  C  C5    . DG  I 5 77  ? -9.539  -31.335 87.885 1.00 74.58  ? 4    DG  I C5    1 
ATOM   7652  C  C6    . DG  I 5 77  ? -9.431  -30.025 87.342 1.00 74.48  ? 4    DG  I C6    1 
ATOM   7653  O  O6    . DG  I 5 77  ? -8.974  -28.997 87.867 1.00 74.27  ? 4    DG  I O6    1 
ATOM   7654  N  N1    . DG  I 5 77  ? -9.932  -29.956 86.044 1.00 74.04  ? 4    DG  I N1    1 
ATOM   7655  C  C2    . DG  I 5 77  ? -10.469 -31.016 85.351 1.00 73.76  ? 4    DG  I C2    1 
ATOM   7656  N  N2    . DG  I 5 77  ? -10.903 -30.758 84.110 1.00 73.44  ? 4    DG  I N2    1 
ATOM   7657  N  N3    . DG  I 5 77  ? -10.575 -32.242 85.843 1.00 73.64  ? 4    DG  I N3    1 
ATOM   7658  C  C4    . DG  I 5 77  ? -10.093 -32.330 87.109 1.00 74.71  ? 4    DG  I C4    1 
ATOM   7659  P  P     . DC  I 5 78  ? -10.200 -38.794 85.952 1.00 74.66  ? 5    DC  I P     1 
ATOM   7660  O  OP1   . DC  I 5 78  ? -11.192 -39.864 85.717 1.00 75.08  ? 5    DC  I OP1   1 
ATOM   7661  O  OP2   . DC  I 5 78  ? -9.046  -39.021 86.852 1.00 75.48  ? 5    DC  I OP2   1 
ATOM   7662  O  "O5'" . DC  I 5 78  ? -9.617  -38.301 84.540 1.00 74.33  ? 5    DC  I "O5'" 1 
ATOM   7663  C  "C5'" . DC  I 5 78  ? -10.275 -37.298 83.751 1.00 72.89  ? 5    DC  I "C5'" 1 
ATOM   7664  C  "C4'" . DC  I 5 78  ? -9.270  -36.359 83.100 1.00 72.42  ? 5    DC  I "C4'" 1 
ATOM   7665  O  "O4'" . DC  I 5 78  ? -8.938  -35.306 84.038 1.00 71.71  ? 5    DC  I "O4'" 1 
ATOM   7666  C  "C3'" . DC  I 5 78  ? -7.927  -36.968 82.680 1.00 72.10  ? 5    DC  I "C3'" 1 
ATOM   7667  O  "O3'" . DC  I 5 78  ? -7.574  -36.508 81.398 1.00 71.49  ? 5    DC  I "O3'" 1 
ATOM   7668  C  "C2'" . DC  I 5 78  ? -6.927  -36.405 83.682 1.00 71.81  ? 5    DC  I "C2'" 1 
ATOM   7669  C  "C1'" . DC  I 5 78  ? -7.562  -35.040 83.889 1.00 71.90  ? 5    DC  I "C1'" 1 
ATOM   7670  N  N1    . DC  I 5 78  ? -7.112  -34.283 85.077 1.00 72.18  ? 5    DC  I N1    1 
ATOM   7671  C  C2    . DC  I 5 78  ? -7.238  -32.884 85.065 1.00 72.02  ? 5    DC  I C2    1 
ATOM   7672  O  O2    . DC  I 5 78  ? -7.722  -32.323 84.066 1.00 71.38  ? 5    DC  I O2    1 
ATOM   7673  N  N3    . DC  I 5 78  ? -6.824  -32.191 86.159 1.00 71.77  ? 5    DC  I N3    1 
ATOM   7674  C  C4    . DC  I 5 78  ? -6.314  -32.842 87.211 1.00 72.13  ? 5    DC  I C4    1 
ATOM   7675  N  N4    . DC  I 5 78  ? -5.920  -32.125 88.266 1.00 72.31  ? 5    DC  I N4    1 
ATOM   7676  C  C5    . DC  I 5 78  ? -6.177  -34.264 87.235 1.00 72.48  ? 5    DC  I C5    1 
ATOM   7677  C  C6    . DC  I 5 78  ? -6.588  -34.939 86.157 1.00 72.24  ? 5    DC  I C6    1 
ATOM   7678  P  P     . DT  I 5 79  ? -7.551  -37.495 80.142 1.00 70.81  ? 6    DT  I P     1 
ATOM   7679  O  OP1   . DT  I 5 79  ? -8.654  -38.472 80.312 1.00 70.36  ? 6    DT  I OP1   1 
ATOM   7680  O  OP2   . DT  I 5 79  ? -6.144  -37.935 79.960 1.00 68.67  ? 6    DT  I OP2   1 
ATOM   7681  O  "O5'" . DT  I 5 79  ? -7.964  -36.510 78.936 1.00 68.66  ? 6    DT  I "O5'" 1 
ATOM   7682  C  "C5'" . DT  I 5 79  ? -8.787  -35.354 79.154 1.00 65.07  ? 6    DT  I "C5'" 1 
ATOM   7683  C  "C4'" . DT  I 5 79  ? -8.099  -34.092 78.643 1.00 63.22  ? 6    DT  I "C4'" 1 
ATOM   7684  O  "O4'" . DT  I 5 79  ? -7.426  -33.391 79.727 1.00 63.18  ? 6    DT  I "O4'" 1 
ATOM   7685  C  "C3'" . DT  I 5 79  ? -7.019  -34.281 77.576 1.00 61.34  ? 6    DT  I "C3'" 1 
ATOM   7686  O  "O3'" . DT  I 5 79  ? -6.914  -33.086 76.857 1.00 57.90  ? 6    DT  I "O3'" 1 
ATOM   7687  C  "C2'" . DT  I 5 79  ? -5.760  -34.394 78.422 1.00 62.21  ? 6    DT  I "C2'" 1 
ATOM   7688  C  "C1'" . DT  I 5 79  ? -6.051  -33.264 79.404 1.00 63.31  ? 6    DT  I "C1'" 1 
ATOM   7689  N  N1    . DT  I 5 79  ? -5.240  -33.236 80.655 1.00 64.48  ? 6    DT  I N1    1 
ATOM   7690  C  C2    . DT  I 5 79  ? -5.046  -32.021 81.289 1.00 65.04  ? 6    DT  I C2    1 
ATOM   7691  O  O2    . DT  I 5 79  ? -5.494  -30.956 80.904 1.00 64.11  ? 6    DT  I O2    1 
ATOM   7692  N  N3    . DT  I 5 79  ? -4.290  -32.088 82.424 1.00 65.96  ? 6    DT  I N3    1 
ATOM   7693  C  C4    . DT  I 5 79  ? -3.717  -33.204 82.994 1.00 66.99  ? 6    DT  I C4    1 
ATOM   7694  O  O4    . DT  I 5 79  ? -3.063  -33.098 84.030 1.00 69.00  ? 6    DT  I O4    1 
ATOM   7695  C  C5    . DT  I 5 79  ? -3.954  -34.451 82.288 1.00 66.51  ? 6    DT  I C5    1 
ATOM   7696  C  C7    . DT  I 5 79  ? -3.400  -35.760 82.778 1.00 65.69  ? 6    DT  I C7    1 
ATOM   7697  C  C6    . DT  I 5 79  ? -4.694  -34.400 81.168 1.00 65.57  ? 6    DT  I C6    1 
ATOM   7698  P  P     . DG  I 5 80  ? -7.148  -32.888 75.290 1.00 53.94  ? 7    DG  I P     1 
ATOM   7699  O  OP1   . DG  I 5 80  ? -8.542  -32.471 75.148 1.00 52.17  ? 7    DG  I OP1   1 
ATOM   7700  O  OP2   . DG  I 5 80  ? -6.544  -33.963 74.466 1.00 54.84  ? 7    DG  I OP2   1 
ATOM   7701  O  "O5'" . DG  I 5 80  ? -6.228  -31.604 75.064 1.00 52.22  ? 7    DG  I "O5'" 1 
ATOM   7702  C  "C5'" . DG  I 5 80  ? -6.372  -30.439 75.891 1.00 47.78  ? 7    DG  I "C5'" 1 
ATOM   7703  C  "C4'" . DG  I 5 80  ? -5.033  -29.776 76.196 1.00 45.78  ? 7    DG  I "C4'" 1 
ATOM   7704  O  "O4'" . DG  I 5 80  ? -4.409  -30.423 77.325 1.00 44.89  ? 7    DG  I "O4'" 1 
ATOM   7705  C  "C3'" . DG  I 5 80  ? -3.975  -29.753 75.088 1.00 44.37  ? 7    DG  I "C3'" 1 
ATOM   7706  O  "O3'" . DG  I 5 80  ? -3.491  -28.406 75.001 1.00 42.07  ? 7    DG  I "O3'" 1 
ATOM   7707  C  "C2'" . DG  I 5 80  ? -2.919  -30.747 75.558 1.00 43.94  ? 7    DG  I "C2'" 1 
ATOM   7708  C  "C1'" . DG  I 5 80  ? -3.036  -30.576 77.065 1.00 46.34  ? 7    DG  I "C1'" 1 
ATOM   7709  N  N9    . DG  I 5 80  ? -2.619  -31.700 77.902 1.00 48.43  ? 7    DG  I N9    1 
ATOM   7710  C  C8    . DG  I 5 80  ? -2.729  -33.046 77.661 1.00 48.89  ? 7    DG  I C8    1 
ATOM   7711  N  N7    . DG  I 5 80  ? -2.277  -33.782 78.629 1.00 50.82  ? 7    DG  I N7    1 
ATOM   7712  C  C5    . DG  I 5 80  ? -1.841  -32.861 79.570 1.00 51.21  ? 7    DG  I C5    1 
ATOM   7713  C  C6    . DG  I 5 80  ? -1.247  -33.052 80.843 1.00 51.87  ? 7    DG  I C6    1 
ATOM   7714  O  O6    . DG  I 5 80  ? -0.985  -34.129 81.390 1.00 53.15  ? 7    DG  I O6    1 
ATOM   7715  N  N1    . DG  I 5 80  ? -0.960  -31.831 81.475 1.00 52.44  ? 7    DG  I N1    1 
ATOM   7716  C  C2    . DG  I 5 80  ? -1.224  -30.582 80.926 1.00 51.18  ? 7    DG  I C2    1 
ATOM   7717  N  N2    . DG  I 5 80  ? -0.909  -29.491 81.625 1.00 50.01  ? 7    DG  I N2    1 
ATOM   7718  N  N3    . DG  I 5 80  ? -1.782  -30.401 79.746 1.00 50.28  ? 7    DG  I N3    1 
ATOM   7719  C  C4    . DG  I 5 80  ? -2.062  -31.577 79.134 1.00 49.89  ? 7    DG  I C4    1 
ATOM   7720  P  P     . DA  I 5 81  ? -2.418  -27.879 73.941 1.00 39.83  ? 8    DA  I P     1 
ATOM   7721  O  OP1   . DA  I 5 81  ? -3.210  -27.095 72.979 1.00 40.51  ? 8    DA  I OP1   1 
ATOM   7722  O  OP2   . DA  I 5 81  ? -1.504  -28.940 73.461 1.00 39.29  ? 8    DA  I OP2   1 
ATOM   7723  O  "O5'" . DA  I 5 81  ? -1.569  -26.873 74.821 1.00 42.40  ? 8    DA  I "O5'" 1 
ATOM   7724  C  "C5'" . DA  I 5 81  ? -2.153  -26.120 75.898 1.00 42.42  ? 8    DA  I "C5'" 1 
ATOM   7725  C  "C4'" . DA  I 5 81  ? -1.007  -25.501 76.687 1.00 43.38  ? 8    DA  I "C4'" 1 
ATOM   7726  O  "O4'" . DA  I 5 81  ? -0.489  -26.443 77.659 1.00 43.75  ? 8    DA  I "O4'" 1 
ATOM   7727  C  "C3'" . DA  I 5 81  ? 0.192   -25.058 75.842 1.00 42.73  ? 8    DA  I "C3'" 1 
ATOM   7728  O  "O3'" . DA  I 5 81  ? 0.644   -23.796 76.354 1.00 43.72  ? 8    DA  I "O3'" 1 
ATOM   7729  C  "C2'" . DA  I 5 81  ? 1.207   -26.189 76.009 1.00 42.83  ? 8    DA  I "C2'" 1 
ATOM   7730  C  "C1'" . DA  I 5 81  ? 0.852   -26.789 77.363 1.00 44.66  ? 8    DA  I "C1'" 1 
ATOM   7731  N  N9    . DA  I 5 81  ? 0.893   -28.249 77.408 1.00 46.04  ? 8    DA  I N9    1 
ATOM   7732  C  C8    . DA  I 5 81  ? 0.446   -29.104 76.447 1.00 46.81  ? 8    DA  I C8    1 
ATOM   7733  N  N7    . DA  I 5 81  ? 0.591   -30.364 76.746 1.00 47.40  ? 8    DA  I N7    1 
ATOM   7734  C  C5    . DA  I 5 81  ? 1.161   -30.337 77.994 1.00 47.75  ? 8    DA  I C5    1 
ATOM   7735  C  C6    . DA  I 5 81  ? 1.558   -31.371 78.864 1.00 47.09  ? 8    DA  I C6    1 
ATOM   7736  N  N6    . DA  I 5 81  ? 1.429   -32.659 78.562 1.00 48.12  ? 8    DA  I N6    1 
ATOM   7737  N  N1    . DA  I 5 81  ? 2.102   -31.014 80.043 1.00 47.23  ? 8    DA  I N1    1 
ATOM   7738  C  C2    . DA  I 5 81  ? 2.244   -29.706 80.349 1.00 46.98  ? 8    DA  I C2    1 
ATOM   7739  N  N3    . DA  I 5 81  ? 1.905   -28.638 79.613 1.00 47.01  ? 8    DA  I N3    1 
ATOM   7740  C  C4    . DA  I 5 81  ? 1.360   -29.031 78.431 1.00 47.36  ? 8    DA  I C4    1 
ATOM   7741  P  P     . DA  I 5 82  ? 1.935   -23.007 75.845 1.00 43.86  ? 9    DA  I P     1 
ATOM   7742  O  OP1   . DA  I 5 82  ? 1.563   -21.616 76.125 1.00 43.36  ? 9    DA  I OP1   1 
ATOM   7743  O  OP2   . DA  I 5 82  ? 2.265   -23.431 74.470 1.00 44.39  ? 9    DA  I OP2   1 
ATOM   7744  O  "O5'" . DA  I 5 82  ? 3.169   -23.439 76.772 1.00 45.12  ? 9    DA  I "O5'" 1 
ATOM   7745  C  "C5'" . DA  I 5 82  ? 3.147   -23.368 78.173 1.00 45.99  ? 9    DA  I "C5'" 1 
ATOM   7746  C  "C4'" . DA  I 5 82  ? 4.386   -24.082 78.696 1.00 48.78  ? 9    DA  I "C4'" 1 
ATOM   7747  O  "O4'" . DA  I 5 82  ? 4.180   -25.512 78.614 1.00 48.70  ? 9    DA  I "O4'" 1 
ATOM   7748  C  "C3'" . DA  I 5 82  ? 5.694   -23.781 77.964 1.00 48.76  ? 9    DA  I "C3'" 1 
ATOM   7749  O  "O3'" . DA  I 5 82  ? 6.587   -23.183 78.918 1.00 50.64  ? 9    DA  I "O3'" 1 
ATOM   7750  C  "C2'" . DA  I 5 82  ? 6.145   -25.143 77.423 1.00 48.71  ? 9    DA  I "C2'" 1 
ATOM   7751  C  "C1'" . DA  I 5 82  ? 5.408   -26.126 78.325 1.00 50.48  ? 9    DA  I "C1'" 1 
ATOM   7752  N  N9    . DA  I 5 82  ? 5.038   -27.435 77.796 1.00 52.10  ? 9    DA  I N9    1 
ATOM   7753  C  C8    . DA  I 5 82  ? 4.447   -27.717 76.593 1.00 53.46  ? 9    DA  I C8    1 
ATOM   7754  N  N7    . DA  I 5 82  ? 4.207   -28.993 76.403 1.00 54.27  ? 9    DA  I N7    1 
ATOM   7755  C  C5    . DA  I 5 82  ? 4.661   -29.587 77.568 1.00 54.20  ? 9    DA  I C5    1 
ATOM   7756  C  C6    . DA  I 5 82  ? 4.700   -30.923 77.996 1.00 54.44  ? 9    DA  I C6    1 
ATOM   7757  N  N6    . DA  I 5 82  ? 4.242   -31.928 77.260 1.00 55.09  ? 9    DA  I N6    1 
ATOM   7758  N  N1    . DA  I 5 82  ? 5.221   -31.188 79.215 1.00 55.22  ? 9    DA  I N1    1 
ATOM   7759  C  C2    . DA  I 5 82  ? 5.685   -30.175 79.960 1.00 54.71  ? 9    DA  I C2    1 
ATOM   7760  N  N3    . DA  I 5 82  ? 5.703   -28.875 79.663 1.00 54.31  ? 9    DA  I N3    1 
ATOM   7761  C  C4    . DA  I 5 82  ? 5.174   -28.643 78.442 1.00 53.73  ? 9    DA  I C4    1 
ATOM   7762  P  P     . DC  I 5 83  ? 8.065   -22.623 78.597 1.00 50.91  ? 10   DC  I P     1 
ATOM   7763  O  OP1   . DC  I 5 83  ? 8.318   -21.592 79.630 1.00 51.64  ? 10   DC  I OP1   1 
ATOM   7764  O  OP2   . DC  I 5 83  ? 8.135   -22.248 77.179 1.00 49.28  ? 10   DC  I OP2   1 
ATOM   7765  O  "O5'" . DC  I 5 83  ? 9.024   -23.890 78.798 1.00 54.02  ? 10   DC  I "O5'" 1 
ATOM   7766  C  "C5'" . DC  I 5 83  ? 9.094   -24.592 80.026 1.00 56.54  ? 10   DC  I "C5'" 1 
ATOM   7767  C  "C4'" . DC  I 5 83  ? 9.988   -25.801 79.845 1.00 59.28  ? 10   DC  I "C4'" 1 
ATOM   7768  O  "O4'" . DC  I 5 83  ? 9.214   -26.844 79.216 1.00 60.08  ? 10   DC  I "O4'" 1 
ATOM   7769  C  "C3'" . DC  I 5 83  ? 11.210  -25.614 78.952 1.00 60.82  ? 10   DC  I "C3'" 1 
ATOM   7770  O  "O3'" . DC  I 5 83  ? 12.312  -26.275 79.547 1.00 63.69  ? 10   DC  I "O3'" 1 
ATOM   7771  C  "C2'" . DC  I 5 83  ? 10.792  -26.292 77.651 1.00 60.65  ? 10   DC  I "C2'" 1 
ATOM   7772  C  "C1'" . DC  I 5 83  ? 10.041  -27.461 78.263 1.00 60.71  ? 10   DC  I "C1'" 1 
ATOM   7773  N  N1    . DC  I 5 83  ? 9.147   -28.243 77.385 1.00 61.06  ? 10   DC  I N1    1 
ATOM   7774  C  C2    . DC  I 5 83  ? 8.899   -29.585 77.712 1.00 61.23  ? 10   DC  I C2    1 
ATOM   7775  O  O2    . DC  I 5 83  ? 9.441   -30.080 78.703 1.00 62.14  ? 10   DC  I O2    1 
ATOM   7776  N  N3    . DC  I 5 83  ? 8.073   -30.309 76.925 1.00 60.53  ? 10   DC  I N3    1 
ATOM   7777  C  C4    . DC  I 5 83  ? 7.519   -29.737 75.856 1.00 59.91  ? 10   DC  I C4    1 
ATOM   7778  N  N4    . DC  I 5 83  ? 6.719   -30.490 75.107 1.00 58.67  ? 10   DC  I N4    1 
ATOM   7779  C  C5    . DC  I 5 83  ? 7.748   -28.371 75.508 1.00 60.10  ? 10   DC  I C5    1 
ATOM   7780  C  C6    . DC  I 5 83  ? 8.565   -27.664 76.295 1.00 60.24  ? 10   DC  I C6    1 
ATOM   7781  P  P     . DA  I 5 84  ? 13.800  -25.814 79.201 1.00 66.18  ? 11   DA  I P     1 
ATOM   7782  O  OP1   . DA  I 5 84  ? 13.938  -24.450 79.757 1.00 64.68  ? 11   DA  I OP1   1 
ATOM   7783  O  OP2   . DA  I 5 84  ? 14.060  -26.057 77.767 1.00 65.47  ? 11   DA  I OP2   1 
ATOM   7784  O  "O5'" . DA  I 5 84  ? 14.682  -26.876 80.019 1.00 69.17  ? 11   DA  I "O5'" 1 
ATOM   7785  C  "C5'" . DA  I 5 84  ? 14.076  -27.788 80.931 1.00 73.54  ? 11   DA  I "C5'" 1 
ATOM   7786  C  "C4'" . DA  I 5 84  ? 14.497  -29.226 80.654 1.00 77.17  ? 11   DA  I "C4'" 1 
ATOM   7787  O  "O4'" . DA  I 5 84  ? 13.471  -29.910 79.885 1.00 77.83  ? 11   DA  I "O4'" 1 
ATOM   7788  C  "C3'" . DA  I 5 84  ? 15.811  -29.397 79.895 1.00 79.27  ? 11   DA  I "C3'" 1 
ATOM   7789  O  "O3'" . DA  I 5 84  ? 16.628  -30.370 80.540 1.00 82.21  ? 11   DA  I "O3'" 1 
ATOM   7790  C  "C2'" . DA  I 5 84  ? 15.387  -29.861 78.506 1.00 79.20  ? 11   DA  I "C2'" 1 
ATOM   7791  C  "C1'" . DA  I 5 84  ? 14.034  -30.528 78.743 1.00 78.98  ? 11   DA  I "C1'" 1 
ATOM   7792  N  N9    . DA  I 5 84  ? 13.138  -30.347 77.596 1.00 79.30  ? 11   DA  I N9    1 
ATOM   7793  C  C8    . DA  I 5 84  ? 12.839  -29.170 76.964 1.00 79.44  ? 11   DA  I C8    1 
ATOM   7794  N  N7    . DA  I 5 84  ? 12.013  -29.290 75.955 1.00 79.46  ? 11   DA  I N7    1 
ATOM   7795  C  C5    . DA  I 5 84  ? 11.752  -30.648 75.918 1.00 79.70  ? 11   DA  I C5    1 
ATOM   7796  C  C6    . DA  I 5 84  ? 10.941  -31.433 75.069 1.00 79.59  ? 11   DA  I C6    1 
ATOM   7797  N  N6    . DA  I 5 84  ? 10.227  -30.919 74.063 1.00 79.22  ? 11   DA  I N6    1 
ATOM   7798  N  N1    . DA  I 5 84  ? 10.898  -32.765 75.298 1.00 79.22  ? 11   DA  I N1    1 
ATOM   7799  C  C2    . DA  I 5 84  ? 11.619  -33.277 76.308 1.00 79.33  ? 11   DA  I C2    1 
ATOM   7800  N  N3    . DA  I 5 84  ? 12.419  -32.643 77.170 1.00 79.08  ? 11   DA  I N3    1 
ATOM   7801  C  C4    . DA  I 5 84  ? 12.441  -31.319 76.919 1.00 79.35  ? 11   DA  I C4    1 
ATOM   7802  P  P     . DT  I 5 85  ? 18.159  -30.572 80.109 1.00 84.37  ? 12   DT  I P     1 
ATOM   7803  O  OP1   . DT  I 5 85  ? 18.897  -30.944 81.341 1.00 84.56  ? 12   DT  I OP1   1 
ATOM   7804  O  OP2   . DT  I 5 85  ? 18.605  -29.408 79.307 1.00 84.03  ? 12   DT  I OP2   1 
ATOM   7805  O  "O5'" . DT  I 5 85  ? 18.076  -31.833 79.129 1.00 84.95  ? 12   DT  I "O5'" 1 
ATOM   7806  C  "C5'" . DT  I 5 85  ? 17.451  -33.030 79.564 1.00 87.15  ? 12   DT  I "C5'" 1 
ATOM   7807  C  "C4'" . DT  I 5 85  ? 17.293  -33.984 78.398 1.00 89.08  ? 12   DT  I "C4'" 1 
ATOM   7808  O  "O4'" . DT  I 5 85  ? 16.147  -33.579 77.603 1.00 89.48  ? 12   DT  I "O4'" 1 
ATOM   7809  C  "C3'" . DT  I 5 85  ? 18.500  -34.032 77.461 1.00 90.18  ? 12   DT  I "C3'" 1 
ATOM   7810  O  "O3'" . DT  I 5 85  ? 18.910  -35.376 77.233 1.00 91.63  ? 12   DT  I "O3'" 1 
ATOM   7811  C  "C2'" . DT  I 5 85  ? 17.989  -33.374 76.184 1.00 90.03  ? 12   DT  I "C2'" 1 
ATOM   7812  C  "C1'" . DT  I 5 85  ? 16.498  -33.703 76.243 1.00 89.76  ? 12   DT  I "C1'" 1 
ATOM   7813  N  N1    . DT  I 5 85  ? 15.649  -32.815 75.386 1.00 89.47  ? 12   DT  I N1    1 
ATOM   7814  C  C2    . DT  I 5 85  ? 14.631  -33.370 74.629 1.00 89.31  ? 12   DT  I C2    1 
ATOM   7815  O  O2    . DT  I 5 85  ? 14.356  -34.557 74.621 1.00 89.27  ? 12   DT  I O2    1 
ATOM   7816  N  N3    . DT  I 5 85  ? 13.924  -32.467 73.873 1.00 89.33  ? 12   DT  I N3    1 
ATOM   7817  C  C4    . DT  I 5 85  ? 14.132  -31.101 73.787 1.00 89.08  ? 12   DT  I C4    1 
ATOM   7818  O  O4    . DT  I 5 85  ? 13.433  -30.393 73.069 1.00 88.97  ? 12   DT  I O4    1 
ATOM   7819  C  C5    . DT  I 5 85  ? 15.213  -30.586 74.601 1.00 89.12  ? 12   DT  I C5    1 
ATOM   7820  C  C7    . DT  I 5 85  ? 15.551  -29.125 74.610 1.00 89.04  ? 12   DT  I C7    1 
ATOM   7821  C  C6    . DT  I 5 85  ? 15.909  -31.456 75.345 1.00 89.07  ? 12   DT  I C6    1 
ATOM   7822  P  P     . DG  I 5 86  ? 20.406  -35.723 76.775 1.00 92.73  ? 13   DG  I P     1 
ATOM   7823  O  OP1   . DG  I 5 86  ? 21.163  -36.057 78.005 1.00 92.92  ? 13   DG  I OP1   1 
ATOM   7824  O  OP2   . DG  I 5 86  ? 20.922  -34.661 75.868 1.00 92.42  ? 13   DG  I OP2   1 
ATOM   7825  O  "O5'" . DG  I 5 86  ? 20.211  -37.065 75.916 1.00 92.46  ? 13   DG  I "O5'" 1 
ATOM   7826  C  "C5'" . DG  I 5 86  ? 18.925  -37.675 75.737 1.00 92.15  ? 13   DG  I "C5'" 1 
ATOM   7827  C  "C4'" . DG  I 5 86  ? 18.715  -38.179 74.312 1.00 91.87  ? 13   DG  I "C4'" 1 
ATOM   7828  O  "O4'" . DG  I 5 86  ? 17.808  -37.295 73.598 1.00 92.22  ? 13   DG  I "O4'" 1 
ATOM   7829  C  "C3'" . DG  I 5 86  ? 19.963  -38.314 73.442 1.00 91.18  ? 13   DG  I "C3'" 1 
ATOM   7830  O  "O3'" . DG  I 5 86  ? 19.908  -39.566 72.722 1.00 89.45  ? 13   DG  I "O3'" 1 
ATOM   7831  C  "C2'" . DG  I 5 86  ? 19.920  -37.047 72.574 1.00 91.75  ? 13   DG  I "C2'" 1 
ATOM   7832  C  "C1'" . DG  I 5 86  ? 18.421  -36.780 72.431 1.00 92.63  ? 13   DG  I "C1'" 1 
ATOM   7833  N  N9    . DG  I 5 86  ? 18.034  -35.367 72.310 1.00 93.61  ? 13   DG  I N9    1 
ATOM   7834  C  C8    . DG  I 5 86  ? 18.576  -34.292 72.978 1.00 94.22  ? 13   DG  I C8    1 
ATOM   7835  N  N7    . DG  I 5 86  ? 18.027  -33.142 72.681 1.00 94.22  ? 13   DG  I N7    1 
ATOM   7836  C  C5    . DG  I 5 86  ? 17.050  -33.468 71.750 1.00 94.13  ? 13   DG  I C5    1 
ATOM   7837  C  C6    . DG  I 5 86  ? 16.128  -32.632 71.063 1.00 94.00  ? 13   DG  I C6    1 
ATOM   7838  O  O6    . DG  I 5 86  ? 15.997  -31.404 71.153 1.00 94.30  ? 13   DG  I O6    1 
ATOM   7839  N  N1    . DG  I 5 86  ? 15.303  -33.355 70.201 1.00 93.67  ? 13   DG  I N1    1 
ATOM   7840  C  C2    . DG  I 5 86  ? 15.368  -34.722 70.025 1.00 93.90  ? 13   DG  I C2    1 
ATOM   7841  N  N2    . DG  I 5 86  ? 14.500  -35.255 69.154 1.00 93.44  ? 13   DG  I N2    1 
ATOM   7842  N  N3    . DG  I 5 86  ? 16.222  -35.520 70.665 1.00 94.18  ? 13   DG  I N3    1 
ATOM   7843  C  C4    . DG  I 5 86  ? 17.037  -34.832 71.512 1.00 94.10  ? 13   DG  I C4    1 
ATOM   7844  P  P     . DC  I 5 87  ? 20.873  -39.922 71.489 1.00 88.45  ? 14   DC  I P     1 
ATOM   7845  O  OP1   . DC  I 5 87  ? 20.909  -41.396 71.368 1.00 88.50  ? 14   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I 5 87  ? 22.129  -39.143 71.596 1.00 87.97  ? 14   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I 5 87  ? 20.080  -39.313 70.240 1.00 87.64  ? 14   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I 5 87  ? 19.130  -40.068 69.493 1.00 85.98  ? 14   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I 5 87  ? 18.840  -39.361 68.180 1.00 84.34  ? 14   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I 5 87  ? 18.434  -38.005 68.483 1.00 83.67  ? 14   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I 5 87  ? 20.016  -39.264 67.199 1.00 83.11  ? 14   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I 5 87  ? 19.618  -39.554 65.859 1.00 80.99  ? 14   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I 5 87  ? 20.443  -37.806 67.308 1.00 83.72  ? 14   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I 5 87  ? 19.081  -37.162 67.560 1.00 84.00  ? 14   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I 5 87  ? 19.117  -35.782 68.115 1.00 84.78  ? 14   DC  I N1    1 
ATOM   7856  C  C2    . DC  I 5 87  ? 18.358  -34.778 67.487 1.00 85.13  ? 14   DC  I C2    1 
ATOM   7857  O  O2    . DC  I 5 87  ? 17.674  -35.054 66.489 1.00 85.54  ? 14   DC  I O2    1 
ATOM   7858  N  N3    . DC  I 5 87  ? 18.395  -33.521 67.998 1.00 84.82  ? 14   DC  I N3    1 
ATOM   7859  C  C4    . DC  I 5 87  ? 19.141  -33.254 69.074 1.00 84.91  ? 14   DC  I C4    1 
ATOM   7860  N  N4    . DC  I 5 87  ? 19.140  -32.000 69.529 1.00 84.91  ? 14   DC  I N4    1 
ATOM   7861  C  C5    . DC  I 5 87  ? 19.920  -34.258 69.729 1.00 84.93  ? 14   DC  I C5    1 
ATOM   7862  C  C6    . DC  I 5 87  ? 19.877  -35.497 69.220 1.00 84.83  ? 14   DC  I C6    1 
ATOM   7863  P  P     . DC  I 5 88  ? 19.499  -41.060 65.335 1.00 79.82  ? 15   DC  I P     1 
ATOM   7864  O  OP1   . DC  I 5 88  ? 19.187  -41.895 66.522 1.00 79.75  ? 15   DC  I OP1   1 
ATOM   7865  O  OP2   . DC  I 5 88  ? 20.683  -41.366 64.491 1.00 79.47  ? 15   DC  I OP2   1 
ATOM   7866  O  "O5'" . DC  I 5 88  ? 18.207  -41.007 64.379 1.00 78.91  ? 15   DC  I "O5'" 1 
ATOM   7867  C  "C5'" . DC  I 5 88  ? 16.892  -40.731 64.918 1.00 76.38  ? 15   DC  I "C5'" 1 
ATOM   7868  C  "C4'" . DC  I 5 88  ? 15.992  -39.928 63.978 1.00 74.73  ? 15   DC  I "C4'" 1 
ATOM   7869  O  "O4'" . DC  I 5 88  ? 16.463  -38.559 63.914 1.00 74.65  ? 15   DC  I "O4'" 1 
ATOM   7870  C  "C3'" . DC  I 5 88  ? 15.879  -40.423 62.532 1.00 73.37  ? 15   DC  I "C3'" 1 
ATOM   7871  O  "O3'" . DC  I 5 88  ? 14.536  -40.267 62.056 1.00 71.25  ? 15   DC  I "O3'" 1 
ATOM   7872  C  "C2'" . DC  I 5 88  ? 16.861  -39.540 61.777 1.00 73.73  ? 15   DC  I "C2'" 1 
ATOM   7873  C  "C1'" . DC  I 5 88  ? 16.837  -38.246 62.590 1.00 75.11  ? 15   DC  I "C1'" 1 
ATOM   7874  N  N1    . DC  I 5 88  ? 18.140  -37.495 62.569 1.00 76.26  ? 15   DC  I N1    1 
ATOM   7875  C  C2    . DC  I 5 88  ? 18.117  -36.092 62.547 1.00 76.81  ? 15   DC  I C2    1 
ATOM   7876  O  O2    . DC  I 5 88  ? 17.026  -35.508 62.566 1.00 76.02  ? 15   DC  I O2    1 
ATOM   7877  N  N3    . DC  I 5 88  ? 19.298  -35.412 62.506 1.00 77.82  ? 15   DC  I N3    1 
ATOM   7878  C  C4    . DC  I 5 88  ? 20.462  -36.071 62.487 1.00 78.18  ? 15   DC  I C4    1 
ATOM   7879  N  N4    . DC  I 5 88  ? 21.587  -35.346 62.451 1.00 78.49  ? 15   DC  I N4    1 
ATOM   7880  C  C5    . DC  I 5 88  ? 20.510  -37.501 62.506 1.00 77.99  ? 15   DC  I C5    1 
ATOM   7881  C  C6    . DC  I 5 88  ? 19.340  -38.160 62.545 1.00 77.34  ? 15   DC  I C6    1 
ATOM   7882  P  P     . DT  I 5 89  ? 14.015  -40.741 60.606 1.00 70.53  ? 16   DT  I P     1 
ATOM   7883  O  OP1   . DT  I 5 89  ? 12.701  -41.393 60.818 1.00 70.05  ? 16   DT  I OP1   1 
ATOM   7884  O  OP2   . DT  I 5 89  ? 15.093  -41.431 59.853 1.00 71.11  ? 16   DT  I OP2   1 
ATOM   7885  O  "O5'" . DT  I 5 89  ? 13.753  -39.374 59.828 1.00 68.63  ? 16   DT  I "O5'" 1 
ATOM   7886  C  "C5'" . DT  I 5 89  ? 13.016  -38.333 60.444 1.00 65.81  ? 16   DT  I "C5'" 1 
ATOM   7887  C  "C4'" . DT  I 5 89  ? 13.272  -37.073 59.656 1.00 63.62  ? 16   DT  I "C4'" 1 
ATOM   7888  O  "O4'" . DT  I 5 89  ? 14.648  -36.670 59.826 1.00 64.36  ? 16   DT  I "O4'" 1 
ATOM   7889  C  "C3'" . DT  I 5 89  ? 13.068  -37.269 58.163 1.00 61.92  ? 16   DT  I "C3'" 1 
ATOM   7890  O  "O3'" . DT  I 5 89  ? 12.024  -36.384 57.811 1.00 58.65  ? 16   DT  I "O3'" 1 
ATOM   7891  C  "C2'" . DT  I 5 89  ? 14.426  -36.962 57.529 1.00 62.48  ? 16   DT  I "C2'" 1 
ATOM   7892  C  "C1'" . DT  I 5 89  ? 15.106  -36.134 58.612 1.00 64.90  ? 16   DT  I "C1'" 1 
ATOM   7893  N  N1    . DT  I 5 89  ? 16.603  -36.166 58.664 1.00 67.24  ? 16   DT  I N1    1 
ATOM   7894  C  C2    . DT  I 5 89  ? 17.305  -34.970 58.597 1.00 68.61  ? 16   DT  I C2    1 
ATOM   7895  O  O2    . DT  I 5 89  ? 16.795  -33.869 58.476 1.00 69.59  ? 16   DT  I O2    1 
ATOM   7896  N  N3    . DT  I 5 89  ? 18.667  -35.104 58.661 1.00 69.78  ? 16   DT  I N3    1 
ATOM   7897  C  C4    . DT  I 5 89  ? 19.392  -36.276 58.795 1.00 69.67  ? 16   DT  I C4    1 
ATOM   7898  O  O4    . DT  I 5 89  ? 20.619  -36.256 58.841 1.00 70.51  ? 16   DT  I O4    1 
ATOM   7899  C  C5    . DT  I 5 89  ? 18.602  -37.490 58.865 1.00 68.79  ? 16   DT  I C5    1 
ATOM   7900  C  C7    . DT  I 5 89  ? 19.258  -38.828 59.003 1.00 68.71  ? 16   DT  I C7    1 
ATOM   7901  C  C6    . DT  I 5 89  ? 17.265  -37.378 58.800 1.00 67.97  ? 16   DT  I C6    1 
ATOM   7902  P  P     . DT  I 5 90  ? 11.478  -36.218 56.328 1.00 56.07  ? 17   DT  I P     1 
ATOM   7903  O  OP1   . DT  I 5 90  ? 10.019  -36.372 56.487 1.00 56.52  ? 17   DT  I OP1   1 
ATOM   7904  O  OP2   . DT  I 5 90  ? 12.239  -37.046 55.362 1.00 55.38  ? 17   DT  I OP2   1 
ATOM   7905  O  "O5'" . DT  I 5 90  ? 11.807  -34.690 55.979 1.00 56.93  ? 17   DT  I "O5'" 1 
ATOM   7906  C  "C5'" . DT  I 5 90  ? 11.654  -33.659 56.938 1.00 56.51  ? 17   DT  I "C5'" 1 
ATOM   7907  C  "C4'" . DT  I 5 90  ? 12.641  -32.548 56.635 1.00 58.08  ? 17   DT  I "C4'" 1 
ATOM   7908  O  "O4'" . DT  I 5 90  ? 14.011  -32.997 56.801 1.00 58.96  ? 17   DT  I "O4'" 1 
ATOM   7909  C  "C3'" . DT  I 5 90  ? 12.518  -31.967 55.231 1.00 57.57  ? 17   DT  I "C3'" 1 
ATOM   7910  O  "O3'" . DT  I 5 90  ? 12.219  -30.583 55.368 1.00 55.56  ? 17   DT  I "O3'" 1 
ATOM   7911  C  "C2'" . DT  I 5 90  ? 13.867  -32.262 54.571 1.00 58.35  ? 17   DT  I "C2'" 1 
ATOM   7912  C  "C1'" . DT  I 5 90  ? 14.803  -32.457 55.765 1.00 61.06  ? 17   DT  I "C1'" 1 
ATOM   7913  N  N1    . DT  I 5 90  ? 15.997  -33.373 55.561 1.00 64.35  ? 17   DT  I N1    1 
ATOM   7914  C  C2    . DT  I 5 90  ? 17.273  -32.843 55.667 1.00 65.77  ? 17   DT  I C2    1 
ATOM   7915  O  O2    . DT  I 5 90  ? 17.497  -31.670 55.909 1.00 66.25  ? 17   DT  I O2    1 
ATOM   7916  N  N3    . DT  I 5 90  ? 18.294  -33.746 55.473 1.00 67.13  ? 17   DT  I N3    1 
ATOM   7917  C  C4    . DT  I 5 90  ? 18.187  -35.101 55.199 1.00 67.23  ? 17   DT  I C4    1 
ATOM   7918  O  O4    . DT  I 5 90  ? 19.174  -35.817 55.041 1.00 68.10  ? 17   DT  I O4    1 
ATOM   7919  C  C5    . DT  I 5 90  ? 16.831  -35.599 55.104 1.00 66.97  ? 17   DT  I C5    1 
ATOM   7920  C  C7    . DT  I 5 90  ? 16.592  -37.050 54.797 1.00 65.96  ? 17   DT  I C7    1 
ATOM   7921  C  C6    . DT  I 5 90  ? 15.816  -34.724 55.287 1.00 65.30  ? 17   DT  I C6    1 
ATOM   7922  P  P     . DT  I 5 91  ? 11.979  -29.641 54.108 1.00 54.51  ? 18   DT  I P     1 
ATOM   7923  O  OP1   . DT  I 5 91  ? 10.987  -28.692 54.601 1.00 56.84  ? 18   DT  I OP1   1 
ATOM   7924  O  OP2   . DT  I 5 91  ? 11.680  -30.413 52.885 1.00 54.09  ? 18   DT  I OP2   1 
ATOM   7925  O  "O5'" . DT  I 5 91  ? 13.392  -28.901 53.901 1.00 58.87  ? 18   DT  I "O5'" 1 
ATOM   7926  C  "C5'" . DT  I 5 91  ? 14.081  -28.222 54.951 1.00 62.45  ? 18   DT  I "C5'" 1 
ATOM   7927  C  "C4'" . DT  I 5 91  ? 15.464  -27.784 54.492 1.00 67.10  ? 18   DT  I "C4'" 1 
ATOM   7928  O  "O4'" . DT  I 5 91  ? 16.378  -28.909 54.419 1.00 68.52  ? 18   DT  I "O4'" 1 
ATOM   7929  C  "C3'" . DT  I 5 91  ? 15.537  -27.078 53.139 1.00 69.47  ? 18   DT  I "C3'" 1 
ATOM   7930  O  "O3'" . DT  I 5 91  ? 16.343  -25.920 53.301 1.00 72.70  ? 18   DT  I "O3'" 1 
ATOM   7931  C  "C2'" . DT  I 5 91  ? 16.190  -28.106 52.214 1.00 69.71  ? 18   DT  I "C2'" 1 
ATOM   7932  C  "C1'" . DT  I 5 91  ? 17.064  -28.899 53.183 1.00 70.75  ? 18   DT  I "C1'" 1 
ATOM   7933  N  N1    . DT  I 5 91  ? 17.365  -30.341 52.831 1.00 73.34  ? 18   DT  I N1    1 
ATOM   7934  C  C2    . DT  I 5 91  ? 18.639  -30.831 53.069 1.00 75.02  ? 18   DT  I C2    1 
ATOM   7935  O  O2    . DT  I 5 91  ? 19.548  -30.165 53.536 1.00 75.03  ? 18   DT  I O2    1 
ATOM   7936  N  N3    . DT  I 5 91  ? 18.826  -32.151 52.734 1.00 76.29  ? 18   DT  I N3    1 
ATOM   7937  C  C4    . DT  I 5 91  ? 17.894  -33.022 52.204 1.00 76.44  ? 18   DT  I C4    1 
ATOM   7938  O  O4    . DT  I 5 91  ? 18.186  -34.186 51.946 1.00 78.05  ? 18   DT  I O4    1 
ATOM   7939  C  C5    . DT  I 5 91  ? 16.579  -32.458 51.979 1.00 75.69  ? 18   DT  I C5    1 
ATOM   7940  C  C7    . DT  I 5 91  ? 15.480  -33.303 51.404 1.00 74.81  ? 18   DT  I C7    1 
ATOM   7941  C  C6    . DT  I 5 91  ? 16.383  -31.165 52.300 1.00 74.58  ? 18   DT  I C6    1 
ATOM   7942  P  P     . DT  I 5 92  ? 16.454  -24.746 52.219 1.00 75.29  ? 19   DT  I P     1 
ATOM   7943  O  OP1   . DT  I 5 92  ? 16.510  -23.516 53.040 1.00 75.85  ? 19   DT  I OP1   1 
ATOM   7944  O  OP2   . DT  I 5 92  ? 15.433  -24.908 51.160 1.00 73.31  ? 19   DT  I OP2   1 
ATOM   7945  O  "O5'" . DT  I 5 92  ? 17.878  -24.963 51.503 1.00 78.84  ? 19   DT  I "O5'" 1 
ATOM   7946  C  "C5'" . DT  I 5 92  ? 19.076  -25.206 52.247 1.00 84.26  ? 19   DT  I "C5'" 1 
ATOM   7947  C  "C4'" . DT  I 5 92  ? 20.168  -25.786 51.358 1.00 88.61  ? 19   DT  I "C4'" 1 
ATOM   7948  O  "O4'" . DT  I 5 92  ? 19.998  -27.222 51.211 1.00 89.69  ? 19   DT  I "O4'" 1 
