data_4JDA
# 
_entry.id   4JDA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4JDA         
RCSB  RCSB077901   
WWPDB D_1000077901 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DSC . unspecified 
PDB 3KL1 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4JDA 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, X.' 1 
'Wang, G.'  2 
'Chen, Z.'  3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Insights into the Abscisic Acid Stereospecificity by the ABA Receptors PYR/PYL/RCAR' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            8 
_citation.page_first                e67477 
_citation.page_last                 e67477 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23844015 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0067477 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, X.' 1 
primary 'Jiang, L.' 2 
primary 'Wang, G.'  3 
primary 'Yu, L.'    4 
primary 'Zhang, Q.' 5 
primary 'Xin, Q.'   6 
primary 'Wu, W.'    7 
primary 'Gong, Z.'  8 
primary 'Chen, Z.'  9 
# 
_cell.entry_id           4JDA 
_cell.length_a           142.738 
_cell.length_b           142.738 
_cell.length_c           99.802 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4JDA 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Abscisic acid receptor PYL3'                                                                       21645.680 4  
? ? 'UNP residues 21-209' ? 
2 non-polymer syn '(2Z,4E)-5-[(1R)-1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl]-3-methylpenta-2,4-dienoic acid' 264.317   4  
? ? ?                     ? 
3 water       nat water                                                                                               18.015    95 
? ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PYR1-like protein 3, Regulatory components of ABA receptor 13' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMTPYGLTKDEFSTLDSIIRTHHTFPRSPNTCTSLIAHRVDAPAHAIWRFVRDFANPNKYKHFIKSCTIRVNGNGIKEI
KVGTIREVSVVSGLPASTSVEILEVLDEEKRILSFRVLGGEHRLNNYRSVTSVNEFVVLEKDKKKRVYSVVLESYIVDIP
QGNTEEDTRMFVDTVVKSNLQNLAVISTASPT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMTPYGLTKDEFSTLDSIIRTHHTFPRSPNTCTSLIAHRVDAPAHAIWRFVRDFANPNKYKHFIKSCTIRVNGNGIKEI
KVGTIREVSVVSGLPASTSVEILEVLDEEKRILSFRVLGGEHRLNNYRSVTSVNEFVVLEKDKKKRVYSVVLESYIVDIP
QGNTEEDTRMFVDTVVKSNLQNLAVISTASPT
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   THR n 
1 5   PRO n 
1 6   TYR n 
1 7   GLY n 
1 8   LEU n 
1 9   THR n 
1 10  LYS n 
1 11  ASP n 
1 12  GLU n 
1 13  PHE n 
1 14  SER n 
1 15  THR n 
1 16  LEU n 
1 17  ASP n 
1 18  SER n 
1 19  ILE n 
1 20  ILE n 
1 21  ARG n 
1 22  THR n 
1 23  HIS n 
1 24  HIS n 
1 25  THR n 
1 26  PHE n 
1 27  PRO n 
1 28  ARG n 
1 29  SER n 
1 30  PRO n 
1 31  ASN n 
1 32  THR n 
1 33  CYS n 
1 34  THR n 
1 35  SER n 
1 36  LEU n 
1 37  ILE n 
1 38  ALA n 
1 39  HIS n 
1 40  ARG n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  PRO n 
1 45  ALA n 
1 46  HIS n 
1 47  ALA n 
1 48  ILE n 
1 49  TRP n 
1 50  ARG n 
1 51  PHE n 
1 52  VAL n 
1 53  ARG n 
1 54  ASP n 
1 55  PHE n 
1 56  ALA n 
1 57  ASN n 
1 58  PRO n 
1 59  ASN n 
1 60  LYS n 
1 61  TYR n 
1 62  LYS n 
1 63  HIS n 
1 64  PHE n 
1 65  ILE n 
1 66  LYS n 
1 67  SER n 
1 68  CYS n 
1 69  THR n 
1 70  ILE n 
1 71  ARG n 
1 72  VAL n 
1 73  ASN n 
1 74  GLY n 
1 75  ASN n 
1 76  GLY n 
1 77  ILE n 
1 78  LYS n 
1 79  GLU n 
1 80  ILE n 
1 81  LYS n 
1 82  VAL n 
1 83  GLY n 
1 84  THR n 
1 85  ILE n 
1 86  ARG n 
1 87  GLU n 
1 88  VAL n 
1 89  SER n 
1 90  VAL n 
1 91  VAL n 
1 92  SER n 
1 93  GLY n 
1 94  LEU n 
1 95  PRO n 
1 96  ALA n 
1 97  SER n 
1 98  THR n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 ILE n 
1 103 LEU n 
1 104 GLU n 
1 105 VAL n 
1 106 LEU n 
1 107 ASP n 
1 108 GLU n 
1 109 GLU n 
1 110 LYS n 
1 111 ARG n 
1 112 ILE n 
1 113 LEU n 
1 114 SER n 
1 115 PHE n 
1 116 ARG n 
1 117 VAL n 
1 118 LEU n 
1 119 GLY n 
1 120 GLY n 
1 121 GLU n 
1 122 HIS n 
1 123 ARG n 
1 124 LEU n 
1 125 ASN n 
1 126 ASN n 
1 127 TYR n 
1 128 ARG n 
1 129 SER n 
1 130 VAL n 
1 131 THR n 
1 132 SER n 
1 133 VAL n 
1 134 ASN n 
1 135 GLU n 
1 136 PHE n 
1 137 VAL n 
1 138 VAL n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 ASP n 
1 143 LYS n 
1 144 LYS n 
1 145 LYS n 
1 146 ARG n 
1 147 VAL n 
1 148 TYR n 
1 149 SER n 
1 150 VAL n 
1 151 VAL n 
1 152 LEU n 
1 153 GLU n 
1 154 SER n 
1 155 TYR n 
1 156 ILE n 
1 157 VAL n 
1 158 ASP n 
1 159 ILE n 
1 160 PRO n 
1 161 GLN n 
1 162 GLY n 
1 163 ASN n 
1 164 THR n 
1 165 GLU n 
1 166 GLU n 
1 167 ASP n 
1 168 THR n 
1 169 ARG n 
1 170 MET n 
1 171 PHE n 
1 172 VAL n 
1 173 ASP n 
1 174 THR n 
1 175 VAL n 
1 176 VAL n 
1 177 LYS n 
1 178 SER n 
1 179 ASN n 
1 180 LEU n 
1 181 GLN n 
1 182 ASN n 
1 183 LEU n 
1 184 ALA n 
1 185 VAL n 
1 186 ILE n 
1 187 SER n 
1 188 THR n 
1 189 ALA n 
1 190 SER n 
1 191 PRO n 
1 192 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'mouse-ear cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PYL3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta 2 (DE3) cells' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pgex 4t-2' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYL3_ARATH 
_struct_ref.pdbx_db_accession          Q9SSM7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TPYGLTKDEFSTLDSIIRTHHTFPRSPNTCTSLIAHRVDAPAHAIWRFVRDFANPNKYKHFIKSCTIRVNGNGIKEIKVG
TIREVSVVSGLPASTSVEILEVLDEEKRILSFRVLGGEHRLNNYRSVTSVNEFVVLEKDKKKRVYSVVLESYIVDIPQGN
TEEDTRMFVDTVVKSNLQNLAVISTASPT
;
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4JDA A 4 ? 192 ? Q9SSM7 21 ? 209 ? 21 209 
2 1 4JDA B 4 ? 192 ? Q9SSM7 21 ? 209 ? 21 209 
3 1 4JDA C 4 ? 192 ? Q9SSM7 21 ? 209 ? 21 209 
4 1 4JDA D 4 ? 192 ? Q9SSM7 21 ? 209 ? 21 209 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4JDA GLY A 1 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 18 1  
1 4JDA HIS A 2 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 19 2  
1 4JDA MET A 3 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 20 3  
2 4JDA GLY B 1 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 18 4  
2 4JDA HIS B 2 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 19 5  
2 4JDA MET B 3 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 20 6  
3 4JDA GLY C 1 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 18 7  
3 4JDA HIS C 2 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 19 8  
3 4JDA MET C 3 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 20 9  
4 4JDA GLY D 1 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 18 10 
4 4JDA HIS D 2 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 19 11 
4 4JDA MET D 3 ? UNP Q9SSM7 ? ? 'EXPRESSION TAG' 20 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A9S non-polymer         . '(2Z,4E)-5-[(1R)-1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl]-3-methylpenta-2,4-dienoic acid' ? 
'C15 H20 O4'     264.317 
ALA 'L-peptide linking' y ALANINE                                                                                             ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                            ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                          ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                     ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                            ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                           ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                     ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                             ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                           ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                               ? 
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                          ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                             ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                              ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                          ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                       ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                             ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                              ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                           ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                          ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                            ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                              ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4JDA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.39 
_exptl_crystal.density_percent_sol   63.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'20% PEG 8000, 0.1M Tris-HCl, 0.2M MgCl2, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           130 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX-225' 
_diffrn_detector.pdbx_collection_date   2010-07-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4JDA 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   3 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.65 
_reflns.number_obs                   32032 
_reflns.number_all                   33679 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.65 
_reflns_shell.d_res_low                   2.70 
_reflns_shell.percent_possible_all        70.8 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           1198 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4JDA 
_refine.ls_number_reflns_obs                     29323 
_refine.ls_number_reflns_all                     33679 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.12 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    91.68 
_refine.ls_R_factor_obs                          0.24459 
_refine.ls_R_factor_all                          0.24459 
_refine.ls_R_factor_R_work                       0.24332 
_refine.ls_R_factor_R_free                       0.26728 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1544 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.930 
_refine.correlation_coeff_Fo_to_Fc_free          0.918 
_refine.B_iso_mean                               63.446 
_refine.aniso_B[1][1]                            -3.67 
_refine.aniso_B[2][2]                            -3.67 
_refine.aniso_B[3][3]                            11.90 
_refine.aniso_B[1][2]                            -3.67 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      4DSC 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.564 
_refine.pdbx_overall_ESU_R_Free                  0.318 
_refine.overall_SU_ML                            0.263 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             26.481 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5225 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.number_atoms_solvent             95 
_refine_hist.number_atoms_total               5396 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        38.12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.008  0.019  ? 5396  ? 'X-RAY DIFFRACTION' 
r_bond_other_d         0.001  0.020  ? 4957  ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.287  1.951  ? 7372  ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      0.769  3.000  ? 11260 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.866  5.000  ? 683   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 36.325 23.163 ? 215   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 17.622 15.000 ? 790   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 14.663 15.000 ? 36    ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.069  0.200  ? 901   ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.004  0.020  ? 6121  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     0.001  0.020  ? 1269  ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.651 
_refine_ls_shell.d_res_low                        2.719 
_refine_ls_shell.number_reflns_R_work             1559 
_refine_ls_shell.R_factor_R_work                  0.347 
_refine_ls_shell.percent_reflns_obs               66.05 
_refine_ls_shell.R_factor_R_free                  0.485 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             81 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4JDA 
_struct.title                     'Complex structure of abscisic acid receptor PYL3 with (-)-ABA' 
_struct.pdbx_descriptor           'Abscisic acid receptor PYL3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4JDA 
_struct_keywords.pdbx_keywords   'HORMONE RECEPTOR' 
_struct_keywords.text            'abscisic acid receptor, PP2C, HORMONE RECEPTOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 9   ? HIS A 24  ? THR A 26  HIS A 41  1 ? 16 
HELX_P HELX_P2  2  PRO A 44  ? ARG A 53  ? PRO A 61  ARG A 70  1 ? 10 
HELX_P HELX_P3  3  ASN A 57  ? TYR A 61  ? ASN A 74  TYR A 78  5 ? 5  
HELX_P HELX_P4  4  THR A 164 ? SER A 187 ? THR A 181 SER A 204 1 ? 24 
HELX_P HELX_P5  5  THR B 9   ? HIS B 24  ? THR B 26  HIS B 41  1 ? 16 
HELX_P HELX_P6  6  PRO B 44  ? ARG B 53  ? PRO B 61  ARG B 70  1 ? 10 
HELX_P HELX_P7  7  ASN B 57  ? TYR B 61  ? ASN B 74  TYR B 78  5 ? 5  
HELX_P HELX_P8  8  THR B 164 ? ALA B 189 ? THR B 181 ALA B 206 1 ? 26 
HELX_P HELX_P9  9  THR C 9   ? HIS C 24  ? THR C 26  HIS C 41  1 ? 16 
HELX_P HELX_P10 10 PRO C 44  ? ARG C 53  ? PRO C 61  ARG C 70  1 ? 10 
HELX_P HELX_P11 11 ASN C 57  ? TYR C 61  ? ASN C 74  TYR C 78  5 ? 5  
HELX_P HELX_P12 12 THR C 164 ? ALA C 189 ? THR C 181 ALA C 206 1 ? 26 
HELX_P HELX_P13 13 THR D 9   ? THR D 15  ? THR D 26  THR D 32  1 ? 7  
HELX_P HELX_P14 14 LEU D 16  ? HIS D 24  ? LEU D 33  HIS D 41  1 ? 9  
HELX_P HELX_P15 15 PRO D 44  ? ARG D 53  ? PRO D 61  ARG D 70  1 ? 10 
HELX_P HELX_P16 16 ASN D 57  ? TYR D 61  ? ASN D 74  TYR D 78  5 ? 5  
HELX_P HELX_P17 17 THR D 164 ? SER D 187 ? THR D 181 SER D 204 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 7 ? 
D ? 7 ? 
E ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 32  ? VAL A 41  ? THR A 49  VAL A 58  
A 2 ARG A 146 ? ASP A 158 ? ARG A 163 ASP A 175 
A 3 ARG A 128 ? VAL A 138 ? ARG A 145 VAL A 155 
A 4 ILE A 112 ? GLY A 119 ? ILE A 129 GLY A 136 
A 5 THR A 98  ? ASP A 107 ? THR A 115 ASP A 124 
A 6 ILE A 85  ? VAL A 90  ? ILE A 102 VAL A 107 
A 7 ILE A 65  ? VAL A 72  ? ILE A 82  VAL A 89  
B 1 THR B 32  ? VAL B 41  ? THR B 49  VAL B 58  
B 2 TYR B 148 ? ASP B 158 ? TYR B 165 ASP B 175 
B 3 ARG B 128 ? PHE B 136 ? ARG B 145 PHE B 153 
B 4 ILE B 112 ? GLY B 119 ? ILE B 129 GLY B 136 
B 5 THR B 98  ? ASP B 107 ? THR B 115 ASP B 124 
B 6 ILE B 85  ? VAL B 90  ? ILE B 102 VAL B 107 
B 7 ILE B 65  ? VAL B 72  ? ILE B 82  VAL B 89  
C 1 THR C 32  ? VAL C 41  ? THR C 49  VAL C 58  
C 2 TYR C 148 ? ASP C 158 ? TYR C 165 ASP C 175 
C 3 ARG C 128 ? PHE C 136 ? ARG C 145 PHE C 153 
C 4 ILE C 112 ? GLY C 119 ? ILE C 129 GLY C 136 
C 5 THR C 98  ? ASP C 107 ? THR C 115 ASP C 124 
C 6 ILE C 85  ? VAL C 90  ? ILE C 102 VAL C 107 
C 7 ILE C 65  ? SER C 67  ? ILE C 82  SER C 84  
D 1 THR C 32  ? VAL C 41  ? THR C 49  VAL C 58  
D 2 TYR C 148 ? ASP C 158 ? TYR C 165 ASP C 175 
D 3 ARG C 128 ? PHE C 136 ? ARG C 145 PHE C 153 
D 4 ILE C 112 ? GLY C 119 ? ILE C 129 GLY C 136 
D 5 THR C 98  ? ASP C 107 ? THR C 115 ASP C 124 
D 6 ILE C 85  ? VAL C 90  ? ILE C 102 VAL C 107 
D 7 ILE C 70  ? VAL C 72  ? ILE C 87  VAL C 89  
E 1 THR D 32  ? VAL D 41  ? THR D 49  VAL D 58  
E 2 TYR D 148 ? ASP D 158 ? TYR D 165 ASP D 175 
E 3 ARG D 128 ? PHE D 136 ? ARG D 145 PHE D 153 
E 4 ILE D 112 ? GLY D 119 ? ILE D 129 GLY D 136 
E 5 THR D 98  ? ASP D 107 ? THR D 115 ASP D 124 
E 6 ILE D 85  ? VAL D 90  ? ILE D 102 VAL D 107 
E 7 ILE D 65  ? ILE D 70  ? ILE D 82  ILE D 87  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 37  ? N ILE A 54  O GLU A 153 ? O GLU A 170 
A 2 3 O ILE A 156 ? O ILE A 173 N ARG A 128 ? N ARG A 145 
A 3 4 O THR A 131 ? O THR A 148 N LEU A 113 ? N LEU A 130 
A 4 5 O ARG A 116 ? O ARG A 133 N ILE A 102 ? N ILE A 119 
A 5 6 O SER A 99  ? O SER A 116 N VAL A 88  ? N VAL A 105 
A 6 7 O SER A 89  ? O SER A 106 N SER A 67  ? N SER A 84  
B 1 2 N ILE B 37  ? N ILE B 54  O GLU B 153 ? O GLU B 170 
B 2 3 O TYR B 148 ? O TYR B 165 N PHE B 136 ? N PHE B 153 
B 3 4 O THR B 131 ? O THR B 148 N LEU B 113 ? N LEU B 130 
B 4 5 O LEU B 118 ? O LEU B 135 N VAL B 100 ? N VAL B 117 
B 5 6 O SER B 99  ? O SER B 116 N VAL B 88  ? N VAL B 105 
B 6 7 O SER B 89  ? O SER B 106 N SER B 67  ? N SER B 84  
C 1 2 N ILE C 37  ? N ILE C 54  O GLU C 153 ? O GLU C 170 
C 2 3 O TYR C 148 ? O TYR C 165 N PHE C 136 ? N PHE C 153 
C 3 4 O THR C 131 ? O THR C 148 N LEU C 113 ? N LEU C 130 
C 4 5 O LEU C 118 ? O LEU C 135 N VAL C 100 ? N VAL C 117 
C 5 6 O GLU C 101 ? O GLU C 118 N ARG C 86  ? N ARG C 103 
C 6 7 O SER C 89  ? O SER C 106 N SER C 67  ? N SER C 84  
D 1 2 N ILE C 37  ? N ILE C 54  O GLU C 153 ? O GLU C 170 
D 2 3 O TYR C 148 ? O TYR C 165 N PHE C 136 ? N PHE C 153 
D 3 4 O THR C 131 ? O THR C 148 N LEU C 113 ? N LEU C 130 
D 4 5 O LEU C 118 ? O LEU C 135 N VAL C 100 ? N VAL C 117 
D 5 6 O GLU C 101 ? O GLU C 118 N ARG C 86  ? N ARG C 103 
D 6 7 O ILE C 85  ? O ILE C 102 N ARG C 71  ? N ARG C 88  
E 1 2 N ILE D 37  ? N ILE D 54  O GLU D 153 ? O GLU D 170 
E 2 3 O ILE D 156 ? O ILE D 173 N ARG D 128 ? N ARG D 145 
E 3 4 O SER D 129 ? O SER D 146 N PHE D 115 ? N PHE D 132 
E 4 5 O SER D 114 ? O SER D 131 N GLU D 104 ? N GLU D 121 
E 5 6 O SER D 99  ? O SER D 116 N VAL D 88  ? N VAL D 105 
E 6 7 O GLU D 87  ? O GLU D 104 N THR D 69  ? N THR D 86  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE A9S A 301' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE A9S B 301' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE A9S C 301' 
AC4 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE A9S D 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 LYS A 62  ? LYS A 79  . ? 1_555 ? 
2  AC1 8 VAL A 90  ? VAL A 107 . ? 1_555 ? 
3  AC1 8 ALA A 96  ? ALA A 113 . ? 1_555 ? 
4  AC1 8 SER A 99  ? SER A 116 . ? 1_555 ? 
5  AC1 8 PHE A 115 ? PHE A 132 . ? 1_555 ? 
6  AC1 8 HIS A 122 ? HIS A 139 . ? 1_555 ? 
7  AC1 8 LEU A 124 ? LEU A 141 . ? 1_555 ? 
8  AC1 8 TYR A 127 ? TYR A 144 . ? 1_555 ? 
9  AC2 7 LYS B 62  ? LYS B 79  . ? 1_555 ? 
10 AC2 7 ALA B 96  ? ALA B 113 . ? 1_555 ? 
11 AC2 7 SER B 99  ? SER B 116 . ? 1_555 ? 
12 AC2 7 LEU B 124 ? LEU B 141 . ? 1_555 ? 
13 AC2 7 TYR B 127 ? TYR B 144 . ? 1_555 ? 
14 AC2 7 VAL B 172 ? VAL B 189 . ? 1_555 ? 
15 AC2 7 ASN B 179 ? ASN B 196 . ? 1_555 ? 
16 AC3 7 LYS C 62  ? LYS C 79  . ? 1_555 ? 
17 AC3 7 VAL C 90  ? VAL C 107 . ? 1_555 ? 
18 AC3 7 SER C 99  ? SER C 116 . ? 1_555 ? 
19 AC3 7 HIS C 122 ? HIS C 139 . ? 1_555 ? 
20 AC3 7 LEU C 124 ? LEU C 141 . ? 1_555 ? 
21 AC3 7 TYR C 127 ? TYR C 144 . ? 1_555 ? 
22 AC3 7 VAL C 175 ? VAL C 192 . ? 1_555 ? 
23 AC4 9 LYS D 62  ? LYS D 79  . ? 1_555 ? 
24 AC4 9 VAL D 90  ? VAL D 107 . ? 1_555 ? 
25 AC4 9 ALA D 96  ? ALA D 113 . ? 1_555 ? 
26 AC4 9 SER D 99  ? SER D 116 . ? 1_555 ? 
27 AC4 9 HIS D 122 ? HIS D 139 . ? 1_555 ? 
28 AC4 9 LEU D 124 ? LEU D 141 . ? 1_555 ? 
29 AC4 9 TYR D 127 ? TYR D 144 . ? 1_555 ? 
30 AC4 9 GLU D 153 ? GLU D 170 . ? 1_555 ? 
31 AC4 9 ASN D 179 ? ASN D 196 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4JDA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4JDA 
_atom_sites.fract_transf_matrix[1][1]   0.007006 
_atom_sites.fract_transf_matrix[1][2]   0.004045 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008090 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010020 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . TYR A 1 6   ? 46.188  -57.098 10.976  1.00 88.11  ? 23  TYR A N   1 
ATOM   2    C CA  . TYR A 1 6   ? 46.775  -57.781 9.780   1.00 81.58  ? 23  TYR A CA  1 
ATOM   3    C C   . TYR A 1 6   ? 48.316  -57.748 9.731   1.00 76.58  ? 23  TYR A C   1 
ATOM   4    O O   . TYR A 1 6   ? 48.950  -58.745 9.385   1.00 73.41  ? 23  TYR A O   1 
ATOM   5    C CB  . TYR A 1 6   ? 46.158  -57.246 8.475   1.00 81.18  ? 23  TYR A CB  1 
ATOM   6    C CG  . TYR A 1 6   ? 45.819  -55.763 8.417   1.00 81.81  ? 23  TYR A CG  1 
ATOM   7    C CD1 . TYR A 1 6   ? 46.797  -54.799 8.602   1.00 86.24  ? 23  TYR A CD1 1 
ATOM   8    C CD2 . TYR A 1 6   ? 44.521  -55.327 8.120   1.00 81.98  ? 23  TYR A CD2 1 
ATOM   9    C CE1 . TYR A 1 6   ? 46.507  -53.449 8.521   1.00 87.45  ? 23  TYR A CE1 1 
ATOM   10   C CE2 . TYR A 1 6   ? 44.222  -53.976 8.033   1.00 83.57  ? 23  TYR A CE2 1 
ATOM   11   C CZ  . TYR A 1 6   ? 45.230  -53.042 8.234   1.00 86.53  ? 23  TYR A CZ  1 
ATOM   12   O OH  . TYR A 1 6   ? 45.000  -51.687 8.161   1.00 92.70  ? 23  TYR A OH  1 
ATOM   13   N N   . GLY A 1 7   ? 48.914  -56.619 10.103  1.00 72.24  ? 24  GLY A N   1 
ATOM   14   C CA  . GLY A 1 7   ? 50.365  -56.434 9.997   1.00 69.75  ? 24  GLY A CA  1 
ATOM   15   C C   . GLY A 1 7   ? 50.843  -56.105 8.592   1.00 67.76  ? 24  GLY A C   1 
ATOM   16   O O   . GLY A 1 7   ? 52.039  -55.936 8.368   1.00 64.44  ? 24  GLY A O   1 
ATOM   17   N N   . LEU A 1 8   ? 49.900  -56.014 7.656   1.00 66.52  ? 25  LEU A N   1 
ATOM   18   C CA  . LEU A 1 8   ? 50.180  -55.824 6.238   1.00 67.34  ? 25  LEU A CA  1 
ATOM   19   C C   . LEU A 1 8   ? 50.405  -54.357 5.857   1.00 67.17  ? 25  LEU A C   1 
ATOM   20   O O   . LEU A 1 8   ? 49.896  -53.442 6.508   1.00 66.12  ? 25  LEU A O   1 
ATOM   21   C CB  . LEU A 1 8   ? 49.017  -56.385 5.397   1.00 66.76  ? 25  LEU A CB  1 
ATOM   22   C CG  . LEU A 1 8   ? 49.044  -57.836 4.881   1.00 65.37  ? 25  LEU A CG  1 
ATOM   23   C CD1 . LEU A 1 8   ? 49.852  -58.784 5.755   1.00 63.59  ? 25  LEU A CD1 1 
ATOM   24   C CD2 . LEU A 1 8   ? 47.616  -58.341 4.680   1.00 62.97  ? 25  LEU A CD2 1 
ATOM   25   N N   . THR A 1 9   ? 51.173  -54.157 4.787   1.00 67.17  ? 26  THR A N   1 
ATOM   26   C CA  . THR A 1 9   ? 51.303  -52.855 4.139   1.00 66.64  ? 26  THR A CA  1 
ATOM   27   C C   . THR A 1 9   ? 50.109  -52.646 3.227   1.00 65.71  ? 26  THR A C   1 
ATOM   28   O O   . THR A 1 9   ? 49.528  -53.616 2.739   1.00 66.58  ? 26  THR A O   1 
ATOM   29   C CB  . THR A 1 9   ? 52.553  -52.799 3.251   1.00 67.50  ? 26  THR A CB  1 
ATOM   30   O OG1 . THR A 1 9   ? 52.448  -53.792 2.219   1.00 70.05  ? 26  THR A OG1 1 
ATOM   31   C CG2 . THR A 1 9   ? 53.806  -53.049 4.066   1.00 66.95  ? 26  THR A CG2 1 
ATOM   32   N N   . LYS A 1 10  ? 49.757  -51.389 2.973   1.00 65.76  ? 27  LYS A N   1 
ATOM   33   C CA  . LYS A 1 10  ? 48.680  -51.076 2.028   1.00 65.55  ? 27  LYS A CA  1 
ATOM   34   C C   . LYS A 1 10  ? 48.851  -51.831 0.697   1.00 66.45  ? 27  LYS A C   1 
ATOM   35   O O   . LYS A 1 10  ? 47.884  -52.367 0.162   1.00 66.02  ? 27  LYS A O   1 
ATOM   36   C CB  . LYS A 1 10  ? 48.570  -49.562 1.801   1.00 66.72  ? 27  LYS A CB  1 
ATOM   37   C CG  . LYS A 1 10  ? 48.017  -48.788 2.996   1.00 66.45  ? 27  LYS A CG  1 
ATOM   38   N N   . ASP A 1 11  ? 50.079  -51.903 0.186   1.00 68.86  ? 28  ASP A N   1 
ATOM   39   C CA  . ASP A 1 11  ? 50.349  -52.646 -1.052  1.00 71.98  ? 28  ASP A CA  1 
ATOM   40   C C   . ASP A 1 11  ? 50.035  -54.133 -0.926  1.00 70.11  ? 28  ASP A C   1 
ATOM   41   O O   . ASP A 1 11  ? 49.428  -54.714 -1.817  1.00 70.67  ? 28  ASP A O   1 
ATOM   42   C CB  . ASP A 1 11  ? 51.808  -52.477 -1.493  1.00 76.49  ? 28  ASP A CB  1 
ATOM   43   N N   . GLU A 1 12  ? 50.448  -54.742 0.180   1.00 67.38  ? 29  GLU A N   1 
ATOM   44   C CA  . GLU A 1 12  ? 50.261  -56.178 0.369   1.00 63.99  ? 29  GLU A CA  1 
ATOM   45   C C   . GLU A 1 12  ? 48.790  -56.537 0.531   1.00 64.47  ? 29  GLU A C   1 
ATOM   46   O O   . GLU A 1 12  ? 48.318  -57.525 -0.030  1.00 66.53  ? 29  GLU A O   1 
ATOM   47   C CB  . GLU A 1 12  ? 51.038  -56.664 1.584   1.00 61.55  ? 29  GLU A CB  1 
ATOM   48   C CG  . GLU A 1 12  ? 52.537  -56.729 1.381   1.00 59.93  ? 29  GLU A CG  1 
ATOM   49   C CD  . GLU A 1 12  ? 53.293  -56.652 2.683   1.00 59.78  ? 29  GLU A CD  1 
ATOM   50   O OE1 . GLU A 1 12  ? 52.667  -56.273 3.694   1.00 61.13  ? 29  GLU A OE1 1 
ATOM   51   O OE2 . GLU A 1 12  ? 54.510  -56.958 2.705   1.00 60.15  ? 29  GLU A OE2 1 
ATOM   52   N N   . PHE A 1 13  ? 48.064  -55.741 1.303   1.00 65.66  ? 30  PHE A N   1 
ATOM   53   C CA  . PHE A 1 13  ? 46.647  -56.009 1.507   1.00 66.28  ? 30  PHE A CA  1 
ATOM   54   C C   . PHE A 1 13  ? 45.854  -55.684 0.250   1.00 64.96  ? 30  PHE A C   1 
ATOM   55   O O   . PHE A 1 13  ? 44.849  -56.332 -0.031  1.00 62.45  ? 30  PHE A O   1 
ATOM   56   C CB  . PHE A 1 13  ? 46.091  -55.250 2.718   1.00 67.66  ? 30  PHE A CB  1 
ATOM   57   C CG  . PHE A 1 13  ? 44.621  -55.498 2.960   1.00 66.16  ? 30  PHE A CG  1 
ATOM   58   C CD1 . PHE A 1 13  ? 44.170  -56.756 3.333   1.00 61.89  ? 30  PHE A CD1 1 
ATOM   59   C CD2 . PHE A 1 13  ? 43.685  -54.477 2.780   1.00 66.63  ? 30  PHE A CD2 1 
ATOM   60   C CE1 . PHE A 1 13  ? 42.824  -56.987 3.540   1.00 61.56  ? 30  PHE A CE1 1 
ATOM   61   C CE2 . PHE A 1 13  ? 42.336  -54.708 2.987   1.00 63.69  ? 30  PHE A CE2 1 
ATOM   62   C CZ  . PHE A 1 13  ? 41.906  -55.967 3.371   1.00 61.62  ? 30  PHE A CZ  1 
ATOM   63   N N   . SER A 1 14  ? 46.317  -54.702 -0.521  1.00 68.24  ? 31  SER A N   1 
ATOM   64   C CA  . SER A 1 14  ? 45.679  -54.387 -1.804  1.00 67.76  ? 31  SER A CA  1 
ATOM   65   C C   . SER A 1 14  ? 45.495  -55.685 -2.573  1.00 66.19  ? 31  SER A C   1 
ATOM   66   O O   . SER A 1 14  ? 44.400  -55.973 -3.052  1.00 67.26  ? 31  SER A O   1 
ATOM   67   C CB  . SER A 1 14  ? 46.509  -53.398 -2.629  1.00 68.36  ? 31  SER A CB  1 
ATOM   68   N N   . THR A 1 15  ? 46.550  -56.499 -2.627  1.00 62.94  ? 32  THR A N   1 
ATOM   69   C CA  . THR A 1 15  ? 46.533  -57.679 -3.482  1.00 59.84  ? 32  THR A CA  1 
ATOM   70   C C   . THR A 1 15  ? 45.983  -58.911 -2.775  1.00 55.85  ? 32  THR A C   1 
ATOM   71   O O   . THR A 1 15  ? 45.447  -59.793 -3.443  1.00 57.47  ? 32  THR A O   1 
ATOM   72   C CB  . THR A 1 15  ? 47.914  -58.019 -4.102  1.00 61.80  ? 32  THR A CB  1 
ATOM   73   O OG1 . THR A 1 15  ? 48.342  -59.312 -3.659  1.00 61.53  ? 32  THR A OG1 1 
ATOM   74   C CG2 . THR A 1 15  ? 48.986  -56.962 -3.799  1.00 62.04  ? 32  THR A CG2 1 
ATOM   75   N N   . LEU A 1 16  ? 46.098  -58.977 -1.445  1.00 52.20  ? 33  LEU A N   1 
ATOM   76   C CA  . LEU A 1 16  ? 45.603  -60.136 -0.659  1.00 48.49  ? 33  LEU A CA  1 
ATOM   77   C C   . LEU A 1 16  ? 44.132  -60.023 -0.192  1.00 45.30  ? 33  LEU A C   1 
ATOM   78   O O   . LEU A 1 16  ? 43.461  -61.032 0.031   1.00 42.05  ? 33  LEU A O   1 
ATOM   79   C CB  . LEU A 1 16  ? 46.492  -60.348 0.557   1.00 49.85  ? 33  LEU A CB  1 
ATOM   80   C CG  . LEU A 1 16  ? 47.824  -61.112 0.507   1.00 51.51  ? 33  LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 16  ? 48.478  -61.156 -0.854  1.00 53.65  ? 33  LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 16  ? 48.781  -60.505 1.523   1.00 51.36  ? 33  LEU A CD2 1 
ATOM   83   N N   . ASP A 1 17  ? 43.629  -58.804 -0.042  1.00 44.82  ? 34  ASP A N   1 
ATOM   84   C CA  . ASP A 1 17  ? 42.226  -58.598 0.342   1.00 45.52  ? 34  ASP A CA  1 
ATOM   85   C C   . ASP A 1 17  ? 41.346  -59.671 -0.317  1.00 46.98  ? 34  ASP A C   1 
ATOM   86   O O   . ASP A 1 17  ? 40.705  -60.456 0.347   1.00 47.95  ? 34  ASP A O   1 
ATOM   87   C CB  . ASP A 1 17  ? 41.780  -57.177 -0.040  1.00 45.66  ? 34  ASP A CB  1 
ATOM   88   C CG  . ASP A 1 17  ? 40.409  -56.819 0.488   0.50 46.51  ? 34  ASP A CG  1 
ATOM   89   O OD1 . ASP A 1 17  ? 39.769  -57.693 1.081   1.00 49.19  ? 34  ASP A OD1 1 
ATOM   90   O OD2 . ASP A 1 17  ? 39.968  -55.656 0.334   1.00 46.17  ? 34  ASP A OD2 1 
ATOM   91   N N   . SER A 1 18  ? 41.367  -59.714 -1.637  1.00 50.98  ? 35  SER A N   1 
ATOM   92   C CA  . SER A 1 18  ? 40.627  -60.697 -2.428  1.00 52.36  ? 35  SER A CA  1 
ATOM   93   C C   . SER A 1 18  ? 40.805  -62.132 -1.927  1.00 50.46  ? 35  SER A C   1 
ATOM   94   O O   . SER A 1 18  ? 39.836  -62.802 -1.659  1.00 47.72  ? 35  SER A O   1 
ATOM   95   C CB  . SER A 1 18  ? 41.067  -60.590 -3.900  1.00 54.75  ? 35  SER A CB  1 
ATOM   96   O OG  . SER A 1 18  ? 40.473  -61.605 -4.695  1.00 58.94  ? 35  SER A OG  1 
ATOM   97   N N   . ILE A 1 19  ? 42.051  -62.574 -1.790  1.00 52.72  ? 36  ILE A N   1 
ATOM   98   C CA  . ILE A 1 19  ? 42.386  -63.945 -1.394  1.00 53.66  ? 36  ILE A CA  1 
ATOM   99   C C   . ILE A 1 19  ? 41.953  -64.239 0.046   1.00 56.88  ? 36  ILE A C   1 
ATOM   100  O O   . ILE A 1 19  ? 41.533  -65.364 0.352   1.00 59.87  ? 36  ILE A O   1 
ATOM   101  C CB  . ILE A 1 19  ? 43.913  -64.207 -1.493  1.00 54.74  ? 36  ILE A CB  1 
ATOM   102  C CG1 . ILE A 1 19  ? 44.445  -63.974 -2.927  1.00 53.35  ? 36  ILE A CG1 1 
ATOM   103  C CG2 . ILE A 1 19  ? 44.262  -65.607 -0.994  1.00 53.62  ? 36  ILE A CG2 1 
ATOM   104  N N   . ILE A 1 20  ? 42.076  -63.252 0.938   1.00 56.10  ? 37  ILE A N   1 
ATOM   105  C CA  . ILE A 1 20  ? 41.584  -63.424 2.304   1.00 56.08  ? 37  ILE A CA  1 
ATOM   106  C C   . ILE A 1 20  ? 40.071  -63.653 2.240   1.00 56.62  ? 37  ILE A C   1 
ATOM   107  O O   . ILE A 1 20  ? 39.540  -64.675 2.695   1.00 56.41  ? 37  ILE A O   1 
ATOM   108  C CB  . ILE A 1 20  ? 41.892  -62.194 3.206   1.00 56.28  ? 37  ILE A CB  1 
ATOM   109  C CG1 . ILE A 1 20  ? 43.402  -62.047 3.428   1.00 56.13  ? 37  ILE A CG1 1 
ATOM   110  C CG2 . ILE A 1 20  ? 41.196  -62.308 4.559   1.00 53.63  ? 37  ILE A CG2 1 
ATOM   111  C CD1 . ILE A 1 20  ? 43.820  -60.619 3.703   1.00 57.55  ? 37  ILE A CD1 1 
ATOM   112  N N   . ARG A 1 21  ? 39.383  -62.700 1.634   1.00 55.19  ? 38  ARG A N   1 
ATOM   113  C CA  . ARG A 1 21  ? 37.947  -62.715 1.647   1.00 54.02  ? 38  ARG A CA  1 
ATOM   114  C C   . ARG A 1 21  ? 37.437  -64.023 1.067   1.00 54.38  ? 38  ARG A C   1 
ATOM   115  O O   . ARG A 1 21  ? 36.614  -64.677 1.701   1.00 58.35  ? 38  ARG A O   1 
ATOM   116  C CB  . ARG A 1 21  ? 37.393  -61.495 0.927   1.00 53.83  ? 38  ARG A CB  1 
ATOM   117  C CG  . ARG A 1 21  ? 37.846  -60.190 1.561   1.00 54.85  ? 38  ARG A CG  1 
ATOM   118  C CD  . ARG A 1 21  ? 37.266  -58.977 0.867   1.00 56.22  ? 38  ARG A CD  1 
ATOM   119  N NE  . ARG A 1 21  ? 35.898  -58.746 1.300   1.00 59.33  ? 38  ARG A NE  1 
ATOM   120  C CZ  . ARG A 1 21  ? 35.504  -57.797 2.146   1.00 60.37  ? 38  ARG A CZ  1 
ATOM   121  N NH1 . ARG A 1 21  ? 36.372  -56.937 2.676   1.00 59.76  ? 38  ARG A NH1 1 
ATOM   122  N NH2 . ARG A 1 21  ? 34.212  -57.709 2.456   1.00 61.56  ? 38  ARG A NH2 1 
ATOM   123  N N   . THR A 1 22  ? 37.953  -64.457 -0.082  1.00 53.36  ? 39  THR A N   1 
ATOM   124  C CA  . THR A 1 22  ? 37.380  -65.663 -0.710  1.00 53.45  ? 39  THR A CA  1 
ATOM   125  C C   . THR A 1 22  ? 37.850  -66.963 -0.061  1.00 51.79  ? 39  THR A C   1 
ATOM   126  O O   . THR A 1 22  ? 37.041  -67.879 0.113   1.00 50.18  ? 39  THR A O   1 
ATOM   127  C CB  . THR A 1 22  ? 37.477  -65.747 -2.287  1.00 53.64  ? 39  THR A CB  1 
ATOM   128  O OG1 . THR A 1 22  ? 38.006  -67.022 -2.684  1.00 52.85  ? 39  THR A OG1 1 
ATOM   129  C CG2 . THR A 1 22  ? 38.326  -64.687 -2.903  1.00 53.37  ? 39  THR A CG2 1 
ATOM   130  N N   . HIS A 1 23  ? 39.126  -67.048 0.296   1.00 52.19  ? 40  HIS A N   1 
ATOM   131  C CA  . HIS A 1 23  ? 39.685  -68.306 0.812   1.00 54.48  ? 40  HIS A CA  1 
ATOM   132  C C   . HIS A 1 23  ? 39.850  -68.445 2.336   1.00 54.64  ? 40  HIS A C   1 
ATOM   133  O O   . HIS A 1 23  ? 39.697  -69.561 2.835   1.00 54.78  ? 40  HIS A O   1 
ATOM   134  C CB  . HIS A 1 23  ? 41.039  -68.587 0.170   1.00 56.78  ? 40  HIS A CB  1 
ATOM   135  C CG  . HIS A 1 23  ? 40.957  -68.898 -1.286  1.00 59.33  ? 40  HIS A CG  1 
ATOM   136  N ND1 . HIS A 1 23  ? 40.375  -70.050 -1.765  1.00 60.67  ? 40  HIS A ND1 1 
ATOM   137  C CD2 . HIS A 1 23  ? 41.389  -68.213 -2.369  1.00 61.53  ? 40  HIS A CD2 1 
ATOM   138  C CE1 . HIS A 1 23  ? 40.440  -70.056 -3.084  1.00 62.93  ? 40  HIS A CE1 1 
ATOM   139  N NE2 . HIS A 1 23  ? 41.057  -68.955 -3.474  1.00 63.90  ? 40  HIS A NE2 1 
ATOM   140  N N   . HIS A 1 24  ? 40.186  -67.360 3.054   1.00 53.82  ? 41  HIS A N   1 
ATOM   141  C CA  . HIS A 1 24  ? 40.571  -67.443 4.498   1.00 54.27  ? 41  HIS A CA  1 
ATOM   142  C C   . HIS A 1 24  ? 39.459  -67.111 5.512   1.00 53.20  ? 41  HIS A C   1 
ATOM   143  O O   . HIS A 1 24  ? 39.553  -67.497 6.651   1.00 54.43  ? 41  HIS A O   1 
ATOM   144  C CB  . HIS A 1 24  ? 41.799  -66.562 4.811   1.00 54.21  ? 41  HIS A CB  1 
ATOM   145  C CG  . HIS A 1 24  ? 43.097  -67.074 4.241   1.00 54.48  ? 41  HIS A CG  1 
ATOM   146  N ND1 . HIS A 1 24  ? 43.698  -68.239 4.660   1.00 55.70  ? 41  HIS A ND1 1 
ATOM   147  C CD2 . HIS A 1 24  ? 43.929  -66.545 3.313   1.00 54.08  ? 41  HIS A CD2 1 
ATOM   148  C CE1 . HIS A 1 24  ? 44.829  -68.419 3.999   1.00 53.95  ? 41  HIS A CE1 1 
ATOM   149  N NE2 . HIS A 1 24  ? 44.987  -67.407 3.169   1.00 52.20  ? 41  HIS A NE2 1 
ATOM   150  N N   . THR A 1 25  ? 38.432  -66.386 5.094   1.00 55.74  ? 42  THR A N   1 
ATOM   151  C CA  . THR A 1 25  ? 37.270  -66.048 5.926   1.00 55.36  ? 42  THR A CA  1 
ATOM   152  C C   . THR A 1 25  ? 36.528  -67.259 6.486   1.00 57.07  ? 42  THR A C   1 
ATOM   153  O O   . THR A 1 25  ? 36.341  -68.258 5.796   1.00 58.89  ? 42  THR A O   1 
ATOM   154  C CB  . THR A 1 25  ? 36.251  -65.229 5.097   1.00 56.92  ? 42  THR A CB  1 
ATOM   155  O OG1 . THR A 1 25  ? 36.464  -63.834 5.326   1.00 57.30  ? 42  THR A OG1 1 
ATOM   156  C CG2 . THR A 1 25  ? 34.792  -65.560 5.449   1.00 59.04  ? 42  THR A CG2 1 
ATOM   157  N N   . PHE A 1 26  ? 36.076  -67.158 7.735   1.00 57.21  ? 43  PHE A N   1 
ATOM   158  C CA  . PHE A 1 26  ? 35.105  -68.114 8.261   1.00 56.23  ? 43  PHE A CA  1 
ATOM   159  C C   . PHE A 1 26  ? 33.889  -67.387 8.801   1.00 57.50  ? 43  PHE A C   1 
ATOM   160  O O   . PHE A 1 26  ? 34.031  -66.358 9.453   1.00 62.59  ? 43  PHE A O   1 
ATOM   161  C CB  . PHE A 1 26  ? 35.720  -68.927 9.380   1.00 54.14  ? 43  PHE A CB  1 
ATOM   162  C CG  . PHE A 1 26  ? 36.853  -69.779 8.941   1.00 51.32  ? 43  PHE A CG  1 
ATOM   163  C CD1 . PHE A 1 26  ? 36.623  -71.040 8.445   1.00 49.95  ? 43  PHE A CD1 1 
ATOM   164  C CD2 . PHE A 1 26  ? 38.153  -69.314 9.033   1.00 49.78  ? 43  PHE A CD2 1 
ATOM   165  C CE1 . PHE A 1 26  ? 37.671  -71.834 8.040   1.00 49.67  ? 43  PHE A CE1 1 
ATOM   166  C CE2 . PHE A 1 26  ? 39.211  -70.101 8.643   1.00 48.82  ? 43  PHE A CE2 1 
ATOM   167  C CZ  . PHE A 1 26  ? 38.969  -71.363 8.141   1.00 49.91  ? 43  PHE A CZ  1 
ATOM   168  N N   . PRO A 1 27  ? 32.692  -67.931 8.563   0.50 57.73  ? 44  PRO A N   1 
ATOM   169  C CA  . PRO A 1 27  ? 31.502  -67.293 9.112   1.00 60.28  ? 44  PRO A CA  1 
ATOM   170  C C   . PRO A 1 27  ? 31.363  -67.483 10.633  1.00 62.80  ? 44  PRO A C   1 
ATOM   171  O O   . PRO A 1 27  ? 31.428  -68.609 11.133  1.00 62.62  ? 44  PRO A O   1 
ATOM   172  C CB  . PRO A 1 27  ? 30.359  -67.974 8.359   1.00 59.07  ? 44  PRO A CB  1 
ATOM   173  C CG  . PRO A 1 27  ? 30.895  -69.312 7.971   1.00 58.30  ? 44  PRO A CG  1 
ATOM   174  C CD  . PRO A 1 27  ? 32.382  -69.169 7.830   1.00 57.15  ? 44  PRO A CD  1 
ATOM   175  N N   . ARG A 1 28  ? 31.185  -66.373 11.344  1.00 65.68  ? 45  ARG A N   1 
ATOM   176  C CA  . ARG A 1 28  ? 30.915  -66.387 12.774  1.00 70.57  ? 45  ARG A CA  1 
ATOM   177  C C   . ARG A 1 28  ? 29.815  -67.403 13.097  1.00 73.08  ? 45  ARG A C   1 
ATOM   178  O O   . ARG A 1 28  ? 28.795  -67.446 12.427  1.00 74.47  ? 45  ARG A O   1 
ATOM   179  C CB  . ARG A 1 28  ? 30.520  -64.972 13.239  1.00 72.15  ? 45  ARG A CB  1 
ATOM   180  C CG  . ARG A 1 28  ? 29.942  -64.878 14.652  1.00 74.32  ? 45  ARG A CG  1 
ATOM   181  C CD  . ARG A 1 28  ? 29.953  -63.452 15.206  1.00 74.09  ? 45  ARG A CD  1 
ATOM   182  N NE  . ARG A 1 28  ? 31.099  -63.190 16.082  1.00 74.88  ? 45  ARG A NE  1 
ATOM   183  N N   . SER A 1 29  ? 30.063  -68.254 14.089  1.00 77.28  ? 46  SER A N   1 
ATOM   184  C CA  . SER A 1 29  ? 29.045  -69.153 14.653  1.00 78.34  ? 46  SER A CA  1 
ATOM   185  C C   . SER A 1 29  ? 29.041  -68.872 16.151  1.00 78.79  ? 46  SER A C   1 
ATOM   186  O O   . SER A 1 29  ? 29.971  -68.248 16.653  1.00 79.05  ? 46  SER A O   1 
ATOM   187  C CB  . SER A 1 29  ? 29.385  -70.630 14.397  1.00 78.67  ? 46  SER A CB  1 
ATOM   188  O OG  . SER A 1 29  ? 29.976  -70.833 13.121  1.00 79.54  ? 46  SER A OG  1 
ATOM   189  N N   . PRO A 1 30  ? 28.000  -69.318 16.877  1.00 81.18  ? 47  PRO A N   1 
ATOM   190  C CA  . PRO A 1 30  ? 28.051  -69.128 18.333  1.00 77.62  ? 47  PRO A CA  1 
ATOM   191  C C   . PRO A 1 30  ? 29.138  -69.985 18.946  1.00 74.25  ? 47  PRO A C   1 
ATOM   192  O O   . PRO A 1 30  ? 29.340  -71.122 18.521  1.00 72.01  ? 47  PRO A O   1 
ATOM   193  C CB  . PRO A 1 30  ? 26.670  -69.593 18.811  1.00 79.70  ? 47  PRO A CB  1 
ATOM   194  C CG  . PRO A 1 30  ? 26.153  -70.471 17.723  1.00 81.29  ? 47  PRO A CG  1 
ATOM   195  C CD  . PRO A 1 30  ? 26.731  -69.932 16.442  1.00 81.57  ? 47  PRO A CD  1 
ATOM   196  N N   . ASN A 1 31  ? 29.842  -69.425 19.922  1.00 72.44  ? 48  ASN A N   1 
ATOM   197  C CA  . ASN A 1 31  ? 30.909  -70.129 20.618  1.00 72.41  ? 48  ASN A CA  1 
ATOM   198  C C   . ASN A 1 31  ? 32.049  -70.622 19.719  1.00 68.67  ? 48  ASN A C   1 