ATOM   7949  C  "C3'" . DT  I 5 92  ? 20.220  -25.215 49.940 1.00 91.56  ? 19   DT  I "C3'" 1 
ATOM   7950  O  "O3'" . DT  I 5 92  ? 21.567  -24.849 49.638 1.00 95.22  ? 19   DT  I "O3'" 1 
ATOM   7951  C  "C2'" . DT  I 5 92  ? 19.711  -26.355 49.055 1.00 91.18  ? 19   DT  I "C2'" 1 
ATOM   7952  C  "C1'" . DT  I 5 92  ? 20.188  -27.568 49.853 1.00 91.43  ? 19   DT  I "C1'" 1 
ATOM   7953  N  N1    . DT  I 5 92  ? 19.511  -28.893 49.568 1.00 92.84  ? 19   DT  I N1    1 
ATOM   7954  C  C2    . DT  I 5 92  ? 20.268  -30.057 49.609 1.00 93.62  ? 19   DT  I C2    1 
ATOM   7955  O  O2    . DT  I 5 92  ? 21.461  -30.085 49.862 1.00 94.18  ? 19   DT  I O2    1 
ATOM   7956  N  N3    . DT  I 5 92  ? 19.574  -31.213 49.340 1.00 94.19  ? 19   DT  I N3    1 
ATOM   7957  C  C4    . DT  I 5 92  ? 18.222  -31.329 49.042 1.00 94.69  ? 19   DT  I C4    1 
ATOM   7958  O  O4    . DT  I 5 92  ? 17.698  -32.419 48.813 1.00 94.71  ? 19   DT  I O4    1 
ATOM   7959  C  C5    . DT  I 5 92  ? 17.485  -30.078 49.012 1.00 94.36  ? 19   DT  I C5    1 
ATOM   7960  C  C7    . DT  I 5 92  ? 16.015  -30.065 48.698 1.00 94.50  ? 19   DT  I C7    1 
ATOM   7961  C  C6    . DT  I 5 92  ? 18.155  -28.941 49.274 1.00 93.68  ? 19   DT  I C6    1 
ATOM   7962  P  P     . DG  I 5 93  ? 21.921  -23.741 48.541 1.00 97.98  ? 20   DG  I P     1 
ATOM   7963  O  OP1   . DG  I 5 93  ? 22.736  -22.716 49.238 1.00 98.29  ? 20   DG  I OP1   1 
ATOM   7964  O  OP2   . DG  I 5 93  ? 20.697  -23.355 47.794 1.00 97.04  ? 20   DG  I OP2   1 
ATOM   7965  O  "O5'" . DG  I 5 93  ? 22.853  -24.559 47.536 1.00 100.61 ? 20   DG  I "O5'" 1 
ATOM   7966  C  "C5'" . DG  I 5 93  ? 24.185  -24.919 47.909 1.00 104.93 ? 20   DG  I "C5'" 1 
ATOM   7967  C  "C4'" . DG  I 5 93  ? 24.727  -25.989 46.974 1.00 107.93 ? 20   DG  I "C4'" 1 
ATOM   7968  O  "O4'" . DG  I 5 93  ? 23.991  -27.226 47.183 1.00 108.83 ? 20   DG  I "O4'" 1 
ATOM   7969  C  "C3'" . DG  I 5 93  ? 24.644  -25.667 45.479 1.00 109.43 ? 20   DG  I "C3'" 1 
ATOM   7970  O  "O3'" . DG  I 5 93  ? 25.892  -25.997 44.861 1.00 111.64 ? 20   DG  I "O3'" 1 
ATOM   7971  C  "C2'" . DG  I 5 93  ? 23.474  -26.539 45.009 1.00 109.71 ? 20   DG  I "C2'" 1 
ATOM   7972  C  "C1'" . DG  I 5 93  ? 23.610  -27.754 45.924 1.00 109.89 ? 20   DG  I "C1'" 1 
ATOM   7973  N  N9    . DG  I 5 93  ? 22.374  -28.526 46.062 1.00 110.84 ? 20   DG  I N9    1 
ATOM   7974  C  C8    . DG  I 5 93  ? 21.131  -28.041 46.400 1.00 111.41 ? 20   DG  I C8    1 
ATOM   7975  N  N7    . DG  I 5 93  ? 20.202  -28.956 46.442 1.00 111.78 ? 20   DG  I N7    1 
ATOM   7976  C  C5    . DG  I 5 93  ? 20.869  -30.130 46.107 1.00 111.72 ? 20   DG  I C5    1 
ATOM   7977  C  C6    . DG  I 5 93  ? 20.380  -31.458 45.986 1.00 111.89 ? 20   DG  I C6    1 
ATOM   7978  O  O6    . DG  I 5 93  ? 19.221  -31.862 46.159 1.00 111.70 ? 20   DG  I O6    1 
ATOM   7979  N  N1    . DG  I 5 93  ? 21.385  -32.363 45.622 1.00 111.93 ? 20   DG  I N1    1 
ATOM   7980  C  C2    . DG  I 5 93  ? 22.703  -32.018 45.399 1.00 112.09 ? 20   DG  I C2    1 
ATOM   7981  N  N2    . DG  I 5 93  ? 23.535  -33.015 45.059 1.00 112.39 ? 20   DG  I N2    1 
ATOM   7982  N  N3    . DG  I 5 93  ? 23.174  -30.779 45.514 1.00 111.90 ? 20   DG  I N3    1 
ATOM   7983  C  C4    . DG  I 5 93  ? 22.208  -29.883 45.868 1.00 111.45 ? 20   DG  I C4    1 
ATOM   7984  P  P     . DA  I 5 94  ? 26.170  -25.989 43.271 1.00 113.73 ? 21   DA  I P     1 
ATOM   7985  O  OP1   . DA  I 5 94  ? 26.837  -24.707 42.950 1.00 113.53 ? 21   DA  I OP1   1 
ATOM   7986  O  OP2   . DA  I 5 94  ? 24.961  -26.382 42.505 1.00 113.25 ? 21   DA  I OP2   1 
ATOM   7987  O  "O5'" . DA  I 5 94  ? 27.222  -27.196 43.133 1.00 115.09 ? 21   DA  I "O5'" 1 
ATOM   7988  C  "C5'" . DA  I 5 94  ? 27.082  -28.397 43.915 1.00 116.98 ? 21   DA  I "C5'" 1 
ATOM   7989  C  "C4'" . DA  I 5 94  ? 26.982  -29.660 43.068 1.00 118.73 ? 21   DA  I "C4'" 1 
ATOM   7990  O  "O4'" . DA  I 5 94  ? 25.702  -30.306 43.311 1.00 119.12 ? 21   DA  I "O4'" 1 
ATOM   7991  C  "C3'" . DA  I 5 94  ? 27.091  -29.488 41.551 1.00 119.93 ? 21   DA  I "C3'" 1 
ATOM   7992  O  "O3'" . DA  I 5 94  ? 27.947  -30.500 40.995 1.00 121.45 ? 21   DA  I "O3'" 1 
ATOM   7993  C  "C2'" . DA  I 5 94  ? 25.643  -29.631 41.086 1.00 119.87 ? 21   DA  I "C2'" 1 
ATOM   7994  C  "C1'" . DA  I 5 94  ? 25.121  -30.666 42.073 1.00 119.79 ? 21   DA  I "C1'" 1 
ATOM   7995  N  N9    . DA  I 5 94  ? 23.663  -30.679 42.191 1.00 120.09 ? 21   DA  I N9    1 
ATOM   7996  C  C8    . DA  I 5 94  ? 22.871  -29.656 42.630 1.00 120.20 ? 21   DA  I C8    1 
ATOM   7997  N  N7    . DA  I 5 94  ? 21.591  -29.933 42.637 1.00 120.28 ? 21   DA  I N7    1 
ATOM   7998  C  C5    . DA  I 5 94  ? 21.534  -31.231 42.161 1.00 120.40 ? 21   DA  I C5    1 
ATOM   7999  C  C6    . DA  I 5 94  ? 20.452  -32.107 41.925 1.00 120.37 ? 21   DA  I C6    1 
ATOM   8000  N  N6    . DA  I 5 94  ? 19.182  -31.766 42.158 1.00 120.15 ? 21   DA  I N6    1 
ATOM   8001  N  N1    . DA  I 5 94  ? 20.727  -33.342 41.443 1.00 120.41 ? 21   DA  I N1    1 
ATOM   8002  C  C2    . DA  I 5 94  ? 22.007  -33.673 41.212 1.00 120.51 ? 21   DA  I C2    1 
ATOM   8003  N  N3    . DA  I 5 94  ? 23.105  -32.933 41.395 1.00 120.58 ? 21   DA  I N3    1 
ATOM   8004  C  C4    . DA  I 5 94  ? 22.802  -31.710 41.876 1.00 120.36 ? 21   DA  I C4    1 
ATOM   8005  P  P     . DT  I 5 95  ? 28.219  -30.638 39.416 1.00 122.61 ? 22   DT  I P     1 
ATOM   8006  O  OP1   . DT  I 5 95  ? 29.586  -31.192 39.274 1.00 122.96 ? 22   DT  I OP1   1 
ATOM   8007  O  OP2   . DT  I 5 95  ? 27.882  -29.357 38.750 1.00 122.44 ? 22   DT  I OP2   1 
ATOM   8008  O  "O5'" . DT  I 5 95  ? 27.147  -31.737 38.943 1.00 123.68 ? 22   DT  I "O5'" 1 
ATOM   8009  C  "C5'" . DT  I 5 95  ? 27.331  -33.130 39.232 1.00 125.45 ? 22   DT  I "C5'" 1 
ATOM   8010  C  "C4'" . DT  I 5 95  ? 26.320  -33.989 38.486 1.00 126.86 ? 22   DT  I "C4'" 1 
ATOM   8011  O  "O4'" . DT  I 5 95  ? 24.958  -33.597 38.830 1.00 127.35 ? 22   DT  I "O4'" 1 
ATOM   8012  C  "C3'" . DT  I 5 95  ? 26.402  -33.925 36.956 1.00 127.58 ? 22   DT  I "C3'" 1 
ATOM   8013  O  "O3'" . DT  I 5 95  ? 26.429  -35.253 36.417 1.00 128.09 ? 22   DT  I "O3'" 1 
ATOM   8014  C  "C2'" . DT  I 5 95  ? 25.120  -33.187 36.568 1.00 127.77 ? 22   DT  I "C2'" 1 
ATOM   8015  C  "C1'" . DT  I 5 95  ? 24.186  -33.721 37.649 1.00 127.85 ? 22   DT  I "C1'" 1 
ATOM   8016  N  N1    . DT  I 5 95  ? 22.858  -33.018 37.774 1.00 127.92 ? 22   DT  I N1    1 
ATOM   8017  C  C2    . DT  I 5 95  ? 21.684  -33.759 37.728 1.00 127.74 ? 22   DT  I C2    1 
ATOM   8018  O  O2    . DT  I 5 95  ? 21.641  -34.972 37.592 1.00 127.37 ? 22   DT  I O2    1 
ATOM   8019  N  N3    . DT  I 5 95  ? 20.536  -33.012 37.852 1.00 127.79 ? 22   DT  I N3    1 
ATOM   8020  C  C4    . DT  I 5 95  ? 20.439  -31.637 38.012 1.00 127.92 ? 22   DT  I C4    1 
ATOM   8021  O  O4    . DT  I 5 95  ? 19.350  -31.077 38.113 1.00 127.80 ? 22   DT  I O4    1 
ATOM   8022  C  C5    . DT  I 5 95  ? 21.700  -30.922 38.049 1.00 128.09 ? 22   DT  I C5    1 
ATOM   8023  C  C7    . DT  I 5 95  ? 21.747  -29.428 38.216 1.00 128.05 ? 22   DT  I C7    1 
ATOM   8024  C  C6    . DT  I 5 95  ? 22.828  -31.639 37.930 1.00 128.06 ? 22   DT  I C6    1 
ATOM   8025  P  P     . DG  I 5 96  ? 26.894  -35.546 34.909 1.00 128.33 ? 23   DG  I P     1 
ATOM   8026  O  OP1   . DG  I 5 96  ? 28.336  -35.195 34.830 1.00 128.30 ? 23   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I 5 96  ? 25.933  -34.907 33.975 1.00 128.28 ? 23   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I 5 96  ? 26.713  -37.146 34.814 1.00 127.95 ? 23   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I 5 96  ? 26.287  -37.800 33.608 1.00 127.19 ? 23   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I 5 96  ? 24.933  -38.478 33.785 1.00 126.70 ? 23   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I 5 96  ? 24.020  -37.595 34.501 1.00 126.94 ? 23   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I 5 96  ? 24.221  -38.854 32.481 1.00 126.08 ? 23   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I 5 96  ? 23.600  -40.151 32.603 1.00 124.55 ? 23   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I 5 96  ? 23.204  -37.723 32.325 1.00 126.54 ? 23   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I 5 96  ? 22.806  -37.494 33.779 1.00 126.99 ? 23   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I 5 96  ? 22.198  -36.184 34.004 1.00 127.28 ? 23   DG  I N9    1 
ATOM   8037  C  C8    . DG  I 5 96  ? 22.817  -34.954 33.872 1.00 127.47 ? 23   DG  I C8    1 
ATOM   8038  N  N7    . DG  I 5 96  ? 22.038  -33.941 34.127 1.00 127.59 ? 23   DG  I N7    1 
ATOM   8039  C  C5    . DG  I 5 96  ? 20.815  -34.534 34.449 1.00 127.49 ? 23   DG  I C5    1 
ATOM   8040  C  C6    . DG  I 5 96  ? 19.583  -33.933 34.819 1.00 127.04 ? 23   DG  I C6    1 
ATOM   8041  O  O6    . DG  I 5 96  ? 19.332  -32.723 34.934 1.00 126.69 ? 23   DG  I O6    1 
ATOM   8042  N  N1    . DG  I 5 96  ? 18.582  -34.886 35.062 1.00 126.80 ? 23   DG  I N1    1 
ATOM   8043  C  C2    . DG  I 5 96  ? 18.752  -36.251 34.964 1.00 127.14 ? 23   DG  I C2    1 
ATOM   8044  N  N2    . DG  I 5 96  ? 17.670  -37.009 35.240 1.00 127.04 ? 23   DG  I N2    1 
ATOM   8045  N  N3    . DG  I 5 96  ? 19.903  -36.831 34.620 1.00 127.46 ? 23   DG  I N3    1 
ATOM   8046  C  C4    . DG  I 5 96  ? 20.892  -35.916 34.377 1.00 127.49 ? 23   DG  I C4    1 
ATOM   8047  P  P     . DG  I 5 97  ? 22.465  -40.705 31.599 1.00 123.41 ? 24   DG  I P     1 
ATOM   8048  O  OP1   . DG  I 5 97  ? 22.241  -42.129 31.945 1.00 123.20 ? 24   DG  I OP1   1 
ATOM   8049  O  OP2   . DG  I 5 97  ? 22.840  -40.343 30.210 1.00 123.30 ? 24   DG  I OP2   1 
ATOM   8050  O  "O5'" . DG  I 5 97  ? 21.149  -39.869 31.984 1.00 121.93 ? 24   DG  I "O5'" 1 
ATOM   8051  C  "C5'" . DG  I 5 97  ? 20.027  -40.506 32.623 1.00 119.65 ? 24   DG  I "C5'" 1 
ATOM   8052  C  "C4'" . DG  I 5 97  ? 18.707  -39.876 32.194 1.00 117.62 ? 24   DG  I "C4'" 1 
ATOM   8053  O  "O4'" . DG  I 5 97  ? 18.804  -38.428 32.241 1.00 117.64 ? 24   DG  I "O4'" 1 
ATOM   8054  C  "C3'" . DG  I 5 97  ? 18.207  -40.219 30.790 1.00 116.03 ? 24   DG  I "C3'" 1 
ATOM   8055  O  "O3'" . DG  I 5 97  ? 16.796  -40.404 30.822 1.00 113.16 ? 24   DG  I "O3'" 1 
ATOM   8056  C  "C2'" . DG  I 5 97  ? 18.557  -38.976 29.974 1.00 116.61 ? 24   DG  I "C2'" 1 
ATOM   8057  C  "C1'" . DG  I 5 97  ? 18.304  -37.901 31.026 1.00 117.54 ? 24   DG  I "C1'" 1 
ATOM   8058  N  N9    . DG  I 5 97  ? 18.945  -36.608 30.806 1.00 117.91 ? 24   DG  I N9    1 
ATOM   8059  C  C8    . DG  I 5 97  ? 20.157  -36.339 30.214 1.00 118.29 ? 24   DG  I C8    1 
ATOM   8060  N  N7    . DG  I 5 97  ? 20.446  -35.065 30.182 1.00 118.64 ? 24   DG  I N7    1 
ATOM   8061  C  C5    . DG  I 5 97  ? 19.359  -34.453 30.797 1.00 118.61 ? 24   DG  I C5    1 
ATOM   8062  C  C6    . DG  I 5 97  ? 19.096  -33.082 31.061 1.00 118.66 ? 24   DG  I C6    1 
ATOM   8063  O  O6    . DG  I 5 97  ? 19.802  -32.098 30.788 1.00 118.96 ? 24   DG  I O6    1 
ATOM   8064  N  N1    . DG  I 5 97  ? 17.871  -32.900 31.705 1.00 118.41 ? 24   DG  I N1    1 
ATOM   8065  C  C2    . DG  I 5 97  ? 17.010  -33.919 32.054 1.00 118.33 ? 24   DG  I C2    1 
ATOM   8066  N  N2    . DG  I 5 97  ? 15.876  -33.571 32.671 1.00 118.34 ? 24   DG  I N2    1 
ATOM   8067  N  N3    . DG  I 5 97  ? 17.244  -35.203 31.816 1.00 118.25 ? 24   DG  I N3    1 
ATOM   8068  C  C4    . DG  I 5 97  ? 18.431  -35.395 31.188 1.00 118.29 ? 24   DG  I C4    1 
ATOM   8069  P  P     . DA  I 5 98  ? 16.107  -41.525 29.914 1.00 110.78 ? 25   DA  I P     1 
ATOM   8070  O  OP1   . DA  I 5 98  ? 16.400  -42.830 30.549 1.00 110.10 ? 25   DA  I OP1   1 
ATOM   8071  O  OP2   . DA  I 5 98  ? 16.469  -41.258 28.501 1.00 110.70 ? 25   DA  I OP2   1 
ATOM   8072  O  "O5'" . DA  I 5 98  ? 14.538  -41.232 30.034 1.00 109.26 ? 25   DA  I "O5'" 1 
ATOM   8073  C  "C5'" . DA  I 5 98  ? 13.872  -41.277 31.301 1.00 106.74 ? 25   DA  I "C5'" 1 
ATOM   8074  C  "C4'" . DA  I 5 98  ? 12.815  -40.186 31.353 1.00 104.35 ? 25   DA  I "C4'" 1 
ATOM   8075  O  "O4'" . DA  I 5 98  ? 13.429  -38.896 31.090 1.00 104.52 ? 25   DA  I "O4'" 1 
ATOM   8076  C  "C3'" . DA  I 5 98  ? 11.669  -40.353 30.358 1.00 102.41 ? 25   DA  I "C3'" 1 
ATOM   8077  O  "O3'" . DA  I 5 98  ? 10.424  -40.203 31.053 1.00 98.78  ? 25   DA  I "O3'" 1 
ATOM   8078  C  "C2'" . DA  I 5 98  ? 11.911  -39.274 29.300 1.00 103.28 ? 25   DA  I "C2'" 1 
ATOM   8079  C  "C1'" . DA  I 5 98  ? 12.760  -38.234 30.030 1.00 104.73 ? 25   DA  I "C1'" 1 
ATOM   8080  N  N9    . DA  I 5 98  ? 13.786  -37.581 29.216 1.00 105.80 ? 25   DA  I N9    1 
ATOM   8081  C  C8    . DA  I 5 98  ? 14.593  -38.161 28.272 1.00 106.32 ? 25   DA  I C8    1 
ATOM   8082  N  N7    . DA  I 5 98  ? 15.435  -37.329 27.703 1.00 106.63 ? 25   DA  I N7    1 
ATOM   8083  C  C5    . DA  I 5 98  ? 15.168  -36.117 28.316 1.00 106.72 ? 25   DA  I C5    1 
ATOM   8084  C  C6    . DA  I 5 98  ? 15.725  -34.828 28.158 1.00 107.08 ? 25   DA  I C6    1 
ATOM   8085  N  N6    . DA  I 5 98  ? 16.707  -34.555 27.291 1.00 107.40 ? 25   DA  I N6    1 
ATOM   8086  N  N1    . DA  I 5 98  ? 15.233  -33.825 28.926 1.00 107.23 ? 25   DA  I N1    1 
ATOM   8087  C  C2    . DA  I 5 98  ? 14.248  -34.105 29.797 1.00 107.16 ? 25   DA  I C2    1 
ATOM   8088  N  N3    . DA  I 5 98  ? 13.646  -35.277 30.033 1.00 106.67 ? 25   DA  I N3    1 
ATOM   8089  C  C4    . DA  I 5 98  ? 14.155  -36.253 29.255 1.00 106.47 ? 25   DA  I C4    1 
ATOM   8090  P  P     . DG  I 5 99  ? 8.997   -40.466 30.366 1.00 96.21  ? 26   DG  I P     1 
ATOM   8091  O  OP1   . DG  I 5 99  ? 8.056   -40.884 31.431 1.00 95.29  ? 26   DG  I OP1   1 
ATOM   8092  O  OP2   . DG  I 5 99  ? 9.198   -41.331 29.180 1.00 96.30  ? 26   DG  I OP2   1 
ATOM   8093  O  "O5'" . DG  I 5 99  ? 8.551   -39.030 29.814 1.00 93.80  ? 26   DG  I "O5'" 1 
ATOM   8094  C  "C5'" . DG  I 5 99  ? 8.479   -37.889 30.659 1.00 90.37  ? 26   DG  I "C5'" 1 
ATOM   8095  C  "C4'" . DG  I 5 99  ? 8.390   -36.620 29.832 1.00 88.00  ? 26   DG  I "C4'" 1 
ATOM   8096  O  "O4'" . DG  I 5 99  ? 9.631   -36.418 29.098 1.00 88.83  ? 26   DG  I "O4'" 1 
ATOM   8097  C  "C3'" . DG  I 5 99  ? 7.266   -36.578 28.801 1.00 85.94  ? 26   DG  I "C3'" 1 
ATOM   8098  O  "O3'" . DG  I 5 99  ? 6.612   -35.312 28.935 1.00 82.08  ? 26   DG  I "O3'" 1 
ATOM   8099  C  "C2'" . DG  I 5 99  ? 8.019   -36.699 27.473 1.00 87.18  ? 26   DG  I "C2'" 1 
ATOM   8100  C  "C1'" . DG  I 5 99  ? 9.302   -35.938 27.810 1.00 89.49  ? 26   DG  I "C1'" 1 
ATOM   8101  N  N9    . DG  I 5 99  ? 10.454  -36.084 26.905 1.00 91.69  ? 26   DG  I N9    1 
ATOM   8102  C  C8    . DG  I 5 99  ? 10.763  -37.153 26.091 1.00 92.78  ? 26   DG  I C8    1 
ATOM   8103  N  N7    . DG  I 5 99  ? 11.861  -36.995 25.398 1.00 93.60  ? 26   DG  I N7    1 
ATOM   8104  C  C5    . DG  I 5 99  ? 12.324  -35.737 25.767 1.00 94.18  ? 26   DG  I C5    1 
ATOM   8105  C  C6    . DG  I 5 99  ? 13.481  -35.016 25.342 1.00 95.02  ? 26   DG  I C6    1 
ATOM   8106  O  O6    . DG  I 5 99  ? 14.355  -35.363 24.526 1.00 94.68  ? 26   DG  I O6    1 
ATOM   8107  N  N1    . DG  I 5 99  ? 13.581  -33.764 25.965 1.00 95.65  ? 26   DG  I N1    1 
ATOM   8108  C  C2    . DG  I 5 99  ? 12.674  -33.272 26.884 1.00 95.66  ? 26   DG  I C2    1 
ATOM   8109  N  N2    . DG  I 5 99  ? 12.929  -32.050 27.386 1.00 96.10  ? 26   DG  I N2    1 
ATOM   8110  N  N3    . DG  I 5 99  ? 11.591  -33.941 27.287 1.00 94.92  ? 26   DG  I N3    1 
ATOM   8111  C  C4    . DG  I 5 99  ? 11.469  -35.163 26.694 1.00 93.57  ? 26   DG  I C4    1 
ATOM   8112  P  P     . DC  I 5 100 ? 5.041   -35.101 29.189 1.00 77.38  ? 27   DC  I P     1 
ATOM   8113  O  OP1   . DC  I 5 100 ? 4.684   -35.576 30.539 1.00 78.08  ? 27   DC  I OP1   1 
ATOM   8114  O  OP2   . DC  I 5 100 ? 4.284   -35.599 28.030 1.00 78.17  ? 27   DC  I OP2   1 
ATOM   8115  O  "O5'" . DC  I 5 100 ? 4.923   -33.517 29.169 1.00 80.24  ? 27   DC  I "O5'" 1 
ATOM   8116  C  "C5'" . DC  I 5 100 ? 5.858   -32.718 29.897 1.00 82.80  ? 27   DC  I "C5'" 1 
ATOM   8117  C  "C4'" . DC  I 5 100 ? 6.576   -31.740 28.980 1.00 84.34  ? 27   DC  I "C4'" 1 
ATOM   8118  O  "O4'" . DC  I 5 100 ? 7.501   -32.431 28.101 1.00 83.91  ? 27   DC  I "O4'" 1 
ATOM   8119  C  "C3'" . DC  I 5 100 ? 5.648   -30.913 28.090 1.00 85.83  ? 27   DC  I "C3'" 1 
ATOM   8120  O  "O3'" . DC  I 5 100 ? 5.751   -29.543 28.498 1.00 88.87  ? 27   DC  I "O3'" 1 
ATOM   8121  C  "C2'" . DC  I 5 100 ? 6.155   -31.165 26.664 1.00 85.09  ? 27   DC  I "C2'" 1 
ATOM   8122  C  "C1'" . DC  I 5 100 ? 7.564   -31.712 26.889 1.00 84.46  ? 27   DC  I "C1'" 1 
ATOM   8123  N  N1    . DC  I 5 100 ? 8.117   -32.619 25.813 1.00 84.31  ? 27   DC  I N1    1 
ATOM   8124  C  C2    . DC  I 5 100 ? 9.357   -32.320 25.196 1.00 84.51  ? 27   DC  I C2    1 
ATOM   8125  O  O2    . DC  I 5 100 ? 10.010  -31.314 25.514 1.00 84.78  ? 27   DC  I O2    1 
ATOM   8126  N  N3    . DC  I 5 100 ? 9.835   -33.157 24.240 1.00 84.77  ? 27   DC  I N3    1 
ATOM   8127  C  C4    . DC  I 5 100 ? 9.140   -34.246 23.890 1.00 84.84  ? 27   DC  I C4    1 
ATOM   8128  N  N4    . DC  I 5 100 ? 9.670   -35.023 22.940 1.00 84.56  ? 27   DC  I N4    1 
ATOM   8129  C  C5    . DC  I 5 100 ? 7.881   -34.573 24.497 1.00 84.24  ? 27   DC  I C5    1 
ATOM   8130  C  C6    . DC  I 5 100 ? 7.418   -33.741 25.443 1.00 83.95  ? 27   DC  I C6    1 
ATOM   8131  P  P     . DA  I 5 101 ? 4.696   -28.413 28.071 1.00 90.77  ? 28   DA  I P     1 
ATOM   8132  O  OP1   . DA  I 5 101 ? 4.729   -27.353 29.106 1.00 90.45  ? 28   DA  I OP1   1 
ATOM   8133  O  OP2   . DA  I 5 101 ? 3.417   -29.054 27.698 1.00 91.00  ? 28   DA  I OP2   1 
ATOM   8134  O  "O5'" . DA  I 5 101 ? 5.345   -27.858 26.718 1.00 93.75  ? 28   DA  I "O5'" 1 
ATOM   8135  C  "C5'" . DA  I 5 101 ? 6.703   -27.423 26.701 1.00 97.15  ? 28   DA  I "C5'" 1 
ATOM   8136  C  "C4'" . DA  I 5 101 ? 7.243   -27.387 25.284 1.00 99.48  ? 28   DA  I "C4'" 1 
ATOM   8137  O  "O4'" . DA  I 5 101 ? 7.404   -28.733 24.780 1.00 99.16  ? 28   DA  I "O4'" 1 
ATOM   8138  C  "C3'" . DA  I 5 101 ? 6.380   -26.658 24.257 1.00 101.61 ? 28   DA  I "C3'" 1 
ATOM   8139  O  "O3'" . DA  I 5 101 ? 7.236   -25.817 23.502 1.00 106.11 ? 28   DA  I "O3'" 1 
ATOM   8140  C  "C2'" . DA  I 5 101 ? 5.837   -27.786 23.378 1.00 100.52 ? 28   DA  I "C2'" 1 
ATOM   8141  C  "C1'" . DA  I 5 101 ? 7.071   -28.682 23.410 1.00 99.24  ? 28   DA  I "C1'" 1 
ATOM   8142  N  N9    . DA  I 5 101 ? 6.897   -30.048 22.945 1.00 98.34  ? 28   DA  I N9    1 
ATOM   8143  C  C8    . DA  I 5 101 ? 5.896   -30.922 23.267 1.00 98.39  ? 28   DA  I C8    1 
ATOM   8144  N  N7    . DA  I 5 101 ? 6.017   -32.096 22.694 1.00 98.11  ? 28   DA  I N7    1 
ATOM   8145  C  C5    . DA  I 5 101 ? 7.179   -31.981 21.948 1.00 97.78  ? 28   DA  I C5    1 
ATOM   8146  C  C6    . DA  I 5 101 ? 7.867   -32.879 21.102 1.00 97.50  ? 28   DA  I C6    1 
ATOM   8147  N  N6    . DA  I 5 101 ? 7.451   -34.128 20.864 1.00 97.38  ? 28   DA  I N6    1 
ATOM   8148  N  N1    . DA  I 5 101 ? 9.003   -32.444 20.507 1.00 97.41  ? 28   DA  I N1    1 
ATOM   8149  C  C2    . DA  I 5 101 ? 9.427   -31.192 20.741 1.00 97.33  ? 28   DA  I C2    1 
ATOM   8150  N  N3    . DA  I 5 101 ? 8.863   -30.262 21.516 1.00 97.56  ? 28   DA  I N3    1 
ATOM   8151  C  C4    . DA  I 5 101 ? 7.737   -30.722 22.094 1.00 97.85  ? 28   DA  I C4    1 
ATOM   8152  P  P     . DG  I 5 102 ? 6.745   -24.393 22.942 1.00 109.45 ? 29   DG  I P     1 
ATOM   8153  O  OP1   . DG  I 5 102 ? 7.295   -23.352 23.861 1.00 109.30 ? 29   DG  I OP1   1 
ATOM   8154  O  OP2   . DG  I 5 102 ? 5.287   -24.466 22.636 1.00 108.51 ? 29   DG  I OP2   1 
ATOM   8155  O  "O5'" . DG  I 5 102 ? 7.528   -24.296 21.538 1.00 112.31 ? 29   DG  I "O5'" 1 
ATOM   8156  C  "C5'" . DG  I 5 102 ? 8.987   -24.426 21.528 1.00 116.80 ? 29   DG  I "C5'" 1 
ATOM   8157  C  "C4'" . DG  I 5 102 ? 9.468   -24.816 20.134 1.00 119.89 ? 29   DG  I "C4'" 1 
ATOM   8158  O  "O4'" . DG  I 5 102 ? 9.312   -26.246 19.922 1.00 120.33 ? 29   DG  I "O4'" 1 
ATOM   8159  C  "C3'" . DG  I 5 102 ? 8.770   -24.118 18.966 1.00 121.83 ? 29   DG  I "C3'" 1 
ATOM   8160  O  "O3'" . DG  I 5 102 ? 9.754   -23.651 18.041 1.00 125.13 ? 29   DG  I "O3'" 1 
ATOM   8161  C  "C2'" . DG  I 5 102 ? 7.851   -25.193 18.366 1.00 121.28 ? 29   DG  I "C2'" 1 
ATOM   8162  C  "C1'" . DG  I 5 102 ? 8.602   -26.487 18.716 1.00 120.71 ? 29   DG  I "C1'" 1 
ATOM   8163  N  N9    . DG  I 5 102 ? 7.744   -27.652 18.935 1.00 120.69 ? 29   DG  I N9    1 
ATOM   8164  C  C8    . DG  I 5 102 ? 6.641   -27.742 19.753 1.00 120.84 ? 29   DG  I C8    1 
ATOM   8165  N  N7    . DG  I 5 102 ? 6.074   -28.920 19.745 1.00 120.66 ? 29   DG  I N7    1 
ATOM   8166  C  C5    . DG  I 5 102 ? 6.854   -29.664 18.871 1.00 120.67 ? 29   DG  I C5    1 
ATOM   8167  C  C6    . DG  I 5 102 ? 6.734   -31.018 18.462 1.00 120.79 ? 29   DG  I C6    1 
ATOM   8168  O  O6    . DG  I 5 102 ? 5.877   -31.848 18.808 1.00 120.68 ? 29   DG  I O6    1 
ATOM   8169  N  N1    . DG  I 5 102 ? 7.738   -31.389 17.559 1.00 120.93 ? 29   DG  I N1    1 
ATOM   8170  C  C2    . DG  I 5 102 ? 8.739   -30.550 17.109 1.00 121.01 ? 29   DG  I C2    1 
ATOM   8171  N  N2    . DG  I 5 102 ? 9.622   -31.074 16.240 1.00 120.91 ? 29   DG  I N2    1 
ATOM   8172  N  N3    . DG  I 5 102 ? 8.860   -29.278 17.488 1.00 120.97 ? 29   DG  I N3    1 
ATOM   8173  C  C4    . DG  I 5 102 ? 7.889   -28.899 18.366 1.00 120.75 ? 29   DG  I C4    1 
ATOM   8174  P  P     . DT  I 5 103 ? 9.391   -22.558 16.921 1.00 127.73 ? 30   DT  I P     1 
ATOM   8175  O  OP1   . DT  I 5 103 ? 10.591  -21.702 16.741 1.00 127.56 ? 30   DT  I OP1   1 
ATOM   8176  O  OP2   . DT  I 5 103 ? 8.081   -21.937 17.248 1.00 127.53 ? 30   DT  I OP2   1 
ATOM   8177  O  "O5'" . DT  I 5 103 ? 9.180   -23.472 15.620 1.00 128.87 ? 30   DT  I "O5'" 1 
ATOM   8178  C  "C5'" . DT  I 5 103 ? 10.306  -24.086 14.992 1.00 131.35 ? 30   DT  I "C5'" 1 
ATOM   8179  C  "C4'" . DT  I 5 103 ? 9.892   -25.228 14.078 1.00 133.06 ? 30   DT  I "C4'" 1 
ATOM   8180  O  "O4'" . DT  I 5 103 ? 9.119   -26.207 14.816 1.00 133.25 ? 30   DT  I "O4'" 1 
ATOM   8181  C  "C3'" . DT  I 5 103 ? 9.027   -24.839 12.877 1.00 134.20 ? 30   DT  I "C3'" 1 
ATOM   8182  O  "O3'" . DT  I 5 103 ? 9.760   -25.076 11.671 1.00 136.02 ? 30   DT  I "O3'" 1 
ATOM   8183  C  "C2'" . DT  I 5 103 ? 7.791   -25.736 12.982 1.00 133.72 ? 30   DT  I "C2'" 1 
ATOM   8184  C  "C1'" . DT  I 5 103 ? 8.309   -26.863 13.866 1.00 133.39 ? 30   DT  I "C1'" 1 
ATOM   8185  N  N1    . DT  I 5 103 ? 7.255   -27.692 14.549 1.00 133.47 ? 30   DT  I N1    1 
ATOM   8186  C  C2    . DT  I 5 103 ? 7.108   -29.027 14.189 1.00 133.40 ? 30   DT  I C2    1 
ATOM   8187  O  O2    . DT  I 5 103 ? 7.787   -29.586 13.340 1.00 133.40 ? 30   DT  I O2    1 
ATOM   8188  N  N3    . DT  I 5 103 ? 6.121   -29.704 14.870 1.00 133.28 ? 30   DT  I N3    1 
ATOM   8189  C  C4    . DT  I 5 103 ? 5.284   -29.192 15.855 1.00 133.37 ? 30   DT  I C4    1 
ATOM   8190  O  O4    . DT  I 5 103 ? 4.436   -29.891 16.401 1.00 133.31 ? 30   DT  I O4    1 
ATOM   8191  C  C5    . DT  I 5 103 ? 5.485   -27.792 16.189 1.00 133.56 ? 30   DT  I C5    1 
ATOM   8192  C  C7    . DT  I 5 103 ? 4.642   -27.112 17.238 1.00 133.45 ? 30   DT  I C7    1 
ATOM   8193  C  C6    . DT  I 5 103 ? 6.448   -27.120 15.531 1.00 133.70 ? 30   DT  I C6    1 
ATOM   8194  P  P     . DT  I 5 104 ? 9.250   -24.572 10.230 1.00 137.39 ? 31   DT  I P     1 
ATOM   8195  O  OP1   . DT  I 5 104 ? 10.458  -24.191 9.459  1.00 137.44 ? 31   DT  I OP1   1 
ATOM   8196  O  OP2   . DT  I 5 104 ? 8.141   -23.598 10.396 1.00 137.31 ? 31   DT  I OP2   1 
ATOM   8197  O  "O5'" . DT  I 5 104 ? 8.618   -25.902 9.602  1.00 137.54 ? 31   DT  I "O5'" 1 
ATOM   8198  C  "C5'" . DT  I 5 104 ? 9.446   -27.004 9.241  1.00 138.50 ? 31   DT  I "C5'" 1 
ATOM   8199  C  "C4'" . DT  I 5 104 ? 8.584   -28.174 8.797  1.00 139.20 ? 31   DT  I "C4'" 1 
ATOM   8200  O  "O4'" . DT  I 5 104 ? 7.793   -28.642 9.923  1.00 139.47 ? 31   DT  I "O4'" 1 
ATOM   8201  C  "C3'" . DT  I 5 104 ? 7.594   -27.855 7.674  1.00 139.41 ? 31   DT  I "C3'" 1 
ATOM   8202  O  "O3'" . DT  I 5 104 ? 7.635   -28.873 6.673  1.00 139.37 ? 31   DT  I "O3'" 1 
ATOM   8203  C  "C2'" . DT  I 5 104 ? 6.246   -27.834 8.390  1.00 139.58 ? 31   DT  I "C2'" 1 
ATOM   8204  C  "C1'" . DT  I 5 104 ? 6.484   -28.900 9.455  1.00 139.86 ? 31   DT  I "C1'" 1 
ATOM   8205  N  N1    . DT  I 5 104 ? 5.504   -28.904 10.595 1.00 140.20 ? 31   DT  I N1    1 
ATOM   8206  C  C2    . DT  I 5 104 ? 4.944   -30.106 11.008 1.00 140.28 ? 31   DT  I C2    1 
ATOM   8207  O  O2    . DT  I 5 104 ? 5.193   -31.190 10.500 1.00 140.17 ? 31   DT  I O2    1 
ATOM   8208  N  N3    . DT  I 5 104 ? 4.061   -29.993 12.057 1.00 140.36 ? 31   DT  I N3    1 
ATOM   8209  C  C4    . DT  I 5 104 ? 3.689   -28.830 12.721 1.00 140.50 ? 31   DT  I C4    1 
ATOM   8210  O  O4    . DT  I 5 104 ? 2.887   -28.850 13.652 1.00 140.44 ? 31   DT  I O4    1 
ATOM   8211  C  C5    . DT  I 5 104 ? 4.310   -27.609 12.241 1.00 140.51 ? 31   DT  I C5    1 
ATOM   8212  C  C7    . DT  I 5 104 ? 4.000   -26.275 12.867 1.00 140.58 ? 31   DT  I C7    1 
ATOM   8213  C  C6    . DT  I 5 104 ? 5.174   -27.707 11.218 1.00 140.43 ? 31   DT  I C6    1 
ATOM   8214  P  P     . DT  I 5 105 ? 7.065   -28.603 5.199  1.00 139.27 ? 32   DT  I P     1 
ATOM   8215  O  OP1   . DT  I 5 105 ? 7.841   -27.482 4.620  1.00 139.27 ? 32   DT  I OP1   1 
ATOM   8216  O  OP2   . DT  I 5 105 ? 5.590   -28.506 5.280  1.00 139.00 ? 32   DT  I OP2   1 
ATOM   8217  O  "O5'" . DT  I 5 105 ? 7.409   -29.954 4.403  1.00 139.39 ? 32   DT  I "O5'" 1 
ATOM   8218  C  "C5'" . DT  I 5 105 ? 7.687   -31.191 5.074  1.00 139.71 ? 32   DT  I "C5'" 1 
ATOM   8219  C  "C4'" . DT  I 5 105 ? 6.433   -31.956 5.494  1.00 139.96 ? 32   DT  I "C4'" 1 
ATOM   8220  O  "O4'" . DT  I 5 105 ? 5.795   -31.332 6.642  1.00 140.41 ? 32   DT  I "O4'" 1 
ATOM   8221  C  "C3'" . DT  I 5 105 ? 5.325   -32.123 4.442  1.00 139.70 ? 32   DT  I "C3'" 1 
ATOM   8222  O  "O3'" . DT  I 5 105 ? 5.293   -33.492 3.991  1.00 138.71 ? 32   DT  I "O3'" 1 
ATOM   8223  C  "C2'" . DT  I 5 105 ? 4.045   -31.737 5.193  1.00 140.34 ? 32   DT  I "C2'" 1 
ATOM   8224  C  "C1'" . DT  I 5 105 ? 4.477   -31.844 6.654  1.00 140.92 ? 32   DT  I "C1'" 1 
ATOM   8225  N  N1    . DT  I 5 105 ? 3.589   -31.130 7.658  1.00 141.71 ? 32   DT  I N1    1 
ATOM   8226  C  C2    . DT  I 5 105 ? 2.928   -31.864 8.635  1.00 141.95 ? 32   DT  I C2    1 
ATOM   8227  O  O2    . DT  I 5 105 ? 3.018   -33.074 8.756  1.00 141.88 ? 32   DT  I O2    1 
ATOM   8228  N  N3    . DT  I 5 105 ? 2.146   -31.123 9.492  1.00 142.26 ? 32   DT  I N3    1 
ATOM   8229  C  C4    . DT  I 5 105 ? 1.951   -29.749 9.474  1.00 142.44 ? 32   DT  I C4    1 
ATOM   8230  O  O4    . DT  I 5 105 ? 1.224   -29.191 10.295 1.00 142.39 ? 32   DT  I O4    1 
ATOM   8231  C  C5    . DT  I 5 105 ? 2.664   -29.036 8.430  1.00 142.47 ? 32   DT  I C5    1 
ATOM   8232  C  C7    . DT  I 5 105 ? 2.549   -27.542 8.291  1.00 142.63 ? 32   DT  I C7    1 
ATOM   8233  C  C6    . DT  I 5 105 ? 3.429   -29.752 7.587  1.00 142.22 ? 32   DT  I C6    1 
ATOM   8234  P  P     . DC  I 5 106 ? 4.301   -34.045 2.848  1.00 137.68 ? 33   DC  I P     1 
ATOM   8235  O  OP1   . DC  I 5 106 ? 4.892   -35.304 2.334  1.00 137.30 ? 33   DC  I OP1   1 
ATOM   8236  O  OP2   . DC  I 5 106 ? 3.982   -32.944 1.910  1.00 137.68 ? 33   DC  I OP2   1 
ATOM   8237  O  "O5'" . DC  I 5 106 ? 2.954   -34.376 3.651  1.00 136.68 ? 33   DC  I "O5'" 1 
ATOM   8238  C  "C5'" . DC  I 5 106 ? 2.525   -35.713 3.905  1.00 135.12 ? 33   DC  I "C5'" 1 
ATOM   8239  C  "C4'" . DC  I 5 106 ? 1.084   -35.712 4.391  1.00 134.03 ? 33   DC  I "C4'" 1 
ATOM   8240  O  "O4'" . DC  I 5 106 ? 0.867   -34.592 5.298  1.00 134.31 ? 33   DC  I "O4'" 1 
ATOM   8241  C  "C3'" . DC  I 5 106 ? 0.036   -35.575 3.288  1.00 132.83 ? 33   DC  I "C3'" 1 
ATOM   8242  O  "O3'" . DC  I 5 106 ? -1.063  -36.457 3.514  1.00 130.45 ? 33   DC  I "O3'" 1 
ATOM   8243  C  "C2'" . DC  I 5 106 ? -0.404  -34.119 3.394  1.00 133.45 ? 33   DC  I "C2'" 1 
ATOM   8244  C  "C1'" . DC  I 5 106 ? -0.311  -33.918 4.905  1.00 134.13 ? 33   DC  I "C1'" 1 
ATOM   8245  N  N1    . DC  I 5 106 ? -0.269  -32.489 5.359  1.00 134.50 ? 33   DC  I N1    1 
ATOM   8246  C  C2    . DC  I 5 106 ? -0.998  -32.104 6.504  1.00 134.78 ? 33   DC  I C2    1 
ATOM   8247  O  O2    . DC  I 5 106 ? -1.667  -32.948 7.131  1.00 134.55 ? 33   DC  I O2    1 
ATOM   8248  N  N3    . DC  I 5 106 ? -0.947  -30.799 6.897  1.00 134.98 ? 33   DC  I N3    1 
ATOM   8249  C  C4    . DC  I 5 106 ? -0.218  -29.907 6.202  1.00 135.04 ? 33   DC  I C4    1 
ATOM   8250  N  N4    . DC  I 5 106 ? -0.203  -28.638 6.628  1.00 134.93 ? 33   DC  I N4    1 
ATOM   8251  C  C5    . DC  I 5 106 ? 0.528   -30.277 5.035  1.00 134.96 ? 33   DC  I C5    1 
ATOM   8252  C  C6    . DC  I 5 106 ? 0.472   -31.564 4.657  1.00 134.76 ? 33   DC  I C6    1 
ATOM   8253  P  P     . DC  I 5 107 ? -1.688  -37.236 2.264  1.00 128.59 ? 34   DC  I P     1 
ATOM   8254  O  OP1   . DC  I 5 107 ? -0.667  -38.212 1.820  1.00 128.48 ? 34   DC  I OP1   1 
ATOM   8255  O  OP2   . DC  I 5 107 ? -2.198  -36.216 1.318  1.00 128.53 ? 34   DC  I OP2   1 
ATOM   8256  O  "O5'" . DC  I 5 107 ? -2.957  -38.033 2.833  1.00 126.86 ? 34   DC  I "O5'" 1 
ATOM   8257  C  "C5'" . DC  I 5 107 ? -3.022  -38.524 4.176  1.00 124.42 ? 34   DC  I "C5'" 1 
ATOM   8258  C  "C4'" . DC  I 5 107 ? -4.251  -38.001 4.914  1.00 122.39 ? 34   DC  I "C4'" 1 
ATOM   8259  O  "O4'" . DC  I 5 107 ? -4.028  -36.630 5.338  1.00 122.49 ? 34   DC  I "O4'" 1 
ATOM   8260  C  "C3'" . DC  I 5 107 ? -5.563  -37.992 4.123  1.00 120.92 ? 34   DC  I "C3'" 1 
ATOM   8261  O  "O3'" . DC  I 5 107 ? -6.616  -38.524 4.923  1.00 118.73 ? 34   DC  I "O3'" 1 
ATOM   8262  C  "C2'" . DC  I 5 107 ? -5.802  -36.512 3.829  1.00 121.43 ? 34   DC  I "C2'" 1 
ATOM   8263  C  "C1'" . DC  I 5 107 ? -5.208  -35.891 5.087  1.00 122.47 ? 34   DC  I "C1'" 1 
ATOM   8264  N  N1    . DC  I 5 107 ? -4.888  -34.424 5.009  1.00 123.19 ? 34   DC  I N1    1 
ATOM   8265  C  C2    . DC  I 5 107 ? -5.602  -33.526 5.823  1.00 123.55 ? 34   DC  I C2    1 
ATOM   8266  O  O2    . DC  I 5 107 ? -6.478  -33.955 6.584  1.00 123.53 ? 34   DC  I O2    1 
ATOM   8267  N  N3    . DC  I 5 107 ? -5.312  -32.198 5.756  1.00 123.98 ? 34   DC  I N3    1 
ATOM   8268  C  C4    . DC  I 5 107 ? -4.355  -31.759 4.929  1.00 124.06 ? 34   DC  I C4    1 
ATOM   8269  N  N4    . DC  I 5 107 ? -4.109  -30.443 4.903  1.00 124.01 ? 34   DC  I N4    1 
ATOM   8270  C  C5    . DC  I 5 107 ? -3.615  -32.654 4.093  1.00 123.74 ? 34   DC  I C5    1 
ATOM   8271  C  C6    . DC  I 5 107 ? -3.911  -33.961 4.166  1.00 123.41 ? 34   DC  I C6    1 
ATOM   8272  P  P     . DA  I 5 108 ? -7.019  -40.078 4.880  1.00 116.90 ? 35   DA  I P     1 
ATOM   8273  O  OP1   . DA  I 5 108 ? -5.814  -40.894 5.160  1.00 116.59 ? 35   DA  I OP1   1 
ATOM   8274  O  OP2   . DA  I 5 108 ? -7.799  -40.316 3.645  1.00 116.66 ? 35   DA  I OP2   1 
ATOM   8275  O  "O5'" . DA  I 5 108 ? -8.040  -40.227 6.107  1.00 115.38 ? 35   DA  I "O5'" 1 
ATOM   8276  C  "C5'" . DA  I 5 108 ? -7.632  -39.955 7.452  1.00 112.83 ? 35   DA  I "C5'" 1 
ATOM   8277  C  "C4'" . DA  I 5 108 ? -8.571  -38.990 8.169  1.00 110.93 ? 35   DA  I "C4'" 1 
ATOM   8278  O  "O4'" . DA  I 5 108 ? -8.461  -37.651 7.622  1.00 110.72 ? 35   DA  I "O4'" 1 
ATOM   8279  C  "C3'" . DA  I 5 108 ? -10.062 -39.320 8.140  1.00 109.82 ? 35   DA  I "C3'" 1 
ATOM   8280  O  "O3'" . DA  I 5 108 ? -10.573 -39.034 9.440  1.00 107.97 ? 35   DA  I "O3'" 1 
ATOM   8281  C  "C2'" . DA  I 5 108 ? -10.612 -38.362 7.084  1.00 109.99 ? 35   DA  I "C2'" 1 
ATOM   8282  C  "C1'" . DA  I 5 108 ? -9.751  -37.138 7.358  1.00 110.70 ? 35   DA  I "C1'" 1 
ATOM   8283  N  N9    . DA  I 5 108 ? -9.598  -36.217 6.243  1.00 111.38 ? 35   DA  I N9    1 
ATOM   8284  C  C8    . DA  I 5 108 ? -9.526  -36.533 4.915  1.00 111.92 ? 35   DA  I C8    1 
ATOM   8285  N  N7    . DA  I 5 108 ? -9.368  -35.491 4.134  1.00 112.43 ? 35   DA  I N7    1 
ATOM   8286  C  C5    . DA  I 5 108 ? -9.327  -34.418 5.008  1.00 112.22 ? 35   DA  I C5    1 
ATOM   8287  C  C6    . DA  I 5 108 ? -9.176  -33.026 4.808  1.00 112.47 ? 35   DA  I C6    1 
ATOM   8288  N  N6    . DA  I 5 108 ? -9.037  -32.463 3.602  1.00 112.66 ? 35   DA  I N6    1 
ATOM   8289  N  N1    . DA  I 5 108 ? -9.177  -32.227 5.901  1.00 112.45 ? 35   DA  I N1    1 
ATOM   8290  C  C2    . DA  I 5 108 ? -9.318  -32.789 7.111  1.00 112.28 ? 35   DA  I C2    1 
ATOM   8291  N  N3    . DA  I 5 108 ? -9.467  -34.081 7.420  1.00 112.07 ? 35   DA  I N3    1 
ATOM   8292  C  C4    . DA  I 5 108 ? -9.465  -34.851 6.316  1.00 111.86 ? 35   DA  I C4    1 
ATOM   8293  P  P     . DA  I 5 109 ? -12.071 -39.364 9.913  1.00 105.95 ? 36   DA  I P     1 
ATOM   8294  O  OP1   . DA  I 5 109 ? -11.951 -40.210 11.119 1.00 105.50 ? 36   DA  I OP1   1 
ATOM   8295  O  OP2   . DA  I 5 109 ? -12.866 -39.835 8.756  1.00 105.55 ? 36   DA  I OP2   1 
ATOM   8296  O  "O5'" . DA  I 5 109 ? -12.643 -37.931 10.339 1.00 104.94 ? 36   DA  I "O5'" 1 
ATOM   8297  C  "C5'" . DA  I 5 109 ? -11.810 -36.948 10.964 1.00 103.32 ? 36   DA  I "C5'" 1 
ATOM   8298  C  "C4'" . DA  I 5 109 ? -12.460 -35.581 10.851 1.00 102.57 ? 36   DA  I "C4'" 1 
ATOM   8299  O  "O4'" . DA  I 5 109 ? -12.086 -34.974 9.584  1.00 102.70 ? 36   DA  I "O4'" 1 
ATOM   8300  C  "C3'" . DA  I 5 109 ? -13.989 -35.576 10.902 1.00 101.85 ? 36   DA  I "C3'" 1 
ATOM   8301  O  "O3'" . DA  I 5 109 ? -14.412 -34.559 11.814 1.00 100.94 ? 36   DA  I "O3'" 1 
ATOM   8302  C  "C2'" . DA  I 5 109 ? -14.371 -35.284 9.451  1.00 102.16 ? 36   DA  I "C2'" 1 
ATOM   8303  C  "C1'" . DA  I 5 109 ? -13.236 -34.350 9.056  1.00 102.47 ? 36   DA  I "C1'" 1 
ATOM   8304  N  N9    . DA  I 5 109 ? -13.075 -34.128 7.622  1.00 102.46 ? 36   DA  I N9    1 
ATOM   8305  C  C8    . DA  I 5 109 ? -13.242 -35.048 6.626  1.00 102.28 ? 36   DA  I C8    1 
ATOM   8306  N  N7    . DA  I 5 109 ? -13.034 -34.564 5.425  1.00 102.87 ? 36   DA  I N7    1 
ATOM   8307  C  C5    . DA  I 5 109 ? -12.709 -33.235 5.644  1.00 102.95 ? 36   DA  I C5    1 
ATOM   8308  C  C6    . DA  I 5 109 ? -12.371 -32.172 4.770  1.00 103.13 ? 36   DA  I C6    1 
ATOM   8309  N  N6    . DA  I 5 109 ? -12.310 -32.306 3.438  1.00 103.53 ? 36   DA  I N6    1 
ATOM   8310  N  N1    . DA  I 5 109 ? -12.100 -30.961 5.314  1.00 102.84 ? 36   DA  I N1    1 
ATOM   8311  C  C2    . DA  I 5 109 ? -12.161 -30.827 6.647  1.00 102.65 ? 36   DA  I C2    1 
ATOM   8312  N  N3    . DA  I 5 109 ? -12.462 -31.752 7.564  1.00 102.67 ? 36   DA  I N3    1 
ATOM   8313  C  C4    . DA  I 5 109 ? -12.729 -32.947 6.998  1.00 102.65 ? 36   DA  I C4    1 
ATOM   8314  P  P     . DA  I 5 110 ? -15.940 -34.268 12.241 1.00 100.14 ? 37   DA  I P     1 
ATOM   8315  O  OP1   . DA  I 5 110 ? -16.108 -34.840 13.598 1.00 99.22  ? 37   DA  I OP1   1 
ATOM   8316  O  OP2   . DA  I 5 110 ? -16.876 -34.674 11.164 1.00 99.77  ? 37   DA  I OP2   1 
ATOM   8317  O  "O5'" . DA  I 5 110 ? -15.975 -32.664 12.328 1.00 99.77  ? 37   DA  I "O5'" 1 
ATOM   8318  C  "C5'" . DA  I 5 110 ? -14.775 -31.885 12.223 1.00 99.76  ? 37   DA  I "C5'" 1 
ATOM   8319  C  "C4'" . DA  I 5 110 ? -15.050 -30.493 11.663 1.00 100.30 ? 37   DA  I "C4'" 1 
ATOM   8320  O  "O4'" . DA  I 5 110 ? -14.641 -30.429 10.263 1.00 100.86 ? 37   DA  I "O4'" 1 
ATOM   8321  C  "C3'" . DA  I 5 110 ? -16.508 -30.034 11.716 1.00 99.75  ? 37   DA  I "C3'" 1 
ATOM   8322  O  "O3'" . DA  I 5 110 ? -16.604 -28.663 12.094 1.00 98.55  ? 37   DA  I "O3'" 1 
ATOM   8323  C  "C2'" . DA  I 5 110 ? -16.997 -30.254 10.288 1.00 100.74 ? 37   DA  I "C2'" 1 
ATOM   8324  C  "C1'" . DA  I 5 110 ? -15.740 -30.058 9.449  1.00 101.54 ? 37   DA  I "C1'" 1 
ATOM   8325  N  N9    . DA  I 5 110 ? -15.772 -30.863 8.227  1.00 102.41 ? 37   DA  I N9    1 
ATOM   8326  C  C8    . DA  I 5 110 ? -16.080 -32.195 8.119  1.00 102.58 ? 37   DA  I C8    1 
ATOM   8327  N  N7    . DA  I 5 110 ? -16.039 -32.658 6.892  1.00 102.98 ? 37   DA  I N7    1 
ATOM   8328  C  C5    . DA  I 5 110 ? -15.684 -31.553 6.138  1.00 103.43 ? 37   DA  I C5    1 
ATOM   8329  C  C6    . DA  I 5 110 ? -15.471 -31.372 4.750  1.00 103.97 ? 37   DA  I C6    1 
ATOM   8330  N  N6    . DA  I 5 110 ? -15.592 -32.356 3.854  1.00 103.91 ? 37   DA  I N6    1 
ATOM   8331  N  N1    . DA  I 5 110 ? -15.119 -30.138 4.316  1.00 103.96 ? 37   DA  I N1    1 
ATOM   8332  C  C2    . DA  I 5 110 ? -14.996 -29.155 5.219  1.00 104.21 ? 37   DA  I C2    1 
ATOM   8333  N  N3    . DA  I 5 110 ? -15.170 -29.202 6.545  1.00 103.94 ? 37   DA  I N3    1 
ATOM   8334  C  C4    . DA  I 5 110 ? -15.518 -30.439 6.945  1.00 103.06 ? 37   DA  I C4    1 
ATOM   8335  P  P     . DT  I 5 111 ? -18.036 -27.973 12.284 1.00 97.49  ? 38   DT  I P     1 
ATOM   8336  O  OP1   . DT  I 5 111 ? -18.097 -27.371 13.644 1.00 97.16  ? 38   DT  I OP1   1 
ATOM   8337  O  OP2   . DT  I 5 111 ? -19.062 -28.957 11.885 1.00 97.05  ? 38   DT  I OP2   1 
ATOM   8338  O  "O5'" . DT  I 5 111 ? -18.039 -26.806 11.183 1.00 99.18  ? 38   DT  I "O5'" 1 
ATOM   8339  C  "C5'" . DT  I 5 111 ? -16.927 -25.895 11.104 1.00 101.50 ? 38   DT  I "C5'" 1 
ATOM   8340  C  "C4'" . DT  I 5 111 ? -16.911 -25.209 9.747  1.00 103.16 ? 38   DT  I "C4'" 1 
ATOM   8341  O  "O4'" . DT  I 5 111 ? -16.779 -26.201 8.696  1.00 103.05 ? 38   DT  I "O4'" 1 
ATOM   8342  C  "C3'" . DT  I 5 111 ? -18.160 -24.390 9.422  1.00 104.33 ? 38   DT  I "C3'" 1 
ATOM   8343  O  "O3'" . DT  I 5 111 ? -17.757 -23.099 8.973  1.00 106.62 ? 38   DT  I "O3'" 1 
ATOM   8344  C  "C2'" . DT  I 5 111 ? -18.868 -25.207 8.336  1.00 103.79 ? 38   DT  I "C2'" 1 
ATOM   8345  C  "C1'" . DT  I 5 111 ? -17.669 -25.858 7.648  1.00 103.39 ? 38   DT  I "C1'" 1 
ATOM   8346  N  N1    . DT  I 5 111 ? -17.959 -27.082 6.820  1.00 103.29 ? 38   DT  I N1    1 
ATOM   8347  C  C2    . DT  I 5 111 ? -17.735 -27.045 5.445  1.00 103.04 ? 38   DT  I C2    1 
ATOM   8348  O  O2    . DT  I 5 111 ? -17.314 -26.066 4.842  1.00 102.78 ? 38   DT  I O2    1 
ATOM   8349  N  N3    . DT  I 5 111 ? -18.028 -28.220 4.785  1.00 102.59 ? 38   DT  I N3    1 
ATOM   8350  C  C4    . DT  I 5 111 ? -18.502 -29.397 5.346  1.00 102.73 ? 38   DT  I C4    1 
ATOM   8351  O  O4    . DT  I 5 111 ? -18.728 -30.391 4.660  1.00 102.46 ? 38   DT  I O4    1 
ATOM   8352  C  C5    . DT  I 5 111 ? -18.712 -29.368 6.782  1.00 102.75 ? 38   DT  I C5    1 
ATOM   8353  C  C7    . DT  I 5 111 ? -19.231 -30.577 7.507  1.00 102.86 ? 38   DT  I C7    1 
ATOM   8354  C  C6    . DT  I 5 111 ? -18.434 -28.230 7.440  1.00 102.97 ? 38   DT  I C6    1 
ATOM   8355  P  P     . DA  I 5 112 ? -18.811 -21.909 8.781  1.00 108.56 ? 39   DA  I P     1 
ATOM   8356  O  OP1   . DA  I 5 112 ? -18.059 -20.635 8.887  1.00 108.79 ? 39   DA  I OP1   1 
ATOM   8357  O  OP2   . DA  I 5 112 ? -19.971 -22.171 9.666  1.00 107.84 ? 39   DA  I OP2   1 
ATOM   8358  O  "O5'" . DA  I 5 112 ? -19.287 -22.102 7.259  1.00 110.78 ? 39   DA  I "O5'" 1 
ATOM   8359  C  "C5'" . DA  I 5 112 ? -18.367 -21.994 6.164  1.00 113.83 ? 39   DA  I "C5'" 1 
ATOM   8360  C  "C4'" . DA  I 5 112 ? -19.060 -22.171 4.817  1.00 116.21 ? 39   DA  I "C4'" 1 
ATOM   8361  O  "O4'" . DA  I 5 112 ? -19.187 -23.582 4.491  1.00 116.50 ? 39   DA  I "O4'" 1 
ATOM   8362  C  "C3'" . DA  I 5 112 ? -20.471 -21.586 4.716  1.00 117.61 ? 39   DA  I "C3'" 1 
ATOM   8363  O  "O3'" . DA  I 5 112 ? -20.590 -20.816 3.525  1.00 119.81 ? 39   DA  I "O3'" 1 
ATOM   8364  C  "C2'" . DA  I 5 112 ? -21.379 -22.810 4.686  1.00 117.16 ? 39   DA  I "C2'" 1 
ATOM   8365  C  "C1'" . DA  I 5 112 ? -20.476 -23.798 3.957  1.00 116.81 ? 39   DA  I "C1'" 1 
ATOM   8366  N  N9    . DA  I 5 112 ? -20.838 -25.200 4.146  1.00 116.90 ? 39   DA  I N9    1 
ATOM   8367  C  C8    . DA  I 5 112 ? -21.164 -25.829 5.318  1.00 116.97 ? 39   DA  I C8    1 
ATOM   8368  N  N7    . DA  I 5 112 ? -21.444 -27.102 5.178  1.00 117.10 ? 39   DA  I N7    1 
ATOM   8369  C  C5    . DA  I 5 112 ? -21.290 -27.325 3.821  1.00 117.34 ? 39   DA  I C5    1 
ATOM   8370  C  C6    . DA  I 5 112 ? -21.442 -28.481 3.021  1.00 117.72 ? 39   DA  I C6    1 
ATOM   8371  N  N6    . DA  I 5 112 ? -21.799 -29.674 3.515  1.00 117.61 ? 39   DA  I N6    1 
ATOM   8372  N  N1    . DA  I 5 112 ? -21.211 -28.361 1.690  1.00 117.95 ? 39   DA  I N1    1 
ATOM   8373  C  C2    . DA  I 5 112 ? -20.856 -27.162 1.194  1.00 117.90 ? 39   DA  I C2    1 
ATOM   8374  N  N3    . DA  I 5 112 ? -20.679 -26.009 1.846  1.00 117.54 ? 39   DA  I N3    1 
ATOM   8375  C  C4    . DA  I 5 112 ? -20.916 -26.160 3.167  1.00 117.22 ? 39   DA  I C4    1 
ATOM   8376  P  P     . DC  I 5 113 ? -21.524 -19.516 3.503  1.00 121.62 ? 40   DC  I P     1 
ATOM   8377  O  OP1   . DC  I 5 113 ? -21.165 -18.749 2.274  1.00 121.84 ? 40   DC  I OP1   1 
ATOM   8378  O  OP2   . DC  I 5 113 ? -21.464 -18.839 4.834  1.00 121.59 ? 40   DC  I OP2   1 
ATOM   8379  O  "O5'" . DC  I 5 113 ? -22.987 -20.168 3.365  1.00 122.92 ? 40   DC  I "O5'" 1 
ATOM   8380  C  "C5'" . DC  I 5 113 ? -23.772 -19.939 2.194  1.00 125.02 ? 40   DC  I "C5'" 1 
ATOM   8381  C  "C4'" . DC  I 5 113 ? -23.648 -21.130 1.251  1.00 126.55 ? 40   DC  I "C4'" 1 
ATOM   8382  O  "O4'" . DC  I 5 113 ? -23.382 -22.345 2.000  1.00 126.67 ? 40   DC  I "O4'" 1 
ATOM   8383  C  "C3'" . DC  I 5 113 ? -24.941 -21.446 0.520  1.00 127.70 ? 40   DC  I "C3'" 1 
ATOM   8384  O  "O3'" . DC  I 5 113 ? -24.996 -20.667 -0.680 1.00 129.43 ? 40   DC  I "O3'" 1 
ATOM   8385  C  "C2'" . DC  I 5 113 ? -24.832 -22.953 0.230  1.00 127.32 ? 40   DC  I "C2'" 1 
ATOM   8386  C  "C1'" . DC  I 5 113 ? -23.732 -23.437 1.173  1.00 126.93 ? 40   DC  I "C1'" 1 
ATOM   8387  N  N1    . DC  I 5 113 ? -24.125 -24.622 2.014  1.00 126.86 ? 40   DC  I N1    1 
ATOM   8388  C  C2    . DC  I 5 113 ? -24.044 -25.921 1.472  1.00 126.86 ? 40   DC  I C2    1 
ATOM   8389  O  O2    . DC  I 5 113 ? -23.654 -26.087 0.308  1.00 126.96 ? 40   DC  I O2    1 
ATOM   8390  N  N3    . DC  I 5 113 ? -24.400 -26.980 2.243  1.00 126.64 ? 40   DC  I N3    1 
ATOM   8391  C  C4    . DC  I 5 113 ? -24.820 -26.788 3.496  1.00 126.39 ? 40   DC  I C4    1 
ATOM   8392  N  N4    . DC  I 5 113 ? -25.153 -27.871 4.202  1.00 126.15 ? 40   DC  I N4    1 
ATOM   8393  C  C5    . DC  I 5 113 ? -24.912 -25.481 4.072  1.00 126.43 ? 40   DC  I C5    1 
ATOM   8394  C  C6    . DC  I 5 113 ? -24.559 -24.441 3.303  1.00 126.65 ? 40   DC  I C6    1 
ATOM   8395  P  P     . DA  I 5 114 ? -26.368 -19.968 -1.145 1.00 130.71 ? 41   DA  I P     1 
ATOM   8396  O  OP1   . DA  I 5 114 ? -26.055 -19.094 -2.304 1.00 130.79 ? 41   DA  I OP1   1 
ATOM   8397  O  OP2   . DA  I 5 114 ? -27.051 -19.403 0.047  1.00 130.22 ? 41   DA  I OP2   1 
ATOM   8398  O  "O5'" . DA  I 5 114 ? -27.233 -21.213 -1.650 1.00 131.50 ? 41   DA  I "O5'" 1 
ATOM   8399  C  "C5'" . DA  I 5 114 ? -26.814 -21.972 -2.787 1.00 133.11 ? 41   DA  I "C5'" 1 
ATOM   8400  C  "C4'" . DA  I 5 114 ? -27.521 -23.313 -2.794 1.00 134.25 ? 41   DA  I "C4'" 1 
ATOM   8401  O  "O4'" . DA  I 5 114 ? -27.138 -24.065 -1.612 1.00 134.41 ? 41   DA  I "O4'" 1 
ATOM   8402  C  "C3'" . DA  I 5 114 ? -29.047 -23.211 -2.772 1.00 135.00 ? 41   DA  I "C3'" 1 
ATOM   8403  O  "O3'" . DA  I 5 114 ? -29.625 -24.093 -3.727 1.00 136.00 ? 41   DA  I "O3'" 1 
ATOM   8404  C  "C2'" . DA  I 5 114 ? -29.403 -23.634 -1.352 1.00 134.83 ? 41   DA  I "C2'" 1 
ATOM   8405  C  "C1'" . DA  I 5 114 ? -28.307 -24.657 -1.093 1.00 134.71 ? 41   DA  I "C1'" 1 
ATOM   8406  N  N9    . DA  I 5 114 ? -28.180 -24.980 0.324  1.00 134.96 ? 41   DA  I N9    1 
ATOM   8407  C  C8    . DA  I 5 114 ? -27.986 -24.113 1.373  1.00 134.99 ? 41   DA  I C8    1 
ATOM   8408  N  N7    . DA  I 5 114 ? -27.933 -24.712 2.541  1.00 135.01 ? 41   DA  I N7    1 
ATOM   8409  C  C5    . DA  I 5 114 ? -28.113 -26.063 2.235  1.00 135.07 ? 41   DA  I C5    1 
ATOM   8410  C  C6    . DA  I 5 114 ? -28.164 -27.236 3.029  1.00 135.18 ? 41   DA  I C6    1 
ATOM   8411  N  N6    . DA  I 5 114 ? -28.026 -27.214 4.358  1.00 135.14 ? 41   DA  I N6    1 
ATOM   8412  N  N1    . DA  I 5 114 ? -28.358 -28.435 2.407  1.00 135.17 ? 41   DA  I N1    1 
ATOM   8413  C  C2    . DA  I 5 114 ? -28.493 -28.454 1.071  1.00 135.01 ? 41   DA  I C2    1 
ATOM   8414  N  N3    . DA  I 5 114 ? -28.467 -27.423 0.224  1.00 134.98 ? 41   DA  I N3    1 
ATOM   8415  C  C4    . DA  I 5 114 ? -28.272 -26.247 0.873  1.00 135.03 ? 41   DA  I C4    1 
ATOM   8416  P  P     . DC  I 5 115 ? -31.134 -23.877 -4.226 1.00 136.71 ? 42   DC  I P     1 
ATOM   8417  O  OP1   . DC  I 5 115 ? -31.135 -22.688 -5.115 1.00 136.70 ? 42   DC  I OP1   1 
ATOM   8418  O  OP2   . DC  I 5 115 ? -32.052 -23.917 -3.058 1.00 136.18 ? 42   DC  I OP2   1 
ATOM   8419  O  "O5'" . DC  I 5 115 ? -31.412 -25.187 -5.110 1.00 137.36 ? 42   DC  I "O5'" 1 
ATOM   8420  C  "C5'" . DC  I 5 115 ? -30.775 -26.442 -4.818 1.00 138.00 ? 42   DC  I "C5'" 1 
ATOM   8421  C  "C4'" . DC  I 5 115 ? -31.571 -27.326 -3.859 1.00 138.47 ? 42   DC  I "C4'" 1 
ATOM   8422  O  "O4'" . DC  I 5 115 ? -31.124 -27.105 -2.498 1.00 138.82 ? 42   DC  I "O4'" 1 
ATOM   8423  C  "C3'" . DC  I 5 115 ? -33.097 -27.139 -3.825 1.00 138.34 ? 42   DC  I "C3'" 1 
ATOM   8424  O  "O3'" . DC  I 5 115 ? -33.720 -28.211 -4.588 1.00 137.75 ? 42   DC  I "O3'" 1 
ATOM   8425  C  "C2'" . DC  I 5 115 ? -33.456 -27.078 -2.329 1.00 138.67 ? 42   DC  I "C2'" 1 
ATOM   8426  C  "C1'" . DC  I 5 115 ? -32.168 -27.558 -1.657 1.00 139.16 ? 42   DC  I "C1'" 1 
ATOM   8427  N  N1    . DC  I 5 115 ? -31.938 -27.093 -0.237 1.00 139.69 ? 42   DC  I N1    1 
ATOM   8428  C  C2    . DC  I 5 115 ? -31.712 -28.040 0.786  1.00 139.87 ? 42   DC  I C2    1 
ATOM   8429  O  O2    . DC  I 5 115 ? -31.697 -29.253 0.522  1.00 139.90 ? 42   DC  I O2    1 
ATOM   8430  N  N3    . DC  I 5 115 ? -31.503 -27.597 2.059  1.00 139.82 ? 42   DC  I N3    1 
ATOM   8431  C  C4    . DC  I 5 115 ? -31.517 -26.286 2.329  1.00 139.71 ? 42   DC  I C4    1 
ATOM   8432  N  N4    . DC  I 5 115 ? -31.307 -25.907 3.594  1.00 139.44 ? 42   DC  I N4    1 
ATOM   8433  C  C5    . DC  I 5 115 ? -31.746 -25.308 1.310  1.00 139.76 ? 42   DC  I C5    1 
ATOM   8434  C  C6    . DC  I 5 115 ? -31.948 -25.752 0.060  1.00 139.83 ? 42   DC  I C6    1 
ATOM   8435  P  P     . DT  I 5 116 ? -34.717 -29.359 -4.049 1.00 137.23 ? 43   DT  I P     1 
ATOM   8436  O  OP1   . DT  I 5 116 ? -35.029 -30.222 -5.215 1.00 137.31 ? 43   DT  I OP1   1 
ATOM   8437  O  OP2   . DT  I 5 116 ? -35.837 -28.726 -3.313 1.00 137.12 ? 43   DT  I OP2   1 
ATOM   8438  O  "O5'" . DT  I 5 116 ? -33.843 -30.203 -3.002 1.00 136.62 ? 43   DT  I "O5'" 1 
ATOM   8439  C  "C5'" . DT  I 5 116 ? -33.891 -31.634 -2.986 1.00 135.58 ? 43   DT  I "C5'" 1 
ATOM   8440  C  "C4'" . DT  I 5 116 ? -34.759 -32.181 -1.856 1.00 134.69 ? 43   DT  I "C4'" 1 
ATOM   8441  O  "O4'" . DT  I 5 116 ? -34.507 -31.444 -0.628 1.00 134.60 ? 43   DT  I "O4'" 1 
ATOM   8442  C  "C3'" . DT  I 5 116 ? -36.274 -32.149 -2.096 1.00 133.96 ? 43   DT  I "C3'" 1 
ATOM   8443  O  "O3'" . DT  I 5 116 ? -36.785 -33.495 -1.919 1.00 133.03 ? 43   DT  I "O3'" 1 
ATOM   8444  C  "C2'" . DT  I 5 116 ? -36.784 -31.126 -1.074 1.00 134.09 ? 43   DT  I "C2'" 1 
ATOM   8445  C  "C1'" . DT  I 5 116 ? -35.732 -31.211 0.033  1.00 134.27 ? 43   DT  I "C1'" 1 
ATOM   8446  N  N1    . DT  I 5 116 ? -35.597 -29.994 0.920  1.00 134.04 ? 43   DT  I N1    1 
ATOM   8447  C  C2    . DT  I 5 116 ? -35.415 -30.152 2.288  1.00 133.60 ? 43   DT  I C2    1 
ATOM   8448  O  O2    . DT  I 5 116 ? -35.356 -31.232 2.853  1.00 132.99 ? 43   DT  I O2    1 
ATOM   8449  N  N3    . DT  I 5 116 ? -35.301 -28.977 2.994  1.00 133.56 ? 43   DT  I N3    1 
ATOM   8450  C  C4    . DT  I 5 116 ? -35.347 -27.685 2.489  1.00 133.84 ? 43   DT  I C4    1 
ATOM   8451  O  O4    . DT  I 5 116 ? -35.232 -26.701 3.217  1.00 133.82 ? 43   DT  I O4    1 
ATOM   8452  C  C5    . DT  I 5 116 ? -35.537 -27.585 1.056  1.00 133.97 ? 43   DT  I C5    1 
ATOM   8453  C  C7    . DT  I 5 116 ? -35.605 -26.242 0.381  1.00 133.98 ? 43   DT  I C7    1 
ATOM   8454  C  C6    . DT  I 5 116 ? -35.649 -28.726 0.354  1.00 133.97 ? 43   DT  I C6    1 
ATOM   8455  P  P     . DT  I 5 117 ? -38.274 -33.890 -1.445 1.00 132.31 ? 44   DT  I P     1 
ATOM   8456  O  OP1   . DT  I 5 117 ? -38.538 -35.288 -1.869 1.00 132.19 ? 44   DT  I OP1   1 
ATOM   8457  O  OP2   . DT  I 5 117 ? -39.235 -32.825 -1.831 1.00 132.39 ? 44   DT  I OP2   1 
ATOM   8458  O  "O5'" . DT  I 5 117 ? -38.144 -33.887 0.148  1.00 131.22 ? 44   DT  I "O5'" 1 
ATOM   8459  C  "C5'" . DT  I 5 117 ? -37.322 -34.856 0.800  1.00 129.55 ? 44   DT  I "C5'" 1 
ATOM   8460  C  "C4'" . DT  I 5 117 ? -37.504 -34.789 2.309  1.00 127.99 ? 44   DT  I "C4'" 1 
ATOM   8461  O  "O4'" . DT  I 5 117 ? -37.286 -33.422 2.757  1.00 127.83 ? 44   DT  I "O4'" 1 
ATOM   8462  C  "C3'" . DT  I 5 117 ? -38.890 -35.191 2.808  1.00 126.95 ? 44   DT  I "C3'" 1 
ATOM   8463  O  "O3'" . DT  I 5 117 ? -38.742 -36.145 3.861  1.00 125.25 ? 44   DT  I "O3'" 1 
ATOM   8464  C  "C2'" . DT  I 5 117 ? -39.523 -33.877 3.275  1.00 127.18 ? 44   DT  I "C2'" 1 
ATOM   8465  C  "C1'" . DT  I 5 117 ? -38.299 -33.056 3.672  1.00 127.51 ? 44   DT  I "C1'" 1 
ATOM   8466  N  N1    . DT  I 5 117 ? -38.468 -31.558 3.642  1.00 127.63 ? 44   DT  I N1    1 
ATOM   8467  C  C2    . DT  I 5 117 ? -38.283 -30.832 4.810  1.00 127.65 ? 44   DT  I C2    1 
ATOM   8468  O  O2    . DT  I 5 117 ? -37.996 -31.330 5.886  1.00 127.55 ? 44   DT  I O2    1 
ATOM   8469  N  N3    . DT  I 5 117 ? -38.452 -29.473 4.680  1.00 127.74 ? 44   DT  I N3    1 
ATOM   8470  C  C4    . DT  I 5 117 ? -38.776 -28.775 3.528  1.00 127.79 ? 44   DT  I C4    1 
ATOM   8471  O  O4    . DT  I 5 117 ? -38.901 -27.553 3.532  1.00 127.64 ? 44   DT  I O4    1 
ATOM   8472  C  C5    . DT  I 5 117 ? -38.953 -29.589 2.339  1.00 127.92 ? 44   DT  I C5    1 
ATOM   8473  C  C7    . DT  I 5 117 ? -39.307 -28.958 1.021  1.00 128.01 ? 44   DT  I C7    1 
ATOM   8474  C  C6    . DT  I 5 117 ? -38.792 -30.920 2.452  1.00 127.79 ? 44   DT  I C6    1 
ATOM   8475  P  P     . DT  I 5 118 ? -39.975 -37.012 4.423  1.00 124.07 ? 45   DT  I P     1 
ATOM   8476  O  OP1   . DT  I 5 118 ? -39.535 -38.427 4.552  1.00 123.77 ? 45   DT  I OP1   1 
ATOM   8477  O  OP2   . DT  I 5 118 ? -41.204 -36.687 3.659  1.00 124.19 ? 45   DT  I OP2   1 
ATOM   8478  O  "O5'" . DT  I 5 118 ? -40.173 -36.409 5.892  1.00 123.30 ? 45   DT  I "O5'" 1 
ATOM   8479  C  "C5'" . DT  I 5 118 ? -39.173 -36.600 6.894  1.00 121.92 ? 45   DT  I "C5'" 1 
ATOM   8480  C  "C4'" . DT  I 5 118 ? -39.365 -35.605 8.022  1.00 120.60 ? 45   DT  I "C4'" 1 
ATOM   8481  O  "O4'" . DT  I 5 118 ? -39.202 -34.257 7.512  1.00 120.76 ? 45   DT  I "O4'" 1 
ATOM   8482  C  "C3'" . DT  I 5 118 ? -40.765 -35.601 8.624  1.00 119.58 ? 45   DT  I "C3'" 1 
ATOM   8483  O  "O3'" . DT  I 5 118 ? -41.026 -36.684 9.566  1.00 117.55 ? 45   DT  I "O3'" 1 
ATOM   8484  C  "C2'" . DT  I 5 118 ? -40.858 -34.197 9.216  1.00 120.15 ? 45   DT  I "C2'" 1 
ATOM   8485  C  "C1'" . DT  I 5 118 ? -39.956 -33.361 8.308  1.00 120.92 ? 45   DT  I "C1'" 1 
ATOM   8486  N  N1    . DT  I 5 118 ? -40.698 -32.371 7.436  1.00 121.82 ? 45   DT  I N1    1 
ATOM   8487  C  C2    . DT  I 5 118 ? -40.624 -31.019 7.737  1.00 122.18 ? 45   DT  I C2    1 
ATOM   8488  O  O2    . DT  I 5 118 ? -39.987 -30.573 8.674  1.00 122.45 ? 45   DT  I O2    1 
ATOM   8489  N  N3    . DT  I 5 118 ? -41.330 -30.194 6.892  1.00 122.30 ? 45   DT  I N3    1 
ATOM   8490  C  C4    . DT  I 5 118 ? -42.091 -30.573 5.798  1.00 122.44 ? 45   DT  I C4    1 
ATOM   8491  O  O4    . DT  I 5 118 ? -42.686 -29.749 5.106  1.00 122.65 ? 45   DT  I O4    1 
ATOM   8492  C  C5    . DT  I 5 118 ? -42.131 -31.998 5.535  1.00 122.39 ? 45   DT  I C5    1 
ATOM   8493  C  C7    . DT  I 5 118 ? -42.918 -32.545 4.380  1.00 122.45 ? 45   DT  I C7    1 
ATOM   8494  C  C6    . DT  I 5 118 ? -41.444 -32.813 6.353  1.00 122.15 ? 45   DT  I C6    1 
ATOM   8495  P  P     . DT  I 5 119 ? -40.080 -37.231 10.750 1.00 115.87 ? 46   DT  I P     1 
ATOM   8496  O  OP1   . DT  I 5 119 ? -38.706 -37.440 10.237 1.00 115.73 ? 46   DT  I OP1   1 
ATOM   8497  O  OP2   . DT  I 5 119 ? -40.781 -38.379 11.366 1.00 115.43 ? 46   DT  I OP2   1 
ATOM   8498  O  "O5'" . DT  I 5 119 ? -40.117 -36.059 11.841 1.00 115.04 ? 46   DT  I "O5'" 1 
ATOM   8499  C  "C5'" . DT  I 5 119 ? -38.988 -35.210 12.078 1.00 113.58 ? 46   DT  I "C5'" 1 
ATOM   8500  C  "C4'" . DT  I 5 119 ? -39.360 -34.015 12.938 1.00 112.23 ? 46   DT  I "C4'" 1 
ATOM   8501  O  "O4'" . DT  I 5 119 ? -40.037 -32.989 12.157 1.00 112.87 ? 46   DT  I "O4'" 1 
ATOM   8502  C  "C3'" . DT  I 5 119 ? -40.272 -34.340 14.117 1.00 111.21 ? 46   DT  I "C3'" 1 
ATOM   8503  O  "O3'" . DT  I 5 119 ? -39.557 -33.887 15.276 1.00 108.89 ? 46   DT  I "O3'" 1 
ATOM   8504  C  "C2'" . DT  I 5 119 ? -41.580 -33.577 13.815 1.00 112.12 ? 46   DT  I "C2'" 1 
ATOM   8505  C  "C1'" . DT  I 5 119 ? -41.126 -32.451 12.885 1.00 113.06 ? 46   DT  I "C1'" 1 
ATOM   8506  N  N1    . DT  I 5 119 ? -42.128 -31.895 11.876 1.00 113.93 ? 46   DT  I N1    1 
ATOM   8507  C  C2    . DT  I 5 119 ? -42.269 -30.516 11.729 1.00 114.23 ? 46   DT  I C2    1 
ATOM   8508  O  O2    . DT  I 5 119 ? -41.656 -29.677 12.378 1.00 113.66 ? 46   DT  I O2    1 
ATOM   8509  N  N3    . DT  I 5 119 ? -43.186 -30.131 10.774 1.00 114.98 ? 46   DT  I N3    1 
ATOM   8510  C  C4    . DT  I 5 119 ? -43.960 -30.955 9.956  1.00 115.10 ? 46   DT  I C4    1 
ATOM   8511  O  O4    . DT  I 5 119 ? -44.751 -30.496 9.129  1.00 115.22 ? 46   DT  I O4    1 
ATOM   8512  C  C5    . DT  I 5 119 ? -43.763 -32.377 10.151 1.00 114.82 ? 46   DT  I C5    1 
ATOM   8513  C  C7    . DT  I 5 119 ? -44.538 -33.380 9.333  1.00 114.99 ? 46   DT  I C7    1 
ATOM   8514  C  C6    . DT  I 5 119 ? -42.874 -32.768 11.084 1.00 114.30 ? 46   DT  I C6    1 
ATOM   8515  P  P     . DG  I 5 120 ? -39.902 -34.425 16.772 1.00 107.05 ? 47   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 5 120 ? -38.683 -35.103 17.324 1.00 105.95 ? 47   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 5 120 ? -41.221 -35.118 16.776 1.00 106.99 ? 47   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 5 120 ? -40.114 -33.055 17.585 1.00 104.65 ? 47   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 5 120 ? -39.118 -31.991 17.383 1.00 101.29 ? 47   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 5 120 ? -39.826 -30.647 17.526 1.00 98.91  ? 47   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 5 120 ? -40.813 -30.500 16.464 1.00 98.75  ? 47   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 5 120 ? -40.572 -30.468 18.843 1.00 97.38  ? 47   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 5 120 ? -40.321 -29.162 19.344 1.00 95.22  ? 47   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 5 120 ? -42.045 -30.681 18.474 1.00 97.59  ? 47   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 5 120 ? -42.078 -30.196 17.030 1.00 98.52  ? 47   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 5 120 ? -43.129 -30.785 16.202 1.00 98.31  ? 47   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 5 120 ? -43.562 -32.088 16.204 1.00 97.87  ? 47   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 5 120 ? -44.516 -32.322 15.351 1.00 97.80  ? 47   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 5 120 ? -44.733 -31.095 14.742 1.00 98.44  ? 47   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 5 120 ? -45.651 -30.732 13.726 1.00 98.54  ? 47   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 5 120 ? -46.479 -31.460 13.161 1.00 98.39  ? 47   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 5 120 ? -45.552 -29.380 13.384 1.00 98.72  ? 47   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 5 120 ? -44.670 -28.486 13.955 1.00 99.15  ? 47   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 5 120 ? -44.714 -27.221 13.502 1.00 99.52  ? 47   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 5 120 ? -43.801 -28.817 14.907 1.00 99.15  ? 47   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 5 120 ? -43.887 -30.134 15.252 1.00 98.69  ? 47   DG  I C4    1 
ATOM   8537  P  P     . DG  I 5 121 ? -40.615 -28.835 20.884 1.00 93.72  ? 48   DG  I P     1 
ATOM   8538  O  OP1   . DG  I 5 121 ? -39.349 -28.324 21.464 1.00 94.03  ? 48   DG  I OP1   1 
ATOM   8539  O  OP2   . DG  I 5 121 ? -41.309 -29.980 21.506 1.00 93.18  ? 48   DG  I OP2   1 
ATOM   8540  O  "O5'" . DG  I 5 121 ? -41.692 -27.648 20.810 1.00 96.13  ? 48   DG  I "O5'" 1 
ATOM   8541  C  "C5'" . DG  I 5 121 ? -41.385 -26.423 20.144 1.00 98.54  ? 48   DG  I "C5'" 1 
ATOM   8542  C  "C4'" . DG  I 5 121 ? -42.650 -25.780 19.607 1.00 100.29 ? 48   DG  I "C4'" 1 
ATOM   8543  O  "O4'" . DG  I 5 121 ? -43.320 -26.676 18.684 1.00 100.83 ? 48   DG  I "O4'" 1 