ATOM   199  O O   . ASN A 1 31  ? 32.660  -71.663 19.985  1.00 68.01  ? 48  ASN A O   1 
ATOM   200  C CB  . ASN A 1 31  ? 30.320  -71.277 21.448  1.00 76.13  ? 48  ASN A CB  1 
ATOM   201  C CG  . ASN A 1 31  ? 29.606  -70.779 22.683  1.00 79.01  ? 48  ASN A CG  1 
ATOM   202  O OD1 . ASN A 1 31  ? 30.242  -70.287 23.620  1.00 82.01  ? 48  ASN A OD1 1 
ATOM   203  N ND2 . ASN A 1 31  ? 28.286  -70.901 22.697  1.00 79.57  ? 48  ASN A ND2 1 
ATOM   204  N N   . THR A 1 32  ? 32.348  -69.857 18.671  1.00 66.07  ? 49  THR A N   1 
ATOM   205  C CA  . THR A 1 32  ? 33.524  -70.122 17.835  1.00 63.89  ? 49  THR A CA  1 
ATOM   206  C C   . THR A 1 32  ? 34.482  -68.951 17.850  1.00 62.46  ? 49  THR A C   1 
ATOM   207  O O   . THR A 1 32  ? 34.092  -67.809 18.045  1.00 63.90  ? 49  THR A O   1 
ATOM   208  C CB  . THR A 1 32  ? 33.167  -70.437 16.379  1.00 60.86  ? 49  THR A CB  1 
ATOM   209  O OG1 . THR A 1 32  ? 32.316  -69.406 15.860  1.00 61.53  ? 49  THR A OG1 1 
ATOM   210  C CG2 . THR A 1 32  ? 32.476  -71.779 16.300  1.00 60.70  ? 49  THR A CG2 1 
ATOM   211  N N   . CYS A 1 33  ? 35.751  -69.268 17.657  1.00 61.78  ? 50  CYS A N   1 
ATOM   212  C CA  . CYS A 1 33  ? 36.825  -68.291 17.681  1.00 58.54  ? 50  CYS A CA  1 
ATOM   213  C C   . CYS A 1 33  ? 37.433  -68.333 16.300  1.00 55.60  ? 50  CYS A C   1 
ATOM   214  O O   . CYS A 1 33  ? 37.702  -69.414 15.778  1.00 54.98  ? 50  CYS A O   1 
ATOM   215  C CB  . CYS A 1 33  ? 37.866  -68.673 18.742  1.00 55.93  ? 50  CYS A CB  1 
ATOM   216  S SG  . CYS A 1 33  ? 39.176  -67.466 18.899  0.50 53.10  ? 50  CYS A SG  1 
ATOM   217  N N   . THR A 1 34  ? 37.615  -67.168 15.696  1.00 55.14  ? 51  THR A N   1 
ATOM   218  C CA  . THR A 1 34  ? 38.233  -67.085 14.382  1.00 55.72  ? 51  THR A CA  1 
ATOM   219  C C   . THR A 1 34  ? 39.289  -66.003 14.401  1.00 54.47  ? 51  THR A C   1 
ATOM   220  O O   . THR A 1 34  ? 39.193  -65.027 15.159  1.00 53.71  ? 51  THR A O   1 
ATOM   221  C CB  . THR A 1 34  ? 37.197  -66.830 13.256  1.00 57.51  ? 51  THR A CB  1 
ATOM   222  O OG1 . THR A 1 34  ? 37.798  -67.072 11.979  1.00 58.67  ? 51  THR A OG1 1 
ATOM   223  C CG2 . THR A 1 34  ? 36.662  -65.405 13.295  1.00 58.04  ? 51  THR A CG2 1 
ATOM   224  N N   . SER A 1 35  ? 40.312  -66.199 13.577  1.00 54.75  ? 52  SER A N   1 
ATOM   225  C CA  . SER A 1 35  ? 41.430  -65.264 13.503  1.00 55.22  ? 52  SER A CA  1 
ATOM   226  C C   . SER A 1 35  ? 42.260  -65.505 12.265  1.00 52.47  ? 52  SER A C   1 
ATOM   227  O O   . SER A 1 35  ? 42.208  -66.572 11.665  1.00 49.58  ? 52  SER A O   1 
ATOM   228  C CB  . SER A 1 35  ? 42.342  -65.399 14.732  1.00 56.98  ? 52  SER A CB  1 
ATOM   229  O OG  . SER A 1 35  ? 43.408  -64.459 14.693  1.00 58.66  ? 52  SER A OG  1 
ATOM   230  N N   . LEU A 1 36  ? 43.041  -64.495 11.915  1.00 52.18  ? 53  LEU A N   1 
ATOM   231  C CA  . LEU A 1 36  ? 43.986  -64.591 10.831  1.00 52.68  ? 53  LEU A CA  1 
ATOM   232  C C   . LEU A 1 36  ? 45.308  -64.059 11.326  1.00 52.25  ? 53  LEU A C   1 
ATOM   233  O O   . LEU A 1 36  ? 45.344  -63.044 12.022  1.00 52.19  ? 53  LEU A O   1 
ATOM   234  C CB  . LEU A 1 36  ? 43.508  -63.749 9.667   1.00 53.57  ? 53  LEU A CB  1 
ATOM   235  C CG  . LEU A 1 36  ? 44.250  -63.815 8.341   1.00 52.34  ? 53  LEU A CG  1 
ATOM   236  C CD1 . LEU A 1 36  ? 43.310  -63.172 7.350   1.00 55.17  ? 53  LEU A CD1 1 
ATOM   237  C CD2 . LEU A 1 36  ? 45.575  -63.075 8.358   1.00 52.88  ? 53  LEU A CD2 1 
ATOM   238  N N   . ILE A 1 37  ? 46.378  -64.750 10.944  1.00 51.26  ? 54  ILE A N   1 
ATOM   239  C CA  . ILE A 1 37  ? 47.738  -64.350 11.246  1.00 51.40  ? 54  ILE A CA  1 
ATOM   240  C C   . ILE A 1 37  ? 48.512  -64.297 9.930   1.00 51.33  ? 54  ILE A C   1 
ATOM   241  O O   . ILE A 1 37  ? 48.350  -65.193 9.107   1.00 50.46  ? 54  ILE A O   1 
ATOM   242  C CB  . ILE A 1 37  ? 48.385  -65.357 12.228  1.00 50.87  ? 54  ILE A CB  1 
ATOM   243  C CG1 . ILE A 1 37  ? 47.841  -65.145 13.641  1.00 50.01  ? 54  ILE A CG1 1 
ATOM   244  C CG2 . ILE A 1 37  ? 49.900  -65.222 12.232  1.00 52.22  ? 54  ILE A CG2 1 
ATOM   245  N N   . ALA A 1 38  ? 49.355  -63.266 9.761   1.00 52.94  ? 55  ALA A N   1 
ATOM   246  C CA  . ALA A 1 38  ? 50.144  -63.021 8.526   1.00 51.68  ? 55  ALA A CA  1 
ATOM   247  C C   . ALA A 1 38  ? 51.642  -62.956 8.790   1.00 52.53  ? 55  ALA A C   1 
ATOM   248  O O   . ALA A 1 38  ? 52.099  -62.126 9.560   1.00 53.85  ? 55  ALA A O   1 
ATOM   249  C CB  . ALA A 1 38  ? 49.713  -61.714 7.896   1.00 50.58  ? 55  ALA A CB  1 
ATOM   250  N N   . HIS A 1 39  ? 52.428  -63.797 8.131   1.00 54.70  ? 56  HIS A N   1 
ATOM   251  C CA  . HIS A 1 39  ? 53.855  -63.823 8.416   1.00 56.27  ? 56  HIS A CA  1 
ATOM   252  C C   . HIS A 1 39  ? 54.706  -63.792 7.162   1.00 56.46  ? 56  HIS A C   1 
ATOM   253  O O   . HIS A 1 39  ? 54.518  -64.597 6.266   1.00 62.28  ? 56  HIS A O   1 
ATOM   254  C CB  . HIS A 1 39  ? 54.218  -65.052 9.260   1.00 57.19  ? 56  HIS A CB  1 
ATOM   255  C CG  . HIS A 1 39  ? 55.536  -64.920 9.961   1.00 59.93  ? 56  HIS A CG  1 
ATOM   256  N ND1 . HIS A 1 39  ? 56.729  -65.299 9.384   1.00 61.56  ? 56  HIS A ND1 1 
ATOM   257  C CD2 . HIS A 1 39  ? 55.852  -64.412 11.175  1.00 60.44  ? 56  HIS A CD2 1 
ATOM   258  C CE1 . HIS A 1 39  ? 57.722  -65.048 10.218  1.00 61.30  ? 56  HIS A CE1 1 
ATOM   259  N NE2 . HIS A 1 39  ? 57.216  -64.514 11.314  1.00 61.50  ? 56  HIS A NE2 1 
ATOM   260  N N   . ARG A 1 40  ? 55.663  -62.877 7.140   1.00 55.98  ? 57  ARG A N   1 
ATOM   261  C CA  . ARG A 1 40  ? 56.587  -62.715 6.038   1.00 57.20  ? 57  ARG A CA  1 
ATOM   262  C C   . ARG A 1 40  ? 57.775  -63.637 6.164   1.00 57.41  ? 57  ARG A C   1 
ATOM   263  O O   . ARG A 1 40  ? 58.362  -63.741 7.231   1.00 61.03  ? 57  ARG A O   1 
ATOM   264  C CB  . ARG A 1 40  ? 57.120  -61.286 5.995   1.00 57.71  ? 57  ARG A CB  1 
ATOM   265  C CG  . ARG A 1 40  ? 56.072  -60.281 5.580   1.00 60.60  ? 57  ARG A CG  1 
ATOM   266  C CD  . ARG A 1 40  ? 56.667  -58.907 5.306   1.00 63.15  ? 57  ARG A CD  1 
ATOM   267  N NE  . ARG A 1 40  ? 55.616  -57.890 5.264   1.00 65.32  ? 57  ARG A NE  1 
ATOM   268  C CZ  . ARG A 1 40  ? 55.017  -57.371 6.337   1.00 65.44  ? 57  ARG A CZ  1 
ATOM   269  N NH1 . ARG A 1 40  ? 55.362  -57.742 7.569   1.00 66.38  ? 57  ARG A NH1 1 
ATOM   270  N NH2 . ARG A 1 40  ? 54.061  -56.466 6.178   1.00 66.43  ? 57  ARG A NH2 1 
ATOM   271  N N   . VAL A 1 41  ? 58.138  -64.272 5.053   1.00 56.48  ? 58  VAL A N   1 
ATOM   272  C CA  . VAL A 1 41  ? 59.339  -65.068 4.950   1.00 55.16  ? 58  VAL A CA  1 
ATOM   273  C C   . VAL A 1 41  ? 60.140  -64.527 3.808   1.00 58.21  ? 58  VAL A C   1 
ATOM   274  O O   . VAL A 1 41  ? 59.584  -64.255 2.754   1.00 61.79  ? 58  VAL A O   1 
ATOM   275  C CB  . VAL A 1 41  ? 59.012  -66.512 4.614   1.00 54.16  ? 58  VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 41  ? 60.282  -67.352 4.575   1.00 54.11  ? 58  VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 41  ? 58.010  -67.055 5.614   1.00 54.20  ? 58  VAL A CG2 1 
ATOM   278  N N   . ASP A 1 42  ? 61.447  -64.387 3.994   1.00 61.86  ? 59  ASP A N   1 
ATOM   279  C CA  . ASP A 1 42  ? 62.311  -63.899 2.916   1.00 64.41  ? 59  ASP A CA  1 
ATOM   280  C C   . ASP A 1 42  ? 62.742  -65.065 2.039   1.00 62.04  ? 59  ASP A C   1 
ATOM   281  O O   . ASP A 1 42  ? 63.911  -65.440 2.009   1.00 62.50  ? 59  ASP A O   1 
ATOM   282  C CB  . ASP A 1 42  ? 63.512  -63.135 3.476   1.00 66.93  ? 59  ASP A CB  1 
ATOM   283  C CG  . ASP A 1 42  ? 63.092  -61.887 4.251   1.00 69.59  ? 59  ASP A CG  1 
ATOM   284  O OD1 . ASP A 1 42  ? 62.362  -61.046 3.671   0.50 68.30  ? 59  ASP A OD1 1 
ATOM   285  O OD2 . ASP A 1 42  ? 63.485  -61.756 5.437   0.50 68.64  ? 59  ASP A OD2 1 
ATOM   286  N N   . ALA A 1 43  ? 61.768  -65.636 1.338   1.00 58.96  ? 60  ALA A N   1 
ATOM   287  C CA  . ALA A 1 43  ? 62.010  -66.736 0.430   1.00 58.14  ? 60  ALA A CA  1 
ATOM   288  C C   . ALA A 1 43  ? 60.850  -66.841 -0.532  1.00 58.49  ? 60  ALA A C   1 
ATOM   289  O O   . ALA A 1 43  ? 59.729  -66.473 -0.182  1.00 57.84  ? 60  ALA A O   1 
ATOM   290  C CB  . ALA A 1 43  ? 62.170  -68.036 1.187   1.00 57.74  ? 60  ALA A CB  1 
ATOM   291  N N   . PRO A 1 44  ? 61.120  -67.326 -1.757  1.00 60.59  ? 61  PRO A N   1 
ATOM   292  C CA  . PRO A 1 44  ? 60.088  -67.454 -2.784  1.00 59.25  ? 61  PRO A CA  1 
ATOM   293  C C   . PRO A 1 44  ? 59.048  -68.487 -2.425  1.00 58.27  ? 61  PRO A C   1 
ATOM   294  O O   . PRO A 1 44  ? 59.337  -69.454 -1.714  1.00 60.45  ? 61  PRO A O   1 
ATOM   295  C CB  . PRO A 1 44  ? 60.868  -67.903 -4.021  1.00 62.13  ? 61  PRO A CB  1 
ATOM   296  C CG  . PRO A 1 44  ? 62.179  -68.408 -3.516  1.00 62.40  ? 61  PRO A CG  1 
ATOM   297  C CD  . PRO A 1 44  ? 62.465  -67.600 -2.298  1.00 61.47  ? 61  PRO A CD  1 
ATOM   298  N N   . ALA A 1 45  ? 57.849  -68.293 -2.943  1.00 56.00  ? 62  ALA A N   1 
ATOM   299  C CA  . ALA A 1 45  ? 56.701  -69.064 -2.514  1.00 54.79  ? 62  ALA A CA  1 
ATOM   300  C C   . ALA A 1 45  ? 56.875  -70.561 -2.697  1.00 55.64  ? 62  ALA A C   1 
ATOM   301  O O   . ALA A 1 45  ? 56.340  -71.355 -1.920  1.00 57.64  ? 62  ALA A O   1 
ATOM   302  C CB  . ALA A 1 45  ? 55.458  -68.591 -3.242  1.00 54.58  ? 62  ALA A CB  1 
ATOM   303  N N   . HIS A 1 46  ? 57.605  -70.971 -3.721  1.00 57.21  ? 63  HIS A N   1 
ATOM   304  C CA  . HIS A 1 46  ? 57.690  -72.397 -3.995  1.00 56.36  ? 63  HIS A CA  1 
ATOM   305  C C   . HIS A 1 46  ? 58.529  -73.077 -2.917  1.00 54.33  ? 63  HIS A C   1 
ATOM   306  O O   . HIS A 1 46  ? 58.324  -74.253 -2.626  1.00 53.40  ? 63  HIS A O   1 
ATOM   307  C CB  . HIS A 1 46  ? 58.232  -72.667 -5.400  1.00 57.46  ? 63  HIS A CB  1 
ATOM   308  C CG  . HIS A 1 46  ? 59.680  -72.358 -5.561  1.00 58.11  ? 63  HIS A CG  1 
ATOM   309  N ND1 . HIS A 1 46  ? 60.128  -71.227 -6.203  1.00 59.84  ? 63  HIS A ND1 1 
ATOM   310  C CD2 . HIS A 1 46  ? 60.785  -73.025 -5.156  1.00 58.98  ? 63  HIS A CD2 1 
ATOM   311  C CE1 . HIS A 1 46  ? 61.448  -71.211 -6.194  1.00 60.57  ? 63  HIS A CE1 1 
ATOM   312  N NE2 . HIS A 1 46  ? 61.872  -72.286 -5.555  1.00 60.68  ? 63  HIS A NE2 1 
ATOM   313  N N   . ALA A 1 47  ? 59.455  -72.323 -2.321  1.00 52.16  ? 64  ALA A N   1 
ATOM   314  C CA  . ALA A 1 47  ? 60.345  -72.863 -1.297  1.00 51.21  ? 64  ALA A CA  1 
ATOM   315  C C   . ALA A 1 47  ? 59.571  -73.171 -0.032  1.00 50.98  ? 64  ALA A C   1 
ATOM   316  O O   . ALA A 1 47  ? 59.814  -74.182 0.631   0.50 50.22  ? 64  ALA A O   1 
ATOM   317  C CB  . ALA A 1 47  ? 61.455  -71.878 -0.993  1.00 50.56  ? 64  ALA A CB  1 
ATOM   318  N N   . ILE A 1 48  ? 58.633  -72.288 0.295   1.00 51.32  ? 65  ILE A N   1 
ATOM   319  C CA  . ILE A 1 48  ? 57.843  -72.442 1.497   1.00 50.45  ? 65  ILE A CA  1 
ATOM   320  C C   . ILE A 1 48  ? 56.768  -73.474 1.283   1.00 50.34  ? 65  ILE A C   1 
ATOM   321  O O   . ILE A 1 48  ? 56.404  -74.204 2.202   1.00 53.84  ? 65  ILE A O   1 
ATOM   322  C CB  . ILE A 1 48  ? 57.172  -71.134 1.908   1.00 48.94  ? 65  ILE A CB  1 
ATOM   323  C CG1 . ILE A 1 48  ? 58.226  -70.076 2.215   1.00 47.97  ? 65  ILE A CG1 1 
ATOM   324  C CG2 . ILE A 1 48  ? 56.293  -71.373 3.128   1.00 48.16  ? 65  ILE A CG2 1 
ATOM   325  C CD1 . ILE A 1 48  ? 57.630  -68.708 2.454   1.00 48.16  ? 65  ILE A CD1 1 
ATOM   326  N N   . TRP A 1 49  ? 56.255  -73.531 0.069   1.00 50.04  ? 66  TRP A N   1 
ATOM   327  C CA  . TRP A 1 49  ? 55.167  -74.444 -0.246  1.00 49.70  ? 66  TRP A CA  1 
ATOM   328  C C   . TRP A 1 49  ? 55.633  -75.900 -0.173  1.00 48.59  ? 66  TRP A C   1 
ATOM   329  O O   . TRP A 1 49  ? 54.866  -76.801 0.137   1.00 46.24  ? 66  TRP A O   1 
ATOM   330  C CB  . TRP A 1 49  ? 54.630  -74.087 -1.633  1.00 51.67  ? 66  TRP A CB  1 
ATOM   331  C CG  . TRP A 1 49  ? 53.576  -74.981 -2.147  1.00 52.17  ? 66  TRP A CG  1 
ATOM   332  C CD1 . TRP A 1 49  ? 53.680  -75.844 -3.191  1.00 51.79  ? 66  TRP A CD1 1 
ATOM   333  C CD2 . TRP A 1 49  ? 52.257  -75.123 -1.629  1.00 53.37  ? 66  TRP A CD2 1 
ATOM   334  N NE1 . TRP A 1 49  ? 52.503  -76.515 -3.361  1.00 53.72  ? 66  TRP A NE1 1 
ATOM   335  C CE2 . TRP A 1 49  ? 51.606  -76.089 -2.417  1.00 54.72  ? 66  TRP A CE2 1 
ATOM   336  C CE3 . TRP A 1 49  ? 51.562  -74.532 -0.570  1.00 53.83  ? 66  TRP A CE3 1 
ATOM   337  C CZ2 . TRP A 1 49  ? 50.286  -76.483 -2.180  1.00 55.28  ? 66  TRP A CZ2 1 
ATOM   338  C CZ3 . TRP A 1 49  ? 50.258  -74.912 -0.338  1.00 53.90  ? 66  TRP A CZ3 1 
ATOM   339  C CH2 . TRP A 1 49  ? 49.630  -75.881 -1.139  1.00 55.40  ? 66  TRP A CH2 1 
ATOM   340  N N   . ARG A 1 50  ? 56.906  -76.132 -0.449  1.00 50.18  ? 67  ARG A N   1 
ATOM   341  C CA  . ARG A 1 50  ? 57.440  -77.470 -0.347  1.00 52.30  ? 67  ARG A CA  1 
ATOM   342  C C   . ARG A 1 50  ? 57.040  -78.068 0.985   1.00 54.42  ? 67  ARG A C   1 
ATOM   343  O O   . ARG A 1 50  ? 56.667  -79.244 1.045   1.00 57.45  ? 67  ARG A O   1 
ATOM   344  C CB  . ARG A 1 50  ? 58.956  -77.455 -0.462  1.00 53.89  ? 67  ARG A CB  1 
ATOM   345  C CG  . ARG A 1 50  ? 59.612  -78.799 -0.172  1.00 56.19  ? 67  ARG A CG  1 
ATOM   346  N N   . PHE A 1 51  ? 57.117  -77.249 2.049   1.00 52.64  ? 68  PHE A N   1 
ATOM   347  C CA  . PHE A 1 51  ? 56.842  -77.708 3.409   1.00 48.67  ? 68  PHE A CA  1 
ATOM   348  C C   . PHE A 1 51  ? 55.368  -77.640 3.734   1.00 48.06  ? 68  PHE A C   1 
ATOM   349  O O   . PHE A 1 51  ? 54.821  -78.581 4.293   1.00 47.89  ? 68  PHE A O   1 
ATOM   350  C CB  . PHE A 1 51  ? 57.638  -76.888 4.421   1.00 47.17  ? 68  PHE A CB  1 
ATOM   351  C CG  . PHE A 1 51  ? 59.124  -77.012 4.247   1.00 45.22  ? 68  PHE A CG  1 
ATOM   352  C CD1 . PHE A 1 51  ? 59.745  -78.222 4.438   1.00 44.65  ? 68  PHE A CD1 1 
ATOM   353  C CD2 . PHE A 1 51  ? 59.883  -75.932 3.887   1.00 44.23  ? 68  PHE A CD2 1 
ATOM   354  C CE1 . PHE A 1 51  ? 61.101  -78.354 4.266   1.00 44.84  ? 68  PHE A CE1 1 
ATOM   355  C CE2 . PHE A 1 51  ? 61.240  -76.051 3.715   1.00 44.41  ? 68  PHE A CE2 1 
ATOM   356  C CZ  . PHE A 1 51  ? 61.852  -77.262 3.910   1.00 44.75  ? 68  PHE A CZ  1 
ATOM   357  N N   . VAL A 1 52  ? 54.723  -76.535 3.380   1.00 46.35  ? 69  VAL A N   1 
ATOM   358  C CA  . VAL A 1 52  ? 53.324  -76.348 3.731   1.00 46.23  ? 69  VAL A CA  1 
ATOM   359  C C   . VAL A 1 52  ? 52.472  -77.504 3.225   1.00 48.93  ? 69  VAL A C   1 
ATOM   360  O O   . VAL A 1 52  ? 51.553  -77.953 3.919   1.00 49.17  ? 69  VAL A O   1 
ATOM   361  C CB  . VAL A 1 52  ? 52.777  -75.053 3.140   1.00 46.34  ? 69  VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 52  ? 51.278  -74.970 3.329   1.00 46.06  ? 69  VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 52  ? 53.460  -73.844 3.758   1.00 45.99  ? 69  VAL A CG2 1 
ATOM   364  N N   . ARG A 1 53  ? 52.795  -77.980 2.020   1.00 51.43  ? 70  ARG A N   1 
ATOM   365  C CA  . ARG A 1 53  ? 52.070  -79.064 1.338   1.00 52.40  ? 70  ARG A CA  1 
ATOM   366  C C   . ARG A 1 53  ? 52.397  -80.477 1.833   1.00 52.51  ? 70  ARG A C   1 
ATOM   367  O O   . ARG A 1 53  ? 51.730  -81.434 1.436   1.00 53.85  ? 70  ARG A O   1 
ATOM   368  C CB  . ARG A 1 53  ? 52.345  -78.995 -0.174  1.00 52.98  ? 70  ARG A CB  1 
ATOM   369  C CG  . ARG A 1 53  ? 53.705  -79.530 -0.591  1.00 56.01  ? 70  ARG A CG  1 
ATOM   370  C CD  . ARG A 1 53  ? 54.001  -79.264 -2.070  1.00 59.70  ? 70  ARG A CD  1 
ATOM   371  N NE  . ARG A 1 53  ? 53.172  -80.124 -2.917  1.00 60.13  ? 70  ARG A NE  1 
ATOM   372  C CZ  . ARG A 1 53  ? 53.482  -81.370 -3.266  1.00 59.85  ? 70  ARG A CZ  1 
ATOM   373  N NH1 . ARG A 1 53  ? 54.623  -81.938 -2.888  1.00 59.20  ? 70  ARG A NH1 1 
ATOM   374  N NH2 . ARG A 1 53  ? 52.634  -82.055 -4.004  1.00 61.84  ? 70  ARG A NH2 1 
ATOM   375  N N   . ASP A 1 54  ? 53.428  -80.609 2.670   1.00 51.84  ? 71  ASP A N   1 
ATOM   376  C CA  . ASP A 1 54  ? 53.976  -81.925 3.053   1.00 50.57  ? 71  ASP A CA  1 
ATOM   377  C C   . ASP A 1 54  ? 53.157  -82.473 4.189   1.00 51.59  ? 71  ASP A C   1 
ATOM   378  O O   . ASP A 1 54  ? 53.593  -82.500 5.342   1.00 50.52  ? 71  ASP A O   1 
ATOM   379  C CB  . ASP A 1 54  ? 55.450  -81.796 3.458   1.00 49.24  ? 71  ASP A CB  1 
ATOM   380  C CG  . ASP A 1 54  ? 56.106  -83.137 3.768   1.00 48.12  ? 71  ASP A CG  1 
ATOM   381  O OD1 . ASP A 1 54  ? 55.402  -84.125 4.027   1.00 47.49  ? 71  ASP A OD1 1 
ATOM   382  O OD2 . ASP A 1 54  ? 57.348  -83.197 3.755   1.00 47.28  ? 71  ASP A OD2 1 
ATOM   383  N N   . PHE A 1 55  ? 51.957  -82.922 3.842   1.00 53.39  ? 72  PHE A N   1 
ATOM   384  C CA  . PHE A 1 55  ? 50.906  -83.206 4.826   1.00 54.30  ? 72  PHE A CA  1 
ATOM   385  C C   . PHE A 1 55  ? 51.233  -84.343 5.812   1.00 56.56  ? 72  PHE A C   1 
ATOM   386  O O   . PHE A 1 55  ? 50.621  -84.438 6.877   1.00 56.52  ? 72  PHE A O   1 
ATOM   387  C CB  . PHE A 1 55  ? 49.624  -83.521 4.075   1.00 53.16  ? 72  PHE A CB  1 
ATOM   388  C CG  . PHE A 1 55  ? 48.419  -83.638 4.944   1.00 51.76  ? 72  PHE A CG  1 
ATOM   389  C CD1 . PHE A 1 55  ? 47.854  -82.514 5.511   1.00 50.94  ? 72  PHE A CD1 1 
ATOM   390  C CD2 . PHE A 1 55  ? 47.833  -84.870 5.167   1.00 51.87  ? 72  PHE A CD2 1 
ATOM   391  C CE1 . PHE A 1 55  ? 46.728  -82.617 6.299   1.00 51.25  ? 72  PHE A CE1 1 
ATOM   392  C CE2 . PHE A 1 55  ? 46.702  -84.984 5.953   1.00 52.21  ? 72  PHE A CE2 1 
ATOM   393  C CZ  . PHE A 1 55  ? 46.151  -83.858 6.523   1.00 52.18  ? 72  PHE A CZ  1 
ATOM   394  N N   . ALA A 1 56  ? 52.187  -85.196 5.459   1.00 58.41  ? 73  ALA A N   1 
ATOM   395  C CA  . ALA A 1 56  ? 52.548  -86.324 6.304   1.00 61.08  ? 73  ALA A CA  1 
ATOM   396  C C   . ALA A 1 56  ? 53.762  -86.018 7.168   1.00 63.05  ? 73  ALA A C   1 
ATOM   397  O O   . ALA A 1 56  ? 54.162  -86.864 7.974   1.00 65.11  ? 73  ALA A O   1 
ATOM   398  C CB  . ALA A 1 56  ? 52.824  -87.549 5.449   1.00 63.13  ? 73  ALA A CB  1 
ATOM   399  N N   . ASN A 1 57  ? 54.358  -84.833 6.978   1.00 62.51  ? 74  ASN A N   1 
ATOM   400  C CA  . ASN A 1 57  ? 55.507  -84.389 7.773   1.00 61.47  ? 74  ASN A CA  1 
ATOM   401  C C   . ASN A 1 57  ? 55.363  -82.929 8.215   1.00 60.13  ? 74  ASN A C   1 
ATOM   402  O O   . ASN A 1 57  ? 56.116  -82.058 7.764   1.00 61.49  ? 74  ASN A O   1 
ATOM   403  C CB  . ASN A 1 57  ? 56.820  -84.571 7.008   1.00 62.36  ? 74  ASN A CB  1 
ATOM   404  C CG  . ASN A 1 57  ? 56.968  -85.959 6.418   1.00 64.32  ? 74  ASN A CG  1 
ATOM   405  O OD1 . ASN A 1 57  ? 57.312  -86.911 7.110   1.00 66.89  ? 74  ASN A OD1 1 
ATOM   406  N ND2 . ASN A 1 57  ? 56.708  -86.076 5.126   1.00 65.09  ? 74  ASN A ND2 1 
ATOM   407  N N   . PRO A 1 58  ? 54.388  -82.660 9.104   1.00 58.52  ? 75  PRO A N   1 
ATOM   408  C CA  . PRO A 1 58  ? 54.202  -81.358 9.725   1.00 57.30  ? 75  PRO A CA  1 
ATOM   409  C C   . PRO A 1 58  ? 55.192  -81.084 10.841  1.00 59.74  ? 75  PRO A C   1 
ATOM   410  O O   . PRO A 1 58  ? 55.362  -79.940 11.252  1.00 58.99  ? 75  PRO A O   1 
ATOM   411  C CB  . PRO A 1 58  ? 52.802  -81.456 10.306  1.00 58.09  ? 75  PRO A CB  1 
ATOM   412  C CG  . PRO A 1 58  ? 52.634  -82.889 10.617  1.00 58.88  ? 75  PRO A CG  1 
ATOM   413  C CD  . PRO A 1 58  ? 53.322  -83.599 9.496   1.00 59.23  ? 75  PRO A CD  1 
ATOM   414  N N   . ASN A 1 59  ? 55.836  -82.131 11.343  1.00 63.58  ? 76  ASN A N   1 
ATOM   415  C CA  . ASN A 1 59  ? 56.884  -81.959 12.340  1.00 64.65  ? 76  ASN A CA  1 
ATOM   416  C C   . ASN A 1 59  ? 58.069  -81.150 11.812  1.00 64.45  ? 76  ASN A C   1 
ATOM   417  O O   . ASN A 1 59  ? 58.816  -80.577 12.596  1.00 66.67  ? 76  ASN A O   1 
ATOM   418  C CB  . ASN A 1 59  ? 57.348  -83.307 12.907  1.00 68.84  ? 76  ASN A CB  1 
ATOM   419  C CG  . ASN A 1 59  ? 57.621  -84.350 11.829  1.00 70.56  ? 76  ASN A CG  1 
ATOM   420  O OD1 . ASN A 1 59  ? 58.777  -84.686 11.561  0.50 70.26  ? 76  ASN A OD1 1 
ATOM   421  N ND2 . ASN A 1 59  ? 56.557  -84.887 11.226  1.00 69.11  ? 76  ASN A ND2 1 
ATOM   422  N N   . LYS A 1 60  ? 58.229  -81.089 10.490  1.00 63.45  ? 77  LYS A N   1 
ATOM   423  C CA  . LYS A 1 60  ? 59.306  -80.307 9.877   1.00 60.99  ? 77  LYS A CA  1 
ATOM   424  C C   . LYS A 1 60  ? 59.232  -78.819 10.229  1.00 58.75  ? 77  LYS A C   1 
ATOM   425  O O   . LYS A 1 60  ? 60.259  -78.160 10.318  1.00 58.37  ? 77  LYS A O   1 
ATOM   426  C CB  . LYS A 1 60  ? 59.350  -80.522 8.355   1.00 62.17  ? 77  LYS A CB  1 
ATOM   427  C CG  . LYS A 1 60  ? 60.271  -81.671 7.942   1.00 65.34  ? 77  LYS A CG  1 
ATOM   428  C CD  . LYS A 1 60  ? 59.862  -82.332 6.623   1.00 65.91  ? 77  LYS A CD  1 
ATOM   429  N N   . TYR A 1 61  ? 58.037  -78.284 10.441  1.00 56.61  ? 78  TYR A N   1 
ATOM   430  C CA  . TYR A 1 61  ? 57.920  -76.890 10.853  1.00 54.44  ? 78  TYR A CA  1 
ATOM   431  C C   . TYR A 1 61  ? 56.973  -76.622 11.997  1.00 52.80  ? 78  TYR A C   1 
ATOM   432  O O   . TYR A 1 61  ? 56.794  -75.470 12.367  1.00 50.57  ? 78  TYR A O   1 
ATOM   433  C CB  . TYR A 1 61  ? 57.544  -75.997 9.665   1.00 55.92  ? 78  TYR A CB  1 
ATOM   434  C CG  . TYR A 1 61  ? 56.126  -76.116 9.108   1.00 55.89  ? 78  TYR A CG  1 
ATOM   435  C CD1 . TYR A 1 61  ? 55.110  -75.256 9.518   1.00 54.80  ? 78  TYR A CD1 1 
ATOM   436  C CD2 . TYR A 1 61  ? 55.838  -77.029 8.102   1.00 57.88  ? 78  TYR A CD2 1 
ATOM   437  C CE1 . TYR A 1 61  ? 53.832  -75.344 8.977   1.00 55.46  ? 78  TYR A CE1 1 
ATOM   438  C CE2 . TYR A 1 61  ? 54.573  -77.118 7.539   1.00 58.40  ? 78  TYR A CE2 1 
ATOM   439  C CZ  . TYR A 1 61  ? 53.569  -76.278 7.972   1.00 57.89  ? 78  TYR A CZ  1 
ATOM   440  O OH  . TYR A 1 61  ? 52.318  -76.403 7.390   1.00 55.89  ? 78  TYR A OH  1 
ATOM   441  N N   . LYS A 1 62  ? 56.376  -77.669 12.559  1.00 53.35  ? 79  LYS A N   1 
ATOM   442  C CA  . LYS A 1 62  ? 55.494  -77.528 13.710  1.00 53.17  ? 79  LYS A CA  1 
ATOM   443  C C   . LYS A 1 62  ? 56.120  -78.219 14.910  1.00 54.78  ? 79  LYS A C   1 
ATOM   444  O O   . LYS A 1 62  ? 56.223  -79.447 14.948  1.00 55.25  ? 79  LYS A O   1 
ATOM   445  C CB  . LYS A 1 62  ? 54.139  -78.152 13.429  1.00 52.41  ? 79  LYS A CB  1 
ATOM   446  C CG  . LYS A 1 62  ? 53.402  -77.587 12.242  0.50 51.10  ? 79  LYS A CG  1 
ATOM   447  C CD  . LYS A 1 62  ? 51.996  -78.150 12.223  0.50 50.58  ? 79  LYS A CD  1 
ATOM   448  C CE  . LYS A 1 62  ? 51.208  -77.624 11.046  1.00 49.49  ? 79  LYS A CE  1 
ATOM   449  N NZ  . LYS A 1 62  ? 49.834  -78.180 11.042  1.00 50.77  ? 79  LYS A NZ  1 
ATOM   450  N N   . HIS A 1 63  ? 56.506  -77.424 15.899  1.00 56.04  ? 80  HIS A N   1 
ATOM   451  C CA  . HIS A 1 63  ? 57.392  -77.886 16.949  1.00 57.09  ? 80  HIS A CA  1 
ATOM   452  C C   . HIS A 1 63  ? 56.718  -78.766 17.990  1.00 57.40  ? 80  HIS A C   1 
ATOM   453  O O   . HIS A 1 63  ? 57.359  -79.671 18.531  1.00 58.74  ? 80  HIS A O   1 
ATOM   454  C CB  . HIS A 1 63  ? 58.064  -76.689 17.613  1.00 59.32  ? 80  HIS A CB  1 
ATOM   455  C CG  . HIS A 1 63  ? 58.893  -77.043 18.808  1.00 62.76  ? 80  HIS A CG  1 
ATOM   456  N ND1 . HIS A 1 63  ? 58.619  -76.557 20.066  1.00 62.95  ? 80  HIS A ND1 1 
ATOM   457  C CD2 . HIS A 1 63  ? 59.975  -77.845 18.941  1.00 64.87  ? 80  HIS A CD2 1 
ATOM   458  C CE1 . HIS A 1 63  ? 59.504  -77.034 20.919  1.00 64.07  ? 80  HIS A CE1 1 
ATOM   459  N NE2 . HIS A 1 63  ? 60.343  -77.811 20.263  1.00 64.35  ? 80  HIS A NE2 1 
ATOM   460  N N   . PHE A 1 64  ? 55.437  -78.529 18.256  1.00 57.58  ? 81  PHE A N   1 
ATOM   461  C CA  . PHE A 1 64  ? 54.719  -79.258 19.315  1.00 59.89  ? 81  PHE A CA  1 
ATOM   462  C C   . PHE A 1 64  ? 54.056  -80.529 18.812  1.00 61.66  ? 81  PHE A C   1 
ATOM   463  O O   . PHE A 1 64  ? 53.113  -81.023 19.415  1.00 61.62  ? 81  PHE A O   1 
ATOM   464  C CB  . PHE A 1 64  ? 53.721  -78.326 20.016  1.00 60.03  ? 81  PHE A CB  1 
ATOM   465  C CG  . PHE A 1 64  ? 54.386  -77.130 20.623  1.00 60.78  ? 81  PHE A CG  1 
ATOM   466  C CD1 . PHE A 1 64  ? 55.200  -77.278 21.732  1.00 62.65  ? 81  PHE A CD1 1 
ATOM   467  C CD2 . PHE A 1 64  ? 54.283  -75.879 20.035  1.00 61.58  ? 81  PHE A CD2 1 
ATOM   468  C CE1 . PHE A 1 64  ? 55.863  -76.194 22.276  1.00 62.93  ? 81  PHE A CE1 1 
ATOM   469  C CE2 . PHE A 1 64  ? 54.940  -74.788 20.570  1.00 62.47  ? 81  PHE A CE2 1 
ATOM   470  C CZ  . PHE A 1 64  ? 55.731  -74.951 21.701  1.00 64.54  ? 81  PHE A CZ  1 
ATOM   471  N N   . ILE A 1 65  ? 54.599  -81.063 17.718  1.00 60.49  ? 82  ILE A N   1 
ATOM   472  C CA  . ILE A 1 65  ? 54.144  -82.304 17.098  1.00 61.88  ? 82  ILE A CA  1 
ATOM   473  C C   . ILE A 1 65  ? 55.318  -83.268 17.175  1.00 64.79  ? 82  ILE A C   1 
ATOM   474  O O   . ILE A 1 65  ? 56.330  -83.085 16.504  1.00 63.49  ? 82  ILE A O   1 
ATOM   475  C CB  . ILE A 1 65  ? 53.724  -82.092 15.612  1.00 60.59  ? 82  ILE A CB  1 
ATOM   476  C CG1 . ILE A 1 65  ? 52.409  -81.308 15.524  1.00 57.97  ? 82  ILE A CG1 1 
ATOM   477  C CG2 . ILE A 1 65  ? 53.536  -83.423 14.895  1.00 60.37  ? 82  ILE A CG2 1 
ATOM   478  N N   . LYS A 1 66  ? 55.179  -84.288 18.010  1.00 68.80  ? 83  LYS A N   1 
ATOM   479  C CA  . LYS A 1 66  ? 56.203  -85.310 18.139  1.00 72.80  ? 83  LYS A CA  1 
ATOM   480  C C   . LYS A 1 66  ? 56.303  -86.032 16.797  1.00 72.89  ? 83  LYS A C   1 
ATOM   481  O O   . LYS A 1 66  ? 57.376  -86.087 16.186  1.00 75.84  ? 83  LYS A O   1 
ATOM   482  C CB  . LYS A 1 66  ? 55.836  -86.278 19.280  1.00 75.11  ? 83  LYS A CB  1 
ATOM   483  C CG  . LYS A 1 66  ? 56.911  -87.281 19.687  1.00 79.81  ? 83  LYS A CG  1 
ATOM   484  C CD  . LYS A 1 66  ? 56.419  -88.179 20.828  1.00 82.16  ? 83  LYS A CD  1 
ATOM   485  C CE  . LYS A 1 66  ? 57.302  -89.407 21.029  1.00 84.85  ? 83  LYS A CE  1 
ATOM   486  N N   . SER A 1 67  ? 55.164  -86.536 16.325  1.00 69.53  ? 84  SER A N   1 
ATOM   487  C CA  . SER A 1 67  ? 55.126  -87.425 15.168  1.00 68.43  ? 84  SER A CA  1 
ATOM   488  C C   . SER A 1 67  ? 53.747  -87.500 14.504  1.00 66.30  ? 84  SER A C   1 
ATOM   489  O O   . SER A 1 67  ? 52.718  -87.114 15.083  1.00 62.55  ? 84  SER A O   1 
ATOM   490  C CB  . SER A 1 67  ? 55.535  -88.831 15.594  1.00 69.74  ? 84  SER A CB  1 
ATOM   491  O OG  . SER A 1 67  ? 54.471  -89.466 16.276  1.00 68.25  ? 84  SER A OG  1 
ATOM   492  N N   . CYS A 1 68  ? 53.743  -88.037 13.289  1.00 66.39  ? 85  CYS A N   1 
ATOM   493  C CA  . CYS A 1 68  ? 52.550  -88.054 12.461  1.00 65.68  ? 85  CYS A CA  1 
ATOM   494  C C   . CYS A 1 68  ? 52.462  -89.313 11.603  1.00 66.26  ? 85  CYS A C   1 
ATOM   495  O O   . CYS A 1 68  ? 53.352  -89.595 10.811  1.00 67.82  ? 85  CYS A O   1 
ATOM   496  C CB  . CYS A 1 68  ? 52.547  -86.814 11.580  1.00 65.32  ? 85  CYS A CB  1 
ATOM   497  S SG  . CYS A 1 68  ? 51.484  -86.944 10.140  1.00 69.09  ? 85  CYS A SG  1 
ATOM   498  N N   . THR A 1 69  ? 51.383  -90.067 11.774  1.00 67.17  ? 86  THR A N   1 
ATOM   499  C CA  . THR A 1 69  ? 51.113  -91.245 10.953  1.00 68.17  ? 86  THR A CA  1 
ATOM   500  C C   . THR A 1 69  ? 49.976  -90.952 9.964   1.00 66.23  ? 86  THR A C   1 
ATOM   501  O O   . THR A 1 69  ? 49.064  -90.176 10.267  1.00 62.53  ? 86  THR A O   1 
ATOM   502  C CB  . THR A 1 69  ? 50.718  -92.443 11.829  1.00 71.06  ? 86  THR A CB  1 
ATOM   503  O OG1 . THR A 1 69  ? 51.689  -92.623 12.864  1.00 73.10  ? 86  THR A OG1 1 
ATOM   504  C CG2 . THR A 1 69  ? 50.634  -93.714 11.003  1.00 75.13  ? 86  THR A CG2 1 
ATOM   505  N N   . ILE A 1 70  ? 50.040  -91.558 8.778   1.00 66.64  ? 87  ILE A N   1 
ATOM   506  C CA  . ILE A 1 70  ? 48.950  -91.453 7.813   1.00 65.44  ? 87  ILE A CA  1 
ATOM   507  C C   . ILE A 1 70  ? 47.987  -92.606 8.062   1.00 67.52  ? 87  ILE A C   1 
ATOM   508  O O   . ILE A 1 70  ? 48.394  -93.760 8.077   1.00 72.63  ? 87  ILE A O   1 
ATOM   509  C CB  . ILE A 1 70  ? 49.450  -91.437 6.352   1.00 64.72  ? 87  ILE A CB  1 
ATOM   510  C CG1 . ILE A 1 70  ? 49.974  -90.041 5.976   1.00 60.35  ? 87  ILE A CG1 1 
ATOM   511  C CG2 . ILE A 1 70  ? 48.326  -91.812 5.397   1.00 65.55  ? 87  ILE A CG2 1 
ATOM   512  N N   . ARG A 1 71  ? 46.713  -92.272 8.252   1.00 69.04  ? 88  ARG A N   1 
ATOM   513  C CA  . ARG A 1 71  ? 45.684  -93.233 8.643   1.00 72.05  ? 88  ARG A CA  1 
ATOM   514  C C   . ARG A 1 71  ? 44.845  -93.730 7.476   1.00 73.97  ? 88  ARG A C   1 
ATOM   515  O O   . ARG A 1 71  ? 44.553  -94.918 7.395   1.00 76.14  ? 88  ARG A O   1 
ATOM   516  C CB  . ARG A 1 71  ? 44.761  -92.611 9.690   1.00 73.23  ? 88  ARG A CB  1 
ATOM   517  C CG  . ARG A 1 71  ? 45.438  -92.352 11.020  1.00 73.66  ? 88  ARG A CG  1 
ATOM   518  C CD  . ARG A 1 71  ? 46.137  -93.600 11.527  1.00 78.03  ? 88  ARG A CD  1 
ATOM   519  N NE  . ARG A 1 71  ? 46.468  -93.515 12.945  1.00 81.49  ? 88  ARG A NE  1 
ATOM   520  C CZ  . ARG A 1 71  ? 47.117  -94.457 13.621  1.00 84.18  ? 88  ARG A CZ  1 
ATOM   521  N NH1 . ARG A 1 71  ? 47.506  -95.577 13.018  1.00 86.17  ? 88  ARG A NH1 1 
ATOM   522  N NH2 . ARG A 1 71  ? 47.379  -94.279 14.911  1.00 87.56  ? 88  ARG A NH2 1 
ATOM   523  N N   . VAL A 1 72  ? 44.423  -92.829 6.596   1.00 74.26  ? 89  VAL A N   1 
ATOM   524  C CA  . VAL A 1 72  ? 43.803  -93.250 5.340   1.00 74.82  ? 89  VAL A CA  1 
ATOM   525  C C   . VAL A 1 72  ? 44.540  -92.603 4.170   1.00 72.96  ? 89  VAL A C   1 
ATOM   526  O O   . VAL A 1 72  ? 44.789  -91.404 4.170   1.00 69.58  ? 89  VAL A O   1 
ATOM   527  C CB  . VAL A 1 72  ? 42.287  -92.971 5.311   1.00 74.36  ? 89  VAL A CB  1 
ATOM   528  C CG1 . VAL A 1 72  ? 41.686  -93.204 6.691   1.00 74.53  ? 89  VAL A CG1 1 
ATOM   529  C CG2 . VAL A 1 72  ? 41.989  -91.559 4.844   1.00 74.89  ? 89  VAL A CG2 1 
ATOM   530  N N   . ASN A 1 73  ? 44.907  -93.425 3.194   1.00 78.77  ? 90  ASN A N   1 
ATOM   531  C CA  . ASN A 1 73  ? 45.716  -92.995 2.057   1.00 80.59  ? 90  ASN A CA  1 
ATOM   532  C C   . ASN A 1 73  ? 44.840  -92.418 0.943   1.00 82.49  ? 90  ASN A C   1 
ATOM   533  O O   . ASN A 1 73  ? 44.495  -91.233 0.951   1.00 81.19  ? 90  ASN A O   1 
ATOM   534  C CB  . ASN A 1 73  ? 46.530  -94.185 1.517   1.00 82.05  ? 90  ASN A CB  1 
ATOM   535  C CG  . ASN A 1 73  ? 47.622  -94.641 2.473   0.50 81.35  ? 90  ASN A CG  1 
ATOM   536  O OD1 . ASN A 1 73  ? 47.654  -95.794 2.901   1.00 80.18  ? 90  ASN A OD1 1 
ATOM   537  N ND2 . ASN A 1 73  ? 48.531  -93.737 2.800   1.00 80.89  ? 90  ASN A ND2 1 
ATOM   538  N N   . LYS A 1 78  ? 49.546  -94.271 -1.103  1.00 109.72 ? 95  LYS A N   1 
ATOM   539  C CA  . LYS A 1 78  ? 50.808  -93.807 -1.670  1.00 110.58 ? 95  LYS A CA  1 
ATOM   540  C C   . LYS A 1 78  ? 50.980  -92.284 -1.546  1.00 107.17 ? 95  LYS A C   1 
ATOM   541  O O   . LYS A 1 78  ? 51.736  -91.817 -0.686  1.00 100.98 ? 95  LYS A O   1 
ATOM   542  C CB  . LYS A 1 78  ? 50.924  -94.242 -3.138  1.00 111.67 ? 95  LYS A CB  1 
ATOM   543  N N   . GLU A 1 79  ? 50.260  -91.531 -2.388  1.00 103.28 ? 96  GLU A N   1 
ATOM   544  C CA  . GLU A 1 79  ? 50.472  -90.081 -2.574  1.00 99.82  ? 96  GLU A CA  1 
ATOM   545  C C   . GLU A 1 79  ? 49.400  -89.262 -1.852  0.50 89.91  ? 96  GLU A C   1 
ATOM   546  O O   . GLU A 1 79  ? 48.248  -89.682 -1.766  1.00 85.44  ? 96  GLU A O   1 
ATOM   547  C CB  . GLU A 1 79  ? 50.457  -89.732 -4.078  1.00 106.88 ? 96  GLU A CB  1 
ATOM   548  C CG  . GLU A 1 79  ? 51.665  -88.944 -4.592  1.00 113.85 ? 96  GLU A CG  1 
ATOM   549  C CD  . GLU A 1 79  ? 51.617  -87.454 -4.270  1.00 118.80 ? 96  GLU A CD  1 
ATOM   550  O OE1 . GLU A 1 79  ? 51.501  -87.086 -3.076  1.00 122.22 ? 96  GLU A OE1 1 
ATOM   551  O OE2 . GLU A 1 79  ? 51.722  -86.646 -5.221  1.00 119.33 ? 96  GLU A OE2 1 
ATOM   552  N N   . ILE A 1 80  ? 49.785  -88.086 -1.357  1.00 82.95  ? 97  ILE A N   1 
ATOM   553  C CA  . ILE A 1 80  ? 48.879  -87.209 -0.602  1.00 76.06  ? 97  ILE A CA  1 
ATOM   554  C C   . ILE A 1 80  ? 47.830  -86.595 -1.540  1.00 74.98  ? 97  ILE A C   1 
ATOM   555  O O   . ILE A 1 80  ? 48.164  -86.038 -2.590  1.00 75.77  ? 97  ILE A O   1 
ATOM   556  C CB  . ILE A 1 80  ? 49.671  -86.111 0.167   1.00 74.10  ? 97  ILE A CB  1 
ATOM   557  C CG1 . ILE A 1 80  ? 50.408  -86.730 1.360   1.00 73.51  ? 97  ILE A CG1 1 
ATOM   558  C CG2 . ILE A 1 80  ? 48.774  -84.981 0.658   1.00 70.53  ? 97  ILE A CG2 1 
ATOM   559  N N   . LYS A 1 81  ? 46.563  -86.717 -1.144  1.00 71.67  ? 98  LYS A N   1 
ATOM   560  C CA  . LYS A 1 81  ? 45.419  -86.230 -1.915  1.00 70.08  ? 98  LYS A CA  1 
ATOM   561  C C   . LYS A 1 81  ? 44.397  -85.641 -0.957  1.00 68.58  ? 98  LYS A C   1 
ATOM   562  O O   . LYS A 1 81  ? 44.392  -85.965 0.238   1.00 70.45  ? 98  LYS A O   1 
ATOM   563  C CB  . LYS A 1 81  ? 44.771  -87.376 -2.707  1.00 68.12  ? 98  LYS A CB  1 
ATOM   564  N N   . VAL A 1 82  ? 43.525  -84.778 -1.474  1.00 66.75  ? 99  VAL A N   1 
ATOM   565  C CA  . VAL A 1 82  ? 42.413  -84.263 -0.679  1.00 63.52  ? 99  VAL A CA  1 
ATOM   566  C C   . VAL A 1 82  ? 41.662  -85.466 -0.111  1.00 65.94  ? 99  VAL A C   1 
ATOM   567  O O   . VAL A 1 82  ? 41.551  -86.494 -0.774  1.00 66.99  ? 99  VAL A O   1 
ATOM   568  C CB  . VAL A 1 82  ? 41.500  -83.338 -1.506  1.00 61.19  ? 99  VAL A CB  1 
ATOM   569  C CG1 . VAL A 1 82  ? 40.173  -83.087 -0.811  1.00 61.78  ? 99  VAL A CG1 1 
ATOM   570  C CG2 . VAL A 1 82  ? 42.201  -82.019 -1.748  1.00 61.39  ? 99  VAL A CG2 1 
ATOM   571  N N   . GLY A 1 83  ? 41.206  -85.357 1.136   1.00 69.75  ? 100 GLY A N   1 
ATOM   572  C CA  . GLY A 1 83  ? 40.554  -86.475 1.829   1.00 69.64  ? 100 GLY A CA  1 
ATOM   573  C C   . GLY A 1 83  ? 41.523  -87.318 2.650   1.00 70.56  ? 100 GLY A C   1 
ATOM   574  O O   . GLY A 1 83  ? 41.095  -88.132 3.469   1.00 70.13  ? 100 GLY A O   1 
ATOM   575  N N   . THR A 1 84  ? 42.829  -87.136 2.441   1.00 70.17  ? 101 THR A N   1 
ATOM   576  C CA  . THR A 1 84  ? 43.829  -87.848 3.235   1.00 68.06  ? 101 THR A CA  1 
ATOM   577  C C   . THR A 1 84  ? 43.684  -87.507 4.706   1.00 66.66  ? 101 THR A C   1 
ATOM   578  O O   . THR A 1 84  ? 43.495  -86.338 5.065   1.00 65.86  ? 101 THR A O   1 
ATOM   579  C CB  . THR A 1 84  ? 45.254  -87.468 2.823   1.00 67.63  ? 101 THR A CB  1 
ATOM   580  O OG1 . THR A 1 84  ? 45.493  -87.888 1.476   1.00 67.17  ? 101 THR A OG1 1 
ATOM   581  C CG2 . THR A 1 84  ? 46.265  -88.129 3.751   1.00 68.53  ? 101 THR A CG2 1 
ATOM   582  N N   . ILE A 1 85  ? 43.795  -88.527 5.549   1.00 65.83  ? 102 ILE A N   1 
ATOM   583  C CA  . ILE A 1 85  ? 43.679  -88.349 6.992   1.00 65.08  ? 102 ILE A CA  1 
ATOM   584  C C   . ILE A 1 85  ? 44.977  -88.753 7.687   1.00 63.95  ? 102 ILE A C   1 
ATOM   585  O O   . ILE A 1 85  ? 45.543  -89.815 7.400   1.00 61.24  ? 102 ILE A O   1 
ATOM   586  C CB  . ILE A 1 85  ? 42.519  -89.170 7.593   1.00 67.24  ? 102 ILE A CB  1 
ATOM   587  C CG1 . ILE A 1 85  ? 41.200  -88.858 6.869   1.00 68.30  ? 102 ILE A CG1 1 
ATOM   588  C CG2 . ILE A 1 85  ? 42.385  -88.866 9.080   1.00 66.32  ? 102 ILE A CG2 1 
ATOM   589  C CD1 . ILE A 1 85  ? 40.028  -89.716 7.303   1.00 68.99  ? 102 ILE A CD1 1 
ATOM   590  N N   . ARG A 1 86  ? 45.429  -87.893 8.603   1.00 62.52  ? 103 ARG A N   1 
ATOM   591  C CA  . ARG A 1 86  ? 46.620  -88.148 9.415   1.00 60.97  ? 103 ARG A CA  1 
ATOM   592  C C   . ARG A 1 86  ? 46.265  -88.055 10.894  1.00 62.47  ? 103 ARG A C   1 
ATOM   593  O O   . ARG A 1 86  ? 45.337  -87.334 11.281  1.00 60.07  ? 103 ARG A O   1 
ATOM   594  C CB  . ARG A 1 86  ? 47.714  -87.134 9.105   1.00 58.46  ? 103 ARG A CB  1 
ATOM   595  C CG  . ARG A 1 86  ? 47.357  -85.723 9.546   1.00 58.69  ? 103 ARG A CG  1 
ATOM   596  C CD  . ARG A 1 86  ? 48.389  -84.699 9.108   1.00 58.07  ? 103 ARG A CD  1 
ATOM   597  N NE  . ARG A 1 86  ? 48.004  -83.342 9.500   1.00 55.55  ? 103 ARG A NE  1 
ATOM   598  C CZ  . ARG A 1 86  ? 48.610  -82.243 9.072   1.00 54.72  ? 103 ARG A CZ  1 
ATOM   599  N NH1 . ARG A 1 86  ? 49.631  -82.318 8.230   1.00 54.92  ? 103 ARG A NH1 1 
ATOM   600  N NH2 . ARG A 1 86  ? 48.192  -81.063 9.483   1.00 56.43  ? 103 ARG A NH2 1 
ATOM   601  N N   . GLU A 1 87  ? 47.002  -88.797 11.711  1.00 62.80  ? 104 GLU A N   1 
ATOM   602  C CA  . GLU A 1 87  ? 46.876  -88.701 13.141  1.00 64.36  ? 104 GLU A CA  1 
ATOM   603  C C   . GLU A 1 87  ? 48.154  -88.064 13.620  1.00 64.13  ? 104 GLU A C   1 
ATOM   604  O O   . GLU A 1 87  ? 49.238  -88.472 13.215  1.00 66.54  ? 104 GLU A O   1 
ATOM   605  C CB  . GLU A 1 87  ? 46.676  -90.077 13.774  1.00 69.18  ? 104 GLU A CB  1 
ATOM   606  C CG  . GLU A 1 87  ? 46.756  -90.054 15.297  1.00 74.46  ? 104 GLU A CG  1 
ATOM   607  C CD  . GLU A 1 87  ? 45.875  -91.089 15.977  1.00 80.18  ? 104 GLU A CD  1 
ATOM   608  O OE1 . GLU A 1 87  ? 45.553  -92.130 15.349  1.00 77.37  ? 104 GLU A OE1 1 
ATOM   609  O OE2 . GLU A 1 87  ? 45.510  -90.849 17.154  1.00 81.38  ? 104 GLU A OE2 1 
ATOM   610  N N   . VAL A 1 88  ? 48.024  -87.059 14.473  1.00 62.94  ? 105 VAL A N   1 
ATOM   611  C CA  . VAL A 1 88  ? 49.169  -86.323 14.979  1.00 63.49  ? 105 VAL A CA  1 
ATOM   612  C C   . VAL A 1 88  ? 49.311  -86.494 16.497  1.00 67.59  ? 105 VAL A C   1 
ATOM   613  O O   . VAL A 1 88  ? 48.357  -86.287 17.269  1.00 66.66  ? 105 VAL A O   1 
ATOM   614  C CB  . VAL A 1 88  ? 49.075  -84.845 14.544  1.00 61.53  ? 105 VAL A CB  1 
ATOM   615  C CG1 . VAL A 1 88  ? 49.017  -83.884 15.717  1.00 62.06  ? 105 VAL A CG1 1 
ATOM   616  C CG2 . VAL A 1 88  ? 50.238  -84.516 13.629  1.00 64.16  ? 105 VAL A CG2 1 