ATOM   8544  C  "C3'" . DG  I 5 121 ? -43.681 -25.424 20.676 1.00 101.39 ? 48   DG  I "C3'" 1 
ATOM   8545  O  "O3'" . DG  I 5 121 ? -43.882 -24.019 20.636 1.00 103.06 ? 48   DG  I "O3'" 1 
ATOM   8546  C  "C2'" . DG  I 5 121 ? -44.931 -26.215 20.283 1.00 101.47 ? 48   DG  I "C2'" 1 
ATOM   8547  C  "C1'" . DG  I 5 121 ? -44.700 -26.411 18.790 1.00 101.71 ? 48   DG  I "C1'" 1 
ATOM   8548  N  N9    . DG  I 5 121 ? -45.467 -27.481 18.149 1.00 102.76 ? 48   DG  I N9    1 
ATOM   8549  C  C8    . DG  I 5 121 ? -45.534 -28.815 18.490 1.00 103.11 ? 48   DG  I C8    1 
ATOM   8550  N  N7    . DG  I 5 121 ? -46.313 -29.520 17.711 1.00 103.22 ? 48   DG  I N7    1 
ATOM   8551  C  C5    . DG  I 5 121 ? -46.794 -28.598 16.790 1.00 103.57 ? 48   DG  I C5    1 
ATOM   8552  C  C6    . DG  I 5 121 ? -47.681 -28.766 15.693 1.00 104.29 ? 48   DG  I C6    1 
ATOM   8553  O  O6    . DG  I 5 121 ? -48.235 -29.814 15.312 1.00 104.62 ? 48   DG  I O6    1 
ATOM   8554  N  N1    . DG  I 5 121 ? -47.908 -27.559 15.006 1.00 104.37 ? 48   DG  I N1    1 
ATOM   8555  C  C2    . DG  I 5 121 ? -47.348 -26.340 15.339 1.00 104.01 ? 48   DG  I C2    1 
ATOM   8556  N  N2    . DG  I 5 121 ? -47.673 -25.282 14.577 1.00 103.59 ? 48   DG  I N2    1 
ATOM   8557  N  N3    . DG  I 5 121 ? -46.518 -26.177 16.366 1.00 103.92 ? 48   DG  I N3    1 
ATOM   8558  C  C4    . DG  I 5 121 ? -46.283 -27.339 17.044 1.00 103.51 ? 48   DG  I C4    1 
ATOM   8559  P  P     . DT  I 5 122 ? -44.855 -23.272 21.663 1.00 104.29 ? 49   DT  I P     1 
ATOM   8560  O  OP1   . DT  I 5 122 ? -44.283 -21.934 21.938 1.00 104.36 ? 49   DT  I OP1   1 
ATOM   8561  O  OP2   . DT  I 5 122 ? -45.202 -24.180 22.778 1.00 103.76 ? 49   DT  I OP2   1 
ATOM   8562  O  "O5'" . DT  I 5 122 ? -46.173 -23.117 20.777 1.00 106.42 ? 49   DT  I "O5'" 1 
ATOM   8563  C  "C5'" . DT  I 5 122 ? -46.233 -22.162 19.726 1.00 109.17 ? 49   DT  I "C5'" 1 
ATOM   8564  C  "C4'" . DT  I 5 122 ? -47.616 -22.194 19.111 1.00 111.43 ? 49   DT  I "C4'" 1 
ATOM   8565  O  "O4'" . DT  I 5 122 ? -47.870 -23.529 18.617 1.00 111.74 ? 49   DT  I "O4'" 1 
ATOM   8566  C  "C3'" . DT  I 5 122 ? -48.756 -21.828 20.058 1.00 113.15 ? 49   DT  I "C3'" 1 
ATOM   8567  O  "O3'" . DT  I 5 122 ? -49.415 -20.690 19.496 1.00 116.36 ? 49   DT  I "O3'" 1 
ATOM   8568  C  "C2'" . DT  I 5 122 ? -49.636 -23.082 20.119 1.00 112.56 ? 49   DT  I "C2'" 1 
ATOM   8569  C  "C1'" . DT  I 5 122 ? -49.193 -23.913 18.915 1.00 112.21 ? 49   DT  I "C1'" 1 
ATOM   8570  N  N1    . DT  I 5 122 ? -49.194 -25.408 19.119 1.00 112.29 ? 49   DT  I N1    1 
ATOM   8571  C  C2    . DT  I 5 122 ? -49.618 -26.244 18.092 1.00 112.43 ? 49   DT  I C2    1 
ATOM   8572  O  O2    . DT  I 5 122 ? -50.009 -25.851 17.004 1.00 112.92 ? 49   DT  I O2    1 
ATOM   8573  N  N3    . DT  I 5 122 ? -49.575 -27.589 18.379 1.00 112.01 ? 49   DT  I N3    1 
ATOM   8574  C  C4    . DT  I 5 122 ? -49.158 -28.178 19.561 1.00 111.91 ? 49   DT  I C4    1 
ATOM   8575  O  O4    . DT  I 5 122 ? -49.166 -29.399 19.699 1.00 111.23 ? 49   DT  I O4    1 
ATOM   8576  C  C5    . DT  I 5 122 ? -48.724 -27.253 20.594 1.00 112.26 ? 49   DT  I C5    1 
ATOM   8577  C  C7    . DT  I 5 122 ? -48.245 -27.748 21.932 1.00 112.52 ? 49   DT  I C7    1 
ATOM   8578  C  C6    . DT  I 5 122 ? -48.760 -25.936 20.325 1.00 112.21 ? 49   DT  I C6    1 
ATOM   8579  P  P     . DA  I 5 123 ? -50.609 -19.860 20.185 1.00 118.63 ? 50   DA  I P     1 
ATOM   8580  O  OP1   . DA  I 5 123 ? -50.068 -18.531 20.568 1.00 118.56 ? 50   DA  I OP1   1 
ATOM   8581  O  OP2   . DA  I 5 123 ? -51.314 -20.696 21.192 1.00 118.06 ? 50   DA  I OP2   1 
ATOM   8582  O  "O5'" . DA  I 5 123 ? -51.608 -19.652 18.946 1.00 121.09 ? 50   DA  I "O5'" 1 
ATOM   8583  C  "C5'" . DA  I 5 123 ? -51.648 -20.599 17.870 1.00 124.65 ? 50   DA  I "C5'" 1 
ATOM   8584  C  "C4'" . DA  I 5 123 ? -52.958 -21.372 17.835 1.00 127.35 ? 50   DA  I "C4'" 1 
ATOM   8585  O  "O4'" . DA  I 5 123 ? -52.674 -22.796 17.906 1.00 127.78 ? 50   DA  I "O4'" 1 
ATOM   8586  C  "C3'" . DA  I 5 123 ? -53.937 -21.085 18.977 1.00 129.02 ? 50   DA  I "C3'" 1 
ATOM   8587  O  "O3'" . DA  I 5 123 ? -55.234 -20.825 18.446 1.00 131.39 ? 50   DA  I "O3'" 1 
ATOM   8588  C  "C2'" . DA  I 5 123 ? -53.900 -22.369 19.808 1.00 128.83 ? 50   DA  I "C2'" 1 
ATOM   8589  C  "C1'" . DA  I 5 123 ? -53.682 -23.386 18.697 1.00 128.44 ? 50   DA  I "C1'" 1 
ATOM   8590  N  N9    . DA  I 5 123 ? -53.271 -24.729 19.112 1.00 128.81 ? 50   DA  I N9    1 
ATOM   8591  C  C8    . DA  I 5 123 ? -52.675 -25.109 20.288 1.00 128.97 ? 50   DA  I C8    1 
ATOM   8592  N  N7    . DA  I 5 123 ? -52.426 -26.397 20.370 1.00 129.05 ? 50   DA  I N7    1 
ATOM   8593  C  C5    . DA  I 5 123 ? -52.884 -26.898 19.161 1.00 129.14 ? 50   DA  I C5    1 
ATOM   8594  C  C6    . DA  I 5 123 ? -52.914 -28.203 18.618 1.00 129.23 ? 50   DA  I C6    1 
ATOM   8595  N  N6    . DA  I 5 123 ? -52.445 -29.272 19.267 1.00 129.41 ? 50   DA  I N6    1 
ATOM   8596  N  N1    . DA  I 5 123 ? -53.445 -28.369 17.382 1.00 129.27 ? 50   DA  I N1    1 
ATOM   8597  C  C2    . DA  I 5 123 ? -53.919 -27.294 16.730 1.00 129.23 ? 50   DA  I C2    1 
ATOM   8598  N  N3    . DA  I 5 123 ? -53.946 -26.020 17.139 1.00 129.23 ? 50   DA  I N3    1 
ATOM   8599  C  C4    . DA  I 5 123 ? -53.411 -25.885 18.374 1.00 129.13 ? 50   DA  I C4    1 
ATOM   8600  P  P     . DG  I 5 124 ? -56.277 -19.870 19.224 1.00 133.55 ? 51   DG  I P     1 
ATOM   8601  O  OP1   . DG  I 5 124 ? -56.097 -18.486 18.695 1.00 133.40 ? 51   DG  I OP1   1 
ATOM   8602  O  OP2   . DG  I 5 124 ? -56.185 -20.125 20.682 1.00 133.25 ? 51   DG  I OP2   1 
ATOM   8603  O  "O5'" . DG  I 5 124 ? -57.703 -20.444 18.745 1.00 134.37 ? 51   DG  I "O5'" 1 
ATOM   8604  C  "C5'" . DG  I 5 124 ? -57.906 -20.800 17.374 1.00 135.99 ? 51   DG  I "C5'" 1 
ATOM   8605  C  "C4'" . DG  I 5 124 ? -58.578 -22.156 17.302 1.00 137.12 ? 51   DG  I "C4'" 1 
ATOM   8606  O  "O4'" . DG  I 5 124 ? -57.614 -23.174 17.672 1.00 137.33 ? 51   DG  I "O4'" 1 
ATOM   8607  C  "C3'" . DG  I 5 124 ? -59.755 -22.299 18.268 1.00 137.87 ? 51   DG  I "C3'" 1 
ATOM   8608  O  "O3'" . DG  I 5 124 ? -60.993 -22.447 17.558 1.00 138.46 ? 51   DG  I "O3'" 1 
ATOM   8609  C  "C2'" . DG  I 5 124 ? -59.408 -23.517 19.129 1.00 138.06 ? 51   DG  I "C2'" 1 
ATOM   8610  C  "C1'" . DG  I 5 124 ? -58.311 -24.211 18.328 1.00 137.93 ? 51   DG  I "C1'" 1 
ATOM   8611  N  N9    . DG  I 5 124 ? -57.388 -24.970 19.170 1.00 138.21 ? 51   DG  I N9    1 
ATOM   8612  C  C8    . DG  I 5 124 ? -56.584 -24.471 20.170 1.00 138.43 ? 51   DG  I C8    1 
ATOM   8613  N  N7    . DG  I 5 124 ? -55.857 -25.376 20.765 1.00 138.46 ? 51   DG  I N7    1 
ATOM   8614  C  C5    . DG  I 5 124 ? -56.201 -26.561 20.123 1.00 138.48 ? 51   DG  I C5    1 
ATOM   8615  C  C6    . DG  I 5 124 ? -55.735 -27.886 20.341 1.00 138.46 ? 51   DG  I C6    1 
ATOM   8616  O  O6    . DG  I 5 124 ? -54.899 -28.278 21.172 1.00 138.20 ? 51   DG  I O6    1 
ATOM   8617  N  N1    . DG  I 5 124 ? -56.339 -28.801 19.472 1.00 138.62 ? 51   DG  I N1    1 
ATOM   8618  C  C2    . DG  I 5 124 ? -57.278 -28.470 18.513 1.00 138.62 ? 51   DG  I C2    1 
ATOM   8619  N  N2    . DG  I 5 124 ? -57.754 -29.480 17.766 1.00 138.48 ? 51   DG  I N2    1 
ATOM   8620  N  N3    . DG  I 5 124 ? -57.722 -27.232 18.301 1.00 138.44 ? 51   DG  I N3    1 
ATOM   8621  C  C4    . DG  I 5 124 ? -57.145 -26.328 19.138 1.00 138.38 ? 51   DG  I C4    1 
ATOM   8622  P  P     . DT  I 5 125 ? -62.409 -22.292 18.303 1.00 138.99 ? 52   DT  I P     1 
ATOM   8623  O  OP1   . DT  I 5 125 ? -63.418 -21.932 17.277 1.00 138.96 ? 52   DT  I OP1   1 
ATOM   8624  O  OP2   . DT  I 5 125 ? -62.238 -21.434 19.501 1.00 138.90 ? 52   DT  I OP2   1 
ATOM   8625  O  "O5'" . DT  I 5 125 ? -62.699 -23.780 18.813 1.00 138.99 ? 52   DT  I "O5'" 1 
ATOM   8626  C  "C5'" . DT  I 5 125 ? -62.654 -24.880 17.902 1.00 139.09 ? 52   DT  I "C5'" 1 
ATOM   8627  C  "C4'" . DT  I 5 125 ? -62.576 -26.199 18.647 1.00 139.07 ? 52   DT  I "C4'" 1 
ATOM   8628  O  "O4'" . DT  I 5 125 ? -61.227 -26.444 19.109 1.00 139.04 ? 52   DT  I "O4'" 1 
ATOM   8629  C  "C3'" . DT  I 5 125 ? -63.419 -26.273 19.912 1.00 139.11 ? 52   DT  I "C3'" 1 
ATOM   8630  O  "O3'" . DT  I 5 125 ? -64.739 -26.723 19.578 1.00 139.26 ? 52   DT  I "O3'" 1 
ATOM   8631  C  "C2'" . DT  I 5 125 ? -62.650 -27.264 20.786 1.00 139.11 ? 52   DT  I "C2'" 1 
ATOM   8632  C  "C1'" . DT  I 5 125 ? -61.328 -27.489 20.053 1.00 139.17 ? 52   DT  I "C1'" 1 
ATOM   8633  N  N1    . DT  I 5 125 ? -60.140 -27.499 20.981 1.00 139.39 ? 52   DT  I N1    1 
ATOM   8634  C  C2    . DT  I 5 125 ? -59.438 -28.682 21.167 1.00 139.37 ? 52   DT  I C2    1 
ATOM   8635  O  O2    . DT  I 5 125 ? -59.711 -29.737 20.610 1.00 139.09 ? 52   DT  I O2    1 
ATOM   8636  N  N3    . DT  I 5 125 ? -58.378 -28.585 22.043 1.00 139.49 ? 52   DT  I N3    1 
ATOM   8637  C  C4    . DT  I 5 125 ? -57.960 -27.459 22.743 1.00 139.48 ? 52   DT  I C4    1 
ATOM   8638  O  O4    . DT  I 5 125 ? -56.989 -27.495 23.498 1.00 139.34 ? 52   DT  I O4    1 
ATOM   8639  C  C5    . DT  I 5 125 ? -58.738 -26.256 22.507 1.00 139.42 ? 52   DT  I C5    1 
ATOM   8640  C  C7    . DT  I 5 125 ? -58.399 -24.960 23.195 1.00 139.23 ? 52   DT  I C7    1 
ATOM   8641  C  C6    . DT  I 5 125 ? -59.774 -26.336 21.653 1.00 139.44 ? 52   DT  I C6    1 
ATOM   8642  P  P     . DA  I 5 126 ? -65.896 -26.974 20.672 1.00 139.26 ? 53   DA  I P     1 
ATOM   8643  O  OP1   . DA  I 5 126 ? -67.200 -26.832 19.979 1.00 139.24 ? 53   DA  I OP1   1 
ATOM   8644  O  OP2   . DA  I 5 126 ? -65.620 -26.135 21.865 1.00 139.12 ? 53   DA  I OP2   1 
ATOM   8645  O  "O5'" . DA  I 5 126 ? -65.688 -28.515 21.075 1.00 138.76 ? 53   DA  I "O5'" 1 
ATOM   8646  C  "C5'" . DA  I 5 126 ? -65.380 -29.516 20.090 1.00 137.87 ? 53   DA  I "C5'" 1 
ATOM   8647  C  "C4'" . DA  I 5 126 ? -64.750 -30.747 20.733 1.00 137.14 ? 53   DA  I "C4'" 1 
ATOM   8648  O  "O4'" . DA  I 5 126 ? -63.376 -30.479 21.153 1.00 137.13 ? 53   DA  I "O4'" 1 
ATOM   8649  C  "C3'" . DA  I 5 126 ? -65.509 -31.270 21.954 1.00 136.42 ? 53   DA  I "C3'" 1 
ATOM   8650  O  "O3'" . DA  I 5 126 ? -65.827 -32.656 21.732 1.00 135.12 ? 53   DA  I "O3'" 1 
ATOM   8651  C  "C2'" . DA  I 5 126 ? -64.528 -31.024 23.104 1.00 136.79 ? 53   DA  I "C2'" 1 
ATOM   8652  C  "C1'" . DA  I 5 126 ? -63.171 -31.109 22.407 1.00 137.23 ? 53   DA  I "C1'" 1 
ATOM   8653  N  N9    . DA  I 5 126 ? -62.118 -30.416 23.155 1.00 137.67 ? 53   DA  I N9    1 
ATOM   8654  C  C8    . DA  I 5 126 ? -62.061 -29.072 23.423 1.00 137.87 ? 53   DA  I C8    1 
ATOM   8655  N  N7    . DA  I 5 126 ? -61.016 -28.702 24.125 1.00 138.06 ? 53   DA  I N7    1 
ATOM   8656  C  C5    . DA  I 5 126 ? -60.330 -29.891 24.345 1.00 137.94 ? 53   DA  I C5    1 
ATOM   8657  C  C6    . DA  I 5 126 ? -59.126 -30.178 25.031 1.00 137.76 ? 53   DA  I C6    1 
ATOM   8658  N  N6    . DA  I 5 126 ? -58.390 -29.239 25.639 1.00 137.53 ? 53   DA  I N6    1 
ATOM   8659  N  N1    . DA  I 5 126 ? -58.710 -31.469 25.070 1.00 137.63 ? 53   DA  I N1    1 
ATOM   8660  C  C2    . DA  I 5 126 ? -59.454 -32.404 24.456 1.00 137.71 ? 53   DA  I C2    1 
ATOM   8661  N  N3    . DA  I 5 126 ? -60.601 -32.258 23.782 1.00 137.78 ? 53   DA  I N3    1 
ATOM   8662  C  C4    . DA  I 5 126 ? -60.995 -30.963 23.757 1.00 137.87 ? 53   DA  I C4    1 
ATOM   8663  P  P     . DT  I 5 127 ? -66.059 -33.704 22.924 1.00 134.15 ? 54   DT  I P     1 
ATOM   8664  O  OP1   . DT  I 5 127 ? -66.583 -34.954 22.323 1.00 134.04 ? 54   DT  I OP1   1 
ATOM   8665  O  OP2   . DT  I 5 127 ? -66.835 -33.042 24.003 1.00 134.21 ? 54   DT  I OP2   1 
ATOM   8666  O  "O5'" . DT  I 5 127 ? -64.560 -33.944 23.452 1.00 132.49 ? 54   DT  I "O5'" 1 
ATOM   8667  C  "C5'" . DT  I 5 127 ? -63.666 -34.864 22.805 1.00 129.66 ? 54   DT  I "C5'" 1 
ATOM   8668  C  "C4'" . DT  I 5 127 ? -63.026 -35.789 23.832 1.00 127.33 ? 54   DT  I "C4'" 1 
ATOM   8669  O  "O4'" . DT  I 5 127 ? -61.960 -35.081 24.516 1.00 126.97 ? 54   DT  I "O4'" 1 
ATOM   8670  C  "C3'" . DT  I 5 127 ? -63.976 -36.304 24.915 1.00 125.81 ? 54   DT  I "C3'" 1 
ATOM   8671  O  "O3'" . DT  I 5 127 ? -63.767 -37.714 25.060 1.00 123.50 ? 54   DT  I "O3'" 1 
ATOM   8672  C  "C2'" . DT  I 5 127 ? -63.603 -35.504 26.168 1.00 126.04 ? 54   DT  I "C2'" 1 
ATOM   8673  C  "C1'" . DT  I 5 127 ? -62.150 -35.112 25.919 1.00 126.54 ? 54   DT  I "C1'" 1 
ATOM   8674  N  N1    . DT  I 5 127 ? -61.770 -33.770 26.495 1.00 126.56 ? 54   DT  I N1    1 
ATOM   8675  C  C2    . DT  I 5 127 ? -60.548 -33.608 27.136 1.00 126.50 ? 54   DT  I C2    1 
ATOM   8676  O  O2    . DT  I 5 127 ? -59.717 -34.494 27.274 1.00 126.29 ? 54   DT  I O2    1 
ATOM   8677  N  N3    . DT  I 5 127 ? -60.317 -32.339 27.616 1.00 126.36 ? 54   DT  I N3    1 
ATOM   8678  C  C4    . DT  I 5 127 ? -61.161 -31.242 27.530 1.00 126.43 ? 54   DT  I C4    1 
ATOM   8679  O  O4    . DT  I 5 127 ? -60.845 -30.153 27.999 1.00 126.45 ? 54   DT  I O4    1 
ATOM   8680  C  C5    . DT  I 5 127 ? -62.421 -31.475 26.855 1.00 126.54 ? 54   DT  I C5    1 
ATOM   8681  C  C7    . DT  I 5 127 ? -63.431 -30.371 26.693 1.00 126.62 ? 54   DT  I C7    1 
ATOM   8682  C  C6    . DT  I 5 127 ? -62.658 -32.708 26.379 1.00 126.63 ? 54   DT  I C6    1 
ATOM   8683  P  P     . DC  I 5 128 ? -64.345 -38.575 26.290 1.00 121.83 ? 55   DC  I P     1 
ATOM   8684  O  OP1   . DC  I 5 128 ? -64.514 -39.971 25.809 1.00 121.87 ? 55   DC  I OP1   1 
ATOM   8685  O  OP2   . DC  I 5 128 ? -65.497 -37.867 26.909 1.00 122.03 ? 55   DC  I OP2   1 
ATOM   8686  O  "O5'" . DC  I 5 128 ? -63.122 -38.551 27.327 1.00 119.62 ? 55   DC  I "O5'" 1 
ATOM   8687  C  "C5'" . DC  I 5 128 ? -61.793 -38.868 26.884 1.00 116.07 ? 55   DC  I "C5'" 1 
ATOM   8688  C  "C4'" . DC  I 5 128 ? -60.754 -38.671 27.983 1.00 113.19 ? 55   DC  I "C4'" 1 
ATOM   8689  O  "O4'" . DC  I 5 128 ? -60.620 -37.256 28.280 1.00 112.82 ? 55   DC  I "O4'" 1 
ATOM   8690  C  "C3'" . DC  I 5 128 ? -61.051 -39.371 29.311 1.00 111.11 ? 55   DC  I "C3'" 1 
ATOM   8691  O  "O3'" . DC  I 5 128 ? -59.929 -40.161 29.700 1.00 107.76 ? 55   DC  I "O3'" 1 
ATOM   8692  C  "C2'" . DC  I 5 128 ? -61.322 -38.237 30.299 1.00 111.56 ? 55   DC  I "C2'" 1 
ATOM   8693  C  "C1'" . DC  I 5 128 ? -60.555 -37.071 29.681 1.00 112.46 ? 55   DC  I "C1'" 1 
ATOM   8694  N  N1    . DC  I 5 128 ? -61.077 -35.696 30.035 1.00 112.76 ? 55   DC  I N1    1 
ATOM   8695  C  C2    . DC  I 5 128 ? -60.306 -34.853 30.856 1.00 112.83 ? 55   DC  I C2    1 
ATOM   8696  O  O2    . DC  I 5 128 ? -59.213 -35.247 31.284 1.00 112.86 ? 55   DC  I O2    1 
ATOM   8697  N  N3    . DC  I 5 128 ? -60.783 -33.616 31.165 1.00 113.00 ? 55   DC  I N3    1 
ATOM   8698  C  C4    . DC  I 5 128 ? -61.969 -33.212 30.693 1.00 113.08 ? 55   DC  I C4    1 
ATOM   8699  N  N4    . DC  I 5 128 ? -62.392 -31.988 31.027 1.00 113.12 ? 55   DC  I N4    1 
ATOM   8700  C  C5    . DC  I 5 128 ? -62.771 -34.049 29.857 1.00 113.08 ? 55   DC  I C5    1 
ATOM   8701  C  C6    . DC  I 5 128 ? -62.291 -35.267 29.560 1.00 112.85 ? 55   DC  I C6    1 
ATOM   8702  P  P     . DT  I 5 129 ? -60.050 -41.328 30.796 1.00 105.15 ? 56   DT  I P     1 
ATOM   8703  O  OP1   . DT  I 5 129 ? -59.085 -42.387 30.422 1.00 104.99 ? 56   DT  I OP1   1 
ATOM   8704  O  OP2   . DT  I 5 129 ? -61.473 -41.677 31.005 1.00 105.50 ? 56   DT  I OP2   1 
ATOM   8705  O  "O5'" . DT  I 5 129 ? -59.554 -40.613 32.137 1.00 103.15 ? 56   DT  I "O5'" 1 
ATOM   8706  C  "C5'" . DT  I 5 129 ? -58.165 -40.322 32.337 1.00 99.22  ? 56   DT  I "C5'" 1 
ATOM   8707  C  "C4'" . DT  I 5 129 ? -57.914 -39.676 33.689 1.00 96.10  ? 56   DT  I "C4'" 1 
ATOM   8708  O  "O4'" . DT  I 5 129 ? -58.498 -38.347 33.703 1.00 95.74  ? 56   DT  I "O4'" 1 
ATOM   8709  C  "C3'" . DT  I 5 129 ? -58.488 -40.417 34.896 1.00 94.16  ? 56   DT  I "C3'" 1 
ATOM   8710  O  "O3'" . DT  I 5 129 ? -57.493 -40.499 35.919 1.00 90.87  ? 56   DT  I "O3'" 1 
ATOM   8711  C  "C2'" . DT  I 5 129 ? -59.682 -39.549 35.308 1.00 94.84  ? 56   DT  I "C2'" 1 
ATOM   8712  C  "C1'" . DT  I 5 129 ? -59.209 -38.153 34.906 1.00 95.45  ? 56   DT  I "C1'" 1 
ATOM   8713  N  N1    . DT  I 5 129 ? -60.262 -37.101 34.652 1.00 96.15  ? 56   DT  I N1    1 
ATOM   8714  C  C2    . DT  I 5 129 ? -60.092 -35.839 35.202 1.00 96.48  ? 56   DT  I C2    1 
ATOM   8715  O  O2    . DT  I 5 129 ? -59.144 -35.519 35.896 1.00 96.17  ? 56   DT  I O2    1 
ATOM   8716  N  N3    . DT  I 5 129 ? -61.095 -34.944 34.914 1.00 96.89  ? 56   DT  I N3    1 
ATOM   8717  C  C4    . DT  I 5 129 ? -62.224 -35.164 34.143 1.00 97.01  ? 56   DT  I C4    1 
ATOM   8718  O  O4    . DT  I 5 129 ? -63.059 -34.283 33.954 1.00 97.23  ? 56   DT  I O4    1 
ATOM   8719  C  C5    . DT  I 5 129 ? -62.345 -36.497 33.594 1.00 96.81  ? 56   DT  I C5    1 
ATOM   8720  C  C7    . DT  I 5 129 ? -63.530 -36.857 32.747 1.00 97.07  ? 56   DT  I C7    1 
ATOM   8721  C  C6    . DT  I 5 129 ? -61.372 -37.385 33.866 1.00 96.49  ? 56   DT  I C6    1 
ATOM   8722  P  P     . DG  I 5 130 ? -56.437 -41.707 36.009 1.00 88.28  ? 57   DG  I P     1 
ATOM   8723  O  OP1   . DG  I 5 130 ? -55.815 -41.929 34.688 1.00 88.33  ? 57   DG  I OP1   1 
ATOM   8724  O  OP2   . DG  I 5 130 ? -57.095 -42.830 36.705 1.00 88.68  ? 57   DG  I OP2   1 
ATOM   8725  O  "O5'" . DG  I 5 130 ? -55.320 -41.136 37.000 1.00 86.59  ? 57   DG  I "O5'" 1 
ATOM   8726  C  "C5'" . DG  I 5 130 ? -54.539 -39.982 36.654 1.00 83.37  ? 57   DG  I "C5'" 1 
ATOM   8727  C  "C4'" . DG  I 5 130 ? -54.336 -39.021 37.821 1.00 80.86  ? 57   DG  I "C4'" 1 
ATOM   8728  O  "O4'" . DG  I 5 130 ? -55.465 -38.119 37.964 1.00 80.27  ? 57   DG  I "O4'" 1 
ATOM   8729  C  "C3'" . DG  I 5 130 ? -54.085 -39.612 39.202 1.00 79.78  ? 57   DG  I "C3'" 1 
ATOM   8730  O  "O3'" . DG  I 5 130 ? -52.985 -38.866 39.754 1.00 78.31  ? 57   DG  I "O3'" 1 
ATOM   8731  C  "C2'" . DG  I 5 130 ? -55.424 -39.427 39.932 1.00 79.73  ? 57   DG  I "C2'" 1 
ATOM   8732  C  "C1'" . DG  I 5 130 ? -56.070 -38.222 39.244 1.00 80.15  ? 57   DG  I "C1'" 1 
ATOM   8733  N  N9    . DG  I 5 130 ? -57.514 -38.296 38.977 1.00 80.34  ? 57   DG  I N9    1 
ATOM   8734  C  C8    . DG  I 5 130 ? -58.229 -39.424 38.644 1.00 80.18  ? 57   DG  I C8    1 
ATOM   8735  N  N7    . DG  I 5 130 ? -59.494 -39.201 38.437 1.00 80.54  ? 57   DG  I N7    1 
ATOM   8736  C  C5    . DG  I 5 130 ? -59.642 -37.834 38.627 1.00 80.55  ? 57   DG  I C5    1 
ATOM   8737  C  C6    . DG  I 5 130 ? -60.803 -37.019 38.534 1.00 80.42  ? 57   DG  I C6    1 
ATOM   8738  O  O6    . DG  I 5 130 ? -61.955 -37.365 38.246 1.00 80.29  ? 57   DG  I O6    1 
ATOM   8739  N  N1    . DG  I 5 130 ? -60.534 -35.677 38.809 1.00 80.34  ? 57   DG  I N1    1 
ATOM   8740  C  C2    . DG  I 5 130 ? -59.285 -35.190 39.129 1.00 79.94  ? 57   DG  I C2    1 
ATOM   8741  N  N2    . DG  I 5 130 ? -59.205 -33.871 39.358 1.00 79.24  ? 57   DG  I N2    1 
ATOM   8742  N  N3    . DG  I 5 130 ? -58.191 -35.948 39.220 1.00 79.81  ? 57   DG  I N3    1 
ATOM   8743  C  C4    . DG  I 5 130 ? -58.432 -37.259 38.961 1.00 80.00  ? 57   DG  I C4    1 
ATOM   8744  P  P     . DC  I 5 131 ? -52.332 -39.091 41.207 1.00 77.14  ? 58   DC  I P     1 
ATOM   8745  O  OP1   . DC  I 5 131 ? -50.951 -38.570 41.124 1.00 77.82  ? 58   DC  I OP1   1 
ATOM   8746  O  OP2   . DC  I 5 131 ? -52.525 -40.499 41.623 1.00 77.40  ? 58   DC  I OP2   1 
ATOM   8747  O  "O5'" . DC  I 5 131 ? -53.183 -38.154 42.183 1.00 75.54  ? 58   DC  I "O5'" 1 
ATOM   8748  C  "C5'" . DC  I 5 131 ? -53.434 -36.798 41.845 1.00 76.68  ? 58   DC  I "C5'" 1 
ATOM   8749  C  "C4'" . DC  I 5 131 ? -54.466 -36.150 42.759 1.00 78.20  ? 58   DC  I "C4'" 1 
ATOM   8750  O  "O4'" . DC  I 5 131 ? -55.813 -36.382 42.252 1.00 79.14  ? 58   DC  I "O4'" 1 
ATOM   8751  C  "C3'" . DC  I 5 131 ? -54.483 -36.614 44.214 1.00 78.57  ? 58   DC  I "C3'" 1 
ATOM   8752  O  "O3'" . DC  I 5 131 ? -54.681 -35.483 45.054 1.00 78.21  ? 58   DC  I "O3'" 1 
ATOM   8753  C  "C2'" . DC  I 5 131 ? -55.691 -37.550 44.248 1.00 79.16  ? 58   DC  I "C2'" 1 
ATOM   8754  C  "C1'" . DC  I 5 131 ? -56.635 -36.767 43.337 1.00 80.12  ? 58   DC  I "C1'" 1 
ATOM   8755  N  N1    . DC  I 5 131 ? -57.842 -37.493 42.801 1.00 81.56  ? 58   DC  I N1    1 
ATOM   8756  C  C2    . DC  I 5 131 ? -59.023 -36.776 42.509 1.00 82.45  ? 58   DC  I C2    1 
ATOM   8757  O  O2    . DC  I 5 131 ? -59.081 -35.548 42.700 1.00 82.94  ? 58   DC  I O2    1 
ATOM   8758  N  N3    . DC  I 5 131 ? -60.095 -37.456 42.020 1.00 83.05  ? 58   DC  I N3    1 
ATOM   8759  C  C4    . DC  I 5 131 ? -60.024 -38.780 41.820 1.00 83.33  ? 58   DC  I C4    1 
ATOM   8760  N  N4    . DC  I 5 131 ? -61.107 -39.404 41.336 1.00 83.75  ? 58   DC  I N4    1 
ATOM   8761  C  C5    . DC  I 5 131 ? -58.839 -39.526 42.107 1.00 82.87  ? 58   DC  I C5    1 
ATOM   8762  C  C6    . DC  I 5 131 ? -57.786 -38.848 42.589 1.00 82.27  ? 58   DC  I C6    1 
ATOM   8763  P  P     . DA  I 5 132 ? -53.479 -34.823 45.889 1.00 77.65  ? 59   DA  I P     1 
ATOM   8764  O  OP1   . DA  I 5 132 ? -52.345 -34.620 44.961 1.00 77.28  ? 59   DA  I OP1   1 
ATOM   8765  O  OP2   . DA  I 5 132 ? -53.288 -35.599 47.136 1.00 76.61  ? 59   DA  I OP2   1 
ATOM   8766  O  "O5'" . DA  I 5 132 ? -54.083 -33.400 46.302 1.00 78.85  ? 59   DA  I "O5'" 1 
ATOM   8767  C  "C5'" . DA  I 5 132 ? -54.558 -32.487 45.309 1.00 81.08  ? 59   DA  I "C5'" 1 
ATOM   8768  C  "C4'" . DA  I 5 132 ? -55.769 -31.693 45.788 1.00 83.10  ? 59   DA  I "C4'" 1 
ATOM   8769  O  "O4'" . DA  I 5 132 ? -57.009 -32.438 45.634 1.00 83.66  ? 59   DA  I "O4'" 1 
ATOM   8770  C  "C3'" . DA  I 5 132 ? -55.794 -31.234 47.242 1.00 84.29  ? 59   DA  I "C3'" 1 
ATOM   8771  O  "O3'" . DA  I 5 132 ? -56.540 -30.020 47.269 1.00 85.48  ? 59   DA  I "O3'" 1 
ATOM   8772  C  "C2'" . DA  I 5 132 ? -56.521 -32.382 47.951 1.00 83.82  ? 59   DA  I "C2'" 1 
ATOM   8773  C  "C1'" . DA  I 5 132 ? -57.544 -32.804 46.898 1.00 83.73  ? 59   DA  I "C1'" 1 
ATOM   8774  N  N9    . DA  I 5 132 ? -57.795 -34.234 46.761 1.00 83.78  ? 59   DA  I N9    1 
ATOM   8775  C  C8    . DA  I 5 132 ? -56.947 -35.272 47.041 1.00 83.92  ? 59   DA  I C8    1 
ATOM   8776  N  N7    . DA  I 5 132 ? -57.451 -36.456 46.786 1.00 83.47  ? 59   DA  I N7    1 
ATOM   8777  C  C5    . DA  I 5 132 ? -58.711 -36.172 46.288 1.00 83.42  ? 59   DA  I C5    1 
ATOM   8778  C  C6    . DA  I 5 132 ? -59.759 -36.994 45.830 1.00 83.21  ? 59   DA  I C6    1 
ATOM   8779  N  N6    . DA  I 5 132 ? -59.667 -38.323 45.802 1.00 83.07  ? 59   DA  I N6    1 
ATOM   8780  N  N1    . DA  I 5 132 ? -60.898 -36.400 45.401 1.00 83.26  ? 59   DA  I N1    1 
ATOM   8781  C  C2    . DA  I 5 132 ? -60.985 -35.062 45.430 1.00 83.09  ? 59   DA  I C2    1 
ATOM   8782  N  N3    . DA  I 5 132 ? -60.067 -34.185 45.840 1.00 83.68  ? 59   DA  I N3    1 
ATOM   8783  C  C4    . DA  I 5 132 ? -58.943 -34.808 46.261 1.00 83.78  ? 59   DA  I C4    1 
ATOM   8784  P  P     . DG  I 5 133 ? -56.548 -29.024 48.517 1.00 86.54  ? 60   DG  I P     1 
ATOM   8785  O  OP1   . DG  I 5 133 ? -56.059 -27.702 48.066 1.00 87.09  ? 60   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I 5 133 ? -55.945 -29.671 49.711 1.00 85.92  ? 60   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I 5 133 ? -58.117 -28.909 48.743 1.00 87.69  ? 60   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I 5 133 ? -58.626 -29.543 49.881 1.00 89.71  ? 60   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I 5 133 ? -60.074 -29.935 49.713 1.00 90.78  ? 60   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I 5 133 ? -60.179 -31.246 49.098 1.00 90.63  ? 60   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I 5 133 ? -60.727 -30.047 51.074 1.00 91.98  ? 60   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I 5 133 ? -62.026 -29.512 51.017 1.00 94.39  ? 60   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I 5 133 ? -60.716 -31.542 51.380 1.00 91.37  ? 60   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I 5 133 ? -60.797 -32.155 49.988 1.00 90.58  ? 60   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I 5 133 ? -60.159 -33.470 49.886 1.00 90.30  ? 60   DG  I N9    1 
ATOM   8796  C  C8    . DG  I 5 133 ? -58.862 -33.824 50.194 1.00 90.36  ? 60   DG  I C8    1 
ATOM   8797  N  N7    . DG  I 5 133 ? -58.596 -35.090 49.999 1.00 89.56  ? 60   DG  I N7    1 
ATOM   8798  C  C5    . DG  I 5 133 ? -59.795 -35.614 49.533 1.00 89.55  ? 60   DG  I C5    1 
ATOM   8799  C  C6    . DG  I 5 133 ? -60.135 -36.941 49.151 1.00 89.34  ? 60   DG  I C6    1 
ATOM   8800  O  O6    . DG  I 5 133 ? -59.416 -37.950 49.144 1.00 88.99  ? 60   DG  I O6    1 
ATOM   8801  N  N1    . DG  I 5 133 ? -61.468 -37.038 48.738 1.00 89.39  ? 60   DG  I N1    1 
ATOM   8802  C  C2    . DG  I 5 133 ? -62.359 -35.982 48.706 1.00 89.76  ? 60   DG  I C2    1 
ATOM   8803  N  N2    . DG  I 5 133 ? -63.603 -36.247 48.283 1.00 89.77  ? 60   DG  I N2    1 
ATOM   8804  N  N3    . DG  I 5 133 ? -62.057 -34.740 49.063 1.00 89.49  ? 60   DG  I N3    1 
ATOM   8805  C  C4    . DG  I 5 133 ? -60.763 -34.629 49.462 1.00 89.87  ? 60   DG  I C4    1 
ATOM   8806  P  P     . DG  I 5 134 ? -62.638 -28.855 52.339 1.00 96.49  ? 61   DG  I P     1 
ATOM   8807  O  OP1   . DG  I 5 134 ? -63.156 -27.520 51.964 1.00 96.71  ? 61   DG  I OP1   1 
ATOM   8808  O  OP2   . DG  I 5 134 ? -61.658 -28.983 53.448 1.00 96.64  ? 61   DG  I OP2   1 
ATOM   8809  O  "O5'" . DG  I 5 134 ? -63.865 -29.830 52.671 1.00 98.21  ? 61   DG  I "O5'" 1 
ATOM   8810  C  "C5'" . DG  I 5 134 ? -64.801 -30.219 51.665 1.00 100.12 ? 61   DG  I "C5'" 1 
ATOM   8811  C  "C4'" . DG  I 5 134 ? -65.461 -31.538 52.032 1.00 101.79 ? 61   DG  I "C4'" 1 
ATOM   8812  O  "O4'" . DG  I 5 134 ? -64.604 -32.626 51.601 1.00 102.07 ? 61   DG  I "O4'" 1 
ATOM   8813  C  "C3'" . DG  I 5 134 ? -65.695 -31.758 53.530 1.00 102.54 ? 61   DG  I "C3'" 1 
ATOM   8814  O  "O3'" . DG  I 5 134 ? -67.095 -31.762 53.811 1.00 104.15 ? 61   DG  I "O3'" 1 
ATOM   8815  C  "C2'" . DG  I 5 134 ? -65.051 -33.110 53.839 1.00 102.19 ? 61   DG  I "C2'" 1 
ATOM   8816  C  "C1'" . DG  I 5 134 ? -64.829 -33.718 52.463 1.00 101.81 ? 61   DG  I "C1'" 1 
ATOM   8817  N  N9    . DG  I 5 134 ? -63.665 -34.595 52.443 1.00 101.47 ? 61   DG  I N9    1 
ATOM   8818  C  C8    . DG  I 5 134 ? -62.382 -34.268 52.818 1.00 101.42 ? 61   DG  I C8    1 
ATOM   8819  N  N7    . DG  I 5 134 ? -61.535 -35.252 52.710 1.00 100.92 ? 61   DG  I N7    1 
ATOM   8820  C  C5    . DG  I 5 134 ? -62.305 -36.303 52.233 1.00 100.91 ? 61   DG  I C5    1 
ATOM   8821  C  C6    . DG  I 5 134 ? -61.932 -37.633 51.921 1.00 100.70 ? 61   DG  I C6    1 
ATOM   8822  O  O6    . DG  I 5 134 ? -60.810 -38.146 52.010 1.00 100.55 ? 61   DG  I O6    1 
ATOM   8823  N  N1    . DG  I 5 134 ? -63.012 -38.393 51.463 1.00 100.93 ? 61   DG  I N1    1 
ATOM   8824  C  C2    . DG  I 5 134 ? -64.299 -37.920 51.328 1.00 101.18 ? 61   DG  I C2    1 
ATOM   8825  N  N2    . DG  I 5 134 ? -65.211 -38.794 50.873 1.00 101.16 ? 61   DG  I N2    1 
ATOM   8826  N  N3    . DG  I 5 134 ? -64.664 -36.673 51.620 1.00 101.35 ? 61   DG  I N3    1 
ATOM   8827  C  C4    . DG  I 5 134 ? -63.621 -35.920 52.066 1.00 101.34 ? 61   DG  I C4    1 
ATOM   8828  P  P     . DT  I 5 135 ? -67.667 -31.973 55.299 1.00 105.51 ? 62   DT  I P     1 
ATOM   8829  O  OP1   . DT  I 5 135 ? -68.981 -31.296 55.387 1.00 105.21 ? 62   DT  I OP1   1 
ATOM   8830  O  OP2   . DT  I 5 135 ? -66.610 -31.654 56.287 1.00 105.33 ? 62   DT  I OP2   1 
ATOM   8831  O  "O5'" . DT  I 5 135 ? -67.894 -33.551 55.346 1.00 106.06 ? 62   DT  I "O5'" 1 
ATOM   8832  C  "C5'" . DT  I 5 135 ? -68.667 -34.212 54.348 1.00 107.37 ? 62   DT  I "C5'" 1 
ATOM   8833  C  "C4'" . DT  I 5 135 ? -68.757 -35.684 54.697 1.00 108.24 ? 62   DT  I "C4'" 1 
ATOM   8834  O  "O4'" . DT  I 5 135 ? -67.533 -36.334 54.274 1.00 108.53 ? 62   DT  I "O4'" 1 
ATOM   8835  C  "C3'" . DT  I 5 135 ? -68.895 -35.928 56.201 1.00 108.72 ? 62   DT  I "C3'" 1 
ATOM   8836  O  "O3'" . DT  I 5 135 ? -70.199 -36.477 56.491 1.00 109.41 ? 62   DT  I "O3'" 1 
ATOM   8837  C  "C2'" . DT  I 5 135 ? -67.706 -36.815 56.575 1.00 108.76 ? 62   DT  I "C2'" 1 
ATOM   8838  C  "C1'" . DT  I 5 135 ? -67.166 -37.301 55.234 1.00 108.67 ? 62   DT  I "C1'" 1 
ATOM   8839  N  N1    . DT  I 5 135 ? -65.676 -37.477 55.239 1.00 108.64 ? 62   DT  I N1    1 
ATOM   8840  C  C2    . DT  I 5 135 ? -65.129 -38.685 54.837 1.00 108.75 ? 62   DT  I C2    1 
ATOM   8841  O  O2    . DT  I 5 135 ? -65.785 -39.643 54.459 1.00 108.90 ? 62   DT  I O2    1 