ATOM   617  N N   . SER A 1 89  ? 50.506  -86.892 16.919  1.00 66.78  ? 106 SER A N   1 
ATOM   618  C CA  . SER A 1 89  ? 50.761  -87.120 18.325  1.00 65.83  ? 106 SER A CA  1 
ATOM   619  C C   . SER A 1 89  ? 51.507  -85.915 18.849  1.00 65.15  ? 106 SER A C   1 
ATOM   620  O O   . SER A 1 89  ? 52.538  -85.526 18.303  1.00 62.65  ? 106 SER A O   1 
ATOM   621  C CB  . SER A 1 89  ? 51.555  -88.406 18.545  1.00 66.76  ? 106 SER A CB  1 
ATOM   622  O OG  . SER A 1 89  ? 52.883  -88.263 18.089  1.00 66.61  ? 106 SER A OG  1 
ATOM   623  N N   . VAL A 1 90  ? 50.969  -85.343 19.922  1.00 68.32  ? 107 VAL A N   1 
ATOM   624  C CA  . VAL A 1 90  ? 51.446  -84.082 20.482  1.00 69.10  ? 107 VAL A CA  1 
ATOM   625  C C   . VAL A 1 90  ? 52.647  -84.275 21.410  1.00 73.12  ? 107 VAL A C   1 
ATOM   626  O O   . VAL A 1 90  ? 52.805  -85.303 22.081  1.00 74.97  ? 107 VAL A O   1 
ATOM   627  C CB  . VAL A 1 90  ? 50.311  -83.367 21.232  1.00 68.95  ? 107 VAL A CB  1 
ATOM   628  C CG1 . VAL A 1 90  ? 50.788  -82.086 21.902  1.00 68.74  ? 107 VAL A CG1 1 
ATOM   629  C CG2 . VAL A 1 90  ? 49.168  -83.076 20.268  1.00 70.67  ? 107 VAL A CG2 1 
ATOM   630  N N   . VAL A 1 91  ? 53.500  -83.262 21.422  1.00 75.70  ? 108 VAL A N   1 
ATOM   631  C CA  . VAL A 1 91  ? 54.701  -83.266 22.241  1.00 77.82  ? 108 VAL A CA  1 
ATOM   632  C C   . VAL A 1 91  ? 54.355  -83.359 23.726  1.00 76.12  ? 108 VAL A C   1 
ATOM   633  O O   . VAL A 1 91  ? 53.242  -83.037 24.147  1.00 74.65  ? 108 VAL A O   1 
ATOM   634  C CB  . VAL A 1 91  ? 55.592  -82.040 21.899  1.00 77.81  ? 108 VAL A CB  1 
ATOM   635  C CG1 . VAL A 1 91  ? 55.874  -81.162 23.114  1.00 79.24  ? 108 VAL A CG1 1 
ATOM   636  C CG2 . VAL A 1 91  ? 56.872  -82.499 21.206  1.00 77.31  ? 108 VAL A CG2 1 
ATOM   637  N N   . SER A 1 92  ? 55.332  -83.815 24.500  1.00 79.15  ? 109 SER A N   1 
ATOM   638  C CA  . SER A 1 92  ? 55.139  -84.183 25.906  1.00 77.37  ? 109 SER A CA  1 
ATOM   639  C C   . SER A 1 92  ? 54.825  -82.984 26.799  1.00 75.39  ? 109 SER A C   1 
ATOM   640  O O   . SER A 1 92  ? 54.137  -83.133 27.808  1.00 72.68  ? 109 SER A O   1 
ATOM   641  C CB  . SER A 1 92  ? 56.398  -84.892 26.419  1.00 81.39  ? 109 SER A CB  1 
ATOM   642  O OG  . SER A 1 92  ? 56.982  -85.694 25.395  1.00 82.38  ? 109 SER A OG  1 
ATOM   643  N N   . GLY A 1 93  ? 55.325  -81.804 26.419  1.00 73.84  ? 110 GLY A N   1 
ATOM   644  C CA  . GLY A 1 93  ? 55.166  -80.586 27.207  1.00 70.93  ? 110 GLY A CA  1 
ATOM   645  C C   . GLY A 1 93  ? 53.843  -79.871 27.023  1.00 69.46  ? 110 GLY A C   1 
ATOM   646  O O   . GLY A 1 93  ? 53.734  -78.682 27.312  1.00 71.57  ? 110 GLY A O   1 
ATOM   647  N N   . LEU A 1 94  ? 52.824  -80.591 26.569  1.00 68.27  ? 111 LEU A N   1 
ATOM   648  C CA  . LEU A 1 94  ? 51.544  -79.981 26.225  1.00 68.45  ? 111 LEU A CA  1 
ATOM   649  C C   . LEU A 1 94  ? 50.406  -80.927 26.560  1.00 68.46  ? 111 LEU A C   1 
ATOM   650  O O   . LEU A 1 94  ? 50.479  -82.114 26.205  1.00 70.36  ? 111 LEU A O   1 
ATOM   651  C CB  . LEU A 1 94  ? 51.485  -79.697 24.720  1.00 69.43  ? 111 LEU A CB  1 
ATOM   652  C CG  . LEU A 1 94  ? 51.943  -78.363 24.153  1.00 66.81  ? 111 LEU A CG  1 
ATOM   653  C CD1 . LEU A 1 94  ? 51.432  -78.275 22.726  1.00 68.20  ? 111 LEU A CD1 1 
ATOM   654  C CD2 . LEU A 1 94  ? 51.415  -77.198 24.963  1.00 67.20  ? 111 LEU A CD2 1 
ATOM   655  N N   . PRO A 1 95  ? 49.337  -80.406 27.199  1.00 66.32  ? 112 PRO A N   1 
ATOM   656  C CA  . PRO A 1 95  ? 48.214  -81.247 27.642  1.00 68.06  ? 112 PRO A CA  1 
ATOM   657  C C   . PRO A 1 95  ? 47.645  -82.110 26.519  1.00 69.34  ? 112 PRO A C   1 
ATOM   658  O O   . PRO A 1 95  ? 47.515  -83.325 26.675  1.00 72.31  ? 112 PRO A O   1 
ATOM   659  C CB  . PRO A 1 95  ? 47.167  -80.235 28.132  1.00 68.49  ? 112 PRO A CB  1 
ATOM   660  C CG  . PRO A 1 95  ? 47.626  -78.896 27.669  1.00 67.01  ? 112 PRO A CG  1 
ATOM   661  C CD  . PRO A 1 95  ? 49.110  -78.983 27.498  1.00 65.66  ? 112 PRO A CD  1 
ATOM   662  N N   . ALA A 1 96  ? 47.332  -81.481 25.390  1.00 68.74  ? 113 ALA A N   1 
ATOM   663  C CA  . ALA A 1 96  ? 46.932  -82.196 24.182  1.00 66.41  ? 113 ALA A CA  1 
ATOM   664  C C   . ALA A 1 96  ? 47.837  -83.396 23.964  1.00 67.15  ? 113 ALA A C   1 
ATOM   665  O O   . ALA A 1 96  ? 49.024  -83.340 24.271  1.00 73.24  ? 113 ALA A O   1 
ATOM   666  C CB  . ALA A 1 96  ? 47.006  -81.261 22.986  1.00 65.50  ? 113 ALA A CB  1 
ATOM   667  N N   . SER A 1 97  ? 47.283  -84.491 23.460  1.00 68.02  ? 114 SER A N   1 
ATOM   668  C CA  . SER A 1 97  ? 48.097  -85.682 23.198  1.00 69.55  ? 114 SER A CA  1 
ATOM   669  C C   . SER A 1 97  ? 48.014  -86.155 21.757  1.00 65.13  ? 114 SER A C   1 
ATOM   670  O O   . SER A 1 97  ? 48.928  -86.814 21.279  1.00 61.04  ? 114 SER A O   1 
ATOM   671  C CB  . SER A 1 97  ? 47.704  -86.830 24.140  1.00 73.95  ? 114 SER A CB  1 
ATOM   672  O OG  . SER A 1 97  ? 46.606  -87.578 23.629  1.00 75.59  ? 114 SER A OG  1 
ATOM   673  N N   . THR A 1 98  ? 46.930  -85.807 21.071  1.00 67.12  ? 115 THR A N   1 
ATOM   674  C CA  . THR A 1 98  ? 46.582  -86.437 19.790  1.00 66.51  ? 115 THR A CA  1 
ATOM   675  C C   . THR A 1 98  ? 45.625  -85.575 18.969  1.00 62.96  ? 115 THR A C   1 
ATOM   676  O O   . THR A 1 98  ? 44.716  -84.951 19.510  1.00 66.38  ? 115 THR A O   1 
ATOM   677  C CB  . THR A 1 98  ? 45.948  -87.820 20.064  1.00 69.67  ? 115 THR A CB  1 
ATOM   678  O OG1 . THR A 1 98  ? 46.990  -88.787 20.235  1.00 69.81  ? 115 THR A OG1 1 
ATOM   679  C CG2 . THR A 1 98  ? 45.029  -88.281 18.941  1.00 72.88  ? 115 THR A CG2 1 
ATOM   680  N N   . SER A 1 99  ? 45.824  -85.530 17.663  1.00 62.11  ? 116 SER A N   1 
ATOM   681  C CA  . SER A 1 99  ? 44.799  -84.958 16.770  1.00 62.02  ? 116 SER A CA  1 
ATOM   682  C C   . SER A 1 99  ? 44.700  -85.735 15.469  1.00 58.04  ? 116 SER A C   1 
ATOM   683  O O   . SER A 1 99  ? 45.716  -86.113 14.889  1.00 54.61  ? 116 SER A O   1 
ATOM   684  C CB  . SER A 1 99  ? 45.076  -83.483 16.472  1.00 61.70  ? 116 SER A CB  1 
ATOM   685  O OG  . SER A 1 99  ? 43.964  -82.878 15.815  1.00 65.17  ? 116 SER A OG  1 
ATOM   686  N N   . VAL A 1 100 ? 43.471  -85.973 15.023  1.00 58.69  ? 117 VAL A N   1 
ATOM   687  C CA  . VAL A 1 100 ? 43.234  -86.595 13.713  1.00 59.43  ? 117 VAL A CA  1 
ATOM   688  C C   . VAL A 1 100 ? 42.637  -85.550 12.776  1.00 57.42  ? 117 VAL A C   1 
ATOM   689  O O   . VAL A 1 100 ? 41.588  -84.977 13.054  1.00 55.21  ? 117 VAL A O   1 
ATOM   690  C CB  . VAL A 1 100 ? 42.403  -87.917 13.785  1.00 61.96  ? 117 VAL A CB  1 
ATOM   691  C CG1 . VAL A 1 100 ? 41.621  -88.028 15.083  1.00 64.97  ? 117 VAL A CG1 1 
ATOM   692  C CG2 . VAL A 1 100 ? 41.481  -88.090 12.580  1.00 62.00  ? 117 VAL A CG2 1 
ATOM   693  N N   . GLU A 1 101 ? 43.333  -85.319 11.667  1.00 57.89  ? 118 GLU A N   1 
ATOM   694  C CA  . GLU A 1 101 ? 43.023  -84.234 10.746  1.00 57.00  ? 118 GLU A CA  1 
ATOM   695  C C   . GLU A 1 101 ? 42.811  -84.720 9.288   1.00 57.18  ? 118 GLU A C   1 
ATOM   696  O O   . GLU A 1 101 ? 43.551  -85.584 8.786   1.00 56.04  ? 118 GLU A O   1 
ATOM   697  C CB  . GLU A 1 101 ? 44.167  -83.229 10.794  1.00 53.53  ? 118 GLU A CB  1 
ATOM   698  N N   . ILE A 1 102 ? 41.809  -84.150 8.613   1.00 55.44  ? 119 ILE A N   1 
ATOM   699  C CA  . ILE A 1 102 ? 41.580  -84.436 7.193   1.00 52.41  ? 119 ILE A CA  1 
ATOM   700  C C   . ILE A 1 102 ? 41.877  -83.239 6.314   1.00 50.80  ? 119 ILE A C   1 
ATOM   701  O O   . ILE A 1 102 ? 41.496  -82.107 6.606   1.00 49.24  ? 119 ILE A O   1 
ATOM   702  C CB  . ILE A 1 102 ? 40.151  -84.931 6.914   1.00 53.46  ? 119 ILE A CB  1 
ATOM   703  C CG1 . ILE A 1 102 ? 40.099  -85.660 5.580   1.00 54.13  ? 119 ILE A CG1 1 
ATOM   704  C CG2 . ILE A 1 102 ? 39.133  -83.798 6.941   1.00 55.07  ? 119 ILE A CG2 1 
ATOM   705  C CD1 . ILE A 1 102 ? 38.834  -86.456 5.403   1.00 55.18  ? 119 ILE A CD1 1 
ATOM   706  N N   . LEU A 1 103 ? 42.564  -83.525 5.224   1.00 50.72  ? 120 LEU A N   1 
ATOM   707  C CA  . LEU A 1 103 ? 43.007  -82.518 4.281   1.00 51.27  ? 120 LEU A CA  1 
ATOM   708  C C   . LEU A 1 103 ? 41.867  -82.196 3.321   1.00 53.86  ? 120 LEU A C   1 
ATOM   709  O O   . LEU A 1 103 ? 41.385  -83.088 2.619   1.00 54.86  ? 120 LEU A O   1 
ATOM   710  C CB  . LEU A 1 103 ? 44.205  -83.085 3.536   1.00 51.38  ? 120 LEU A CB  1 
ATOM   711  C CG  . LEU A 1 103 ? 44.712  -82.501 2.238   1.00 52.42  ? 120 LEU A CG  1 
ATOM   712  C CD1 . LEU A 1 103 ? 44.732  -80.987 2.270   1.00 54.84  ? 120 LEU A CD1 1 
ATOM   713  C CD2 . LEU A 1 103 ? 46.107  -83.066 1.997   1.00 53.64  ? 120 LEU A CD2 1 
ATOM   714  N N   . GLU A 1 104 ? 41.442  -80.934 3.296   1.00 55.80  ? 121 GLU A N   1 
ATOM   715  C CA  . GLU A 1 104 ? 40.255  -80.525 2.536   1.00 59.46  ? 121 GLU A CA  1 
ATOM   716  C C   . GLU A 1 104 ? 40.512  -79.679 1.267   1.00 60.10  ? 121 GLU A C   1 
ATOM   717  O O   . GLU A 1 104 ? 39.685  -79.656 0.364   1.00 62.74  ? 121 GLU A O   1 
ATOM   718  C CB  . GLU A 1 104 ? 39.299  -79.784 3.460   1.00 59.98  ? 121 GLU A CB  1 
ATOM   719  C CG  . GLU A 1 104 ? 38.611  -80.715 4.439   1.00 62.15  ? 121 GLU A CG  1 
ATOM   720  C CD  . GLU A 1 104 ? 37.500  -80.040 5.210   1.00 63.45  ? 121 GLU A CD  1 
ATOM   721  O OE1 . GLU A 1 104 ? 37.529  -78.789 5.303   1.00 63.50  ? 121 GLU A OE1 1 
ATOM   722  O OE2 . GLU A 1 104 ? 36.611  -80.765 5.726   1.00 63.48  ? 121 GLU A OE2 1 
ATOM   723  N N   . VAL A 1 105 ? 41.642  -78.983 1.218   1.00 58.05  ? 122 VAL A N   1 
ATOM   724  C CA  . VAL A 1 105 ? 42.010  -78.160 0.085   1.00 56.42  ? 122 VAL A CA  1 
ATOM   725  C C   . VAL A 1 105 ? 43.501  -78.337 -0.156  1.00 56.82  ? 122 VAL A C   1 
ATOM   726  O O   . VAL A 1 105 ? 44.279  -78.277 0.775   1.00 57.42  ? 122 VAL A O   1 
ATOM   727  C CB  . VAL A 1 105 ? 41.699  -76.678 0.366   1.00 55.56  ? 122 VAL A CB  1 
ATOM   728  C CG1 . VAL A 1 105 ? 42.204  -75.776 -0.750  1.00 54.80  ? 122 VAL A CG1 1 
ATOM   729  C CG2 . VAL A 1 105 ? 40.204  -76.485 0.573   1.00 56.67  ? 122 VAL A CG2 1 
ATOM   730  N N   . LEU A 1 106 ? 43.884  -78.591 -1.403  1.00 59.13  ? 123 LEU A N   1 
ATOM   731  C CA  . LEU A 1 106 ? 45.287  -78.673 -1.804  1.00 59.09  ? 123 LEU A CA  1 
ATOM   732  C C   . LEU A 1 106 ? 45.400  -78.097 -3.212  1.00 61.18  ? 123 LEU A C   1 
ATOM   733  O O   . LEU A 1 106 ? 45.279  -78.804 -4.209  1.00 65.60  ? 123 LEU A O   1 
ATOM   734  C CB  . LEU A 1 106 ? 45.790  -80.119 -1.750  1.00 59.03  ? 123 LEU A CB  1 
ATOM   735  C CG  . LEU A 1 106 ? 47.273  -80.330 -2.059  1.00 58.98  ? 123 LEU A CG  1 
ATOM   736  C CD1 . LEU A 1 106 ? 48.130  -79.586 -1.045  1.00 59.51  ? 123 LEU A CD1 1 
ATOM   737  C CD2 . LEU A 1 106 ? 47.644  -81.805 -2.086  1.00 58.66  ? 123 LEU A CD2 1 
ATOM   738  N N   . ASP A 1 107 ? 45.600  -76.792 -3.274  1.00 61.94  ? 124 ASP A N   1 
ATOM   739  C CA  . ASP A 1 107 ? 45.649  -76.075 -4.518  1.00 62.83  ? 124 ASP A CA  1 
ATOM   740  C C   . ASP A 1 107 ? 47.099  -75.758 -4.845  1.00 62.25  ? 124 ASP A C   1 
ATOM   741  O O   . ASP A 1 107 ? 47.635  -74.745 -4.410  1.00 61.83  ? 124 ASP A O   1 
ATOM   742  C CB  . ASP A 1 107 ? 44.823  -74.800 -4.389  1.00 64.32  ? 124 ASP A CB  1 
ATOM   743  C CG  . ASP A 1 107 ? 44.630  -74.103 -5.712  1.00 68.35  ? 124 ASP A CG  1 
ATOM   744  O OD1 . ASP A 1 107 ? 45.645  -73.821 -6.390  1.00 71.91  ? 124 ASP A OD1 1 
ATOM   745  O OD2 . ASP A 1 107 ? 43.464  -73.830 -6.072  1.00 69.72  ? 124 ASP A OD2 1 
ATOM   746  N N   . GLU A 1 108 ? 47.726  -76.623 -5.635  1.00 63.83  ? 125 GLU A N   1 
ATOM   747  C CA  . GLU A 1 108 ? 49.147  -76.470 -5.995  1.00 64.17  ? 125 GLU A CA  1 
ATOM   748  C C   . GLU A 1 108 ? 49.412  -75.207 -6.836  1.00 63.07  ? 125 GLU A C   1 
ATOM   749  O O   . GLU A 1 108 ? 50.529  -74.693 -6.855  1.00 64.03  ? 125 GLU A O   1 
ATOM   750  C CB  . GLU A 1 108 ? 49.643  -77.708 -6.754  1.00 65.38  ? 125 GLU A CB  1 
ATOM   751  C CG  . GLU A 1 108 ? 49.428  -79.047 -6.043  1.00 67.57  ? 125 GLU A CG  1 
ATOM   752  C CD  . GLU A 1 108 ? 50.484  -79.356 -4.992  1.00 69.97  ? 125 GLU A CD  1 
ATOM   753  O OE1 . GLU A 1 108 ? 50.356  -80.397 -4.310  1.00 71.82  ? 125 GLU A OE1 1 
ATOM   754  O OE2 . GLU A 1 108 ? 51.446  -78.572 -4.838  1.00 71.06  ? 125 GLU A OE2 1 
ATOM   755  N N   . GLU A 1 109 ? 48.382  -74.720 -7.525  1.00 63.20  ? 126 GLU A N   1 
ATOM   756  C CA  . GLU A 1 109 ? 48.479  -73.517 -8.356  1.00 63.99  ? 126 GLU A CA  1 
ATOM   757  C C   . GLU A 1 109 ? 48.477  -72.260 -7.494  1.00 62.39  ? 126 GLU A C   1 
ATOM   758  O O   . GLU A 1 109 ? 49.366  -71.413 -7.619  1.00 58.47  ? 126 GLU A O   1 
ATOM   759  C CB  . GLU A 1 109 ? 47.328  -73.465 -9.378  1.00 65.73  ? 126 GLU A CB  1 
ATOM   760  N N   . LYS A 1 110 ? 47.486  -72.146 -6.611  1.00 61.94  ? 127 LYS A N   1 
ATOM   761  C CA  . LYS A 1 110 ? 47.436  -71.030 -5.659  1.00 61.75  ? 127 LYS A CA  1 
ATOM   762  C C   . LYS A 1 110 ? 48.279  -71.243 -4.395  1.00 59.20  ? 127 LYS A C   1 
ATOM   763  O O   . LYS A 1 110 ? 48.440  -70.322 -3.612  1.00 58.56  ? 127 LYS A O   1 
ATOM   764  C CB  . LYS A 1 110 ? 46.007  -70.753 -5.243  1.00 62.38  ? 127 LYS A CB  1 
ATOM   765  C CG  . LYS A 1 110 ? 45.120  -70.198 -6.344  1.00 66.27  ? 127 LYS A CG  1 
ATOM   766  C CD  . LYS A 1 110 ? 43.720  -70.805 -6.272  1.00 69.25  ? 127 LYS A CD  1 
ATOM   767  C CE  . LYS A 1 110 ? 42.614  -69.780 -6.441  1.00 71.84  ? 127 LYS A CE  1 
ATOM   768  N NZ  . LYS A 1 110 ? 42.425  -69.376 -7.851  1.00 75.61  ? 127 LYS A NZ  1 
ATOM   769  N N   . ARG A 1 111 ? 48.813  -72.442 -4.192  1.00 58.60  ? 128 ARG A N   1 
ATOM   770  C CA  . ARG A 1 111 ? 49.553  -72.759 -2.952  1.00 60.15  ? 128 ARG A CA  1 
ATOM   771  C C   . ARG A 1 111 ? 48.718  -72.562 -1.665  1.00 57.36  ? 128 ARG A C   1 
ATOM   772  O O   . ARG A 1 111 ? 49.092  -71.802 -0.791  1.00 54.88  ? 128 ARG A O   1 
ATOM   773  C CB  . ARG A 1 111 ? 50.846  -71.936 -2.879  1.00 61.42  ? 128 ARG A CB  1 
ATOM   774  C CG  . ARG A 1 111 ? 51.657  -71.973 -4.167  1.00 62.26  ? 128 ARG A CG  1 
ATOM   775  C CD  . ARG A 1 111 ? 53.083  -71.531 -3.944  1.00 62.37  ? 128 ARG A CD  1 
ATOM   776  N NE  . ARG A 1 111 ? 53.932  -71.836 -5.094  1.00 64.19  ? 128 ARG A NE  1 
ATOM   777  C CZ  . ARG A 1 111 ? 54.057  -71.060 -6.164  1.00 64.47  ? 128 ARG A CZ  1 
ATOM   778  N NH1 . ARG A 1 111 ? 53.384  -69.917 -6.267  1.00 63.40  ? 128 ARG A NH1 1 
ATOM   779  N NH2 . ARG A 1 111 ? 54.863  -71.430 -7.143  1.00 67.67  ? 128 ARG A NH2 1 
ATOM   780  N N   . ILE A 1 112 ? 47.589  -73.256 -1.572  1.00 55.85  ? 129 ILE A N   1 
ATOM   781  C CA  . ILE A 1 112 ? 46.661  -73.086 -0.469  1.00 54.82  ? 129 ILE A CA  1 
ATOM   782  C C   . ILE A 1 112 ? 46.394  -74.443 0.151   1.00 53.88  ? 129 ILE A C   1 
ATOM   783  O O   . ILE A 1 112 ? 45.843  -75.313 -0.491  1.00 52.16  ? 129 ILE A O   1 
ATOM   784  C CB  . ILE A 1 112 ? 45.310  -72.501 -0.952  1.00 56.88  ? 129 ILE A CB  1 
ATOM   785  C CG1 . ILE A 1 112 ? 45.501  -71.099 -1.559  1.00 59.70  ? 129 ILE A CG1 1 
ATOM   786  C CG2 . ILE A 1 112 ? 44.298  -72.459 0.182   1.00 55.07  ? 129 ILE A CG2 1 
ATOM   787  C CD1 . ILE A 1 112 ? 44.283  -70.557 -2.302  1.00 59.82  ? 129 ILE A CD1 1 
ATOM   788  N N   . LEU A 1 113 ? 46.790  -74.638 1.400   1.00 56.19  ? 130 LEU A N   1 
ATOM   789  C CA  . LEU A 1 113 ? 46.388  -75.847 2.108   1.00 56.79  ? 130 LEU A CA  1 
ATOM   790  C C   . LEU A 1 113 ? 45.298  -75.480 3.073   1.00 56.57  ? 130 LEU A C   1 
ATOM   791  O O   . LEU A 1 113 ? 45.277  -74.363 3.579   1.00 60.61  ? 130 LEU A O   1 
ATOM   792  C CB  . LEU A 1 113 ? 47.560  -76.467 2.850   1.00 56.28  ? 130 LEU A CB  1 
ATOM   793  C CG  . LEU A 1 113 ? 47.350  -77.923 3.288   1.00 56.75  ? 130 LEU A CG  1 
ATOM   794  C CD1 . LEU A 1 113 ? 48.655  -78.701 3.275   1.00 56.47  ? 130 LEU A CD1 1 
ATOM   795  C CD2 . LEU A 1 113 ? 46.738  -78.012 4.675   1.00 58.40  ? 130 LEU A CD2 1 
ATOM   796  N N   . SER A 1 114 ? 44.372  -76.405 3.291   1.00 56.72  ? 131 SER A N   1 
ATOM   797  C CA  . SER A 1 114 ? 43.449  -76.328 4.422   1.00 56.21  ? 131 SER A CA  1 
ATOM   798  C C   . SER A 1 114 ? 43.144  -77.725 4.936   1.00 55.35  ? 131 SER A C   1 
ATOM   799  O O   . SER A 1 114 ? 43.021  -78.668 4.137   1.00 51.90  ? 131 SER A O   1 
ATOM   800  C CB  . SER A 1 114 ? 42.154  -75.643 4.023   1.00 57.34  ? 131 SER A CB  1 
ATOM   801  O OG  . SER A 1 114 ? 41.145  -75.887 4.985   1.00 59.15  ? 131 SER A OG  1 
ATOM   802  N N   . PHE A 1 115 ? 43.043  -77.849 6.262   1.00 54.58  ? 132 PHE A N   1 
ATOM   803  C CA  . PHE A 1 115 ? 42.646  -79.118 6.902   1.00 56.10  ? 132 PHE A CA  1 
ATOM   804  C C   . PHE A 1 115 ? 41.615  -78.911 8.015   1.00 55.53  ? 132 PHE A C   1 
ATOM   805  O O   . PHE A 1 115 ? 41.387  -77.797 8.480   1.00 52.92  ? 132 PHE A O   1 
ATOM   806  C CB  . PHE A 1 115 ? 43.866  -79.902 7.422   1.00 56.54  ? 132 PHE A CB  1 
ATOM   807  C CG  . PHE A 1 115 ? 44.536  -79.280 8.619   1.00 58.17  ? 132 PHE A CG  1 
ATOM   808  C CD1 . PHE A 1 115 ? 45.494  -78.289 8.460   1.00 56.18  ? 132 PHE A CD1 1 
ATOM   809  C CD2 . PHE A 1 115 ? 44.206  -79.694 9.920   1.00 60.04  ? 132 PHE A CD2 1 
ATOM   810  C CE1 . PHE A 1 115 ? 46.106  -77.723 9.564   1.00 57.51  ? 132 PHE A CE1 1 
ATOM   811  C CE2 . PHE A 1 115 ? 44.820  -79.129 11.032  1.00 58.89  ? 132 PHE A CE2 1 
ATOM   812  C CZ  . PHE A 1 115 ? 45.775  -78.143 10.851  1.00 59.21  ? 132 PHE A CZ  1 
ATOM   813  N N   . ARG A 1 116 ? 40.982  -80.001 8.410   1.00 56.80  ? 133 ARG A N   1 
ATOM   814  C CA  . ARG A 1 116 ? 39.956  -79.970 9.427   1.00 58.79  ? 133 ARG A CA  1 
ATOM   815  C C   . ARG A 1 116 ? 40.274  -81.059 10.425  1.00 59.35  ? 133 ARG A C   1 
ATOM   816  O O   . ARG A 1 116 ? 40.646  -82.178 10.039  1.00 56.37  ? 133 ARG A O   1 
ATOM   817  C CB  . ARG A 1 116 ? 38.590  -80.218 8.797   1.00 62.53  ? 133 ARG A CB  1 
ATOM   818  C CG  . ARG A 1 116 ? 37.456  -80.474 9.771   1.00 66.46  ? 133 ARG A CG  1 
ATOM   819  C CD  . ARG A 1 116 ? 36.140  -80.729 9.040   1.00 72.65  ? 133 ARG A CD  1 
ATOM   820  N NE  . ARG A 1 116 ? 35.441  -79.490 8.702   1.00 76.50  ? 133 ARG A NE  1 
ATOM   821  C CZ  . ARG A 1 116 ? 34.443  -79.392 7.821   1.00 85.78  ? 133 ARG A CZ  1 
ATOM   822  N NH1 . ARG A 1 116 ? 33.994  -80.462 7.159   1.00 91.00  ? 133 ARG A NH1 1 
ATOM   823  N NH2 . ARG A 1 116 ? 33.880  -78.205 7.598   1.00 87.29  ? 133 ARG A NH2 1 
ATOM   824  N N   . VAL A 1 117 ? 40.142  -80.707 11.705  1.00 59.03  ? 134 VAL A N   1 
ATOM   825  C CA  . VAL A 1 117 ? 40.286  -81.651 12.802  1.00 60.17  ? 134 VAL A CA  1 
ATOM   826  C C   . VAL A 1 117 ? 39.010  -82.474 12.929  1.00 61.12  ? 134 VAL A C   1 
ATOM   827  O O   . VAL A 1 117 ? 37.943  -81.934 13.193  1.00 65.23  ? 134 VAL A O   1 
ATOM   828  C CB  . VAL A 1 117 ? 40.578  -80.926 14.142  1.00 60.84  ? 134 VAL A CB  1 
ATOM   829  C CG1 . VAL A 1 117 ? 40.520  -81.889 15.319  1.00 61.53  ? 134 VAL A CG1 1 
ATOM   830  C CG2 . VAL A 1 117 ? 41.946  -80.273 14.090  1.00 61.83  ? 134 VAL A CG2 1 
ATOM   831  N N   . LEU A 1 118 ? 39.141  -83.782 12.754  1.00 60.76  ? 135 LEU A N   1 
ATOM   832  C CA  . LEU A 1 118 ? 38.030  -84.723 12.880  1.00 61.94  ? 135 LEU A CA  1 
ATOM   833  C C   . LEU A 1 118 ? 37.891  -85.304 14.294  1.00 63.47  ? 135 LEU A C   1 
ATOM   834  O O   . LEU A 1 118 ? 36.831  -85.810 14.658  1.00 63.81  ? 135 LEU A O   1 
ATOM   835  C CB  . LEU A 1 118 ? 38.243  -85.885 11.908  1.00 62.01  ? 135 LEU A CB  1 
ATOM   836  C CG  . LEU A 1 118 ? 37.615  -85.864 10.516  1.00 62.31  ? 135 LEU A CG  1 
ATOM   837  C CD1 . LEU A 1 118 ? 37.216  -84.479 10.029  1.00 62.68  ? 135 LEU A CD1 1 
ATOM   838  C CD2 . LEU A 1 118 ? 38.568  -86.555 9.546   1.00 62.45  ? 135 LEU A CD2 1 
ATOM   839  N N   . GLY A 1 119 ? 38.969  -85.271 15.071  1.00 65.29  ? 136 GLY A N   1 
ATOM   840  C CA  . GLY A 1 119 ? 38.954  -85.827 16.421  1.00 65.25  ? 136 GLY A CA  1 
ATOM   841  C C   . GLY A 1 119 ? 40.283  -85.717 17.130  1.00 65.42  ? 136 GLY A C   1 
ATOM   842  O O   . GLY A 1 119 ? 41.165  -84.969 16.707  1.00 64.18  ? 136 GLY A O   1 
ATOM   843  N N   . GLY A 1 120 ? 40.417  -86.478 18.211  1.00 68.70  ? 137 GLY A N   1 
ATOM   844  C CA  . GLY A 1 120 ? 41.634  -86.508 19.021  1.00 71.07  ? 137 GLY A CA  1 
ATOM   845  C C   . GLY A 1 120 ? 41.425  -85.995 20.438  1.00 73.29  ? 137 GLY A C   1 
ATOM   846  O O   . GLY A 1 120 ? 40.365  -85.457 20.777  1.00 71.95  ? 137 GLY A O   1 
ATOM   847  N N   . GLU A 1 121 ? 42.450  -86.167 21.267  1.00 75.37  ? 138 GLU A N   1 
ATOM   848  C CA  . GLU A 1 121 ? 42.434  -85.646 22.625  1.00 77.80  ? 138 GLU A CA  1 
ATOM   849  C C   . GLU A 1 121 ? 43.246  -84.351 22.698  1.00 72.94  ? 138 GLU A C   1 
ATOM   850  O O   . GLU A 1 121 ? 44.471  -84.351 22.509  1.00 70.99  ? 138 GLU A O   1 
ATOM   851  C CB  . GLU A 1 121 ? 42.987  -86.686 23.594  1.00 85.52  ? 138 GLU A CB  1 
ATOM   852  C CG  . GLU A 1 121 ? 42.184  -87.981 23.623  1.00 90.26  ? 138 GLU A CG  1 
ATOM   853  C CD  . GLU A 1 121 ? 42.991  -89.161 24.142  1.00 96.86  ? 138 GLU A CD  1 
ATOM   854  O OE1 . GLU A 1 121 ? 44.131  -89.389 23.653  1.00 93.93  ? 138 GLU A OE1 1 
ATOM   855  O OE2 . GLU A 1 121 ? 42.476  -89.866 25.041  1.00 101.97 ? 138 GLU A OE2 1 
ATOM   856  N N   . HIS A 1 122 ? 42.527  -83.259 22.958  1.00 68.79  ? 139 HIS A N   1 
ATOM   857  C CA  . HIS A 1 122 ? 43.063  -81.897 23.072  1.00 66.17  ? 139 HIS A CA  1 
ATOM   858  C C   . HIS A 1 122 ? 41.822  -81.015 23.215  1.00 65.50  ? 139 HIS A C   1 
ATOM   859  O O   . HIS A 1 122 ? 40.708  -81.529 23.156  1.00 62.64  ? 139 HIS A O   1 
ATOM   860  C CB  . HIS A 1 122 ? 43.855  -81.501 21.830  1.00 66.43  ? 139 HIS A CB  1 
ATOM   861  C CG  . HIS A 1 122 ? 43.086  -81.698 20.571  1.00 66.57  ? 139 HIS A CG  1 
ATOM   862  N ND1 . HIS A 1 122 ? 43.315  -82.755 19.719  1.00 66.52  ? 139 HIS A ND1 1 
ATOM   863  C CD2 . HIS A 1 122 ? 42.031  -81.023 20.068  1.00 65.00  ? 139 HIS A CD2 1 
ATOM   864  C CE1 . HIS A 1 122 ? 42.441  -82.710 18.733  1.00 67.47  ? 139 HIS A CE1 1 
ATOM   865  N NE2 . HIS A 1 122 ? 41.652  -81.667 18.922  1.00 67.43  ? 139 HIS A NE2 1 
ATOM   866  N N   . ARG A 1 123 ? 42.001  -79.705 23.384  1.00 68.39  ? 140 ARG A N   1 
ATOM   867  C CA  . ARG A 1 123 ? 40.878  -78.791 23.681  1.00 71.39  ? 140 ARG A CA  1 
ATOM   868  C C   . ARG A 1 123 ? 40.680  -77.726 22.588  1.00 72.36  ? 140 ARG A C   1 
ATOM   869  O O   . ARG A 1 123 ? 40.589  -76.529 22.871  1.00 75.42  ? 140 ARG A O   1 
ATOM   870  C CB  . ARG A 1 123 ? 41.090  -78.120 25.048  1.00 71.04  ? 140 ARG A CB  1 
ATOM   871  N N   . LEU A 1 124 ? 40.595  -78.184 21.345  1.00 71.84  ? 141 LEU A N   1 
ATOM   872  C CA  . LEU A 1 124 ? 40.394  -77.323 20.174  1.00 70.63  ? 141 LEU A CA  1 
ATOM   873  C C   . LEU A 1 124 ? 39.537  -78.086 19.159  1.00 68.98  ? 141 LEU A C   1 
ATOM   874  O O   . LEU A 1 124 ? 39.971  -78.350 18.027  1.00 66.62  ? 141 LEU A O   1 
ATOM   875  C CB  . LEU A 1 124 ? 41.740  -76.930 19.548  1.00 70.47  ? 141 LEU A CB  1 
ATOM   876  C CG  . LEU A 1 124 ? 42.742  -76.103 20.369  1.00 69.47  ? 141 LEU A CG  1 
ATOM   877  C CD1 . LEU A 1 124 ? 44.047  -75.905 19.605  1.00 68.49  ? 141 LEU A CD1 1 
ATOM   878  C CD2 . LEU A 1 124 ? 42.159  -74.753 20.756  1.00 69.41  ? 141 LEU A CD2 1 
ATOM   879  N N   . ASN A 1 125 ? 38.325  -78.453 19.580  1.00 67.82  ? 142 ASN A N   1 
ATOM   880  C CA  . ASN A 1 125 ? 37.455  -79.273 18.740  1.00 67.81  ? 142 ASN A CA  1 
ATOM   881  C C   . ASN A 1 125 ? 37.005  -78.483 17.531  1.00 64.99  ? 142 ASN A C   1 
ATOM   882  O O   . ASN A 1 125 ? 36.844  -77.258 17.583  1.00 63.32  ? 142 ASN A O   1 
ATOM   883  C CB  . ASN A 1 125 ? 36.200  -79.778 19.462  1.00 70.28  ? 142 ASN A CB  1 
ATOM   884  C CG  . ASN A 1 125 ? 36.468  -80.238 20.875  1.00 70.61  ? 142 ASN A CG  1 
ATOM   885  O OD1 . ASN A 1 125 ? 35.977  -79.626 21.818  1.00 70.88  ? 142 ASN A OD1 1 
ATOM   886  N ND2 . ASN A 1 125 ? 37.242  -81.310 21.031  1.00 69.79  ? 142 ASN A ND2 1 
ATOM   887  N N   . ASN A 1 126 ? 36.799  -79.214 16.445  1.00 63.44  ? 143 ASN A N   1 
ATOM   888  C CA  . ASN A 1 126 ? 36.392  -78.632 15.178  1.00 62.40  ? 143 ASN A CA  1 
ATOM   889  C C   . ASN A 1 126 ? 37.338  -77.550 14.691  1.00 59.01  ? 143 ASN A C   1 
ATOM   890  O O   . ASN A 1 126 ? 36.923  -76.613 14.033  1.00 60.56  ? 143 ASN A O   1 
ATOM   891  C CB  . ASN A 1 126 ? 34.950  -78.123 15.275  1.00 61.18  ? 143 ASN A CB  1 
ATOM   892  C CG  . ASN A 1 126 ? 33.967  -79.242 15.565  1.00 60.54  ? 143 ASN A CG  1 
ATOM   893  O OD1 . ASN A 1 126 ? 34.258  -80.426 15.360  1.00 57.91  ? 143 ASN A OD1 1 
ATOM   894  N ND2 . ASN A 1 126 ? 32.793  -78.874 16.037  1.00 61.40  ? 143 ASN A ND2 1 
ATOM   895  N N   . TYR A 1 127 ? 38.615  -77.688 15.008  0.50 57.20  ? 144 TYR A N   1 
ATOM   896  C CA  . TYR A 1 127 ? 39.586  -76.767 14.481  1.00 56.69  ? 144 TYR A CA  1 
ATOM   897  C C   . TYR A 1 127 ? 39.678  -77.005 12.982  1.00 55.73  ? 144 TYR A C   1 
ATOM   898  O O   . TYR A 1 127 ? 39.674  -78.139 12.511  1.00 52.74  ? 144 TYR A O   1 
ATOM   899  C CB  . TYR A 1 127 ? 40.952  -76.971 15.147  1.00 56.92  ? 144 TYR A CB  1 
ATOM   900  C CG  . TYR A 1 127 ? 42.034  -76.071 14.620  1.00 55.40  ? 144 TYR A CG  1 
ATOM   901  C CD1 . TYR A 1 127 ? 42.253  -74.817 15.178  1.00 55.60  ? 144 TYR A CD1 1 
ATOM   902  C CD2 . TYR A 1 127 ? 42.849  -76.469 13.559  1.00 55.59  ? 144 TYR A CD2 1 
ATOM   903  C CE1 . TYR A 1 127 ? 43.252  -73.980 14.690  1.00 54.02  ? 144 TYR A CE1 1 
ATOM   904  C CE2 . TYR A 1 127 ? 43.857  -75.640 13.072  1.00 52.68  ? 144 TYR A CE2 1 
ATOM   905  C CZ  . TYR A 1 127 ? 44.046  -74.402 13.638  1.00 51.60  ? 144 TYR A CZ  1 
ATOM   906  O OH  . TYR A 1 127 ? 45.024  -73.580 13.153  1.00 52.32  ? 144 TYR A OH  1 
ATOM   907  N N   . ARG A 1 128 ? 39.709  -75.926 12.227  1.00 56.63  ? 145 ARG A N   1 
ATOM   908  C CA  . ARG A 1 128 ? 40.137  -76.019 10.855  1.00 57.26  ? 145 ARG A CA  1 
ATOM   909  C C   . ARG A 1 128 ? 40.721  -74.704 10.467  1.00 54.91  ? 145 ARG A C   1 
ATOM   910  O O   . ARG A 1 128 ? 40.309  -73.654 10.965  1.00 53.96  ? 145 ARG A O   1 
ATOM   911  C CB  . ARG A 1 128 ? 39.018  -76.446 9.899   1.00 60.43  ? 145 ARG A CB  1 
ATOM   912  C CG  . ARG A 1 128 ? 38.045  -75.366 9.480   1.00 63.68  ? 145 ARG A CG  1 
ATOM   913  C CD  . ARG A 1 128 ? 36.785  -75.989 8.884   1.00 66.31  ? 145 ARG A CD  1 
ATOM   914  N NE  . ARG A 1 128 ? 35.573  -75.426 9.485   1.00 68.35  ? 145 ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 128 ? 34.873  -74.413 8.982   1.00 68.65  ? 145 ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 128 ? 35.240  -73.837 7.837   1.00 71.38  ? 145 ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 128 ? 33.787  -73.985 9.618   1.00 67.61  ? 145 ARG A NH2 1 
ATOM   918  N N   . SER A 1 129 ? 41.701  -74.794 9.580   1.00 52.63  ? 146 SER A N   1 
ATOM   919  C CA  . SER A 1 129 ? 42.509  -73.672 9.189   1.00 49.23  ? 146 SER A CA  1 
ATOM   920  C C   . SER A 1 129 ? 42.736  -73.727 7.699   1.00 48.13  ? 146 SER A C   1 
ATOM   921  O O   . SER A 1 129 ? 42.482  -74.742 7.055   1.00 46.02  ? 146 SER A O   1 
ATOM   922  C CB  . SER A 1 129 ? 43.852  -73.758 9.878   1.00 46.66  ? 146 SER A CB  1 
ATOM   923  O OG  . SER A 1 129 ? 44.474  -74.974 9.510   1.00 45.72  ? 146 SER A OG  1 
ATOM   924  N N   . VAL A 1 130 ? 43.254  -72.620 7.187   1.00 48.94  ? 147 VAL A N   1 
ATOM   925  C CA  . VAL A 1 130 ? 43.496  -72.428 5.779   1.00 49.58  ? 147 VAL A CA  1 
ATOM   926  C C   . VAL A 1 130 ? 44.773  -71.631 5.681   1.00 49.56  ? 147 VAL A C   1 
ATOM   927  O O   . VAL A 1 130 ? 44.859  -70.552 6.256   1.00 51.79  ? 147 VAL A O   1 
ATOM   928  C CB  . VAL A 1 130 ? 42.371  -71.595 5.138   1.00 50.04  ? 147 VAL A CB  1 
ATOM   929  C CG1 . VAL A 1 130 ? 42.771  -71.137 3.746   1.00 49.62  ? 147 VAL A CG1 1 
ATOM   930  C CG2 . VAL A 1 130 ? 41.053  -72.379 5.109   1.00 50.27  ? 147 VAL A CG2 1 
ATOM   931  N N   . THR A 1 131 ? 45.741  -72.158 4.941   1.00 48.30  ? 148 THR A N   1 
ATOM   932  C CA  . THR A 1 131 ? 47.057  -71.558 4.799   1.00 48.00  ? 148 THR A CA  1 
ATOM   933  C C   . THR A 1 131 ? 47.325  -71.263 3.325   1.00 47.97  ? 148 THR A C   1 
ATOM   934  O O   . THR A 1 131 ? 47.001  -72.081 2.479   1.00 46.09  ? 148 THR A O   1 
ATOM   935  C CB  . THR A 1 131 ? 48.137  -72.557 5.246   1.00 47.33  ? 148 THR A CB  1 
ATOM   936  O OG1 . THR A 1 131 ? 47.701  -73.227 6.423   1.00 49.62  ? 148 THR A OG1 1 
ATOM   937  C CG2 . THR A 1 131 ? 49.460  -71.879 5.495   1.00 47.18  ? 148 THR A CG2 1 
ATOM   938  N N   . SER A 1 132 ? 47.965  -70.129 3.037   1.00 47.41  ? 149 SER A N   1 
ATOM   939  C CA  . SER A 1 132 ? 48.247  -69.731 1.675   1.00 47.14  ? 149 SER A CA  1 
ATOM   940  C C   . SER A 1 132 ? 49.554  -68.975 1.592   1.00 49.08  ? 149 SER A C   1 
ATOM   941  O O   . SER A 1 132 ? 49.828  -68.125 2.418   1.00 53.18  ? 149 SER A O   1 
ATOM   942  C CB  . SER A 1 132 ? 47.122  -68.854 1.154   1.00 46.21  ? 149 SER A CB  1 
ATOM   943  O OG  . SER A 1 132 ? 47.185  -67.560 1.717   1.00 44.31  ? 149 SER A OG  1 
ATOM   944  N N   . VAL A 1 133 ? 50.350  -69.275 0.572   1.00 51.00  ? 150 VAL A N   1 
ATOM   945  C CA  . VAL A 1 133 ? 51.658  -68.659 0.381   1.00 50.69  ? 150 VAL A CA  1 
ATOM   946  C C   . VAL A 1 133 ? 51.565  -67.727 -0.800  1.00 49.64  ? 150 VAL A C   1 
ATOM   947  O O   . VAL A 1 133 ? 51.104  -68.136 -1.837  1.00 51.68  ? 150 VAL A O   1 
ATOM   948  C CB  . VAL A 1 133 ? 52.717  -69.733 0.097   1.00 51.18  ? 150 VAL A CB  1 
ATOM   949  C CG1 . VAL A 1 133 ? 54.115  -69.124 0.017   1.00 50.85  ? 150 VAL A CG1 1 
ATOM   950  C CG2 . VAL A 1 133 ? 52.655  -70.804 1.178   1.00 50.64  ? 150 VAL A CG2 1 
ATOM   951  N N   . ASN A 1 134 ? 51.995  -66.483 -0.638  1.00 50.98  ? 151 ASN A N   1 
ATOM   952  C CA  . ASN A 1 134 ? 51.862  -65.476 -1.671  1.00 55.04  ? 151 ASN A CA  1 
ATOM   953  C C   . ASN A 1 134 ? 53.119  -64.684 -1.891  1.00 55.76  ? 151 ASN A C   1 
ATOM   954  O O   . ASN A 1 134 ? 53.573  -63.990 -0.978  1.00 58.93  ? 151 ASN A O   1 
ATOM   955  C CB  . ASN A 1 134 ? 50.783  -64.505 -1.278  1.00 59.05  ? 151 ASN A CB  1 
ATOM   956  C CG  . ASN A 1 134 ? 49.465  -65.176 -1.112  1.00 61.72  ? 151 ASN A CG  1 
ATOM   957  O OD1 . ASN A 1 134 ? 48.790  -65.460 -2.105  1.00 63.43  ? 151 ASN A OD1 1 
ATOM   958  N ND2 . ASN A 1 134 ? 49.090  -65.463 0.145   1.00 61.69  ? 151 ASN A ND2 1 
ATOM   959  N N   . GLU A 1 135 ? 53.643  -64.731 -3.116  1.00 55.43  ? 152 GLU A N   1 
ATOM   960  C CA  . GLU A 1 135 ? 54.936  -64.125 -3.412  1.00 53.42  ? 152 GLU A CA  1 
ATOM   961  C C   . GLU A 1 135 ? 54.798  -62.662 -3.758  1.00 53.29  ? 152 GLU A C   1 
ATOM   962  O O   . GLU A 1 135 ? 53.749  -62.205 -4.184  1.00 55.80  ? 152 GLU A O   1 
ATOM   963  C CB  . GLU A 1 135 ? 55.635  -64.868 -4.546  1.00 53.38  ? 152 GLU A CB  1 
ATOM   964  C CG  . GLU A 1 135 ? 57.135  -64.657 -4.571  1.00 53.58  ? 152 GLU A CG  1 
ATOM   965  C CD  . GLU A 1 135 ? 57.848  -65.613 -5.495  1.00 55.19  ? 152 GLU A CD  1 
ATOM   966  O OE1 . GLU A 1 135 ? 58.498  -65.130 -6.438  1.00 62.62  ? 152 GLU A OE1 1 
ATOM   967  O OE2 . GLU A 1 135 ? 57.778  -66.842 -5.296  1.00 55.25  ? 152 GLU A OE2 1 
ATOM   968  N N   . PHE A 1 136 ? 55.877  -61.932 -3.547  1.00 52.96  ? 153 PHE A N   1 
ATOM   969  C CA  . PHE A 1 136 ? 55.933  -60.518 -3.819  1.00 54.06  ? 153 PHE A CA  1 
ATOM   970  C C   . PHE A 1 136 ? 57.309  -60.164 -4.371  1.00 56.57  ? 153 PHE A C   1 
ATOM   971  O O   . PHE A 1 136 ? 58.295  -60.863 -4.115  1.00 55.68  ? 153 PHE A O   1 
ATOM   972  C CB  . PHE A 1 136 ? 55.675  -59.731 -2.532  1.00 53.66  ? 153 PHE A CB  1 
ATOM   973  C CG  . PHE A 1 136 ? 54.241  -59.777 -2.068  1.00 51.90  ? 153 PHE A CG  1 
ATOM   974  C CD1 . PHE A 1 136 ? 53.785  -60.825 -1.294  1.00 50.18  ? 153 PHE A CD1 1 
ATOM   975  C CD2 . PHE A 1 136 ? 53.367  -58.765 -2.396  1.00 51.34  ? 153 PHE A CD2 1 
ATOM   976  C CE1 . PHE A 1 136 ? 52.480  -60.869 -0.861  1.00 50.82  ? 153 PHE A CE1 1 
ATOM   977  C CE2 . PHE A 1 136 ? 52.059  -58.802 -1.975  1.00 52.46  ? 153 PHE A CE2 1 
ATOM   978  C CZ  . PHE A 1 136 ? 51.610  -59.852 -1.201  1.00 51.49  ? 153 PHE A CZ  1 
ATOM   979  N N   . VAL A 1 137 ? 57.361  -59.069 -5.121  1.00 60.29  ? 154 VAL A N   1 
ATOM   980  C CA  . VAL A 1 137 ? 58.580  -58.589 -5.755  1.00 63.34  ? 154 VAL A CA  1 
ATOM   981  C C   . VAL A 1 137 ? 58.690  -57.110 -5.450  1.00 66.53  ? 154 VAL A C   1 
ATOM   982  O O   . VAL A 1 137 ? 57.702  -56.397 -5.546  1.00 69.55  ? 154 VAL A O   1 
ATOM   983  C CB  . VAL A 1 137 ? 58.499  -58.831 -7.284  1.00 64.69  ? 154 VAL A CB  1 
ATOM   984  C CG1 . VAL A 1 137 ? 59.400  -57.883 -8.076  1.00 65.10  ? 154 VAL A CG1 1 
ATOM   985  C CG2 . VAL A 1 137 ? 58.824  -60.286 -7.599  1.00 64.12  ? 154 VAL A CG2 1 
ATOM   986  N N   . VAL A 1 138 ? 59.874  -56.645 -5.073  1.00 71.72  ? 155 VAL A N   1 
ATOM   987  C CA  . VAL A 1 138 ? 60.097  -55.207 -4.849  1.00 77.56  ? 155 VAL A CA  1 
ATOM   988  C C   . VAL A 1 138 ? 61.387  -54.754 -5.530  1.00 81.05  ? 155 VAL A C   1 
ATOM   989  O O   . VAL A 1 138 ? 62.315  -55.552 -5.679  1.00 79.03  ? 155 VAL A O   1 
ATOM   990  C CB  . VAL A 1 138 ? 60.134  -54.847 -3.344  1.00 78.35  ? 155 VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 138 ? 58.765  -55.068 -2.709  1.00 78.85  ? 155 VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 138 ? 61.203  -55.649 -2.610  1.00 78.42  ? 155 VAL A CG2 1 
ATOM   993  N N   . LEU A 1 139 ? 61.433  -53.481 -5.939  1.00 86.23  ? 156 LEU A N   1 
ATOM   994  C CA  . LEU A 1 139 ? 62.592  -52.925 -6.666  1.00 90.98  ? 156 LEU A CA  1 
ATOM   995  C C   . LEU A 1 139 ? 63.365  -51.892 -5.836  1.00 92.78  ? 156 LEU A C   1 
ATOM   996  O O   . LEU A 1 139 ? 62.821  -51.277 -4.914  1.00 92.60  ? 156 LEU A O   1 
ATOM   997  C CB  . LEU A 1 139 ? 62.145  -52.297 -7.994  1.00 91.58  ? 156 LEU A CB  1 
ATOM   998  N N   . LYS A 1 144 ? 68.301  -54.795 -8.327  1.00 90.66  ? 161 LYS A N   1 
ATOM   999  C CA  . LYS A 1 144 ? 68.253  -55.454 -7.025  1.00 93.55  ? 161 LYS A CA  1 
ATOM   1000 C C   . LYS A 1 144 ? 66.806  -55.660 -6.549  1.00 95.93  ? 161 LYS A C   1 
ATOM   1001 O O   . LYS A 1 144 ? 66.377  -55.086 -5.540  1.00 96.05  ? 161 LYS A O   1 
ATOM   1002 C CB  . LYS A 1 144 ? 69.045  -54.650 -5.989  1.00 91.45  ? 161 LYS A CB  1 
ATOM   1003 N N   . LYS A 1 145 ? 66.059  -56.482 -7.287  1.00 97.43  ? 162 LYS A N   1 
ATOM   1004 C CA  . LYS A 1 145 ? 64.685  -56.825 -6.919  1.00 94.75  ? 162 LYS A CA  1 
ATOM   1005 C C   . LYS A 1 145 ? 64.699  -58.046 -6.016  1.00 93.90  ? 162 LYS A C   1 
ATOM   1006 O O   . LYS A 1 145 ? 65.094  -59.129 -6.455  1.00 95.34  ? 162 LYS A O   1 
ATOM   1007 C CB  . LYS A 1 145 ? 63.841  -57.121 -8.160  1.00 95.17  ? 162 LYS A CB  1 
ATOM   1008 N N   . ARG A 1 146 ? 64.287  -57.867 -4.759  1.00 90.99  ? 163 ARG A N   1 
ATOM   1009 C CA  . ARG A 1 146 ? 64.249  -58.966 -3.784  1.00 87.66  ? 163 ARG A CA  1 
ATOM   1010 C C   . ARG A 1 146 ? 62.863  -59.596 -3.746  1.00 84.36  ? 163 ARG A C   1 
ATOM   1011 O O   . ARG A 1 146 ? 61.866  -58.904 -3.943  1.00 91.50  ? 163 ARG A O   1 
ATOM   1012 C CB  . ARG A 1 146 ? 64.666  -58.493 -2.373  1.00 85.72  ? 163 ARG A CB  1 
ATOM   1013 C CG  . ARG A 1 146 ? 63.683  -57.595 -1.625  1.00 83.28  ? 163 ARG A CG  1 
ATOM   1014 C CD  . ARG A 1 146 ? 63.957  -57.599 -0.119  1.00 81.66  ? 163 ARG A CD  1 
ATOM   1015 N NE  . ARG A 1 146 ? 62.906  -56.932 0.661   1.00 80.01  ? 163 ARG A NE  1 
ATOM   1016 C CZ  . ARG A 1 146 ? 61.925  -57.563 1.304   1.00 72.99  ? 163 ARG A CZ  1 
ATOM   1017 N N   . VAL A 1 147 ? 62.806  -60.903 -3.496  1.00 77.46  ? 164 VAL A N   1 
ATOM   1018 C CA  . VAL A 1 147 ? 61.531  -61.602 -3.373  1.00 74.44  ? 164 VAL A CA  1 
ATOM   1019 C C   . VAL A 1 147 ? 61.292  -62.075 -1.940  1.00 69.58  ? 164 VAL A C   1 
ATOM   1020 O O   . VAL A 1 147 ? 62.189  -62.634 -1.289  1.00 64.92  ? 164 VAL A O   1 
ATOM   1021 C CB  . VAL A 1 147 ? 61.410  -62.800 -4.354  1.00 76.54  ? 164 VAL A CB  1 
ATOM   1022 C CG1 . VAL A 1 147 ? 61.894  -62.399 -5.739  1.00 78.42  ? 164 VAL A CG1 1 
ATOM   1023 C CG2 . VAL A 1 147 ? 62.172  -64.029 -3.864  1.00 77.42  ? 164 VAL A CG2 1 
ATOM   1024 N N   . TYR A 1 148 ? 60.072  -61.832 -1.463  1.00 65.12  ? 165 TYR A N   1 
ATOM   1025 C CA  . TYR A 1 148 ? 59.598  -62.385 -0.211  1.00 60.31  ? 165 TYR A CA  1 
ATOM   1026 C C   . TYR A 1 148 ? 58.180  -62.881 -0.379  1.00 60.17  ? 165 TYR A C   1 
ATOM   1027 O O   . TYR A 1 148 ? 57.486  -62.472 -1.302  1.00 58.94  ? 165 TYR A O   1 
ATOM   1028 C CB  . TYR A 1 148 ? 59.646  -61.332 0.880   1.00 58.58  ? 165 TYR A CB  1 
ATOM   1029 C CG  . TYR A 1 148 ? 58.615  -60.246 0.761   1.00 57.99  ? 165 TYR A CG  1 
ATOM   1030 C CD1 . TYR A 1 148 ? 58.809  -59.183 -0.093  1.00 59.12  ? 165 TYR A CD1 1 
ATOM   1031 C CD2 . TYR A 1 148 ? 57.451  -60.266 1.535   1.00 58.28  ? 165 TYR A CD2 1 
ATOM   1032 C CE1 . TYR A 1 148 ? 57.870  -58.172 -0.201  1.00 61.55  ? 165 TYR A CE1 1 
ATOM   1033 C CE2 . TYR A 1 148 ? 56.498  -59.256 1.440   1.00 58.12  ? 165 TYR A CE2 1 
ATOM   1034 C CZ  . TYR A 1 148 ? 56.716  -58.207 0.572   1.00 61.26  ? 165 TYR A CZ  1 