ATOM   8842  N  N3    . DT  I 5 135 ? -63.756 -38.738 54.889 1.00 108.61 ? 62   DT  I N3    1 
ATOM   8843  C  C4    . DT  I 5 135 ? -62.891 -37.732 55.296 1.00 108.75 ? 62   DT  I C4    1 
ATOM   8844  O  O4    . DT  I 5 135 ? -61.672 -37.895 55.299 1.00 108.63 ? 62   DT  I O4    1 
ATOM   8845  C  C5    . DT  I 5 135 ? -63.524 -36.495 55.707 1.00 108.84 ? 62   DT  I C5    1 
ATOM   8846  C  C7    . DT  I 5 135 ? -62.706 -35.323 56.172 1.00 108.67 ? 62   DT  I C7    1 
ATOM   8847  C  C6    . DT  I 5 135 ? -64.866 -36.431 55.660 1.00 108.79 ? 62   DT  I C6    1 
ATOM   8848  P  P     . DG  I 5 136 ? -70.468 -37.648 57.554 1.00 109.64 ? 63   DG  I P     1 
ATOM   8849  O  OP1   . DG  I 5 136 ? -71.934 -37.871 57.611 1.00 109.40 ? 63   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I 5 136 ? -69.729 -37.347 58.807 1.00 109.46 ? 63   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I 5 136 ? -69.776 -38.890 56.816 1.00 109.29 ? 63   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I 5 136 ? -70.374 -40.179 56.805 1.00 109.17 ? 63   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I 5 136 ? -69.678 -41.062 57.824 1.00 108.97 ? 63   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I 5 136 ? -68.244 -40.946 57.636 1.00 108.48 ? 63   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I 5 136 ? -69.981 -40.683 59.274 1.00 109.07 ? 63   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I 5 136 ? -70.706 -41.758 59.934 1.00 109.72 ? 63   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I 5 136 ? -68.619 -40.289 59.862 1.00 108.57 ? 63   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I 5 136 ? -67.617 -40.931 58.900 1.00 108.09 ? 63   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I 5 136 ? -66.313 -40.257 58.812 1.00 107.36 ? 63   DG  I N9    1 
ATOM   8860  C  C8    . DG  I 5 136 ? -66.034 -38.930 59.055 1.00 107.12 ? 63   DG  I C8    1 
ATOM   8861  N  N7    . DG  I 5 136 ? -64.776 -38.622 58.908 1.00 106.75 ? 63   DG  I N7    1 
ATOM   8862  C  C5    . DG  I 5 136 ? -64.173 -39.820 58.545 1.00 106.52 ? 63   DG  I C5    1 
ATOM   8863  C  C6    . DG  I 5 136 ? -62.814 -40.112 58.248 1.00 106.27 ? 63   DG  I C6    1 
ATOM   8864  O  O6    . DG  I 5 136 ? -61.849 -39.336 58.251 1.00 106.50 ? 63   DG  I O6    1 
ATOM   8865  N  N1    . DG  I 5 136 ? -62.613 -41.455 57.924 1.00 105.67 ? 63   DG  I N1    1 
ATOM   8866  C  C2    . DG  I 5 136 ? -63.611 -42.401 57.892 1.00 105.83 ? 63   DG  I C2    1 
ATOM   8867  N  N2    . DG  I 5 136 ? -63.237 -43.643 57.557 1.00 105.59 ? 63   DG  I N2    1 
ATOM   8868  N  N3    . DG  I 5 136 ? -64.888 -42.143 58.165 1.00 106.29 ? 63   DG  I N3    1 
ATOM   8869  C  C4    . DG  I 5 136 ? -65.103 -40.837 58.484 1.00 106.73 ? 63   DG  I C4    1 
ATOM   8870  P  P     . DG  I 5 137 ? -70.159 -42.653 61.163 1.00 109.94 ? 64   DG  I P     1 
ATOM   8871  O  OP1   . DG  I 5 137 ? -71.108 -43.775 61.363 1.00 109.84 ? 64   DG  I OP1   1 
ATOM   8872  O  OP2   . DG  I 5 137 ? -69.829 -41.765 62.310 1.00 109.82 ? 64   DG  I OP2   1 
ATOM   8873  O  "O5'" . DG  I 5 137 ? -68.800 -43.236 60.552 1.00 109.13 ? 64   DG  I "O5'" 1 
ATOM   8874  C  "C5'" . DG  I 5 137 ? -68.675 -44.601 60.161 1.00 107.60 ? 64   DG  I "C5'" 1 
ATOM   8875  C  "C4'" . DG  I 5 137 ? -67.516 -45.193 60.942 1.00 106.54 ? 64   DG  I "C4'" 1 
ATOM   8876  O  "O4'" . DG  I 5 137 ? -66.349 -44.335 60.795 1.00 105.93 ? 64   DG  I "O4'" 1 
ATOM   8877  C  "C3'" . DG  I 5 137 ? -67.778 -45.313 62.440 1.00 106.04 ? 64   DG  I "C3'" 1 
ATOM   8878  O  "O3'" . DG  I 5 137 ? -67.359 -46.601 62.891 1.00 105.41 ? 64   DG  I "O3'" 1 
ATOM   8879  C  "C2'" . DG  I 5 137 ? -66.965 -44.157 63.034 1.00 105.83 ? 64   DG  I "C2'" 1 
ATOM   8880  C  "C1'" . DG  I 5 137 ? -65.788 -44.064 62.068 1.00 105.20 ? 64   DG  I "C1'" 1 
ATOM   8881  N  N9    . DG  I 5 137 ? -65.098 -42.764 62.054 1.00 103.81 ? 64   DG  I N9    1 
ATOM   8882  C  C8    . DG  I 5 137 ? -65.626 -41.532 62.374 1.00 103.45 ? 64   DG  I C8    1 
ATOM   8883  N  N7    . DG  I 5 137 ? -64.776 -40.548 62.273 1.00 102.79 ? 64   DG  I N7    1 
ATOM   8884  C  C5    . DG  I 5 137 ? -63.599 -41.159 61.859 1.00 102.27 ? 64   DG  I C5    1 
ATOM   8885  C  C6    . DG  I 5 137 ? -62.323 -40.595 61.579 1.00 101.55 ? 64   DG  I C6    1 
ATOM   8886  O  O6    . DG  I 5 137 ? -61.976 -39.406 61.644 1.00 100.94 ? 64   DG  I O6    1 
ATOM   8887  N  N1    . DG  I 5 137 ? -61.398 -41.563 61.186 1.00 100.90 ? 64   DG  I N1    1 
ATOM   8888  C  C2    . DG  I 5 137 ? -61.674 -42.908 61.076 1.00 101.08 ? 64   DG  I C2    1 
ATOM   8889  N  N2    . DG  I 5 137 ? -60.662 -43.691 60.683 1.00 100.33 ? 64   DG  I N2    1 
ATOM   8890  N  N3    . DG  I 5 137 ? -62.863 -43.450 61.334 1.00 101.72 ? 64   DG  I N3    1 
ATOM   8891  C  C4    . DG  I 5 137 ? -63.780 -42.523 61.720 1.00 102.57 ? 64   DG  I C4    1 
ATOM   8892  P  P     . DA  I 5 138 ? -67.241 -47.000 64.446 1.00 105.12 ? 65   DA  I P     1 
ATOM   8893  O  OP1   . DA  I 5 138 ? -68.095 -48.189 64.667 1.00 105.01 ? 65   DA  I OP1   1 
ATOM   8894  O  OP2   . DA  I 5 138 ? -67.417 -45.800 65.302 1.00 104.82 ? 65   DA  I OP2   1 
ATOM   8895  O  "O5'" . DA  I 5 138 ? -65.712 -47.460 64.564 1.00 103.53 ? 65   DA  I "O5'" 1 
ATOM   8896  C  "C5'" . DA  I 5 138 ? -65.192 -48.438 63.668 1.00 101.63 ? 65   DA  I "C5'" 1 
ATOM   8897  C  "C4'" . DA  I 5 138 ? -63.675 -48.394 63.660 1.00 100.24 ? 65   DA  I "C4'" 1 
ATOM   8898  O  "O4'" . DA  I 5 138 ? -63.216 -47.055 63.324 1.00 99.78  ? 65   DA  I "O4'" 1 
ATOM   8899  C  "C3'" . DA  I 5 138 ? -63.040 -48.751 65.001 1.00 99.53  ? 65   DA  I "C3'" 1 
ATOM   8900  O  "O3'" . DA  I 5 138 ? -62.028 -49.742 64.789 1.00 98.82  ? 65   DA  I "O3'" 1 
ATOM   8901  C  "C2'" . DA  I 5 138 ? -62.515 -47.411 65.523 1.00 99.21  ? 65   DA  I "C2'" 1 
ATOM   8902  C  "C1'" . DA  I 5 138 ? -62.214 -46.651 64.238 1.00 98.67  ? 65   DA  I "C1'" 1 
ATOM   8903  N  N9    . DA  I 5 138 ? -62.260 -45.200 64.427 1.00 97.69  ? 65   DA  I N9    1 
ATOM   8904  C  C8    . DA  I 5 138 ? -63.344 -44.456 64.822 1.00 97.53  ? 65   DA  I C8    1 
ATOM   8905  N  N7    . DA  I 5 138 ? -63.104 -43.168 64.920 1.00 96.79  ? 65   DA  I N7    1 
ATOM   8906  C  C5    . DA  I 5 138 ? -61.762 -43.052 64.563 1.00 96.45  ? 65   DA  I C5    1 
ATOM   8907  C  C6    . DA  I 5 138 ? -60.887 -41.937 64.462 1.00 95.56  ? 65   DA  I C6    1 
ATOM   8908  N  N6    . DA  I 5 138 ? -61.261 -40.681 64.725 1.00 94.84  ? 65   DA  I N6    1 
ATOM   8909  N  N1    . DA  I 5 138 ? -59.605 -42.166 64.078 1.00 95.24  ? 65   DA  I N1    1 
ATOM   8910  C  C2    . DA  I 5 138 ? -59.221 -43.425 63.809 1.00 95.46  ? 65   DA  I C2    1 
ATOM   8911  N  N3    . DA  I 5 138 ? -59.948 -44.550 63.870 1.00 96.04  ? 65   DA  I N3    1 
ATOM   8912  C  C4    . DA  I 5 138 ? -61.223 -44.296 64.257 1.00 96.85  ? 65   DA  I C4    1 
ATOM   8913  P  P     . DT  I 5 139 ? -60.819 -50.000 65.818 1.00 98.73  ? 66   DT  I P     1 
ATOM   8914  O  OP1   . DT  I 5 139 ? -60.088 -51.213 65.380 1.00 98.20  ? 66   DT  I OP1   1 
ATOM   8915  O  OP2   . DT  I 5 139 ? -61.335 -49.903 67.205 1.00 97.92  ? 66   DT  I OP2   1 
ATOM   8916  O  "O5'" . DT  I 5 139 ? -59.897 -48.718 65.559 1.00 98.40  ? 66   DT  I "O5'" 1 
ATOM   8917  C  "C5'" . DT  I 5 139 ? -58.682 -48.795 64.822 1.00 96.29  ? 66   DT  I "C5'" 1 
ATOM   8918  C  "C4'" . DT  I 5 139 ? -57.628 -47.930 65.492 1.00 94.33  ? 66   DT  I "C4'" 1 
ATOM   8919  O  "O4'" . DT  I 5 139 ? -58.151 -46.586 65.677 1.00 93.86  ? 66   DT  I "O4'" 1 
ATOM   8920  C  "C3'" . DT  I 5 139 ? -57.158 -48.398 66.870 1.00 93.03  ? 66   DT  I "C3'" 1 
ATOM   8921  O  "O3'" . DT  I 5 139 ? -55.743 -48.328 66.825 1.00 91.95  ? 66   DT  I "O3'" 1 
ATOM   8922  C  "C2'" . DT  I 5 139 ? -57.797 -47.397 67.837 1.00 92.85  ? 66   DT  I "C2'" 1 
ATOM   8923  C  "C1'" . DT  I 5 139 ? -57.821 -46.134 66.978 1.00 92.95  ? 66   DT  I "C1'" 1 
ATOM   8924  N  N1    . DT  I 5 139 ? -58.795 -45.038 67.353 1.00 92.04  ? 66   DT  I N1    1 
ATOM   8925  C  C2    . DT  I 5 139 ? -58.372 -43.719 67.281 1.00 91.65  ? 66   DT  I C2    1 
ATOM   8926  O  O2    . DT  I 5 139 ? -57.248 -43.384 66.947 1.00 91.44  ? 66   DT  I O2    1 
ATOM   8927  N  N3    . DT  I 5 139 ? -59.317 -42.783 67.624 1.00 91.51  ? 66   DT  I N3    1 
ATOM   8928  C  C4    . DT  I 5 139 ? -60.622 -43.020 68.018 1.00 91.57  ? 66   DT  I C4    1 
ATOM   8929  O  O4    . DT  I 5 139 ? -61.383 -42.096 68.304 1.00 91.30  ? 66   DT  I O4    1 
ATOM   8930  C  C5    . DT  I 5 139 ? -61.008 -44.419 68.068 1.00 91.75  ? 66   DT  I C5    1 
ATOM   8931  C  C7    . DT  I 5 139 ? -62.397 -44.818 68.483 1.00 92.01  ? 66   DT  I C7    1 
ATOM   8932  C  C6    . DT  I 5 139 ? -60.091 -45.345 67.735 1.00 91.74  ? 66   DT  I C6    1 
ATOM   8933  P  P     . DA  I 5 140 ? -54.740 -48.691 68.024 1.00 91.12  ? 67   DA  I P     1 
ATOM   8934  O  OP1   . DA  I 5 140 ? -54.317 -50.099 67.860 1.00 90.51  ? 67   DA  I OP1   1 
ATOM   8935  O  OP2   . DA  I 5 140 ? -55.335 -48.235 69.302 1.00 91.14  ? 67   DA  I OP2   1 
ATOM   8936  O  "O5'" . DA  I 5 140 ? -53.476 -47.747 67.722 1.00 89.92  ? 67   DA  I "O5'" 1 
ATOM   8937  C  "C5'" . DA  I 5 140 ? -53.534 -46.745 66.692 1.00 87.90  ? 67   DA  I "C5'" 1 
ATOM   8938  C  "C4'" . DA  I 5 140 ? -52.844 -45.439 67.070 1.00 86.50  ? 67   DA  I "C4'" 1 
ATOM   8939  O  "O4'" . DA  I 5 140 ? -53.825 -44.420 67.418 1.00 85.65  ? 67   DA  I "O4'" 1 
ATOM   8940  C  "C3'" . DA  I 5 140 ? -51.856 -45.481 68.232 1.00 85.77  ? 67   DA  I "C3'" 1 
ATOM   8941  O  "O3'" . DA  I 5 140 ? -50.717 -44.720 67.848 1.00 85.09  ? 67   DA  I "O3'" 1 
ATOM   8942  C  "C2'" . DA  I 5 140 ? -52.627 -44.851 69.396 1.00 85.08  ? 67   DA  I "C2'" 1 
ATOM   8943  C  "C1'" . DA  I 5 140 ? -53.545 -43.861 68.687 1.00 84.21  ? 67   DA  I "C1'" 1 
ATOM   8944  N  N9    . DA  I 5 140 ? -54.843 -43.626 69.320 1.00 83.00  ? 67   DA  I N9    1 
ATOM   8945  C  C8    . DA  I 5 140 ? -55.780 -44.565 69.646 1.00 82.43  ? 67   DA  I C8    1 
ATOM   8946  N  N7    . DA  I 5 140 ? -56.865 -44.066 70.187 1.00 82.21  ? 67   DA  I N7    1 
ATOM   8947  C  C5    . DA  I 5 140 ? -56.634 -42.704 70.211 1.00 81.94  ? 67   DA  I C5    1 
ATOM   8948  C  C6    . DA  I 5 140 ? -57.405 -41.613 70.667 1.00 81.92  ? 67   DA  I C6    1 
ATOM   8949  N  N6    . DA  I 5 140 ? -58.620 -41.743 71.201 1.00 81.70  ? 67   DA  I N6    1 
ATOM   8950  N  N1    . DA  I 5 140 ? -56.882 -40.371 70.549 1.00 82.08  ? 67   DA  I N1    1 
ATOM   8951  C  C2    . DA  I 5 140 ? -55.663 -40.237 70.010 1.00 81.73  ? 67   DA  I C2    1 
ATOM   8952  N  N3    . DA  I 5 140 ? -54.846 -41.185 69.546 1.00 81.65  ? 67   DA  I N3    1 
ATOM   8953  C  C4    . DA  I 5 140 ? -55.392 -42.411 69.676 1.00 82.32  ? 67   DA  I C4    1 
ATOM   8954  P  P     . DT  I 5 141 ? -49.406 -44.618 68.763 1.00 84.32  ? 68   DT  I P     1 
ATOM   8955  O  OP1   . DT  I 5 141 ? -48.236 -44.472 67.870 1.00 84.68  ? 68   DT  I OP1   1 
ATOM   8956  O  OP2   . DT  I 5 141 ? -49.438 -45.709 69.761 1.00 84.48  ? 68   DT  I OP2   1 
ATOM   8957  O  "O5'" . DT  I 5 141 ? -49.617 -43.222 69.509 1.00 82.92  ? 68   DT  I "O5'" 1 
ATOM   8958  C  "C5'" . DT  I 5 141 ? -49.809 -42.054 68.711 1.00 80.97  ? 68   DT  I "C5'" 1 
ATOM   8959  C  "C4'" . DT  I 5 141 ? -50.049 -40.821 69.559 1.00 79.43  ? 68   DT  I "C4'" 1 
ATOM   8960  O  "O4'" . DT  I 5 141 ? -51.397 -40.836 70.091 1.00 79.19  ? 68   DT  I "O4'" 1 
ATOM   8961  C  "C3'" . DT  I 5 141 ? -49.111 -40.655 70.752 1.00 78.64  ? 68   DT  I "C3'" 1 
ATOM   8962  O  "O3'" . DT  I 5 141 ? -48.458 -39.401 70.579 1.00 77.87  ? 68   DT  I "O3'" 1 
ATOM   8963  C  "C2'" . DT  I 5 141 ? -50.019 -40.692 71.991 1.00 78.43  ? 68   DT  I "C2'" 1 
ATOM   8964  C  "C1'" . DT  I 5 141 ? -51.388 -40.334 71.414 1.00 78.56  ? 68   DT  I "C1'" 1 
ATOM   8965  N  N1    . DT  I 5 141 ? -52.587 -40.923 72.110 1.00 78.14  ? 68   DT  I N1    1 
ATOM   8966  C  C2    . DT  I 5 141 ? -53.594 -40.081 72.554 1.00 77.82  ? 68   DT  I C2    1 
ATOM   8967  O  O2    . DT  I 5 141 ? -53.581 -38.867 72.437 1.00 76.97  ? 68   DT  I O2    1 
ATOM   8968  N  N3    . DT  I 5 141 ? -54.647 -40.722 73.159 1.00 78.22  ? 68   DT  I N3    1 
ATOM   8969  C  C4    . DT  I 5 141 ? -54.804 -42.082 73.364 1.00 78.42  ? 68   DT  I C4    1 
ATOM   8970  O  O4    . DT  I 5 141 ? -55.804 -42.529 73.920 1.00 79.34  ? 68   DT  I O4    1 
ATOM   8971  C  C5    . DT  I 5 141 ? -53.720 -42.910 72.873 1.00 77.89  ? 68   DT  I C5    1 
ATOM   8972  C  C7    . DT  I 5 141 ? -53.755 -44.404 73.021 1.00 77.52  ? 68   DT  I C7    1 
ATOM   8973  C  C6    . DT  I 5 141 ? -52.685 -42.298 72.277 1.00 78.08  ? 68   DT  I C6    1 
ATOM   8974  P  P     . DT  I 5 142 ? -47.311 -38.867 71.564 1.00 77.03  ? 69   DT  I P     1 
ATOM   8975  O  OP1   . DT  I 5 142 ? -46.509 -37.872 70.822 1.00 77.25  ? 69   DT  I OP1   1 
ATOM   8976  O  OP2   . DT  I 5 142 ? -46.643 -40.035 72.186 1.00 76.96  ? 69   DT  I OP2   1 
ATOM   8977  O  "O5'" . DT  I 5 142 ? -48.137 -38.062 72.671 1.00 75.90  ? 69   DT  I "O5'" 1 
ATOM   8978  C  "C5'" . DT  I 5 142 ? -48.978 -36.992 72.244 1.00 74.36  ? 69   DT  I "C5'" 1 
ATOM   8979  C  "C4'" . DT  I 5 142 ? -49.798 -36.452 73.398 1.00 72.98  ? 69   DT  I "C4'" 1 
ATOM   8980  O  "O4'" . DT  I 5 142 ? -50.850 -37.386 73.742 1.00 71.88  ? 69   DT  I "O4'" 1 
ATOM   8981  C  "C3'" . DT  I 5 142 ? -48.992 -36.222 74.668 1.00 73.10  ? 69   DT  I "C3'" 1 
ATOM   8982  O  "O3'" . DT  I 5 142 ? -49.223 -34.884 75.059 1.00 73.94  ? 69   DT  I "O3'" 1 
ATOM   8983  C  "C2'" . DT  I 5 142 ? -49.540 -37.241 75.671 1.00 72.20  ? 69   DT  I "C2'" 1 
ATOM   8984  C  "C1'" . DT  I 5 142 ? -50.959 -37.454 75.149 1.00 71.54  ? 69   DT  I "C1'" 1 
ATOM   8985  N  N1    . DT  I 5 142 ? -51.619 -38.755 75.501 1.00 70.03  ? 69   DT  I N1    1 
ATOM   8986  C  C2    . DT  I 5 142 ? -52.942 -38.742 75.892 1.00 69.34  ? 69   DT  I C2    1 
ATOM   8987  O  O2    . DT  I 5 142 ? -53.612 -37.728 75.980 1.00 69.30  ? 69   DT  I O2    1 
ATOM   8988  N  N3    . DT  I 5 142 ? -53.464 -39.976 76.186 1.00 69.31  ? 69   DT  I N3    1 
ATOM   8989  C  C4    . DT  I 5 142 ? -52.810 -41.194 76.126 1.00 69.65  ? 69   DT  I C4    1 
ATOM   8990  O  O4    . DT  I 5 142 ? -53.384 -42.241 76.415 1.00 70.42  ? 69   DT  I O4    1 
ATOM   8991  C  C5    . DT  I 5 142 ? -51.421 -41.137 75.711 1.00 69.39  ? 69   DT  I C5    1 
ATOM   8992  C  C7    . DT  I 5 142 ? -50.589 -42.385 75.602 1.00 69.15  ? 69   DT  I C7    1 
ATOM   8993  C  C6    . DT  I 5 142 ? -50.904 -39.937 75.419 1.00 69.31  ? 69   DT  I C6    1 
ATOM   8994  P  P     . DG  I 5 143 ? -48.311 -34.146 76.144 1.00 74.63  ? 70   DG  I P     1 
ATOM   8995  O  OP1   . DG  I 5 143 ? -48.154 -32.751 75.678 1.00 74.80  ? 70   DG  I OP1   1 
ATOM   8996  O  OP2   . DG  I 5 143 ? -47.126 -34.972 76.457 1.00 73.72  ? 70   DG  I OP2   1 
ATOM   8997  O  "O5'" . DG  I 5 143 ? -49.278 -34.117 77.408 1.00 76.58  ? 70   DG  I "O5'" 1 
ATOM   8998  C  "C5'" . DG  I 5 143 ? -50.504 -33.367 77.300 1.00 79.52  ? 70   DG  I "C5'" 1 
ATOM   8999  C  "C4'" . DG  I 5 143 ? -51.472 -33.724 78.416 1.00 81.04  ? 70   DG  I "C4'" 1 
ATOM   9000  O  "O4'" . DG  I 5 143 ? -51.869 -35.113 78.271 1.00 81.15  ? 70   DG  I "O4'" 1 
ATOM   9001  C  "C3'" . DG  I 5 143 ? -50.867 -33.592 79.810 1.00 82.72  ? 70   DG  I "C3'" 1 
ATOM   9002  O  "O3'" . DG  I 5 143 ? -51.795 -32.931 80.659 1.00 86.09  ? 70   DG  I "O3'" 1 
ATOM   9003  C  "C2'" . DG  I 5 143 ? -50.587 -35.038 80.219 1.00 81.88  ? 70   DG  I "C2'" 1 
ATOM   9004  C  "C1'" . DG  I 5 143 ? -51.755 -35.737 79.531 1.00 81.09  ? 70   DG  I "C1'" 1 
ATOM   9005  N  N9    . DG  I 5 143 ? -51.639 -37.189 79.375 1.00 80.69  ? 70   DG  I N9    1 
ATOM   9006  C  C8    . DG  I 5 143 ? -50.544 -37.948 79.019 1.00 80.21  ? 70   DG  I C8    1 
ATOM   9007  N  N7    . DG  I 5 143 ? -50.792 -39.231 78.982 1.00 80.21  ? 70   DG  I N7    1 
ATOM   9008  C  C5    . DG  I 5 143 ? -52.136 -39.329 79.339 1.00 80.32  ? 70   DG  I C5    1 
ATOM   9009  C  C6    . DG  I 5 143 ? -52.977 -40.464 79.479 1.00 80.37  ? 70   DG  I C6    1 
ATOM   9010  O  O6    . DG  I 5 143 ? -52.683 -41.659 79.303 1.00 80.31  ? 70   DG  I O6    1 
ATOM   9011  N  N1    . DG  I 5 143 ? -54.276 -40.106 79.864 1.00 80.59  ? 70   DG  I N1    1 
ATOM   9012  C  C2    . DG  I 5 143 ? -54.705 -38.810 80.084 1.00 81.10  ? 70   DG  I C2    1 
ATOM   9013  N  N2    . DG  I 5 143 ? -55.983 -38.630 80.449 1.00 81.59  ? 70   DG  I N2    1 
ATOM   9014  N  N3    . DG  I 5 143 ? -53.927 -37.745 79.956 1.00 80.72  ? 70   DG  I N3    1 
ATOM   9015  C  C4    . DG  I 5 143 ? -52.665 -38.079 79.583 1.00 80.57  ? 70   DG  I C4    1 
ATOM   9016  P  P     . DA  I 5 144 ? -51.331 -32.221 82.027 1.00 88.98  ? 71   DA  I P     1 
ATOM   9017  O  OP1   . DA  I 5 144 ? -51.524 -30.762 81.854 1.00 88.73  ? 71   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I 5 144 ? -50.009 -32.750 82.450 1.00 87.72  ? 71   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I 5 144 ? -52.439 -32.744 83.054 1.00 89.15  ? 71   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I 5 144 ? -53.818 -32.436 82.847 1.00 90.29  ? 71   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I 5 144 ? -54.640 -33.547 83.466 1.00 91.02  ? 71   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I 5 144 ? -54.234 -34.781 82.827 1.00 90.45  ? 71   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I 5 144 ? -54.361 -33.723 84.962 1.00 91.94  ? 71   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I 5 144 ? -55.527 -33.482 85.766 1.00 93.89  ? 71   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I 5 144 ? -53.848 -35.154 85.104 1.00 91.16  ? 71   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I 5 144 ? -54.272 -35.803 83.790 1.00 90.12  ? 71   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I 5 144 ? -53.373 -36.871 83.382 1.00 89.30  ? 71   DA  I N9    1 
ATOM   9028  C  C8    . DA  I 5 144 ? -52.083 -36.748 82.947 1.00 88.81  ? 71   DA  I C8    1 
ATOM   9029  N  N7    . DA  I 5 144 ? -51.512 -37.894 82.657 1.00 88.70  ? 71   DA  I N7    1 
ATOM   9030  C  C5    . DA  I 5 144 ? -52.496 -38.831 82.924 1.00 88.51  ? 71   DA  I C5    1 
ATOM   9031  C  C6    . DA  I 5 144 ? -52.525 -40.236 82.823 1.00 88.34  ? 71   DA  I C6    1 
ATOM   9032  N  N6    . DA  I 5 144 ? -51.482 -40.958 82.404 1.00 87.73  ? 71   DA  I N6    1 
ATOM   9033  N  N1    . DA  I 5 144 ? -53.671 -40.867 83.175 1.00 88.65  ? 71   DA  I N1    1 
ATOM   9034  C  C2    . DA  I 5 144 ? -54.714 -40.137 83.597 1.00 88.66  ? 71   DA  I C2    1 
ATOM   9035  N  N3    . DA  I 5 144 ? -54.804 -38.815 83.731 1.00 88.16  ? 71   DA  I N3    1 
ATOM   9036  C  C4    . DA  I 5 144 ? -53.652 -38.218 83.376 1.00 88.75  ? 71   DA  I C4    1 
ATOM   9037  P  P     . DT  I 5 145 ? -55.391 -33.133 87.334 1.00 94.93  ? 72   DT  I P     1 
ATOM   9038  O  OP1   . DT  I 5 145 ? -56.452 -32.153 87.662 1.00 94.36  ? 72   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I 5 145 ? -53.973 -32.823 87.655 1.00 94.67  ? 72   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I 5 145 ? -55.715 -34.529 88.046 1.00 95.46  ? 72   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I 5 145 ? -56.924 -35.237 87.793 1.00 95.69  ? 72   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I 5 145 ? -56.725 -36.680 88.215 1.00 95.95  ? 72   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I 5 145 ? -55.746 -37.282 87.329 1.00 95.85  ? 72   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I 5 145 ? -56.178 -36.860 89.636 1.00 96.14  ? 72   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I 5 145 ? -57.092 -37.621 90.428 1.00 96.12  ? 72   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I 5 145 ? -54.844 -37.587 89.437 1.00 96.09  ? 72   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I 5 145 ? -55.102 -38.271 88.098 1.00 95.87  ? 72   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I 5 145 ? -53.906 -38.832 87.382 1.00 95.34  ? 72   DT  I N1    1 
ATOM   9049  C  C2    . DT  I 5 145 ? -53.901 -40.185 87.093 1.00 95.56  ? 72   DT  I C2    1 
ATOM   9050  O  O2    . DT  I 5 145 ? -54.814 -40.947 87.385 1.00 96.31  ? 72   DT  I O2    1 
ATOM   9051  N  N3    . DT  I 5 145 ? -52.776 -40.624 86.440 1.00 95.01  ? 72   DT  I N3    1 
ATOM   9052  C  C4    . DT  I 5 145 ? -51.681 -39.868 86.058 1.00 95.07  ? 72   DT  I C4    1 
ATOM   9053  O  O4    . DT  I 5 145 ? -50.721 -40.371 85.477 1.00 95.51  ? 72   DT  I O4    1 
ATOM   9054  C  C5    . DT  I 5 145 ? -51.751 -38.462 86.387 1.00 94.72  ? 72   DT  I C5    1 
ATOM   9055  C  C7    . DT  I 5 145 ? -50.622 -37.538 86.028 1.00 94.51  ? 72   DT  I C7    1 
ATOM   9056  C  C6    . DT  I 5 145 ? -52.844 -38.018 87.028 1.00 94.89  ? 72   DT  I C6    1 
ATOM   9057  O  "O5'" . DA  J 6 1   ? -49.996 -50.806 84.110 1.00 105.36 ? -72  DA  J "O5'" 1 
ATOM   9058  C  "C5'" . DA  J 6 1   ? -51.252 -50.220 83.755 1.00 104.98 ? -72  DA  J "C5'" 1 
ATOM   9059  C  "C4'" . DA  J 6 1   ? -52.180 -50.155 84.959 1.00 104.53 ? -72  DA  J "C4'" 1 
ATOM   9060  O  "O4'" . DA  J 6 1   ? -51.486 -49.522 86.066 1.00 104.02 ? -72  DA  J "O4'" 1 
ATOM   9061  C  "C3'" . DA  J 6 1   ? -53.455 -49.353 84.726 1.00 104.43 ? -72  DA  J "C3'" 1 
ATOM   9062  O  "O3'" . DA  J 6 1   ? -54.563 -50.238 84.587 1.00 105.10 ? -72  DA  J "O3'" 1 
ATOM   9063  C  "C2'" . DA  J 6 1   ? -53.597 -48.469 85.965 1.00 103.72 ? -72  DA  J "C2'" 1 
ATOM   9064  C  "C1'" . DA  J 6 1   ? -52.172 -48.358 86.495 1.00 103.07 ? -72  DA  J "C1'" 1 
ATOM   9065  N  N9    . DA  J 6 1   ? -51.439 -47.163 86.047 1.00 101.87 ? -72  DA  J N9    1 
ATOM   9066  C  C8    . DA  J 6 1   ? -50.209 -47.144 85.447 1.00 101.32 ? -72  DA  J C8    1 
ATOM   9067  N  N7    . DA  J 6 1   ? -49.772 -45.940 85.154 1.00 100.65 ? -72  DA  J N7    1 
ATOM   9068  C  C5    . DA  J 6 1   ? -50.781 -45.100 85.594 1.00 100.24 ? -72  DA  J C5    1 
ATOM   9069  C  C6    . DA  J 6 1   ? -50.927 -43.693 85.573 1.00 99.40  ? -72  DA  J C6    1 
ATOM   9070  N  N6    . DA  J 6 1   ? -50.004 -42.870 85.067 1.00 98.68  ? -72  DA  J N6    1 
ATOM   9071  N  N1    . DA  J 6 1   ? -52.057 -43.164 86.090 1.00 99.13  ? -72  DA  J N1    1 
ATOM   9072  C  C2    . DA  J 6 1   ? -52.981 -43.991 86.600 1.00 99.60  ? -72  DA  J C2    1 
ATOM   9073  N  N3    . DA  J 6 1   ? -52.954 -45.327 86.675 1.00 100.44 ? -72  DA  J N3    1 
ATOM   9074  C  C4    . DA  J 6 1   ? -51.818 -45.833 86.152 1.00 100.86 ? -72  DA  J C4    1 
ATOM   9075  P  P     . DT  J 6 2   ? -55.975 -49.717 84.030 1.00 105.93 ? -71  DT  J P     1 
ATOM   9076  O  OP1   . DT  J 6 2   ? -56.862 -50.898 83.913 1.00 106.19 ? -71  DT  J OP1   1 
ATOM   9077  O  OP2   . DT  J 6 2   ? -55.735 -48.875 82.838 1.00 105.89 ? -71  DT  J OP2   1 
ATOM   9078  O  "O5'" . DT  J 6 2   ? -56.494 -48.763 85.205 1.00 105.80 ? -71  DT  J "O5'" 1 
ATOM   9079  C  "C5'" . DT  J 6 2   ? -57.828 -48.856 85.686 1.00 106.17 ? -71  DT  J "C5'" 1 
ATOM   9080  C  "C4'" . DT  J 6 2   ? -58.602 -47.629 85.250 1.00 106.16 ? -71  DT  J "C4'" 1 
ATOM   9081  O  "O4'" . DT  J 6 2   ? -57.727 -46.475 85.362 1.00 105.72 ? -71  DT  J "O4'" 1 
ATOM   9082  C  "C3'" . DT  J 6 2   ? -59.120 -47.678 83.809 1.00 106.23 ? -71  DT  J "C3'" 1 
ATOM   9083  O  "O3'" . DT  J 6 2   ? -60.555 -47.496 83.689 1.00 106.62 ? -71  DT  J "O3'" 1 
ATOM   9084  C  "C2'" . DT  J 6 2   ? -58.316 -46.617 83.062 1.00 106.16 ? -71  DT  J "C2'" 1 
ATOM   9085  C  "C1'" . DT  J 6 2   ? -57.787 -45.710 84.176 1.00 105.91 ? -71  DT  J "C1'" 1 
ATOM   9086  N  N1    . DT  J 6 2   ? -56.438 -45.108 83.873 1.00 105.77 ? -71  DT  J N1    1 
ATOM   9087  C  C2    . DT  J 6 2   ? -56.263 -43.730 83.958 1.00 105.65 ? -71  DT  J C2    1 
ATOM   9088  O  O2    . DT  J 6 2   ? -57.143 -42.948 84.284 1.00 105.73 ? -71  DT  J O2    1 
ATOM   9089  N  N3    . DT  J 6 2   ? -54.995 -43.292 83.648 1.00 105.10 ? -71  DT  J N3    1 
ATOM   9090  C  C4    . DT  J 6 2   ? -53.911 -44.064 83.266 1.00 104.99 ? -71  DT  J C4    1 
ATOM   9091  O  O4    . DT  J 6 2   ? -52.815 -43.574 83.012 1.00 104.58 ? -71  DT  J O4    1 
ATOM   9092  C  C5    . DT  J 6 2   ? -54.155 -45.488 83.194 1.00 105.37 ? -71  DT  J C5    1 
ATOM   9093  C  C7    . DT  J 6 2   ? -53.046 -46.419 82.790 1.00 105.54 ? -71  DT  J C7    1 
ATOM   9094  C  C6    . DT  J 6 2   ? -55.388 -45.932 83.495 1.00 105.68 ? -71  DT  J C6    1 
ATOM   9095  P  P     . DC  J 6 3   ? -61.428 -46.351 84.412 1.00 107.09 ? -70  DC  J P     1 
ATOM   9096  O  OP1   . DC  J 6 3   ? -61.111 -46.343 85.860 1.00 106.95 ? -70  DC  J OP1   1 
ATOM   9097  O  OP2   . DC  J 6 3   ? -62.835 -46.536 83.983 1.00 106.99 ? -70  DC  J OP2   1 
ATOM   9098  O  "O5'" . DC  J 6 3   ? -60.905 -44.991 83.750 1.00 106.43 ? -70  DC  J "O5'" 1 
ATOM   9099  C  "C5'" . DC  J 6 3   ? -61.268 -43.714 84.282 1.00 105.51 ? -70  DC  J "C5'" 1 
ATOM   9100  C  "C4'" . DC  J 6 3   ? -61.097 -42.611 83.244 1.00 105.03 ? -70  DC  J "C4'" 1 
ATOM   9101  O  "O4'" . DC  J 6 3   ? -59.703 -42.464 82.855 1.00 104.49 ? -70  DC  J "O4'" 1 
ATOM   9102  C  "C3'" . DC  J 6 3   ? -61.865 -42.798 81.935 1.00 104.70 ? -70  DC  J "C3'" 1 
ATOM   9103  O  "O3'" . DC  J 6 3   ? -62.365 -41.546 81.522 1.00 104.72 ? -70  DC  J "O3'" 1 
ATOM   9104  C  "C2'" . DC  J 6 3   ? -60.792 -43.253 80.957 1.00 104.36 ? -70  DC  J "C2'" 1 
ATOM   9105  C  "C1'" . DC  J 6 3   ? -59.652 -42.361 81.443 1.00 103.93 ? -70  DC  J "C1'" 1 
ATOM   9106  N  N1    . DC  J 6 3   ? -58.292 -42.732 80.942 1.00 103.09 ? -70  DC  J N1    1 
ATOM   9107  C  C2    . DC  J 6 3   ? -57.278 -41.754 80.896 1.00 102.32 ? -70  DC  J C2    1 
ATOM   9108  O  O2    . DC  J 6 3   ? -57.519 -40.601 81.277 1.00 101.39 ? -70  DC  J O2    1 
ATOM   9109  N  N3    . DC  J 6 3   ? -56.050 -42.111 80.436 1.00 102.10 ? -70  DC  J N3    1 
ATOM   9110  C  C4    . DC  J 6 3   ? -55.822 -43.368 80.033 1.00 102.44 ? -70  DC  J C4    1 
ATOM   9111  N  N4    . DC  J 6 3   ? -54.599 -43.673 79.588 1.00 102.35 ? -70  DC  J N4    1 
ATOM   9112  C  C5    . DC  J 6 3   ? -56.840 -44.376 80.069 1.00 102.95 ? -70  DC  J C5    1 
ATOM   9113  C  C6    . DC  J 6 3   ? -58.046 -44.015 80.525 1.00 102.99 ? -70  DC  J C6    1 
ATOM   9114  P  P     . DA  J 6 4   ? -63.941 -41.370 81.374 1.00 105.09 ? -69  DA  J P     1 
ATOM   9115  O  OP1   . DA  J 6 4   ? -64.500 -41.260 82.744 1.00 104.92 ? -69  DA  J OP1   1 
ATOM   9116  O  OP2   . DA  J 6 4   ? -64.417 -42.437 80.454 1.00 105.32 ? -69  DA  J OP2   1 
ATOM   9117  O  "O5'" . DA  J 6 4   ? -64.097 -39.962 80.620 1.00 103.29 ? -69  DA  J "O5'" 1 
ATOM   9118  C  "C5'" . DA  J 6 4   ? -63.477 -38.786 81.140 1.00 101.02 ? -69  DA  J "C5'" 1 
ATOM   9119  C  "C4'" . DA  J 6 4   ? -62.534 -38.155 80.122 1.00 99.19  ? -69  DA  J "C4'" 1 
ATOM   9120  O  "O4'" . DA  J 6 4   ? -61.340 -38.971 79.942 1.00 97.69  ? -69  DA  J "O4'" 1 
ATOM   9121  C  "C3'" . DA  J 6 4   ? -63.101 -37.935 78.717 1.00 98.66  ? -69  DA  J "C3'" 1 
ATOM   9122  O  "O3'" . DA  J 6 4   ? -62.759 -36.633 78.259 1.00 98.61  ? -69  DA  J "O3'" 1 
ATOM   9123  C  "C2'" . DA  J 6 4   ? -62.373 -38.987 77.889 1.00 97.68  ? -69  DA  J "C2'" 1 
ATOM   9124  C  "C1'" . DA  J 6 4   ? -61.011 -38.874 78.570 1.00 96.19  ? -69  DA  J "C1'" 1 
ATOM   9125  N  N9    . DA  J 6 4   ? -60.012 -39.873 78.187 1.00 93.74  ? -69  DA  J N9    1 
ATOM   9126  C  C8    . DA  J 6 4   ? -60.172 -41.227 78.094 1.00 93.00  ? -69  DA  J C8    1 
ATOM   9127  N  N7    . DA  J 6 4   ? -59.091 -41.866 77.721 1.00 92.02  ? -69  DA  J N7    1 
ATOM   9128  C  C5    . DA  J 6 4   ? -58.154 -40.860 77.549 1.00 91.40  ? -69  DA  J C5    1 
ATOM   9129  C  C6    . DA  J 6 4   ? -56.797 -40.873 77.154 1.00 90.09  ? -69  DA  J C6    1 
ATOM   9130  N  N6    . DA  J 6 4   ? -56.136 -41.993 76.854 1.00 89.04  ? -69  DA  J N6    1 
ATOM   9131  N  N1    . DA  J 6 4   ? -56.145 -39.691 77.083 1.00 89.48  ? -69  DA  J N1    1 
ATOM   9132  C  C2    . DA  J 6 4   ? -56.809 -38.567 77.382 1.00 90.06  ? -69  DA  J C2    1 
ATOM   9133  N  N3    . DA  J 6 4   ? -58.081 -38.428 77.763 1.00 91.13  ? -69  DA  J N3    1 
ATOM   9134  C  C4    . DA  J 6 4   ? -58.705 -39.623 77.830 1.00 92.16  ? -69  DA  J C4    1 
ATOM   9135  P  P     . DA  J 6 5   ? -63.831 -35.448 78.227 1.00 98.83  ? -68  DA  J P     1 
ATOM   9136  O  OP1   . DA  J 6 5   ? -63.873 -34.859 79.589 1.00 98.33  ? -68  DA  J OP1   1 
ATOM   9137  O  OP2   . DA  J 6 5   ? -65.078 -35.946 77.588 1.00 98.82  ? -68  DA  J OP2   1 