ATOM   1035 O OH  . TYR A 1 148 ? 55.796  -57.187 0.446   1.00 62.24  ? 165 TYR A OH  1 
ATOM   1036 N N   . SER A 1 149 ? 57.754  -63.759 0.523   1.00 59.29  ? 166 SER A N   1 
ATOM   1037 C CA  . SER A 1 149 ? 56.383  -64.243 0.530   1.00 58.12  ? 166 SER A CA  1 
ATOM   1038 C C   . SER A 1 149 ? 55.655  -63.786 1.789   1.00 58.15  ? 166 SER A C   1 
ATOM   1039 O O   . SER A 1 149 ? 56.277  -63.439 2.802   1.00 56.05  ? 166 SER A O   1 
ATOM   1040 C CB  . SER A 1 149 ? 56.352  -65.766 0.469   1.00 58.38  ? 166 SER A CB  1 
ATOM   1041 O OG  . SER A 1 149 ? 57.139  -66.250 -0.594  1.00 60.70  ? 166 SER A OG  1 
ATOM   1042 N N   . VAL A 1 150 ? 54.327  -63.786 1.703   1.00 55.52  ? 167 VAL A N   1 
ATOM   1043 C CA  . VAL A 1 150 ? 53.484  -63.570 2.845   1.00 50.87  ? 167 VAL A CA  1 
ATOM   1044 C C   . VAL A 1 150 ? 52.681  -64.825 3.027   1.00 49.18  ? 167 VAL A C   1 
ATOM   1045 O O   . VAL A 1 150 ? 51.894  -65.184 2.166   1.00 50.58  ? 167 VAL A O   1 
ATOM   1046 C CB  . VAL A 1 150 ? 52.538  -62.404 2.615   1.00 51.40  ? 167 VAL A CB  1 
ATOM   1047 C CG1 . VAL A 1 150 ? 51.460  -62.375 3.692   1.00 51.27  ? 167 VAL A CG1 1 
ATOM   1048 C CG2 . VAL A 1 150 ? 53.322  -61.102 2.572   1.00 51.43  ? 167 VAL A CG2 1 
ATOM   1049 N N   . VAL A 1 151 ? 52.891  -65.496 4.150   1.00 49.13  ? 168 VAL A N   1 
ATOM   1050 C CA  . VAL A 1 151 ? 52.117  -66.675 4.495   1.00 48.56  ? 168 VAL A CA  1 
ATOM   1051 C C   . VAL A 1 151 ? 50.917  -66.198 5.324   1.00 49.72  ? 168 VAL A C   1 
ATOM   1052 O O   . VAL A 1 151 ? 51.067  -65.431 6.275   1.00 51.80  ? 168 VAL A O   1 
ATOM   1053 C CB  . VAL A 1 151 ? 52.971  -67.702 5.268   1.00 46.79  ? 168 VAL A CB  1 
ATOM   1054 C CG1 . VAL A 1 151 ? 52.183  -68.974 5.529   1.00 45.99  ? 168 VAL A CG1 1 
ATOM   1055 C CG2 . VAL A 1 151 ? 54.236  -68.042 4.487   1.00 46.29  ? 168 VAL A CG2 1 
ATOM   1056 N N   . LEU A 1 152 ? 49.727  -66.606 4.915   1.00 49.02  ? 169 LEU A N   1 
ATOM   1057 C CA  . LEU A 1 152 ? 48.526  -66.318 5.651   1.00 49.89  ? 169 LEU A CA  1 
ATOM   1058 C C   . LEU A 1 152 ? 48.015  -67.629 6.199   1.00 50.84  ? 169 LEU A C   1 
ATOM   1059 O O   . LEU A 1 152 ? 47.832  -68.583 5.444   1.00 51.11  ? 169 LEU A O   1 
ATOM   1060 C CB  . LEU A 1 152 ? 47.475  -65.735 4.733   1.00 51.41  ? 169 LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 152 ? 47.793  -64.497 3.906   1.00 52.44  ? 169 LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 152 ? 46.555  -64.164 3.110   1.00 52.31  ? 169 LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 152 ? 48.196  -63.304 4.761   1.00 53.89  ? 169 LEU A CD2 1 
ATOM   1064 N N   . GLU A 1 153 ? 47.826  -67.681 7.517   1.00 52.36  ? 170 GLU A N   1 
ATOM   1065 C CA  . GLU A 1 153 ? 47.118  -68.775 8.163   1.00 52.76  ? 170 GLU A CA  1 
ATOM   1066 C C   . GLU A 1 153 ? 45.971  -68.195 8.972   1.00 52.16  ? 170 GLU A C   1 
ATOM   1067 O O   . GLU A 1 153 ? 46.156  -67.250 9.746   1.00 52.18  ? 170 GLU A O   1 
ATOM   1068 C CB  . GLU A 1 153 ? 48.043  -69.598 9.051   1.00 55.56  ? 170 GLU A CB  1 
ATOM   1069 C CG  . GLU A 1 153 ? 47.464  -70.945 9.488   1.00 57.24  ? 170 GLU A CG  1 
ATOM   1070 C CD  . GLU A 1 153 ? 48.536  -72.023 9.664   1.00 61.22  ? 170 GLU A CD  1 
ATOM   1071 O OE1 . GLU A 1 153 ? 49.105  -72.460 8.633   1.00 56.92  ? 170 GLU A OE1 1 
ATOM   1072 O OE2 . GLU A 1 153 ? 48.811  -72.442 10.827  1.00 64.12  ? 170 GLU A OE2 1 
ATOM   1073 N N   . SER A 1 154 ? 44.780  -68.744 8.741   1.00 50.82  ? 171 SER A N   1 
ATOM   1074 C CA  . SER A 1 154 ? 43.569  -68.352 9.436   1.00 49.83  ? 171 SER A CA  1 
ATOM   1075 C C   . SER A 1 154 ? 42.894  -69.618 9.922   1.00 48.42  ? 171 SER A C   1 
ATOM   1076 O O   . SER A 1 154 ? 43.130  -70.690 9.372   1.00 45.67  ? 171 SER A O   1 
ATOM   1077 C CB  . SER A 1 154 ? 42.625  -67.622 8.477   1.00 50.67  ? 171 SER A CB  1 
ATOM   1078 O OG  . SER A 1 154 ? 42.210  -68.495 7.434   1.00 50.49  ? 171 SER A OG  1 
ATOM   1079 N N   . TYR A 1 155 ? 42.039  -69.490 10.931  1.00 48.84  ? 172 TYR A N   1 
ATOM   1080 C CA  . TYR A 1 155 ? 41.383  -70.657 11.488  1.00 51.28  ? 172 TYR A CA  1 
ATOM   1081 C C   . TYR A 1 155 ? 40.020  -70.349 12.070  1.00 52.21  ? 172 TYR A C   1 
ATOM   1082 O O   . TYR A 1 155 ? 39.667  -69.192 12.311  1.00 52.55  ? 172 TYR A O   1 
ATOM   1083 C CB  . TYR A 1 155 ? 42.264  -71.273 12.572  1.00 53.66  ? 172 TYR A CB  1 
ATOM   1084 C CG  . TYR A 1 155 ? 42.523  -70.324 13.714  1.00 55.87  ? 172 TYR A CG  1 
ATOM   1085 C CD1 . TYR A 1 155 ? 41.599  -70.192 14.754  1.00 58.66  ? 172 TYR A CD1 1 
ATOM   1086 C CD2 . TYR A 1 155 ? 43.664  -69.551 13.751  1.00 55.31  ? 172 TYR A CD2 1 
ATOM   1087 C CE1 . TYR A 1 155 ? 41.815  -69.316 15.793  1.00 59.28  ? 172 TYR A CE1 1 
ATOM   1088 C CE2 . TYR A 1 155 ? 43.884  -68.664 14.786  1.00 58.39  ? 172 TYR A CE2 1 
ATOM   1089 C CZ  . TYR A 1 155 ? 42.957  -68.554 15.808  1.00 59.64  ? 172 TYR A CZ  1 
ATOM   1090 O OH  . TYR A 1 155 ? 43.166  -67.679 16.853  1.00 61.92  ? 172 TYR A OH  1 
ATOM   1091 N N   . ILE A 1 156 ? 39.250  -71.407 12.275  1.00 52.51  ? 173 ILE A N   1 
ATOM   1092 C CA  . ILE A 1 156 ? 38.096  -71.345 13.147  1.00 53.79  ? 173 ILE A CA  1 
ATOM   1093 C C   . ILE A 1 156 ? 38.139  -72.531 14.133  1.00 54.06  ? 173 ILE A C   1 
ATOM   1094 O O   . ILE A 1 156 ? 38.492  -73.665 13.766  1.00 52.55  ? 173 ILE A O   1 
ATOM   1095 C CB  . ILE A 1 156 ? 36.775  -71.294 12.362  1.00 53.43  ? 173 ILE A CB  1 
ATOM   1096 C CG1 . ILE A 1 156 ? 35.599  -71.202 13.349  1.00 53.57  ? 173 ILE A CG1 1 
ATOM   1097 C CG2 . ILE A 1 156 ? 36.636  -72.507 11.441  1.00 53.28  ? 173 ILE A CG2 1 
ATOM   1098 C CD1 . ILE A 1 156 ? 34.276  -70.821 12.729  1.00 53.27  ? 173 ILE A CD1 1 
ATOM   1099 N N   . VAL A 1 157 ? 37.806  -72.260 15.390  1.00 55.97  ? 174 VAL A N   1 
ATOM   1100 C CA  . VAL A 1 157 ? 37.827  -73.314 16.432  1.00 57.79  ? 174 VAL A CA  1 
ATOM   1101 C C   . VAL A 1 157 ? 36.691  -73.139 17.428  1.00 57.00  ? 174 VAL A C   1 
ATOM   1102 O O   . VAL A 1 157 ? 36.275  -72.012 17.698  1.00 55.78  ? 174 VAL A O   1 
ATOM   1103 C CB  . VAL A 1 157 ? 39.173  -73.337 17.187  1.00 55.59  ? 174 VAL A CB  1 
ATOM   1104 C CG1 . VAL A 1 157 ? 39.305  -72.134 18.102  1.00 54.85  ? 174 VAL A CG1 1 
ATOM   1105 C CG2 . VAL A 1 157 ? 39.332  -74.626 17.958  1.00 56.92  ? 174 VAL A CG2 1 
ATOM   1106 N N   . ASP A 1 158 ? 36.188  -74.251 17.959  1.00 58.19  ? 175 ASP A N   1 
ATOM   1107 C CA  . ASP A 1 158 ? 35.197  -74.189 19.039  1.00 59.95  ? 175 ASP A CA  1 
ATOM   1108 C C   . ASP A 1 158 ? 35.853  -73.544 20.261  1.00 60.46  ? 175 ASP A C   1 
ATOM   1109 O O   . ASP A 1 158 ? 37.050  -73.688 20.487  1.00 56.06  ? 175 ASP A O   1 
ATOM   1110 C CB  . ASP A 1 158 ? 34.667  -75.585 19.408  1.00 60.45  ? 175 ASP A CB  1 
ATOM   1111 C CG  . ASP A 1 158 ? 33.566  -76.089 18.464  1.00 60.69  ? 175 ASP A CG  1 
ATOM   1112 O OD1 . ASP A 1 158 ? 33.408  -75.558 17.348  1.00 62.53  ? 175 ASP A OD1 1 
ATOM   1113 O OD2 . ASP A 1 158 ? 32.847  -77.037 18.846  1.00 60.72  ? 175 ASP A OD2 1 
ATOM   1114 N N   . ILE A 1 159 ? 35.065  -72.806 21.025  1.00 63.65  ? 176 ILE A N   1 
ATOM   1115 C CA  . ILE A 1 159 ? 35.518  -72.265 22.300  1.00 67.00  ? 176 ILE A CA  1 
ATOM   1116 C C   . ILE A 1 159 ? 35.117  -73.272 23.382  1.00 69.85  ? 176 ILE A C   1 
ATOM   1117 O O   . ILE A 1 159 ? 33.926  -73.399 23.681  1.00 72.20  ? 176 ILE A O   1 
ATOM   1118 C CB  . ILE A 1 159 ? 34.870  -70.893 22.571  1.00 67.16  ? 176 ILE A CB  1 
ATOM   1119 C CG1 . ILE A 1 159 ? 35.196  -69.933 21.417  1.00 68.43  ? 176 ILE A CG1 1 
ATOM   1120 C CG2 . ILE A 1 159 ? 35.342  -70.329 23.898  1.00 66.10  ? 176 ILE A CG2 1 
ATOM   1121 C CD1 . ILE A 1 159 ? 34.460  -68.614 21.484  1.00 68.63  ? 176 ILE A CD1 1 
ATOM   1122 N N   . PRO A 1 160 ? 36.093  -74.002 23.964  1.00 73.33  ? 177 PRO A N   1 
ATOM   1123 C CA  . PRO A 1 160 ? 35.744  -75.016 24.977  1.00 76.87  ? 177 PRO A CA  1 
ATOM   1124 C C   . PRO A 1 160 ? 35.130  -74.428 26.255  1.00 79.56  ? 177 PRO A C   1 
ATOM   1125 O O   . PRO A 1 160 ? 35.339  -73.252 26.562  1.00 81.25  ? 177 PRO A O   1 
ATOM   1126 C CB  . PRO A 1 160 ? 37.086  -75.680 25.286  1.00 75.78  ? 177 PRO A CB  1 
ATOM   1127 C CG  . PRO A 1 160 ? 38.105  -74.643 24.953  1.00 74.82  ? 177 PRO A CG  1 
ATOM   1128 C CD  . PRO A 1 160 ? 37.552  -73.898 23.779  1.00 74.11  ? 177 PRO A CD  1 
ATOM   1129 N N   . GLN A 1 161 ? 34.382  -75.254 26.983  0.50 81.79  ? 178 GLN A N   1 
ATOM   1130 C CA  . GLN A 1 161 ? 33.668  -74.813 28.181  1.00 84.17  ? 178 GLN A CA  1 
ATOM   1131 C C   . GLN A 1 161 ? 34.617  -74.167 29.191  1.00 84.90  ? 178 GLN A C   1 
ATOM   1132 O O   . GLN A 1 161 ? 35.590  -74.793 29.628  1.00 84.71  ? 178 GLN A O   1 
ATOM   1133 C CB  . GLN A 1 161 ? 32.937  -75.992 28.837  1.00 84.27  ? 178 GLN A CB  1 
ATOM   1134 N N   . GLY A 1 162 ? 34.330  -72.912 29.539  1.00 85.39  ? 179 GLY A N   1 
ATOM   1135 C CA  . GLY A 1 162 ? 35.080  -72.187 30.566  1.00 86.77  ? 179 GLY A CA  1 
ATOM   1136 C C   . GLY A 1 162 ? 36.336  -71.506 30.054  1.00 87.24  ? 179 GLY A C   1 
ATOM   1137 O O   . GLY A 1 162 ? 37.405  -71.622 30.658  1.00 90.93  ? 179 GLY A O   1 
ATOM   1138 N N   . ASN A 1 163 ? 36.200  -70.799 28.937  1.00 84.80  ? 180 ASN A N   1 
ATOM   1139 C CA  . ASN A 1 163 ? 37.287  -70.033 28.327  1.00 81.06  ? 180 ASN A CA  1 
ATOM   1140 C C   . ASN A 1 163 ? 36.661  -68.937 27.500  1.00 76.53  ? 180 ASN A C   1 
ATOM   1141 O O   . ASN A 1 163 ? 35.624  -69.159 26.886  1.00 76.25  ? 180 ASN A O   1 
ATOM   1142 C CB  . ASN A 1 163 ? 38.139  -70.917 27.410  1.00 82.50  ? 180 ASN A CB  1 
ATOM   1143 C CG  . ASN A 1 163 ? 39.143  -71.778 28.164  1.00 84.92  ? 180 ASN A CG  1 
ATOM   1144 O OD1 . ASN A 1 163 ? 39.608  -72.795 27.646  1.00 85.19  ? 180 ASN A OD1 1 
ATOM   1145 N ND2 . ASN A 1 163 ? 39.493  -71.371 29.382  1.00 87.49  ? 180 ASN A ND2 1 
ATOM   1146 N N   . THR A 1 164 ? 37.269  -67.757 27.486  1.00 74.11  ? 181 THR A N   1 
ATOM   1147 C CA  . THR A 1 164 ? 36.761  -66.667 26.654  1.00 75.60  ? 181 THR A CA  1 
ATOM   1148 C C   . THR A 1 164 ? 37.232  -66.780 25.198  1.00 74.25  ? 181 THR A C   1 
ATOM   1149 O O   . THR A 1 164 ? 38.165  -67.524 24.871  1.00 77.11  ? 181 THR A O   1 
ATOM   1150 C CB  . THR A 1 164 ? 37.204  -65.296 27.184  1.00 76.60  ? 181 THR A CB  1 
ATOM   1151 O OG1 . THR A 1 164 ? 38.626  -65.299 27.380  1.00 78.38  ? 181 THR A OG1 1 
ATOM   1152 C CG2 . THR A 1 164 ? 36.494  -64.975 28.485  1.00 77.71  ? 181 THR A CG2 1 
ATOM   1153 N N   . GLU A 1 165 ? 36.590  -66.024 24.322  1.00 72.89  ? 182 GLU A N   1 
ATOM   1154 C CA  . GLU A 1 165 ? 37.063  -65.934 22.956  1.00 73.17  ? 182 GLU A CA  1 
ATOM   1155 C C   . GLU A 1 165 ? 38.494  -65.435 22.985  1.00 69.92  ? 182 GLU A C   1 
ATOM   1156 O O   . GLU A 1 165 ? 39.397  -66.096 22.465  1.00 65.08  ? 182 GLU A O   1 
ATOM   1157 C CB  . GLU A 1 165 ? 36.190  -64.992 22.123  1.00 76.32  ? 182 GLU A CB  1 
ATOM   1158 C CG  . GLU A 1 165 ? 36.388  -65.142 20.621  1.00 78.51  ? 182 GLU A CG  1 
ATOM   1159 C CD  . GLU A 1 165 ? 35.631  -64.096 19.832  1.00 82.06  ? 182 GLU A CD  1 
ATOM   1160 O OE2 . GLU A 1 165 ? 34.644  -64.468 19.163  1.00 85.41  ? 182 GLU A OE2 1 
ATOM   1161 N N   . GLU A 1 166 ? 38.693  -64.287 23.633  1.00 71.12  ? 183 GLU A N   1 
ATOM   1162 C CA  . GLU A 1 166 ? 40.014  -63.646 23.716  1.00 72.15  ? 183 GLU A CA  1 
ATOM   1163 C C   . GLU A 1 166 ? 41.113  -64.594 24.188  1.00 71.08  ? 183 GLU A C   1 
ATOM   1164 O O   . GLU A 1 166 ? 42.235  -64.510 23.714  1.00 74.71  ? 183 GLU A O   1 
ATOM   1165 C CB  . GLU A 1 166 ? 39.971  -62.408 24.619  1.00 72.52  ? 183 GLU A CB  1 
ATOM   1166 N N   . ASP A 1 167 ? 40.804  -65.504 25.099  1.00 70.90  ? 184 ASP A N   1 
ATOM   1167 C CA  . ASP A 1 167 ? 41.829  -66.421 25.579  1.00 74.19  ? 184 ASP A CA  1 
ATOM   1168 C C   . ASP A 1 167 ? 42.045  -67.585 24.625  1.00 71.34  ? 184 ASP A C   1 
ATOM   1169 O O   . ASP A 1 167 ? 43.166  -68.081 24.518  1.00 74.78  ? 184 ASP A O   1 
ATOM   1170 C CB  . ASP A 1 167 ? 41.520  -66.917 26.996  1.00 77.79  ? 184 ASP A CB  1 
ATOM   1171 C CG  . ASP A 1 167 ? 41.581  -65.805 28.020  1.00 79.70  ? 184 ASP A CG  1 
ATOM   1172 O OD1 . ASP A 1 167 ? 42.418  -64.885 27.877  1.00 81.49  ? 184 ASP A OD1 1 
ATOM   1173 O OD2 . ASP A 1 167 ? 40.778  -65.846 28.970  1.00 83.41  ? 184 ASP A OD2 1 
ATOM   1174 N N   . THR A 1 168 ? 40.993  -68.027 23.941  1.00 68.83  ? 185 THR A N   1 
ATOM   1175 C CA  . THR A 1 168 ? 41.163  -68.989 22.846  1.00 66.47  ? 185 THR A CA  1 
ATOM   1176 C C   . THR A 1 168 ? 41.978  -68.350 21.697  1.00 65.50  ? 185 THR A C   1 
ATOM   1177 O O   . THR A 1 168 ? 42.936  -68.947 21.195  1.00 65.69  ? 185 THR A O   1 
ATOM   1178 C CB  . THR A 1 168 ? 39.817  -69.530 22.328  1.00 63.04  ? 185 THR A CB  1 
ATOM   1179 N N   . ARG A 1 169 ? 41.637  -67.124 21.308  1.00 65.07  ? 186 ARG A N   1 
ATOM   1180 C CA  . ARG A 1 169 ? 42.370  -66.447 20.226  1.00 66.02  ? 186 ARG A CA  1 
ATOM   1181 C C   . ARG A 1 169 ? 43.839  -66.259 20.592  1.00 64.14  ? 186 ARG A C   1 
ATOM   1182 O O   . ARG A 1 169 ? 44.718  -66.629 19.838  1.00 63.08  ? 186 ARG A O   1 
ATOM   1183 C CB  . ARG A 1 169 ? 41.720  -65.099 19.865  1.00 70.60  ? 186 ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 169 ? 42.167  -64.527 18.517  1.00 72.89  ? 186 ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 169 ? 41.148  -63.551 17.915  1.00 76.64  ? 186 ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 169 ? 40.924  -62.379 18.768  1.00 78.94  ? 186 ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 169 ? 39.837  -62.154 19.506  0.50 81.32  ? 186 ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 169 ? 38.810  -63.001 19.504  1.00 82.45  ? 186 ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 169 ? 39.771  -61.055 20.250  1.00 83.78  ? 186 ARG A NH2 1 
ATOM   1190 N N   . MET A 1 170 ? 44.096  -65.703 21.766  1.00 67.27  ? 187 MET A N   1 
ATOM   1191 C CA  . MET A 1 170 ? 45.462  -65.495 22.257  1.00 68.56  ? 187 MET A CA  1 
ATOM   1192 C C   . MET A 1 170 ? 46.304  -66.767 22.172  1.00 63.72  ? 187 MET A C   1 
ATOM   1193 O O   . MET A 1 170 ? 47.449  -66.735 21.704  1.00 62.90  ? 187 MET A O   1 
ATOM   1194 C CB  . MET A 1 170 ? 45.402  -65.013 23.702  1.00 76.81  ? 187 MET A CB  1 
ATOM   1195 C CG  . MET A 1 170 ? 46.701  -64.492 24.292  1.00 83.16  ? 187 MET A CG  1 
ATOM   1196 S SD  . MET A 1 170 ? 46.539  -64.366 26.090  1.00 95.56  ? 187 MET A SD  1 
ATOM   1197 C CE  . MET A 1 170 ? 45.090  -63.320 26.270  1.00 95.14  ? 187 MET A CE  1 
ATOM   1198 N N   . PHE A 1 171 ? 45.736  -67.888 22.609  1.00 58.76  ? 188 PHE A N   1 
ATOM   1199 C CA  . PHE A 1 171 ? 46.463  -69.155 22.571  1.00 56.49  ? 188 PHE A CA  1 
ATOM   1200 C C   . PHE A 1 171 ? 46.764  -69.625 21.150  1.00 57.02  ? 188 PHE A C   1 
ATOM   1201 O O   . PHE A 1 171 ? 47.902  -69.985 20.821  1.00 57.93  ? 188 PHE A O   1 
ATOM   1202 C CB  . PHE A 1 171 ? 45.690  -70.268 23.275  1.00 54.05  ? 188 PHE A CB  1 
ATOM   1203 C CG  . PHE A 1 171 ? 46.388  -71.593 23.217  1.00 52.81  ? 188 PHE A CG  1 
ATOM   1204 C CD1 . PHE A 1 171 ? 47.634  -71.754 23.805  1.00 55.41  ? 188 PHE A CD1 1 
ATOM   1205 C CD2 . PHE A 1 171 ? 45.828  -72.663 22.554  1.00 51.24  ? 188 PHE A CD2 1 
ATOM   1206 C CE1 . PHE A 1 171 ? 48.311  -72.969 23.741  1.00 55.77  ? 188 PHE A CE1 1 
ATOM   1207 C CE2 . PHE A 1 171 ? 46.488  -73.881 22.490  1.00 53.03  ? 188 PHE A CE2 1 
ATOM   1208 C CZ  . PHE A 1 171 ? 47.734  -74.037 23.086  1.00 54.08  ? 188 PHE A CZ  1 
ATOM   1209 N N   . VAL A 1 172 ? 45.726  -69.663 20.322  1.00 56.01  ? 189 VAL A N   1 
ATOM   1210 C CA  . VAL A 1 172 ? 45.837  -70.312 19.036  1.00 54.50  ? 189 VAL A CA  1 
ATOM   1211 C C   . VAL A 1 172 ? 46.779  -69.500 18.146  1.00 52.46  ? 189 VAL A C   1 
ATOM   1212 O O   . VAL A 1 172 ? 47.626  -70.069 17.443  1.00 48.99  ? 189 VAL A O   1 
ATOM   1213 C CB  . VAL A 1 172 ? 44.449  -70.518 18.387  1.00 56.01  ? 189 VAL A CB  1 
ATOM   1214 C CG1 . VAL A 1 172 ? 44.597  -71.132 16.994  1.00 56.33  ? 189 VAL A CG1 1 
ATOM   1215 N N   . ASP A 1 173 ? 46.645  -68.175 18.207  1.00 52.04  ? 190 ASP A N   1 
ATOM   1216 C CA  . ASP A 1 173 ? 47.491  -67.274 17.427  1.00 53.59  ? 190 ASP A CA  1 
ATOM   1217 C C   . ASP A 1 173 ? 48.938  -67.614 17.697  1.00 53.72  ? 190 ASP A C   1 
ATOM   1218 O O   . ASP A 1 173 ? 49.714  -67.880 16.788  1.00 59.03  ? 190 ASP A O   1 
ATOM   1219 C CB  . ASP A 1 173 ? 47.216  -65.807 17.780  1.00 54.80  ? 190 ASP A CB  1 
ATOM   1220 C CG  . ASP A 1 173 ? 45.884  -65.307 17.230  1.00 56.69  ? 190 ASP A CG  1 
ATOM   1221 O OD1 . ASP A 1 173 ? 45.217  -66.036 16.453  1.00 56.72  ? 190 ASP A OD1 1 
ATOM   1222 O OD2 . ASP A 1 173 ? 45.497  -64.175 17.575  1.00 59.20  ? 190 ASP A OD2 1 
ATOM   1223 N N   . THR A 1 174 ? 49.265  -67.630 18.971  1.00 54.02  ? 191 THR A N   1 
ATOM   1224 C CA  . THR A 1 174 ? 50.575  -68.012 19.472  1.00 54.28  ? 191 THR A CA  1 
ATOM   1225 C C   . THR A 1 174 ? 51.169  -69.275 18.812  1.00 51.65  ? 191 THR A C   1 
ATOM   1226 O O   . THR A 1 174 ? 52.339  -69.281 18.400  1.00 50.22  ? 191 THR A O   1 
ATOM   1227 C CB  . THR A 1 174 ? 50.469  -68.172 21.012  1.00 55.21  ? 191 THR A CB  1 
ATOM   1228 O OG1 . THR A 1 174 ? 50.514  -66.880 21.637  1.00 55.96  ? 191 THR A OG1 1 
ATOM   1229 C CG2 . THR A 1 174 ? 51.555  -68.996 21.544  1.00 56.73  ? 191 THR A CG2 1 
ATOM   1230 N N   . VAL A 1 175 ? 50.372  -70.329 18.716  1.00 50.27  ? 192 VAL A N   1 
ATOM   1231 C CA  . VAL A 1 175 ? 50.818  -71.568 18.077  1.00 51.35  ? 192 VAL A CA  1 
ATOM   1232 C C   . VAL A 1 175 ? 51.035  -71.351 16.567  1.00 52.91  ? 192 VAL A C   1 
ATOM   1233 O O   . VAL A 1 175 ? 52.023  -71.813 15.980  1.00 56.66  ? 192 VAL A O   1 
ATOM   1234 C CB  . VAL A 1 175 ? 49.798  -72.712 18.262  1.00 51.56  ? 192 VAL A CB  1 
ATOM   1235 C CG1 . VAL A 1 175 ? 50.297  -73.990 17.597  1.00 51.29  ? 192 VAL A CG1 1 
ATOM   1236 C CG2 . VAL A 1 175 ? 49.510  -72.959 19.743  1.00 52.81  ? 192 VAL A CG2 1 
ATOM   1237 N N   . VAL A 1 176 ? 50.120  -70.651 15.922  1.00 49.89  ? 193 VAL A N   1 
ATOM   1238 C CA  . VAL A 1 176 ? 50.296  -70.378 14.510  1.00 48.02  ? 193 VAL A CA  1 
ATOM   1239 C C   . VAL A 1 176 ? 51.561  -69.558 14.275  1.00 48.17  ? 193 VAL A C   1 
ATOM   1240 O O   . VAL A 1 176 ? 52.353  -69.883 13.379  1.00 49.56  ? 193 VAL A O   1 
ATOM   1241 C CB  . VAL A 1 176 ? 49.065  -69.679 13.908  1.00 45.86  ? 193 VAL A CB  1 
ATOM   1242 C CG2 . VAL A 1 176 ? 47.931  -70.677 13.839  1.00 44.19  ? 193 VAL A CG2 1 
ATOM   1243 N N   . LYS A 1 177 ? 51.778  -68.510 15.067  1.00 47.36  ? 194 LYS A N   1 
ATOM   1244 C CA  . LYS A 1 177 ? 53.013  -67.729 14.896  1.00 49.28  ? 194 LYS A CA  1 
ATOM   1245 C C   . LYS A 1 177 ? 54.222  -68.637 15.052  1.00 48.10  ? 194 LYS A C   1 
ATOM   1246 O O   . LYS A 1 177 ? 55.151  -68.596 14.263  1.00 47.47  ? 194 LYS A O   1 
ATOM   1247 C CB  . LYS A 1 177 ? 53.095  -66.534 15.848  1.00 50.10  ? 194 LYS A CB  1 
ATOM   1248 C CG  . LYS A 1 177 ? 52.669  -65.220 15.203  1.00 50.40  ? 194 LYS A CG  1 
ATOM   1249 N N   . SER A 1 178 ? 54.171  -69.483 16.066  1.00 48.95  ? 195 SER A N   1 
ATOM   1250 C CA  . SER A 1 178 ? 55.173  -70.514 16.254  1.00 48.89  ? 195 SER A CA  1 
ATOM   1251 C C   . SER A 1 178 ? 55.366  -71.374 14.992  1.00 48.30  ? 195 SER A C   1 
ATOM   1252 O O   . SER A 1 178 ? 56.496  -71.633 14.585  1.00 48.10  ? 195 SER A O   1 
ATOM   1253 C CB  . SER A 1 178 ? 54.800  -71.391 17.457  1.00 48.90  ? 195 SER A CB  1 
ATOM   1254 O OG  . SER A 1 178 ? 55.582  -72.577 17.490  1.00 49.78  ? 195 SER A OG  1 
ATOM   1255 N N   . ASN A 1 179 ? 54.277  -71.838 14.389  1.00 48.06  ? 196 ASN A N   1 
ATOM   1256 C CA  . ASN A 1 179 ? 54.392  -72.674 13.189  1.00 47.96  ? 196 ASN A CA  1 
ATOM   1257 C C   . ASN A 1 179 ? 55.093  -71.896 12.084  1.00 48.04  ? 196 ASN A C   1 
ATOM   1258 O O   . ASN A 1 179 ? 56.012  -72.404 11.443  1.00 46.99  ? 196 ASN A O   1 
ATOM   1259 C CB  . ASN A 1 179 ? 53.026  -73.148 12.686  1.00 47.86  ? 196 ASN A CB  1 
ATOM   1260 C CG  . ASN A 1 179 ? 52.319  -74.070 13.664  1.00 48.83  ? 196 ASN A CG  1 
ATOM   1261 O OD1 . ASN A 1 179 ? 52.944  -74.907 14.315  1.00 50.93  ? 196 ASN A OD1 1 
ATOM   1262 N N   . LEU A 1 180 ? 54.666  -70.651 11.898  1.00 47.98  ? 197 LEU A N   1 
ATOM   1263 C CA  . LEU A 1 180 ? 55.116  -69.832 10.776  1.00 47.91  ? 197 LEU A CA  1 
ATOM   1264 C C   . LEU A 1 180 ? 56.542  -69.325 10.961  1.00 49.93  ? 197 LEU A C   1 
ATOM   1265 O O   . LEU A 1 180 ? 57.276  -69.103 10.000  1.00 49.82  ? 197 LEU A O   1 
ATOM   1266 C CB  . LEU A 1 180 ? 54.165  -68.646 10.593  1.00 48.02  ? 197 LEU A CB  1 
ATOM   1267 C CG  . LEU A 1 180 ? 52.712  -69.003 10.296  1.00 46.82  ? 197 LEU A CG  1 
ATOM   1268 C CD1 . LEU A 1 180 ? 51.879  -67.753 10.157  1.00 48.08  ? 197 LEU A CD1 1 
ATOM   1269 C CD2 . LEU A 1 180 ? 52.618  -69.825 9.034   1.00 49.35  ? 197 LEU A CD2 1 
ATOM   1270 N N   . GLN A 1 181 ? 56.966  -69.144 12.202  1.00 52.12  ? 198 GLN A N   1 
ATOM   1271 C CA  . GLN A 1 181 ? 58.315  -68.666 12.408  1.00 52.08  ? 198 GLN A CA  1 
ATOM   1272 C C   . GLN A 1 181 ? 59.307  -69.817 12.164  1.00 49.04  ? 198 GLN A C   1 
ATOM   1273 O O   . GLN A 1 181 ? 60.432  -69.606 11.744  1.00 49.67  ? 198 GLN A O   1 
ATOM   1274 C CB  . GLN A 1 181 ? 58.459  -68.036 13.787  1.00 54.78  ? 198 GLN A CB  1 
ATOM   1275 C CG  . GLN A 1 181 ? 59.575  -66.995 13.847  1.00 59.05  ? 198 GLN A CG  1 
ATOM   1276 C CD  . GLN A 1 181 ? 59.078  -65.560 13.961  1.00 61.39  ? 198 GLN A CD  1 
ATOM   1277 O OE1 . GLN A 1 181 ? 57.973  -65.293 14.450  1.00 60.60  ? 198 GLN A OE1 1 
ATOM   1278 N NE2 . GLN A 1 181 ? 59.922  -64.620 13.541  1.00 64.55  ? 198 GLN A NE2 1 
ATOM   1279 N N   . ASN A 1 182 ? 58.871  -71.042 12.394  1.00 47.29  ? 199 ASN A N   1 
ATOM   1280 C CA  . ASN A 1 182 ? 59.715  -72.189 12.141  1.00 48.06  ? 199 ASN A CA  1 
ATOM   1281 C C   . ASN A 1 182 ? 59.821  -72.436 10.654  1.00 47.73  ? 199 ASN A C   1 
ATOM   1282 O O   . ASN A 1 182 ? 60.889  -72.756 10.139  1.00 49.14  ? 199 ASN A O   1 
ATOM   1283 C CB  . ASN A 1 182 ? 59.132  -73.431 12.803  1.00 48.85  ? 199 ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 182 ? 59.185  -73.367 14.310  1.00 48.75  ? 199 ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 182 ? 60.090  -72.783 14.878  1.00 48.46  ? 199 ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 182 ? 58.198  -73.953 14.957  1.00 49.68  ? 199 ASN A ND2 1 
ATOM   1287 N N   . LEU A 1 183 ? 58.687  -72.293 9.986   1.00 47.62  ? 200 LEU A N   1 
ATOM   1288 C CA  . LEU A 1 183 ? 58.565  -72.454 8.538   1.00 47.76  ? 200 LEU A CA  1 
ATOM   1289 C C   . LEU A 1 183 ? 59.478  -71.469 7.832   1.00 49.48  ? 200 LEU A C   1 
ATOM   1290 O O   . LEU A 1 183 ? 60.098  -71.831 6.836   1.00 49.80  ? 200 LEU A O   1 
ATOM   1291 C CB  . LEU A 1 183 ? 57.110  -72.223 8.109   1.00 45.16  ? 200 LEU A CB  1 
ATOM   1292 C CG  . LEU A 1 183 ? 56.713  -72.368 6.644   1.00 44.51  ? 200 LEU A CG  1 
ATOM   1293 C CD1 . LEU A 1 183 ? 56.781  -73.809 6.146   1.00 45.04  ? 200 LEU A CD1 1 
ATOM   1294 C CD2 . LEU A 1 183 ? 55.297  -71.847 6.491   1.00 44.04  ? 200 LEU A CD2 1 
ATOM   1295 N N   . ALA A 1 184 ? 59.567  -70.250 8.376   1.00 50.56  ? 201 ALA A N   1 
ATOM   1296 C CA  . ALA A 1 184 ? 60.441  -69.198 7.843   1.00 53.09  ? 201 ALA A CA  1 
ATOM   1297 C C   . ALA A 1 184 ? 61.920  -69.586 7.859   1.00 53.97  ? 201 ALA A C   1 
ATOM   1298 O O   . ALA A 1 184 ? 62.680  -69.196 6.975   1.00 60.56  ? 201 ALA A O   1 
ATOM   1299 C CB  . ALA A 1 184 ? 60.241  -67.895 8.606   1.00 53.14  ? 201 ALA A CB  1 
ATOM   1300 N N   . VAL A 1 185 ? 62.328  -70.348 8.855   1.00 53.10  ? 202 VAL A N   1 
ATOM   1301 C CA  . VAL A 1 185 ? 63.712  -70.783 8.943   1.00 53.86  ? 202 VAL A CA  1 
ATOM   1302 C C   . VAL A 1 185 ? 64.044  -71.899 7.931   1.00 54.51  ? 202 VAL A C   1 
ATOM   1303 O O   . VAL A 1 185 ? 65.014  -71.746 7.191   1.00 53.26  ? 202 VAL A O   1 
ATOM   1304 C CB  . VAL A 1 185 ? 64.061  -71.234 10.376  1.00 53.32  ? 202 VAL A CB  1 
ATOM   1305 C CG1 . VAL A 1 185 ? 65.454  -71.823 10.448  1.00 53.99  ? 202 VAL A CG1 1 
ATOM   1306 C CG2 . VAL A 1 185 ? 63.949  -70.071 11.342  1.00 54.33  ? 202 VAL A CG2 1 
ATOM   1307 N N   . ILE A 1 186 ? 63.281  -73.006 7.899   1.00 53.84  ? 203 ILE A N   1 
ATOM   1308 C CA  . ILE A 1 186 ? 63.629  -74.117 6.989   1.00 55.38  ? 203 ILE A CA  1 
ATOM   1309 C C   . ILE A 1 186 ? 63.512  -73.723 5.531   1.00 58.96  ? 203 ILE A C   1 
ATOM   1310 O O   . ILE A 1 186 ? 64.211  -74.271 4.689   1.00 64.13  ? 203 ILE A O   1 
ATOM   1311 C CB  . ILE A 1 186 ? 62.791  -75.419 7.117   1.00 55.84  ? 203 ILE A CB  1 
ATOM   1312 C CG1 . ILE A 1 186 ? 61.317  -75.149 7.347   1.00 54.48  ? 203 ILE A CG1 1 
ATOM   1313 C CG2 . ILE A 1 186 ? 63.326  -76.374 8.176   1.00 58.01  ? 203 ILE A CG2 1 
ATOM   1314 C CD1 . ILE A 1 186 ? 60.527  -76.437 7.367   1.00 55.15  ? 203 ILE A CD1 1 
ATOM   1315 N N   . SER A 1 187 ? 62.626  -72.791 5.223   1.00 61.10  ? 204 SER A N   1 
ATOM   1316 C CA  . SER A 1 187 ? 62.372  -72.449 3.842   1.00 64.01  ? 204 SER A CA  1 
ATOM   1317 C C   . SER A 1 187 ? 63.326  -71.376 3.329   1.00 64.86  ? 204 SER A C   1 
ATOM   1318 O O   . SER A 1 187 ? 63.333  -71.078 2.135   1.00 64.88  ? 204 SER A O   1 
ATOM   1319 C CB  . SER A 1 187 ? 60.917  -72.024 3.674   1.00 65.70  ? 204 SER A CB  1 
ATOM   1320 O OG  . SER A 1 187 ? 60.647  -70.916 4.500   1.00 67.88  ? 204 SER A OG  1 
ATOM   1321 N N   . THR A 1 188 ? 64.136  -70.804 4.217   1.00 66.53  ? 205 THR A N   1 
ATOM   1322 C CA  . THR A 1 188 ? 65.174  -69.855 3.799   1.00 69.60  ? 205 THR A CA  1 
ATOM   1323 C C   . THR A 1 188 ? 66.597  -70.448 3.908   1.00 72.53  ? 205 THR A C   1 
ATOM   1324 O O   . THR A 1 188 ? 66.820  -71.453 4.580   1.00 73.66  ? 205 THR A O   1 
ATOM   1325 C CB  . THR A 1 188 ? 65.041  -68.512 4.550   1.00 70.40  ? 205 THR A CB  1 
ATOM   1326 O OG1 . THR A 1 188 ? 65.721  -67.490 3.810   1.00 72.61  ? 205 THR A OG1 1 
ATOM   1327 C CG2 . THR A 1 188 ? 65.603  -68.589 5.995   1.00 69.70  ? 205 THR A CG2 1 
ATOM   1328 N N   . ALA A 1 189 ? 67.552  -69.818 3.229   1.00 81.02  ? 206 ALA A N   1 
ATOM   1329 C CA  . ALA A 1 189 ? 68.914  -70.365 3.083   1.00 87.59  ? 206 ALA A CA  1 
ATOM   1330 C C   . ALA A 1 189 ? 69.805  -70.158 4.326   1.00 95.76  ? 206 ALA A C   1 
ATOM   1331 O O   . ALA A 1 189 ? 69.599  -69.220 5.105   1.00 95.60  ? 206 ALA A O   1 
ATOM   1332 C CB  . ALA A 1 189 ? 69.585  -69.769 1.847   1.00 86.89  ? 206 ALA A CB  1 
ATOM   1333 N N   . SER A 1 190 ? 70.794  -71.044 4.488   1.00 103.32 ? 207 SER A N   1 
ATOM   1334 C CA  . SER A 1 190 ? 71.765  -70.980 5.589   1.00 106.35 ? 207 SER A CA  1 
ATOM   1335 C C   . SER A 1 190 ? 73.145  -71.435 5.120   1.00 107.33 ? 207 SER A C   1 
ATOM   1336 O O   . SER A 1 190 ? 74.056  -70.624 4.944   1.00 109.91 ? 207 SER A O   1 
ATOM   1337 C CB  . SER A 1 190 ? 71.314  -71.864 6.756   1.00 108.08 ? 207 SER A CB  1 
ATOM   1338 O OG  . SER A 1 190 ? 71.418  -73.242 6.430   1.00 107.67 ? 207 SER A OG  1 
ATOM   1339 N N   . TYR B 1 6   ? 65.541  -54.059 20.754  1.00 84.27  ? 23  TYR B N   1 
ATOM   1340 C CA  . TYR B 1 6   ? 64.634  -52.871 20.842  1.00 90.37  ? 23  TYR B CA  1 
ATOM   1341 C C   . TYR B 1 6   ? 63.442  -52.976 19.885  1.00 91.33  ? 23  TYR B C   1 
ATOM   1342 O O   . TYR B 1 6   ? 63.383  -52.267 18.882  1.00 94.48  ? 23  TYR B O   1 
ATOM   1343 C CB  . TYR B 1 6   ? 65.419  -51.570 20.577  1.00 97.19  ? 23  TYR B CB  1 
ATOM   1344 C CG  . TYR B 1 6   ? 64.568  -50.309 20.605  1.00 103.02 ? 23  TYR B CG  1 
ATOM   1345 C CD1 . TYR B 1 6   ? 63.801  -49.990 21.721  1.00 104.80 ? 23  TYR B CD1 1 
ATOM   1346 C CD2 . TYR B 1 6   ? 64.534  -49.437 19.521  1.00 109.06 ? 23  TYR B CD2 1 
ATOM   1347 C CE1 . TYR B 1 6   ? 63.024  -48.841 21.761  1.00 107.96 ? 23  TYR B CE1 1 
ATOM   1348 C CE2 . TYR B 1 6   ? 63.756  -48.288 19.548  1.00 113.98 ? 23  TYR B CE2 1 
ATOM   1349 C CZ  . TYR B 1 6   ? 63.002  -47.996 20.672  1.00 113.19 ? 23  TYR B CZ  1 
ATOM   1350 O OH  . TYR B 1 6   ? 62.226  -46.858 20.716  1.00 118.85 ? 23  TYR B OH  1 
ATOM   1351 N N   . GLY B 1 7   ? 62.505  -53.869 20.196  1.00 90.75  ? 24  GLY B N   1 
ATOM   1352 C CA  . GLY B 1 7   ? 61.247  -53.979 19.447  1.00 93.16  ? 24  GLY B CA  1 
ATOM   1353 C C   . GLY B 1 7   ? 60.032  -53.879 20.352  1.00 93.25  ? 24  GLY B C   1 
ATOM   1354 O O   . GLY B 1 7   ? 59.027  -54.547 20.120  1.00 91.69  ? 24  GLY B O   1 
ATOM   1355 N N   . LEU B 1 8   ? 60.111  -53.021 21.369  1.00 95.20  ? 25  LEU B N   1 
ATOM   1356 C CA  . LEU B 1 8   ? 59.132  -53.022 22.459  1.00 95.23  ? 25  LEU B CA  1 
ATOM   1357 C C   . LEU B 1 8   ? 58.457  -51.653 22.675  1.00 100.15 ? 25  LEU B C   1 
ATOM   1358 O O   . LEU B 1 8   ? 57.868  -51.122 21.734  1.00 108.61 ? 25  LEU B O   1 
ATOM   1359 C CB  . LEU B 1 8   ? 59.748  -53.615 23.745  1.00 95.03  ? 25  LEU B CB  1 
ATOM   1360 C CG  . LEU B 1 8   ? 61.050  -53.126 24.422  1.00 94.17  ? 25  LEU B CG  1 
ATOM   1361 C CD1 . LEU B 1 8   ? 62.061  -54.257 24.554  1.00 90.05  ? 25  LEU B CD1 1 
ATOM   1362 C CD2 . LEU B 1 8   ? 61.701  -51.921 23.761  1.00 98.88  ? 25  LEU B CD2 1 
ATOM   1363 N N   . THR B 1 9   ? 58.511  -51.093 23.888  1.00 99.98  ? 26  THR B N   1 
ATOM   1364 C CA  . THR B 1 9   ? 57.889  -49.790 24.180  1.00 105.26 ? 26  THR B CA  1 
ATOM   1365 C C   . THR B 1 9   ? 58.864  -48.870 24.914  1.00 108.99 ? 26  THR B C   1 
ATOM   1366 O O   . THR B 1 9   ? 59.943  -49.299 25.318  1.00 108.78 ? 26  THR B O   1 
ATOM   1367 C CB  . THR B 1 9   ? 56.603  -49.940 25.030  1.00 103.90 ? 26  THR B CB  1 
ATOM   1368 O OG1 . THR B 1 9   ? 56.924  -50.488 26.313  1.00 95.30  ? 26  THR B OG1 1 
ATOM   1369 C CG2 . THR B 1 9   ? 55.591  -50.848 24.337  1.00 103.15 ? 26  THR B CG2 1 
ATOM   1370 N N   . LYS B 1 10  ? 58.474  -47.609 25.091  1.00 116.89 ? 27  LYS B N   1 
ATOM   1371 C CA  . LYS B 1 10  ? 59.333  -46.609 25.742  1.00 122.26 ? 27  LYS B CA  1 
ATOM   1372 C C   . LYS B 1 10  ? 59.497  -46.840 27.253  1.00 121.54 ? 27  LYS B C   1 
ATOM   1373 O O   . LYS B 1 10  ? 60.596  -46.672 27.793  1.00 121.32 ? 27  LYS B O   1 
ATOM   1374 C CB  . LYS B 1 10  ? 58.800  -45.193 25.487  1.00 127.64 ? 27  LYS B CB  1 
ATOM   1375 N N   . ASP B 1 11  ? 58.408  -47.213 27.926  1.00 119.84 ? 28  ASP B N   1 
ATOM   1376 C CA  . ASP B 1 11  ? 58.443  -47.494 29.367  1.00 119.31 ? 28  ASP B CA  1 
ATOM   1377 C C   . ASP B 1 11  ? 59.261  -48.755 29.670  1.00 113.56 ? 28  ASP B C   1 
ATOM   1378 O O   . ASP B 1 11  ? 59.997  -48.804 30.657  1.00 116.83 ? 28  ASP B O   1 
ATOM   1379 C CB  . ASP B 1 11  ? 57.024  -47.631 29.931  1.00 120.93 ? 28  ASP B CB  1 
ATOM   1380 N N   . GLU B 1 12  ? 59.134  -49.764 28.811  1.00 107.27 ? 29  GLU B N   1 
ATOM   1381 C CA  . GLU B 1 12  ? 59.890  -51.010 28.950  1.00 102.53 ? 29  GLU B CA  1 
ATOM   1382 C C   . GLU B 1 12  ? 61.385  -50.814 28.692  1.00 103.07 ? 29  GLU B C   1 
ATOM   1383 O O   . GLU B 1 12  ? 62.207  -51.520 29.276  1.00 102.75 ? 29  GLU B O   1 
ATOM   1384 C CB  . GLU B 1 12  ? 59.349  -52.083 27.995  1.00 100.00 ? 29  GLU B CB  1 
ATOM   1385 C CG  . GLU B 1 12  ? 57.992  -52.668 28.386  1.00 98.05  ? 29  GLU B CG  1 
ATOM   1386 C CD  . GLU B 1 12  ? 57.334  -53.464 27.266  1.00 93.46  ? 29  GLU B CD  1 
ATOM   1387 O OE1 . GLU B 1 12  ? 57.589  -53.165 26.081  1.00 90.71  ? 29  GLU B OE1 1 
ATOM   1388 O OE2 . GLU B 1 12  ? 56.544  -54.382 27.567  1.00 90.37  ? 29  GLU B OE2 1 
ATOM   1389 N N   . PHE B 1 13  ? 61.737  -49.871 27.817  1.00 104.54 ? 30  PHE B N   1 
ATOM   1390 C CA  . PHE B 1 13  ? 63.142  -49.628 27.478  1.00 103.39 ? 30  PHE B CA  1 
ATOM   1391 C C   . PHE B 1 13  ? 63.883  -48.910 28.599  1.00 103.91 ? 30  PHE B C   1 
ATOM   1392 O O   . PHE B 1 13  ? 65.002  -49.294 28.939  1.00 101.35 ? 30  PHE B O   1 
ATOM   1393 C CB  . PHE B 1 13  ? 63.281  -48.828 26.176  1.00 107.44 ? 30  PHE B CB  1 
ATOM   1394 C CG  . PHE B 1 13  ? 64.689  -48.792 25.640  1.00 109.47 ? 30  PHE B CG  1 
ATOM   1395 C CD1 . PHE B 1 13  ? 65.168  -49.827 24.839  1.00 107.77 ? 30  PHE B CD1 1 
ATOM   1396 C CD2 . PHE B 1 13  ? 65.541  -47.736 25.947  1.00 111.26 ? 30  PHE B CD2 1 
ATOM   1397 C CE1 . PHE B 1 13  ? 66.466  -49.807 24.349  1.00 109.33 ? 30  PHE B CE1 1 
ATOM   1398 C CE2 . PHE B 1 13  ? 66.840  -47.710 25.459  1.00 113.00 ? 30  PHE B CE2 1 
ATOM   1399 C CZ  . PHE B 1 13  ? 67.303  -48.746 24.658  1.00 112.13 ? 30  PHE B CZ  1 
ATOM   1400 N N   . SER B 1 14  ? 63.264  -47.871 29.165  1.00 107.66 ? 31  SER B N   1 
ATOM   1401 C CA  . SER B 1 14  ? 63.860  -47.107 30.272  1.00 109.38 ? 31  SER B CA  1 
ATOM   1402 C C   . SER B 1 14  ? 63.755  -47.916 31.565  1.00 108.74 ? 31  SER B C   1 
ATOM   1403 O O   . SER B 1 14  ? 63.123  -47.482 32.533  1.00 114.76 ? 31  SER B O   1 
ATOM   1404 C CB  . SER B 1 14  ? 63.170  -45.745 30.430  1.00 112.51 ? 31  SER B CB  1 
ATOM   1405 N N   . THR B 1 15  ? 64.403  -49.081 31.567  1.00 100.44 ? 32  THR B N   1 
ATOM   1406 C CA  . THR B 1 15  ? 64.232  -50.112 32.592  1.00 96.92  ? 32  THR B CA  1 
ATOM   1407 C C   . THR B 1 15  ? 65.157  -51.292 32.274  1.00 94.08  ? 32  THR B C   1 
ATOM   1408 O O   . THR B 1 15  ? 66.001  -51.679 33.085  1.00 93.25  ? 32  THR B O   1 
ATOM   1409 C CB  . THR B 1 15  ? 62.778  -50.639 32.635  1.00 96.18  ? 32  THR B CB  1 
ATOM   1410 O OG1 . THR B 1 15  ? 61.877  -49.581 32.980  1.00 98.44  ? 32  THR B OG1 1 
ATOM   1411 C CG2 . THR B 1 15  ? 62.631  -51.775 33.646  1.00 96.14  ? 32  THR B CG2 1 
ATOM   1412 N N   . LEU B 1 16  ? 64.987  -51.853 31.077  1.00 91.25  ? 33  LEU B N   1 
ATOM   1413 C CA  . LEU B 1 16  ? 65.786  -52.992 30.634  1.00 87.18  ? 33  LEU B CA  1 
ATOM   1414 C C   . LEU B 1 16  ? 67.113  -52.585 29.972  1.00 86.23  ? 33  LEU B C   1 
ATOM   1415 O O   . LEU B 1 16  ? 67.960  -53.441 29.721  1.00 82.92  ? 33  LEU B O   1 
ATOM   1416 C CB  . LEU B 1 16  ? 64.968  -53.901 29.699  1.00 84.35  ? 33  LEU B CB  1 
ATOM   1417 C CG  . LEU B 1 16  ? 64.056  -54.939 30.368  1.00 83.17  ? 33  LEU B CG  1 
ATOM   1418 N N   . ASP B 1 17  ? 67.326  -51.299 29.711  1.00 90.97  ? 34  ASP B N   1 
ATOM   1419 C CA  . ASP B 1 17  ? 68.552  -50.902 28.996  1.00 97.55  ? 34  ASP B CA  1 
ATOM   1420 C C   . ASP B 1 17  ? 69.809  -51.031 29.869  1.00 97.46  ? 34  ASP B C   1 
ATOM   1421 O O   . ASP B 1 17  ? 70.902  -51.282 29.353  1.00 100.61 ? 34  ASP B O   1 
ATOM   1422 C CB  . ASP B 1 17  ? 68.430  -49.506 28.355  1.00 99.31  ? 34  ASP B CB  1 
ATOM   1423 C CG  . ASP B 1 17  ? 68.779  -48.390 29.299  0.50 101.98 ? 34  ASP B CG  1 
ATOM   1424 O OD1 . ASP B 1 17  ? 68.227  -48.365 30.415  1.00 108.69 ? 34  ASP B OD1 1 
ATOM   1425 O OD2 . ASP B 1 17  ? 69.599  -47.534 28.911  1.00 101.91 ? 34  ASP B OD2 1 
ATOM   1426 N N   . SER B 1 18  ? 69.649  -50.878 31.180  1.00 97.21  ? 35  SER B N   1 
ATOM   1427 C CA  . SER B 1 18  ? 70.756  -51.095 32.106  1.00 97.64  ? 35  SER B CA  1 
ATOM   1428 C C   . SER B 1 18  ? 71.152  -52.560 32.090  1.00 93.75  ? 35  SER B C   1 
ATOM   1429 O O   . SER B 1 18  ? 72.319  -52.888 32.296  1.00 96.20  ? 35  SER B O   1 
ATOM   1430 C CB  . SER B 1 18  ? 70.385  -50.668 33.524  1.00 101.08 ? 35  SER B CB  1 
ATOM   1431 O OG  . SER B 1 18  ? 69.267  -51.398 33.986  1.00 105.29 ? 35  SER B OG  1 
ATOM   1432 N N   . ILE B 1 19  ? 70.181  -53.435 31.837  1.00 89.27  ? 36  ILE B N   1 
ATOM   1433 C CA  . ILE B 1 19  ? 70.463  -54.860 31.661  1.00 87.87  ? 36  ILE B CA  1 
ATOM   1434 C C   . ILE B 1 19  ? 71.089  -55.089 30.288  1.00 83.17  ? 36  ILE B C   1 
ATOM   1435 O O   . ILE B 1 19  ? 72.001  -55.907 30.152  1.00 83.83  ? 36  ILE B O   1 
ATOM   1436 C CB  . ILE B 1 19  ? 69.200  -55.752 31.825  1.00 88.47  ? 36  ILE B CB  1 
ATOM   1437 C CG1 . ILE B 1 19  ? 68.650  -55.678 33.261  1.00 92.14  ? 36  ILE B CG1 1 
ATOM   1438 C CG2 . ILE B 1 19  ? 69.514  -57.202 31.479  1.00 88.55  ? 36  ILE B CG2 1 
ATOM   1439 C CD1 . ILE B 1 19  ? 67.548  -54.661 33.463  1.00 93.04  ? 36  ILE B CD1 1 
ATOM   1440 N N   . ILE B 1 20  ? 70.606  -54.366 29.276  1.00 78.98  ? 37  ILE B N   1 
ATOM   1441 C CA  . ILE B 1 20  ? 71.128  -54.523 27.915  1.00 76.43  ? 37  ILE B CA  1 
ATOM   1442 C C   . ILE B 1 20  ? 72.631  -54.217 27.897  1.00 76.42  ? 37  ILE B C   1 
ATOM   1443 O O   . ILE B 1 20  ? 73.416  -54.992 27.352  1.00 75.11  ? 37  ILE B O   1 
ATOM   1444 C CB  . ILE B 1 20  ? 70.350  -53.669 26.873  1.00 76.88  ? 37  ILE B CB  1 
ATOM   1445 C CG1 . ILE B 1 20  ? 68.882  -54.130 26.762  1.00 70.37  ? 37  ILE B CG1 1 
ATOM   1446 C CG2 . ILE B 1 20  ? 71.009  -53.748 25.494  1.00 78.52  ? 37  ILE B CG2 1 
ATOM   1447 N N   . ARG B 1 21  ? 73.018  -53.110 28.528  1.00 80.77  ? 38  ARG B N   1 
ATOM   1448 C CA  . ARG B 1 21  ? 74.437  -52.730 28.697  1.00 83.57  ? 38  ARG B CA  1 
ATOM   1449 C C   . ARG B 1 21  ? 75.253  -53.695 29.566  1.00 84.50  ? 38  ARG B C   1 
ATOM   1450 O O   . ARG B 1 21  ? 76.238  -54.270 29.099  1.00 85.83  ? 38  ARG B O   1 
ATOM   1451 C CB  . ARG B 1 21  ? 74.537  -51.327 29.286  1.00 87.95  ? 38  ARG B CB  1 
ATOM   1452 C CG  . ARG B 1 21  ? 74.105  -50.248 28.315  1.00 94.32  ? 38  ARG B CG  1 
ATOM   1453 C CD  . ARG B 1 21  ? 73.648  -48.988 29.020  1.00 100.05 ? 38  ARG B CD  1 
ATOM   1454 N NE  . ARG B 1 21  ? 73.255  -47.970 28.049  1.00 106.80 ? 38  ARG B NE  1 
ATOM   1455 C CZ  . ARG B 1 21  ? 72.645  -46.826 28.352  1.00 115.21 ? 38  ARG B CZ  1 
ATOM   1456 N NH1 . ARG B 1 21  ? 72.337  -46.527 29.615  1.00 119.03 ? 38  ARG B NH1 1 
ATOM   1457 N NH2 . ARG B 1 21  ? 72.337  -45.972 27.381  1.00 119.13 ? 38  ARG B NH2 1 
ATOM   1458 N N   . THR B 1 22  ? 74.851  -53.883 30.820  1.00 83.08  ? 39  THR B N   1 
ATOM   1459 C CA  . THR B 1 22  ? 75.634  -54.738 31.718  1.00 88.39  ? 39  THR B CA  1 
ATOM   1460 C C   . THR B 1 22  ? 75.703  -56.210 31.292  1.00 85.89  ? 39  THR B C   1 
ATOM   1461 O O   . THR B 1 22  ? 76.572  -56.931 31.779  1.00 89.21  ? 39  THR B O   1 
ATOM   1462 C CB  . THR B 1 22  ? 75.174  -54.668 33.205  1.00 93.37  ? 39  THR B CB  1 
ATOM   1463 O OG1 . THR B 1 22  ? 73.746  -54.703 33.294  1.00 96.45  ? 39  THR B OG1 1 
ATOM   1464 C CG2 . THR B 1 22  ? 75.675  -53.398 33.872  1.00 97.29  ? 39  THR B CG2 1 
ATOM   1465 N N   . HIS B 1 23  ? 74.822  -56.660 30.396  1.00 79.58  ? 40  HIS B N   1 
ATOM   1466 C CA  . HIS B 1 23  ? 74.758  -58.093 30.069  1.00 78.58  ? 40  HIS B CA  1 
ATOM   1467 C C   . HIS B 1 23  ? 74.672  -58.469 28.578  1.00 76.03  ? 40  HIS B C   1 
ATOM   1468 O O   . HIS B 1 23  ? 75.207  -59.509 28.177  1.00 74.54  ? 40  HIS B O   1 
ATOM   1469 C CB  . HIS B 1 23  ? 73.598  -58.735 30.831  1.00 78.62  ? 40  HIS B CB  1 
ATOM   1470 C CG  . HIS B 1 23  ? 73.754  -58.682 32.320  1.00 83.35  ? 40  HIS B CG  1 
ATOM   1471 N ND1 . HIS B 1 23  ? 74.480  -59.620 33.027  1.00 88.49  ? 40  HIS B ND1 1 
ATOM   1472 C CD2 . HIS B 1 23  ? 73.285  -57.802 33.236  1.00 83.35  ? 40  HIS B CD2 1 
ATOM   1473 C CE1 . HIS B 1 23  ? 74.446  -59.322 34.314  1.00 89.61  ? 40  HIS B CE1 1 
ATOM   1474 N NE2 . HIS B 1 23  ? 73.728  -58.223 34.467  1.00 87.91  ? 40  HIS B NE2 1 
ATOM   1475 N N   . HIS B 1 24  ? 74.007  -57.640 27.772  1.00 72.57  ? 41  HIS B N   1 
ATOM   1476 C CA  . HIS B 1 24  ? 73.702  -57.994 26.384  1.00 72.50  ? 41  HIS B CA  1 
ATOM   1477 C C   . HIS B 1 24  ? 74.599  -57.332 25.344  1.00 76.03  ? 41  HIS B C   1 
ATOM   1478 O O   . HIS B 1 24  ? 74.701  -57.826 24.217  1.00 76.68  ? 41  HIS B O   1 
ATOM   1479 C CB  . HIS B 1 24  ? 72.226  -57.707 26.062  1.00 69.01  ? 41  HIS B CB  1 
ATOM   1480 C CG  . HIS B 1 24  ? 71.279  -58.668 26.706  1.00 67.56  ? 41  HIS B CG  1 
ATOM   1481 N ND1 . HIS B 1 24  ? 71.204  -59.996 26.344  1.00 68.50  ? 41  HIS B ND1 1 
ATOM   1482 C CD2 . HIS B 1 24  ? 70.381  -58.500 27.705  1.00 66.63  ? 41  HIS B CD2 1 
ATOM   1483 C CE1 . HIS B 1 24  ? 70.300  -60.604 27.092  1.00 68.84  ? 41  HIS B CE1 1 
ATOM   1484 N NE2 . HIS B 1 24  ? 69.787  -59.719 27.927  1.00 67.05  ? 41  HIS B NE2 1 
ATOM   1485 N N   . THR B 1 25  ? 75.247  -56.227 25.714  1.00 77.06  ? 42  THR B N   1 
ATOM   1486 C CA  . THR B 1 25  ? 76.066  -55.475 24.771  1.00 79.68  ? 42  THR B CA  1 
ATOM   1487 C C   . THR B 1 25  ? 77.396  -56.184 24.488  1.00 85.15  ? 42  THR B C   1 
ATOM   1488 O O   . THR B 1 25  ? 78.177  -56.422 25.394  1.00 85.65  ? 42  THR B O   1 
ATOM   1489 C CB  . THR B 1 25  ? 76.298  -54.043 25.277  1.00 78.41  ? 42  THR B CB  1 
ATOM   1490 O OG1 . THR B 1 25  ? 75.041  -53.358 25.328  1.00 74.45  ? 42  THR B OG1 1 
ATOM   1491 C CG2 . THR B 1 25  ? 77.228  -53.278 24.344  1.00 82.82  ? 42  THR B CG2 1 
ATOM   1492 N N   . PHE B 1 26  ? 77.639  -56.516 23.221  1.00 76.85  ? 43  PHE B N   1 
ATOM   1493 C CA  . PHE B 1 26  ? 78.870  -57.212 22.809  1.00 82.95  ? 43  PHE B CA  1 
ATOM   1494 C C   . PHE B 1 26  ? 79.931  -56.255 22.261  1.00 86.87  ? 43  PHE B C   1 
ATOM   1495 O O   . PHE B 1 26  ? 79.600  -55.316 21.534  1.00 88.79  ? 43  PHE B O   1 
ATOM   1496 C CB  . PHE B 1 26  ? 78.578  -58.244 21.721  1.00 81.67  ? 43  PHE B CB  1 
ATOM   1497 C CG  . PHE B 1 26  ? 77.842  -59.450 22.206  1.00 80.80  ? 43  PHE B CG  1 
ATOM   1498 C CD1 . PHE B 1 26  ? 78.523  -60.495 22.815  1.00 80.14  ? 43  PHE B CD1 1 
ATOM   1499 C CD2 . PHE B 1 26  ? 76.465  -59.554 22.036  1.00 80.60  ? 43  PHE B CD2 1 
ATOM   1500 C CE1 . PHE B 1 26  ? 77.843  -61.620 23.257  1.00 79.70  ? 43  PHE B CE1 1 
ATOM   1501 C CE2 . PHE B 1 26  ? 75.781  -60.676 22.472  1.00 78.80  ? 43  PHE B CE2 1 
ATOM   1502 C CZ  . PHE B 1 26  ? 76.470  -61.715 23.076  1.00 78.36  ? 43  PHE B CZ  1 
ATOM   1503 N N   . PRO B 1 27  ? 81.213  -56.500 22.594  0.50 92.57  ? 44  PRO B N   1 
ATOM   1504 C CA  . PRO B 1 27  ? 82.266  -55.661 22.031  1.00 96.02  ? 44  PRO B CA  1 
ATOM   1505 C C   . PRO B 1 27  ? 82.411  -55.854 20.522  1.00 95.41  ? 44  PRO B C   1 
ATOM   1506 O O   . PRO B 1 27  ? 82.722  -56.959 20.067  1.00 90.47  ? 44  PRO B O   1 
ATOM   1507 C CB  . PRO B 1 27  ? 83.535  -56.119 22.773  1.00 98.42  ? 44  PRO B CB  1 
ATOM   1508 C CG  . PRO B 1 27  ? 83.215  -57.464 23.328  1.00 96.48  ? 44  PRO B CG  1 
ATOM   1509 C CD  . PRO B 1 27  ? 81.738  -57.473 23.572  1.00 95.51  ? 44  PRO B CD  1 
ATOM   1510 N N   . ARG B 1 28  ? 82.166  -54.777 19.774  1.00 98.42  ? 45  ARG B N   1 
ATOM   1511 C CA  . ARG B 1 28  ? 82.323  -54.739 18.310  1.00 97.13  ? 45  ARG B CA  1 
ATOM   1512 C C   . ARG B 1 28  ? 83.681  -55.322 17.870  1.00 93.23  ? 45  ARG B C   1 
ATOM   1513 O O   . ARG B 1 28  ? 84.731  -54.935 18.384  1.00 92.28  ? 45  ARG B O   1 
ATOM   1514 C CB  . ARG B 1 28  ? 82.180  -53.282 17.830  1.00 97.14  ? 45  ARG B CB  1 
ATOM   1515 C CG  . ARG B 1 28  ? 82.253  -53.063 16.331  1.00 98.16  ? 45  ARG B CG  1 
ATOM   1516 C CD  . ARG B 1 28  ? 82.691  -51.639 16.011  1.00 100.71 ? 45  ARG B CD  1 
ATOM   1517 N N   . SER B 1 29  ? 83.640  -56.266 16.933  1.00 89.23  ? 46  SER B N   1 
ATOM   1518 C CA  . SER B 1 29  ? 84.844  -56.920 16.413  1.00 89.81  ? 46  SER B CA  1 
ATOM   1519 C C   . SER B 1 29  ? 84.857  -56.852 14.873  1.00 91.89  ? 46  SER B C   1 
ATOM   1520 O O   . SER B 1 29  ? 83.810  -56.614 14.247  1.00 87.06  ? 46  SER B O   1 
ATOM   1521 C CB  . SER B 1 29  ? 84.882  -58.371 16.908  1.00 88.60  ? 46  SER B CB  1 
ATOM   1522 O OG  . SER B 1 29  ? 85.948  -59.114 16.342  1.00 88.84  ? 46  SER B OG  1 
ATOM   1523 N N   . PRO B 1 30  ? 86.040  -57.032 14.249  1.00 96.85  ? 47  PRO B N   1 
ATOM   1524 C CA  . PRO B 1 30  ? 85.995  -57.066 12.782  1.00 97.86  ? 47  PRO B CA  1 
ATOM   1525 C C   . PRO B 1 30  ? 85.462  -58.409 12.305  1.00 94.22  ? 47  PRO B C   1 
ATOM   1526 O O   . PRO B 1 30  ? 85.618  -59.421 13.002  1.00 92.55  ? 47  PRO B O   1 
ATOM   1527 C CB  . PRO B 1 30  ? 87.457  -56.867 12.364  1.00 98.77  ? 47  PRO B CB  1 
ATOM   1528 C CG  . PRO B 1 30  ? 88.284  -57.178 13.576  1.00 100.17 ? 47  PRO B CG  1 
ATOM   1529 C CD  . PRO B 1 30  ? 87.386  -57.340 14.771  1.00 97.32  ? 47  PRO B CD  1 
ATOM   1530 N N   . ASN B 1 31  ? 84.817  -58.410 11.143  1.00 89.74  ? 48  ASN B N   1 
ATOM   1531 C CA  . ASN B 1 31  ? 84.249  -59.631 10.582  1.00 87.55  ? 48  ASN B CA  1 
ATOM   1532 C C   . ASN B 1 31  ? 83.265  -60.358 11.517  1.00 83.71  ? 48  ASN B C   1 
ATOM   1533 O O   . ASN B 1 31  ? 83.198  -61.590 11.494  1.00 85.28  ? 48  ASN B O   1 
ATOM   1534 C CB  . ASN B 1 31  ? 85.373  -60.590 10.146  1.00 88.73  ? 48  ASN B CB  1 
ATOM   1535 C CG  . ASN B 1 31  ? 86.244  -60.007 9.042   1.00 93.24  ? 48  ASN B CG  1 
ATOM   1536 O OD1 . ASN B 1 31  ? 85.744  -59.644 7.973   1.00 97.29  ? 48  ASN B OD1 1 
ATOM   1537 N ND2 . ASN B 1 31  ? 87.549  -59.924 9.288   1.00 91.91  ? 48  ASN B ND2 1 
ATOM   1538 N N   . THR B 1 32  ? 82.505  -59.611 12.327  1.00 78.47  ? 49  THR B N   1 
ATOM   1539 C CA  . THR B 1 32  ? 81.445  -60.219 13.153  1.00 75.98  ? 49  THR B CA  1 
ATOM   1540 C C   . THR B 1 32  ? 80.089  -59.569 12.923  1.00 72.09  ? 49  THR B C   1 
ATOM   1541 O O   . THR B 1 32  ? 79.978  -58.551 12.245  1.00 73.65  ? 49  THR B O   1 
ATOM   1542 C CB  . THR B 1 32  ? 81.742  -60.182 14.680  1.00 77.14  ? 49  THR B CB  1 
ATOM   1543 O OG1 . THR B 1 32  ? 81.824  -58.826 15.137  1.00 76.31  ? 49  THR B OG1 1 
ATOM   1544 C CG2 . THR B 1 32  ? 83.026  -60.945 15.019  1.00 77.47  ? 49  THR B CG2 1 
ATOM   1545 N N   . CYS B 1 33  ? 79.067  -60.186 13.505  1.00 67.90  ? 50  CYS B N   1 
ATOM   1546 C CA  . CYS B 1 33  ? 77.688  -59.727 13.410  1.00 65.54  ? 50  CYS B CA  1 
ATOM   1547 C C   . CYS B 1 33  ? 77.023  -59.898 14.776  1.00 65.89  ? 50  CYS B C   1 
ATOM   1548 O O   . CYS B 1 33  ? 77.135  -60.966 15.401  1.00 64.32  ? 50  CYS B O   1 
ATOM   1549 C CB  . CYS B 1 33  ? 76.947  -60.553 12.354  1.00 62.32  ? 50  CYS B CB  1 
ATOM   1550 S SG  . CYS B 1 33  ? 75.156  -60.446 12.431  0.50 60.95  ? 50  CYS B SG  1 
ATOM   1551 N N   . THR B 1 34  ? 76.338  -58.850 15.233  1.00 65.46  ? 51  THR B N   1 
ATOM   1552 C CA  . THR B 1 34  ? 75.629  -58.887 16.507  1.00 64.90  ? 51  THR B CA  1 
ATOM   1553 C C   . THR B 1 34  ? 74.256  -58.225 16.441  1.00 63.85  ? 51  THR B C   1 
ATOM   1554 O O   . THR B 1 34  ? 74.072  -57.255 15.711  1.00 64.62  ? 51  THR B O   1 
ATOM   1555 C CB  . THR B 1 34  ? 76.444  -58.203 17.626  1.00 66.33  ? 51  THR B CB  1 
ATOM   1556 O OG1 . THR B 1 34  ? 75.789  -58.411 18.889  1.00 67.90  ? 51  THR B OG1 1 
ATOM   1557 C CG2 . THR B 1 34  ? 76.604  -56.690 17.373  1.00 64.81  ? 51  THR B CG2 1 
ATOM   1558 N N   . SER B 1 35  ? 73.304  -58.759 17.211  1.00 63.44  ? 52  SER B N   1 
ATOM   1559 C CA  . SER B 1 35  ? 72.031  -58.069 17.482  1.00 64.70  ? 52  SER B CA  1 
ATOM   1560 C C   . SER B 1 35  ? 71.349  -58.541 18.778  1.00 61.87  ? 52  SER B C   1 
ATOM   1561 O O   . SER B 1 35  ? 71.809  -59.465 19.440  1.00 57.89  ? 52  SER B O   1 
ATOM   1562 C CB  . SER B 1 35  ? 71.063  -58.207 16.297  1.00 63.99  ? 52  SER B CB  1 
ATOM   1563 O OG  . SER B 1 35  ? 70.614  -59.537 16.163  1.00 63.64  ? 52  SER B OG  1 
ATOM   1564 N N   . LEU B 1 36  ? 70.242  -57.882 19.108  1.00 62.86  ? 53  LEU B N   1 
ATOM   1565 C CA  . LEU B 1 36  ? 69.462  -58.155 20.302  1.00 63.76  ? 53  LEU B CA  1 
ATOM   1566 C C   . LEU B 1 36  ? 67.996  -58.339 19.885  1.00 63.61  ? 53  LEU B C   1 
ATOM   1567 O O   . LEU B 1 36  ? 67.415  -57.450 19.262  1.00 67.64  ? 53  LEU B O   1 
ATOM   1568 C CB  . LEU B 1 36  ? 69.616  -56.977 21.277  1.00 65.34  ? 53  LEU B CB  1 
ATOM   1569 C CG  . LEU B 1 36  ? 68.812  -56.848 22.582  1.00 66.48  ? 53  LEU B CG  1 
ATOM   1570 C CD1 . LEU B 1 36  ? 67.325  -56.596 22.380  1.00 66.83  ? 53  LEU B CD1 1 
ATOM   1571 C CD2 . LEU B 1 36  ? 69.007  -58.069 23.448  1.00 68.70  ? 53  LEU B CD2 1 
ATOM   1572 N N   . ILE B 1 37  ? 67.413  -59.487 20.225  1.00 60.69  ? 54  ILE B N   1 
ATOM   1573 C CA  . ILE B 1 37  ? 65.994  -59.770 19.982  1.00 59.44  ? 54  ILE B CA  1 
ATOM   1574 C C   . ILE B 1 37  ? 65.217  -59.745 21.314  1.00 60.61  ? 54  ILE B C   1 
ATOM   1575 O O   . ILE B 1 37  ? 65.730  -60.157 22.355  1.00 61.49  ? 54  ILE B O   1 
ATOM   1576 C CB  . ILE B 1 37  ? 65.818  -61.145 19.299  1.00 57.94  ? 54  ILE B CB  1 
ATOM   1577 C CG1 . ILE B 1 37  ? 66.493  -61.166 17.922  1.00 58.50  ? 54  ILE B CG1 1 
ATOM   1578 C CG2 . ILE B 1 37  ? 64.355  -61.478 19.143  1.00 57.94  ? 54  ILE B CG2 1 
ATOM   1579 N N   . ALA B 1 38  ? 63.984  -59.249 21.272  1.00 60.20  ? 55  ALA B N   1 
ATOM   1580 C CA  . ALA B 1 38  ? 63.141  -59.109 22.459  1.00 57.89  ? 55  ALA B CA  1 
ATOM   1581 C C   . ALA B 1 38  ? 61.800  -59.736 22.174  1.00 57.63  ? 55  ALA B C   1 
ATOM   1582 O O   . ALA B 1 38  ? 61.200  -59.437 21.165  1.00 60.41  ? 55  ALA B O   1 
ATOM   1583 C CB  . ALA B 1 38  ? 62.951  -57.639 22.793  1.00 57.99  ? 55  ALA B CB  1 
ATOM   1584 N N   . HIS B 1 39  ? 61.305  -60.579 23.064  1.00 61.15  ? 56  HIS B N   1 
ATOM   1585 C CA  . HIS B 1 39  ? 60.012  -61.208 22.841  1.00 62.92  ? 56  HIS B CA  1 
ATOM   1586 C C   . HIS B 1 39  ? 59.159  -61.225 24.097  1.00 64.60  ? 56  HIS B C   1 
ATOM   1587 O O   . HIS B 1 39  ? 59.534  -61.852 25.081  1.00 70.45  ? 56  HIS B O   1 
ATOM   1588 C CB  . HIS B 1 39  ? 60.229  -62.629 22.354  1.00 63.46  ? 56  HIS B CB  1 
ATOM   1589 C CG  . HIS B 1 39  ? 58.974  -63.299 21.910  1.00 65.15  ? 56  HIS B CG  1 
ATOM   1590 N ND1 . HIS B 1 39  ? 58.414  -64.356 22.592  1.00 68.13  ? 56  HIS B ND1 1 
ATOM   1591 C CD2 . HIS B 1 39  ? 58.155  -63.045 20.867  1.00 66.70  ? 56  HIS B CD2 1 
ATOM   1592 C CE1 . HIS B 1 39  ? 57.305  -64.731 21.980  1.00 68.89  ? 56  HIS B CE1 1 
ATOM   1593 N NE2 . HIS B 1 39  ? 57.127  -63.951 20.931  1.00 68.68  ? 56  HIS B NE2 1 
ATOM   1594 N N   . ARG B 1 40  ? 58.021  -60.535 24.067  1.00 66.61  ? 57  ARG B N   1 
ATOM   1595 C CA  . ARG B 1 40  ? 57.074  -60.563 25.187  1.00 69.66  ? 57  ARG B CA  1 
ATOM   1596 C C   . ARG B 1 40  ? 56.384  -61.917 25.296  1.00 69.02  ? 57  ARG B C   1 
ATOM   1597 O O   . ARG B 1 40  ? 55.956  -62.486 24.294  1.00 74.33  ? 57  ARG B O   1 
ATOM   1598 C CB  . ARG B 1 40  ? 56.000  -59.485 25.045  1.00 73.32  ? 57  ARG B CB  1 
ATOM   1599 C CG  . ARG B 1 40  ? 56.298  -58.172 25.757  1.00 78.36  ? 57  ARG B CG  1 
ATOM   1600 C CD  . ARG B 1 40  ? 55.207  -57.121 25.516  1.00 83.05  ? 57  ARG B CD  1 
ATOM   1601 N NE  . ARG B 1 40  ? 55.694  -55.955 24.769  1.00 85.94  ? 57  ARG B NE  1 
ATOM   1602 C CZ  . ARG B 1 40  ? 55.953  -55.922 23.458  1.00 89.89  ? 57  ARG B CZ  1 
ATOM   1603 N NH1 . ARG B 1 40  ? 55.783  -56.993 22.689  1.00 90.70  ? 57  ARG B NH1 1 
ATOM   1604 N NH2 . ARG B 1 40  ? 56.397  -54.800 22.902  1.00 93.10  ? 57  ARG B NH2 1 
ATOM   1605 N N   . VAL B 1 41  ? 56.277  -62.407 26.528  1.00 68.27  ? 58  VAL B N   1 
ATOM   1606 C CA  . VAL B 1 41  ? 55.569  -63.639 26.863  1.00 66.66  ? 58  VAL B CA  1 
ATOM   1607 C C   . VAL B 1 41  ? 54.574  -63.336 27.990  1.00 67.68  ? 58  VAL B C   1 
ATOM   1608 O O   . VAL B 1 41  ? 54.939  -62.720 28.993  1.00 66.99  ? 58  VAL B O   1 
ATOM   1609 C CB  . VAL B 1 41  ? 56.561  -64.710 27.362  1.00 67.23  ? 58  VAL B CB  1 
ATOM   1610 C CG1 . VAL B 1 41  ? 55.850  -66.031 27.633  1.00 68.26  ? 58  VAL B CG1 1 
ATOM   1611 C CG2 . VAL B 1 41  ? 57.701  -64.886 26.364  1.00 66.67  ? 58  VAL B CG2 1 
ATOM   1612 N N   . ASP B 1 42  ? 53.319  -63.753 27.829  1.00 70.59  ? 59  ASP B N   1 
ATOM   1613 C CA  . ASP B 1 42  ? 52.352  -63.649 28.915  1.00 74.11  ? 59  ASP B CA  1 
ATOM   1614 C C   . ASP B 1 42  ? 52.483  -64.896 29.796  1.00 74.25  ? 59  ASP B C   1 
ATOM   1615 O O   . ASP B 1 42  ? 51.705  -65.856 29.698  1.00 70.39  ? 59  ASP B O   1 
ATOM   1616 C CB  . ASP B 1 42  ? 50.928  -63.452 28.408  1.00 76.00  ? 59  ASP B CB  1 
ATOM   1617 C CG  . ASP B 1 42  ? 49.988  -62.929 29.498  1.00 80.69  ? 59  ASP B CG  1 
ATOM   1618 O OD1 . ASP B 1 42  ? 50.288  -61.855 30.066  0.50 79.74  ? 59  ASP B OD1 1 
ATOM   1619 O OD2 . ASP B 1 42  ? 48.951  -63.582 29.775  0.50 79.43  ? 59  ASP B OD2 1 
ATOM   1620 N N   . ALA B 1 43  ? 53.515  -64.854 30.638  1.00 72.48  ? 60  ALA B N   1 
ATOM   1621 C CA  . ALA B 1 43  ? 53.854  -65.931 31.550  1.00 72.59  ? 60  ALA B CA  1 
ATOM   1622 C C   . ALA B 1 43  ? 54.821  -65.378 32.596  1.00 71.46  ? 60  ALA B C   1 
ATOM   1623 O O   . ALA B 1 43  ? 55.665  -64.549 32.284  1.00 75.45  ? 60  ALA B O   1 
ATOM   1624 C CB  . ALA B 1 43  ? 54.496  -67.087 30.795  1.00 71.96  ? 60  ALA B CB  1 
ATOM   1625 N N   . PRO B 1 44  ? 54.711  -65.837 33.842  1.00 69.23  ? 61  PRO B N   1 
ATOM   1626 C CA  . PRO B 1 44  ? 55.646  -65.329 34.822  1.00 68.66  ? 61  PRO B CA  1 
ATOM   1627 C C   . PRO B 1 44  ? 57.061  -65.802 34.506  1.00 66.27  ? 61  PRO B C   1 
ATOM   1628 O O   . PRO B 1 44  ? 57.241  -66.818 33.837  1.00 67.57  ? 61  PRO B O   1 
ATOM   1629 C CB  . PRO B 1 44  ? 55.126  -65.918 36.135  1.00 70.57  ? 61  PRO B CB  1 
ATOM   1630 C CG  . PRO B 1 44  ? 54.426  -67.164 35.740  1.00 70.01  ? 61  PRO B CG  1 
ATOM   1631 C CD  . PRO B 1 44  ? 53.839  -66.890 34.390  1.00 70.86  ? 61  PRO B CD  1 
ATOM   1632 N N   . ALA B 1 45  ? 58.052  -65.063 34.979  1.00 64.44  ? 62  ALA B N   1 
ATOM   1633 C CA  . ALA B 1 45  ? 59.439  -65.308 34.599  1.00 62.83  ? 62  ALA B CA  1 
ATOM   1634 C C   . ALA B 1 45  ? 59.967  -66.643 35.093  1.00 62.01  ? 62  ALA B C   1 
ATOM   1635 O O   . ALA B 1 45  ? 60.884  -67.199 34.501  1.00 63.22  ? 62  ALA B O   1 
ATOM   1636 C CB  . ALA B 1 45  ? 60.330  -64.184 35.112  1.00 63.64  ? 62  ALA B CB  1 
ATOM   1637 N N   . HIS B 1 46  ? 59.418  -67.152 36.189  1.00 60.58  ? 63  HIS B N   1 
ATOM   1638 C CA  . HIS B 1 46  ? 59.946  -68.383 36.755  1.00 59.14  ? 63  HIS B CA  1 
ATOM   1639 C C   . HIS B 1 46  ? 59.591  -69.531 35.811  1.00 56.02  ? 63  HIS B C   1 
ATOM   1640 O O   . HIS B 1 46  ? 60.434  -70.358 35.480  1.00 56.45  ? 63  HIS B O   1 
ATOM   1641 C CB  . HIS B 1 46  ? 59.434  -68.614 38.195  1.00 59.41  ? 63  HIS B CB  1 
ATOM   1642 C CG  . HIS B 1 46  ? 58.023  -69.092 38.259  1.00 58.20  ? 63  HIS B CG  1 
ATOM   1643 N ND1 . HIS B 1 46  ? 56.948  -68.232 38.237  1.00 57.70  ? 63  HIS B ND1 1 
ATOM   1644 C CD2 . HIS B 1 46  ? 57.508  -70.346 38.286  1.00 57.29  ? 63  HIS B CD2 1 
ATOM   1645 C CE1 . HIS B 1 46  ? 55.827  -68.938 38.252  1.00 57.41  ? 63  HIS B CE1 1 
ATOM   1646 N NE2 . HIS B 1 46  ? 56.140  -70.222 38.281  1.00 56.32  ? 63  HIS B NE2 1 
ATOM   1647 N N   . ALA B 1 47  ? 58.352  -69.548 35.341  1.00 54.72  ? 64  ALA B N   1 
ATOM   1648 C CA  . ALA B 1 47  ? 57.891  -70.592 34.430  1.00 54.03  ? 64  ALA B CA  1 
ATOM   1649 C C   . ALA B 1 47  ? 58.757  -70.649 33.167  1.00 51.95  ? 64  ALA B C   1 
ATOM   1650 O O   . ALA B 1 47  ? 59.053  -71.732 32.654  0.50 49.73  ? 64  ALA B O   1 
ATOM   1651 C CB  . ALA B 1 47  ? 56.433  -70.365 34.071  1.00 53.57  ? 64  ALA B CB  1 
ATOM   1652 N N   . ILE B 1 48  ? 59.182  -69.478 32.702  1.00 51.59  ? 65  ILE B N   1 
ATOM   1653 C CA  . ILE B 1 48  ? 60.031  -69.390 31.523  1.00 51.93  ? 65  ILE B CA  1 
ATOM   1654 C C   . ILE B 1 48  ? 61.433  -69.875 31.864  1.00 53.68  ? 65  ILE B C   1 
ATOM   1655 O O   . ILE B 1 48  ? 61.961  -70.802 31.235  1.00 56.43  ? 65  ILE B O   1 
ATOM   1656 C CB  . ILE B 1 48  ? 60.081  -67.961 30.942  1.00 50.89  ? 65  ILE B CB  1 
ATOM   1657 C CG1 . ILE B 1 48  ? 58.668  -67.427 30.663  1.00 50.15  ? 65  ILE B CG1 1 
ATOM   1658 C CG2 . ILE B 1 48  ? 60.864  -67.951 29.638  1.00 50.53  ? 65  ILE B CG2 1 
ATOM   1659 C CD1 . ILE B 1 48  ? 58.594  -65.924 30.471  1.00 50.54  ? 65  ILE B CD1 1 
ATOM   1660 N N   . TRP B 1 49  ? 62.035  -69.263 32.876  1.00 57.00  ? 66  TRP B N   1 
ATOM   1661 C CA  . TRP B 1 49  ? 63.399  -69.614 33.291  1.00 56.20  ? 66  TRP B CA  1 
ATOM   1662 C C   . TRP B 1 49  ? 63.590  -71.117 33.476  1.00 55.20  ? 66  TRP B C   1 
ATOM   1663 O O   . TRP B 1 49  ? 64.630  -71.669 33.120  1.00 53.76  ? 66  TRP B O   1 
ATOM   1664 C CB  . TRP B 1 49  ? 63.764  -68.870 34.568  1.00 59.29  ? 66  TRP B CB  1 
ATOM   1665 C CG  . TRP B 1 49  ? 65.139  -69.191 35.063  1.00 62.00  ? 66  TRP B CG  1 
ATOM   1666 C CD1 . TRP B 1 49  ? 65.446  -69.883 36.177  1.00 61.26  ? 66  TRP B CD1 1 
ATOM   1667 C CD2 . TRP B 1 49  ? 66.388  -68.859 34.430  1.00 62.89  ? 66  TRP B CD2 1 
ATOM   1668 N NE1 . TRP B 1 49  ? 66.802  -70.009 36.293  1.00 64.98  ? 66  TRP B NE1 1 
ATOM   1669 C CE2 . TRP B 1 49  ? 67.408  -69.380 35.239  1.00 63.82  ? 66  TRP B CE2 1 
ATOM   1670 C CE3 . TRP B 1 49  ? 66.739  -68.157 33.270  1.00 63.47  ? 66  TRP B CE3 1 
ATOM   1671 C CZ2 . TRP B 1 49  ? 68.767  -69.233 34.932  1.00 63.45  ? 66  TRP B CZ2 1 
ATOM   1672 C CZ3 . TRP B 1 49  ? 68.099  -68.008 32.964  1.00 63.14  ? 66  TRP B CZ3 1 
ATOM   1673 C CH2 . TRP B 1 49  ? 69.089  -68.542 33.799  1.00 62.62  ? 66  TRP B CH2 1 
ATOM   1674 N N   . ARG B 1 50  ? 62.578  -71.785 34.007  1.00 55.82  ? 67  ARG B N   1 
ATOM   1675 C CA  . ARG B 1 50  ? 62.647  -73.227 34.162  1.00 59.51  ? 67  ARG B CA  1 
ATOM   1676 C C   . ARG B 1 50  ? 63.059  -73.925 32.853  1.00 55.50  ? 67  ARG B C   1 
ATOM   1677 O O   . ARG B 1 50  ? 63.707  -74.973 32.910  1.00 56.58  ? 67  ARG B O   1 
ATOM   1678 C CB  . ARG B 1 50  ? 61.322  -73.774 34.706  1.00 65.95  ? 67  ARG B CB  1 
ATOM   1679 C CG  . ARG B 1 50  ? 61.389  -75.188 35.267  1.00 73.46  ? 67  ARG B CG  1 
ATOM   1680 C CD  . ARG B 1 50  ? 61.433  -76.248 34.155  1.00 79.22  ? 67  ARG B CD  1 
ATOM   1681 N NE  . ARG B 1 50  ? 60.195  -76.281 33.385  1.00 80.01  ? 67  ARG B NE  1 
ATOM   1682 C CZ  . ARG B 1 50  ? 59.136  -77.030 33.691  1.00 83.43  ? 67  ARG B CZ  1 
ATOM   1683 N NH1 . ARG B 1 50  ? 59.147  -77.845 34.751  1.00 87.41  ? 67  ARG B NH1 1 
ATOM   1684 N NH2 . ARG B 1 50  ? 58.049  -76.962 32.932  1.00 82.44  ? 67  ARG B NH2 1 
ATOM   1685 N N   . PHE B 1 51  ? 62.712  -73.345 31.695  1.00 50.03  ? 68  PHE B N   1 
ATOM   1686 C CA  . PHE B 1 51  ? 63.138  -73.884 30.378  1.00 46.44  ? 68  PHE B CA  1 
ATOM   1687 C C   . PHE B 1 51  ? 64.444  -73.310 29.929  1.00 47.25  ? 68  PHE B C   1 
ATOM   1688 O O   . PHE B 1 51  ? 65.364  -74.042 29.558  1.00 46.76  ? 68  PHE B O   1 
ATOM   1689 C CB  . PHE B 1 51  ? 62.099  -73.612 29.296  1.00 44.48  ? 68  PHE B CB  1 
ATOM   1690 C CG  . PHE B 1 51  ? 60.856  -74.418 29.458  1.00 41.69  ? 68  PHE B CG  1 
ATOM   1691 C CD1 . PHE B 1 51  ? 60.898  -75.780 29.310  1.00 41.31  ? 68  PHE B CD1 1 
ATOM   1692 C CD2 . PHE B 1 51  ? 59.677  -73.821 29.798  1.00 40.41  ? 68  PHE B CD2 1 
ATOM   1693 C CE1 . PHE B 1 51  ? 59.775  -76.539 29.486  1.00 41.97  ? 68  PHE B CE1 1 
ATOM   1694 C CE2 . PHE B 1 51  ? 58.532  -74.569 29.963  1.00 40.84  ? 68  PHE B CE2 1 
ATOM   1695 C CZ  . PHE B 1 51  ? 58.582  -75.933 29.814  1.00 41.46  ? 68  PHE B CZ  1 
ATOM   1696 N N   . VAL B 1 52  ? 64.541  -71.993 29.984  1.00 48.53  ? 69  VAL B N   1 
ATOM   1697 C CA  . VAL B 1 52  ? 65.772  -71.337 29.585  1.00 51.40  ? 69  VAL B CA  1 
ATOM   1698 C C   . VAL B 1 52  ? 66.994  -71.950 30.249  1.00 53.84  ? 69  VAL B C   1 
ATOM   1699 O O   . VAL B 1 52  ? 67.995  -72.193 29.582  1.00 57.00  ? 69  VAL B O   1 
ATOM   1700 C CB  . VAL B 1 52  ? 65.743  -69.834 29.886  1.00 53.72  ? 69  VAL B CB  1 
ATOM   1701 C CG1 . VAL B 1 52  ? 67.079  -69.205 29.518  1.00 55.75  ? 69  VAL B CG1 1 
ATOM   1702 C CG2 . VAL B 1 52  ? 64.611  -69.160 29.118  1.00 53.04  ? 69  VAL B CG2 1 
ATOM   1703 N N   . ARG B 1 53  ? 66.919  -72.201 31.554  1.00 56.99  ? 70  ARG B N   1 
ATOM   1704 C CA  . ARG B 1 53  ? 68.065  -72.759 32.303  1.00 58.65  ? 70  ARG B CA  1 
ATOM   1705 C C   . ARG B 1 53  ? 68.460  -74.187 31.915  1.00 58.72  ? 70  ARG B C   1 
ATOM   1706 O O   . ARG B 1 53  ? 69.598  -74.586 32.138  1.00 59.02  ? 70  ARG B O   1 
ATOM   1707 C CB  . ARG B 1 53  ? 67.799  -72.711 33.804  1.00 60.24  ? 70  ARG B CB  1 
ATOM   1708 C CG  . ARG B 1 53  ? 66.713  -73.668 34.287  1.00 61.96  ? 70  ARG B CG  1 
ATOM   1709 C CD  . ARG B 1 53  ? 66.253  -73.298 35.697  1.00 60.90  ? 70  ARG B CD  1 
ATOM   1710 N NE  . ARG B 1 53  ? 67.361  -73.494 36.620  1.00 61.29  ? 70  ARG B NE  1 
ATOM   1711 C CZ  . ARG B 1 53  ? 67.660  -74.649 37.215  1.00 60.40  ? 70  ARG B CZ  1 
ATOM   1712 N NH1 . ARG B 1 53  ? 66.922  -75.734 37.032  1.00 60.40  ? 70  ARG B NH1 1 
ATOM   1713 N NH2 . ARG B 1 53  ? 68.711  -74.721 38.008  1.00 60.48  ? 70  ARG B NH2 1 
ATOM   1714 N N   . ASP B 1 54  ? 67.527  -74.937 31.326  1.00 58.88  ? 71  ASP B N   1 
ATOM   1715 C CA  . ASP B 1 54  ? 67.693  -76.372 31.066  1.00 57.56  ? 71  ASP B CA  1 
ATOM   1716 C C   . ASP B 1 54  ? 68.713  -76.627 29.941  1.00 59.83  ? 71  ASP B C   1 
ATOM   1717 O O   . ASP B 1 54  ? 68.375  -77.076 28.836  1.00 61.49  ? 71  ASP B O   1 
ATOM   1718 C CB  . ASP B 1 54  ? 66.325  -76.989 30.735  1.00 56.08  ? 71  ASP B CB  1 
ATOM   1719 C CG  . ASP B 1 54  ? 66.289  -78.506 30.892  1.00 57.52  ? 71  ASP B CG  1 
ATOM   1720 O OD1 . ASP B 1 54  ? 67.348  -79.171 30.928  1.00 59.04  ? 71  ASP B OD1 1 
ATOM   1721 O OD2 . ASP B 1 54  ? 65.172  -79.050 30.980  1.00 58.72  ? 71  ASP B OD2 1 
ATOM   1722 N N   . PHE B 1 55  ? 69.977  -76.358 30.240  1.00 59.07  ? 72  PHE B N   1 
ATOM   1723 C CA  . PHE B 1 55  ? 71.044  -76.509 29.269  1.00 59.09  ? 72  PHE B CA  1 
ATOM   1724 C C   . PHE B 1 55  ? 71.068  -77.892 28.609  1.00 61.23  ? 72  PHE B C   1 
ATOM   1725 O O   . PHE B 1 55  ? 71.455  -78.032 27.449  1.00 64.53  ? 72  PHE B O   1 
ATOM   1726 C CB  . PHE B 1 55  ? 72.370  -76.245 29.955  1.00 60.72  ? 72  PHE B CB  1 
ATOM   1727 C CG  . PHE B 1 55  ? 73.509  -76.014 29.010  1.00 61.45  ? 72  PHE B CG  1 
ATOM   1728 C CD1 . PHE B 1 55  ? 73.642  -74.800 28.355  1.00 59.67  ? 72  PHE B CD1 1 
ATOM   1729 C CD2 . PHE B 1 55  ? 74.468  -77.003 28.799  1.00 61.51  ? 72  PHE B CD2 1 
ATOM   1730 C CE1 . PHE B 1 55  ? 74.696  -74.581 27.500  1.00 59.99  ? 72  PHE B CE1 1 
ATOM   1731 C CE2 . PHE B 1 55  ? 75.531  -76.783 27.950  1.00 60.82  ? 72  PHE B CE2 1 
ATOM   1732 C CZ  . PHE B 1 55  ? 75.643  -75.571 27.297  1.00 60.85  ? 72  PHE B CZ  1 
ATOM   1733 N N   . ALA B 1 56  ? 70.649  -78.910 29.344  1.00 64.82  ? 73  ALA B N   1 
ATOM   1734 C CA  . ALA B 1 56  ? 70.683  -80.288 28.848  1.00 67.68  ? 73  ALA B CA  1 
ATOM   1735 C C   . ALA B 1 56  ? 69.612  -80.587 27.810  1.00 66.73  ? 73  ALA B C   1 
ATOM   1736 O O   . ALA B 1 56  ? 69.792  -81.494 27.002  1.00 71.70  ? 73  ALA B O   1 
ATOM   1737 C CB  . ALA B 1 56  ? 70.551  -81.267 30.006  1.00 69.28  ? 73  ALA B CB  1 
ATOM   1738 N N   . ASN B 1 57  ? 68.503  -79.849 27.843  1.00 63.99  ? 74  ASN B N   1 
ATOM   1739 C CA  . ASN B 1 57  ? 67.372  -80.102 26.949  1.00 62.23  ? 74  ASN B CA  1 
ATOM   1740 C C   . ASN B 1 57  ? 66.930  -78.841 26.186  1.00 60.37  ? 74  ASN B C   1 
ATOM   1741 O O   . ASN B 1 57  ? 65.827  -78.346 26.386  1.00 61.54  ? 74  ASN B O   1 
ATOM   1742 C CB  . ASN B 1 57  ? 66.196  -80.654 27.753  1.00 62.59  ? 74  ASN B CB  1 
ATOM   1743 C CG  . ASN B 1 57  ? 66.549  -81.907 28.527  1.00 64.21  ? 74  ASN B CG  1 
ATOM   1744 O OD1 . ASN B 1 57  ? 66.653  -82.993 27.955  1.00 62.54  ? 74  ASN B OD1 1 
ATOM   1745 N ND2 . ASN B 1 57  ? 66.708  -81.766 29.849  1.00 63.89  ? 74  ASN B ND2 1 
ATOM   1746 N N   . PRO B 1 58  ? 67.784  -78.321 25.298  1.00 59.49  ? 75  PRO B N   1 
ATOM   1747 C CA  . PRO B 1 58  ? 67.411  -77.157 24.498  1.00 58.83  ? 75  PRO B CA  1 
ATOM   1748 C C   . PRO B 1 58  ? 66.238  -77.445 23.552  1.00 58.51  ? 75  PRO B C   1 
ATOM   1749 O O   . PRO B 1 58  ? 65.426  -76.556 23.284  1.00 54.44  ? 75  PRO B O   1 
ATOM   1750 C CB  . PRO B 1 58  ? 68.672  -76.873 23.690  1.00 60.22  ? 75  PRO B CB  1 
ATOM   1751 C CG  . PRO B 1 58  ? 69.391  -78.177 23.607  1.00 60.76  ? 75  PRO B CG  1 
ATOM   1752 C CD  . PRO B 1 58  ? 69.077  -78.893 24.882  1.00 61.53  ? 75  PRO B CD  1 
ATOM   1753 N N   . ASN B 1 59  ? 66.171  -78.685 23.063  1.00 58.99  ? 76  ASN B N   1 
ATOM   1754 C CA  . ASN B 1 59  ? 65.058  -79.177 22.232  1.00 60.01  ? 76  ASN B CA  1 
ATOM   1755 C C   . ASN B 1 59  ? 63.647  -78.926 22.763  1.00 60.08  ? 76  ASN B C   1 
ATOM   1756 O O   . ASN B 1 59  ? 62.687  -78.979 22.002  1.00 63.52  ? 76  ASN B O   1 
ATOM   1757 C CB  . ASN B 1 59  ? 65.217  -80.682 21.961  1.00 61.95  ? 76  ASN B CB  1 
ATOM   1758 C CG  . ASN B 1 59  ? 65.423  -81.490 23.231  1.00 63.10  ? 76  ASN B CG  1 
ATOM   1759 O OD1 . ASN B 1 59  ? 64.460  -81.910 23.873  0.50 62.37  ? 76  ASN B OD1 1 
ATOM   1760 N ND2 . ASN B 1 59  ? 66.688  -81.709 23.601  1.00 64.02  ? 76  ASN B ND2 1 
ATOM   1761 N N   . LYS B 1 60  ? 63.496  -78.681 24.057  1.00 59.79  ? 77  LYS B N   1 
ATOM   1762 C CA  . LYS B 1 60  ? 62.174  -78.367 24.579  1.00 58.95  ? 77  LYS B CA  1 
ATOM   1763 C C   . LYS B 1 60  ? 61.561  -77.133 23.916  1.00 57.53  ? 77  LYS B C   1 
ATOM   1764 O O   . LYS B 1 60  ? 60.338  -77.050 23.766  1.00 55.95  ? 77  LYS B O   1 
ATOM   1765 C CB  . LYS B 1 60  ? 62.192  -78.205 26.095  1.00 58.76  ? 77  LYS B CB  1 
ATOM   1766 C CG  . LYS B 1 60  ? 61.671  -79.428 26.827  1.00 60.28  ? 77  LYS B CG  1 
ATOM   1767 C CD  . LYS B 1 60  ? 62.583  -80.627 26.644  1.00 61.06  ? 77  LYS B CD  1 
ATOM   1768 N N   . TYR B 1 61  ? 62.399  -76.176 23.534  1.00 56.68  ? 78  TYR B N   1 
ATOM   1769 C CA  . TYR B 1 61  ? 61.905  -74.978 22.844  1.00 56.39  ? 78  TYR B CA  1 
ATOM   1770 C C   . TYR B 1 61  ? 62.671  -74.578 21.582  1.00 53.80  ? 78  TYR B C   1 
ATOM   1771 O O   . TYR B 1 61  ? 62.256  -73.658 20.891  1.00 54.01  ? 78  TYR B O   1 
ATOM   1772 C CB  . TYR B 1 61  ? 61.787  -73.791 23.818  1.00 55.40  ? 78  TYR B CB  1 
ATOM   1773 C CG  . TYR B 1 61  ? 63.071  -73.167 24.309  1.00 55.55  ? 78  TYR B CG  1 
ATOM   1774 C CD1 . TYR B 1 61  ? 63.741  -73.685 25.417  1.00 57.49  ? 78  TYR B CD1 1 
ATOM   1775 C CD2 . TYR B 1 61  ? 63.576  -72.014 23.723  1.00 56.61  ? 78  TYR B CD2 1 
ATOM   1776 C CE1 . TYR B 1 61  ? 64.905  -73.096 25.905  1.00 56.64  ? 78  TYR B CE1 1 
ATOM   1777 C CE2 . TYR B 1 61  ? 64.740  -71.414 24.195  1.00 56.88  ? 78  TYR B CE2 1 
ATOM   1778 C CZ  . TYR B 1 61  ? 65.403  -71.954 25.294  1.00 57.42  ? 78  TYR B CZ  1 
ATOM   1779 O OH  . TYR B 1 61  ? 66.564  -71.368 25.779  1.00 54.03  ? 78  TYR B OH  1 
ATOM   1780 N N   . LYS B 1 62  ? 63.764  -75.267 21.284  1.00 53.41  ? 79  LYS B N   1 
ATOM   1781 C CA  . LYS B 1 62  ? 64.547  -75.018 20.082  1.00 52.95  ? 79  LYS B CA  1 
ATOM   1782 C C   . LYS B 1 62  ? 64.215  -76.087 19.077  1.00 52.37  ? 79  LYS B C   1 
ATOM   1783 O O   . LYS B 1 62  ? 64.623  -77.241 19.215  1.00 51.75  ? 79  LYS B O   1 
ATOM   1784 C CB  . LYS B 1 62  ? 66.038  -75.050 20.399  1.00 54.75  ? 79  LYS B CB  1 
ATOM   1785 C CG  . LYS B 1 62  ? 66.492  -73.940 21.338  1.00 55.60  ? 79  LYS B CG  1 
ATOM   1786 C CD  . LYS B 1 62  ? 68.009  -73.898 21.471  1.00 56.28  ? 79  LYS B CD  1 
ATOM   1787 C CE  . LYS B 1 62  ? 68.437  -72.818 22.446  1.00 56.94  ? 79  LYS B CE  1 
ATOM   1788 N NZ  . LYS B 1 62  ? 69.909  -72.829 22.639  1.00 59.08  ? 79  LYS B NZ  1 
ATOM   1789 N N   . HIS B 1 63  ? 63.461  -75.701 18.061  1.00 52.63  ? 80  HIS B N   1 
ATOM   1790 C CA  . HIS B 1 63  ? 62.884  -76.674 17.155  1.00 54.05  ? 80  HIS B CA  1 
ATOM   1791 C C   . HIS B 1 63  ? 63.907  -77.391 16.253  1.00 55.00  ? 80  HIS B C   1 
ATOM   1792 O O   . HIS B 1 63  ? 63.690  -78.534 15.860  1.00 55.07  ? 80  HIS B O   1 
ATOM   1793 C CB  . HIS B 1 63  ? 61.810  -76.005 16.317  1.00 55.05  ? 80  HIS B CB  1 
ATOM   1794 C CG  . HIS B 1 63  ? 61.228  -76.895 15.269  1.00 56.95  ? 80  HIS B CG  1 
ATOM   1795 N ND1 . HIS B 1 63  ? 61.413  -76.672 13.922  1.00 55.33  ? 80  HIS B ND1 1 
ATOM   1796 C CD2 . HIS B 1 63  ? 60.492  -78.025 15.367  1.00 56.90  ? 80  HIS B CD2 1 
ATOM   1797 C CE1 . HIS B 1 63  ? 60.795  -77.612 13.236  1.00 55.41  ? 80  HIS B CE1 1 
ATOM   1798 N NE2 . HIS B 1 63  ? 60.219  -78.438 14.087  1.00 56.76  ? 80  HIS B NE2 1 
ATOM   1799 N N   . PHE B 1 64  ? 65.023  -76.736 15.953  1.00 56.77  ? 81  PHE B N   1 
ATOM   1800 C CA  . PHE B 1 64  ? 66.003  -77.280 14.998  1.00 58.81  ? 81  PHE B CA  1 
ATOM   1801 C C   . PHE B 1 64  ? 67.062  -78.173 15.615  1.00 60.63  ? 81  PHE B C   1 
ATOM   1802 O O   . PHE B 1 64  ? 67.847  -78.799 14.894  1.00 58.60  ? 81  PHE B O   1 
ATOM   1803 C CB  . PHE B 1 64  ? 66.617  -76.140 14.217  1.00 58.26  ? 81  PHE B CB  1 
ATOM   1804 C CG  . PHE B 1 64  ? 65.593  -75.399 13.434  1.00 61.06  ? 81  PHE B CG  1 
ATOM   1805 C CD1 . PHE B 1 64  ? 65.022  -75.991 12.305  1.00 61.43  ? 81  PHE B CD1 1 
ATOM   1806 C CD2 . PHE B 1 64  ? 65.113  -74.168 13.865  1.00 61.33  ? 81  PHE B CD2 1 
ATOM   1807 C CE1 . PHE B 1 64  ? 64.044  -75.348 11.591  1.00 59.39  ? 81  PHE B CE1 1 
ATOM   1808 C CE2 . PHE B 1 64  ? 64.127  -73.515 13.146  1.00 60.10  ? 81  PHE B CE2 1 
ATOM   1809 C CZ  . PHE B 1 64  ? 63.596  -74.114 12.009  1.00 60.87  ? 81  PHE B CZ  1 
ATOM   1810 N N   . ILE B 1 65  ? 67.048  -78.235 16.949  1.00 62.28  ? 82  ILE B N   1 
ATOM   1811 C CA  . ILE B 1 65  ? 67.846  -79.185 17.717  1.00 62.08  ? 82  ILE B CA  1 
ATOM   1812 C C   . ILE B 1 65  ? 67.011  -80.450 17.911  1.00 63.09  ? 82  ILE B C   1 
ATOM   1813 O O   . ILE B 1 65  ? 66.040  -80.456 18.677  1.00 62.39  ? 82  ILE B O   1 
ATOM   1814 C CB  . ILE B 1 65  ? 68.263  -78.571 19.071  1.00 60.96  ? 82  ILE B CB  1 
ATOM   1815 C CG1 . ILE B 1 65  ? 69.402  -77.579 18.847  1.00 59.13  ? 82  ILE B CG1 1 
ATOM   1816 C CG2 . ILE B 1 65  ? 68.692  -79.641 20.069  1.00 61.73  ? 82  ILE B CG2 1 
ATOM   1817 C CD1 . ILE B 1 65  ? 68.992  -76.312 18.137  1.00 58.89  ? 82  ILE B CD1 1 
ATOM   1818 N N   . LYS B 1 66  ? 67.388  -81.505 17.193  1.00 64.76  ? 83  LYS B N   1 
ATOM   1819 C CA  . LYS B 1 66  ? 66.682  -82.793 17.239  1.00 70.23  ? 83  LYS B CA  1 
ATOM   1820 C C   . LYS B 1 66  ? 66.939  -83.503 18.573  1.00 74.98  ? 83  LYS B C   1 
ATOM   1821 O O   . LYS B 1 66  ? 66.031  -84.103 19.150  1.00 77.28  ? 83  LYS B O   1 
ATOM   1822 C CB  . LYS B 1 66  ? 67.097  -83.682 16.037  1.00 72.25  ? 83  LYS B CB  1 
ATOM   1823 C CG  . LYS B 1 66  ? 67.619  -85.080 16.373  1.00 71.40  ? 83  LYS B CG  1 
ATOM   1824 N N   . SER B 1 67  ? 68.185  -83.435 19.045  1.00 74.99  ? 84  SER B N   1 
ATOM   1825 C CA  . SER B 1 67  ? 68.552  -83.967 20.347  1.00 73.30  ? 84  SER B CA  1 
ATOM   1826 C C   . SER B 1 67  ? 69.877  -83.361 20.820  1.00 72.82  ? 84  SER B C   1 
ATOM   1827 O O   . SER B 1 67  ? 70.701  -82.926 20.004  1.00 70.85  ? 84  SER B O   1 
ATOM   1828 C CB  . SER B 1 67  ? 68.660  -85.487 20.289  1.00 75.50  ? 84  SER B CB  1 
ATOM   1829 O OG  . SER B 1 67  ? 69.726  -85.886 19.445  1.00 78.00  ? 84  SER B OG  1 
ATOM   1830 N N   . CYS B 1 68  ? 70.053  -83.345 22.145  1.00 71.23  ? 85  CYS B N   1 
ATOM   1831 C CA  . CYS B 1 68  ? 71.224  -82.778 22.820  1.00 66.81  ? 85  CYS B CA  1 
ATOM   1832 C C   . CYS B 1 68  ? 71.902  -83.849 23.665  1.00 65.85  ? 85  CYS B C   1 
ATOM   1833 O O   . CYS B 1 68  ? 71.286  -84.852 24.024  1.00 66.54  ? 85  CYS B O   1 
ATOM   1834 C CB  . CYS B 1 68  ? 70.778  -81.629 23.722  1.00 66.43  ? 85  CYS B CB  1 
ATOM   1835 S SG  . CYS B 1 68  ? 72.054  -80.954 24.816  1.00 64.69  ? 85  CYS B SG  1 
ATOM   1836 N N   . THR B 1 69  ? 73.170  -83.648 23.992  1.00 65.09  ? 86  THR B N   1 
ATOM   1837 C CA  . THR B 1 69  ? 73.867  -84.608 24.850  1.00 67.95  ? 86  THR B CA  1 
ATOM   1838 C C   . THR B 1 69  ? 74.996  -83.962 25.626  1.00 67.82  ? 86  THR B C   1 
ATOM   1839 O O   . THR B 1 69  ? 75.904  -83.361 25.046  1.00 69.15  ? 86  THR B O   1 
ATOM   1840 C CB  . THR B 1 69  ? 74.410  -85.801 24.048  1.00 69.49  ? 86  THR B CB  1 
ATOM   1841 O OG1 . THR B 1 69  ? 73.310  -86.525 23.484  1.00 71.99  ? 86  THR B OG1 1 
ATOM   1842 C CG2 . THR B 1 69  ? 75.220  -86.737 24.941  1.00 69.85  ? 86  THR B CG2 1 
ATOM   1843 N N   . ILE B 1 70  ? 74.926  -84.094 26.945  1.00 66.14  ? 87  ILE B N   1 
ATOM   1844 C CA  . ILE B 1 70  ? 75.950  -83.556 27.806  1.00 65.02  ? 87  ILE B CA  1 
ATOM   1845 C C   . ILE B 1 70  ? 77.197  -84.408 27.613  1.00 65.44  ? 87  ILE B C   1 
ATOM   1846 O O   . ILE B 1 70  ? 77.129  -85.626 27.704  1.00 67.80  ? 87  ILE B O   1 
ATOM   1847 C CB  . ILE B 1 70  ? 75.468  -83.533 29.261  1.00 63.89  ? 87  ILE B CB  1 
ATOM   1848 C CG1 . ILE B 1 70  ? 74.252  -82.627 29.350  1.00 63.82  ? 87  ILE B CG1 1 
ATOM   1849 C CG2 . ILE B 1 70  ? 76.543  -82.988 30.185  1.00 65.25  ? 87  ILE B CG2 1 
ATOM   1850 N N   . ARG B 1 71  ? 78.312  -83.762 27.289  1.00 66.01  ? 88  ARG B N   1 
ATOM   1851 C CA  . ARG B 1 71  ? 79.572  -84.449 26.991  1.00 70.02  ? 88  ARG B CA  1 
ATOM   1852 C C   . ARG B 1 71  ? 80.617  -84.242 28.087  1.00 71.37  ? 88  ARG B C   1 
ATOM   1853 O O   . ARG B 1 71  ? 81.472  -85.102 28.308  1.00 72.85  ? 88  ARG B O   1 
ATOM   1854 C CB  . ARG B 1 71  ? 80.149  -83.957 25.658  1.00 71.66  ? 88  ARG B CB  1 
ATOM   1855 C CG  . ARG B 1 71  ? 80.013  -84.937 24.509  1.00 73.62  ? 88  ARG B CG  1 
ATOM   1856 C CD  . ARG B 1 71  ? 78.619  -84.948 23.942  1.00 75.99  ? 88  ARG B CD  1 
ATOM   1857 N NE  . ARG B 1 71  ? 78.556  -85.737 22.715  1.00 79.74  ? 88  ARG B NE  1 
ATOM   1858 C CZ  . ARG B 1 71  ? 78.458  -87.064 22.666  1.00 82.16  ? 88  ARG B CZ  1 
ATOM   1859 N NH1 . ARG B 1 71  ? 78.416  -87.790 23.779  1.00 86.87  ? 88  ARG B NH1 1 
ATOM   1860 N NH2 . ARG B 1 71  ? 78.402  -87.674 21.491  1.00 81.38  ? 88  ARG B NH2 1 
ATOM   1861 N N   . VAL B 1 72  ? 80.572  -83.075 28.723  1.00 70.89  ? 89  VAL B N   1 
ATOM   1862 C CA  . VAL B 1 72  ? 81.361  -82.784 29.907  1.00 70.19  ? 89  VAL B CA  1 
ATOM   1863 C C   . VAL B 1 72  ? 80.417  -82.278 30.983  1.00 69.96  ? 89  VAL B C   1 
ATOM   1864 O O   . VAL B 1 72  ? 79.851  -81.196 30.847  1.00 67.99  ? 89  VAL B O   1 
ATOM   1865 C CB  . VAL B 1 72  ? 82.411  -81.698 29.626  1.00 70.86  ? 89  VAL B CB  1 
ATOM   1866 C CG1 . VAL B 1 72  ? 83.085  -81.259 30.922  1.00 71.17  ? 89  VAL B CG1 1 
ATOM   1867 C CG2 . VAL B 1 72  ? 83.439  -82.200 28.616  1.00 71.20  ? 89  VAL B CG2 1 
ATOM   1868 N N   . ASN B 1 73  ? 80.255  -83.068 32.043  1.00 73.77  ? 90  ASN B N   1 
ATOM   1869 C CA  . ASN B 1 73  ? 79.370  -82.721 33.171  1.00 73.74  ? 90  ASN B CA  1 