ATOM   9138  O  "O5'" . DA  J 6 5   ? -63.140 -34.419 77.208 1.00 97.70  ? -68  DA  J "O5'" 1 
ATOM   9139  C  "C5'" . DA  J 6 5   ? -61.967 -33.685 77.595 1.00 96.38  ? -68  DA  J "C5'" 1 
ATOM   9140  C  "C4'" . DA  J 6 5   ? -60.799 -33.835 76.620 1.00 94.85  ? -68  DA  J "C4'" 1 
ATOM   9141  O  "O4'" . DA  J 6 5   ? -60.321 -35.199 76.501 1.00 94.51  ? -68  DA  J "O4'" 1 
ATOM   9142  C  "C3'" . DA  J 6 5   ? -61.066 -33.364 75.195 1.00 93.77  ? -68  DA  J "C3'" 1 
ATOM   9143  O  "O3'" . DA  J 6 5   ? -60.283 -32.194 75.010 1.00 92.74  ? -68  DA  J "O3'" 1 
ATOM   9144  C  "C2'" . DA  J 6 5   ? -60.640 -34.531 74.296 1.00 93.15  ? -68  DA  J "C2'" 1 
ATOM   9145  C  "C1'" . DA  J 6 5   ? -59.743 -35.347 75.219 1.00 93.06  ? -68  DA  J "C1'" 1 
ATOM   9146  N  N9    . DA  J 6 5   ? -59.650 -36.786 74.960 1.00 92.27  ? -68  DA  J N9    1 
ATOM   9147  C  C8    . DA  J 6 5   ? -60.642 -37.720 75.113 1.00 92.35  ? -68  DA  J C8    1 
ATOM   9148  N  N7    . DA  J 6 5   ? -60.275 -38.949 74.825 1.00 91.88  ? -68  DA  J N7    1 
ATOM   9149  C  C5    . DA  J 6 5   ? -58.941 -38.817 74.462 1.00 90.95  ? -68  DA  J C5    1 
ATOM   9150  C  C6    . DA  J 6 5   ? -57.968 -39.754 74.044 1.00 90.40  ? -68  DA  J C6    1 
ATOM   9151  N  N6    . DA  J 6 5   ? -58.205 -41.063 73.925 1.00 89.81  ? -68  DA  J N6    1 
ATOM   9152  N  N1    . DA  J 6 5   ? -56.729 -39.292 73.753 1.00 90.22  ? -68  DA  J N1    1 
ATOM   9153  C  C2    . DA  J 6 5   ? -56.478 -37.979 73.872 1.00 90.28  ? -68  DA  J C2    1 
ATOM   9154  N  N3    . DA  J 6 5   ? -57.309 -37.005 74.256 1.00 90.82  ? -68  DA  J N3    1 
ATOM   9155  C  C4    . DA  J 6 5   ? -58.537 -37.491 74.541 1.00 91.38  ? -68  DA  J C4    1 
ATOM   9156  P  P     . DT  J 6 6   ? -60.599 -31.138 73.845 1.00 92.00  ? -67  DT  J P     1 
ATOM   9157  O  OP1   . DT  J 6 6   ? -60.085 -29.816 74.280 1.00 90.87  ? -67  DT  J OP1   1 
ATOM   9158  O  OP2   . DT  J 6 6   ? -62.013 -31.282 73.420 1.00 91.37  ? -67  DT  J OP2   1 
ATOM   9159  O  "O5'" . DT  J 6 6   ? -59.676 -31.709 72.664 1.00 91.01  ? -67  DT  J "O5'" 1 
ATOM   9160  C  "C5'" . DT  J 6 6   ? -58.282 -32.002 72.879 1.00 89.09  ? -67  DT  J "C5'" 1 
ATOM   9161  C  "C4'" . DT  J 6 6   ? -57.657 -32.780 71.723 1.00 87.47  ? -67  DT  J "C4'" 1 
ATOM   9162  O  "O4'" . DT  J 6 6   ? -57.823 -34.219 71.881 1.00 87.07  ? -67  DT  J "O4'" 1 
ATOM   9163  C  "C3'" . DT  J 6 6   ? -58.194 -32.466 70.329 1.00 86.52  ? -67  DT  J "C3'" 1 
ATOM   9164  O  "O3'" . DT  J 6 6   ? -57.111 -32.537 69.431 1.00 84.71  ? -67  DT  J "O3'" 1 
ATOM   9165  C  "C2'" . DT  J 6 6   ? -59.152 -33.629 70.078 1.00 86.86  ? -67  DT  J "C2'" 1 
ATOM   9166  C  "C1'" . DT  J 6 6   ? -58.290 -34.750 70.653 1.00 86.81  ? -67  DT  J "C1'" 1 
ATOM   9167  N  N1    . DT  J 6 6   ? -58.951 -36.100 70.847 1.00 86.42  ? -67  DT  J N1    1 
ATOM   9168  C  C2    . DT  J 6 6   ? -58.164 -37.238 70.746 1.00 86.19  ? -67  DT  J C2    1 
ATOM   9169  O  O2    . DT  J 6 6   ? -56.967 -37.219 70.517 1.00 85.81  ? -67  DT  J O2    1 
ATOM   9170  N  N3    . DT  J 6 6   ? -58.832 -38.425 70.931 1.00 86.30  ? -67  DT  J N3    1 
ATOM   9171  C  C4    . DT  J 6 6   ? -60.179 -38.594 71.203 1.00 86.58  ? -67  DT  J C4    1 
ATOM   9172  O  O4    . DT  J 6 6   ? -60.656 -39.716 71.348 1.00 86.58  ? -67  DT  J O4    1 
ATOM   9173  C  C5    . DT  J 6 6   ? -60.956 -37.368 71.294 1.00 86.69  ? -67  DT  J C5    1 
ATOM   9174  C  C7    . DT  J 6 6   ? -62.434 -37.402 71.579 1.00 86.95  ? -67  DT  J C7    1 
ATOM   9175  C  C6    . DT  J 6 6   ? -60.311 -36.200 71.113 1.00 86.44  ? -67  DT  J C6    1 
ATOM   9176  P  P     . DA  J 6 7   ? -56.814 -31.432 68.314 1.00 83.13  ? -66  DA  J P     1 
ATOM   9177  O  OP1   . DA  J 6 7   ? -56.325 -30.211 69.001 1.00 83.00  ? -66  DA  J OP1   1 
ATOM   9178  O  OP2   . DA  J 6 7   ? -57.941 -31.380 67.347 1.00 82.69  ? -66  DA  J OP2   1 
ATOM   9179  O  "O5'" . DA  J 6 7   ? -55.574 -32.117 67.581 1.00 80.41  ? -66  DA  J "O5'" 1 
ATOM   9180  C  "C5'" . DA  J 6 7   ? -54.510 -32.627 68.386 1.00 77.63  ? -66  DA  J "C5'" 1 
ATOM   9181  C  "C4'" . DA  J 6 7   ? -54.012 -33.977 67.899 1.00 76.16  ? -66  DA  J "C4'" 1 
ATOM   9182  O  "O4'" . DA  J 6 7   ? -54.955 -35.036 68.223 1.00 74.86  ? -66  DA  J "O4'" 1 
ATOM   9183  C  "C3'" . DA  J 6 7   ? -53.778 -34.042 66.395 1.00 76.05  ? -66  DA  J "C3'" 1 
ATOM   9184  O  "O3'" . DA  J 6 7   ? -52.439 -34.487 66.152 1.00 76.38  ? -66  DA  J "O3'" 1 
ATOM   9185  C  "C2'" . DA  J 6 7   ? -54.872 -34.990 65.886 1.00 75.06  ? -66  DA  J "C2'" 1 
ATOM   9186  C  "C1'" . DA  J 6 7   ? -55.155 -35.870 67.100 1.00 73.96  ? -66  DA  J "C1'" 1 
ATOM   9187  N  N9    . DA  J 6 7   ? -56.518 -36.409 67.167 1.00 72.91  ? -66  DA  J N9    1 
ATOM   9188  C  C8    . DA  J 6 7   ? -57.684 -35.695 67.286 1.00 72.38  ? -66  DA  J C8    1 
ATOM   9189  N  N7    . DA  J 6 7   ? -58.766 -36.437 67.327 1.00 72.15  ? -66  DA  J N7    1 
ATOM   9190  C  C5    . DA  J 6 7   ? -58.282 -37.733 67.233 1.00 72.04  ? -66  DA  J C5    1 
ATOM   9191  C  C6    . DA  J 6 7   ? -58.927 -38.992 67.226 1.00 71.66  ? -66  DA  J C6    1 
ATOM   9192  N  N6    . DA  J 6 7   ? -60.252 -39.137 67.317 1.00 71.96  ? -66  DA  J N6    1 
ATOM   9193  N  N1    . DA  J 6 7   ? -58.154 -40.099 67.120 1.00 71.39  ? -66  DA  J N1    1 
ATOM   9194  C  C2    . DA  J 6 7   ? -56.824 -39.948 67.024 1.00 71.58  ? -66  DA  J C2    1 
ATOM   9195  N  N3    . DA  J 6 7   ? -56.104 -38.820 67.023 1.00 71.18  ? -66  DA  J N3    1 
ATOM   9196  C  C4    . DA  J 6 7   ? -56.897 -37.736 67.132 1.00 71.99  ? -66  DA  J C4    1 
ATOM   9197  P  P     . DT  J 6 8   ? -51.844 -34.634 64.667 1.00 77.15  ? -65  DT  J P     1 
ATOM   9198  O  OP1   . DT  J 6 8   ? -50.382 -34.705 64.802 1.00 76.50  ? -65  DT  J OP1   1 
ATOM   9199  O  OP2   . DT  J 6 8   ? -52.487 -33.649 63.762 1.00 76.87  ? -65  DT  J OP2   1 
ATOM   9200  O  "O5'" . DT  J 6 8   ? -52.311 -36.099 64.240 1.00 78.40  ? -65  DT  J "O5'" 1 
ATOM   9201  C  "C5'" . DT  J 6 8   ? -51.886 -37.250 64.982 1.00 78.67  ? -65  DT  J "C5'" 1 
ATOM   9202  C  "C4'" . DT  J 6 8   ? -52.378 -38.523 64.315 1.00 79.28  ? -65  DT  J "C4'" 1 
ATOM   9203  O  "O4'" . DT  J 6 8   ? -53.783 -38.725 64.617 1.00 79.45  ? -65  DT  J "O4'" 1 
ATOM   9204  C  "C3'" . DT  J 6 8   ? -52.265 -38.551 62.792 1.00 79.84  ? -65  DT  J "C3'" 1 
ATOM   9205  O  "O3'" . DT  J 6 8   ? -51.682 -39.793 62.405 1.00 80.58  ? -65  DT  J "O3'" 1 
ATOM   9206  C  "C2'" . DT  J 6 8   ? -53.712 -38.394 62.316 1.00 79.48  ? -65  DT  J "C2'" 1 
ATOM   9207  C  "C1'" . DT  J 6 8   ? -54.474 -39.091 63.438 1.00 79.39  ? -65  DT  J "C1'" 1 
ATOM   9208  N  N1    . DT  J 6 8   ? -55.945 -38.753 63.587 1.00 79.33  ? -65  DT  J N1    1 
ATOM   9209  C  C2    . DT  J 6 8   ? -56.861 -39.787 63.732 1.00 79.21  ? -65  DT  J C2    1 
ATOM   9210  O  O2    . DT  J 6 8   ? -56.562 -40.970 63.746 1.00 78.99  ? -65  DT  J O2    1 
ATOM   9211  N  N3    . DT  J 6 8   ? -58.168 -39.389 63.866 1.00 78.96  ? -65  DT  J N3    1 
ATOM   9212  C  C4    . DT  J 6 8   ? -58.651 -38.091 63.872 1.00 79.42  ? -65  DT  J C4    1 
ATOM   9213  O  O4    . DT  J 6 8   ? -59.850 -37.848 63.999 1.00 80.25  ? -65  DT  J O4    1 
ATOM   9214  C  C5    . DT  J 6 8   ? -57.653 -37.055 63.718 1.00 79.37  ? -65  DT  J C5    1 
ATOM   9215  C  C7    . DT  J 6 8   ? -58.063 -35.608 63.711 1.00 79.25  ? -65  DT  J C7    1 
ATOM   9216  C  C6    . DT  J 6 8   ? -56.366 -37.429 63.585 1.00 79.26  ? -65  DT  J C6    1 
ATOM   9217  P  P     . DC  J 6 9   ? -51.017 -40.030 60.965 1.00 81.49  ? -64  DC  J P     1 
ATOM   9218  O  OP1   . DC  J 6 9   ? -49.601 -40.395 61.203 1.00 80.96  ? -64  DC  J OP1   1 
ATOM   9219  O  OP2   . DC  J 6 9   ? -51.387 -38.901 60.074 1.00 80.42  ? -64  DC  J OP2   1 
ATOM   9220  O  "O5'" . DC  J 6 9   ? -51.747 -41.342 60.404 1.00 81.50  ? -64  DC  J "O5'" 1 
ATOM   9221  C  "C5'" . DC  J 6 9   ? -51.970 -42.474 61.242 1.00 82.04  ? -64  DC  J "C5'" 1 
ATOM   9222  C  "C4'" . DC  J 6 9   ? -53.190 -43.246 60.771 1.00 82.50  ? -64  DC  J "C4'" 1 
ATOM   9223  O  "O4'" . DC  J 6 9   ? -54.426 -42.623 61.219 1.00 82.76  ? -64  DC  J "O4'" 1 
ATOM   9224  C  "C3'" . DC  J 6 9   ? -53.294 -43.386 59.261 1.00 82.88  ? -64  DC  J "C3'" 1 
ATOM   9225  O  "O3'" . DC  J 6 9   ? -53.177 -44.755 58.927 1.00 83.59  ? -64  DC  J "O3'" 1 
ATOM   9226  C  "C2'" . DC  J 6 9   ? -54.667 -42.830 58.887 1.00 82.92  ? -64  DC  J "C2'" 1 
ATOM   9227  C  "C1'" . DC  J 6 9   ? -55.412 -42.768 60.217 1.00 82.42  ? -64  DC  J "C1'" 1 
ATOM   9228  N  N1    . DC  J 6 9   ? -56.374 -41.623 60.332 1.00 82.10  ? -64  DC  J N1    1 
ATOM   9229  C  C2    . DC  J 6 9   ? -57.741 -41.872 60.528 1.00 82.29  ? -64  DC  J C2    1 
ATOM   9230  O  O2    . DC  J 6 9   ? -58.144 -43.041 60.600 1.00 83.50  ? -64  DC  J O2    1 
ATOM   9231  N  N3    . DC  J 6 9   ? -58.592 -40.820 60.636 1.00 81.83  ? -64  DC  J N3    1 
ATOM   9232  C  C4    . DC  J 6 9   ? -58.134 -39.567 60.556 1.00 81.82  ? -64  DC  J C4    1 
ATOM   9233  N  N4    . DC  J 6 9   ? -59.016 -38.567 60.664 1.00 81.60  ? -64  DC  J N4    1 
ATOM   9234  C  C5    . DC  J 6 9   ? -56.748 -39.290 60.354 1.00 81.96  ? -64  DC  J C5    1 
ATOM   9235  C  C6    . DC  J 6 9   ? -55.918 -40.337 60.250 1.00 81.85  ? -64  DC  J C6    1 
ATOM   9236  P  P     . DC  J 6 10  ? -52.821 -45.197 57.432 1.00 83.99  ? -63  DC  J P     1 
ATOM   9237  O  OP1   . DC  J 6 10  ? -51.949 -46.392 57.506 1.00 83.72  ? -63  DC  J OP1   1 
ATOM   9238  O  OP2   . DC  J 6 10  ? -52.367 -44.002 56.678 1.00 83.85  ? -63  DC  J OP2   1 
ATOM   9239  O  "O5'" . DC  J 6 10  ? -54.262 -45.624 56.873 1.00 83.70  ? -63  DC  J "O5'" 1 
ATOM   9240  C  "C5'" . DC  J 6 10  ? -55.072 -46.593 57.555 1.00 83.47  ? -63  DC  J "C5'" 1 
ATOM   9241  C  "C4'" . DC  J 6 10  ? -56.502 -46.569 57.029 1.00 83.72  ? -63  DC  J "C4'" 1 
ATOM   9242  O  "O4'" . DC  J 6 10  ? -57.228 -45.421 57.557 1.00 83.19  ? -63  DC  J "O4'" 1 
ATOM   9243  C  "C3'" . DC  J 6 10  ? -56.636 -46.505 55.503 1.00 83.73  ? -63  DC  J "C3'" 1 
ATOM   9244  O  "O3'" . DC  J 6 10  ? -57.660 -47.387 55.046 1.00 84.25  ? -63  DC  J "O3'" 1 
ATOM   9245  C  "C2'" . DC  J 6 10  ? -57.041 -45.058 55.254 1.00 83.25  ? -63  DC  J "C2'" 1 
ATOM   9246  C  "C1'" . DC  J 6 10  ? -57.909 -44.801 56.484 1.00 82.73  ? -63  DC  J "C1'" 1 
ATOM   9247  N  N1    . DC  J 6 10  ? -58.168 -43.351 56.778 1.00 82.38  ? -63  DC  J N1    1 
ATOM   9248  C  C2    . DC  J 6 10  ? -59.409 -42.981 57.325 1.00 82.26  ? -63  DC  J C2    1 
ATOM   9249  O  O2    . DC  J 6 10  ? -60.255 -43.856 57.561 1.00 83.02  ? -63  DC  J O2    1 
ATOM   9250  N  N3    . DC  J 6 10  ? -59.648 -41.668 57.584 1.00 81.48  ? -63  DC  J N3    1 
ATOM   9251  C  C4    . DC  J 6 10  ? -58.712 -40.754 57.319 1.00 80.91  ? -63  DC  J C4    1 
ATOM   9252  N  N4    . DC  J 6 10  ? -59.002 -39.482 57.593 1.00 80.31  ? -63  DC  J N4    1 
ATOM   9253  C  C5    . DC  J 6 10  ? -57.445 -41.102 56.757 1.00 81.34  ? -63  DC  J C5    1 
ATOM   9254  C  C6    . DC  J 6 10  ? -57.220 -42.399 56.504 1.00 81.63  ? -63  DC  J C6    1 
ATOM   9255  P  P     . DA  J 6 11  ? -57.392 -48.435 53.862 1.00 83.61  ? -62  DA  J P     1 
ATOM   9256  O  OP1   . DA  J 6 11  ? -56.711 -49.605 54.463 1.00 83.67  ? -62  DA  J OP1   1 
ATOM   9257  O  OP2   . DA  J 6 11  ? -56.787 -47.716 52.715 1.00 83.28  ? -62  DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  J 6 11  ? -58.870 -48.865 53.436 1.00 82.75  ? -62  DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  J 6 11  ? -59.915 -48.907 54.399 1.00 81.63  ? -62  DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  J 6 11  ? -61.206 -48.380 53.802 1.00 80.76  ? -62  DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  J 6 11  ? -61.432 -47.039 54.293 1.00 80.12  ? -62  DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  J 6 11  ? -61.269 -48.350 52.274 1.00 80.40  ? -62  DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  J 6 11  ? -62.397 -49.142 51.850 1.00 81.50  ? -62  DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  J 6 11  ? -61.357 -46.860 51.933 1.00 80.08  ? -62  DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  J 6 11  ? -61.825 -46.199 53.234 1.00 79.90  ? -62  DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  J 6 11  ? -61.243 -44.881 53.507 1.00 79.30  ? -62  DA  J N9    1 
ATOM   9267  C  C8    . DA  J 6 11  ? -59.926 -44.511 53.413 1.00 78.13  ? -62  DA  J C8    1 
ATOM   9268  N  N7    . DA  J 6 11  ? -59.700 -43.257 53.726 1.00 77.89  ? -62  DA  J N7    1 
ATOM   9269  C  C5    . DA  J 6 11  ? -60.954 -42.764 54.050 1.00 78.69  ? -62  DA  J C5    1 
ATOM   9270  C  C6    . DA  J 6 11  ? -61.407 -41.490 54.464 1.00 78.44  ? -62  DA  J C6    1 
ATOM   9271  N  N6    . DA  J 6 11  ? -60.597 -40.441 54.630 1.00 78.89  ? -62  DA  J N6    1 
ATOM   9272  N  N1    . DA  J 6 11  ? -62.729 -41.332 54.703 1.00 78.32  ? -62  DA  J N1    1 
ATOM   9273  C  C2    . DA  J 6 11  ? -63.544 -42.382 54.533 1.00 78.89  ? -62  DA  J C2    1 
ATOM   9274  N  N3    . DA  J 6 11  ? -63.236 -43.626 54.152 1.00 78.84  ? -62  DA  J N3    1 
ATOM   9275  C  C4    . DA  J 6 11  ? -61.917 -43.753 53.921 1.00 78.90  ? -62  DA  J C4    1 
ATOM   9276  P  P     . DC  J 6 12  ? -62.929 -49.249 50.333 1.00 82.26  ? -61  DC  J P     1 
ATOM   9277  O  OP1   . DC  J 6 12  ? -63.825 -50.422 50.242 1.00 82.31  ? -61  DC  J OP1   1 
ATOM   9278  O  OP2   . DC  J 6 12  ? -61.788 -49.148 49.396 1.00 81.28  ? -61  DC  J OP2   1 
ATOM   9279  O  "O5'" . DC  J 6 12  ? -63.842 -47.936 50.207 1.00 82.88  ? -61  DC  J "O5'" 1 
ATOM   9280  C  "C5'" . DC  J 6 12  ? -64.904 -47.695 51.132 1.00 83.64  ? -61  DC  J "C5'" 1 
ATOM   9281  C  "C4'" . DC  J 6 12  ? -65.648 -46.426 50.757 1.00 84.72  ? -61  DC  J "C4'" 1 
ATOM   9282  O  "O4'" . DC  J 6 12  ? -64.920 -45.267 51.250 1.00 85.42  ? -61  DC  J "O4'" 1 
ATOM   9283  C  "C3'" . DC  J 6 12  ? -65.844 -46.209 49.257 1.00 85.25  ? -61  DC  J "C3'" 1 
ATOM   9284  O  "O3'" . DC  J 6 12  ? -67.221 -45.909 49.004 1.00 86.40  ? -61  DC  J "O3'" 1 
ATOM   9285  C  "C2'" . DC  J 6 12  ? -64.903 -45.045 48.934 1.00 85.01  ? -61  DC  J "C2'" 1 
ATOM   9286  C  "C1'" . DC  J 6 12  ? -64.895 -44.269 50.249 1.00 84.76  ? -61  DC  J "C1'" 1 
ATOM   9287  N  N1    . DC  J 6 12  ? -63.698 -43.377 50.454 1.00 84.32  ? -61  DC  J N1    1 
ATOM   9288  C  C2    . DC  J 6 12  ? -63.860 -42.091 51.010 1.00 83.71  ? -61  DC  J C2    1 
ATOM   9289  O  O2    . DC  J 6 12  ? -64.989 -41.697 51.333 1.00 83.14  ? -61  DC  J O2    1 
ATOM   9290  N  N3    . DC  J 6 12  ? -62.756 -41.306 51.180 1.00 83.55  ? -61  DC  J N3    1 
ATOM   9291  C  C4    . DC  J 6 12  ? -61.545 -41.757 50.821 1.00 83.12  ? -61  DC  J C4    1 
ATOM   9292  N  N4    . DC  J 6 12  ? -60.491 -40.958 51.007 1.00 82.40  ? -61  DC  J N4    1 
ATOM   9293  C  C5    . DC  J 6 12  ? -61.359 -43.056 50.253 1.00 83.52  ? -61  DC  J C5    1 
ATOM   9294  C  C6    . DC  J 6 12  ? -62.448 -43.823 50.092 1.00 83.84  ? -61  DC  J C6    1 
ATOM   9295  P  P     . DC  J 6 13  ? -67.778 -45.506 47.555 1.00 87.20  ? -60  DC  J P     1 
ATOM   9296  O  OP1   . DC  J 6 13  ? -69.185 -45.968 47.513 1.00 87.25  ? -60  DC  J OP1   1 
ATOM   9297  O  OP2   . DC  J 6 13  ? -66.816 -45.963 46.525 1.00 86.16  ? -60  DC  J OP2   1 
ATOM   9298  O  "O5'" . DC  J 6 13  ? -67.767 -43.899 47.595 1.00 88.05  ? -60  DC  J "O5'" 1 
ATOM   9299  C  "C5'" . DC  J 6 13  ? -68.662 -43.172 48.455 1.00 89.24  ? -60  DC  J "C5'" 1 
ATOM   9300  C  "C4'" . DC  J 6 13  ? -68.706 -41.692 48.103 1.00 90.32  ? -60  DC  J "C4'" 1 
ATOM   9301  O  "O4'" . DC  J 6 13  ? -67.438 -41.076 48.455 1.00 90.06  ? -60  DC  J "O4'" 1 
ATOM   9302  C  "C3'" . DC  J 6 13  ? -68.947 -41.376 46.625 1.00 91.32  ? -60  DC  J "C3'" 1 
ATOM   9303  O  "O3'" . DC  J 6 13  ? -69.959 -40.375 46.459 1.00 93.20  ? -60  DC  J "O3'" 1 
ATOM   9304  C  "C2'" . DC  J 6 13  ? -67.591 -40.887 46.112 1.00 90.76  ? -60  DC  J "C2'" 1 
ATOM   9305  C  "C1'" . DC  J 6 13  ? -66.959 -40.304 47.371 1.00 90.08  ? -60  DC  J "C1'" 1 
ATOM   9306  N  N1    . DC  J 6 13  ? -65.455 -40.329 47.369 1.00 89.64  ? -60  DC  J N1    1 
ATOM   9307  C  C2    . DC  J 6 13  ? -64.728 -39.151 47.627 1.00 89.30  ? -60  DC  J C2    1 
ATOM   9308  O  O2    . DC  J 6 13  ? -65.332 -38.096 47.856 1.00 89.04  ? -60  DC  J O2    1 
ATOM   9309  N  N3    . DC  J 6 13  ? -63.367 -39.199 47.622 1.00 88.95  ? -60  DC  J N3    1 
ATOM   9310  C  C4    . DC  J 6 13  ? -62.737 -40.355 47.373 1.00 88.78  ? -60  DC  J C4    1 
ATOM   9311  N  N4    . DC  J 6 13  ? -61.399 -40.369 47.374 1.00 88.01  ? -60  DC  J N4    1 
ATOM   9312  C  C5    . DC  J 6 13  ? -63.459 -41.560 47.107 1.00 88.84  ? -60  DC  J C5    1 
ATOM   9313  C  C6    . DC  J 6 13  ? -64.796 -41.502 47.116 1.00 89.05  ? -60  DC  J C6    1 
ATOM   9314  P  P     . DT  J 6 14  ? -70.590 -40.101 45.002 1.00 94.74  ? -59  DT  J P     1 
ATOM   9315  O  OP1   . DT  J 6 14  ? -72.017 -39.723 45.184 1.00 94.72  ? -59  DT  J OP1   1 
ATOM   9316  O  OP2   . DT  J 6 14  ? -70.222 -41.230 44.105 1.00 93.80  ? -59  DT  J OP2   1 
ATOM   9317  O  "O5'" . DT  J 6 14  ? -69.792 -38.813 44.484 1.00 95.59  ? -59  DT  J "O5'" 1 
ATOM   9318  C  "C5'" . DT  J 6 14  ? -69.749 -37.605 45.243 1.00 97.20  ? -59  DT  J "C5'" 1 
ATOM   9319  C  "C4'" . DT  J 6 14  ? -68.759 -36.647 44.600 1.00 98.21  ? -59  DT  J "C4'" 1 
ATOM   9320  O  "O4'" . DT  J 6 14  ? -67.402 -37.079 44.882 1.00 97.79  ? -59  DT  J "O4'" 1 
ATOM   9321  C  "C3'" . DT  J 6 14  ? -68.858 -36.547 43.074 1.00 99.02  ? -59  DT  J "C3'" 1 
ATOM   9322  O  "O3'" . DT  J 6 14  ? -68.810 -35.186 42.689 1.00 100.55 ? -59  DT  J "O3'" 1 
ATOM   9323  C  "C2'" . DT  J 6 14  ? -67.626 -37.290 42.566 1.00 98.41  ? -59  DT  J "C2'" 1 
ATOM   9324  C  "C1'" . DT  J 6 14  ? -66.660 -36.918 43.689 1.00 97.74  ? -59  DT  J "C1'" 1 
ATOM   9325  N  N1    . DT  J 6 14  ? -65.411 -37.728 43.749 1.00 97.06  ? -59  DT  J N1    1 
ATOM   9326  C  C2    . DT  J 6 14  ? -64.217 -37.092 44.050 1.00 96.41  ? -59  DT  J C2    1 
ATOM   9327  O  O2    . DT  J 6 14  ? -64.116 -35.896 44.281 1.00 95.97  ? -59  DT  J O2    1 
ATOM   9328  N  N3    . DT  J 6 14  ? -63.126 -37.922 44.074 1.00 95.93  ? -59  DT  J N3    1 
ATOM   9329  C  C4    . DT  J 6 14  ? -63.112 -39.285 43.834 1.00 96.03  ? -59  DT  J C4    1 
ATOM   9330  O  O4    . DT  J 6 14  ? -62.068 -39.929 43.885 1.00 95.55  ? -59  DT  J O4    1 
ATOM   9331  C  C5    . DT  J 6 14  ? -64.393 -39.887 43.521 1.00 96.36  ? -59  DT  J C5    1 
ATOM   9332  C  C7    . DT  J 6 14  ? -64.517 -41.359 43.239 1.00 96.26  ? -59  DT  J C7    1 
ATOM   9333  C  C6    . DT  J 6 14  ? -65.467 -39.087 43.493 1.00 96.53  ? -59  DT  J C6    1 
ATOM   9334  P  P     . DG  J 6 15  ? -70.042 -34.571 41.862 1.00 101.78 ? -58  DG  J P     1 
ATOM   9335  O  OP1   . DG  J 6 15  ? -71.205 -34.475 42.798 1.00 101.50 ? -58  DG  J OP1   1 
ATOM   9336  O  OP2   . DG  J 6 15  ? -70.140 -35.340 40.584 1.00 101.52 ? -58  DG  J OP2   1 
ATOM   9337  O  "O5'" . DG  J 6 15  ? -69.533 -33.093 41.503 1.00 101.20 ? -58  DG  J "O5'" 1 
ATOM   9338  C  "C5'" . DG  J 6 15  ? -69.035 -32.215 42.520 1.00 100.39 ? -58  DG  J "C5'" 1 
ATOM   9339  C  "C4'" . DG  J 6 15  ? -67.884 -31.369 41.996 1.00 99.51  ? -58  DG  J "C4'" 1 
ATOM   9340  O  "O4'" . DG  J 6 15  ? -66.640 -32.112 42.033 1.00 98.70  ? -58  DG  J "O4'" 1 
ATOM   9341  C  "C3'" . DG  J 6 15  ? -68.078 -30.856 40.569 1.00 99.07  ? -58  DG  J "C3'" 1 
ATOM   9342  O  "O3'" . DG  J 6 15  ? -68.109 -29.411 40.619 1.00 98.85  ? -58  DG  J "O3'" 1 
ATOM   9343  C  "C2'" . DG  J 6 15  ? -66.974 -31.527 39.736 1.00 98.64  ? -58  DG  J "C2'" 1 
ATOM   9344  C  "C1'" . DG  J 6 15  ? -66.023 -32.154 40.761 1.00 98.54  ? -58  DG  J "C1'" 1 
ATOM   9345  N  N9    . DG  J 6 15  ? -65.663 -33.560 40.547 1.00 98.19  ? -58  DG  J N9    1 
ATOM   9346  C  C8    . DG  J 6 15  ? -66.459 -34.554 40.027 1.00 98.20  ? -58  DG  J C8    1 
ATOM   9347  N  N7    . DG  J 6 15  ? -65.874 -35.719 39.972 1.00 97.89  ? -58  DG  J N7    1 
ATOM   9348  C  C5    . DG  J 6 15  ? -64.610 -35.493 40.495 1.00 97.46  ? -58  DG  J C5    1 
ATOM   9349  C  C6    . DG  J 6 15  ? -63.527 -36.389 40.690 1.00 97.33  ? -58  DG  J C6    1 
ATOM   9350  O  O6    . DG  J 6 15  ? -63.479 -37.598 40.428 1.00 96.86  ? -58  DG  J O6    1 
ATOM   9351  N  N1    . DG  J 6 15  ? -62.413 -35.764 41.252 1.00 97.20  ? -58  DG  J N1    1 
ATOM   9352  C  C2    . DG  J 6 15  ? -62.358 -34.430 41.586 1.00 97.18  ? -58  DG  J C2    1 
ATOM   9353  N  N2    . DG  J 6 15  ? -61.207 -34.000 42.118 1.00 96.49  ? -58  DG  J N2    1 
ATOM   9354  N  N3    . DG  J 6 15  ? -63.366 -33.579 41.409 1.00 97.64  ? -58  DG  J N3    1 
ATOM   9355  C  C4    . DG  J 6 15  ? -64.462 -34.171 40.859 1.00 97.80  ? -58  DG  J C4    1 
ATOM   9356  P  P     . DC  J 6 16  ? -67.018 -28.410 40.010 1.00 98.23  ? -57  DC  J P     1 
ATOM   9357  O  OP1   . DC  J 6 16  ? -67.367 -27.060 40.512 1.00 98.18  ? -57  DC  J OP1   1 
ATOM   9358  O  OP2   . DC  J 6 16  ? -66.936 -28.662 38.550 1.00 98.07  ? -57  DC  J OP2   1 
ATOM   9359  O  "O5'" . DC  J 6 16  ? -65.635 -28.864 40.686 1.00 97.61  ? -57  DC  J "O5'" 1 
ATOM   9360  C  "C5'" . DC  J 6 16  ? -64.505 -27.988 40.715 1.00 96.09  ? -57  DC  J "C5'" 1 
ATOM   9361  C  "C4'" . DC  J 6 16  ? -63.411 -28.428 39.755 1.00 95.16  ? -57  DC  J "C4'" 1 
ATOM   9362  O  "O4'" . DC  J 6 16  ? -63.417 -29.863 39.538 1.00 94.31  ? -57  DC  J "O4'" 1 
ATOM   9363  C  "C3'" . DC  J 6 16  ? -63.469 -27.795 38.364 1.00 94.77  ? -57  DC  J "C3'" 1 
ATOM   9364  O  "O3'" . DC  J 6 16  ? -62.231 -27.174 38.090 1.00 94.75  ? -57  DC  J "O3'" 1 
ATOM   9365  C  "C2'" . DC  J 6 16  ? -63.665 -28.974 37.422 1.00 94.12  ? -57  DC  J "C2'" 1 
ATOM   9366  C  "C1'" . DC  J 6 16  ? -62.955 -30.056 38.221 1.00 93.65  ? -57  DC  J "C1'" 1 
ATOM   9367  N  N1    . DC  J 6 16  ? -63.223 -31.463 37.805 1.00 93.51  ? -57  DC  J N1    1 
ATOM   9368  C  C2    . DC  J 6 16  ? -62.295 -32.456 38.164 1.00 93.09  ? -57  DC  J C2    1 
ATOM   9369  O  O2    . DC  J 6 16  ? -61.286 -32.148 38.809 1.00 93.52  ? -57  DC  J O2    1 
ATOM   9370  N  N3    . DC  J 6 16  ? -62.525 -33.739 37.789 1.00 92.72  ? -57  DC  J N3    1 
ATOM   9371  C  C4    . DC  J 6 16  ? -63.626 -34.043 37.092 1.00 92.67  ? -57  DC  J C4    1 
ATOM   9372  N  N4    . DC  J 6 16  ? -63.800 -35.322 36.753 1.00 92.43  ? -57  DC  J N4    1 
ATOM   9373  C  C5    . DC  J 6 16  ? -64.590 -33.053 36.714 1.00 92.79  ? -57  DC  J C5    1 
ATOM   9374  C  C6    . DC  J 6 16  ? -64.350 -31.788 37.089 1.00 93.34  ? -57  DC  J C6    1 
ATOM   9375  P  P     . DA  J 6 17  ? -62.029 -25.613 38.341 1.00 95.06  ? -56  DA  J P     1 
ATOM   9376  O  OP1   . DA  J 6 17  ? -62.772 -25.201 39.559 1.00 94.97  ? -56  DA  J OP1   1 
ATOM   9377  O  OP2   . DA  J 6 17  ? -62.286 -24.932 37.053 1.00 95.38  ? -56  DA  J OP2   1 
ATOM   9378  O  "O5'" . DA  J 6 17  ? -60.460 -25.538 38.634 1.00 95.68  ? -56  DA  J "O5'" 1 
ATOM   9379  C  "C5'" . DA  J 6 17  ? -59.900 -26.165 39.795 1.00 96.34  ? -56  DA  J "C5'" 1 
ATOM   9380  C  "C4'" . DA  J 6 17  ? -58.645 -26.967 39.465 1.00 96.57  ? -56  DA  J "C4'" 1 
ATOM   9381  O  "O4'" . DA  J 6 17  ? -58.994 -28.200 38.786 1.00 96.41  ? -56  DA  J "O4'" 1 
ATOM   9382  C  "C3'" . DA  J 6 17  ? -57.613 -26.283 38.572 1.00 96.89  ? -56  DA  J "C3'" 1 
ATOM   9383  O  "O3'" . DA  J 6 17  ? -56.311 -26.701 38.989 1.00 97.88  ? -56  DA  J "O3'" 1 
ATOM   9384  C  "C2'" . DA  J 6 17  ? -57.967 -26.795 37.177 1.00 96.46  ? -56  DA  J "C2'" 1 
ATOM   9385  C  "C1'" . DA  J 6 17  ? -58.435 -28.217 37.482 1.00 96.16  ? -56  DA  J "C1'" 1 
ATOM   9386  N  N9    . DA  J 6 17  ? -59.461 -28.750 36.588 1.00 95.88  ? -56  DA  J N9    1 
ATOM   9387  C  C8    . DA  J 6 17  ? -60.409 -28.062 35.876 1.00 95.85  ? -56  DA  J C8    1 
ATOM   9388  N  N7    . DA  J 6 17  ? -61.196 -28.830 35.161 1.00 95.97  ? -56  DA  J N7    1 
ATOM   9389  C  C5    . DA  J 6 17  ? -60.738 -30.111 35.426 1.00 95.84  ? -56  DA  J C5    1 
ATOM   9390  C  C6    . DA  J 6 17  ? -61.145 -31.392 34.983 1.00 95.62  ? -56  DA  J C6    1 
ATOM   9391  N  N6    . DA  J 6 17  ? -62.158 -31.595 34.134 1.00 95.30  ? -56  DA  J N6    1 
ATOM   9392  N  N1    . DA  J 6 17  ? -60.460 -32.466 35.442 1.00 95.45  ? -56  DA  J N1    1 
ATOM   9393  C  C2    . DA  J 6 17  ? -59.439 -32.281 36.291 1.00 95.35  ? -56  DA  J C2    1 
ATOM   9394  N  N3    . DA  J 6 17  ? -58.972 -31.132 36.780 1.00 95.75  ? -56  DA  J N3    1 
ATOM   9395  C  C4    . DA  J 6 17  ? -59.667 -30.078 36.305 1.00 95.84  ? -56  DA  J C4    1 
ATOM   9396  P  P     . DG  J 6 18  ? -54.952 -26.046 38.437 1.00 98.81  ? -55  DG  J P     1 
ATOM   9397  O  OP1   . DG  J 6 18  ? -54.080 -25.834 39.612 1.00 98.39  ? -55  DG  J OP1   1 
ATOM   9398  O  OP2   . DG  J 6 18  ? -55.261 -24.913 37.524 1.00 98.62  ? -55  DG  J OP2   1 
ATOM   9399  O  "O5'" . DG  J 6 18  ? -54.336 -27.230 37.557 1.00 98.49  ? -55  DG  J "O5'" 1 
ATOM   9400  C  "C5'" . DG  J 6 18  ? -54.099 -28.499 38.149 1.00 99.43  ? -55  DG  J "C5'" 1 
ATOM   9401  C  "C4'" . DG  J 6 18  ? -54.114 -29.583 37.084 1.00 100.33 ? -55  DG  J "C4'" 1 
ATOM   9402  O  "O4'" . DG  J 6 18  ? -55.430 -29.647 36.470 1.00 100.98 ? -55  DG  J "O4'" 1 
ATOM   9403  C  "C3'" . DG  J 6 18  ? -53.124 -29.374 35.936 1.00 100.96 ? -55  DG  J "C3'" 1 
ATOM   9404  O  "O3'" . DG  J 6 18  ? -52.469 -30.596 35.651 1.00 101.99 ? -55  DG  J "O3'" 1 
ATOM   9405  C  "C2'" . DG  J 6 18  ? -54.014 -28.981 34.760 1.00 101.07 ? -55  DG  J "C2'" 1 
ATOM   9406  C  "C1'" . DG  J 6 18  ? -55.234 -29.839 35.084 1.00 100.90 ? -55  DG  J "C1'" 1 
ATOM   9407  N  N9    . DG  J 6 18  ? -56.450 -29.510 34.346 1.00 100.48 ? -55  DG  J N9    1 
ATOM   9408  C  C8    . DG  J 6 18  ? -56.984 -28.271 34.083 1.00 100.54 ? -55  DG  J C8    1 
ATOM   9409  N  N7    . DG  J 6 18  ? -58.090 -28.321 33.392 1.00 100.73 ? -55  DG  J N7    1 
ATOM   9410  C  C5    . DG  J 6 18  ? -58.299 -29.678 33.184 1.00 100.40 ? -55  DG  J C5    1 
ATOM   9411  C  C6    . DG  J 6 18  ? -59.339 -30.354 32.499 1.00 100.31 ? -55  DG  J C6    1 
ATOM   9412  O  O6    . DG  J 6 18  ? -60.316 -29.852 31.925 1.00 100.74 ? -55  DG  J O6    1 
ATOM   9413  N  N1    . DG  J 6 18  ? -59.171 -31.743 32.526 1.00 99.89  ? -55  DG  J N1    1 
ATOM   9414  C  C2    . DG  J 6 18  ? -58.121 -32.392 33.144 1.00 99.60  ? -55  DG  J C2    1 
ATOM   9415  N  N2    . DG  J 6 18  ? -58.100 -33.728 33.083 1.00 98.78  ? -55  DG  J N2    1 
ATOM   9416  N  N3    . DG  J 6 18  ? -57.144 -31.769 33.788 1.00 99.86  ? -55  DG  J N3    1 
ATOM   9417  C  C4    . DG  J 6 18  ? -57.297 -30.421 33.768 1.00 100.30 ? -55  DG  J C4    1 
ATOM   9418  P  P     . DA  J 6 19  ? -50.912 -30.595 35.293 1.00 102.83 ? -54  DA  J P     1 
ATOM   9419  O  OP1   . DA  J 6 19  ? -50.200 -30.839 36.562 1.00 102.64 ? -54  DA  J OP1   1 
ATOM   9420  O  OP2   . DA  J 6 19  ? -50.610 -29.383 34.498 1.00 102.77 ? -54  DA  J OP2   1 
ATOM   9421  O  "O5'" . DA  J 6 19  ? -50.739 -31.851 34.314 1.00 103.46 ? -54  DA  J "O5'" 1 
ATOM   9422  C  "C5'" . DA  J 6 19  ? -51.110 -33.154 34.734 1.00 104.85 ? -54  DA  J "C5'" 1 
ATOM   9423  C  "C4'" . DA  J 6 19  ? -52.067 -33.831 33.766 1.00 106.13 ? -54  DA  J "C4'" 1 
ATOM   9424  O  "O4'" . DA  J 6 19  ? -53.206 -32.988 33.472 1.00 106.04 ? -54  DA  J "O4'" 1 
ATOM   9425  C  "C3'" . DA  J 6 19  ? -51.465 -34.209 32.417 1.00 107.31 ? -54  DA  J "C3'" 1 
ATOM   9426  O  "O3'" . DA  J 6 19  ? -51.372 -35.621 32.349 1.00 110.12 ? -54  DA  J "O3'" 1 
ATOM   9427  C  "C2'" . DA  J 6 19  ? -52.447 -33.658 31.380 1.00 106.80 ? -54  DA  J "C2'" 1 
ATOM   9428  C  "C1'" . DA  J 6 19  ? -53.693 -33.374 32.209 1.00 105.93 ? -54  DA  J "C1'" 1 
ATOM   9429  N  N9    . DA  J 6 19  ? -54.521 -32.297 31.675 1.00 105.28 ? -54  DA  J N9    1 
ATOM   9430  C  C8    . DA  J 6 19  ? -54.327 -30.956 31.849 1.00 105.03 ? -54  DA  J C8    1 
ATOM   9431  N  N7    . DA  J 6 19  ? -55.225 -30.208 31.259 1.00 105.17 ? -54  DA  J N7    1 
ATOM   9432  C  C5    . DA  J 6 19  ? -56.068 -31.123 30.650 1.00 105.15 ? -54  DA  J C5    1 
ATOM   9433  C  C6    . DA  J 6 19  ? -57.227 -30.969 29.862 1.00 105.00 ? -54  DA  J C6    1 
ATOM   9434  N  N6    . DA  J 6 19  ? -57.738 -29.776 29.549 1.00 105.20 ? -54  DA  J N6    1 
ATOM   9435  N  N1    . DA  J 6 19  ? -57.839 -32.085 29.407 1.00 105.07 ? -54  DA  J N1    1 