ATOM   1870 C C   . ASN B 1 73  ? 79.781  -81.438 33.918  1.00 71.68  ? 90  ASN B C   1 
ATOM   1871 O O   . ASN B 1 73  ? 80.954  -81.235 34.251  1.00 70.64  ? 90  ASN B O   1 
ATOM   1872 C CB  . ASN B 1 73  ? 79.295  -83.895 34.159  1.00 74.30  ? 90  ASN B CB  1 
ATOM   1873 C CG  . ASN B 1 73  ? 78.563  -85.096 33.590  0.50 75.99  ? 90  ASN B CG  1 
ATOM   1874 O OD1 . ASN B 1 73  ? 77.588  -84.947 32.861  1.00 81.98  ? 90  ASN B OD1 1 
ATOM   1875 N ND2 . ASN B 1 73  ? 79.024  -86.294 33.931  1.00 76.04  ? 90  ASN B ND2 1 
ATOM   1876 N N   . GLU B 1 79  ? 74.798  -82.423 37.401  1.00 78.16  ? 96  GLU B N   1 
ATOM   1877 C CA  . GLU B 1 79  ? 74.367  -81.100 37.840  1.00 79.16  ? 96  GLU B CA  1 
ATOM   1878 C C   . GLU B 1 79  ? 74.961  -80.018 36.943  0.50 73.47  ? 96  GLU B C   1 
ATOM   1879 O O   . GLU B 1 79  ? 76.153  -80.022 36.656  1.00 67.11  ? 96  GLU B O   1 
ATOM   1880 C CB  . GLU B 1 79  ? 74.790  -80.847 39.294  1.00 83.93  ? 96  GLU B CB  1 
ATOM   1881 C CG  . GLU B 1 79  ? 74.017  -79.722 39.988  1.00 86.85  ? 96  GLU B CG  1 
ATOM   1882 C CD  . GLU B 1 79  ? 72.942  -80.234 40.941  1.00 89.36  ? 96  GLU B CD  1 
ATOM   1883 O OE1 . GLU B 1 79  ? 73.282  -80.962 41.905  1.00 94.02  ? 96  GLU B OE1 1 
ATOM   1884 O OE2 . GLU B 1 79  ? 71.756  -79.905 40.733  1.00 88.63  ? 96  GLU B OE2 1 
ATOM   1885 N N   . ILE B 1 80  ? 74.122  -79.069 36.548  1.00 71.93  ? 97  ILE B N   1 
ATOM   1886 C CA  . ILE B 1 80  ? 74.461  -78.081 35.519  1.00 69.12  ? 97  ILE B CA  1 
ATOM   1887 C C   . ILE B 1 80  ? 75.139  -76.839 36.110  1.00 68.71  ? 97  ILE B C   1 
ATOM   1888 O O   . ILE B 1 80  ? 74.486  -75.995 36.722  1.00 71.55  ? 97  ILE B O   1 
ATOM   1889 C CB  . ILE B 1 80  ? 73.188  -77.641 34.760  1.00 67.02  ? 97  ILE B CB  1 
ATOM   1890 C CG1 . ILE B 1 80  ? 72.481  -78.844 34.130  1.00 67.25  ? 97  ILE B CG1 1 
ATOM   1891 C CG2 . ILE B 1 80  ? 73.511  -76.596 33.702  1.00 68.39  ? 97  ILE B CG2 1 
ATOM   1892 C CD1 . ILE B 1 80  ? 73.294  -79.583 33.081  1.00 67.72  ? 97  ILE B CD1 1 
ATOM   1893 N N   . LYS B 1 81  ? 76.447  -76.735 35.918  1.00 65.45  ? 98  LYS B N   1 
ATOM   1894 C CA  . LYS B 1 81  ? 77.191  -75.535 36.286  1.00 64.59  ? 98  LYS B CA  1 
ATOM   1895 C C   . LYS B 1 81  ? 77.765  -74.826 35.038  1.00 61.26  ? 98  LYS B C   1 
ATOM   1896 O O   . LYS B 1 81  ? 77.815  -75.403 33.949  1.00 58.82  ? 98  LYS B O   1 
ATOM   1897 C CB  . LYS B 1 81  ? 78.336  -75.905 37.240  1.00 64.20  ? 98  LYS B CB  1 
ATOM   1898 N N   . VAL B 1 82  ? 78.181  -73.571 35.213  1.00 57.17  ? 99  VAL B N   1 
ATOM   1899 C CA  . VAL B 1 82  ? 79.107  -72.941 34.295  1.00 56.30  ? 99  VAL B CA  1 
ATOM   1900 C C   . VAL B 1 82  ? 80.252  -73.907 34.046  1.00 57.53  ? 99  VAL B C   1 
ATOM   1901 O O   . VAL B 1 82  ? 80.814  -74.469 34.998  1.00 57.47  ? 99  VAL B O   1 
ATOM   1902 C CB  . VAL B 1 82  ? 79.723  -71.654 34.873  1.00 56.74  ? 99  VAL B CB  1 
ATOM   1903 C CG1 . VAL B 1 82  ? 80.926  -71.220 34.044  1.00 56.10  ? 99  VAL B CG1 1 
ATOM   1904 C CG2 . VAL B 1 82  ? 78.685  -70.537 34.938  1.00 57.78  ? 99  VAL B CG2 1 
ATOM   1905 N N   . GLY B 1 83  ? 80.592  -74.103 32.772  1.00 56.54  ? 100 GLY B N   1 
ATOM   1906 C CA  . GLY B 1 83  ? 81.670  -75.006 32.397  1.00 55.96  ? 100 GLY B CA  1 
ATOM   1907 C C   . GLY B 1 83  ? 81.179  -76.327 31.844  1.00 56.02  ? 100 GLY B C   1 
ATOM   1908 O O   . GLY B 1 83  ? 81.956  -77.068 31.245  1.00 57.18  ? 100 GLY B O   1 
ATOM   1909 N N   . THR B 1 84  ? 79.903  -76.644 32.040  1.00 55.52  ? 101 THR B N   1 
ATOM   1910 C CA  . THR B 1 84  ? 79.306  -77.783 31.344  1.00 57.38  ? 101 THR B CA  1 
ATOM   1911 C C   . THR B 1 84  ? 79.338  -77.611 29.815  1.00 58.90  ? 101 THR B C   1 
ATOM   1912 O O   . THR B 1 84  ? 79.032  -76.527 29.295  1.00 58.29  ? 101 THR B O   1 
ATOM   1913 C CB  . THR B 1 84  ? 77.851  -77.951 31.747  1.00 58.55  ? 101 THR B CB  1 
ATOM   1914 O OG1 . THR B 1 84  ? 77.762  -77.998 33.174  1.00 58.98  ? 101 THR B OG1 1 
ATOM   1915 C CG2 . THR B 1 84  ? 77.279  -79.229 31.146  1.00 61.18  ? 101 THR B CG2 1 
ATOM   1916 N N   . ILE B 1 85  ? 79.696  -78.680 29.104  1.00 59.97  ? 102 ILE B N   1 
ATOM   1917 C CA  . ILE B 1 85  ? 79.687  -78.680 27.628  1.00 61.28  ? 102 ILE B CA  1 
ATOM   1918 C C   . ILE B 1 85  ? 78.613  -79.649 27.083  1.00 60.69  ? 102 ILE B C   1 
ATOM   1919 O O   . ILE B 1 85  ? 78.566  -80.815 27.476  1.00 58.76  ? 102 ILE B O   1 
ATOM   1920 C CB  . ILE B 1 85  ? 81.082  -79.031 27.047  1.00 59.33  ? 102 ILE B CB  1 
ATOM   1921 N N   . ARG B 1 86  ? 77.743  -79.151 26.202  1.00 62.36  ? 103 ARG B N   1 
ATOM   1922 C CA  . ARG B 1 86  ? 76.764  -79.999 25.495  1.00 64.38  ? 103 ARG B CA  1 
ATOM   1923 C C   . ARG B 1 86  ? 77.095  -80.145 24.017  1.00 64.65  ? 103 ARG B C   1 
ATOM   1924 O O   . ARG B 1 86  ? 77.845  -79.331 23.466  1.00 66.01  ? 103 ARG B O   1 
ATOM   1925 C CB  . ARG B 1 86  ? 75.346  -79.450 25.630  1.00 65.10  ? 103 ARG B CB  1 
ATOM   1926 C CG  . ARG B 1 86  ? 75.060  -78.099 24.971  1.00 66.16  ? 103 ARG B CG  1 
ATOM   1927 C CD  . ARG B 1 86  ? 73.554  -77.886 24.907  1.00 68.52  ? 103 ARG B CD  1 
ATOM   1928 N NE  . ARG B 1 86  ? 73.063  -76.585 25.359  1.00 71.80  ? 103 ARG B NE  1 
ATOM   1929 C CZ  . ARG B 1 86  ? 72.955  -75.494 24.600  1.00 79.74  ? 103 ARG B CZ  1 
ATOM   1930 N NH1 . ARG B 1 86  ? 73.350  -75.491 23.319  1.00 81.19  ? 103 ARG B NH1 1 
ATOM   1931 N NH2 . ARG B 1 86  ? 72.454  -74.382 25.133  1.00 80.67  ? 103 ARG B NH2 1 
ATOM   1932 N N   . GLU B 1 87  ? 76.541  -81.184 23.389  1.00 64.72  ? 104 GLU B N   1 
ATOM   1933 C CA  . GLU B 1 87  ? 76.615  -81.334 21.935  1.00 67.84  ? 104 GLU B CA  1 
ATOM   1934 C C   . GLU B 1 87  ? 75.224  -81.501 21.337  1.00 69.44  ? 104 GLU B C   1 
ATOM   1935 O O   . GLU B 1 87  ? 74.519  -82.468 21.630  1.00 68.02  ? 104 GLU B O   1 
ATOM   1936 C CB  . GLU B 1 87  ? 77.507  -82.506 21.525  1.00 69.30  ? 104 GLU B CB  1 
ATOM   1937 C CG  . GLU B 1 87  ? 77.933  -82.450 20.063  1.00 69.82  ? 104 GLU B CG  1 
ATOM   1938 C CD  . GLU B 1 87  ? 78.940  -83.524 19.681  1.00 72.77  ? 104 GLU B CD  1 
ATOM   1939 O OE1 . GLU B 1 87  ? 79.236  -84.398 20.524  1.00 75.14  ? 104 GLU B OE1 1 
ATOM   1940 O OE2 . GLU B 1 87  ? 79.434  -83.502 18.529  1.00 72.15  ? 104 GLU B OE2 1 
ATOM   1941 N N   . VAL B 1 88  ? 74.841  -80.545 20.495  1.00 72.03  ? 105 VAL B N   1 
ATOM   1942 C CA  . VAL B 1 88  ? 73.547  -80.576 19.807  1.00 71.81  ? 105 VAL B CA  1 
ATOM   1943 C C   . VAL B 1 88  ? 73.672  -81.352 18.499  1.00 69.27  ? 105 VAL B C   1 
ATOM   1944 O O   . VAL B 1 88  ? 74.712  -81.302 17.833  1.00 66.54  ? 105 VAL B O   1 
ATOM   1945 C CB  . VAL B 1 88  ? 73.041  -79.156 19.489  1.00 69.65  ? 105 VAL B CB  1 
ATOM   1946 C CG2 . VAL B 1 88  ? 72.949  -78.336 20.769  1.00 70.76  ? 105 VAL B CG2 1 
ATOM   1947 N N   . SER B 1 89  ? 72.623  -82.096 18.164  1.00 65.99  ? 106 SER B N   1 
ATOM   1948 C CA  . SER B 1 89  ? 72.538  -82.752 16.876  1.00 67.14  ? 106 SER B CA  1 
ATOM   1949 C C   . SER B 1 89  ? 71.315  -82.158 16.171  1.00 67.99  ? 106 SER B C   1 
ATOM   1950 O O   . SER B 1 89  ? 70.180  -82.210 16.675  1.00 67.93  ? 106 SER B O   1 
ATOM   1951 C CB  . SER B 1 89  ? 72.472  -84.279 17.015  1.00 66.87  ? 106 SER B CB  1 
ATOM   1952 O OG  . SER B 1 89  ? 71.221  -84.718 17.511  1.00 67.23  ? 106 SER B OG  1 
ATOM   1953 N N   . VAL B 1 90  ? 71.580  -81.575 15.008  1.00 66.86  ? 107 VAL B N   1 
ATOM   1954 C CA  . VAL B 1 90  ? 70.646  -80.695 14.332  1.00 66.50  ? 107 VAL B CA  1 
ATOM   1955 C C   . VAL B 1 90  ? 69.671  -81.459 13.446  1.00 67.06  ? 107 VAL B C   1 
ATOM   1956 O O   . VAL B 1 90  ? 69.973  -82.520 12.913  1.00 68.12  ? 107 VAL B O   1 
ATOM   1957 C CB  . VAL B 1 90  ? 71.411  -79.671 13.486  1.00 66.86  ? 107 VAL B CB  1 
ATOM   1958 C CG1 . VAL B 1 90  ? 70.455  -78.747 12.742  1.00 66.32  ? 107 VAL B CG1 1 
ATOM   1959 C CG2 . VAL B 1 90  ? 72.348  -78.878 14.384  1.00 66.71  ? 107 VAL B CG2 1 
ATOM   1960 N N   . VAL B 1 91  ? 68.478  -80.909 13.318  1.00 67.32  ? 108 VAL B N   1 
ATOM   1961 C CA  . VAL B 1 91  ? 67.459  -81.482 12.460  1.00 68.75  ? 108 VAL B CA  1 
ATOM   1962 C C   . VAL B 1 91  ? 67.980  -81.567 11.023  1.00 69.20  ? 108 VAL B C   1 
ATOM   1963 O O   . VAL B 1 91  ? 68.638  -80.653 10.531  1.00 69.86  ? 108 VAL B O   1 
ATOM   1964 C CB  . VAL B 1 91  ? 66.170  -80.650 12.584  1.00 69.37  ? 108 VAL B CB  1 
ATOM   1965 C CG1 . VAL B 1 91  ? 65.329  -80.707 11.327  1.00 72.42  ? 108 VAL B CG1 1 
ATOM   1966 C CG2 . VAL B 1 91  ? 65.388  -81.114 13.808  1.00 69.24  ? 108 VAL B CG2 1 
ATOM   1967 N N   . SER B 1 92  ? 67.689  -82.679 10.357  1.00 71.14  ? 109 SER B N   1 
ATOM   1968 C CA  . SER B 1 92  ? 68.259  -82.961 9.038   1.00 72.02  ? 109 SER B CA  1 
ATOM   1969 C C   . SER B 1 92  ? 67.841  -81.954 7.961   1.00 72.90  ? 109 SER B C   1 
ATOM   1970 O O   . SER B 1 92  ? 68.499  -81.838 6.925   1.00 76.51  ? 109 SER B O   1 
ATOM   1971 C CB  . SER B 1 92  ? 67.891  -84.371 8.597   1.00 72.64  ? 109 SER B CB  1 
ATOM   1972 O OG  . SER B 1 92  ? 66.532  -84.437 8.227   1.00 74.30  ? 109 SER B OG  1 
ATOM   1973 N N   . GLY B 1 93  ? 66.764  -81.221 8.209   1.00 73.10  ? 110 GLY B N   1 
ATOM   1974 C CA  . GLY B 1 93  ? 66.321  -80.161 7.308   1.00 75.92  ? 110 GLY B CA  1 
ATOM   1975 C C   . GLY B 1 93  ? 67.231  -78.948 7.170   1.00 76.10  ? 110 GLY B C   1 
ATOM   1976 O O   . GLY B 1 93  ? 66.883  -78.002 6.464   1.00 76.50  ? 110 GLY B O   1 
ATOM   1977 N N   . LEU B 1 94  ? 68.373  -78.955 7.850   1.00 76.31  ? 111 LEU B N   1 
ATOM   1978 C CA  . LEU B 1 94  ? 69.347  -77.877 7.733   1.00 78.60  ? 111 LEU B CA  1 
ATOM   1979 C C   . LEU B 1 94  ? 70.725  -78.471 7.494   1.00 81.37  ? 111 LEU B C   1 
ATOM   1980 O O   . LEU B 1 94  ? 71.029  -79.554 8.015   1.00 79.07  ? 111 LEU B O   1 
ATOM   1981 C CB  . LEU B 1 94  ? 69.366  -77.030 9.010   1.00 78.47  ? 111 LEU B CB  1 
ATOM   1982 C CG  . LEU B 1 94  ? 68.108  -76.200 9.274   1.00 78.37  ? 111 LEU B CG  1 
ATOM   1983 C CD1 . LEU B 1 94  ? 68.097  -75.649 10.696  1.00 76.15  ? 111 LEU B CD1 1 
ATOM   1984 C CD2 . LEU B 1 94  ? 68.009  -75.076 8.250   1.00 79.20  ? 111 LEU B CD2 1 
ATOM   1985 N N   . PRO B 1 95  ? 71.572  -77.755 6.721   1.00 84.79  ? 112 PRO B N   1 
ATOM   1986 C CA  . PRO B 1 95  ? 72.910  -78.258 6.370   1.00 83.89  ? 112 PRO B CA  1 
ATOM   1987 C C   . PRO B 1 95  ? 73.802  -78.456 7.594   1.00 79.35  ? 112 PRO B C   1 
ATOM   1988 O O   . PRO B 1 95  ? 74.593  -79.400 7.627   1.00 76.44  ? 112 PRO B O   1 
ATOM   1989 C CB  . PRO B 1 95  ? 73.473  -77.181 5.428   1.00 84.13  ? 112 PRO B CB  1 
ATOM   1990 C CG  . PRO B 1 95  ? 72.692  -75.950 5.725   1.00 85.12  ? 112 PRO B CG  1 
ATOM   1991 C CD  . PRO B 1 95  ? 71.339  -76.391 6.206   1.00 84.79  ? 112 PRO B CD  1 
ATOM   1992 N N   . ALA B 1 96  ? 73.660  -77.586 8.593   1.00 77.33  ? 113 ALA B N   1 
ATOM   1993 C CA  . ALA B 1 96  ? 74.345  -77.774 9.872   1.00 75.30  ? 113 ALA B CA  1 
ATOM   1994 C C   . ALA B 1 96  ? 73.914  -79.103 10.514  1.00 74.53  ? 113 ALA B C   1 
ATOM   1995 O O   . ALA B 1 96  ? 72.748  -79.499 10.404  1.00 75.44  ? 113 ALA B O   1 
ATOM   1996 C CB  . ALA B 1 96  ? 74.062  -76.607 10.799  1.00 73.75  ? 113 ALA B CB  1 
ATOM   1997 N N   . SER B 1 97  ? 74.864  -79.794 11.148  1.00 72.69  ? 114 SER B N   1 
ATOM   1998 C CA  . SER B 1 97  ? 74.616  -81.125 11.724  1.00 73.52  ? 114 SER B CA  1 
ATOM   1999 C C   . SER B 1 97  ? 74.814  -81.185 13.244  1.00 72.37  ? 114 SER B C   1 
ATOM   2000 O O   . SER B 1 97  ? 74.107  -81.910 13.949  1.00 71.65  ? 114 SER B O   1 
ATOM   2001 C CB  . SER B 1 97  ? 75.526  -82.160 11.059  1.00 74.50  ? 114 SER B CB  1 
ATOM   2002 O OG  . SER B 1 97  ? 76.895  -81.802 11.203  1.00 77.41  ? 114 SER B OG  1 
ATOM   2003 N N   . THR B 1 98  ? 75.778  -80.433 13.752  1.00 71.48  ? 115 THR B N   1 
ATOM   2004 C CA  . THR B 1 98  ? 76.107  -80.505 15.162  1.00 68.93  ? 115 THR B CA  1 
ATOM   2005 C C   . THR B 1 98  ? 76.673  -79.180 15.644  1.00 66.72  ? 115 THR B C   1 
ATOM   2006 O O   . THR B 1 98  ? 77.247  -78.415 14.861  1.00 62.19  ? 115 THR B O   1 
ATOM   2007 C CB  . THR B 1 98  ? 77.119  -81.636 15.425  1.00 69.86  ? 115 THR B CB  1 
ATOM   2008 O OG1 . THR B 1 98  ? 77.382  -81.736 16.823  1.00 72.18  ? 115 THR B OG1 1 
ATOM   2009 C CG2 . THR B 1 98  ? 78.424  -81.372 14.717  1.00 70.20  ? 115 THR B CG2 1 
ATOM   2010 N N   . SER B 1 99  ? 76.477  -78.912 16.934  1.00 65.65  ? 116 SER B N   1 
ATOM   2011 C CA  . SER B 1 99  ? 77.075  -77.754 17.602  1.00 64.45  ? 116 SER B CA  1 
ATOM   2012 C C   . SER B 1 99  ? 77.573  -78.165 18.980  1.00 62.31  ? 116 SER B C   1 
ATOM   2013 O O   . SER B 1 99  ? 76.882  -78.897 19.693  1.00 63.94  ? 116 SER B O   1 
ATOM   2014 C CB  . SER B 1 99  ? 76.053  -76.633 17.738  1.00 63.25  ? 116 SER B CB  1 
ATOM   2015 O OG  . SER B 1 99  ? 76.696  -75.390 17.950  1.00 64.77  ? 116 SER B OG  1 
ATOM   2016 N N   . VAL B 1 100 ? 78.766  -77.716 19.352  1.00 60.78  ? 117 VAL B N   1 
ATOM   2017 C CA  . VAL B 1 100 ? 79.286  -77.984 20.704  1.00 60.96  ? 117 VAL B CA  1 
ATOM   2018 C C   . VAL B 1 100 ? 79.429  -76.652 21.435  1.00 60.28  ? 117 VAL B C   1 
ATOM   2019 O O   . VAL B 1 100 ? 80.071  -75.722 20.936  1.00 58.00  ? 117 VAL B O   1 
ATOM   2020 C CB  . VAL B 1 100 ? 80.575  -78.870 20.728  1.00 60.66  ? 117 VAL B CB  1 
ATOM   2021 C CG1 . VAL B 1 100 ? 81.104  -79.145 19.338  1.00 62.13  ? 117 VAL B CG1 1 
ATOM   2022 C CG2 . VAL B 1 100 ? 81.674  -78.279 21.601  1.00 61.39  ? 117 VAL B CG2 1 
ATOM   2023 N N   . GLU B 1 101 ? 78.798  -76.571 22.606  1.00 59.96  ? 118 GLU B N   1 
ATOM   2024 C CA  . GLU B 1 101 ? 78.562  -75.298 23.267  1.00 59.28  ? 118 GLU B CA  1 
ATOM   2025 C C   . GLU B 1 101 ? 78.777  -75.412 24.763  1.00 60.77  ? 118 GLU B C   1 
ATOM   2026 O O   . GLU B 1 101 ? 78.287  -76.346 25.389  1.00 62.86  ? 118 GLU B O   1 
ATOM   2027 C CB  . GLU B 1 101 ? 77.136  -74.835 22.992  1.00 55.98  ? 118 GLU B CB  1 
ATOM   2028 N N   . ILE B 1 102 ? 79.486  -74.435 25.321  1.00 61.29  ? 119 ILE B N   1 
ATOM   2029 C CA  . ILE B 1 102 ? 79.884  -74.419 26.722  1.00 61.50  ? 119 ILE B CA  1 
ATOM   2030 C C   . ILE B 1 102 ? 79.031  -73.423 27.477  1.00 61.74  ? 119 ILE B C   1 
ATOM   2031 O O   . ILE B 1 102 ? 78.790  -72.328 26.983  1.00 62.16  ? 119 ILE B O   1 
ATOM   2032 C CB  . ILE B 1 102 ? 81.365  -74.001 26.870  1.00 63.79  ? 119 ILE B CB  1 
ATOM   2033 C CG1 . ILE B 1 102 ? 81.887  -74.225 28.309  1.00 68.73  ? 119 ILE B CG1 1 
ATOM   2034 C CG2 . ILE B 1 102 ? 81.580  -72.548 26.454  1.00 62.22  ? 119 ILE B CG2 1 
ATOM   2035 C CD1 . ILE B 1 102 ? 82.334  -75.643 28.604  1.00 68.98  ? 119 ILE B CD1 1 
ATOM   2036 N N   . LEU B 1 103 ? 78.595  -73.795 28.681  1.00 63.74  ? 120 LEU B N   1 
ATOM   2037 C CA  . LEU B 1 103 ? 77.819  -72.887 29.547  1.00 63.84  ? 120 LEU B CA  1 
ATOM   2038 C C   . LEU B 1 103 ? 78.746  -71.898 30.233  1.00 63.12  ? 120 LEU B C   1 
ATOM   2039 O O   . LEU B 1 103 ? 79.802  -72.286 30.701  1.00 64.49  ? 120 LEU B O   1 
ATOM   2040 C CB  . LEU B 1 103 ? 77.041  -73.681 30.592  1.00 62.51  ? 120 LEU B CB  1 
ATOM   2041 C CG  . LEU B 1 103 ? 76.025  -72.932 31.451  1.00 63.13  ? 120 LEU B CG  1 
ATOM   2042 C CD1 . LEU B 1 103 ? 75.190  -71.926 30.665  1.00 63.43  ? 120 LEU B CD1 1 
ATOM   2043 C CD2 . LEU B 1 103 ? 75.124  -73.948 32.136  1.00 63.68  ? 120 LEU B CD2 1 
ATOM   2044 N N   . GLU B 1 104 ? 78.353  -70.626 30.276  1.00 63.67  ? 121 GLU B N   1 
ATOM   2045 C CA  . GLU B 1 104 ? 79.239  -69.547 30.731  1.00 63.82  ? 121 GLU B CA  1 
ATOM   2046 C C   . GLU B 1 104 ? 78.648  -68.617 31.767  1.00 64.20  ? 121 GLU B C   1 
ATOM   2047 O O   . GLU B 1 104 ? 79.374  -68.096 32.611  1.00 71.12  ? 121 GLU B O   1 
ATOM   2048 C CB  . GLU B 1 104 ? 79.682  -68.702 29.546  1.00 65.54  ? 121 GLU B CB  1 
ATOM   2049 C CG  . GLU B 1 104 ? 80.560  -69.466 28.572  1.00 67.89  ? 121 GLU B CG  1 
ATOM   2050 C CD  . GLU B 1 104 ? 81.417  -68.557 27.723  1.00 71.31  ? 121 GLU B CD  1 
ATOM   2051 O OE1 . GLU B 1 104 ? 81.026  -67.382 27.526  1.00 73.35  ? 121 GLU B OE1 1 
ATOM   2052 O OE2 . GLU B 1 104 ? 82.478  -69.024 27.249  1.00 75.45  ? 121 GLU B OE2 1 
ATOM   2053 N N   . VAL B 1 105 ? 77.352  -68.362 31.690  1.00 61.65  ? 122 VAL B N   1 
ATOM   2054 C CA  . VAL B 1 105 ? 76.691  -67.586 32.713  1.00 60.52  ? 122 VAL B CA  1 
ATOM   2055 C C   . VAL B 1 105 ? 75.396  -68.273 33.046  1.00 61.07  ? 122 VAL B C   1 
ATOM   2056 O O   . VAL B 1 105 ? 74.528  -68.382 32.192  1.00 62.56  ? 122 VAL B O   1 
ATOM   2057 C CB  . VAL B 1 105 ? 76.393  -66.152 32.252  1.00 60.14  ? 122 VAL B CB  1 
ATOM   2058 C CG1 . VAL B 1 105 ? 75.711  -65.364 33.364  1.00 60.54  ? 122 VAL B CG1 1 
ATOM   2059 C CG2 . VAL B 1 105 ? 77.674  -65.467 31.800  1.00 60.42  ? 122 VAL B CG2 1 
ATOM   2060 N N   . LEU B 1 106 ? 75.288  -68.751 34.282  1.00 61.48  ? 123 LEU B N   1 
ATOM   2061 C CA  . LEU B 1 106 ? 74.056  -69.317 34.801  1.00 59.08  ? 123 LEU B CA  1 
ATOM   2062 C C   . LEU B 1 106 ? 73.750  -68.588 36.102  1.00 60.35  ? 123 LEU B C   1 
ATOM   2063 O O   . LEU B 1 106 ? 74.338  -68.878 37.136  1.00 63.40  ? 123 LEU B O   1 
ATOM   2064 C CB  . LEU B 1 106 ? 74.199  -70.826 35.007  1.00 58.15  ? 123 LEU B CB  1 
ATOM   2065 C CG  . LEU B 1 106 ? 72.931  -71.567 35.451  1.00 59.11  ? 123 LEU B CG  1 
ATOM   2066 C CD1 . LEU B 1 106 ? 71.750  -71.257 34.535  1.00 60.64  ? 123 LEU B CD1 1 
ATOM   2067 C CD2 . LEU B 1 106 ? 73.169  -73.066 35.509  1.00 57.51  ? 123 LEU B CD2 1 
ATOM   2068 N N   . ASP B 1 107 ? 72.835  -67.625 36.019  1.00 61.13  ? 124 ASP B N   1 
ATOM   2069 C CA  . ASP B 1 107 ? 72.540  -66.683 37.087  1.00 60.79  ? 124 ASP B CA  1 
ATOM   2070 C C   . ASP B 1 107 ? 71.068  -66.821 37.454  1.00 60.74  ? 124 ASP B C   1 
ATOM   2071 O O   . ASP B 1 107 ? 70.208  -66.125 36.917  1.00 61.37  ? 124 ASP B O   1 
ATOM   2072 C CB  . ASP B 1 107 ? 72.864  -65.266 36.607  1.00 62.17  ? 124 ASP B CB  1 
ATOM   2073 C CG  . ASP B 1 107 ? 72.598  -64.187 37.662  1.00 64.99  ? 124 ASP B CG  1 
ATOM   2074 O OD1 . ASP B 1 107 ? 71.601  -64.269 38.419  1.00 64.43  ? 124 ASP B OD1 1 
ATOM   2075 O OD2 . ASP B 1 107 ? 73.385  -63.215 37.700  1.00 69.39  ? 124 ASP B OD2 1 
ATOM   2076 N N   . GLU B 1 108 ? 70.799  -67.712 38.401  1.00 61.38  ? 125 GLU B N   1 
ATOM   2077 C CA  . GLU B 1 108 ? 69.437  -68.061 38.815  1.00 60.30  ? 125 GLU B CA  1 
ATOM   2078 C C   . GLU B 1 108 ? 68.601  -66.885 39.323  1.00 60.31  ? 125 GLU B C   1 
ATOM   2079 O O   . GLU B 1 108 ? 67.375  -66.930 39.235  1.00 60.20  ? 125 GLU B O   1 
ATOM   2080 C CB  . GLU B 1 108 ? 69.488  -69.129 39.925  1.00 60.84  ? 125 GLU B CB  1 
ATOM   2081 C CG  . GLU B 1 108 ? 70.063  -70.485 39.525  1.00 60.10  ? 125 GLU B CG  1 
ATOM   2082 C CD  . GLU B 1 108 ? 69.151  -71.299 38.608  1.00 61.02  ? 125 GLU B CD  1 
ATOM   2083 O OE1 . GLU B 1 108 ? 69.636  -72.331 38.087  1.00 60.73  ? 125 GLU B OE1 1 
ATOM   2084 O OE2 . GLU B 1 108 ? 67.962  -70.933 38.399  1.00 60.41  ? 125 GLU B OE2 1 
ATOM   2085 N N   . GLU B 1 109 ? 69.247  -65.864 39.889  1.00 62.46  ? 126 GLU B N   1 
ATOM   2086 C CA  . GLU B 1 109 ? 68.533  -64.736 40.523  1.00 64.30  ? 126 GLU B CA  1 
ATOM   2087 C C   . GLU B 1 109 ? 68.211  -63.639 39.511  1.00 64.65  ? 126 GLU B C   1 
ATOM   2088 O O   . GLU B 1 109 ? 67.082  -63.138 39.459  1.00 62.19  ? 126 GLU B O   1 
ATOM   2089 C CB  . GLU B 1 109 ? 69.355  -64.157 41.682  1.00 67.04  ? 126 GLU B CB  1 
ATOM   2090 N N   . LYS B 1 110 ? 69.211  -63.263 38.714  1.00 64.05  ? 127 LYS B N   1 
ATOM   2091 C CA  . LYS B 1 110 ? 68.985  -62.368 37.588  1.00 65.47  ? 127 LYS B CA  1 
ATOM   2092 C C   . LYS B 1 110 ? 68.257  -63.091 36.437  1.00 63.94  ? 127 LYS B C   1 
ATOM   2093 O O   . LYS B 1 110 ? 67.657  -62.439 35.579  1.00 61.03  ? 127 LYS B O   1 
ATOM   2094 C CB  . LYS B 1 110 ? 70.306  -61.781 37.073  1.00 66.76  ? 127 LYS B CB  1 
ATOM   2095 C CG  . LYS B 1 110 ? 71.091  -60.960 38.079  1.00 67.99  ? 127 LYS B CG  1 
ATOM   2096 N N   . ARG B 1 111 ? 68.320  -64.426 36.430  1.00 63.70  ? 128 ARG B N   1 
ATOM   2097 C CA  . ARG B 1 111 ? 67.671  -65.280 35.407  1.00 63.33  ? 128 ARG B CA  1 
ATOM   2098 C C   . ARG B 1 111 ? 68.284  -65.036 34.048  1.00 62.14  ? 128 ARG B C   1 
ATOM   2099 O O   . ARG B 1 111 ? 67.616  -64.601 33.118  1.00 60.69  ? 128 ARG B O   1 
ATOM   2100 C CB  . ARG B 1 111 ? 66.165  -65.056 35.328  1.00 63.13  ? 128 ARG B CB  1 
ATOM   2101 C CG  . ARG B 1 111 ? 65.434  -65.349 36.610  1.00 63.80  ? 128 ARG B CG  1 
ATOM   2102 C CD  . ARG B 1 111 ? 63.990  -65.681 36.314  1.00 64.90  ? 128 ARG B CD  1 
ATOM   2103 N NE  . ARG B 1 111 ? 63.268  -66.055 37.525  1.00 63.64  ? 128 ARG B NE  1 
ATOM   2104 C CZ  . ARG B 1 111 ? 62.584  -65.216 38.293  1.00 59.27  ? 128 ARG B CZ  1 
ATOM   2105 N NH1 . ARG B 1 111 ? 62.501  -63.924 37.997  1.00 55.81  ? 128 ARG B NH1 1 
ATOM   2106 N NH2 . ARG B 1 111 ? 61.977  -65.691 39.368  1.00 60.79  ? 128 ARG B NH2 1 
ATOM   2107 N N   . ILE B 1 112 ? 69.571  -65.314 33.953  1.00 62.09  ? 129 ILE B N   1 
ATOM   2108 C CA  . ILE B 1 112 ? 70.321  -64.985 32.776  1.00 61.65  ? 129 ILE B CA  1 
ATOM   2109 C C   . ILE B 1 112 ? 71.153  -66.185 32.424  1.00 60.60  ? 129 ILE B C   1 
ATOM   2110 O O   . ILE B 1 112 ? 71.946  -66.636 33.243  1.00 61.76  ? 129 ILE B O   1 
ATOM   2111 C CB  . ILE B 1 112 ? 71.251  -63.780 33.029  1.00 64.38  ? 129 ILE B CB  1 
ATOM   2112 C CG1 . ILE B 1 112 ? 70.432  -62.543 33.419  1.00 64.67  ? 129 ILE B CG1 1 
ATOM   2113 C CG2 . ILE B 1 112 ? 72.084  -63.473 31.789  1.00 65.69  ? 129 ILE B CG2 1 
ATOM   2114 C CD1 . ILE B 1 112 ? 71.268  -61.295 33.614  1.00 65.18  ? 129 ILE B CD1 1 
ATOM   2115 N N   . LEU B 1 113 ? 70.969  -66.707 31.212  1.00 58.46  ? 130 LEU B N   1 
ATOM   2116 C CA  . LEU B 1 113 ? 71.864  -67.738 30.687  1.00 56.25  ? 130 LEU B CA  1 
ATOM   2117 C C   . LEU B 1 113 ? 72.809  -67.114 29.667  1.00 54.49  ? 130 LEU B C   1 
ATOM   2118 O O   . LEU B 1 113 ? 72.509  -66.052 29.118  1.00 51.76  ? 130 LEU B O   1 
ATOM   2119 C CB  . LEU B 1 113 ? 71.071  -68.868 30.058  1.00 55.22  ? 130 LEU B CB  1 
ATOM   2120 C CG  . LEU B 1 113 ? 71.794  -70.205 29.918  1.00 55.22  ? 130 LEU B CG  1 
ATOM   2121 C CD1 . LEU B 1 113 ? 70.820  -71.332 30.153  1.00 56.14  ? 130 LEU B CD1 1 
ATOM   2122 C CD2 . LEU B 1 113 ? 72.419  -70.394 28.555  1.00 56.31  ? 130 LEU B CD2 1 
ATOM   2123 N N   . SER B 1 114 ? 73.963  -67.751 29.460  1.00 53.65  ? 131 SER B N   1 
ATOM   2124 C CA  . SER B 1 114 ? 74.829  -67.435 28.320  1.00 55.04  ? 131 SER B CA  1 
ATOM   2125 C C   . SER B 1 114 ? 75.699  -68.623 27.911  1.00 56.39  ? 131 SER B C   1 
ATOM   2126 O O   . SER B 1 114 ? 76.238  -69.321 28.765  1.00 60.61  ? 131 SER B O   1 
ATOM   2127 C CB  . SER B 1 114 ? 75.708  -66.231 28.621  1.00 55.37  ? 131 SER B CB  1 
ATOM   2128 O OG  . SER B 1 114 ? 76.643  -66.010 27.583  1.00 55.83  ? 131 SER B OG  1 
ATOM   2129 N N   . PHE B 1 115 ? 75.826  -68.854 26.606  1.00 56.46  ? 132 PHE B N   1 
ATOM   2130 C CA  . PHE B 1 115 ? 76.722  -69.894 26.103  1.00 58.20  ? 132 PHE B CA  1 
ATOM   2131 C C   . PHE B 1 115 ? 77.534  -69.454 24.882  1.00 57.48  ? 132 PHE B C   1 
ATOM   2132 O O   . PHE B 1 115 ? 77.240  -68.435 24.245  1.00 55.71  ? 132 PHE B O   1 
ATOM   2133 C CB  . PHE B 1 115 ? 75.959  -71.187 25.813  1.00 59.46  ? 132 PHE B CB  1 
ATOM   2134 C CG  . PHE B 1 115 ? 75.173  -71.166 24.534  1.00 62.79  ? 132 PHE B CG  1 
ATOM   2135 C CD1 . PHE B 1 115 ? 73.906  -70.592 24.488  1.00 62.53  ? 132 PHE B CD1 1 
ATOM   2136 C CD2 . PHE B 1 115 ? 75.689  -71.745 23.376  1.00 64.10  ? 132 PHE B CD2 1 
ATOM   2137 C CE1 . PHE B 1 115 ? 73.182  -70.580 23.310  1.00 61.27  ? 132 PHE B CE1 1 
ATOM   2138 C CE2 . PHE B 1 115 ? 74.965  -71.740 22.199  1.00 63.29  ? 132 PHE B CE2 1 
ATOM   2139 C CZ  . PHE B 1 115 ? 73.711  -71.159 22.168  1.00 63.43  ? 132 PHE B CZ  1 
ATOM   2140 N N   . ARG B 1 116 ? 78.567  -70.242 24.596  1.00 56.08  ? 133 ARG B N   1 
ATOM   2141 C CA  . ARG B 1 116 ? 79.531  -69.964 23.552  1.00 56.02  ? 133 ARG B CA  1 
ATOM   2142 C C   . ARG B 1 116 ? 79.698  -71.252 22.785  1.00 56.67  ? 133 ARG B C   1 
ATOM   2143 O O   . ARG B 1 116 ? 79.706  -72.321 23.382  1.00 56.02  ? 133 ARG B O   1 
ATOM   2144 C CB  . ARG B 1 116 ? 80.897  -69.567 24.157  1.00 57.43  ? 133 ARG B CB  1 
ATOM   2145 N N   . VAL B 1 117 ? 79.849  -71.147 21.470  1.00 58.84  ? 134 VAL B N   1 
ATOM   2146 C CA  . VAL B 1 117 ? 80.068  -72.308 20.618  1.00 61.27  ? 134 VAL B CA  1 
ATOM   2147 C C   . VAL B 1 117 ? 81.564  -72.548 20.496  1.00 63.34  ? 134 VAL B C   1 
ATOM   2148 O O   . VAL B 1 117 ? 82.346  -71.605 20.387  1.00 65.30  ? 134 VAL B O   1 
ATOM   2149 C CB  . VAL B 1 117 ? 79.427  -72.105 19.227  1.00 63.65  ? 134 VAL B CB  1 
ATOM   2150 C CG1 . VAL B 1 117 ? 79.853  -73.197 18.255  1.00 64.22  ? 134 VAL B CG1 1 
ATOM   2151 C CG2 . VAL B 1 117 ? 77.906  -72.065 19.358  1.00 64.08  ? 134 VAL B CG2 1 
ATOM   2152 N N   . LEU B 1 118 ? 81.951  -73.819 20.515  1.00 65.72  ? 135 LEU B N   1 
ATOM   2153 C CA  . LEU B 1 118 ? 83.363  -74.217 20.600  1.00 67.61  ? 135 LEU B CA  1 
ATOM   2154 C C   . LEU B 1 118 ? 83.810  -74.995 19.380  1.00 67.85  ? 135 LEU B C   1 
ATOM   2155 O O   . LEU B 1 118 ? 84.998  -75.319 19.240  1.00 67.53  ? 135 LEU B O   1 
ATOM   2156 C CB  . LEU B 1 118 ? 83.582  -75.075 21.863  1.00 66.61  ? 135 LEU B CB  1 
ATOM   2157 C CG  . LEU B 1 118 ? 84.121  -74.447 23.158  1.00 66.47  ? 135 LEU B CG  1 
ATOM   2158 C CD1 . LEU B 1 118 ? 83.886  -72.948 23.319  1.00 64.83  ? 135 LEU B CD1 1 
ATOM   2159 C CD2 . LEU B 1 118 ? 83.527  -75.211 24.324  1.00 67.08  ? 135 LEU B CD2 1 
ATOM   2160 N N   . GLY B 1 119 ? 82.854  -75.293 18.506  1.00 69.85  ? 136 GLY B N   1 
ATOM   2161 C CA  . GLY B 1 119 ? 83.095  -76.110 17.318  1.00 72.12  ? 136 GLY B CA  1 
ATOM   2162 C C   . GLY B 1 119 ? 81.815  -76.791 16.865  1.00 71.89  ? 136 GLY B C   1 
ATOM   2163 O O   . GLY B 1 119 ? 80.715  -76.441 17.317  1.00 69.31  ? 136 GLY B O   1 
ATOM   2164 N N   . GLY B 1 120 ? 81.976  -77.791 16.003  1.00 73.71  ? 137 GLY B N   1 
ATOM   2165 C CA  . GLY B 1 120 ? 80.864  -78.468 15.338  1.00 74.04  ? 137 GLY B CA  1 
ATOM   2166 C C   . GLY B 1 120 ? 80.817  -78.095 13.860  1.00 77.32  ? 137 GLY B C   1 
ATOM   2167 O O   . GLY B 1 120 ? 81.346  -77.050 13.453  1.00 75.22  ? 137 GLY B O   1 
ATOM   2168 N N   . GLU B 1 121 ? 80.190  -78.959 13.059  1.00 78.87  ? 138 GLU B N   1 
ATOM   2169 C CA  . GLU B 1 121 ? 79.951  -78.707 11.636  1.00 78.45  ? 138 GLU B CA  1 
ATOM   2170 C C   . GLU B 1 121 ? 78.728  -77.796 11.430  1.00 78.20  ? 138 GLU B C   1 
ATOM   2171 O O   . GLU B 1 121 ? 77.572  -78.253 11.504  1.00 74.67  ? 138 GLU B O   1 
ATOM   2172 C CB  . GLU B 1 121 ? 79.761  -80.033 10.886  1.00 78.97  ? 138 GLU B CB  1 
ATOM   2173 N N   . HIS B 1 122 ? 79.011  -76.509 11.192  1.00 78.29  ? 139 HIS B N   1 
ATOM   2174 C CA  . HIS B 1 122 ? 78.007  -75.486 10.849  1.00 77.96  ? 139 HIS B CA  1 
ATOM   2175 C C   . HIS B 1 122 ? 78.721  -74.181 10.425  1.00 76.16  ? 139 HIS B C   1 
ATOM   2176 O O   . HIS B 1 122 ? 79.937  -74.181 10.300  1.00 83.20  ? 139 HIS B O   1 
ATOM   2177 C CB  . HIS B 1 122 ? 77.073  -75.250 12.030  1.00 75.93  ? 139 HIS B CB  1 
ATOM   2178 C CG  . HIS B 1 122 ? 77.763  -74.688 13.223  1.00 76.74  ? 139 HIS B CG  1 
ATOM   2179 N ND1 . HIS B 1 122 ? 78.540  -75.454 14.063  1.00 78.54  ? 139 HIS B ND1 1 
ATOM   2180 C CD2 . HIS B 1 122 ? 77.808  -73.429 13.708  1.00 76.31  ? 139 HIS B CD2 1 
ATOM   2181 C CE1 . HIS B 1 122 ? 79.030  -74.689 15.019  1.00 80.17  ? 139 HIS B CE1 1 
ATOM   2182 N NE2 . HIS B 1 122 ? 78.602  -73.454 14.825  1.00 80.05  ? 139 HIS B NE2 1 
ATOM   2183 N N   . ARG B 1 123 ? 77.994  -73.085 10.197  1.00 76.18  ? 140 ARG B N   1 
ATOM   2184 C CA  . ARG B 1 123 ? 78.620  -71.831 9.736   1.00 79.32  ? 140 ARG B CA  1 
ATOM   2185 C C   . ARG B 1 123 ? 78.290  -70.614 10.610  1.00 78.78  ? 140 ARG B C   1 
ATOM   2186 O O   . ARG B 1 123 ? 77.924  -69.550 10.114  1.00 83.48  ? 140 ARG B O   1 
ATOM   2187 C CB  . ARG B 1 123 ? 78.265  -71.561 8.266   1.00 83.39  ? 140 ARG B CB  1 
ATOM   2188 C CG  . ARG B 1 123 ? 79.341  -72.005 7.275   1.00 87.20  ? 140 ARG B CG  1 
ATOM   2189 C CD  . ARG B 1 123 ? 78.957  -71.706 5.825   1.00 86.25  ? 140 ARG B CD  1 
ATOM   2190 N N   . LEU B 1 124 ? 78.461  -70.780 11.913  1.00 75.81  ? 141 LEU B N   1 
ATOM   2191 C CA  . LEU B 1 124 ? 78.239  -69.719 12.896  1.00 74.95  ? 141 LEU B CA  1 
ATOM   2192 C C   . LEU B 1 124 ? 79.351  -69.833 13.929  1.00 76.63  ? 141 LEU B C   1 
ATOM   2193 O O   . LEU B 1 124 ? 79.109  -70.003 15.129  1.00 72.77  ? 141 LEU B O   1 
ATOM   2194 C CB  . LEU B 1 124 ? 76.866  -69.862 13.562  1.00 74.19  ? 141 LEU B CB  1 
ATOM   2195 C CG  . LEU B 1 124 ? 75.644  -69.643 12.669  1.00 74.51  ? 141 LEU B CG  1 
ATOM   2196 C CD1 . LEU B 1 124 ? 74.346  -69.977 13.392  1.00 73.42  ? 141 LEU B CD1 1 
ATOM   2197 C CD2 . LEU B 1 124 ? 75.603  -68.206 12.168  1.00 74.93  ? 141 LEU B CD2 1 
ATOM   2198 N N   . ASN B 1 125 ? 80.584  -69.752 13.436  1.00 78.61  ? 142 ASN B N   1 
ATOM   2199 C CA  . ASN B 1 125 ? 81.763  -69.993 14.253  1.00 75.14  ? 142 ASN B CA  1 
ATOM   2200 C C   . ASN B 1 125 ? 81.937  -68.926 15.316  1.00 71.83  ? 142 ASN B C   1 
ATOM   2201 O O   . ASN B 1 125 ? 81.706  -67.744 15.063  1.00 67.67  ? 142 ASN B O   1 
ATOM   2202 C CB  . ASN B 1 125 ? 83.004  -70.094 13.367  1.00 80.03  ? 142 ASN B CB  1 
ATOM   2203 C CG  . ASN B 1 125 ? 83.057  -71.406 12.598  1.00 85.78  ? 142 ASN B CG  1 
ATOM   2204 O OD1 . ASN B 1 125 ? 82.929  -71.442 11.362  1.00 82.23  ? 142 ASN B OD1 1 
ATOM   2205 N ND2 . ASN B 1 125 ? 83.228  -72.504 13.337  1.00 87.56  ? 142 ASN B ND2 1 
ATOM   2206 N N   . ASN B 1 126 ? 82.324  -69.369 16.514  1.00 70.92  ? 143 ASN B N   1 
ATOM   2207 C CA  . ASN B 1 126 ? 82.504  -68.488 17.659  1.00 70.42  ? 143 ASN B CA  1 
ATOM   2208 C C   . ASN B 1 126 ? 81.236  -67.710 17.982  1.00 65.80  ? 143 ASN B C   1 
ATOM   2209 O O   . ASN B 1 126 ? 81.288  -66.561 18.405  1.00 64.23  ? 143 ASN B O   1 
ATOM   2210 C CB  . ASN B 1 126 ? 83.693  -67.543 17.430  1.00 74.41  ? 143 ASN B CB  1 
ATOM   2211 C CG  . ASN B 1 126 ? 84.966  -68.291 17.081  1.00 76.25  ? 143 ASN B CG  1 
ATOM   2212 O OD1 . ASN B 1 126 ? 85.573  -68.937 17.934  1.00 78.22  ? 143 ASN B OD1 1 
ATOM   2213 N ND2 . ASN B 1 126 ? 85.368  -68.221 15.815  1.00 79.13  ? 143 ASN B ND2 1 
ATOM   2214 N N   . TYR B 1 127 ? 80.096  -68.356 17.783  0.50 64.28  ? 144 TYR B N   1 
ATOM   2215 C CA  . TYR B 1 127 ? 78.823  -67.786 18.165  1.00 63.84  ? 144 TYR B CA  1 
ATOM   2216 C C   . TYR B 1 127 ? 78.749  -67.718 19.673  1.00 64.49  ? 144 TYR B C   1 
ATOM   2217 O O   . TYR B 1 127 ? 79.070  -68.692 20.357  1.00 66.40  ? 144 TYR B O   1 
ATOM   2218 C CB  . TYR B 1 127 ? 77.689  -68.672 17.670  1.00 63.34  ? 144 TYR B CB  1 
ATOM   2219 C CG  . TYR B 1 127 ? 76.309  -68.217 18.081  1.00 61.57  ? 144 TYR B CG  1 
ATOM   2220 C CD1 . TYR B 1 127 ? 75.612  -67.292 17.322  1.00 60.36  ? 144 TYR B CD1 1 
ATOM   2221 C CD2 . TYR B 1 127 ? 75.686  -68.739 19.208  1.00 61.53  ? 144 TYR B CD2 1 
ATOM   2222 C CE1 . TYR B 1 127 ? 74.341  -66.884 17.676  1.00 58.80  ? 144 TYR B CE1 1 
ATOM   2223 C CE2 . TYR B 1 127 ? 74.409  -68.338 19.563  1.00 59.07  ? 144 TYR B CE2 1 
ATOM   2224 C CZ  . TYR B 1 127 ? 73.752  -67.405 18.793  1.00 57.10  ? 144 TYR B CZ  1 
ATOM   2225 O OH  . TYR B 1 127 ? 72.498  -66.996 19.139  1.00 56.39  ? 144 TYR B OH  1 
ATOM   2226 N N   . ARG B 1 128 ? 78.337  -66.577 20.203  1.00 62.81  ? 145 ARG B N   1 
ATOM   2227 C CA  . ARG B 1 128 ? 78.076  -66.493 21.631  1.00 63.22  ? 145 ARG B CA  1 
ATOM   2228 C C   . ARG B 1 128 ? 76.805  -65.707 21.814  1.00 62.51  ? 145 ARG B C   1 
ATOM   2229 O O   . ARG B 1 128 ? 76.497  -64.814 21.025  1.00 62.17  ? 145 ARG B O   1 
ATOM   2230 C CB  . ARG B 1 128 ? 79.247  -65.864 22.407  1.00 63.91  ? 145 ARG B CB  1 
ATOM   2231 N N   . SER B 1 129 ? 76.078  -66.053 22.870  1.00 62.71  ? 146 SER B N   1 
ATOM   2232 C CA  . SER B 1 129 ? 74.746  -65.525 23.114  1.00 59.01  ? 146 SER B CA  1 
ATOM   2233 C C   . SER B 1 129 ? 74.485  -65.286 24.596  1.00 59.08  ? 146 SER B C   1 
ATOM   2234 O O   . SER B 1 129 ? 75.078  -65.934 25.468  1.00 54.82  ? 146 SER B O   1 
ATOM   2235 C CB  . SER B 1 129 ? 73.713  -66.516 22.618  1.00 56.83  ? 146 SER B CB  1 
ATOM   2236 O OG  . SER B 1 129 ? 72.451  -66.192 23.156  1.00 56.93  ? 146 SER B OG  1 
ATOM   2237 N N   . VAL B 1 130 ? 73.568  -64.361 24.863  1.00 59.07  ? 147 VAL B N   1 
ATOM   2238 C CA  . VAL B 1 130 ? 73.157  -64.059 26.217  1.00 60.77  ? 147 VAL B CA  1 
ATOM   2239 C C   . VAL B 1 130 ? 71.640  -63.876 26.256  1.00 61.49  ? 147 VAL B C   1 
ATOM   2240 O O   . VAL B 1 130 ? 71.101  -63.060 25.505  1.00 64.55  ? 147 VAL B O   1 
ATOM   2241 C CB  . VAL B 1 130 ? 73.846  -62.781 26.728  1.00 62.12  ? 147 VAL B CB  1 
ATOM   2242 C CG1 . VAL B 1 130 ? 73.324  -62.418 28.121  1.00 63.17  ? 147 VAL B CG1 1 
ATOM   2243 C CG2 . VAL B 1 130 ? 75.364  -62.955 26.740  1.00 59.82  ? 147 VAL B CG2 1 
ATOM   2244 N N   . THR B 1 131 ? 70.967  -64.637 27.124  1.00 59.01  ? 148 THR B N   1 
ATOM   2245 C CA  . THR B 1 131 ? 69.513  -64.556 27.289  1.00 59.61  ? 148 THR B CA  1 
ATOM   2246 C C   . THR B 1 131 ? 69.101  -64.177 28.731  1.00 60.63  ? 148 THR B C   1 
ATOM   2247 O O   . THR B 1 131 ? 69.730  -64.604 29.691  1.00 63.65  ? 148 THR B O   1 
ATOM   2248 C CB  . THR B 1 131 ? 68.859  -65.902 26.952  1.00 58.97  ? 148 THR B CB  1 
ATOM   2249 O OG1 . THR B 1 131 ? 69.534  -66.503 25.847  1.00 61.55  ? 148 THR B OG1 1 
ATOM   2250 C CG2 . THR B 1 131 ? 67.419  -65.718 26.598  1.00 60.37  ? 148 THR B CG2 1 
ATOM   2251 N N   . SER B 1 132 ? 68.025  -63.410 28.869  1.00 58.95  ? 149 SER B N   1 
ATOM   2252 C CA  . SER B 1 132 ? 67.563  -62.952 30.159  1.00 58.50  ? 149 SER B CA  1 
ATOM   2253 C C   . SER B 1 132 ? 66.047  -62.837 30.204  1.00 59.10  ? 149 SER B C   1 
ATOM   2254 O O   . SER B 1 132 ? 65.448  -62.261 29.314  1.00 57.94  ? 149 SER B O   1 
ATOM   2255 C CB  . SER B 1 132 ? 68.171  -61.585 30.462  1.00 61.17  ? 149 SER B CB  1 
ATOM   2256 O OG  . SER B 1 132 ? 67.522  -60.546 29.744  1.00 61.18  ? 149 SER B OG  1 
ATOM   2257 N N   . VAL B 1 133 ? 65.431  -63.359 31.261  1.00 61.40  ? 150 VAL B N   1 
ATOM   2258 C CA  . VAL B 1 133 ? 63.986  -63.268 31.429  1.00 62.52  ? 150 VAL B CA  1 
ATOM   2259 C C   . VAL B 1 133 ? 63.664  -62.167 32.427  1.00 64.80  ? 150 VAL B C   1 
ATOM   2260 O O   . VAL B 1 133 ? 64.106  -62.225 33.567  1.00 72.78  ? 150 VAL B O   1 
ATOM   2261 C CB  . VAL B 1 133 ? 63.414  -64.598 31.937  1.00 62.39  ? 150 VAL B CB  1 
ATOM   2262 C CG1 . VAL B 1 133 ? 61.892  -64.537 31.997  1.00 64.68  ? 150 VAL B CG1 1 
ATOM   2263 C CG2 . VAL B 1 133 ? 63.870  -65.743 31.050  1.00 61.07  ? 150 VAL B CG2 1 
ATOM   2264 N N   . ASN B 1 134 ? 62.883  -61.178 32.011  1.00 65.86  ? 151 ASN B N   1 
ATOM   2265 C CA  . ASN B 1 134 ? 62.609  -60.004 32.837  1.00 67.75  ? 151 ASN B CA  1 
ATOM   2266 C C   . ASN B 1 134 ? 61.132  -59.803 33.044  1.00 67.60  ? 151 ASN B C   1 
ATOM   2267 O O   . ASN B 1 134 ? 60.417  -59.536 32.096  1.00 67.21  ? 151 ASN B O   1 
ATOM   2268 C CB  . ASN B 1 134 ? 63.170  -58.756 32.174  1.00 69.48  ? 151 ASN B CB  1 
ATOM   2269 C CG  . ASN B 1 134 ? 64.674  -58.776 32.089  1.00 71.02  ? 151 ASN B CG  1 
ATOM   2270 O OD1 . ASN B 1 134 ? 65.363  -58.540 33.086  1.00 69.46  ? 151 ASN B OD1 1 
ATOM   2271 N ND2 . ASN B 1 134 ? 65.197  -59.058 30.893  1.00 71.82  ? 151 ASN B ND2 1 
ATOM   2272 N N   . GLU B 1 135 ? 60.691  -59.894 34.295  1.00 72.70  ? 152 GLU B N   1 
ATOM   2273 C CA  . GLU B 1 135 ? 59.270  -59.852 34.624  1.00 74.88  ? 152 GLU B CA  1 
ATOM   2274 C C   . GLU B 1 135 ? 58.764  -58.428 34.831  1.00 74.67  ? 152 GLU B C   1 
ATOM   2275 O O   . GLU B 1 135 ? 59.479  -57.573 35.353  1.00 76.09  ? 152 GLU B O   1 
ATOM   2276 C CB  . GLU B 1 135 ? 59.002  -60.674 35.876  1.00 77.30  ? 152 GLU B CB  1 
ATOM   2277 C CG  . GLU B 1 135 ? 57.532  -60.926 36.127  1.00 80.46  ? 152 GLU B CG  1 
ATOM   2278 C CD  . GLU B 1 135 ? 57.320  -61.942 37.221  1.00 86.12  ? 152 GLU B CD  1 
ATOM   2279 O OE1 . GLU B 1 135 ? 57.437  -61.567 38.416  1.00 89.90  ? 152 GLU B OE1 1 
ATOM   2280 O OE2 . GLU B 1 135 ? 57.046  -63.114 36.874  1.00 85.70  ? 152 GLU B OE2 1 
ATOM   2281 N N   . PHE B 1 136 ? 57.512  -58.203 34.445  1.00 72.99  ? 153 PHE B N   1 
ATOM   2282 C CA  . PHE B 1 136 ? 56.893  -56.889 34.496  1.00 75.69  ? 153 PHE B CA  1 
ATOM   2283 C C   . PHE B 1 136 ? 55.543  -56.969 35.181  1.00 77.87  ? 153 PHE B C   1 
ATOM   2284 O O   . PHE B 1 136 ? 54.667  -57.706 34.729  1.00 78.68  ? 153 PHE B O   1 
ATOM   2285 C CB  . PHE B 1 136 ? 56.713  -56.341 33.077  1.00 76.33  ? 153 PHE B CB  1 
ATOM   2286 C CG  . PHE B 1 136 ? 57.983  -55.819 32.472  1.00 75.02  ? 153 PHE B CG  1 
ATOM   2287 C CD1 . PHE B 1 136 ? 58.870  -56.680 31.844  1.00 74.86  ? 153 PHE B CD1 1 