ATOM   9436  C  C2    . DA  J 6 19  ? -57.319 -33.278 29.724 1.00 104.86 ? -54  DA  J C2    1 
ATOM   9437  N  N3    . DA  J 6 19  ? -56.238 -33.548 30.456 1.00 104.77 ? -54  DA  J N3    1 
ATOM   9438  C  C4    . DA  J 6 19  ? -55.649 -32.419 30.894 1.00 105.05 ? -54  DA  J C4    1 
ATOM   9439  P  P     . DT  J 6 20  ? -50.362 -36.354 31.335 1.00 112.55 ? -53  DT  J P     1 
ATOM   9440  O  OP1   . DT  J 6 20  ? -50.081 -37.704 31.873 1.00 112.71 ? -53  DT  J OP1   1 
ATOM   9441  O  OP2   . DT  J 6 20  ? -49.214 -35.454 31.086 1.00 111.85 ? -53  DT  J OP2   1 
ATOM   9442  O  "O5'" . DT  J 6 20  ? -51.299 -36.530 29.979 1.00 114.96 ? -53  DT  J "O5'" 1 
ATOM   9443  C  "C5'" . DT  J 6 20  ? -52.446 -37.303 30.021 1.00 118.43 ? -53  DT  J "C5'" 1 
ATOM   9444  C  "C4'" . DT  J 6 20  ? -53.366 -37.109 28.788 1.00 121.33 ? -53  DT  J "C4'" 1 
ATOM   9445  O  "O4'" . DT  J 6 20  ? -54.043 -35.813 28.795 1.00 122.09 ? -53  DT  J "O4'" 1 
ATOM   9446  C  "C3'" . DT  J 6 20  ? -52.638 -37.221 27.440 1.00 123.18 ? -53  DT  J "C3'" 1 
ATOM   9447  O  "O3'" . DT  J 6 20  ? -53.291 -38.208 26.642 1.00 125.83 ? -53  DT  J "O3'" 1 
ATOM   9448  C  "C2'" . DT  J 6 20  ? -52.763 -35.821 26.843 1.00 123.06 ? -53  DT  J "C2'" 1 
ATOM   9449  C  "C1'" . DT  J 6 20  ? -54.110 -35.429 27.441 1.00 122.74 ? -53  DT  J "C1'" 1 
ATOM   9450  N  N1    . DT  J 6 20  ? -54.507 -33.976 27.327 1.00 123.05 ? -53  DT  J N1    1 
ATOM   9451  C  C2    . DT  J 6 20  ? -55.710 -33.643 26.707 1.00 123.62 ? -53  DT  J C2    1 
ATOM   9452  O  O2    . DT  J 6 20  ? -56.496 -34.459 26.235 1.00 123.93 ? -53  DT  J O2    1 
ATOM   9453  N  N3    . DT  J 6 20  ? -55.979 -32.290 26.660 1.00 123.71 ? -53  DT  J N3    1 
ATOM   9454  C  C4    . DT  J 6 20  ? -55.188 -31.261 27.153 1.00 123.59 ? -53  DT  J C4    1 
ATOM   9455  O  O4    . DT  J 6 20  ? -55.535 -30.083 27.050 1.00 123.83 ? -53  DT  J O4    1 
ATOM   9456  C  C5    . DT  J 6 20  ? -53.947 -31.676 27.787 1.00 123.29 ? -53  DT  J C5    1 
ATOM   9457  C  C7    . DT  J 6 20  ? -52.996 -30.662 28.366 1.00 123.05 ? -53  DT  J C7    1 
ATOM   9458  C  C6    . DT  J 6 20  ? -53.672 -32.992 27.843 1.00 123.11 ? -53  DT  J C6    1 
ATOM   9459  P  P     . DA  J 6 21  ? -52.487 -39.500 26.084 1.00 127.69 ? -52  DA  J P     1 
ATOM   9460  O  OP1   . DA  J 6 21  ? -52.789 -40.655 27.013 1.00 127.49 ? -52  DA  J OP1   1 
ATOM   9461  O  OP2   . DA  J 6 21  ? -51.177 -39.095 25.802 1.00 127.44 ? -52  DA  J OP2   1 
ATOM   9462  O  "O5'" . DA  J 6 21  ? -53.320 -39.727 24.660 1.00 130.18 ? -52  DA  J "O5'" 1 
ATOM   9463  C  "C5'" . DA  J 6 21  ? -54.755 -39.928 24.594 1.00 133.68 ? -52  DA  J "C5'" 1 
ATOM   9464  C  "C4'" . DA  J 6 21  ? -55.490 -39.014 23.556 1.00 136.07 ? -52  DA  J "C4'" 1 
ATOM   9465  O  "O4'" . DA  J 6 21  ? -55.603 -37.625 23.996 1.00 136.56 ? -52  DA  J "O4'" 1 
ATOM   9466  C  "C3'" . DA  J 6 21  ? -54.830 -39.046 22.161 1.00 137.57 ? -52  DA  J "C3'" 1 
ATOM   9467  O  "O3'" . DA  J 6 21  ? -55.782 -39.562 21.245 1.00 139.89 ? -52  DA  J "O3'" 1 
ATOM   9468  C  "C2'" . DA  J 6 21  ? -54.403 -37.587 21.919 1.00 137.50 ? -52  DA  J "C2'" 1 
ATOM   9469  C  "C1'" . DA  J 6 21  ? -55.480 -36.850 22.814 1.00 137.27 ? -52  DA  J "C1'" 1 
ATOM   9470  N  N9    . DA  J 6 21  ? -55.115 -35.458 23.120 1.00 137.54 ? -52  DA  J N9    1 
ATOM   9471  C  C8    . DA  J 6 21  ? -53.984 -34.993 23.736 1.00 137.49 ? -52  DA  J C8    1 
ATOM   9472  N  N7    . DA  J 6 21  ? -53.910 -33.688 23.882 1.00 137.58 ? -52  DA  J N7    1 
ATOM   9473  C  C5    . DA  J 6 21  ? -55.076 -33.259 23.318 1.00 137.88 ? -52  DA  J C5    1 
ATOM   9474  C  C6    . DA  J 6 21  ? -55.604 -31.975 23.152 1.00 138.06 ? -52  DA  J C6    1 
ATOM   9475  N  N6    . DA  J 6 21  ? -55.005 -30.848 23.561 1.00 138.11 ? -52  DA  J N6    1 
ATOM   9476  N  N1    . DA  J 6 21  ? -56.798 -31.893 22.546 1.00 138.24 ? -52  DA  J N1    1 
ATOM   9477  C  C2    . DA  J 6 21  ? -57.418 -33.022 22.129 1.00 138.22 ? -52  DA  J C2    1 
ATOM   9478  N  N3    . DA  J 6 21  ? -57.023 -34.282 22.235 1.00 138.24 ? -52  DA  J N3    1 
ATOM   9479  C  C4    . DA  J 6 21  ? -55.833 -34.337 22.843 1.00 137.95 ? -52  DA  J C4    1 
ATOM   9480  P  P     . DC  J 6 22  ? -55.699 -39.328 19.655 1.00 141.88 ? -51  DC  J P     1 
ATOM   9481  O  OP1   . DC  J 6 22  ? -56.423 -40.431 19.050 1.00 142.04 ? -51  DC  J OP1   1 
ATOM   9482  O  OP2   . DC  J 6 22  ? -54.281 -39.108 19.198 1.00 141.69 ? -51  DC  J OP2   1 
ATOM   9483  O  "O5'" . DC  J 6 22  ? -56.550 -37.943 19.522 1.00 143.82 ? -51  DC  J "O5'" 1 
ATOM   9484  C  "C5'" . DC  J 6 22  ? -57.735 -37.882 18.882 1.00 146.69 ? -51  DC  J "C5'" 1 
ATOM   9485  C  "C4'" . DC  J 6 22  ? -57.717 -36.752 17.849 1.00 148.79 ? -51  DC  J "C4'" 1 
ATOM   9486  O  "O4'" . DC  J 6 22  ? -57.193 -35.530 18.444 1.00 149.18 ? -51  DC  J "O4'" 1 
ATOM   9487  C  "C3'" . DC  J 6 22  ? -56.893 -36.993 16.581 1.00 150.05 ? -51  DC  J "C3'" 1 
ATOM   9488  O  "O3'" . DC  J 6 22  ? -57.616 -36.510 15.444 1.00 152.01 ? -51  DC  J "O3'" 1 
ATOM   9489  C  "C2'" . DC  J 6 22  ? -55.618 -36.193 16.851 1.00 149.83 ? -51  DC  J "C2'" 1 
ATOM   9490  C  "C1'" . DC  J 6 22  ? -56.195 -34.988 17.598 1.00 149.56 ? -51  DC  J "C1'" 1 
ATOM   9491  N  N1    . DC  J 6 22  ? -55.226 -34.170 18.422 1.00 149.66 ? -51  DC  J N1    1 
ATOM   9492  C  C2    . DC  J 6 22  ? -55.543 -32.836 18.763 1.00 149.75 ? -51  DC  J C2    1 
ATOM   9493  O  O2    . DC  J 6 22  ? -56.615 -32.334 18.390 1.00 150.02 ? -51  DC  J O2    1 
ATOM   9494  N  N3    . DC  J 6 22  ? -54.707 -32.113 19.506 1.00 149.61 ? -51  DC  J N3    1 
ATOM   9495  C  C4    . DC  J 6 22  ? -53.560 -32.668 19.903 1.00 149.56 ? -51  DC  J C4    1 
ATOM   9496  N  N4    . DC  J 6 22  ? -52.798 -31.916 20.632 1.00 149.42 ? -51  DC  J N4    1 
ATOM   9497  C  C5    . DC  J 6 22  ? -53.159 -34.017 19.571 1.00 149.58 ? -51  DC  J C5    1 
ATOM   9498  C  C6    . DC  J 6 22  ? -54.038 -34.721 18.839 1.00 149.61 ? -51  DC  J C6    1 
ATOM   9499  P  P     . DT  J 6 23  ? -57.169 -36.892 13.946 1.00 153.76 ? -50  DT  J P     1 
ATOM   9500  O  OP1   . DT  J 6 23  ? -57.262 -38.366 13.816 1.00 153.75 ? -50  DT  J OP1   1 
ATOM   9501  O  OP2   . DT  J 6 23  ? -55.882 -36.205 13.666 1.00 153.62 ? -50  DT  J OP2   1 
ATOM   9502  O  "O5'" . DT  J 6 23  ? -58.298 -36.220 13.018 1.00 154.50 ? -50  DT  J "O5'" 1 
ATOM   9503  C  "C5'" . DT  J 6 23  ? -59.037 -35.056 13.431 1.00 155.64 ? -50  DT  J "C5'" 1 
ATOM   9504  C  "C4'" . DT  J 6 23  ? -58.282 -33.743 13.222 1.00 156.53 ? -50  DT  J "C4'" 1 
ATOM   9505  O  "O4'" . DT  J 6 23  ? -57.325 -33.527 14.290 1.00 156.56 ? -50  DT  J "O4'" 1 
ATOM   9506  C  "C3'" . DT  J 6 23  ? -57.448 -33.584 11.946 1.00 157.16 ? -50  DT  J "C3'" 1 
ATOM   9507  O  "O3'" . DT  J 6 23  ? -58.281 -33.153 10.849 1.00 158.07 ? -50  DT  J "O3'" 1 
ATOM   9508  C  "C2'" . DT  J 6 23  ? -56.372 -32.552 12.359 1.00 156.97 ? -50  DT  J "C2'" 1 
ATOM   9509  C  "C1'" . DT  J 6 23  ? -56.535 -32.422 13.879 1.00 156.64 ? -50  DT  J "C1'" 1 
ATOM   9510  N  N1    . DT  J 6 23  ? -55.230 -32.374 14.622 1.00 156.38 ? -50  DT  J N1    1 
ATOM   9511  C  C2    . DT  J 6 23  ? -54.876 -31.208 15.287 1.00 156.28 ? -50  DT  J C2    1 
ATOM   9512  O  O2    . DT  J 6 23  ? -55.568 -30.202 15.313 1.00 156.28 ? -50  DT  J O2    1 
ATOM   9513  N  N3    . DT  J 6 23  ? -53.663 -31.259 15.934 1.00 156.19 ? -50  DT  J N3    1 
ATOM   9514  C  C4    . DT  J 6 23  ? -52.788 -32.332 15.986 1.00 156.11 ? -50  DT  J C4    1 
ATOM   9515  O  O4    . DT  J 6 23  ? -51.723 -32.261 16.597 1.00 155.89 ? -50  DT  J O4    1 
ATOM   9516  C  C5    . DT  J 6 23  ? -53.214 -33.518 15.267 1.00 156.20 ? -50  DT  J C5    1 
ATOM   9517  C  C7    . DT  J 6 23  ? -52.360 -34.755 15.239 1.00 156.24 ? -50  DT  J C7    1 
ATOM   9518  C  C6    . DT  J 6 23  ? -54.396 -33.481 14.630 1.00 156.31 ? -50  DT  J C6    1 
ATOM   9519  P  P     . DA  J 6 24  ? -57.754 -32.280 9.601  1.00 158.77 ? -49  DA  J P     1 
ATOM   9520  O  OP1   . DA  J 6 24  ? -58.848 -32.227 8.594  1.00 158.78 ? -49  DA  J OP1   1 
ATOM   9521  O  OP2   . DA  J 6 24  ? -56.413 -32.773 9.191  1.00 158.72 ? -49  DA  J OP2   1 
ATOM   9522  O  "O5'" . DA  J 6 24  ? -57.565 -30.827 10.263 1.00 158.77 ? -49  DA  J "O5'" 1 
ATOM   9523  C  "C5'" . DA  J 6 24  ? -58.135 -29.639 9.689  1.00 158.76 ? -49  DA  J "C5'" 1 
ATOM   9524  C  "C4'" . DA  J 6 24  ? -57.045 -28.594 9.540  1.00 158.68 ? -49  DA  J "C4'" 1 
ATOM   9525  O  "O4'" . DA  J 6 24  ? -56.096 -28.730 10.635 1.00 158.72 ? -49  DA  J "O4'" 1 
ATOM   9526  C  "C3'" . DA  J 6 24  ? -56.241 -28.707 8.244  1.00 158.64 ? -49  DA  J "C3'" 1 
ATOM   9527  O  "O3'" . DA  J 6 24  ? -56.091 -27.393 7.654  1.00 158.19 ? -49  DA  J "O3'" 1 
ATOM   9528  C  "C2'" . DA  J 6 24  ? -54.942 -29.378 8.705  1.00 158.73 ? -49  DA  J "C2'" 1 
ATOM   9529  C  "C1'" . DA  J 6 24  ? -54.788 -28.795 10.105 1.00 158.87 ? -49  DA  J "C1'" 1 
ATOM   9530  N  N9    . DA  J 6 24  ? -53.894 -29.545 10.986 1.00 159.17 ? -49  DA  J N9    1 
ATOM   9531  C  C8    . DA  J 6 24  ? -53.627 -30.901 10.967 1.00 159.28 ? -49  DA  J C8    1 
ATOM   9532  N  N7    . DA  J 6 24  ? -52.770 -31.284 11.886 1.00 159.42 ? -49  DA  J N7    1 
ATOM   9533  C  C5    . DA  J 6 24  ? -52.448 -30.100 12.554 1.00 159.37 ? -49  DA  J C5    1 
ATOM   9534  C  C6    . DA  J 6 24  ? -51.588 -29.815 13.643 1.00 159.39 ? -49  DA  J C6    1 
ATOM   9535  N  N6    . DA  J 6 24  ? -50.860 -30.746 14.272 1.00 159.31 ? -49  DA  J N6    1 
ATOM   9536  N  N1    . DA  J 6 24  ? -51.501 -28.529 14.063 1.00 159.44 ? -49  DA  J N1    1 
ATOM   9537  C  C2    . DA  J 6 24  ? -52.227 -27.589 13.437 1.00 159.44 ? -49  DA  J C2    1 
ATOM   9538  N  N3    . DA  J 6 24  ? -53.066 -27.734 12.408 1.00 159.33 ? -49  DA  J N3    1 
ATOM   9539  C  C4    . DA  J 6 24  ? -53.132 -29.022 12.009 1.00 159.31 ? -49  DA  J C4    1 
ATOM   9540  P  P     . DC  J 6 25  ? -54.757 -26.844 6.931  1.00 157.61 ? -48  DC  J P     1 
ATOM   9541  O  OP1   . DC  J 6 25  ? -55.108 -25.604 6.195  1.00 157.76 ? -48  DC  J OP1   1 
ATOM   9542  O  OP2   . DC  J 6 25  ? -54.092 -27.948 6.188  1.00 157.64 ? -48  DC  J OP2   1 
ATOM   9543  O  "O5'" . DC  J 6 25  ? -53.831 -26.462 8.183  1.00 156.65 ? -48  DC  J "O5'" 1 
ATOM   9544  C  "C5'" . DC  J 6 25  ? -54.006 -25.245 8.905  1.00 155.28 ? -48  DC  J "C5'" 1 
ATOM   9545  C  "C4'" . DC  J 6 25  ? -52.642 -24.635 9.179  1.00 154.43 ? -48  DC  J "C4'" 1 
ATOM   9546  O  "O4'" . DC  J 6 25  ? -51.915 -25.484 10.106 1.00 154.33 ? -48  DC  J "O4'" 1 
ATOM   9547  C  "C3'" . DC  J 6 25  ? -51.749 -24.491 7.949  1.00 153.76 ? -48  DC  J "C3'" 1 
ATOM   9548  O  "O3'" . DC  J 6 25  ? -51.037 -23.266 8.005  1.00 152.58 ? -48  DC  J "O3'" 1 
ATOM   9549  C  "C2'" . DC  J 6 25  ? -50.798 -25.682 8.040  1.00 153.89 ? -48  DC  J "C2'" 1 
ATOM   9550  C  "C1'" . DC  J 6 25  ? -50.667 -25.858 9.552  1.00 154.15 ? -48  DC  J "C1'" 1 
ATOM   9551  N  N1    . DC  J 6 25  ? -50.316 -27.249 10.030 1.00 154.21 ? -48  DC  J N1    1 
ATOM   9552  C  C2    . DC  J 6 25  ? -49.583 -27.411 11.226 1.00 154.18 ? -48  DC  J C2    1 
ATOM   9553  O  O2    . DC  J 6 25  ? -49.220 -26.415 11.871 1.00 154.23 ? -48  DC  J O2    1 
ATOM   9554  N  N3    . DC  J 6 25  ? -49.275 -28.672 11.647 1.00 154.09 ? -48  DC  J N3    1 
ATOM   9555  C  C4    . DC  J 6 25  ? -49.671 -29.739 10.939 1.00 154.04 ? -48  DC  J C4    1 
ATOM   9556  N  N4    . DC  J 6 25  ? -49.345 -30.952 11.402 1.00 153.89 ? -48  DC  J N4    1 
ATOM   9557  C  C5    . DC  J 6 25  ? -50.423 -29.602 9.727  1.00 154.02 ? -48  DC  J C5    1 
ATOM   9558  C  C6    . DC  J 6 25  ? -50.719 -28.355 9.318  1.00 154.18 ? -48  DC  J C6    1 
ATOM   9559  P  P     . DC  J 6 26  ? -51.089 -22.240 6.774  1.00 151.44 ? -47  DC  J P     1 
ATOM   9560  O  OP1   . DC  J 6 26  ? -52.283 -21.379 6.961  1.00 151.52 ? -47  DC  J OP1   1 
ATOM   9561  O  OP2   . DC  J 6 26  ? -50.918 -23.004 5.515  1.00 151.33 ? -47  DC  J OP2   1 
ATOM   9562  O  "O5'" . DC  J 6 26  ? -49.770 -21.353 6.996  1.00 150.60 ? -47  DC  J "O5'" 1 
ATOM   9563  C  "C5'" . DC  J 6 26  ? -49.378 -20.938 8.310  1.00 149.00 ? -47  DC  J "C5'" 1 
ATOM   9564  C  "C4'" . DC  J 6 26  ? -48.070 -21.585 8.746  1.00 147.78 ? -47  DC  J "C4'" 1 
ATOM   9565  O  "O4'" . DC  J 6 26  ? -48.255 -22.994 9.051  1.00 147.72 ? -47  DC  J "O4'" 1 
ATOM   9566  C  "C3'" . DC  J 6 26  ? -46.930 -21.534 7.722  1.00 146.84 ? -47  DC  J "C3'" 1 
ATOM   9567  O  "O3'" . DC  J 6 26  ? -45.806 -20.849 8.277  1.00 145.38 ? -47  DC  J "O3'" 1 
ATOM   9568  C  "C2'" . DC  J 6 26  ? -46.620 -23.004 7.453  1.00 147.13 ? -47  DC  J "C2'" 1 
ATOM   9569  C  "C1'" . DC  J 6 26  ? -46.988 -23.568 8.819  1.00 147.76 ? -47  DC  J "C1'" 1 
ATOM   9570  N  N1    . DC  J 6 26  ? -47.009 -25.064 8.965  1.00 148.15 ? -47  DC  J N1    1 
ATOM   9571  C  C2    . DC  J 6 26  ? -46.595 -25.639 10.187 1.00 148.39 ? -47  DC  J C2    1 
ATOM   9572  O  O2    . DC  J 6 26  ? -46.220 -24.914 11.127 1.00 148.39 ? -47  DC  J O2    1 
ATOM   9573  N  N3    . DC  J 6 26  ? -46.610 -26.994 10.311 1.00 148.35 ? -47  DC  J N3    1 
ATOM   9574  C  C4    . DC  J 6 26  ? -47.012 -27.762 9.287  1.00 148.39 ? -47  DC  J C4    1 
ATOM   9575  N  N4    . DC  J 6 26  ? -47.013 -29.088 9.464  1.00 148.26 ? -47  DC  J N4    1 
ATOM   9576  C  C5    . DC  J 6 26  ? -47.440 -27.198 8.041  1.00 148.36 ? -47  DC  J C5    1 
ATOM   9577  C  C6    . DC  J 6 26  ? -47.415 -25.862 7.924  1.00 148.21 ? -47  DC  J C6    1 
ATOM   9578  P  P     . DA  J 6 27  ? -45.134 -19.642 7.461  1.00 144.21 ? -46  DA  J P     1 
ATOM   9579  O  OP1   . DA  J 6 27  ? -46.214 -18.690 7.117  1.00 144.29 ? -46  DA  J OP1   1 
ATOM   9580  O  OP2   . DA  J 6 27  ? -44.303 -20.236 6.387  1.00 143.86 ? -46  DA  J OP2   1 
ATOM   9581  O  "O5'" . DA  J 6 27  ? -44.139 -18.913 8.489  1.00 142.59 ? -46  DA  J "O5'" 1 
ATOM   9582  C  "C5'" . DA  J 6 27  ? -44.286 -18.981 9.912  1.00 139.68 ? -46  DA  J "C5'" 1 
ATOM   9583  C  "C4'" . DA  J 6 27  ? -43.112 -19.705 10.565 1.00 137.39 ? -46  DA  J "C4'" 1 
ATOM   9584  O  "O4'" . DA  J 6 27  ? -43.329 -21.136 10.491 1.00 136.55 ? -46  DA  J "O4'" 1 
ATOM   9585  C  "C3'" . DA  J 6 27  ? -41.718 -19.461 9.984  1.00 136.15 ? -46  DA  J "C3'" 1 
ATOM   9586  O  "O3'" . DA  J 6 27  ? -40.784 -19.450 11.061 1.00 134.90 ? -46  DA  J "O3'" 1 
ATOM   9587  C  "C2'" . DA  J 6 27  ? -41.516 -20.666 9.070  1.00 135.95 ? -46  DA  J "C2'" 1 
ATOM   9588  C  "C1'" . DA  J 6 27  ? -42.222 -21.754 9.872  1.00 136.12 ? -46  DA  J "C1'" 1 
ATOM   9589  N  N9    . DA  J 6 27  ? -42.728 -22.873 9.088  1.00 136.22 ? -46  DA  J N9    1 
ATOM   9590  C  C8    . DA  J 6 27  ? -43.068 -22.883 7.765  1.00 136.31 ? -46  DA  J C8    1 
ATOM   9591  N  N7    . DA  J 6 27  ? -43.498 -24.046 7.336  1.00 136.45 ? -46  DA  J N7    1 
ATOM   9592  C  C5    . DA  J 6 27  ? -43.445 -24.856 8.456  1.00 136.40 ? -46  DA  J C5    1 
ATOM   9593  C  C6    . DA  J 6 27  ? -43.767 -26.216 8.671  1.00 136.36 ? -46  DA  J C6    1 
ATOM   9594  N  N6    . DA  J 6 27  ? -44.234 -27.029 7.717  1.00 136.01 ? -46  DA  J N6    1 
ATOM   9595  N  N1    . DA  J 6 27  ? -43.587 -26.715 9.914  1.00 136.53 ? -46  DA  J N1    1 
ATOM   9596  C  C2    . DA  J 6 27  ? -43.119 -25.906 10.878 1.00 136.71 ? -46  DA  J C2    1 
ATOM   9597  N  N3    . DA  J 6 27  ? -42.783 -24.617 10.793 1.00 136.70 ? -46  DA  J N3    1 
ATOM   9598  C  C4    . DA  J 6 27  ? -42.970 -24.147 9.546  1.00 136.41 ? -46  DA  J C4    1 
ATOM   9599  P  P     . DA  J 6 28  ? -39.245 -18.985 10.954 1.00 133.78 ? -45  DA  J P     1 
ATOM   9600  O  OP1   . DA  J 6 28  ? -39.190 -17.523 11.194 1.00 133.83 ? -45  DA  J OP1   1 
ATOM   9601  O  OP2   . DA  J 6 28  ? -38.633 -19.563 9.734  1.00 133.48 ? -45  DA  J OP2   1 
ATOM   9602  O  "O5'" . DA  J 6 28  ? -38.600 -19.714 12.227 1.00 132.05 ? -45  DA  J "O5'" 1 
ATOM   9603  C  "C5'" . DA  J 6 28  ? -39.341 -20.704 12.962 1.00 129.25 ? -45  DA  J "C5'" 1 
ATOM   9604  C  "C4'" . DA  J 6 28  ? -38.821 -22.111 12.702 1.00 127.08 ? -45  DA  J "C4'" 1 
ATOM   9605  O  "O4'" . DA  J 6 28  ? -39.621 -22.806 11.705 1.00 126.45 ? -45  DA  J "O4'" 1 
ATOM   9606  C  "C3'" . DA  J 6 28  ? -37.374 -22.189 12.208 1.00 125.76 ? -45  DA  J "C3'" 1 
ATOM   9607  O  "O3'" . DA  J 6 28  ? -36.672 -23.149 12.973 1.00 123.78 ? -45  DA  J "O3'" 1 
ATOM   9608  C  "C2'" . DA  J 6 28  ? -37.523 -22.657 10.768 1.00 125.76 ? -45  DA  J "C2'" 1 
ATOM   9609  C  "C1'" . DA  J 6 28  ? -38.707 -23.588 10.969 1.00 125.92 ? -45  DA  J "C1'" 1 
ATOM   9610  N  N9    . DA  J 6 28  ? -39.263 -24.113 9.726  1.00 125.78 ? -45  DA  J N9    1 
ATOM   9611  C  C8    . DA  J 6 28  ? -39.431 -23.456 8.538  1.00 125.72 ? -45  DA  J C8    1 
ATOM   9612  N  N7    . DA  J 6 28  ? -39.943 -24.202 7.590  1.00 125.67 ? -45  DA  J N7    1 
ATOM   9613  C  C5    . DA  J 6 28  ? -40.112 -25.436 8.193  1.00 125.52 ? -45  DA  J C5    1 
ATOM   9614  C  C6    . DA  J 6 28  ? -40.613 -26.669 7.723  1.00 125.34 ? -45  DA  J C6    1 
ATOM   9615  N  N6    . DA  J 6 28  ? -41.056 -26.856 6.477  1.00 125.08 ? -45  DA  J N6    1 
ATOM   9616  N  N1    . DA  J 6 28  ? -40.648 -27.708 8.588  1.00 125.32 ? -45  DA  J N1    1 
ATOM   9617  C  C2    . DA  J 6 28  ? -40.207 -27.526 9.841  1.00 125.32 ? -45  DA  J C2    1 
ATOM   9618  N  N3    . DA  J 6 28  ? -39.714 -26.417 10.393 1.00 125.52 ? -45  DA  J N3    1 
ATOM   9619  C  C4    . DA  J 6 28  ? -39.694 -25.400 9.511  1.00 125.58 ? -45  DA  J C4    1 
ATOM   9620  P  P     . DA  J 6 29  ? -35.849 -22.699 14.263 1.00 122.22 ? -44  DA  J P     1 
ATOM   9621  O  OP1   . DA  J 6 29  ? -36.281 -23.573 15.380 1.00 122.29 ? -44  DA  J OP1   1 
ATOM   9622  O  OP2   . DA  J 6 29  ? -35.965 -21.229 14.400 1.00 122.57 ? -44  DA  J OP2   1 
ATOM   9623  O  "O5'" . DA  J 6 29  ? -34.324 -23.021 13.873 1.00 121.34 ? -44  DA  J "O5'" 1 
ATOM   9624  C  "C5'" . DA  J 6 29  ? -33.964 -24.130 13.044 1.00 119.26 ? -44  DA  J "C5'" 1 
ATOM   9625  C  "C4'" . DA  J 6 29  ? -34.382 -25.456 13.672 1.00 117.72 ? -44  DA  J "C4'" 1 
ATOM   9626  O  "O4'" . DA  J 6 29  ? -35.625 -25.933 13.091 1.00 116.79 ? -44  DA  J "O4'" 1 
ATOM   9627  C  "C3'" . DA  J 6 29  ? -33.394 -26.602 13.523 1.00 117.06 ? -44  DA  J "C3'" 1 
ATOM   9628  O  "O3'" . DA  J 6 29  ? -33.479 -27.419 14.690 1.00 116.55 ? -44  DA  J "O3'" 1 
ATOM   9629  C  "C2'" . DA  J 6 29  ? -33.883 -27.296 12.253 1.00 116.74 ? -44  DA  J "C2'" 1 
ATOM   9630  C  "C1'" . DA  J 6 29  ? -35.373 -26.984 12.179 1.00 116.33 ? -44  DA  J "C1'" 1 
ATOM   9631  N  N9    . DA  J 6 29  ? -35.787 -26.581 10.831 1.00 115.76 ? -44  DA  J N9    1 
ATOM   9632  C  C8    . DA  J 6 29  ? -35.650 -25.343 10.260 1.00 115.35 ? -44  DA  J C8    1 
ATOM   9633  N  N7    . DA  J 6 29  ? -36.108 -25.257 9.034  1.00 114.98 ? -44  DA  J N7    1 
ATOM   9634  C  C5    . DA  J 6 29  ? -36.573 -26.534 8.770  1.00 114.84 ? -44  DA  J C5    1 
ATOM   9635  C  C6    . DA  J 6 29  ? -37.180 -27.108 7.630  1.00 114.50 ? -44  DA  J C6    1 
ATOM   9636  N  N6    . DA  J 6 29  ? -37.421 -26.422 6.509  1.00 114.25 ? -44  DA  J N6    1 
ATOM   9637  N  N1    . DA  J 6 29  ? -37.529 -28.414 7.685  1.00 114.23 ? -44  DA  J N1    1 
ATOM   9638  C  C2    . DA  J 6 29  ? -37.283 -29.097 8.813  1.00 114.54 ? -44  DA  J C2    1 
ATOM   9639  N  N3    . DA  J 6 29  ? -36.722 -28.669 9.947  1.00 114.77 ? -44  DA  J N3    1 
ATOM   9640  C  C4    . DA  J 6 29  ? -36.384 -27.366 9.863  1.00 115.10 ? -44  DA  J C4    1 
ATOM   9641  P  P     . DA  J 6 30  ? -32.883 -28.900 14.787 1.00 116.21 ? -43  DA  J P     1 
ATOM   9642  O  OP1   . DA  J 6 30  ? -33.003 -29.296 16.209 1.00 116.70 ? -43  DA  J OP1   1 
ATOM   9643  O  OP2   . DA  J 6 30  ? -31.567 -28.939 14.105 1.00 116.14 ? -43  DA  J OP2   1 
ATOM   9644  O  "O5'" . DA  J 6 30  ? -33.935 -29.771 13.943 1.00 116.66 ? -43  DA  J "O5'" 1 
ATOM   9645  C  "C5'" . DA  J 6 30  ? -34.081 -31.172 14.147 1.00 116.51 ? -43  DA  J "C5'" 1 
ATOM   9646  C  "C4'" . DA  J 6 30  ? -33.803 -31.898 12.843 1.00 116.55 ? -43  DA  J "C4'" 1 
ATOM   9647  O  "O4'" . DA  J 6 30  ? -34.157 -31.041 11.719 1.00 116.30 ? -43  DA  J "O4'" 1 
ATOM   9648  C  "C3'" . DA  J 6 30  ? -32.341 -32.285 12.647 1.00 116.75 ? -43  DA  J "C3'" 1 
ATOM   9649  O  "O3'" . DA  J 6 30  ? -32.264 -33.662 12.288 1.00 117.55 ? -43  DA  J "O3'" 1 
ATOM   9650  C  "C2'" . DA  J 6 30  ? -31.875 -31.362 11.524 1.00 116.62 ? -43  DA  J "C2'" 1 
ATOM   9651  C  "C1'" . DA  J 6 30  ? -33.161 -31.174 10.728 1.00 116.34 ? -43  DA  J "C1'" 1 
ATOM   9652  N  N9    . DA  J 6 30  ? -33.163 -30.004 9.844  1.00 116.09 ? -43  DA  J N9    1 
ATOM   9653  C  C8    . DA  J 6 30  ? -32.542 -28.805 10.062 1.00 115.92 ? -43  DA  J C8    1 
ATOM   9654  N  N7    . DA  J 6 30  ? -32.704 -27.927 9.105  1.00 115.87 ? -43  DA  J N7    1 
ATOM   9655  C  C5    . DA  J 6 30  ? -33.481 -28.599 8.178  1.00 115.94 ? -43  DA  J C5    1 
ATOM   9656  C  C6    . DA  J 6 30  ? -33.999 -28.216 6.921  1.00 115.71 ? -43  DA  J C6    1 
ATOM   9657  N  N6    . DA  J 6 30  ? -33.796 -27.010 6.377  1.00 115.38 ? -43  DA  J N6    1 
ATOM   9658  N  N1    . DA  J 6 30  ? -34.738 -29.124 6.244  1.00 115.80 ? -43  DA  J N1    1 
ATOM   9659  C  C2    . DA  J 6 30  ? -34.940 -30.337 6.786  1.00 115.83 ? -43  DA  J C2    1 
ATOM   9660  N  N3    . DA  J 6 30  ? -34.506 -30.809 7.957  1.00 115.90 ? -43  DA  J N3    1 
ATOM   9661  C  C4    . DA  J 6 30  ? -33.774 -29.884 8.614  1.00 116.06 ? -43  DA  J C4    1 
ATOM   9662  P  P     . DG  J 6 31  ? -30.864 -34.466 12.197 1.00 118.40 ? -42  DG  J P     1 
ATOM   9663  O  OP1   . DG  J 6 31  ? -30.873 -35.425 13.335 1.00 118.07 ? -42  DG  J OP1   1 
ATOM   9664  O  OP2   . DG  J 6 31  ? -29.664 -33.471 11.623 1.00 118.40 ? -42  DG  J OP2   1 
ATOM   9665  O  "O5'" . DG  J 6 31  ? -31.023 -35.309 10.816 1.00 119.67 ? -42  DG  J "O5'" 1 
ATOM   9666  C  "C5'" . DG  J 6 31  ? -32.302 -35.473 10.168 1.00 121.19 ? -42  DG  J "C5'" 1 
ATOM   9667  C  "C4'" . DG  J 6 31  ? -32.236 -35.381 8.640  1.00 122.36 ? -42  DG  J "C4'" 1 
ATOM   9668  O  "O4'" . DG  J 6 31  ? -32.389 -33.992 8.240  1.00 122.75 ? -42  DG  J "O4'" 1 
ATOM   9669  C  "C3'" . DG  J 6 31  ? -30.940 -35.878 7.990  1.00 123.16 ? -42  DG  J "C3'" 1 
ATOM   9670  O  "O3'" . DG  J 6 31  ? -31.221 -36.869 6.987  1.00 124.39 ? -42  DG  J "O3'" 1 
ATOM   9671  C  "C2'" . DG  J 6 31  ? -30.318 -34.617 7.383  1.00 123.15 ? -42  DG  J "C2'" 1 
ATOM   9672  C  "C1'" . DG  J 6 31  ? -31.540 -33.737 7.141  1.00 123.19 ? -42  DG  J "C1'" 1 
ATOM   9673  N  N9    . DG  J 6 31  ? -31.255 -32.302 7.080  1.00 123.55 ? -42  DG  J N9    1 
ATOM   9674  C  C8    . DG  J 6 31  ? -30.779 -31.518 8.102  1.00 123.66 ? -42  DG  J C8    1 
ATOM   9675  N  N7    . DG  J 6 31  ? -30.616 -30.269 7.776  1.00 123.99 ? -42  DG  J N7    1 
ATOM   9676  C  C5    . DG  J 6 31  ? -31.010 -30.213 6.445  1.00 124.23 ? -42  DG  J C5    1 
ATOM   9677  C  C6    . DG  J 6 31  ? -31.047 -29.111 5.552  1.00 124.47 ? -42  DG  J C6    1 
ATOM   9678  O  O6    . DG  J 6 31  ? -30.731 -27.934 5.775  1.00 124.82 ? -42  DG  J O6    1 
ATOM   9679  N  N1    . DG  J 6 31  ? -31.508 -29.472 4.285  1.00 124.73 ? -42  DG  J N1    1 
ATOM   9680  C  C2    . DG  J 6 31  ? -31.887 -30.747 3.929  1.00 124.84 ? -42  DG  J C2    1 
ATOM   9681  N  N2    . DG  J 6 31  ? -32.302 -30.904 2.662  1.00 125.27 ? -42  DG  J N2    1 
ATOM   9682  N  N3    . DG  J 6 31  ? -31.854 -31.791 4.756  1.00 124.39 ? -42  DG  J N3    1 
ATOM   9683  C  C4    . DG  J 6 31  ? -31.408 -31.457 5.998  1.00 124.03 ? -42  DG  J C4    1 
ATOM   9684  P  P     . DT  J 6 32  ? -30.165 -38.020 6.599  1.00 125.17 ? -41  DT  J P     1 
ATOM   9685  O  OP1   . DT  J 6 32  ? -30.801 -39.323 6.944  1.00 124.93 ? -41  DT  J OP1   1 
ATOM   9686  O  OP2   . DT  J 6 32  ? -28.846 -37.650 7.192  1.00 124.91 ? -41  DT  J OP2   1 
ATOM   9687  O  "O5'" . DT  J 6 32  ? -30.007 -37.914 4.992  1.00 126.51 ? -41  DT  J "O5'" 1 
ATOM   9688  C  "C5'" . DT  J 6 32  ? -31.121 -37.488 4.163  1.00 128.29 ? -41  DT  J "C5'" 1 
ATOM   9689  C  "C4'" . DT  J 6 32  ? -30.667 -36.746 2.903  1.00 129.77 ? -41  DT  J "C4'" 1 
ATOM   9690  O  "O4'" . DT  J 6 32  ? -30.551 -35.329 3.202  1.00 130.17 ? -41  DT  J "O4'" 1 
ATOM   9691  C  "C3'" . DT  J 6 32  ? -29.344 -37.169 2.247  1.00 130.67 ? -41  DT  J "C3'" 1 
ATOM   9692  O  "O3'" . DT  J 6 32  ? -29.585 -37.540 0.842  1.00 131.72 ? -41  DT  J "O3'" 1 
ATOM   9693  C  "C2'" . DT  J 6 32  ? -28.452 -35.937 2.421  1.00 130.66 ? -41  DT  J "C2'" 1 
ATOM   9694  C  "C1'" . DT  J 6 32  ? -29.485 -34.814 2.429  1.00 130.73 ? -41  DT  J "C1'" 1 
ATOM   9695  N  N1    . DT  J 6 32  ? -29.025 -33.521 3.034  1.00 131.13 ? -41  DT  J N1    1 
ATOM   9696  C  C2    . DT  J 6 32  ? -29.274 -32.322 2.376  1.00 131.32 ? -41  DT  J C2    1 
ATOM   9697  O  O2    . DT  J 6 32  ? -29.856 -32.226 1.307  1.00 131.39 ? -41  DT  J O2    1 
ATOM   9698  N  N3    . DT  J 6 32  ? -28.806 -31.207 3.027  1.00 131.41 ? -41  DT  J N3    1 
ATOM   9699  C  C4    . DT  J 6 32  ? -28.134 -31.166 4.239  1.00 131.59 ? -41  DT  J C4    1 
ATOM   9700  O  O4    . DT  J 6 32  ? -27.759 -30.104 4.729  1.00 131.82 ? -41  DT  J O4    1 
ATOM   9701  C  C5    . DT  J 6 32  ? -27.905 -32.450 4.873  1.00 131.61 ? -41  DT  J C5    1 
ATOM   9702  C  C7    . DT  J 6 32  ? -27.185 -32.547 6.191  1.00 131.70 ? -41  DT  J C7    1 
ATOM   9703  C  C6    . DT  J 6 32  ? -28.358 -33.548 4.249  1.00 131.40 ? -41  DT  J C6    1 
ATOM   9704  P  P     . DG  J 6 33  ? -28.414 -37.774 -0.260 1.00 132.73 ? -40  DG  J P     1 
ATOM   9705  O  OP1   . DG  J 6 33  ? -28.427 -39.172 -0.790 1.00 132.69 ? -40  DG  J OP1   1 
ATOM   9706  O  OP2   . DG  J 6 33  ? -27.092 -37.374 0.280  1.00 132.84 ? -40  DG  J OP2   1 
ATOM   9707  O  "O5'" . DG  J 6 33  ? -28.798 -36.673 -1.386 1.00 133.82 ? -40  DG  J "O5'" 1 
ATOM   9708  C  "C5'" . DG  J 6 33  ? -28.046 -36.555 -2.605 1.00 135.34 ? -40  DG  J "C5'" 1 
ATOM   9709  C  "C4'" . DG  J 6 33  ? -27.129 -35.327 -2.613 1.00 136.48 ? -40  DG  J "C4'" 1 
ATOM   9710  O  "O4'" . DG  J 6 33  ? -27.257 -34.552 -1.388 1.00 137.04 ? -40  DG  J "O4'" 1 
ATOM   9711  C  "C3'" . DG  J 6 33  ? -25.629 -35.659 -2.732 1.00 137.00 ? -40  DG  J "C3'" 1 
ATOM   9712  O  "O3'" . DG  J 6 33  ? -25.222 -35.653 -4.126 1.00 137.18 ? -40  DG  J "O3'" 1 
ATOM   9713  C  "C2'" . DG  J 6 33  ? -24.921 -34.636 -1.822 1.00 137.29 ? -40  DG  J "C2'" 1 
ATOM   9714  C  "C1'" . DG  J 6 33  ? -26.079 -33.758 -1.287 1.00 137.37 ? -40  DG  J "C1'" 1 
ATOM   9715  N  N9    . DG  J 6 33  ? -25.843 -33.274 0.080  1.00 137.57 ? -40  DG  J N9    1 
ATOM   9716  C  C8    . DG  J 6 33  ? -25.758 -34.046 1.219  1.00 137.66 ? -40  DG  J C8    1 
ATOM   9717  N  N7    . DG  J 6 33  ? -25.523 -33.361 2.304  1.00 137.63 ? -40  DG  J N7    1 
ATOM   9718  C  C5    . DG  J 6 33  ? -25.437 -32.043 1.865  1.00 137.63 ? -40  DG  J C5    1 
ATOM   9719  C  C6    . DG  J 6 33  ? -25.193 -30.849 2.600  1.00 137.62 ? -40  DG  J C6    1 
ATOM   9720  O  O6    . DG  J 6 33  ? -25.002 -30.728 3.817  1.00 137.45 ? -40  DG  J O6    1 
ATOM   9721  N  N1    . DG  J 6 33  ? -25.183 -29.713 1.786  1.00 137.67 ? -40  DG  J N1    1 
ATOM   9722  C  C2    . DG  J 6 33  ? -25.381 -29.734 0.424  1.00 137.70 ? -40  DG  J C2    1 
ATOM   9723  N  N2    . DG  J 6 33  ? -25.336 -28.540 -0.192 1.00 137.85 ? -40  DG  J N2    1 
ATOM   9724  N  N3    . DG  J 6 33  ? -25.611 -30.847 -0.278 1.00 137.66 ? -40  DG  J N3    1 
ATOM   9725  C  C4    . DG  J 6 33  ? -25.626 -31.967 0.499  1.00 137.61 ? -40  DG  J C4    1 
ATOM   9726  P  P     . DT  J 6 34  ? -23.962 -34.859 -4.748 1.00 137.82 ? -39  DT  J P     1 
ATOM   9727  O  OP1   . DT  J 6 34  ? -23.872 -35.272 -6.170 1.00 137.91 ? -39  DT  J OP1   1 
ATOM   9728  O  OP2   . DT  J 6 34  ? -22.764 -35.049 -3.891 1.00 137.89 ? -39  DT  J OP2   1 
ATOM   9729  O  "O5'" . DT  J 6 34  ? -24.411 -33.315 -4.666 1.00 137.99 ? -39  DT  J "O5'" 1 
ATOM   9730  C  "C5'" . DT  J 6 34  ? -24.016 -32.359 -5.662 1.00 138.27 ? -39  DT  J "C5'" 1 
ATOM   9731  C  "C4'" . DT  J 6 34  ? -22.807 -31.536 -5.232 1.00 138.40 ? -39  DT  J "C4'" 1 
ATOM   9732  O  "O4'" . DT  J 6 34  ? -22.841 -31.328 -3.796 1.00 138.65 ? -39  DT  J "O4'" 1 
ATOM   9733  C  "C3'" . DT  J 6 34  ? -21.444 -32.166 -5.548 1.00 138.35 ? -39  DT  J "C3'" 1 
ATOM   9734  O  "O3'" . DT  J 6 34  ? -20.787 -31.416 -6.606 1.00 138.13 ? -39  DT  J "O3'" 1 