ATOM   2288 C CD2 . PHE B 1 136 ? 58.300  -54.473 32.556  1.00 73.20  ? 153 PHE B CD2 1 
ATOM   2289 C CE1 . PHE B 1 136 ? 60.045  -56.204 31.297  1.00 74.22  ? 153 PHE B CE1 1 
ATOM   2290 C CE2 . PHE B 1 136 ? 59.472  -53.991 32.018  1.00 74.03  ? 153 PHE B CE2 1 
ATOM   2291 C CZ  . PHE B 1 136 ? 60.346  -54.856 31.386  1.00 74.66  ? 153 PHE B CZ  1 
ATOM   2292 N N   . VAL B 1 137 ? 55.380  -56.202 36.259  1.00 80.37  ? 154 VAL B N   1 
ATOM   2293 C CA  . VAL B 1 137 ? 54.139  -56.197 37.036  1.00 84.43  ? 154 VAL B CA  1 
ATOM   2294 C C   . VAL B 1 137 ? 53.296  -54.977 36.683  1.00 86.74  ? 154 VAL B C   1 
ATOM   2295 O O   . VAL B 1 137 ? 53.741  -53.845 36.876  1.00 86.39  ? 154 VAL B O   1 
ATOM   2296 C CB  . VAL B 1 137 ? 54.423  -56.178 38.554  1.00 83.40  ? 154 VAL B CB  1 
ATOM   2297 N N   . VAL B 1 138 ? 52.081  -55.218 36.182  1.00 91.19  ? 155 VAL B N   1 
ATOM   2298 C CA  . VAL B 1 138 ? 51.130  -54.149 35.812  1.00 94.58  ? 155 VAL B CA  1 
ATOM   2299 C C   . VAL B 1 138 ? 50.044  -53.949 36.885  1.00 95.35  ? 155 VAL B C   1 
ATOM   2300 O O   . VAL B 1 138 ? 49.624  -52.818 37.167  1.00 94.31  ? 155 VAL B O   1 
ATOM   2301 C CB  . VAL B 1 138 ? 50.470  -54.450 34.444  1.00 90.33  ? 155 VAL B CB  1 
ATOM   2302 C CG1 . VAL B 1 138 ? 49.399  -53.419 34.102  1.00 90.18  ? 155 VAL B CG1 1 
ATOM   2303 C CG2 . VAL B 1 138 ? 51.531  -54.492 33.364  1.00 88.98  ? 155 VAL B CG2 1 
ATOM   2304 N N   . VAL B 1 147 ? 50.798  -59.655 35.393  1.00 77.28  ? 164 VAL B N   1 
ATOM   2305 C CA  . VAL B 1 147 ? 52.018  -60.452 35.253  1.00 77.18  ? 164 VAL B CA  1 
ATOM   2306 C C   . VAL B 1 147 ? 52.391  -60.754 33.797  1.00 73.91  ? 164 VAL B C   1 
ATOM   2307 O O   . VAL B 1 147 ? 51.601  -61.341 33.057  1.00 75.33  ? 164 VAL B O   1 
ATOM   2308 C CB  . VAL B 1 147 ? 51.890  -61.800 35.992  1.00 79.93  ? 164 VAL B CB  1 
ATOM   2309 C CG2 . VAL B 1 147 ? 50.634  -62.563 35.559  1.00 79.91  ? 164 VAL B CG2 1 
ATOM   2310 N N   . TYR B 1 148 ? 53.593  -60.352 33.390  1.00 70.16  ? 165 TYR B N   1 
ATOM   2311 C CA  . TYR B 1 148 ? 54.181  -60.834 32.135  1.00 68.12  ? 165 TYR B CA  1 
ATOM   2312 C C   . TYR B 1 148 ? 55.686  -60.582 32.094  1.00 66.89  ? 165 TYR B C   1 
ATOM   2313 O O   . TYR B 1 148 ? 56.176  -59.714 32.809  1.00 70.59  ? 165 TYR B O   1 
ATOM   2314 C CB  . TYR B 1 148 ? 53.507  -60.184 30.932  1.00 68.12  ? 165 TYR B CB  1 
ATOM   2315 C CG  . TYR B 1 148 ? 53.904  -58.747 30.669  1.00 67.62  ? 165 TYR B CG  1 
ATOM   2316 C CD1 . TYR B 1 148 ? 53.215  -57.697 31.257  1.00 66.14  ? 165 TYR B CD1 1 
ATOM   2317 C CD2 . TYR B 1 148 ? 54.951  -58.441 29.795  1.00 67.57  ? 165 TYR B CD2 1 
ATOM   2318 C CE1 . TYR B 1 148 ? 53.568  -56.386 31.006  1.00 66.11  ? 165 TYR B CE1 1 
ATOM   2319 C CE2 . TYR B 1 148 ? 55.309  -57.130 29.536  1.00 65.94  ? 165 TYR B CE2 1 
ATOM   2320 C CZ  . TYR B 1 148 ? 54.614  -56.110 30.147  1.00 66.34  ? 165 TYR B CZ  1 
ATOM   2321 O OH  . TYR B 1 148 ? 54.964  -54.806 29.904  1.00 66.90  ? 165 TYR B OH  1 
ATOM   2322 N N   . SER B 1 149 ? 56.412  -61.337 31.263  1.00 63.34  ? 166 SER B N   1 
ATOM   2323 C CA  . SER B 1 149 ? 57.857  -61.141 31.108  1.00 60.77  ? 166 SER B CA  1 
ATOM   2324 C C   . SER B 1 149 ? 58.239  -60.705 29.687  1.00 58.90  ? 166 SER B C   1 
ATOM   2325 O O   . SER B 1 149 ? 57.446  -60.822 28.754  1.00 54.97  ? 166 SER B O   1 
ATOM   2326 C CB  . SER B 1 149 ? 58.654  -62.406 31.462  1.00 59.60  ? 166 SER B CB  1 
ATOM   2327 O OG  . SER B 1 149 ? 57.917  -63.309 32.247  1.00 59.46  ? 166 SER B OG  1 
ATOM   2328 N N   . VAL B 1 150 ? 59.464  -60.193 29.569  1.00 56.12  ? 167 VAL B N   1 
ATOM   2329 C CA  . VAL B 1 150 ? 60.114  -59.947 28.295  1.00 57.32  ? 167 VAL B CA  1 
ATOM   2330 C C   . VAL B 1 150 ? 61.402  -60.755 28.299  1.00 59.64  ? 167 VAL B C   1 
ATOM   2331 O O   . VAL B 1 150 ? 62.163  -60.682 29.259  1.00 59.47  ? 167 VAL B O   1 
ATOM   2332 C CB  . VAL B 1 150 ? 60.497  -58.463 28.110  1.00 55.21  ? 167 VAL B CB  1 
ATOM   2333 C CG1 . VAL B 1 150 ? 61.474  -58.292 26.962  1.00 54.76  ? 167 VAL B CG1 1 
ATOM   2334 C CG2 . VAL B 1 150 ? 59.271  -57.617 27.864  1.00 56.10  ? 167 VAL B CG2 1 
ATOM   2335 N N   . VAL B 1 151 ? 61.652  -61.502 27.223  1.00 60.15  ? 168 VAL B N   1 
ATOM   2336 C CA  . VAL B 1 151 ? 62.887  -62.257 27.092  1.00 59.61  ? 168 VAL B CA  1 
ATOM   2337 C C   . VAL B 1 151 ? 63.808  -61.567 26.108  1.00 58.99  ? 168 VAL B C   1 
ATOM   2338 O O   . VAL B 1 151 ? 63.449  -61.390 24.957  1.00 61.22  ? 168 VAL B O   1 
ATOM   2339 C CB  . VAL B 1 151 ? 62.630  -63.671 26.575  1.00 60.41  ? 168 VAL B CB  1 
ATOM   2340 C CG1 . VAL B 1 151 ? 63.948  -64.417 26.385  1.00 60.05  ? 168 VAL B CG1 1 
ATOM   2341 C CG2 . VAL B 1 151 ? 61.713  -64.405 27.532  1.00 63.06  ? 168 VAL B CG2 1 
ATOM   2342 N N   . LEU B 1 152 ? 64.990  -61.184 26.574  1.00 57.13  ? 169 LEU B N   1 
ATOM   2343 C CA  . LEU B 1 152 ? 66.021  -60.627 25.727  1.00 55.83  ? 169 LEU B CA  1 
ATOM   2344 C C   . LEU B 1 152 ? 66.981  -61.739 25.349  1.00 54.75  ? 169 LEU B C   1 
ATOM   2345 O O   . LEU B 1 152 ? 67.408  -62.507 26.196  1.00 53.58  ? 169 LEU B O   1 
ATOM   2346 C CB  . LEU B 1 152 ? 66.794  -59.529 26.464  1.00 56.46  ? 169 LEU B CB  1 
ATOM   2347 C CG  . LEU B 1 152 ? 66.036  -58.284 26.933  1.00 58.55  ? 169 LEU B CG  1 
ATOM   2348 C CD2 . LEU B 1 152 ? 65.182  -57.681 25.821  1.00 57.24  ? 169 LEU B CD2 1 
ATOM   2349 N N   . GLU B 1 153 ? 67.307  -61.842 24.070  1.00 55.89  ? 170 GLU B N   1 
ATOM   2350 C CA  . GLU B 1 153 ? 68.377  -62.733 23.630  1.00 56.62  ? 170 GLU B CA  1 
ATOM   2351 C C   . GLU B 1 153 ? 69.240  -61.983 22.624  1.00 57.21  ? 170 GLU B C   1 
ATOM   2352 O O   . GLU B 1 153 ? 68.734  -61.408 21.661  1.00 56.26  ? 170 GLU B O   1 
ATOM   2353 C CB  . GLU B 1 153 ? 67.831  -64.032 23.037  1.00 55.19  ? 170 GLU B CB  1 
ATOM   2354 C CG  . GLU B 1 153 ? 68.908  -65.095 22.824  1.00 56.68  ? 170 GLU B CG  1 
ATOM   2355 C CD  . GLU B 1 153 ? 68.450  -66.510 23.163  1.00 56.73  ? 170 GLU B CD  1 
ATOM   2356 O OE2 . GLU B 1 153 ? 67.918  -67.223 22.281  1.00 56.91  ? 170 GLU B OE2 1 
ATOM   2357 N N   . SER B 1 154 ? 70.542  -61.976 22.876  1.00 57.86  ? 171 SER B N   1 
ATOM   2358 C CA  . SER B 1 154 ? 71.481  -61.177 22.100  1.00 58.53  ? 171 SER B CA  1 
ATOM   2359 C C   . SER B 1 154 ? 72.679  -62.034 21.767  1.00 56.95  ? 171 SER B C   1 
ATOM   2360 O O   . SER B 1 154 ? 73.103  -62.850 22.600  1.00 57.95  ? 171 SER B O   1 
ATOM   2361 C CB  . SER B 1 154 ? 71.954  -59.991 22.925  1.00 59.60  ? 171 SER B CB  1 
ATOM   2362 O OG  . SER B 1 154 ? 72.747  -60.454 24.007  1.00 62.10  ? 171 SER B OG  1 
ATOM   2363 N N   . TYR B 1 155 ? 73.241  -61.838 20.576  1.00 53.85  ? 172 TYR B N   1 
ATOM   2364 C CA  . TYR B 1 155 ? 74.340  -62.671 20.141  1.00 54.35  ? 172 TYR B CA  1 
ATOM   2365 C C   . TYR B 1 155 ? 75.426  -61.920 19.393  1.00 56.57  ? 172 TYR B C   1 
ATOM   2366 O O   . TYR B 1 155 ? 75.264  -60.761 19.014  1.00 54.96  ? 172 TYR B O   1 
ATOM   2367 C CB  . TYR B 1 155 ? 73.828  -63.779 19.243  1.00 54.10  ? 172 TYR B CB  1 
ATOM   2368 C CG  . TYR B 1 155 ? 73.327  -63.260 17.918  1.00 54.86  ? 172 TYR B CG  1 
ATOM   2369 C CD1 . TYR B 1 155 ? 74.194  -63.046 16.846  1.00 55.59  ? 172 TYR B CD1 1 
ATOM   2370 C CD2 . TYR B 1 155 ? 71.994  -62.949 17.752  1.00 53.92  ? 172 TYR B CD2 1 
ATOM   2371 C CE1 . TYR B 1 155 ? 73.720  -62.554 15.643  1.00 56.18  ? 172 TYR B CE1 1 
ATOM   2372 C CE2 . TYR B 1 155 ? 71.517  -62.461 16.561  1.00 54.46  ? 172 TYR B CE2 1 
ATOM   2373 C CZ  . TYR B 1 155 ? 72.371  -62.275 15.513  1.00 54.62  ? 172 TYR B CZ  1 
ATOM   2374 O OH  . TYR B 1 155 ? 71.848  -61.790 14.349  1.00 55.10  ? 172 TYR B OH  1 
ATOM   2375 N N   . ILE B 1 156 ? 76.538  -62.625 19.194  1.00 58.62  ? 173 ILE B N   1 
ATOM   2376 C CA  . ILE B 1 156 ? 77.610  -62.202 18.313  1.00 60.50  ? 173 ILE B CA  1 
ATOM   2377 C C   . ILE B 1 156 ? 78.092  -63.440 17.603  1.00 59.61  ? 173 ILE B C   1 
ATOM   2378 O O   . ILE B 1 156 ? 78.036  -64.537 18.163  1.00 59.35  ? 173 ILE B O   1 
ATOM   2379 C CB  . ILE B 1 156 ? 78.783  -61.569 19.086  1.00 64.29  ? 173 ILE B CB  1 
ATOM   2380 C CG1 . ILE B 1 156 ? 79.809  -60.991 18.115  1.00 65.64  ? 173 ILE B CG1 1 
ATOM   2381 C CG2 . ILE B 1 156 ? 79.450  -62.580 20.018  1.00 64.29  ? 173 ILE B CG2 1 
ATOM   2382 C CD1 . ILE B 1 156 ? 80.790  -60.061 18.787  1.00 67.59  ? 173 ILE B CD1 1 
ATOM   2383 N N   . VAL B 1 157 ? 78.565  -63.273 16.375  1.00 61.55  ? 174 VAL B N   1 
ATOM   2384 C CA  . VAL B 1 157 ? 79.009  -64.418 15.589  1.00 61.12  ? 174 VAL B CA  1 
ATOM   2385 C C   . VAL B 1 157 ? 79.930  -63.997 14.443  1.00 63.90  ? 174 VAL B C   1 
ATOM   2386 O O   . VAL B 1 157 ? 79.905  -62.850 13.993  1.00 62.28  ? 174 VAL B O   1 
ATOM   2387 C CB  . VAL B 1 157 ? 77.783  -65.178 15.056  1.00 59.37  ? 174 VAL B CB  1 
ATOM   2388 C CG1 . VAL B 1 157 ? 77.044  -64.347 14.020  1.00 58.95  ? 174 VAL B CG1 1 
ATOM   2389 C CG2 . VAL B 1 157 ? 78.165  -66.552 14.533  1.00 59.43  ? 174 VAL B CG2 1 
ATOM   2390 N N   . ASP B 1 158 ? 80.768  -64.928 14.000  1.00 67.35  ? 175 ASP B N   1 
ATOM   2391 C CA  . ASP B 1 158 ? 81.621  -64.691 12.844  1.00 69.45  ? 175 ASP B CA  1 
ATOM   2392 C C   . ASP B 1 158 ? 80.770  -64.676 11.594  1.00 68.35  ? 175 ASP B C   1 
ATOM   2393 O O   . ASP B 1 158 ? 80.110  -65.668 11.261  1.00 66.11  ? 175 ASP B O   1 
ATOM   2394 C CB  . ASP B 1 158 ? 82.691  -65.783 12.689  1.00 72.28  ? 175 ASP B CB  1 
ATOM   2395 C CG  . ASP B 1 158 ? 83.834  -65.665 13.707  1.00 72.86  ? 175 ASP B CG  1 
ATOM   2396 O OD1 . ASP B 1 158 ? 83.936  -64.634 14.410  1.00 74.34  ? 175 ASP B OD1 1 
ATOM   2397 O OD2 . ASP B 1 158 ? 84.641  -66.620 13.785  1.00 71.88  ? 175 ASP B OD2 1 
ATOM   2398 N N   . ILE B 1 159 ? 80.784  -63.537 10.913  1.00 68.67  ? 176 ILE B N   1 
ATOM   2399 C CA  . ILE B 1 159 ? 80.323  -63.482 9.554   1.00 69.91  ? 176 ILE B CA  1 
ATOM   2400 C C   . ILE B 1 159 ? 81.128  -64.535 8.810   1.00 72.22  ? 176 ILE B C   1 
ATOM   2401 O O   . ILE B 1 159 ? 82.355  -64.514 8.869   1.00 74.65  ? 176 ILE B O   1 
ATOM   2402 C CB  . ILE B 1 159 ? 80.578  -62.109 8.919   1.00 69.93  ? 176 ILE B CB  1 
ATOM   2403 C CG1 . ILE B 1 159 ? 79.673  -61.051 9.570   1.00 68.69  ? 176 ILE B CG1 1 
ATOM   2404 C CG2 . ILE B 1 159 ? 80.342  -62.185 7.408   1.00 70.49  ? 176 ILE B CG2 1 
ATOM   2405 C CD1 . ILE B 1 159 ? 80.139  -59.626 9.368   1.00 68.47  ? 176 ILE B CD1 1 
ATOM   2406 N N   . PRO B 1 160 ? 80.453  -65.480 8.138   1.00 73.00  ? 177 PRO B N   1 
ATOM   2407 C CA  . PRO B 1 160 ? 81.228  -66.471 7.395   1.00 77.12  ? 177 PRO B CA  1 
ATOM   2408 C C   . PRO B 1 160 ? 81.827  -65.867 6.128   1.00 84.61  ? 177 PRO B C   1 
ATOM   2409 O O   . PRO B 1 160 ? 81.330  -64.844 5.638   1.00 87.91  ? 177 PRO B O   1 
ATOM   2410 C CB  . PRO B 1 160 ? 80.202  -67.563 7.049   1.00 75.23  ? 177 PRO B CB  1 
ATOM   2411 C CG  . PRO B 1 160 ? 78.892  -67.119 7.618   1.00 73.83  ? 177 PRO B CG  1 
ATOM   2412 C CD  . PRO B 1 160 ? 79.005  -65.665 7.958   1.00 73.07  ? 177 PRO B CD  1 
ATOM   2413 N N   . GLN B 1 161 ? 82.901  -66.472 5.625   0.50 89.03  ? 178 GLN B N   1 
ATOM   2414 C CA  . GLN B 1 161 ? 83.442  -66.086 4.329   1.00 94.43  ? 178 GLN B CA  1 
ATOM   2415 C C   . GLN B 1 161 ? 82.383  -66.434 3.305   1.00 96.13  ? 178 GLN B C   1 
ATOM   2416 O O   . GLN B 1 161 ? 81.738  -67.481 3.419   1.00 96.57  ? 178 GLN B O   1 
ATOM   2417 C CB  . GLN B 1 161 ? 84.742  -66.829 4.008   1.00 97.04  ? 178 GLN B CB  1 
ATOM   2418 N N   . GLY B 1 162 ? 82.191  -65.538 2.336   1.00 95.11  ? 179 GLY B N   1 
ATOM   2419 C CA  . GLY B 1 162 ? 81.171  -65.700 1.305   1.00 93.83  ? 179 GLY B CA  1 
ATOM   2420 C C   . GLY B 1 162 ? 79.820  -65.080 1.638   1.00 94.15  ? 179 GLY B C   1 
ATOM   2421 O O   . GLY B 1 162 ? 78.887  -65.161 0.831   1.00 98.81  ? 179 GLY B O   1 
ATOM   2422 N N   . ASN B 1 163 ? 79.700  -64.456 2.811   1.00 89.50  ? 180 ASN B N   1 
ATOM   2423 C CA  . ASN B 1 163 ? 78.427  -63.882 3.245   1.00 84.05  ? 180 ASN B CA  1 
ATOM   2424 C C   . ASN B 1 163 ? 78.560  -62.449 3.719   1.00 82.03  ? 180 ASN B C   1 
ATOM   2425 O O   . ASN B 1 163 ? 79.627  -62.022 4.159   1.00 80.56  ? 180 ASN B O   1 
ATOM   2426 C CB  . ASN B 1 163 ? 77.827  -64.724 4.362   1.00 83.48  ? 180 ASN B CB  1 
ATOM   2427 C CG  . ASN B 1 163 ? 77.052  -65.915 3.846   1.00 85.45  ? 180 ASN B CG  1 
ATOM   2428 O OD1 . ASN B 1 163 ? 76.214  -65.788 2.952   1.00 87.00  ? 180 ASN B OD1 1 
ATOM   2429 N ND2 . ASN B 1 163 ? 77.311  -67.080 4.422   1.00 85.96  ? 180 ASN B ND2 1 
ATOM   2430 N N   . THR B 1 164 ? 77.458  -61.714 3.632   1.00 82.20  ? 181 THR B N   1 
ATOM   2431 C CA  . THR B 1 164 ? 77.415  -60.335 4.103   1.00 82.19  ? 181 THR B CA  1 
ATOM   2432 C C   . THR B 1 164 ? 76.813  -60.318 5.495   1.00 80.55  ? 181 THR B C   1 
ATOM   2433 O O   . THR B 1 164 ? 76.209  -61.291 5.944   1.00 75.11  ? 181 THR B O   1 
ATOM   2434 C CB  . THR B 1 164 ? 76.585  -59.419 3.176   1.00 81.78  ? 181 THR B CB  1 
ATOM   2435 O OG1 . THR B 1 164 ? 75.191  -59.530 3.492   1.00 77.32  ? 181 THR B OG1 1 
ATOM   2436 C CG2 . THR B 1 164 ? 76.819  -59.771 1.704   1.00 83.36  ? 181 THR B CG2 1 
ATOM   2437 N N   . GLU B 1 165 ? 76.965  -59.193 6.170   1.00 81.48  ? 182 GLU B N   1 
ATOM   2438 C CA  . GLU B 1 165 ? 76.557  -59.100 7.556   1.00 80.21  ? 182 GLU B CA  1 
ATOM   2439 C C   . GLU B 1 165 ? 75.041  -59.050 7.689   1.00 78.06  ? 182 GLU B C   1 
ATOM   2440 O O   . GLU B 1 165 ? 74.483  -59.725 8.556   1.00 81.23  ? 182 GLU B O   1 
ATOM   2441 C CB  . GLU B 1 165 ? 77.184  -57.873 8.198   1.00 80.29  ? 182 GLU B CB  1 
ATOM   2442 C CG  . GLU B 1 165 ? 76.868  -57.717 9.668   1.00 79.54  ? 182 GLU B CG  1 
ATOM   2443 C CD  . GLU B 1 165 ? 76.631  -56.273 10.026  1.00 79.79  ? 182 GLU B CD  1 
ATOM   2444 O OE1 . GLU B 1 165 ? 75.453  -55.894 10.173  1.00 76.69  ? 182 GLU B OE1 1 
ATOM   2445 O OE2 . GLU B 1 165 ? 77.628  -55.523 10.130  1.00 82.54  ? 182 GLU B OE2 1 
ATOM   2446 N N   . GLU B 1 166 ? 74.384  -58.249 6.849   1.00 75.39  ? 183 GLU B N   1 
ATOM   2447 C CA  . GLU B 1 166 ? 72.919  -58.158 6.850   1.00 72.96  ? 183 GLU B CA  1 
ATOM   2448 C C   . GLU B 1 166 ? 72.298  -59.531 6.654   1.00 68.92  ? 183 GLU B C   1 
ATOM   2449 O O   . GLU B 1 166 ? 71.330  -59.876 7.317   1.00 70.05  ? 183 GLU B O   1 
ATOM   2450 C CB  . GLU B 1 166 ? 72.416  -57.205 5.758   1.00 74.09  ? 183 GLU B CB  1 
ATOM   2451 N N   . ASP B 1 167 ? 72.883  -60.324 5.769   1.00 68.44  ? 184 ASP B N   1 
ATOM   2452 C CA  . ASP B 1 167 ? 72.321  -61.625 5.422   1.00 71.52  ? 184 ASP B CA  1 
ATOM   2453 C C   . ASP B 1 167 ? 72.555  -62.667 6.509   1.00 72.18  ? 184 ASP B C   1 
ATOM   2454 O O   . ASP B 1 167 ? 71.796  -63.630 6.601   1.00 75.29  ? 184 ASP B O   1 
ATOM   2455 C CB  . ASP B 1 167 ? 72.865  -62.119 4.068   1.00 74.09  ? 184 ASP B CB  1 
ATOM   2456 C CG  . ASP B 1 167 ? 72.497  -61.188 2.906   1.00 76.25  ? 184 ASP B CG  1 
ATOM   2457 O OD1 . ASP B 1 167 ? 71.494  -60.439 3.013   1.00 74.75  ? 184 ASP B OD1 1 
ATOM   2458 O OD2 . ASP B 1 167 ? 73.228  -61.196 1.888   1.00 81.03  ? 184 ASP B OD2 1 
ATOM   2459 N N   . THR B 1 168 ? 73.595  -62.480 7.325   1.00 74.16  ? 185 THR B N   1 
ATOM   2460 C CA  . THR B 1 168 ? 73.817  -63.313 8.519   1.00 70.88  ? 185 THR B CA  1 
ATOM   2461 C C   . THR B 1 168 ? 72.883  -62.887 9.669   1.00 71.67  ? 185 THR B C   1 
ATOM   2462 O O   . THR B 1 168 ? 72.261  -63.731 10.324  1.00 69.04  ? 185 THR B O   1 
ATOM   2463 C CB  . THR B 1 168 ? 75.292  -63.279 8.976   1.00 69.26  ? 185 THR B CB  1 
ATOM   2464 O OG1 . THR B 1 168 ? 76.142  -63.572 7.866   1.00 71.69  ? 185 THR B OG1 1 
ATOM   2465 C CG2 . THR B 1 168 ? 75.560  -64.321 10.053  1.00 69.16  ? 185 THR B CG2 1 
ATOM   2466 N N   . ARG B 1 169 ? 72.761  -61.581 9.888   1.00 72.42  ? 186 ARG B N   1 
ATOM   2467 C CA  . ARG B 1 169 ? 71.900  -61.069 10.947  1.00 73.09  ? 186 ARG B CA  1 
ATOM   2468 C C   . ARG B 1 169 ? 70.446  -61.506 10.761  1.00 72.57  ? 186 ARG B C   1 
ATOM   2469 O O   . ARG B 1 169 ? 69.804  -61.943 11.706  1.00 69.57  ? 186 ARG B O   1 
ATOM   2470 C CB  . ARG B 1 169 ? 71.977  -59.542 11.032  1.00 75.81  ? 186 ARG B CB  1 
ATOM   2471 C CG  . ARG B 1 169 ? 71.445  -58.973 12.346  1.00 76.83  ? 186 ARG B CG  1 
ATOM   2472 C CD  . ARG B 1 169 ? 71.750  -57.484 12.513  1.00 76.49  ? 186 ARG B CD  1 
ATOM   2473 N NE  . ARG B 1 169 ? 71.086  -56.676 11.489  1.00 76.83  ? 186 ARG B NE  1 
ATOM   2474 C CZ  . ARG B 1 169 ? 71.696  -55.980 10.530  0.50 76.59  ? 186 ARG B CZ  1 
ATOM   2475 N NH1 . ARG B 1 169 ? 73.019  -55.945 10.445  1.00 75.18  ? 186 ARG B NH1 1 
ATOM   2476 N NH2 . ARG B 1 169 ? 70.967  -55.298 9.651   1.00 78.14  ? 186 ARG B NH2 1 
ATOM   2477 N N   . MET B 1 170 ? 69.922  -61.394 9.547   1.00 76.55  ? 187 MET B N   1 
ATOM   2478 C CA  . MET B 1 170 ? 68.529  -61.786 9.315   1.00 76.89  ? 187 MET B CA  1 
ATOM   2479 C C   . MET B 1 170 ? 68.324  -63.279 9.640   1.00 69.73  ? 187 MET B C   1 
ATOM   2480 O O   . MET B 1 170 ? 67.339  -63.647 10.289  1.00 58.66  ? 187 MET B O   1 
ATOM   2481 C CB  . MET B 1 170 ? 68.066  -61.422 7.890   1.00 82.08  ? 187 MET B CB  1 
ATOM   2482 C CG  . MET B 1 170 ? 68.791  -62.132 6.754   1.00 91.00  ? 187 MET B CG  1 
ATOM   2483 S SD  . MET B 1 170 ? 68.289  -61.588 5.089   1.00 105.29 ? 187 MET B SD  1 
ATOM   2484 C CE  . MET B 1 170 ? 66.613  -62.222 5.004   1.00 98.41  ? 187 MET B CE  1 
ATOM   2485 N N   . PHE B 1 171 ? 69.277  -64.121 9.232   1.00 65.90  ? 188 PHE B N   1 
ATOM   2486 C CA  . PHE B 1 171 ? 69.142  -65.563 9.422   1.00 63.75  ? 188 PHE B CA  1 
ATOM   2487 C C   . PHE B 1 171 ? 69.155  -65.943 10.897  1.00 65.57  ? 188 PHE B C   1 
ATOM   2488 O O   . PHE B 1 171 ? 68.340  -66.750 11.344  1.00 70.33  ? 188 PHE B O   1 
ATOM   2489 C CB  . PHE B 1 171 ? 70.233  -66.331 8.686   1.00 60.95  ? 188 PHE B CB  1 
ATOM   2490 C CG  . PHE B 1 171 ? 70.325  -67.775 9.087   1.00 60.28  ? 188 PHE B CG  1 
ATOM   2491 C CD1 . PHE B 1 171 ? 69.338  -68.675 8.714   1.00 60.23  ? 188 PHE B CD1 1 
ATOM   2492 C CD2 . PHE B 1 171 ? 71.392  -68.236 9.861   1.00 61.02  ? 188 PHE B CD2 1 
ATOM   2493 C CE1 . PHE B 1 171 ? 69.412  -70.014 9.089   1.00 60.19  ? 188 PHE B CE1 1 
ATOM   2494 C CE2 . PHE B 1 171 ? 71.475  -69.572 10.240  1.00 60.81  ? 188 PHE B CE2 1 
ATOM   2495 C CZ  . PHE B 1 171 ? 70.484  -70.465 9.847   1.00 60.24  ? 188 PHE B CZ  1 
ATOM   2496 N N   . VAL B 1 172 ? 70.079  -65.366 11.655  1.00 64.28  ? 189 VAL B N   1 
ATOM   2497 C CA  . VAL B 1 172 ? 70.185  -65.677 13.075  1.00 61.66  ? 189 VAL B CA  1 
ATOM   2498 C C   . VAL B 1 172 ? 68.995  -65.092 13.867  1.00 60.12  ? 189 VAL B C   1 
ATOM   2499 O O   . VAL B 1 172 ? 68.437  -65.776 14.736  1.00 60.29  ? 189 VAL B O   1 
ATOM   2500 C CB  . VAL B 1 172 ? 71.552  -65.234 13.634  1.00 62.40  ? 189 VAL B CB  1 
ATOM   2501 C CG1 . VAL B 1 172 ? 71.658  -65.529 15.117  1.00 62.67  ? 189 VAL B CG1 1 
ATOM   2502 C CG2 . VAL B 1 172 ? 72.670  -65.951 12.895  1.00 63.23  ? 189 VAL B CG2 1 
ATOM   2503 N N   . ASP B 1 173 ? 68.578  -63.862 13.549  1.00 57.26  ? 190 ASP B N   1 
ATOM   2504 C CA  . ASP B 1 173 ? 67.377  -63.263 14.176  1.00 56.77  ? 190 ASP B CA  1 
ATOM   2505 C C   . ASP B 1 173 ? 66.141  -64.132 13.990  1.00 54.91  ? 190 ASP B C   1 
ATOM   2506 O O   . ASP B 1 173 ? 65.236  -64.148 14.810  1.00 55.22  ? 190 ASP B O   1 
ATOM   2507 C CB  . ASP B 1 173 ? 67.062  -61.896 13.580  1.00 57.35  ? 190 ASP B CB  1 
ATOM   2508 C CG  . ASP B 1 173 ? 68.071  -60.850 13.950  1.00 61.08  ? 190 ASP B CG  1 
ATOM   2509 O OD1 . ASP B 1 173 ? 69.193  -61.217 14.363  1.00 65.10  ? 190 ASP B OD1 1 
ATOM   2510 O OD2 . ASP B 1 173 ? 67.747  -59.649 13.813  1.00 63.37  ? 190 ASP B OD2 1 
ATOM   2511 N N   . THR B 1 174 ? 66.101  -64.816 12.863  1.00 54.74  ? 191 THR B N   1 
ATOM   2512 C CA  . THR B 1 174 ? 64.981  -65.652 12.493  1.00 53.26  ? 191 THR B CA  1 
ATOM   2513 C C   . THR B 1 174 ? 65.010  -66.908 13.336  1.00 52.52  ? 191 THR B C   1 
ATOM   2514 O O   . THR B 1 174 ? 63.961  -67.455 13.661  1.00 53.64  ? 191 THR B O   1 
ATOM   2515 C CB  . THR B 1 174 ? 65.056  -65.969 10.982  1.00 51.61  ? 191 THR B CB  1 
ATOM   2516 O OG1 . THR B 1 174 ? 64.939  -64.746 10.277  1.00 51.91  ? 191 THR B OG1 1 
ATOM   2517 C CG2 . THR B 1 174 ? 63.954  -66.827 10.531  1.00 52.49  ? 191 THR B CG2 1 
ATOM   2518 N N   . VAL B 1 175 ? 66.209  -67.365 13.679  1.00 52.03  ? 192 VAL B N   1 
ATOM   2519 C CA  . VAL B 1 175 ? 66.359  -68.549 14.506  1.00 52.40  ? 192 VAL B CA  1 
ATOM   2520 C C   . VAL B 1 175 ? 66.038  -68.201 15.959  1.00 54.68  ? 192 VAL B C   1 
ATOM   2521 O O   . VAL B 1 175 ? 65.319  -68.939 16.651  1.00 54.24  ? 192 VAL B O   1 
ATOM   2522 C CB  . VAL B 1 175 ? 67.776  -69.126 14.412  1.00 51.74  ? 192 VAL B CB  1 
ATOM   2523 C CG1 . VAL B 1 175 ? 67.942  -70.288 15.378  1.00 51.89  ? 192 VAL B CG1 1 
ATOM   2524 C CG2 . VAL B 1 175 ? 68.061  -69.583 12.990  1.00 52.74  ? 192 VAL B CG2 1 
ATOM   2525 N N   . VAL B 1 176 ? 66.556  -67.069 16.419  1.00 53.41  ? 193 VAL B N   1 
ATOM   2526 C CA  . VAL B 1 176 ? 66.374  -66.707 17.800  1.00 53.29  ? 193 VAL B CA  1 
ATOM   2527 C C   . VAL B 1 176 ? 64.909  -66.367 18.040  1.00 51.60  ? 193 VAL B C   1 
ATOM   2528 O O   . VAL B 1 176 ? 64.327  -66.757 19.049  1.00 51.82  ? 193 VAL B O   1 
ATOM   2529 C CB  . VAL B 1 176 ? 67.313  -65.564 18.222  1.00 54.64  ? 193 VAL B CB  1 
ATOM   2530 C CG1 . VAL B 1 176 ? 67.088  -65.212 19.681  1.00 54.67  ? 193 VAL B CG1 1 
ATOM   2531 C CG2 . VAL B 1 176 ? 68.763  -65.979 18.025  1.00 54.60  ? 193 VAL B CG2 1 
ATOM   2532 N N   . LYS B 1 177 ? 64.302  -65.680 17.091  1.00 51.70  ? 194 LYS B N   1 
ATOM   2533 C CA  . LYS B 1 177 ? 62.906  -65.306 17.221  1.00 52.51  ? 194 LYS B CA  1 
ATOM   2534 C C   . LYS B 1 177 ? 62.021  -66.550 17.152  1.00 50.92  ? 194 LYS B C   1 
ATOM   2535 O O   . LYS B 1 177 ? 60.924  -66.567 17.686  1.00 50.92  ? 194 LYS B O   1 
ATOM   2536 C CB  . LYS B 1 177 ? 62.506  -64.288 16.141  1.00 54.00  ? 194 LYS B CB  1 
ATOM   2537 C CG  . LYS B 1 177 ? 61.086  -63.731 16.325  1.00 56.94  ? 194 LYS B CG  1 
ATOM   2538 N N   . SER B 1 178 ? 62.513  -67.588 16.492  1.00 49.79  ? 195 SER B N   1 
ATOM   2539 C CA  . SER B 1 178 ? 61.779  -68.826 16.344  1.00 48.35  ? 195 SER B CA  1 
ATOM   2540 C C   . SER B 1 178 ? 61.833  -69.568 17.665  1.00 46.09  ? 195 SER B C   1 
ATOM   2541 O O   . SER B 1 178 ? 60.832  -70.089 18.134  1.00 44.21  ? 195 SER B O   1 
ATOM   2542 C CB  . SER B 1 178 ? 62.384  -69.652 15.204  1.00 48.06  ? 195 SER B CB  1 
ATOM   2543 O OG  . SER B 1 178 ? 61.656  -70.835 14.970  1.00 50.27  ? 195 SER B OG  1 
ATOM   2544 N N   . ASN B 1 179 ? 63.017  -69.603 18.252  1.00 47.56  ? 196 ASN B N   1 
ATOM   2545 C CA  . ASN B 1 179 ? 63.210  -70.143 19.598  1.00 48.50  ? 196 ASN B CA  1 
ATOM   2546 C C   . ASN B 1 179 ? 62.334  -69.447 20.630  1.00 48.53  ? 196 ASN B C   1 
ATOM   2547 O O   . ASN B 1 179 ? 61.634  -70.108 21.387  1.00 50.39  ? 196 ASN B O   1 
ATOM   2548 C CB  . ASN B 1 179 ? 64.677  -70.055 20.011  1.00 48.59  ? 196 ASN B CB  1 
ATOM   2549 C CG  . ASN B 1 179 ? 65.569  -70.981 19.198  1.00 49.65  ? 196 ASN B CG  1 
ATOM   2550 O OD1 . ASN B 1 179 ? 65.099  -71.709 18.321  1.00 55.34  ? 196 ASN B OD1 1 
ATOM   2551 N ND2 . ASN B 1 179 ? 66.856  -70.954 19.479  1.00 48.87  ? 196 ASN B ND2 1 
ATOM   2552 N N   . LEU B 1 180 ? 62.316  -68.123 20.636  1.00 47.13  ? 197 LEU B N   1 
ATOM   2553 C CA  . LEU B 1 180 ? 61.557  -67.424 21.664  1.00 48.19  ? 197 LEU B CA  1 
ATOM   2554 C C   . LEU B 1 180 ? 60.052  -67.596 21.569  1.00 50.37  ? 197 LEU B C   1 
ATOM   2555 O O   . LEU B 1 180 ? 59.361  -67.528 22.586  1.00 52.11  ? 197 LEU B O   1 
ATOM   2556 C CB  . LEU B 1 180 ? 61.885  -65.935 21.673  1.00 47.87  ? 197 LEU B CB  1 
ATOM   2557 C CG  . LEU B 1 180 ? 63.366  -65.597 21.850  1.00 46.80  ? 197 LEU B CG  1 
ATOM   2558 C CD1 . LEU B 1 180 ? 63.543  -64.124 22.178  1.00 47.32  ? 197 LEU B CD1 1 
ATOM   2559 C CD2 . LEU B 1 180 ? 64.006  -66.476 22.898  1.00 45.50  ? 197 LEU B CD2 1 
ATOM   2560 N N   . GLN B 1 181 ? 59.533  -67.800 20.363  1.00 52.83  ? 198 GLN B N   1 
ATOM   2561 C CA  . GLN B 1 181 ? 58.095  -67.980 20.184  1.00 54.14  ? 198 GLN B CA  1 
ATOM   2562 C C   . GLN B 1 181 ? 57.677  -69.343 20.717  1.00 53.81  ? 198 GLN B C   1 
ATOM   2563 O O   . GLN B 1 181 ? 56.643  -69.464 21.379  1.00 52.71  ? 198 GLN B O   1 
ATOM   2564 C CB  . GLN B 1 181 ? 57.698  -67.831 18.714  1.00 57.02  ? 198 GLN B CB  1 
ATOM   2565 C CG  . GLN B 1 181 ? 56.193  -67.874 18.471  1.00 60.90  ? 198 GLN B CG  1 
ATOM   2566 C CD  . GLN B 1 181 ? 55.467  -66.659 19.029  1.00 63.12  ? 198 GLN B CD  1 
ATOM   2567 O OE1 . GLN B 1 181 ? 55.667  -65.536 18.567  1.00 62.86  ? 198 GLN B OE1 1 
ATOM   2568 N NE2 . GLN B 1 181 ? 54.627  -66.880 20.037  1.00 67.47  ? 198 GLN B NE2 1 
ATOM   2569 N N   . ASN B 1 182 ? 58.489  -70.359 20.429  1.00 53.15  ? 199 ASN B N   1 
ATOM   2570 C CA  . ASN B 1 182 ? 58.255  -71.712 20.927  1.00 54.52  ? 199 ASN B CA  1 
ATOM   2571 C C   . ASN B 1 182 ? 58.333  -71.712 22.441  1.00 54.04  ? 199 ASN B C   1 
ATOM   2572 O O   . ASN B 1 182 ? 57.593  -72.409 23.113  1.00 54.36  ? 199 ASN B O   1 
ATOM   2573 C CB  . ASN B 1 182 ? 59.292  -72.690 20.355  1.00 55.63  ? 199 ASN B CB  1 
ATOM   2574 C CG  . ASN B 1 182 ? 59.077  -72.976 18.868  1.00 57.80  ? 199 ASN B CG  1 
ATOM   2575 O OD1 . ASN B 1 182 ? 57.940  -73.107 18.412  1.00 59.50  ? 199 ASN B OD1 1 
ATOM   2576 N ND2 . ASN B 1 182 ? 60.169  -73.078 18.110  1.00 55.81  ? 199 ASN B ND2 1 
ATOM   2577 N N   . LEU B 1 183 ? 59.233  -70.894 22.961  1.00 53.54  ? 200 LEU B N   1 
ATOM   2578 C CA  . LEU B 1 183 ? 59.471  -70.813 24.372  1.00 53.32  ? 200 LEU B CA  1 
ATOM   2579 C C   . LEU B 1 183 ? 58.230  -70.257 25.008  1.00 53.71  ? 200 LEU B C   1 
ATOM   2580 O O   . LEU B 1 183 ? 57.738  -70.784 26.005  1.00 58.22  ? 200 LEU B O   1 
ATOM   2581 C CB  . LEU B 1 183 ? 60.672  -69.906 24.647  1.00 53.31  ? 200 LEU B CB  1 
ATOM   2582 C CG  . LEU B 1 183 ? 60.981  -69.534 26.096  1.00 54.12  ? 200 LEU B CG  1 
ATOM   2583 C CD1 . LEU B 1 183 ? 61.259  -70.758 26.966  1.00 54.95  ? 200 LEU B CD1 1 
ATOM   2584 C CD2 . LEU B 1 183 ? 62.167  -68.588 26.119  1.00 53.94  ? 200 LEU B CD2 1 
ATOM   2585 N N   . ALA B 1 184 ? 57.698  -69.201 24.421  1.00 52.55  ? 201 ALA B N   1 
ATOM   2586 C CA  . ALA B 1 184 ? 56.523  -68.570 24.994  1.00 53.48  ? 201 ALA B CA  1 
ATOM   2587 C C   . ALA B 1 184 ? 55.314  -69.516 25.063  1.00 54.25  ? 201 ALA B C   1 
ATOM   2588 O O   . ALA B 1 184 ? 54.475  -69.403 25.970  1.00 57.15  ? 201 ALA B O   1 
ATOM   2589 C CB  . ALA B 1 184 ? 56.182  -67.319 24.225  1.00 53.62  ? 201 ALA B CB  1 
ATOM   2590 N N   . VAL B 1 185 ? 55.241  -70.458 24.130  1.00 51.77  ? 202 VAL B N   1 
ATOM   2591 C CA  . VAL B 1 185 ? 54.126  -71.401 24.085  1.00 50.76  ? 202 VAL B CA  1 
ATOM   2592 C C   . VAL B 1 185 ? 54.255  -72.426 25.203  1.00 49.16  ? 202 VAL B C   1 
ATOM   2593 O O   . VAL B 1 185 ? 53.282  -72.660 25.910  1.00 45.92  ? 202 VAL B O   1 
ATOM   2594 C CB  . VAL B 1 185 ? 54.037  -72.130 22.716  1.00 50.08  ? 202 VAL B CB  1 
ATOM   2595 C CG1 . VAL B 1 185 ? 53.041  -73.270 22.749  1.00 50.20  ? 202 VAL B CG1 1 
ATOM   2596 C CG2 . VAL B 1 185 ? 53.664  -71.158 21.621  1.00 49.43  ? 202 VAL B CG2 1 
ATOM   2597 N N   . ILE B 1 186 ? 55.420  -73.074 25.318  1.00 48.52  ? 203 ILE B N   1 
ATOM   2598 C CA  . ILE B 1 186 ? 55.643  -74.024 26.420  1.00 49.68  ? 203 ILE B CA  1 
ATOM   2599 C C   . ILE B 1 186 ? 55.599  -73.313 27.770  1.00 51.82  ? 203 ILE B C   1 
ATOM   2600 O O   . ILE B 1 186 ? 55.143  -73.884 28.758  1.00 51.75  ? 203 ILE B O   1 
ATOM   2601 C CB  . ILE B 1 186 ? 57.005  -74.746 26.395  1.00 49.09  ? 203 ILE B CB  1 
ATOM   2602 C CG1 . ILE B 1 186 ? 58.070  -73.862 25.791  1.00 48.82  ? 203 ILE B CG1 1 
ATOM   2603 C CG2 . ILE B 1 186 ? 56.939  -76.109 25.723  1.00 49.36  ? 203 ILE B CG2 1 
ATOM   2604 C CD1 . ILE B 1 186 ? 59.419  -74.072 26.419  1.00 50.06  ? 203 ILE B CD1 1 
ATOM   2605 N N   . SER B 1 187 ? 56.087  -72.078 27.814  1.00 52.80  ? 204 SER B N   1 
ATOM   2606 C CA  . SER B 1 187 ? 56.120  -71.337 29.062  1.00 55.02  ? 204 SER B CA  1 
ATOM   2607 C C   . SER B 1 187 ? 54.731  -70.934 29.548  1.00 55.25  ? 204 SER B C   1 
ATOM   2608 O O   . SER B 1 187 ? 54.485  -70.851 30.748  1.00 55.28  ? 204 SER B O   1 
ATOM   2609 C CB  . SER B 1 187 ? 57.017  -70.115 28.920  1.00 55.70  ? 204 SER B CB  1 
ATOM   2610 O OG  . SER B 1 187 ? 58.379  -70.521 28.868  1.00 56.04  ? 204 SER B OG  1 
ATOM   2611 N N   . THR B 1 188 ? 53.827  -70.697 28.612  1.00 56.84  ? 205 THR B N   1 
ATOM   2612 C CA  . THR B 1 188 ? 52.463  -70.295 28.944  1.00 60.29  ? 205 THR B CA  1 
ATOM   2613 C C   . THR B 1 188 ? 51.582  -71.498 29.275  1.00 62.44  ? 205 THR B C   1 
ATOM   2614 O O   . THR B 1 188 ? 50.699  -71.415 30.133  1.00 66.05  ? 205 THR B O   1 
ATOM   2615 C CB  . THR B 1 188 ? 51.847  -69.489 27.786  1.00 60.81  ? 205 THR B CB  1 
ATOM   2616 O OG1 . THR B 1 188 ? 52.602  -68.282 27.603  1.00 60.16  ? 205 THR B OG1 1 
ATOM   2617 C CG2 . THR B 1 188 ? 50.392  -69.143 28.063  1.00 60.98  ? 205 THR B CG2 1 
ATOM   2618 N N   . ALA B 1 189 ? 51.845  -72.614 28.609  1.00 65.65  ? 206 ALA B N   1 
ATOM   2619 C CA  . ALA B 1 189 ? 51.041  -73.827 28.742  1.00 70.59  ? 206 ALA B CA  1 
ATOM   2620 C C   . ALA B 1 189 ? 51.378  -74.569 30.033  1.00 74.30  ? 206 ALA B C   1 
ATOM   2621 O O   . ALA B 1 189 ? 50.919  -75.691 30.258  1.00 76.86  ? 206 ALA B O   1 
ATOM   2622 C CB  . ALA B 1 189 ? 51.262  -74.737 27.529  1.00 71.31  ? 206 ALA B CB  1 
ATOM   2623 N N   . TYR C 1 6   ? 23.236  -66.949 12.000  1.00 84.50  ? 23  TYR C N   1 
ATOM   2624 C CA  . TYR C 1 6   ? 22.863  -66.388 10.664  1.00 80.59  ? 23  TYR C CA  1 
ATOM   2625 C C   . TYR C 1 6   ? 21.417  -66.676 10.262  1.00 77.23  ? 23  TYR C C   1 
ATOM   2626 O O   . TYR C 1 6   ? 20.830  -65.907 9.518   1.00 74.03  ? 23  TYR C O   1 
ATOM   2627 C CB  . TYR C 1 6   ? 23.859  -66.800 9.551   1.00 81.95  ? 23  TYR C CB  1 
ATOM   2628 C CG  . TYR C 1 6   ? 24.267  -68.274 9.440   1.00 83.45  ? 23  TYR C CG  1 
ATOM   2629 C CD1 . TYR C 1 6   ? 23.357  -69.301 9.654   1.00 87.04  ? 23  TYR C CD1 1 
ATOM   2630 C CD2 . TYR C 1 6   ? 25.571  -68.630 9.068   1.00 84.16  ? 23  TYR C CD2 1 
ATOM   2631 C CE1 . TYR C 1 6   ? 23.727  -70.632 9.541   1.00 90.16  ? 23  TYR C CE1 1 
ATOM   2632 C CE2 . TYR C 1 6   ? 25.946  -69.960 8.940   1.00 85.01  ? 23  TYR C CE2 1 
ATOM   2633 C CZ  . TYR C 1 6   ? 25.013  -70.952 9.180   1.00 88.91  ? 23  TYR C CZ  1 
ATOM   2634 O OH  . TYR C 1 6   ? 25.331  -72.278 9.070   1.00 95.26  ? 23  TYR C OH  1 
ATOM   2635 N N   . GLY C 1 7   ? 20.846  -67.766 10.772  1.00 78.38  ? 24  GLY C N   1 
ATOM   2636 C CA  . GLY C 1 7   ? 19.456  -68.147 10.482  1.00 78.28  ? 24  GLY C CA  1 
ATOM   2637 C C   . GLY C 1 7   ? 19.162  -68.565 9.048   1.00 77.37  ? 24  GLY C C   1 
ATOM   2638 O O   . GLY C 1 7   ? 17.998  -68.671 8.658   1.00 78.89  ? 24  GLY C O   1 
ATOM   2639 N N   . LEU C 1 8   ? 20.214  -68.817 8.274   1.00 76.99  ? 25  LEU C N   1 
ATOM   2640 C CA  . LEU C 1 8   ? 20.106  -69.080 6.837   1.00 76.94  ? 25  LEU C CA  1 
ATOM   2641 C C   . LEU C 1 8   ? 19.977  -70.572 6.536   1.00 79.47  ? 25  LEU C C   1 
ATOM   2642 O O   . LEU C 1 8   ? 20.527  -71.418 7.243   1.00 82.33  ? 25  LEU C O   1 
ATOM   2643 C CB  . LEU C 1 8   ? 21.343  -68.537 6.103   1.00 74.08  ? 25  LEU C CB  1 
ATOM   2644 C CG  . LEU C 1 8   ? 21.236  -67.264 5.259   1.00 71.25  ? 25  LEU C CG  1 
ATOM   2645 C CD1 . LEU C 1 8   ? 20.555  -66.131 5.995   1.00 71.08  ? 25  LEU C CD1 1 
ATOM   2646 C CD2 . LEU C 1 8   ? 22.619  -66.834 4.798   1.00 68.88  ? 25  LEU C CD2 1 
ATOM   2647 N N   . THR C 1 9   ? 19.264  -70.880 5.464   1.00 78.77  ? 26  THR C N   1 
ATOM   2648 C CA  . THR C 1 9   ? 19.166  -72.245 4.974   1.00 81.42  ? 26  THR C CA  1 
ATOM   2649 C C   . THR C 1 9   ? 20.349  -72.565 4.053   1.00 81.51  ? 26  THR C C   1 
ATOM   2650 O O   . THR C 1 9   ? 20.940  -71.667 3.445   1.00 77.18  ? 26  THR C O   1 
ATOM   2651 C CB  . THR C 1 9   ? 17.858  -72.461 4.186   1.00 81.47  ? 26  THR C CB  1 
ATOM   2652 O OG1 . THR C 1 9   ? 17.860  -71.632 3.016   1.00 80.13  ? 26  THR C OG1 1 
ATOM   2653 C CG2 . THR C 1 9   ? 16.636  -72.134 5.047   1.00 80.55  ? 26  THR C CG2 1 
ATOM   2654 N N   . LYS C 1 10  ? 20.670  -73.852 3.941   1.00 83.84  ? 27  LYS C N   1 
ATOM   2655 C CA  . LYS C 1 10  ? 21.727  -74.318 3.042   1.00 84.26  ? 27  LYS C CA  1 
ATOM   2656 C C   . LYS C 1 10  ? 21.580  -73.789 1.602   1.00 83.59  ? 27  LYS C C   1 
ATOM   2657 O O   . LYS C 1 10  ? 22.575  -73.431 0.976   1.00 86.75  ? 27  LYS C O   1 
ATOM   2658 C CB  . LYS C 1 10  ? 21.805  -75.851 3.049   1.00 85.12  ? 27  LYS C CB  1 
ATOM   2659 N N   . ASP C 1 11  ? 20.360  -73.726 1.077   1.00 84.81  ? 28  ASP C N   1 
ATOM   2660 C CA  . ASP C 1 11  ? 20.149  -73.183 -0.278  1.00 85.68  ? 28  ASP C CA  1 
ATOM   2661 C C   . ASP C 1 11  ? 20.504  -71.703 -0.349  1.00 79.44  ? 28  ASP C C   1 
ATOM   2662 O O   . ASP C 1 11  ? 21.204  -71.270 -1.268  1.00 79.53  ? 28  ASP C O   1 
ATOM   2663 C CB  . ASP C 1 11  ? 18.700  -73.384 -0.754  1.00 88.56  ? 28  ASP C CB  1 
ATOM   2664 C CG  . ASP C 1 11  ? 18.432  -74.794 -1.253  1.00 92.40  ? 28  ASP C CG  1 
ATOM   2665 O OD1 . ASP C 1 11  ? 19.267  -75.681 -1.011  1.00 92.49  ? 28  ASP C OD1 1 
ATOM   2666 O OD2 . ASP C 1 11  ? 17.379  -75.022 -1.887  1.00 97.41  ? 28  ASP C OD2 1 
ATOM   2667 N N   . GLU C 1 12  ? 20.018  -70.934 0.623   1.00 74.87  ? 29  GLU C N   1 
ATOM   2668 C CA  . GLU C 1 12  ? 20.267  -69.489 0.663   1.00 71.50  ? 29  GLU C CA  1 
ATOM   2669 C C   . GLU C 1 12  ? 21.763  -69.204 0.785   1.00 71.03  ? 29  GLU C C   1 
ATOM   2670 O O   . GLU C 1 12  ? 22.350  -68.481 -0.038  1.00 70.62  ? 29  GLU C O   1 
ATOM   2671 C CB  . GLU C 1 12  ? 19.493  -68.842 1.816   1.00 68.96  ? 29  GLU C CB  1 
ATOM   2672 C CG  . GLU C 1 12  ? 17.984  -68.835 1.598   1.00 69.57  ? 29  GLU C CG  1 
ATOM   2673 C CD  . GLU C 1 12  ? 17.179  -68.579 2.862   1.00 68.08  ? 29  GLU C CD  1 
ATOM   2674 O OE1 . GLU C 1 12  ? 17.764  -68.679 3.967   1.00 66.09  ? 29  GLU C OE1 1 
ATOM   2675 O OE2 . GLU C 1 12  ? 15.957  -68.281 2.741   1.00 65.68  ? 29  GLU C OE2 1 
ATOM   2676 N N   . PHE C 1 13  ? 22.386  -69.808 1.790   1.00 70.36  ? 30  PHE C N   1 
ATOM   2677 C CA  . PHE C 1 13  ? 23.814  -69.621 1.999   1.00 70.82  ? 30  PHE C CA  1 
ATOM   2678 C C   . PHE C 1 13  ? 24.684  -70.182 0.860   1.00 72.79  ? 30  PHE C C   1 
ATOM   2679 O O   . PHE C 1 13  ? 25.770  -69.670 0.606   1.00 69.55  ? 30  PHE C O   1 
ATOM   2680 C CB  . PHE C 1 13  ? 24.258  -70.208 3.337   1.00 69.99  ? 30  PHE C CB  1 
ATOM   2681 C CG  . PHE C 1 13  ? 25.714  -70.021 3.593   1.00 68.47  ? 30  PHE C CG  1 
ATOM   2682 C CD1 . PHE C 1 13  ? 26.234  -68.746 3.735   1.00 67.03  ? 30  PHE C CD1 1 
ATOM   2683 C CD2 . PHE C 1 13  ? 26.580  -71.108 3.630   1.00 70.81  ? 30  PHE C CD2 1 
ATOM   2684 C CE1 . PHE C 1 13  ? 27.590  -68.556 3.944   1.00 68.26  ? 30  PHE C CE1 1 
ATOM   2685 C CE2 . PHE C 1 13  ? 27.938  -70.927 3.838   1.00 69.79  ? 30  PHE C CE2 1 
ATOM   2686 C CZ  . PHE C 1 13  ? 28.444  -69.648 4.000   1.00 68.68  ? 30  PHE C CZ  1 
ATOM   2687 N N   . SER C 1 14  ? 24.219  -71.231 0.184   1.00 78.28  ? 31  SER C N   1 
ATOM   2688 C CA  . SER C 1 14  ? 24.883  -71.704 -1.039  1.00 80.66  ? 31  SER C CA  1 
ATOM   2689 C C   . SER C 1 14  ? 25.067  -70.539 -2.023  1.00 78.82  ? 31  SER C C   1 
ATOM   2690 O O   . SER C 1 14  ? 26.123  -70.390 -2.633  1.00 79.57  ? 31  SER C O   1 
ATOM   2691 C CB  . SER C 1 14  ? 24.084  -72.837 -1.701  1.00 81.98  ? 31  SER C CB  1 
ATOM   2692 N N   . THR C 1 15  ? 24.042  -69.703 -2.146  1.00 77.33  ? 32  THR C N   1 
ATOM   2693 C CA  . THR C 1 15  ? 24.094  -68.547 -3.024  1.00 77.50  ? 32  THR C CA  1 
ATOM   2694 C C   . THR C 1 15  ? 24.824  -67.384 -2.357  1.00 74.55  ? 32  THR C C   1 
ATOM   2695 O O   . THR C 1 15  ? 25.673  -66.749 -2.977  1.00 77.90  ? 32  THR C O   1 
ATOM   2696 C CB  . THR C 1 15  ? 22.673  -68.082 -3.397  1.00 81.61  ? 32  THR C CB  1 
ATOM   2697 O OG1 . THR C 1 15  ? 21.884  -69.209 -3.813  1.00 83.02  ? 32  THR C OG1 1 
ATOM   2698 C CG2 . THR C 1 15  ? 22.722  -67.037 -4.509  1.00 83.24  ? 32  THR C CG2 1 
ATOM   2699 N N   . LEU C 1 16  ? 24.499  -67.117 -1.090  1.00 70.41  ? 33  LEU C N   1 
ATOM   2700 C CA  . LEU C 1 16  ? 24.992  -65.909 -0.381  1.00 64.59  ? 33  LEU C CA  1 
ATOM   2701 C C   . LEU C 1 16  ? 26.439  -65.970 0.124   1.00 59.60  ? 33  LEU C C   1 
ATOM   2702 O O   . LEU C 1 16  ? 27.061  -64.939 0.385   1.00 54.23  ? 33  LEU C O   1 
ATOM   2703 C CB  . LEU C 1 16  ? 24.056  -65.567 0.785   1.00 63.52  ? 33  LEU C CB  1 
ATOM   2704 C CG  . LEU C 1 16  ? 22.747  -64.828 0.451   1.00 63.52  ? 33  LEU C CG  1 
ATOM   2705 C CD1 . LEU C 1 16  ? 22.357  -64.920 -1.018  1.00 64.10  ? 33  LEU C CD1 1 
ATOM   2706 C CD2 . LEU C 1 16  ? 21.606  -65.321 1.337   1.00 61.76  ? 33  LEU C CD2 1 