ATOM   9735  C  "C2'" . DT  J 6 34  ? -20.718 -32.211 -4.199 1.00 138.69 ? -39  DT  J "C2'" 1 
ATOM   9736  C  "C1'" . DT  J 6 34  ? -21.507 -31.216 -3.349 1.00 139.11 ? -39  DT  J "C1'" 1 
ATOM   9737  N  N1    . DT  J 6 34  ? -21.437 -31.423 -1.844 1.00 139.72 ? -39  DT  J N1    1 
ATOM   9738  C  C2    . DT  J 6 34  ? -21.743 -30.361 -0.987 1.00 139.94 ? -39  DT  J C2    1 
ATOM   9739  O  O2    . DT  J 6 34  ? -22.079 -29.242 -1.359 1.00 139.97 ? -39  DT  J O2    1 
ATOM   9740  N  N3    . DT  J 6 34  ? -21.646 -30.657 0.353  1.00 139.96 ? -39  DT  J N3    1 
ATOM   9741  C  C4    . DT  J 6 34  ? -21.281 -31.871 0.921  1.00 140.00 ? -39  DT  J C4    1 
ATOM   9742  O  O4    . DT  J 6 34  ? -21.228 -32.014 2.140  1.00 140.00 ? -39  DT  J O4    1 
ATOM   9743  C  C5    . DT  J 6 34  ? -20.970 -32.939 -0.020 1.00 140.03 ? -39  DT  J C5    1 
ATOM   9744  C  C7    . DT  J 6 34  ? -20.560 -34.310 0.461  1.00 140.00 ? -39  DT  J C7    1 
ATOM   9745  C  C6    . DT  J 6 34  ? -21.063 -32.665 -1.333 1.00 139.90 ? -39  DT  J C6    1 
ATOM   9746  P  P     . DA  J 6 35  ? -19.462 -30.507 -6.489 1.00 138.07 ? -38  DA  J P     1 
ATOM   9747  O  OP1   . DA  J 6 35  ? -19.067 -30.162 -7.876 1.00 138.08 ? -38  DA  J OP1   1 
ATOM   9748  O  OP2   . DA  J 6 35  ? -18.462 -31.175 -5.624 1.00 137.99 ? -38  DA  J OP2   1 
ATOM   9749  O  "O5'" . DA  J 6 35  ? -19.988 -29.189 -5.735 1.00 137.70 ? -38  DA  J "O5'" 1 
ATOM   9750  C  "C5'" . DA  J 6 35  ? -19.622 -27.873 -6.185 1.00 137.18 ? -38  DA  J "C5'" 1 
ATOM   9751  C  "C4'" . DA  J 6 35  ? -18.787 -27.108 -5.161 1.00 136.68 ? -38  DA  J "C4'" 1 
ATOM   9752  O  "O4'" . DA  J 6 35  ? -19.068 -27.584 -3.817 1.00 136.64 ? -38  DA  J "O4'" 1 
ATOM   9753  C  "C3'" . DA  J 6 35  ? -17.269 -27.203 -5.344 1.00 136.38 ? -38  DA  J "C3'" 1 
ATOM   9754  O  "O3'" . DA  J 6 35  ? -16.701 -25.884 -5.248 1.00 135.87 ? -38  DA  J "O3'" 1 
ATOM   9755  C  "C2'" . DA  J 6 35  ? -16.835 -28.132 -4.206 1.00 136.46 ? -38  DA  J "C2'" 1 
ATOM   9756  C  "C1'" . DA  J 6 35  ? -17.847 -27.763 -3.128 1.00 136.71 ? -38  DA  J "C1'" 1 
ATOM   9757  N  N9    . DA  J 6 35  ? -18.012 -28.766 -2.074 1.00 137.07 ? -38  DA  J N9    1 
ATOM   9758  C  C8    . DA  J 6 35  ? -18.267 -30.105 -2.225 1.00 137.13 ? -38  DA  J C8    1 
ATOM   9759  N  N7    . DA  J 6 35  ? -18.365 -30.766 -1.094 1.00 137.02 ? -38  DA  J N7    1 
ATOM   9760  C  C5    . DA  J 6 35  ? -18.157 -29.795 -0.130 1.00 137.14 ? -38  DA  J C5    1 
ATOM   9761  C  C6    . DA  J 6 35  ? -18.132 -29.847 1.279  1.00 137.18 ? -38  DA  J C6    1 
ATOM   9762  N  N6    . DA  J 6 35  ? -18.326 -30.976 1.966  1.00 137.24 ? -38  DA  J N6    1 
ATOM   9763  N  N1    . DA  J 6 35  ? -17.897 -28.695 1.952  1.00 137.30 ? -38  DA  J N1    1 
ATOM   9764  C  C2    . DA  J 6 35  ? -17.700 -27.563 1.256  1.00 137.33 ? -38  DA  J C2    1 
ATOM   9765  N  N3    . DA  J 6 35  ? -17.702 -27.392 -0.069 1.00 137.27 ? -38  DA  J N3    1 
ATOM   9766  C  C4    . DA  J 6 35  ? -17.937 -28.555 -0.712 1.00 137.19 ? -38  DA  J C4    1 
ATOM   9767  P  P     . DT  J 6 36  ? -15.124 -25.595 -5.117 1.00 135.56 ? -37  DT  J P     1 
ATOM   9768  O  OP1   . DT  J 6 36  ? -14.873 -24.238 -5.661 1.00 135.53 ? -37  DT  J OP1   1 
ATOM   9769  O  OP2   . DT  J 6 36  ? -14.357 -26.747 -5.653 1.00 135.47 ? -37  DT  J OP2   1 
ATOM   9770  O  "O5'" . DT  J 6 36  ? -14.914 -25.568 -3.528 1.00 135.31 ? -37  DT  J "O5'" 1 
ATOM   9771  C  "C5'" . DT  J 6 36  ? -15.516 -24.538 -2.726 1.00 134.62 ? -37  DT  J "C5'" 1 
ATOM   9772  C  "C4'" . DT  J 6 36  ? -14.872 -24.449 -1.346 1.00 133.86 ? -37  DT  J "C4'" 1 
ATOM   9773  O  "O4'" . DT  J 6 36  ? -15.274 -25.598 -0.553 1.00 133.91 ? -37  DT  J "O4'" 1 
ATOM   9774  C  "C3'" . DT  J 6 36  ? -13.341 -24.406 -1.325 1.00 133.26 ? -37  DT  J "C3'" 1 
ATOM   9775  O  "O3'" . DT  J 6 36  ? -12.906 -23.330 -0.490 1.00 131.92 ? -37  DT  J "O3'" 1 
ATOM   9776  C  "C2'" . DT  J 6 36  ? -12.944 -25.773 -0.764 1.00 133.70 ? -37  DT  J "C2'" 1 
ATOM   9777  C  "C1'" . DT  J 6 36  ? -14.144 -26.126 0.114  1.00 134.13 ? -37  DT  J "C1'" 1 
ATOM   9778  N  N1    . DT  J 6 36  ? -14.361 -27.600 0.365  1.00 134.31 ? -37  DT  J N1    1 
ATOM   9779  C  C2    . DT  J 6 36  ? -14.595 -28.045 1.663  1.00 134.47 ? -37  DT  J C2    1 
ATOM   9780  O  O2    . DT  J 6 36  ? -14.643 -27.314 2.644  1.00 134.40 ? -37  DT  J O2    1 
ATOM   9781  N  N3    . DT  J 6 36  ? -14.786 -29.401 1.776  1.00 134.56 ? -37  DT  J N3    1 
ATOM   9782  C  C4    . DT  J 6 36  ? -14.762 -30.341 0.756  1.00 134.61 ? -37  DT  J C4    1 
ATOM   9783  O  O4    . DT  J 6 36  ? -14.944 -31.531 0.984  1.00 134.68 ? -37  DT  J O4    1 
ATOM   9784  C  C5    . DT  J 6 36  ? -14.511 -29.816 -0.587 1.00 134.68 ? -37  DT  J C5    1 
ATOM   9785  C  C7    . DT  J 6 36  ? -14.211 -30.730 -1.819 1.00 134.92 ? -37  DT  J C7    1 
ATOM   9786  C  C6    . DT  J 6 36  ? -14.328 -28.492 -0.709 1.00 134.50 ? -37  DT  J C6    1 
ATOM   9787  P  P     . DT  J 6 37  ? -11.412 -22.728 -0.515 1.00 130.76 ? -36  DT  J P     1 
ATOM   9788  O  OP1   . DT  J 6 37  ? -11.476 -21.394 -1.154 1.00 130.82 ? -36  DT  J OP1   1 
ATOM   9789  O  OP2   . DT  J 6 37  ? -10.465 -23.742 -1.032 1.00 130.64 ? -36  DT  J OP2   1 
ATOM   9790  O  "O5'" . DT  J 6 37  ? -11.127 -22.532 1.051  1.00 129.95 ? -36  DT  J "O5'" 1 
ATOM   9791  C  "C5'" . DT  J 6 37  ? -12.194 -22.247 1.978  1.00 128.32 ? -36  DT  J "C5'" 1 
ATOM   9792  C  "C4'" . DT  J 6 37  ? -12.037 -22.981 3.307  1.00 126.94 ? -36  DT  J "C4'" 1 
ATOM   9793  O  "O4'" . DT  J 6 37  ? -12.373 -24.385 3.147  1.00 126.59 ? -36  DT  J "O4'" 1 
ATOM   9794  C  "C3'" . DT  J 6 37  ? -10.632 -22.935 3.912  1.00 125.88 ? -36  DT  J "C3'" 1 
ATOM   9795  O  "O3'" . DT  J 6 37  ? -10.628 -22.205 5.138  1.00 124.10 ? -36  DT  J "O3'" 1 
ATOM   9796  C  "C2'" . DT  J 6 37  ? -10.230 -24.393 4.131  1.00 126.00 ? -36  DT  J "C2'" 1 
ATOM   9797  C  "C1'" . DT  J 6 37  ? -11.545 -25.151 3.999  1.00 126.26 ? -36  DT  J "C1'" 1 
ATOM   9798  N  N1    . DT  J 6 37  ? -11.353 -26.527 3.433  1.00 126.37 ? -36  DT  J N1    1 
ATOM   9799  C  C2    . DT  J 6 37  ? -11.890 -27.604 4.110  1.00 126.36 ? -36  DT  J C2    1 
ATOM   9800  O  O2    . DT  J 6 37  ? -12.520 -27.495 5.144  1.00 126.24 ? -36  DT  J O2    1 
ATOM   9801  N  N3    . DT  J 6 37  ? -11.660 -28.826 3.527  1.00 126.53 ? -36  DT  J N3    1 
ATOM   9802  C  C4    . DT  J 6 37  ? -10.959 -29.078 2.359  1.00 126.67 ? -36  DT  J C4    1 
ATOM   9803  O  O4    . DT  J 6 37  ? -10.813 -30.219 1.931  1.00 126.63 ? -36  DT  J O4    1 
ATOM   9804  C  C5    . DT  J 6 37  ? -10.412 -27.910 1.698  1.00 126.69 ? -36  DT  J C5    1 
ATOM   9805  C  C7    . DT  J 6 37  ? -9.628  -28.037 0.420  1.00 126.76 ? -36  DT  J C7    1 
ATOM   9806  C  C6    . DT  J 6 37  ? -10.634 -26.710 2.260  1.00 126.57 ? -36  DT  J C6    1 
ATOM   9807  P  P     . DT  J 6 38  ? -9.238  -21.761 5.809  1.00 122.95 ? -35  DT  J P     1 
ATOM   9808  O  OP1   . DT  J 6 38  ? -9.497  -20.509 6.558  1.00 122.78 ? -35  DT  J OP1   1 
ATOM   9809  O  OP2   . DT  J 6 38  ? -8.151  -21.810 4.799  1.00 122.84 ? -35  DT  J OP2   1 
ATOM   9810  O  "O5'" . DT  J 6 38  ? -8.957  -22.949 6.841  1.00 121.92 ? -35  DT  J "O5'" 1 
ATOM   9811  C  "C5'" . DT  J 6 38  ? -9.982  -23.463 7.714  1.00 119.82 ? -35  DT  J "C5'" 1 
ATOM   9812  C  "C4'" . DT  J 6 38  ? -9.433  -24.610 8.565  1.00 118.10 ? -35  DT  J "C4'" 1 
ATOM   9813  O  "O4'" . DT  J 6 38  ? -9.636  -25.888 7.883  1.00 117.68 ? -35  DT  J "O4'" 1 
ATOM   9814  C  "C3'" . DT  J 6 38  ? -7.938  -24.525 8.900  1.00 116.80 ? -35  DT  J "C3'" 1 
ATOM   9815  O  "O3'" . DT  J 6 38  ? -7.682  -24.909 10.247 1.00 114.65 ? -35  DT  J "O3'" 1 
ATOM   9816  C  "C2'" . DT  J 6 38  ? -7.315  -25.536 7.942  1.00 117.16 ? -35  DT  J "C2'" 1 
ATOM   9817  C  "C1'" . DT  J 6 38  ? -8.410  -26.600 7.876  1.00 117.65 ? -35  DT  J "C1'" 1 
ATOM   9818  N  N1    . DT  J 6 38  ? -8.348  -27.489 6.660  1.00 117.68 ? -35  DT  J N1    1 
ATOM   9819  C  C2    . DT  J 6 38  ? -8.944  -28.745 6.688  1.00 117.44 ? -35  DT  J C2    1 
ATOM   9820  O  O2    . DT  J 6 38  ? -9.537  -29.195 7.653  1.00 117.10 ? -35  DT  J O2    1 
ATOM   9821  N  N3    . DT  J 6 38  ? -8.820  -29.461 5.520  1.00 117.38 ? -35  DT  J N3    1 
ATOM   9822  C  C4    . DT  J 6 38  ? -8.173  -29.065 4.358  1.00 117.47 ? -35  DT  J C4    1 
ATOM   9823  O  O4    . DT  J 6 38  ? -8.126  -29.799 3.373  1.00 117.38 ? -35  DT  J O4    1 
ATOM   9824  C  C5    . DT  J 6 38  ? -7.568  -27.742 4.397  1.00 117.54 ? -35  DT  J C5    1 
ATOM   9825  C  C7    . DT  J 6 38  ? -6.832  -27.166 3.218  1.00 117.94 ? -35  DT  J C7    1 
ATOM   9826  C  C6    . DT  J 6 38  ? -7.686  -27.035 5.528  1.00 117.62 ? -35  DT  J C6    1 
ATOM   9827  P  P     . DG  J 6 39  ? -7.837  -23.929 11.512 1.00 112.97 ? -34  DG  J P     1 
ATOM   9828  O  OP1   . DG  J 6 39  ? -8.857  -22.889 11.220 1.00 113.28 ? -34  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J 6 39  ? -6.477  -23.536 11.948 1.00 113.03 ? -34  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J 6 39  ? -8.443  -24.930 12.605 1.00 110.92 ? -34  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J 6 39  ? -9.414  -25.896 12.191 1.00 108.69 ? -34  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J 6 39  ? -9.281  -27.268 12.849 1.00 107.47 ? -34  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J 6 39  ? -8.708  -28.236 11.935 1.00 107.13 ? -34  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J 6 39  ? -8.416  -27.382 14.100 1.00 106.82 ? -34  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J 6 39  ? -8.917  -28.433 14.940 1.00 104.50 ? -34  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J 6 39  ? -7.035  -27.709 13.541 1.00 107.41 ? -34  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J 6 39  ? -7.393  -28.567 12.335 1.00 108.14 ? -34  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J 6 39  ? -6.554  -28.330 11.170 1.00 109.80 ? -34  DG  J N9    1 
ATOM   9839  C  C8    . DG  J 6 39  ? -5.891  -27.175 10.809 1.00 110.34 ? -34  DG  J C8    1 
ATOM   9840  N  N7    . DG  J 6 39  ? -5.227  -27.286 9.689  1.00 110.81 ? -34  DG  J N7    1 
ATOM   9841  C  C5    . DG  J 6 39  ? -5.471  -28.595 9.283  1.00 110.87 ? -34  DG  J C5    1 
ATOM   9842  C  C6    . DG  J 6 39  ? -5.020  -29.301 8.140  1.00 111.23 ? -34  DG  J C6    1 
ATOM   9843  O  O6    . DG  J 6 39  ? -4.288  -28.884 7.231  1.00 111.79 ? -34  DG  J O6    1 
ATOM   9844  N  N1    . DG  J 6 39  ? -5.497  -30.616 8.112  1.00 110.93 ? -34  DG  J N1    1 
ATOM   9845  C  C2    . DG  J 6 39  ? -6.313  -31.175 9.075  1.00 111.01 ? -34  DG  J C2    1 
ATOM   9846  N  N2    . DG  J 6 39  ? -6.674  -32.452 8.889  1.00 111.06 ? -34  DG  J N2    1 
ATOM   9847  N  N3    . DG  J 6 39  ? -6.747  -30.526 10.151 1.00 110.44 ? -34  DG  J N3    1 
ATOM   9848  C  C4    . DG  J 6 39  ? -6.287  -29.249 10.186 1.00 110.41 ? -34  DG  J C4    1 
ATOM   9849  P  P     . DG  J 6 40  ? -8.343  -28.658 16.419 1.00 102.21 ? -33  DG  J P     1 
ATOM   9850  O  OP1   . DG  J 6 40  ? -9.456  -29.192 17.234 1.00 101.64 ? -33  DG  J OP1   1 
ATOM   9851  O  OP2   . DG  J 6 40  ? -7.605  -27.439 16.846 1.00 101.77 ? -33  DG  J OP2   1 
ATOM   9852  O  "O5'" . DG  J 6 40  ? -7.289  -29.838 16.199 1.00 102.70 ? -33  DG  J "O5'" 1 
ATOM   9853  C  "C5'" . DG  J 6 40  ? -7.753  -31.144 15.840 1.00 103.79 ? -33  DG  J "C5'" 1 
ATOM   9854  C  "C4'" . DG  J 6 40  ? -6.601  -32.038 15.406 1.00 104.64 ? -33  DG  J "C4'" 1 
ATOM   9855  O  "O4'" . DG  J 6 40  ? -5.930  -31.455 14.258 1.00 105.08 ? -33  DG  J "O4'" 1 
ATOM   9856  C  "C3'" . DG  J 6 40  ? -5.514  -32.254 16.456 1.00 105.28 ? -33  DG  J "C3'" 1 
ATOM   9857  O  "O3'" . DG  J 6 40  ? -5.121  -33.628 16.467 1.00 105.95 ? -33  DG  J "O3'" 1 
ATOM   9858  C  "C2'" . DG  J 6 40  ? -4.376  -31.343 15.993 1.00 105.64 ? -33  DG  J "C2'" 1 
ATOM   9859  C  "C1'" . DG  J 6 40  ? -4.535  -31.486 14.484 1.00 105.71 ? -33  DG  J "C1'" 1 
ATOM   9860  N  N9    . DG  J 6 40  ? -3.894  -30.472 13.645 1.00 106.18 ? -33  DG  J N9    1 
ATOM   9861  C  C8    . DG  J 6 40  ? -3.550  -29.166 13.939 1.00 106.45 ? -33  DG  J C8    1 
ATOM   9862  N  N7    . DG  J 6 40  ? -2.985  -28.540 12.939 1.00 106.65 ? -33  DG  J N7    1 
ATOM   9863  C  C5    . DG  J 6 40  ? -2.956  -29.492 11.917 1.00 106.84 ? -33  DG  J C5    1 
ATOM   9864  C  C6    . DG  J 6 40  ? -2.458  -29.417 10.585 1.00 106.84 ? -33  DG  J C6    1 
ATOM   9865  O  O6    . DG  J 6 40  ? -1.928  -28.444 10.021 1.00 106.94 ? -33  DG  J O6    1 
ATOM   9866  N  N1    . DG  J 6 40  ? -2.629  -30.627 9.891  1.00 106.60 ? -33  DG  J N1    1 
ATOM   9867  C  C2    . DG  J 6 40  ? -3.205  -31.768 10.422 1.00 106.46 ? -33  DG  J C2    1 
ATOM   9868  N  N2    . DG  J 6 40  ? -3.295  -32.849 9.628  1.00 106.19 ? -33  DG  J N2    1 
ATOM   9869  N  N3    . DG  J 6 40  ? -3.670  -31.848 11.662 1.00 106.38 ? -33  DG  J N3    1 
ATOM   9870  C  C4    . DG  J 6 40  ? -3.512  -30.682 12.345 1.00 106.47 ? -33  DG  J C4    1 
ATOM   9871  P  P     . DA  J 6 41  ? -5.192  -34.497 17.820 1.00 106.15 ? -32  DA  J P     1 
ATOM   9872  O  OP1   . DA  J 6 41  ? -6.625  -34.720 18.134 1.00 106.03 ? -32  DA  J OP1   1 
ATOM   9873  O  OP2   . DA  J 6 41  ? -4.300  -33.861 18.823 1.00 105.99 ? -32  DA  J OP2   1 
ATOM   9874  O  "O5'" . DA  J 6 41  ? -4.533  -35.894 17.397 1.00 106.84 ? -32  DA  J "O5'" 1 
ATOM   9875  C  "C5'" . DA  J 6 41  ? -5.066  -36.676 16.331 1.00 108.89 ? -32  DA  J "C5'" 1 
ATOM   9876  C  "C4'" . DA  J 6 41  ? -3.965  -37.329 15.507 1.00 111.00 ? -32  DA  J "C4'" 1 
ATOM   9877  O  "O4'" . DA  J 6 41  ? -3.439  -36.383 14.536 1.00 111.48 ? -32  DA  J "O4'" 1 
ATOM   9878  C  "C3'" . DA  J 6 41  ? -2.774  -37.867 16.303 1.00 112.41 ? -32  DA  J "C3'" 1 
ATOM   9879  O  "O3'" . DA  J 6 41  ? -2.645  -39.292 16.049 1.00 114.52 ? -32  DA  J "O3'" 1 
ATOM   9880  C  "C2'" . DA  J 6 41  ? -1.594  -36.978 15.882 1.00 112.05 ? -32  DA  J "C2'" 1 
ATOM   9881  C  "C1'" . DA  J 6 41  ? -2.024  -36.363 14.551 1.00 111.66 ? -32  DA  J "C1'" 1 
ATOM   9882  N  N9    . DA  J 6 41  ? -1.606  -34.970 14.355 1.00 111.54 ? -32  DA  J N9    1 
ATOM   9883  C  C8    . DA  J 6 41  ? -1.633  -33.967 15.288 1.00 111.51 ? -32  DA  J C8    1 
ATOM   9884  N  N7    . DA  J 6 41  ? -1.213  -32.807 14.845 1.00 111.67 ? -32  DA  J N7    1 
ATOM   9885  C  C5    . DA  J 6 41  ? -0.887  -33.056 13.520 1.00 111.82 ? -32  DA  J C5    1 
ATOM   9886  C  C6    . DA  J 6 41  ? -0.378  -32.227 12.487 1.00 111.92 ? -32  DA  J C6    1 
ATOM   9887  N  N6    . DA  J 6 41  ? -0.100  -30.928 12.654 1.00 111.80 ? -32  DA  J N6    1 
ATOM   9888  N  N1    . DA  J 6 41  ? -0.161  -32.786 11.270 1.00 111.87 ? -32  DA  J N1    1 
ATOM   9889  C  C2    . DA  J 6 41  ? -0.439  -34.089 11.103 1.00 111.80 ? -32  DA  J C2    1 
ATOM   9890  N  N3    . DA  J 6 41  ? -0.918  -34.964 11.996 1.00 111.80 ? -32  DA  J N3    1 
ATOM   9891  C  C4    . DA  J 6 41  ? -1.124  -34.386 13.199 1.00 111.70 ? -32  DA  J C4    1 
ATOM   9892  P  P     . DA  J 6 42  ? -1.289  -40.106 15.736 1.00 115.77 ? -31  DA  J P     1 
ATOM   9893  O  OP1   . DA  J 6 42  ? -1.655  -41.540 15.693 1.00 115.37 ? -31  DA  J OP1   1 
ATOM   9894  O  OP2   . DA  J 6 42  ? -0.220  -39.667 16.665 1.00 115.57 ? -31  DA  J OP2   1 
ATOM   9895  O  "O5'" . DA  J 6 42  ? -0.915  -39.628 14.247 1.00 117.30 ? -31  DA  J "O5'" 1 
ATOM   9896  C  "C5'" . DA  J 6 42  ? -0.269  -40.504 13.317 1.00 119.26 ? -31  DA  J "C5'" 1 
ATOM   9897  C  "C4'" . DA  J 6 42  ? 1.156   -40.055 13.048 1.00 120.70 ? -31  DA  J "C4'" 1 
ATOM   9898  O  "O4'" . DA  J 6 42  ? 1.185   -38.613 12.913 1.00 121.12 ? -31  DA  J "O4'" 1 
ATOM   9899  C  "C3'" . DA  J 6 42  ? 2.144   -40.389 14.168 1.00 121.66 ? -31  DA  J "C3'" 1 
ATOM   9900  O  "O3'" . DA  J 6 42  ? 2.863   -41.638 13.935 1.00 122.99 ? -31  DA  J "O3'" 1 
ATOM   9901  C  "C2'" . DA  J 6 42  ? 3.050   -39.161 14.283 1.00 121.65 ? -31  DA  J "C2'" 1 
ATOM   9902  C  "C1'" . DA  J 6 42  ? 2.450   -38.133 13.319 1.00 121.56 ? -31  DA  J "C1'" 1 
ATOM   9903  N  N9    . DA  J 6 42  ? 2.288   -36.800 13.908 1.00 121.89 ? -31  DA  J N9    1 
ATOM   9904  C  C8    . DA  J 6 42  ? 1.782   -36.501 15.144 1.00 121.89 ? -31  DA  J C8    1 
ATOM   9905  N  N7    . DA  J 6 42  ? 1.755   -35.216 15.416 1.00 122.20 ? -31  DA  J N7    1 
ATOM   9906  C  C5    . DA  J 6 42  ? 2.282   -34.627 14.277 1.00 122.34 ? -31  DA  J C5    1 
ATOM   9907  C  C6    . DA  J 6 42  ? 2.526   -33.278 13.926 1.00 122.51 ? -31  DA  J C6    1 
ATOM   9908  N  N6    . DA  J 6 42  ? 2.254   -32.248 14.737 1.00 122.56 ? -31  DA  J N6    1 
ATOM   9909  N  N1    . DA  J 6 42  ? 3.066   -33.026 12.708 1.00 122.63 ? -31  DA  J N1    1 
ATOM   9910  C  C2    . DA  J 6 42  ? 3.341   -34.060 11.897 1.00 122.48 ? -31  DA  J C2    1 
ATOM   9911  N  N3    . DA  J 6 42  ? 3.154   -35.367 12.118 1.00 122.34 ? -31  DA  J N3    1 
ATOM   9912  C  C4    . DA  J 6 42  ? 2.617   -35.588 13.335 1.00 122.20 ? -31  DA  J C4    1 
ATOM   9913  P  P     . DA  J 6 43  ? 3.874   -41.982 12.722 1.00 124.06 ? -30  DA  J P     1 
ATOM   9914  O  OP1   . DA  J 6 43  ? 3.125   -42.867 11.799 1.00 123.74 ? -30  DA  J OP1   1 
ATOM   9915  O  OP2   . DA  J 6 43  ? 5.138   -42.463 13.331 1.00 124.05 ? -30  DA  J OP2   1 
ATOM   9916  O  "O5'" . DA  J 6 43  ? 4.213   -40.603 11.973 1.00 124.66 ? -30  DA  J "O5'" 1 
ATOM   9917  C  "C5'" . DA  J 6 43  ? 5.218   -40.543 10.957 1.00 125.32 ? -30  DA  J "C5'" 1 
ATOM   9918  C  "C4'" . DA  J 6 43  ? 6.324   -39.544 11.288 1.00 125.84 ? -30  DA  J "C4'" 1 
ATOM   9919  O  "O4'" . DA  J 6 43  ? 5.787   -38.409 12.025 1.00 126.10 ? -30  DA  J "O4'" 1 
ATOM   9920  C  "C3'" . DA  J 6 43  ? 7.474   -40.096 12.141 1.00 126.06 ? -30  DA  J "C3'" 1 
ATOM   9921  O  "O3'" . DA  J 6 43  ? 8.701   -39.973 11.400 1.00 126.17 ? -30  DA  J "O3'" 1 
ATOM   9922  C  "C2'" . DA  J 6 43  ? 7.454   -39.239 13.423 1.00 126.17 ? -30  DA  J "C2'" 1 
ATOM   9923  C  "C1'" . DA  J 6 43  ? 6.813   -37.947 12.893 1.00 126.22 ? -30  DA  J "C1'" 1 
ATOM   9924  N  N9    . DA  J 6 43  ? 6.244   -37.031 13.889 1.00 126.26 ? -30  DA  J N9    1 
ATOM   9925  C  C8    . DA  J 6 43  ? 5.547   -37.350 15.022 1.00 126.19 ? -30  DA  J C8    1 
ATOM   9926  N  N7    . DA  J 6 43  ? 5.158   -36.313 15.724 1.00 126.40 ? -30  DA  J N7    1 
ATOM   9927  C  C5    . DA  J 6 43  ? 5.633   -35.228 15.007 1.00 126.51 ? -30  DA  J C5    1 
ATOM   9928  C  C6    . DA  J 6 43  ? 5.560   -33.830 15.222 1.00 126.74 ? -30  DA  J C6    1 
ATOM   9929  N  N6    . DA  J 6 43  ? 4.941   -33.278 16.271 1.00 127.06 ? -30  DA  J N6    1 
ATOM   9930  N  N1    . DA  J 6 43  ? 6.142   -33.012 14.314 1.00 126.83 ? -30  DA  J N1    1 
ATOM   9931  C  C2    . DA  J 6 43  ? 6.760   -33.564 13.258 1.00 126.90 ? -30  DA  J C2    1 
ATOM   9932  N  N3    . DA  J 6 43  ? 6.895   -34.860 12.953 1.00 126.75 ? -30  DA  J N3    1 
ATOM   9933  C  C4    . DA  J 6 43  ? 6.306   -35.652 13.873 1.00 126.47 ? -30  DA  J C4    1 
ATOM   9934  P  P     . DC  J 6 44  ? 10.083  -40.682 11.823 1.00 126.19 ? -29  DC  J P     1 
ATOM   9935  O  OP1   . DC  J 6 44  ? 10.688  -41.231 10.586 1.00 125.89 ? -29  DC  J OP1   1 
ATOM   9936  O  OP2   . DC  J 6 44  ? 9.841   -41.590 12.971 1.00 125.87 ? -29  DC  J OP2   1 
ATOM   9937  O  "O5'" . DC  J 6 44  ? 10.967  -39.442 12.341 1.00 126.20 ? -29  DC  J "O5'" 1 
ATOM   9938  C  "C5'" . DC  J 6 44  ? 11.477  -38.475 11.417 1.00 126.00 ? -29  DC  J "C5'" 1 
ATOM   9939  C  "C4'" . DC  J 6 44  ? 11.889  -37.185 12.111 1.00 126.01 ? -29  DC  J "C4'" 1 
ATOM   9940  O  "O4'" . DC  J 6 44  ? 10.777  -36.671 12.891 1.00 126.10 ? -29  DC  J "O4'" 1 
ATOM   9941  C  "C3'" . DC  J 6 44  ? 13.071  -37.301 13.078 1.00 125.90 ? -29  DC  J "C3'" 1 
ATOM   9942  O  "O3'" . DC  J 6 44  ? 14.145  -36.483 12.600 1.00 125.71 ? -29  DC  J "O3'" 1 
ATOM   9943  C  "C2'" . DC  J 6 44  ? 12.520  -36.818 14.426 1.00 125.97 ? -29  DC  J "C2'" 1 
ATOM   9944  C  "C1'" . DC  J 6 44  ? 11.313  -35.981 14.002 1.00 126.04 ? -29  DC  J "C1'" 1 
ATOM   9945  N  N1    . DC  J 6 44  ? 10.233  -35.781 15.044 1.00 125.92 ? -29  DC  J N1    1 
ATOM   9946  C  C2    . DC  J 6 44  ? 9.900   -34.473 15.468 1.00 126.06 ? -29  DC  J C2    1 
ATOM   9947  O  O2    . DC  J 6 44  ? 10.491  -33.488 14.996 1.00 126.13 ? -29  DC  J O2    1 
ATOM   9948  N  N3    . DC  J 6 44  ? 8.922   -34.314 16.400 1.00 126.00 ? -29  DC  J N3    1 
ATOM   9949  C  C4    . DC  J 6 44  ? 8.291   -35.384 16.904 1.00 125.77 ? -29  DC  J C4    1 
ATOM   9950  N  N4    . DC  J 6 44  ? 7.339   -35.165 17.817 1.00 125.67 ? -29  DC  J N4    1 
ATOM   9951  C  C5    . DC  J 6 44  ? 8.607   -36.720 16.487 1.00 125.49 ? -29  DC  J C5    1 
ATOM   9952  C  C6    . DC  J 6 44  ? 9.571   -36.868 15.568 1.00 125.51 ? -29  DC  J C6    1 
ATOM   9953  P  P     . DT  J 6 45  ? 15.629  -36.574 13.216 1.00 125.62 ? -28  DT  J P     1 
ATOM   9954  O  OP1   . DT  J 6 45  ? 16.579  -36.146 12.163 1.00 125.49 ? -28  DT  J OP1   1 
ATOM   9955  O  OP2   . DT  J 6 45  ? 15.790  -37.897 13.864 1.00 125.57 ? -28  DT  J OP2   1 
ATOM   9956  O  "O5'" . DT  J 6 45  ? 15.609  -35.464 14.372 1.00 125.58 ? -28  DT  J "O5'" 1 
ATOM   9957  C  "C5'" . DT  J 6 45  ? 15.551  -34.069 14.059 1.00 125.22 ? -28  DT  J "C5'" 1 
ATOM   9958  C  "C4'" . DT  J 6 45  ? 15.316  -33.258 15.321 1.00 124.80 ? -28  DT  J "C4'" 1 
ATOM   9959  O  "O4'" . DT  J 6 45  ? 14.032  -33.638 15.884 1.00 124.62 ? -28  DT  J "O4'" 1 
ATOM   9960  C  "C3'" . DT  J 6 45  ? 16.355  -33.487 16.421 1.00 124.63 ? -28  DT  J "C3'" 1 
ATOM   9961  O  "O3'" . DT  J 6 45  ? 16.830  -32.237 16.928 1.00 124.32 ? -28  DT  J "O3'" 1 
ATOM   9962  C  "C2'" . DT  J 6 45  ? 15.587  -34.269 17.488 1.00 124.69 ? -28  DT  J "C2'" 1 
ATOM   9963  C  "C1'" . DT  J 6 45  ? 14.176  -33.721 17.286 1.00 124.70 ? -28  DT  J "C1'" 1 
ATOM   9964  N  N1    . DT  J 6 45  ? 13.057  -34.547 17.875 1.00 124.67 ? -28  DT  J N1    1 
ATOM   9965  C  C2    . DT  J 6 45  ? 11.912  -33.918 18.354 1.00 124.43 ? -28  DT  J C2    1 
ATOM   9966  O  O2    . DT  J 6 45  ? 11.727  -32.709 18.342 1.00 124.25 ? -28  DT  J O2    1 
ATOM   9967  N  N3    . DT  J 6 45  ? 10.964  -34.774 18.865 1.00 124.33 ? -28  DT  J N3    1 
ATOM   9968  C  C4    . DT  J 6 45  ? 11.035  -36.159 18.948 1.00 124.37 ? -28  DT  J C4    1 
ATOM   9969  O  O4    . DT  J 6 45  ? 10.117  -36.822 19.429 1.00 124.10 ? -28  DT  J O4    1 
ATOM   9970  C  C5    . DT  J 6 45  ? 12.254  -36.753 18.431 1.00 124.50 ? -28  DT  J C5    1 
ATOM   9971  C  C7    . DT  J 6 45  ? 12.474  -38.241 18.452 1.00 124.58 ? -28  DT  J C7    1 
ATOM   9972  C  C6    . DT  J 6 45  ? 13.187  -35.928 17.929 1.00 124.62 ? -28  DT  J C6    1 
ATOM   9973  P  P     . DG  J 6 46  ? 18.360  -32.133 17.466 1.00 124.07 ? -27  DG  J P     1 
ATOM   9974  O  OP1   . DG  J 6 46  ? 19.261  -32.361 16.294 1.00 124.05 ? -27  DG  J OP1   1 
ATOM   9975  O  OP2   . DG  J 6 46  ? 18.469  -32.991 18.695 1.00 123.51 ? -27  DG  J OP2   1 
ATOM   9976  O  "O5'" . DG  J 6 46  ? 18.524  -30.598 17.915 1.00 123.86 ? -27  DG  J "O5'" 1 
ATOM   9977  C  "C5'" . DG  J 6 46  ? 17.860  -29.522 17.215 1.00 123.26 ? -27  DG  J "C5'" 1 
ATOM   9978  C  "C4'" . DG  J 6 46  ? 17.141  -28.581 18.181 1.00 122.72 ? -27  DG  J "C4'" 1 
ATOM   9979  O  "O4'" . DG  J 6 46  ? 15.938  -29.198 18.711 1.00 122.60 ? -27  DG  J "O4'" 1 
ATOM   9980  C  "C3'" . DG  J 6 46  ? 17.924  -28.124 19.411 1.00 122.10 ? -27  DG  J "C3'" 1 
ATOM   9981  O  "O3'" . DG  J 6 46  ? 17.501  -26.814 19.768 1.00 121.12 ? -27  DG  J "O3'" 1 
ATOM   9982  C  "C2'" . DG  J 6 46  ? 17.517  -29.148 20.466 1.00 122.18 ? -27  DG  J "C2'" 1 
ATOM   9983  C  "C1'" . DG  J 6 46  ? 16.043  -29.333 20.118 1.00 122.75 ? -27  DG  J "C1'" 1 
ATOM   9984  N  N9    . DG  J 6 46  ? 15.499  -30.638 20.470 1.00 123.17 ? -27  DG  J N9    1 
ATOM   9985  C  C8    . DG  J 6 46  ? 15.910  -31.858 19.994 1.00 123.30 ? -27  DG  J C8    1 
ATOM   9986  N  N7    . DG  J 6 46  ? 15.237  -32.862 20.478 1.00 123.57 ? -27  DG  J N7    1 
ATOM   9987  C  C5    . DG  J 6 46  ? 14.315  -32.270 21.328 1.00 123.85 ? -27  DG  J C5    1 
ATOM   9988  C  C6    . DG  J 6 46  ? 13.313  -32.862 22.134 1.00 124.09 ? -27  DG  J C6    1 
ATOM   9989  O  O6    . DG  J 6 46  ? 13.042  -34.065 22.248 1.00 124.07 ? -27  DG  J O6    1 
ATOM   9990  N  N1    . DG  J 6 46  ? 12.588  -31.908 22.852 1.00 124.49 ? -27  DG  J N1    1 
ATOM   9991  C  C2    . DG  J 6 46  ? 12.808  -30.547 22.796 1.00 124.48 ? -27  DG  J C2    1 
ATOM   9992  N  N2    . DG  J 6 46  ? 12.013  -29.778 23.558 1.00 124.66 ? -27  DG  J N2    1 
ATOM   9993  N  N3    . DG  J 6 46  ? 13.749  -29.982 22.041 1.00 124.16 ? -27  DG  J N3    1 
ATOM   9994  C  C4    . DG  J 6 46  ? 14.461  -30.899 21.335 1.00 123.62 ? -27  DG  J C4    1 
ATOM   9995  P  P     . DC  J 6 47  ? 18.309  -25.938 20.840 1.00 120.56 ? -26  DC  J P     1 
ATOM   9996  O  OP1   . DC  J 6 47  ? 17.918  -24.522 20.627 1.00 120.49 ? -26  DC  J OP1   1 
ATOM   9997  O  OP2   . DC  J 6 47  ? 19.743  -26.326 20.784 1.00 120.68 ? -26  DC  J OP2   1 
ATOM   9998  O  "O5'" . DC  J 6 47  ? 17.744  -26.454 22.251 1.00 118.87 ? -26  DC  J "O5'" 1 
ATOM   9999  C  "C5'" . DC  J 6 47  ? 16.393  -26.204 22.666 1.00 116.16 ? -26  DC  J "C5'" 1 
ATOM   10000 C  "C4'" . DC  J 6 47  ? 16.115  -26.762 24.059 1.00 113.96 ? -26  DC  J "C4'" 1 
ATOM   10001 O  "O4'" . DC  J 6 47  ? 15.818  -28.180 23.952 1.00 113.58 ? -26  DC  J "O4'" 1 
ATOM   10002 C  "C3'" . DC  J 6 47  ? 17.255  -26.664 25.077 1.00 112.55 ? -26  DC  J "C3'" 1 
ATOM   10003 O  "O3'" . DC  J 6 47  ? 16.729  -26.308 26.346 1.00 110.41 ? -26  DC  J "O3'" 1 
ATOM   10004 C  "C2'" . DC  J 6 47  ? 17.827  -28.076 25.110 1.00 112.68 ? -26  DC  J "C2'" 1 
ATOM   10005 C  "C1'" . DC  J 6 47  ? 16.533  -28.863 24.963 1.00 113.35 ? -26  DC  J "C1'" 1 
ATOM   10006 N  N1    . DC  J 6 47  ? 16.689  -30.301 24.580 1.00 113.67 ? -26  DC  J N1    1 
ATOM   10007 C  C2    . DC  J 6 47  ? 16.059  -31.302 25.342 1.00 114.05 ? -26  DC  J C2    1 
ATOM   10008 O  O2    . DC  J 6 47  ? 15.377  -31.000 26.331 1.00 114.27 ? -26  DC  J O2    1 
ATOM   10009 N  N3    . DC  J 6 47  ? 16.213  -32.600 24.971 1.00 114.20 ? -26  DC  J N3    1 
ATOM   10010 C  C4    . DC  J 6 47  ? 16.951  -32.911 23.902 1.00 114.25 ? -26  DC  J C4    1 
ATOM   10011 N  N4    . DC  J 6 47  ? 17.071  -34.204 23.584 1.00 114.48 ? -26  DC  J N4    1 
ATOM   10012 C  C5    . DC  J 6 47  ? 17.600  -31.911 23.115 1.00 114.18 ? -26  DC  J C5    1 
ATOM   10013 C  C6    . DC  J 6 47  ? 17.441  -30.636 23.488 1.00 113.90 ? -26  DC  J C6    1 
ATOM   10014 P  P     . DT  J 6 48  ? 16.978  -24.850 26.954 1.00 109.31 ? -25  DT  J P     1 
ATOM   10015 O  OP1   . DT  J 6 48  ? 16.663  -23.845 25.904 1.00 109.05 ? -25  DT  J OP1   1 
ATOM   10016 O  OP2   . DT  J 6 48  ? 18.315  -24.878 27.596 1.00 109.19 ? -25  DT  J OP2   1 
ATOM   10017 O  "O5'" . DT  J 6 48  ? 15.866  -24.778 28.107 1.00 107.45 ? -25  DT  J "O5'" 1 
ATOM   10018 C  "C5'" . DT  J 6 48  ? 14.483  -24.578 27.775 1.00 104.25 ? -25  DT  J "C5'" 1 
ATOM   10019 C  "C4'" . DT  J 6 48  ? 13.554  -25.457 28.603 1.00 101.53 ? -25  DT  J "C4'" 1 
ATOM   10020 O  "O4'" . DT  J 6 48  ? 13.836  -26.854 28.338 1.00 101.37 ? -25  DT  J "O4'" 1 
ATOM   10021 C  "C3'" . DT  J 6 48  ? 13.647  -25.291 30.119 1.00 99.46  ? -25  DT  J "C3'" 1 
ATOM   10022 O  "O3'" . DT  J 6 48  ? 12.345  -25.353 30.696 1.00 95.52  ? -25  DT  J "O3'" 1 
ATOM   10023 C  "C2'" . DT  J 6 48  ? 14.492  -26.483 30.561 1.00 100.30 ? -25  DT  J "C2'" 1 
ATOM   10024 C  "C1'" . DT  J 6 48  ? 14.030  -27.537 29.560 1.00 101.51 ? -25  DT  J "C1'" 1 
ATOM   10025 N  N1    . DT  J 6 48  ? 15.025  -28.619 29.347 1.00 102.77 ? -25  DT  J N1    1 
ATOM   10026 C  C2    . DT  J 6 48  ? 14.637  -29.946 29.460 1.00 103.60 ? -25  DT  J C2    1 
ATOM   10027 O  O2    . DT  J 6 48  ? 13.501  -30.312 29.728 1.00 103.95 ? -25  DT  J O2    1 
ATOM   10028 N  N3    . DT  J 6 48  ? 15.652  -30.852 29.244 1.00 103.89 ? -25  DT  J N3    1 
ATOM   10029 C  C4    . DT  J 6 48  ? 16.976  -30.569 28.936 1.00 104.06 ? -25  DT  J C4    1 
ATOM   10030 O  O4    . DT  J 6 48  ? 17.795  -31.463 28.758 1.00 104.41 ? -25  DT  J O4    1 
ATOM   10031 C  C5    . DT  J 6 48  ? 17.315  -29.163 28.833 1.00 104.10 ? -25  DT  J C5    1 
ATOM   10032 C  C7    . DT  J 6 48  ? 18.714  -28.711 28.506 1.00 104.22 ? -25  DT  J C