ATOM   2707 N N   . ASP C 1 17  ? 26.989  -67.165 0.247   1.00 59.32  ? 34  ASP C N   1 
ATOM   2708 C CA  . ASP C 1 17  ? 28.351  -67.286 0.722   1.00 60.18  ? 34  ASP C CA  1 
ATOM   2709 C C   . ASP C 1 17  ? 29.245  -66.317 -0.040  1.00 59.99  ? 34  ASP C C   1 
ATOM   2710 O O   . ASP C 1 17  ? 29.824  -65.396 0.546   1.00 58.23  ? 34  ASP C O   1 
ATOM   2711 C CB  . ASP C 1 17  ? 28.860  -68.718 0.567   1.00 61.37  ? 34  ASP C CB  1 
ATOM   2712 C CG  . ASP C 1 17  ? 30.251  -68.887 1.102   0.50 62.42  ? 34  ASP C CG  1 
ATOM   2713 O OD1 . ASP C 1 17  ? 30.594  -68.173 2.069   1.00 61.17  ? 34  ASP C OD1 1 
ATOM   2714 O OD2 . ASP C 1 17  ? 31.000  -69.718 0.552   1.00 67.00  ? 34  ASP C OD2 1 
ATOM   2715 N N   . SER C 1 18  ? 29.310  -66.507 -1.353  1.00 60.48  ? 35  SER C N   1 
ATOM   2716 C CA  . SER C 1 18  ? 30.171  -65.704 -2.205  1.00 61.35  ? 35  SER C CA  1 
ATOM   2717 C C   . SER C 1 18  ? 29.992  -64.214 -1.945  1.00 59.19  ? 35  SER C C   1 
ATOM   2718 O O   . SER C 1 18  ? 30.968  -63.486 -1.700  1.00 56.78  ? 35  SER C O   1 
ATOM   2719 C CB  . SER C 1 18  ? 29.886  -66.012 -3.671  1.00 64.86  ? 35  SER C CB  1 
ATOM   2720 O OG  . SER C 1 18  ? 30.844  -65.401 -4.509  1.00 65.48  ? 35  SER C OG  1 
ATOM   2721 N N   . ILE C 1 19  ? 28.740  -63.775 -1.962  1.00 59.09  ? 36  ILE C N   1 
ATOM   2722 C CA  . ILE C 1 19  ? 28.416  -62.367 -1.731  1.00 59.59  ? 36  ILE C CA  1 
ATOM   2723 C C   . ILE C 1 19  ? 28.852  -61.873 -0.354  1.00 57.28  ? 36  ILE C C   1 
ATOM   2724 O O   . ILE C 1 19  ? 29.397  -60.772 -0.245  1.00 56.94  ? 36  ILE C O   1 
ATOM   2725 C CB  . ILE C 1 19  ? 26.905  -62.099 -1.855  1.00 62.16  ? 36  ILE C CB  1 
ATOM   2726 C CG1 . ILE C 1 19  ? 26.423  -62.362 -3.276  1.00 61.72  ? 36  ILE C CG1 1 
ATOM   2727 C CG2 . ILE C 1 19  ? 26.568  -60.659 -1.457  1.00 62.97  ? 36  ILE C CG2 1 
ATOM   2728 C CD1 . ILE C 1 19  ? 24.918  -62.370 -3.380  1.00 62.74  ? 36  ILE C CD1 1 
ATOM   2729 N N   . ILE C 1 20  ? 28.586  -62.664 0.691   1.00 56.02  ? 37  ILE C N   1 
ATOM   2730 C CA  . ILE C 1 20  ? 28.895  -62.252 2.070   1.00 53.54  ? 37  ILE C CA  1 
ATOM   2731 C C   . ILE C 1 20  ? 30.382  -62.008 2.178   1.00 53.14  ? 37  ILE C C   1 
ATOM   2732 O O   . ILE C 1 20  ? 30.844  -61.007 2.737   1.00 54.00  ? 37  ILE C O   1 
ATOM   2733 C CB  . ILE C 1 20  ? 28.493  -63.323 3.112   1.00 54.15  ? 37  ILE C CB  1 
ATOM   2734 C CG1 . ILE C 1 20  ? 26.974  -63.453 3.207   1.00 54.56  ? 37  ILE C CG1 1 
ATOM   2735 C CG2 . ILE C 1 20  ? 29.009  -62.961 4.497   1.00 54.74  ? 37  ILE C CG2 1 
ATOM   2736 C CD1 . ILE C 1 20  ? 26.519  -64.787 3.759   1.00 55.05  ? 37  ILE C CD1 1 
ATOM   2737 N N   . ARG C 1 21  ? 31.134  -62.937 1.616   1.00 53.16  ? 38  ARG C N   1 
ATOM   2738 C CA  . ARG C 1 21  ? 32.579  -62.845 1.645   1.00 53.02  ? 38  ARG C CA  1 
ATOM   2739 C C   . ARG C 1 21  ? 33.092  -61.590 0.917   1.00 52.60  ? 38  ARG C C   1 
ATOM   2740 O O   . ARG C 1 21  ? 33.908  -60.868 1.485   1.00 54.70  ? 38  ARG C O   1 
ATOM   2741 C CB  . ARG C 1 21  ? 33.201  -64.136 1.094   1.00 54.38  ? 38  ARG C CB  1 
ATOM   2742 C CG  . ARG C 1 21  ? 32.777  -65.374 1.885   1.00 55.70  ? 38  ARG C CG  1 
ATOM   2743 C CD  . ARG C 1 21  ? 33.337  -66.665 1.321   1.00 56.91  ? 38  ARG C CD  1 
ATOM   2744 N NE  . ARG C 1 21  ? 34.625  -66.975 1.924   1.00 59.72  ? 38  ARG C NE  1 
ATOM   2745 C CZ  . ARG C 1 21  ? 34.846  -67.865 2.895   1.00 62.11  ? 38  ARG C CZ  1 
ATOM   2746 N NH1 . ARG C 1 21  ? 33.867  -68.585 3.430   1.00 60.68  ? 38  ARG C NH1 1 
ATOM   2747 N NH2 . ARG C 1 21  ? 36.089  -68.033 3.339   1.00 65.98  ? 38  ARG C NH2 1 
ATOM   2748 N N   . THR C 1 22  ? 32.611  -61.285 -0.293  1.00 51.98  ? 39  THR C N   1 
ATOM   2749 C CA  . THR C 1 22  ? 33.225  -60.166 -1.030  1.00 52.41  ? 39  THR C CA  1 
ATOM   2750 C C   . THR C 1 22  ? 32.757  -58.802 -0.499  1.00 49.97  ? 39  THR C C   1 
ATOM   2751 O O   . THR C 1 22  ? 33.569  -57.877 -0.397  1.00 51.43  ? 39  THR C O   1 
ATOM   2752 C CB  . THR C 1 22  ? 33.132  -60.228 -2.622  1.00 56.16  ? 39  THR C CB  1 
ATOM   2753 O OG1 . THR C 1 22  ? 32.158  -59.305 -3.132  1.00 57.44  ? 39  THR C OG1 1 
ATOM   2754 C CG2 . THR C 1 22  ? 32.845  -61.621 -3.181  1.00 56.33  ? 39  THR C CG2 1 
ATOM   2755 N N   . HIS C 1 23  ? 31.480  -58.660 -0.153  1.00 47.46  ? 40  HIS C N   1 
ATOM   2756 C CA  . HIS C 1 23  ? 30.936  -57.332 0.184   1.00 47.27  ? 40  HIS C CA  1 
ATOM   2757 C C   . HIS C 1 23  ? 30.807  -57.050 1.700   1.00 49.73  ? 40  HIS C C   1 
ATOM   2758 O O   . HIS C 1 23  ? 31.174  -55.958 2.162   1.00 52.17  ? 40  HIS C O   1 
ATOM   2759 C CB  . HIS C 1 23  ? 29.583  -57.124 -0.490  1.00 45.69  ? 40  HIS C CB  1 
ATOM   2760 N N   . HIS C 1 24  ? 30.316  -58.026 2.463   1.00 49.29  ? 41  HIS C N   1 
ATOM   2761 C CA  . HIS C 1 24  ? 29.824  -57.779 3.830   1.00 51.52  ? 41  HIS C CA  1 
ATOM   2762 C C   . HIS C 1 24  ? 30.836  -57.970 4.958   1.00 54.55  ? 41  HIS C C   1 
ATOM   2763 O O   . HIS C 1 24  ? 30.582  -57.577 6.088   1.00 56.75  ? 41  HIS C O   1 
ATOM   2764 C CB  . HIS C 1 24  ? 28.641  -58.694 4.129   1.00 50.44  ? 41  HIS C CB  1 
ATOM   2765 C CG  . HIS C 1 24  ? 27.345  -58.197 3.586   1.00 49.73  ? 41  HIS C CG  1 
ATOM   2766 N ND1 . HIS C 1 24  ? 26.615  -57.203 4.195   1.00 49.48  ? 41  HIS C ND1 1 
ATOM   2767 C CD2 . HIS C 1 24  ? 26.644  -58.564 2.491   1.00 50.31  ? 41  HIS C CD2 1 
ATOM   2768 C CE1 . HIS C 1 24  ? 25.510  -56.989 3.508   1.00 50.62  ? 41  HIS C CE1 1 
ATOM   2769 N NE2 . HIS C 1 24  ? 25.510  -57.795 2.463   1.00 51.70  ? 41  HIS C NE2 1 
ATOM   2770 N N   . THR C 1 25  ? 31.965  -58.579 4.635   1.00 57.36  ? 42  THR C N   1 
ATOM   2771 C CA  . THR C 1 25  ? 32.937  -59.075 5.594   1.00 56.22  ? 42  THR C CA  1 
ATOM   2772 C C   . THR C 1 25  ? 33.892  -57.968 5.987   1.00 56.86  ? 42  THR C C   1 
ATOM   2773 O O   . THR C 1 25  ? 34.458  -57.304 5.120   1.00 55.37  ? 42  THR C O   1 
ATOM   2774 C CB  . THR C 1 25  ? 33.699  -60.250 4.939   1.00 59.23  ? 42  THR C CB  1 
ATOM   2775 O OG1 . THR C 1 25  ? 33.120  -61.486 5.366   1.00 60.34  ? 42  THR C OG1 1 
ATOM   2776 C CG2 . THR C 1 25  ? 35.203  -60.248 5.240   1.00 62.56  ? 42  THR C CG2 1 
ATOM   2777 N N   . PHE C 1 26  ? 34.097  -57.763 7.289   1.00 58.78  ? 43  PHE C N   1 
ATOM   2778 C CA  . PHE C 1 26  ? 35.069  -56.744 7.713   1.00 58.87  ? 43  PHE C CA  1 
ATOM   2779 C C   . PHE C 1 26  ? 36.331  -57.363 8.262   1.00 60.40  ? 43  PHE C C   1 
ATOM   2780 O O   . PHE C 1 26  ? 36.315  -58.499 8.732   1.00 62.54  ? 43  PHE C O   1 
ATOM   2781 C CB  . PHE C 1 26  ? 34.449  -55.773 8.696   1.00 58.93  ? 43  PHE C CB  1 
ATOM   2782 C CG  . PHE C 1 26  ? 33.346  -54.961 8.095   1.00 58.00  ? 43  PHE C CG  1 
ATOM   2783 C CD1 . PHE C 1 26  ? 33.633  -53.837 7.329   1.00 57.72  ? 43  PHE C CD1 1 
ATOM   2784 C CD2 . PHE C 1 26  ? 32.023  -55.334 8.262   1.00 56.72  ? 43  PHE C CD2 1 
ATOM   2785 C CE1 . PHE C 1 26  ? 32.622  -53.088 6.761   1.00 56.97  ? 43  PHE C CE1 1 
ATOM   2786 C CE2 . PHE C 1 26  ? 31.003  -54.587 7.692   1.00 56.57  ? 43  PHE C CE2 1 
ATOM   2787 C CZ  . PHE C 1 26  ? 31.304  -53.463 6.946   1.00 56.76  ? 43  PHE C CZ  1 
ATOM   2788 N N   . PRO C 1 27  ? 37.449  -56.647 8.156   0.50 63.25  ? 44  PRO C N   1 
ATOM   2789 C CA  . PRO C 1 27  ? 38.645  -57.243 8.712   1.00 66.62  ? 44  PRO C CA  1 
ATOM   2790 C C   . PRO C 1 27  ? 38.782  -56.910 10.198  1.00 70.31  ? 44  PRO C C   1 
ATOM   2791 O O   . PRO C 1 27  ? 38.469  -55.797 10.629  1.00 69.58  ? 44  PRO C O   1 
ATOM   2792 C CB  . PRO C 1 27  ? 39.775  -56.627 7.868   1.00 65.61  ? 44  PRO C CB  1 
ATOM   2793 C CG  . PRO C 1 27  ? 39.108  -55.799 6.811   1.00 63.76  ? 44  PRO C CG  1 
ATOM   2794 C CD  . PRO C 1 27  ? 37.768  -55.448 7.372   1.00 63.42  ? 44  PRO C CD  1 
ATOM   2795 N N   . ARG C 1 28  ? 39.232  -57.890 10.970  1.00 74.82  ? 45  ARG C N   1 
ATOM   2796 C CA  . ARG C 1 28  ? 39.403  -57.715 12.396  1.00 79.09  ? 45  ARG C CA  1 
ATOM   2797 C C   . ARG C 1 28  ? 40.440  -56.622 12.636  1.00 78.67  ? 45  ARG C C   1 
ATOM   2798 O O   . ARG C 1 28  ? 41.559  -56.737 12.181  1.00 75.23  ? 45  ARG C O   1 
ATOM   2799 C CB  . ARG C 1 28  ? 39.839  -59.040 13.033  1.00 84.06  ? 45  ARG C CB  1 
ATOM   2800 C CG  . ARG C 1 28  ? 40.171  -58.978 14.522  1.00 89.08  ? 45  ARG C CG  1 
ATOM   2801 C CD  . ARG C 1 28  ? 40.236  -60.375 15.129  1.00 90.92  ? 45  ARG C CD  1 
ATOM   2802 N NE  . ARG C 1 28  ? 38.902  -60.908 15.421  1.00 93.65  ? 45  ARG C NE  1 
ATOM   2803 C CZ  . ARG C 1 28  ? 38.159  -60.574 16.481  1.00 99.73  ? 45  ARG C CZ  1 
ATOM   2804 N NH1 . ARG C 1 28  ? 38.606  -59.691 17.374  1.00 101.72 ? 45  ARG C NH1 1 
ATOM   2805 N NH2 . ARG C 1 28  ? 36.953  -61.119 16.654  1.00 97.65  ? 45  ARG C NH2 1 
ATOM   2806 N N   . SER C 1 29  ? 40.029  -55.540 13.292  1.00 77.52  ? 46  SER C N   1 
ATOM   2807 C CA  . SER C 1 29  ? 40.957  -54.551 13.846  1.00 76.81  ? 46  SER C CA  1 
ATOM   2808 C C   . SER C 1 29  ? 40.838  -54.658 15.349  1.00 75.99  ? 46  SER C C   1 
ATOM   2809 O O   . SER C 1 29  ? 39.881  -55.245 15.851  1.00 73.97  ? 46  SER C O   1 
ATOM   2810 C CB  . SER C 1 29  ? 40.597  -53.134 13.416  1.00 77.25  ? 46  SER C CB  1 
ATOM   2811 O OG  . SER C 1 29  ? 40.434  -53.056 12.015  1.00 83.33  ? 46  SER C OG  1 
ATOM   2812 N N   . PRO C 1 30  ? 41.797  -54.086 16.081  1.00 76.51  ? 47  PRO C N   1 
ATOM   2813 C CA  . PRO C 1 30  ? 41.692  -54.174 17.525  1.00 76.42  ? 47  PRO C CA  1 
ATOM   2814 C C   . PRO C 1 30  ? 40.656  -53.190 18.070  1.00 74.48  ? 47  PRO C C   1 
ATOM   2815 O O   . PRO C 1 30  ? 40.309  -52.214 17.400  1.00 72.80  ? 47  PRO C O   1 
ATOM   2816 C CB  . PRO C 1 30  ? 43.112  -53.833 18.014  1.00 78.07  ? 47  PRO C CB  1 
ATOM   2817 C CG  . PRO C 1 30  ? 43.917  -53.508 16.792  1.00 78.01  ? 47  PRO C CG  1 
ATOM   2818 C CD  . PRO C 1 30  ? 42.950  -53.273 15.674  1.00 78.12  ? 47  PRO C CD  1 
ATOM   2819 N N   . ASN C 1 31  ? 40.205  -53.460 19.289  1.00 72.76  ? 48  ASN C N   1 
ATOM   2820 C CA  . ASN C 1 31  ? 39.033  -52.833 19.893  1.00 72.93  ? 48  ASN C CA  1 
ATOM   2821 C C   . ASN C 1 31  ? 37.884  -52.494 18.924  1.00 67.06  ? 48  ASN C C   1 
ATOM   2822 O O   . ASN C 1 31  ? 37.334  -51.393 18.949  1.00 64.46  ? 48  ASN C O   1 
ATOM   2823 C CB  . ASN C 1 31  ? 39.426  -51.628 20.774  1.00 76.45  ? 48  ASN C CB  1 
ATOM   2824 C CG  . ASN C 1 31  ? 38.682  -51.627 22.121  1.00 80.45  ? 48  ASN C CG  1 
ATOM   2825 O OD1 . ASN C 1 31  ? 37.988  -50.665 22.489  1.00 77.55  ? 48  ASN C OD1 1 
ATOM   2826 N ND2 . ASN C 1 31  ? 38.808  -52.732 22.850  1.00 80.07  ? 48  ASN C ND2 1 
ATOM   2827 N N   . THR C 1 32  ? 37.511  -53.478 18.106  1.00 64.54  ? 49  THR C N   1 
ATOM   2828 C CA  . THR C 1 32  ? 36.343  -53.371 17.224  1.00 63.72  ? 49  THR C CA  1 
ATOM   2829 C C   . THR C 1 32  ? 35.378  -54.532 17.409  1.00 62.38  ? 49  THR C C   1 
ATOM   2830 O O   . THR C 1 32  ? 35.731  -55.579 17.953  1.00 62.55  ? 49  THR C O   1 
ATOM   2831 C CB  . THR C 1 32  ? 36.697  -53.394 15.718  1.00 63.22  ? 49  THR C CB  1 
ATOM   2832 O OG1 . THR C 1 32  ? 37.291  -54.657 15.388  1.00 63.02  ? 49  THR C OG1 1 
ATOM   2833 C CG2 . THR C 1 32  ? 37.618  -52.250 15.331  1.00 63.05  ? 49  THR C CG2 1 
ATOM   2834 N N   . CYS C 1 33  ? 34.166  -54.312 16.905  1.00 60.77  ? 50  CYS C N   1 
ATOM   2835 C CA  . CYS C 1 33  ? 33.094  -55.294 16.851  1.00 58.03  ? 50  CYS C CA  1 
ATOM   2836 C C   . CYS C 1 33  ? 32.514  -55.394 15.412  1.00 57.92  ? 50  CYS C C   1 
ATOM   2837 O O   . CYS C 1 33  ? 32.496  -54.424 14.637  1.00 52.71  ? 50  CYS C O   1 
ATOM   2838 C CB  . CYS C 1 33  ? 32.000  -54.890 17.836  1.00 57.10  ? 50  CYS C CB  1 
ATOM   2839 S SG  . CYS C 1 33  ? 30.629  -56.044 17.977  0.50 56.00  ? 50  CYS C SG  1 
ATOM   2840 N N   . THR C 1 34  ? 32.033  -56.583 15.084  1.00 57.33  ? 51  THR C N   1 
ATOM   2841 C CA  . THR C 1 34  ? 31.538  -56.880 13.767  1.00 56.82  ? 51  THR C CA  1 
ATOM   2842 C C   . THR C 1 34  ? 30.538  -58.031 13.832  1.00 56.59  ? 51  THR C C   1 
ATOM   2843 O O   . THR C 1 34  ? 30.664  -58.913 14.667  1.00 56.71  ? 51  THR C O   1 
ATOM   2844 C CB  . THR C 1 34  ? 32.701  -57.256 12.830  1.00 58.83  ? 51  THR C CB  1 
ATOM   2845 O OG1 . THR C 1 34  ? 32.194  -57.518 11.515  1.00 62.48  ? 51  THR C OG1 1 
ATOM   2846 C CG2 . THR C 1 34  ? 33.445  -58.492 13.339  1.00 59.01  ? 51  THR C CG2 1 
ATOM   2847 N N   . SER C 1 35  ? 29.528  -58.001 12.964  1.00 57.86  ? 52  SER C N   1 
ATOM   2848 C CA  . SER C 1 35  ? 28.652  -59.167 12.745  1.00 56.32  ? 52  SER C CA  1 
ATOM   2849 C C   . SER C 1 35  ? 27.799  -58.954 11.512  1.00 53.06  ? 52  SER C C   1 
ATOM   2850 O O   . SER C 1 35  ? 27.902  -57.922 10.846  1.00 51.78  ? 52  SER C O   1 
ATOM   2851 C CB  . SER C 1 35  ? 27.765  -59.508 13.982  1.00 56.35  ? 52  SER C CB  1 
ATOM   2852 O OG  . SER C 1 35  ? 26.999  -58.410 14.443  1.00 54.15  ? 52  SER C OG  1 
ATOM   2853 N N   . LEU C 1 36  ? 26.979  -59.958 11.222  1.00 50.32  ? 53  LEU C N   1 
ATOM   2854 C CA  . LEU C 1 36  ? 26.067  -59.937 10.119  1.00 48.80  ? 53  LEU C CA  1 
ATOM   2855 C C   . LEU C 1 36  ? 24.678  -60.299 10.633  1.00 47.84  ? 53  LEU C C   1 
ATOM   2856 O O   . LEU C 1 36  ? 24.521  -61.221 11.413  1.00 47.30  ? 53  LEU C O   1 
ATOM   2857 C CB  . LEU C 1 36  ? 26.535  -60.965 9.073   1.00 50.59  ? 53  LEU C CB  1 
ATOM   2858 C CG  . LEU C 1 36  ? 26.078  -60.769 7.622   1.00 50.60  ? 53  LEU C CG  1 
ATOM   2859 C CD1 . LEU C 1 36  ? 26.806  -61.719 6.685   1.00 53.52  ? 53  LEU C CD1 1 
ATOM   2860 C CD2 . LEU C 1 36  ? 24.592  -60.979 7.492   1.00 50.51  ? 53  LEU C CD2 1 
ATOM   2861 N N   . ILE C 1 37  ? 23.674  -59.563 10.193  1.00 47.33  ? 54  ILE C N   1 
ATOM   2862 C CA  . ILE C 1 37  ? 22.305  -59.942 10.391  1.00 48.71  ? 54  ILE C CA  1 
ATOM   2863 C C   . ILE C 1 37  ? 21.676  -60.309 9.037   1.00 51.67  ? 54  ILE C C   1 
ATOM   2864 O O   . ILE C 1 37  ? 21.967  -59.688 7.991   1.00 51.62  ? 54  ILE C O   1 
ATOM   2865 C CB  . ILE C 1 37  ? 21.522  -58.805 11.063  1.00 49.76  ? 54  ILE C CB  1 
ATOM   2866 C CG1 . ILE C 1 37  ? 22.028  -58.574 12.497  1.00 52.11  ? 54  ILE C CG1 1 
ATOM   2867 C CG2 . ILE C 1 37  ? 20.044  -59.134 11.112  1.00 50.60  ? 54  ILE C CG2 1 
ATOM   2868 C CD1 . ILE C 1 37  ? 23.328  -57.795 12.590  1.00 53.19  ? 54  ILE C CD1 1 
ATOM   2869 N N   . ALA C 1 38  ? 20.807  -61.317 9.069   1.00 52.47  ? 55  ALA C N   1 
ATOM   2870 C CA  . ALA C 1 38  ? 20.053  -61.732 7.898   1.00 53.09  ? 55  ALA C CA  1 
ATOM   2871 C C   . ALA C 1 38  ? 18.590  -61.703 8.205   1.00 53.74  ? 55  ALA C C   1 
ATOM   2872 O O   . ALA C 1 38  ? 18.167  -62.206 9.222   1.00 57.91  ? 55  ALA C O   1 
ATOM   2873 C CB  . ALA C 1 38  ? 20.447  -63.134 7.484   1.00 53.72  ? 55  ALA C CB  1 
ATOM   2874 N N   . HIS C 1 39  ? 17.799  -61.150 7.307   1.00 56.52  ? 56  HIS C N   1 
ATOM   2875 C CA  . HIS C 1 39  ? 16.376  -61.100 7.529   1.00 58.01  ? 56  HIS C CA  1 
ATOM   2876 C C   . HIS C 1 39  ? 15.611  -61.403 6.250   1.00 59.04  ? 56  HIS C C   1 
ATOM   2877 O O   . HIS C 1 39  ? 15.914  -60.854 5.197   1.00 58.87  ? 56  HIS C O   1 
ATOM   2878 C CB  . HIS C 1 39  ? 15.980  -59.739 8.098   1.00 57.26  ? 56  HIS C CB  1 
ATOM   2879 C CG  . HIS C 1 39  ? 14.603  -59.723 8.670   1.00 60.05  ? 56  HIS C CG  1 
ATOM   2880 N ND1 . HIS C 1 39  ? 13.575  -58.995 8.115   1.00 62.58  ? 56  HIS C ND1 1 
ATOM   2881 C CD2 . HIS C 1 39  ? 14.072  -60.384 9.726   1.00 60.23  ? 56  HIS C CD2 1 
ATOM   2882 C CE1 . HIS C 1 39  ? 12.474  -59.194 8.818   1.00 63.25  ? 56  HIS C CE1 1 
ATOM   2883 N NE2 . HIS C 1 39  ? 12.750  -60.031 9.799   1.00 62.22  ? 56  HIS C NE2 1 
ATOM   2884 N N   . ARG C 1 40  ? 14.636  -62.302 6.362   1.00 62.70  ? 57  ARG C N   1 
ATOM   2885 C CA  . ARG C 1 40  ? 13.786  -62.702 5.239   1.00 62.41  ? 57  ARG C CA  1 
ATOM   2886 C C   . ARG C 1 40  ? 12.616  -61.753 5.149   1.00 62.53  ? 57  ARG C C   1 
ATOM   2887 O O   . ARG C 1 40  ? 11.893  -61.582 6.119   1.00 66.34  ? 57  ARG C O   1 
ATOM   2888 C CB  . ARG C 1 40  ? 13.221  -64.107 5.452   1.00 63.03  ? 57  ARG C CB  1 
ATOM   2889 C CG  . ARG C 1 40  ? 13.916  -65.234 4.710   1.00 63.34  ? 57  ARG C CG  1 
ATOM   2890 C CD  . ARG C 1 40  ? 13.287  -66.590 5.066   1.00 66.08  ? 57  ARG C CD  1 
ATOM   2891 N NE  . ARG C 1 40  ? 14.306  -67.625 5.255   1.00 66.56  ? 57  ARG C NE  1 
ATOM   2892 C CZ  . ARG C 1 40  ? 15.152  -67.677 6.281   1.00 65.92  ? 57  ARG C CZ  1 
ATOM   2893 N NH1 . ARG C 1 40  ? 15.116  -66.768 7.250   1.00 66.33  ? 57  ARG C NH1 1 
ATOM   2894 N NH2 . ARG C 1 40  ? 16.053  -68.641 6.334   1.00 68.05  ? 57  ARG C NH2 1 
ATOM   2895 N N   . VAL C 1 41  ? 12.426  -61.148 3.988   1.00 61.19  ? 58  VAL C N   1 
ATOM   2896 C CA  . VAL C 1 41  ? 11.286  -60.299 3.741   1.00 60.65  ? 58  VAL C CA  1 
ATOM   2897 C C   . VAL C 1 41  ? 10.502  -60.916 2.589   1.00 66.38  ? 58  VAL C C   1 
ATOM   2898 O O   . VAL C 1 41  ? 11.089  -61.351 1.588   1.00 64.30  ? 58  VAL C O   1 
ATOM   2899 C CB  . VAL C 1 41  ? 11.728  -58.881 3.376   1.00 60.05  ? 58  VAL C CB  1 
ATOM   2900 C CG1 . VAL C 1 41  ? 10.528  -57.998 3.070   1.00 60.88  ? 58  VAL C CG1 1 
ATOM   2901 C CG2 . VAL C 1 41  ? 12.562  -58.286 4.502   1.00 60.65  ? 58  VAL C CG2 1 
ATOM   2902 N N   . ASP C 1 42  ? 9.178   -60.975 2.750   1.00 71.23  ? 59  ASP C N   1 
ATOM   2903 C CA  . ASP C 1 42  ? 8.299   -61.571 1.748   1.00 72.19  ? 59  ASP C CA  1 
ATOM   2904 C C   . ASP C 1 42  ? 7.839   -60.492 0.797   1.00 71.72  ? 59  ASP C C   1 
ATOM   2905 O O   . ASP C 1 42  ? 6.687   -60.053 0.842   1.00 73.05  ? 59  ASP C O   1 
ATOM   2906 C CB  . ASP C 1 42  ? 7.093   -62.258 2.392   1.00 73.26  ? 59  ASP C CB  1 
ATOM   2907 C CG  . ASP C 1 42  ? 6.200   -62.942 1.368   1.00 73.35  ? 59  ASP C CG  1 
ATOM   2908 O OD1 . ASP C 1 42  ? 6.677   -63.882 0.688   0.50 72.37  ? 59  ASP C OD1 1 
ATOM   2909 O OD2 . ASP C 1 42  ? 5.021   -62.542 1.255   0.50 72.09  ? 59  ASP C OD2 1 
ATOM   2910 N N   . ALA C 1 43  ? 8.766   -60.060 -0.051  1.00 70.00  ? 60  ALA C N   1 
ATOM   2911 C CA  . ALA C 1 43  ? 8.473   -59.109 -1.107  1.00 66.96  ? 60  ALA C CA  1 
ATOM   2912 C C   . ALA C 1 43  ? 9.605   -59.133 -2.111  1.00 64.45  ? 60  ALA C C   1 
ATOM   2913 O O   . ALA C 1 43  ? 10.738  -59.452 -1.756  1.00 61.65  ? 60  ALA C O   1 
ATOM   2914 C CB  . ALA C 1 43  ? 8.303   -57.709 -0.537  1.00 67.08  ? 60  ALA C CB  1 
ATOM   2915 N N   . PRO C 1 44  ? 9.305   -58.789 -3.374  1.00 64.54  ? 61  PRO C N   1 
ATOM   2916 C CA  . PRO C 1 44  ? 10.338  -58.789 -4.397  1.00 63.66  ? 61  PRO C CA  1 
ATOM   2917 C C   . PRO C 1 44  ? 11.459  -57.812 -4.066  1.00 61.09  ? 61  PRO C C   1 
ATOM   2918 O O   . PRO C 1 44  ? 11.194  -56.712 -3.588  1.00 63.13  ? 61  PRO C O   1 
ATOM   2919 C CB  . PRO C 1 44  ? 9.582   -58.330 -5.642  1.00 63.85  ? 61  PRO C CB  1 
ATOM   2920 C CG  . PRO C 1 44  ? 8.454   -57.532 -5.113  1.00 62.53  ? 61  PRO C CG  1 
ATOM   2921 C CD  . PRO C 1 44  ? 8.024   -58.303 -3.913  1.00 62.70  ? 61  PRO C CD  1 
ATOM   2922 N N   . ALA C 1 45  ? 12.696  -58.208 -4.332  1.00 59.01  ? 62  ALA C N   1 
ATOM   2923 C CA  . ALA C 1 45  ? 13.859  -57.382 -3.998  1.00 56.99  ? 62  ALA C CA  1 
ATOM   2924 C C   . ALA C 1 45  ? 13.707  -55.921 -4.419  1.00 57.60  ? 62  ALA C C   1 
ATOM   2925 O O   . ALA C 1 45  ? 14.145  -55.002 -3.705  1.00 61.87  ? 62  ALA C O   1 
ATOM   2926 C CB  . ALA C 1 45  ? 15.109  -57.968 -4.620  1.00 55.88  ? 62  ALA C CB  1 
ATOM   2927 N N   . HIS C 1 46  ? 13.078  -55.689 -5.567  1.00 54.93  ? 63  HIS C N   1 
ATOM   2928 C CA  . HIS C 1 46  ? 13.023  -54.338 -6.094  1.00 52.94  ? 63  HIS C CA  1 
ATOM   2929 C C   . HIS C 1 46  ? 12.180  -53.447 -5.178  1.00 51.98  ? 63  HIS C C   1 
ATOM   2930 O O   . HIS C 1 46  ? 12.484  -52.267 -5.007  1.00 52.53  ? 63  HIS C O   1 
ATOM   2931 C CB  . HIS C 1 46  ? 12.543  -54.331 -7.554  1.00 52.78  ? 63  HIS C CB  1 
ATOM   2932 C CG  . HIS C 1 46  ? 11.080  -54.548 -7.706  1.00 51.76  ? 63  HIS C CG  1 
ATOM   2933 N ND1 . HIS C 1 46  ? 10.516  -55.804 -7.723  1.00 52.96  ? 63  HIS C ND1 1 
ATOM   2934 C CD2 . HIS C 1 46  ? 10.058  -53.670 -7.819  1.00 51.06  ? 63  HIS C CD2 1 
ATOM   2935 C CE1 . HIS C 1 46  ? 9.204   -55.692 -7.838  1.00 52.40  ? 63  HIS C CE1 1 
ATOM   2936 N NE2 . HIS C 1 46  ? 8.900   -54.407 -7.907  1.00 52.63  ? 63  HIS C NE2 1 
ATOM   2937 N N   . ALA C 1 47  ? 11.152  -54.020 -4.556  1.00 50.73  ? 64  ALA C N   1 
ATOM   2938 C CA  . ALA C 1 47  ? 10.295  -53.259 -3.646  1.00 50.68  ? 64  ALA C CA  1 
ATOM   2939 C C   . ALA C 1 47  ? 11.009  -52.848 -2.351  1.00 50.77  ? 64  ALA C C   1 
ATOM   2940 O O   . ALA C 1 47  ? 10.719  -51.796 -1.774  0.50 47.77  ? 64  ALA C O   1 
ATOM   2941 C CB  . ALA C 1 47  ? 9.060   -54.057 -3.315  1.00 51.18  ? 64  ALA C CB  1 
ATOM   2942 N N   . ILE C 1 48  ? 11.939  -53.693 -1.910  1.00 52.31  ? 65  ILE C N   1 
ATOM   2943 C CA  . ILE C 1 48  ? 12.720  -53.432 -0.711  1.00 51.64  ? 65  ILE C CA  1 
ATOM   2944 C C   . ILE C 1 48  ? 13.772  -52.395 -1.017  1.00 52.93  ? 65  ILE C C   1 
ATOM   2945 O O   . ILE C 1 48  ? 14.012  -51.486 -0.221  1.00 56.97  ? 65  ILE C O   1 
ATOM   2946 C CB  . ILE C 1 48  ? 13.416  -54.700 -0.197  1.00 50.47  ? 65  ILE C CB  1 
ATOM   2947 C CG1 . ILE C 1 48  ? 12.379  -55.750 0.220   1.00 49.46  ? 65  ILE C CG1 1 
ATOM   2948 C CG2 . ILE C 1 48  ? 14.329  -54.364 0.973   1.00 50.28  ? 65  ILE C CG2 1 
ATOM   2949 C CD1 . ILE C 1 48  ? 12.969  -57.124 0.425   1.00 49.88  ? 65  ILE C CD1 1 
ATOM   2950 N N   . TRP C 1 49  ? 14.397  -52.533 -2.181  1.00 55.68  ? 66  TRP C N   1 
ATOM   2951 C CA  . TRP C 1 49  ? 15.496  -51.648 -2.583  1.00 54.15  ? 66  TRP C CA  1 
ATOM   2952 C C   . TRP C 1 49  ? 15.022  -50.191 -2.658  1.00 52.53  ? 66  TRP C C   1 
ATOM   2953 O O   . TRP C 1 49  ? 15.713  -49.280 -2.187  1.00 51.13  ? 66  TRP C O   1 
ATOM   2954 C CB  . TRP C 1 49  ? 16.053  -52.112 -3.935  1.00 54.48  ? 66  TRP C CB  1 
ATOM   2955 C CG  . TRP C 1 49  ? 17.239  -51.347 -4.417  1.00 54.83  ? 66  TRP C CG  1 
ATOM   2956 C CD1 . TRP C 1 49  ? 17.345  -50.696 -5.587  1.00 54.86  ? 66  TRP C CD1 1 
ATOM   2957 C CD2 . TRP C 1 49  ? 18.492  -51.150 -3.729  1.00 55.89  ? 66  TRP C CD2 1 
ATOM   2958 N NE1 . TRP C 1 49  ? 18.580  -50.103 -5.695  1.00 56.95  ? 66  TRP C NE1 1 
ATOM   2959 C CE2 . TRP C 1 49  ? 19.305  -50.368 -4.569  1.00 55.21  ? 66  TRP C CE2 1 
ATOM   2960 C CE3 . TRP C 1 49  ? 19.001  -51.557 -2.480  1.00 53.65  ? 66  TRP C CE3 1 
ATOM   2961 C CZ2 . TRP C 1 49  ? 20.595  -49.989 -4.219  1.00 56.31  ? 66  TRP C CZ2 1 
ATOM   2962 C CZ3 . TRP C 1 49  ? 20.283  -51.184 -2.130  1.00 52.56  ? 66  TRP C CZ3 1 
ATOM   2963 C CH2 . TRP C 1 49  ? 21.071  -50.412 -2.995  1.00 54.96  ? 66  TRP C CH2 1 
ATOM   2964 N N   . ARG C 1 50  ? 13.830  -49.989 -3.224  1.00 50.62  ? 67  ARG C N   1 
ATOM   2965 C CA  . ARG C 1 50  ? 13.244  -48.660 -3.331  1.00 49.42  ? 67  ARG C CA  1 
ATOM   2966 C C   . ARG C 1 50  ? 13.479  -47.888 -2.054  1.00 47.38  ? 67  ARG C C   1 
ATOM   2967 O O   . ARG C 1 50  ? 13.825  -46.699 -2.102  1.00 45.57  ? 67  ARG C O   1 
ATOM   2968 C CB  . ARG C 1 50  ? 11.745  -48.719 -3.636  1.00 50.52  ? 67  ARG C CB  1 
ATOM   2969 C CG  . ARG C 1 50  ? 11.386  -48.814 -5.123  1.00 51.71  ? 67  ARG C CG  1 
ATOM   2970 N N   . PHE C 1 51  ? 13.327  -48.580 -0.919  1.00 46.39  ? 68  PHE C N   1 
ATOM   2971 C CA  . PHE C 1 51  ? 13.534  -47.975 0.407   1.00 43.91  ? 68  PHE C CA  1 
ATOM   2972 C C   . PHE C 1 51  ? 14.993  -47.996 0.838   1.00 43.73  ? 68  PHE C C   1 
ATOM   2973 O O   . PHE C 1 51  ? 15.499  -47.014 1.375   1.00 44.44  ? 68  PHE C O   1 
ATOM   2974 C CB  . PHE C 1 51  ? 12.710  -48.686 1.473   1.00 42.97  ? 68  PHE C CB  1 
ATOM   2975 C CG  . PHE C 1 51  ? 11.205  -48.590 1.286   1.00 41.44  ? 68  PHE C CG  1 
ATOM   2976 C CD1 . PHE C 1 51  ? 10.522  -47.430 1.611   1.00 41.15  ? 68  PHE C CD1 1 
ATOM   2977 C CD2 . PHE C 1 51  ? 10.467  -49.695 0.876   1.00 40.55  ? 68  PHE C CD2 1 
ATOM   2978 C CE1 . PHE C 1 51  ? 9.144   -47.351 1.485   1.00 41.26  ? 68  PHE C CE1 1 
ATOM   2979 C CE2 . PHE C 1 51  ? 9.086   -49.627 0.755   1.00 40.70  ? 68  PHE C CE2 1 
ATOM   2980 C CZ  . PHE C 1 51  ? 8.423   -48.447 1.051   1.00 41.09  ? 68  PHE C CZ  1 
ATOM   2981 N N   . VAL C 1 52  ? 15.673  -49.111 0.633   1.00 43.81  ? 69  VAL C N   1 
ATOM   2982 C CA  . VAL C 1 52  ? 17.045  -49.228 1.133   1.00 44.32  ? 69  VAL C CA  1 
ATOM   2983 C C   . VAL C 1 52  ? 17.908  -48.112 0.557   1.00 48.49  ? 69  VAL C C   1 
ATOM   2984 O O   . VAL C 1 52  ? 18.607  -47.419 1.305   1.00 51.20  ? 69  VAL C O   1 
ATOM   2985 C CB  . VAL C 1 52  ? 17.671  -50.595 0.798   1.00 43.43  ? 69  VAL C CB  1 
ATOM   2986 C CG1 . VAL C 1 52  ? 19.143  -50.653 1.203   1.00 42.74  ? 69  VAL C CG1 1 
ATOM   2987 C CG2 . VAL C 1 52  ? 16.888  -51.722 1.450   1.00 43.14  ? 69  VAL C CG2 1 
ATOM   2988 N N   . ARG C 1 53  ? 17.837  -47.928 -0.768  1.00 51.80  ? 70  ARG C N   1 
ATOM   2989 C CA  . ARG C 1 53  ? 18.643  -46.915 -1.477  1.00 53.11  ? 70  ARG C CA  1 
ATOM   2990 C C   . ARG C 1 53  ? 18.310  -45.472 -1.114  1.00 53.19  ? 70  ARG C C   1 
ATOM   2991 O O   . ARG C 1 53  ? 19.119  -44.586 -1.357  1.00 56.35  ? 70  ARG C O   1 
ATOM   2992 C CB  . ARG C 1 53  ? 18.496  -47.069 -2.999  1.00 55.35  ? 70  ARG C CB  1 
ATOM   2993 C CG  . ARG C 1 53  ? 17.252  -46.416 -3.590  1.00 56.71  ? 70  ARG C CG  1 
ATOM   2994 C CD  . ARG C 1 53  ? 16.871  -47.007 -4.954  1.00 59.45  ? 70  ARG C CD  1 
ATOM   2995 N NE  . ARG C 1 53  ? 17.727  -46.509 -6.034  1.00 61.98  ? 70  ARG C NE  1 
ATOM   2996 C CZ  . ARG C 1 53  ? 17.556  -45.358 -6.691  1.00 61.50  ? 70  ARG C CZ  1 
ATOM   2997 N NH1 . ARG C 1 53  ? 16.553  -44.534 -6.419  1.00 58.28  ? 70  ARG C NH1 1 
ATOM   2998 N NH2 . ARG C 1 53  ? 18.412  -45.024 -7.638  1.00 66.67  ? 70  ARG C NH2 1 
ATOM   2999 N N   . ASP C 1 54  ? 17.117  -45.237 -0.574  1.00 53.07  ? 71  ASP C N   1 
ATOM   3000 C CA  . ASP C 1 54  ? 16.619  -43.882 -0.326  1.00 54.05  ? 71  ASP C CA  1 
ATOM   3001 C C   . ASP C 1 54  ? 17.413  -43.235 0.810   1.00 55.64  ? 71  ASP C C   1 
ATOM   3002 O O   . ASP C 1 54  ? 16.976  -43.174 1.969   1.00 56.66  ? 71  ASP C O   1 
ATOM   3003 C CB  . ASP C 1 54  ? 15.118  -43.917 -0.015  1.00 53.33  ? 71  ASP C CB  1 
ATOM   3004 C CG  . ASP C 1 54  ? 14.495  -42.536 0.052   1.00 55.38  ? 71  ASP C CG  1 
ATOM   3005 O OD1 . ASP C 1 54  ? 15.220  -41.525 0.023   1.00 59.27  ? 71  ASP C OD1 1 
ATOM   3006 O OD2 . ASP C 1 54  ? 13.260  -42.451 0.144   1.00 57.96  ? 71  ASP C OD2 1 
ATOM   3007 N N   . PHE C 1 55  ? 18.585  -42.736 0.447   1.00 55.24  ? 72  PHE C N   1 
ATOM   3008 C CA  . PHE C 1 55  ? 19.557  -42.270 1.407   1.00 53.17  ? 72  PHE C CA  1 
ATOM   3009 C C   . PHE C 1 55  ? 19.064  -41.062 2.183   1.00 54.40  ? 72  PHE C C   1 
ATOM   3010 O O   . PHE C 1 55  ? 19.473  -40.855 3.317   1.00 57.28  ? 72  PHE C O   1 
ATOM   3011 C CB  . PHE C 1 55  ? 20.849  -41.924 0.686   1.00 54.47  ? 72  PHE C CB  1 
ATOM   3012 C CG  . PHE C 1 55  ? 22.026  -41.768 1.591   1.00 55.15  ? 72  PHE C CG  1 
ATOM   3013 C CD1 . PHE C 1 55  ? 22.509  -42.856 2.315   1.00 54.68  ? 72  PHE C CD1 1 
ATOM   3014 C CD2 . PHE C 1 55  ? 22.653  -40.544 1.726   1.00 55.63  ? 72  PHE C CD2 1 
ATOM   3015 C CE1 . PHE C 1 55  ? 23.591  -42.718 3.157   1.00 52.93  ? 72  PHE C CE1 1 
ATOM   3016 C CE2 . PHE C 1 55  ? 23.746  -40.403 2.561   1.00 55.06  ? 72  PHE C CE2 1 
ATOM   3017 C CZ  . PHE C 1 55  ? 24.214  -41.489 3.271   1.00 54.53  ? 72  PHE C CZ  1 
ATOM   3018 N N   . ALA C 1 56  ? 18.192  -40.262 1.590   1.00 54.67  ? 73  ALA C N   1 
ATOM   3019 C CA  . ALA C 1 56  ? 17.688  -39.079 2.277   1.00 57.33  ? 73  ALA C CA  1 
ATOM   3020 C C   . ALA C 1 56  ? 16.464  -39.369 3.117   1.00 59.45  ? 73  ALA C C   1 
ATOM   3021 O O   . ALA C 1 56  ? 15.950  -38.467 3.771   1.00 63.12  ? 73  ALA C O   1 
ATOM   3022 C CB  . ALA C 1 56  ? 17.364  -37.980 1.291   1.00 58.04  ? 73  ALA C CB  1 
ATOM   3023 N N   . ASN C 1 57  ? 15.973  -40.603 3.103   1.00 57.21  ? 74  ASN C N   1 
ATOM   3024 C CA  . ASN C 1 57  ? 14.812  -40.920 3.925   1.00 59.33  ? 74  ASN C CA  1 
ATOM   3025 C C   . ASN C 1 57  ? 14.930  -42.244 4.687   1.00 58.94  ? 74  ASN C C   1 
ATOM   3026 O O   . ASN C 1 57  ? 14.084  -43.125 4.555   1.00 62.92  ? 74  ASN C O   1 
ATOM   3027 C CB  . ASN C 1 57  ? 13.539  -40.848 3.073   1.00 59.97  ? 74  ASN C CB  1 
ATOM   3028 C CG  . ASN C 1 57  ? 13.293  -39.458 2.510   1.00 59.82  ? 74  ASN C CG  1 
ATOM   3029 O OD1 . ASN C 1 57  ? 12.842  -38.562 3.216   1.00 57.25  ? 74  ASN C OD1 1 
ATOM   3030 N ND2 . ASN C 1 57  ? 13.594  -39.275 1.229   1.00 61.64  ? 74  ASN C ND2 1 
ATOM   3031 N N   . PRO C 1 58  ? 15.982  -42.379 5.504   1.00 59.54  ? 75  PRO C N   1 
ATOM   3032 C CA  . PRO C 1 58  ? 16.122  -43.560 6.364   1.00 60.95  ? 75  PRO C CA  1 
ATOM   3033 C C   . PRO C 1 58  ? 14.941  -43.749 7.322   1.00 62.41  ? 75  PRO C C   1 
ATOM   3034 O O   . PRO C 1 58  ? 14.522  -44.878 7.570   1.00 59.65  ? 75  PRO C O   1 
ATOM   3035 C CB  . PRO C 1 58  ? 17.412  -43.289 7.148   1.00 60.81  ? 75  PRO C CB  1 
ATOM   3036 C CG  . PRO C 1 58  ? 17.784  -41.864 6.890   1.00 61.31  ? 75  PRO C CG  1 
ATOM   3037 C CD  . PRO C 1 58  ? 17.122  -41.453 5.621   1.00 60.57  ? 75  PRO C CD  1 
ATOM   3038 N N   . ASN C 1 59  ? 14.414  -42.641 7.842   1.00 66.76  ? 76  ASN C N   1 
ATOM   3039 C CA  . ASN C 1 59  ? 13.257  -42.663 8.750   1.00 66.76  ? 76  ASN C CA  1 
ATOM   3040 C C   . ASN C 1 59  ? 12.068  -43.444 8.216   1.00 65.56  ? 76  ASN C C   1 
ATOM   3041 O O   . ASN C 1 59  ? 11.253  -43.922 9.012   1.00 69.70  ? 76  ASN C O   1 
ATOM   3042 C CB  . ASN C 1 59  ? 12.803  -41.244 9.122   1.00 67.50  ? 76  ASN C CB  1 
ATOM   3043 C CG  . ASN C 1 59  ? 12.344  -40.438 7.920   1.00 68.55  ? 76  ASN C CG  1 
ATOM   3044 O OD1 . ASN C 1 59  ? 11.152  -40.184 7.752   0.50 67.50  ? 76  ASN C OD1 1 
ATOM   3045 N ND2 . ASN C 1 59  ? 13.292  -40.034 7.075   1.00 66.14  ? 76  ASN C ND2 1 
ATOM   3046 N N   . LYS C 1 60  ? 11.963  -43.573 6.891   1.00 60.91  ? 77  LYS C N   1 
ATOM   3047 C CA  . LYS C 1 60  ? 10.921  -44.402 6.282   1.00 61.10  ? 77  LYS C CA  1 
ATOM   3048 C C   . LYS C 1 60  ? 10.883  -45.813 6.859   1.00 58.44  ? 77  LYS C C   1 
ATOM   3049 O O   . LYS C 1 60  ? 9.804   -46.387 7.020   1.00 59.46  ? 77  LYS C O   1 
ATOM   3050 C CB  . LYS C 1 60  ? 11.077  -44.474 4.756   1.00 64.48  ? 77  LYS C CB  1 
ATOM   3051 C CG  . LYS C 1 60  ? 10.146  -43.556 3.962   1.00 67.19  ? 77  LYS C CG  1 
ATOM   3052 C CD  . LYS C 1 60  ? 10.200  -42.101 4.412   1.00 67.28  ? 77  LYS C CD  1 
ATOM   3053 N N   . TYR C 1 61  ? 12.046  -46.376 7.168   1.00 56.54  ? 78  TYR C N   1 
ATOM   3054 C CA  . TYR C 1 61  ? 12.103  -47.693 7.820   1.00 56.02  ? 78  TYR C CA  1 
ATOM   3055 C C   . TYR C 1 61  ? 13.027  -47.793 9.038   1.00 53.45  ? 78  TYR C C   1 
ATOM   3056 O O   . TYR C 1 61  ? 13.149  -48.868 9.604   1.00 53.42  ? 78  TYR C O   1 
ATOM   3057 C CB  . TYR C 1 61  ? 12.473  -48.787 6.805   1.00 54.96  ? 78  TYR C CB  1 
ATOM   3058 C CG  . TYR C 1 61  ? 13.929  -48.817 6.408   1.00 55.52  ? 78  TYR C CG  1 
ATOM   3059 C CD1 . TYR C 1 61  ? 14.431  -47.955 5.427   1.00 55.75  ? 78  TYR C CD1 1 
ATOM   3060 C CD2 . TYR C 1 61  ? 14.816  -49.714 7.005   1.00 58.25  ? 78  TYR C CD2 1 
ATOM   3061 C CE1 . TYR C 1 61  ? 15.775  -47.981 5.060   1.00 55.12  ? 78  TYR C CE1 1 
ATOM   3062 C CE2 . TYR C 1 61  ? 16.161  -49.753 6.642   1.00 57.54  ? 78  TYR C CE2 1 
ATOM   3063 C CZ  . TYR C 1 61  ? 16.631  -48.885 5.670   1.00 56.68  ? 78  TYR C CZ  1 
ATOM   3064 O OH  . TYR C 1 61  ? 17.950  -48.926 5.321   1.00 57.86  ? 78  TYR C OH  1 
ATOM   3065 N N   . LYS C 1 62  ? 13.663  -46.703 9.449   1.00 53.69  ? 79  LYS C N   1 
ATOM   3066 C CA  . LYS C 1 62  ? 14.516  -46.723 10.658  1.00 55.24  ? 79  LYS C CA  1 
ATOM   3067 C C   . LYS C 1 62  ? 13.860  -45.936 11.766  1.00 54.63  ? 79  LYS C C   1 
ATOM   3068 O O   . LYS C 1 62  ? 13.835  -44.708 11.749  1.00 54.34  ? 79  LYS C O   1 
ATOM   3069 C CB  . LYS C 1 62  ? 15.910  -46.168 10.373  1.00 54.42  ? 79  LYS C CB  1 
ATOM   3070 C CG  . LYS C 1 62  ? 16.705  -47.033 9.402   1.00 55.74  ? 79  LYS C CG  1 
ATOM   3071 C CD  . LYS C 1 62  ? 17.989  -46.337 8.977   1.00 56.41  ? 79  LYS C CD  1 
ATOM   3072 C CE  . LYS C 1 62  ? 18.958  -47.272 8.283   1.00 56.62  ? 79  LYS C CE  1 
ATOM   3073 N NZ  . LYS C 1 62  ? 20.233  -46.560 7.954   1.00 58.09  ? 79  LYS C NZ  1 
ATOM   3074 N N   . HIS C 1 63  ? 13.335  -46.663 12.736  1.00 56.00  ? 80  HIS C N   1 
ATOM   3075 C CA  . HIS C 1 63  ? 12.402  -46.096 13.678  1.00 58.36  ? 80  HIS C CA  1 
ATOM   3076 C C   . HIS C 1 63  ? 13.010  -45.128 14.672  1.00 57.75  ? 80  HIS C C   1 
ATOM   3077 O O   . HIS C 1 63  ? 12.291  -44.317 15.245  1.00 59.92  ? 80  HIS C O   1 
ATOM   3078 C CB  . HIS C 1 63  ? 11.680  -47.210 14.429  1.00 62.28  ? 80  HIS C CB  1 
ATOM   3079 C CG  . HIS C 1 63  ? 10.834  -46.721 15.563  1.00 65.35  ? 80  HIS C CG  1 
ATOM   3080 N ND1 . HIS C 1 63  ? 11.214  -46.850 16.880  1.00 66.32  ? 80  HIS C ND1 1 
ATOM   3081 C CD2 . HIS C 1 63  ? 9.644   -46.079 15.577  1.00 67.05  ? 80  HIS C CD2 1 
ATOM   3082 C CE1 . HIS C 1 63  ? 10.282  -46.332 17.657  1.00 69.06  ? 80  HIS C CE1 1 
ATOM   3083 N NE2 . HIS C 1 63  ? 9.314   -45.864 16.891  1.00 70.42  ? 80  HIS C NE2 1 
ATOM   3084 N N   . PHE C 1 64  ? 14.315  -45.208 14.892  1.00 57.50  ? 81  PHE C N   1 
ATOM   3085 C CA  . PHE C 1 64  ? 14.958  -44.321 15.858  1.00 56.51  ? 81  PHE C CA  1 
ATOM   3086 C C   . PHE C 1 64  ? 15.552  -43.088 15.215  1.00 55.37  ? 81  PHE C C   1 
ATOM   3087 O O   . PHE C 1 64  ? 16.151  -42.273 15.907  1.00 53.58  ? 81  PHE C O   1 
ATOM   3088 C CB  . PHE C 1 64  ? 16.001  -45.090 16.643  1.00 58.01  ? 81  PHE C CB  1 
ATOM   3089 C CG  . PHE C 1 64  ? 15.421  -46.259 17.366  1.00 60.92  ? 81  PHE C CG  1 
ATOM   3090 C CD1 . PHE C 1 64  ? 14.731  -46.073 18.560  1.00 64.39  ? 81  PHE C CD1 1 
ATOM   3091 C CD2 . PHE C 1 64  ? 15.490  -47.527 16.827  1.00 60.50  ? 81  PHE C CD2 1 
ATOM   3092 C CE1 . PHE C 1 64  ? 14.159  -47.140 19.217  1.00 64.78  ? 81  PHE C CE1 1 
ATOM   3093 C CE2 . PHE C 1 64  ? 14.927  -48.607 17.487  1.00 62.77  ? 81  PHE C CE2 1 
ATOM   3094 C CZ  . PHE C 1 64  ? 14.256  -48.412 18.677  1.00 64.93  ? 81  PHE C CZ  1 
ATOM   3095 N N   . ILE C 1 65  ? 15.362  -42.941 13.902  1.00 55.06  ? 82  ILE C N   1 
ATOM   3096 C CA  . ILE C 1 65  ? 15.714  -41.706 13.208  1.00 58.18  ? 82  ILE C CA  1 
ATOM   3097 C C   . ILE C 1 65  ? 14.460  -40.850 13.016  1.00 60.84  ? 82  ILE C C   1 
ATOM   3098 O O   . ILE C 1 65  ? 13.558  -41.194 12.237  1.00 60.07  ? 82  ILE C O   1 
ATOM   3099 C CB  . ILE C 1 65  ? 16.433  -41.987 11.867  1.00 59.87  ? 82  ILE C CB  1 
ATOM   3100 C CG1 . ILE C 1 65  ? 17.917  -42.267 12.106  1.00 59.02  ? 82  ILE C CG1 1 
ATOM   3101 C CG2 . ILE C 1 65  ? 16.355  -40.800 10.922  1.00 62.22  ? 82  ILE C CG2 1 
ATOM   3102 C CD1 . ILE C 1 65  ? 18.190  -43.523 12.895  1.00 60.37  ? 82  ILE C CD1 1 
ATOM   3103 N N   . LYS C 1 66  ? 14.414  -39.736 13.743  1.00 63.24  ? 83  LYS C N   1 
ATOM   3104 C CA  . LYS C 1 66  ? 13.298  -38.795 13.660  1.00 69.30  ? 83  LYS C CA  1 
ATOM   3105 C C   . LYS C 1 66  ? 13.304  -38.044 12.327  1.00 71.62  ? 83  LYS C C   1 
ATOM   3106 O O   . LYS C 1 66  ? 12.289  -38.006 11.629  1.00 72.32  ? 83  LYS C O   1 
ATOM   3107 C CB  . LYS C 1 66  ? 13.351  -37.779 14.814  1.00 71.19  ? 83  LYS C CB  1 
ATOM   3108 C CG  . LYS C 1 66  ? 12.338  -36.643 14.701  1.00 72.86  ? 83  LYS C CG  1 
ATOM   3109 N N   . SER C 1 67  ? 14.443  -37.432 11.996  1.00 70.82  ? 84  SER C N   1 
ATOM   3110 C CA  . SER C 1 67  ? 14.564  -36.632 10.776  1.00 69.50  ? 84  SER C CA  1 
ATOM   3111 C C   . SER C 1 67  ? 15.967  -36.721 10.196  1.00 66.95  ? 84  SER C C   1 
ATOM   3112 O O   . SER C 1 67  ? 16.939  -36.948 10.922  1.00 61.47  ? 84  SER C O   1 
ATOM   3113 C CB  . SER C 1 67  ? 14.200  -35.164 11.039  1.00 70.08  ? 84  SER C CB  1 
ATOM   3114 O OG  . SER C 1 67  ? 15.360  -34.348 11.148  1.00 70.88  ? 84  SER C OG  1 
ATOM   3115 N N   . CYS C 1 68  ? 16.043  -36.527 8.879   1.00 65.96  ? 85  CYS C N   1 
ATOM   3116 C CA  . CYS C 1 68  ? 17.294  -36.557 8.133   1.00 63.74  ? 85  CYS C CA  1 
ATOM   3117 C C   . CYS C 1 68  ? 17.480  -35.225 7.424   1.00 65.07  ? 85  CYS C C   1 
ATOM   3118 O O   . CYS C 1 68  ? 16.529  -34.453 7.300   1.00 66.97  ? 85  CYS C O   1 
ATOM   3119 C CB  . CYS C 1 68  ? 17.236  -37.685 7.110   1.00 63.29  ? 85  CYS C CB  1 
ATOM   3120 S SG  . CYS C 1 68  ? 18.773  -37.967 6.217   1.00 64.12  ? 85  CYS C SG  1 
ATOM   3121 N N   . THR C 1 69  ? 18.703  -34.939 6.982   1.00 65.76  ? 86  THR C N   1 
ATOM   3122 C CA  . THR C 1 69  ? 18.977  -33.755 6.156   1.00 67.40  ? 86  THR C CA  1 
ATOM   3123 C C   . THR C 1 69  ? 20.271  -33.949 5.374   1.00 67.56  ? 86  THR C C   1 
ATOM   3124 O O   . THR C 1 69  ? 21.308  -34.252 5.974   1.00 68.31  ? 86  THR C O   1 
ATOM   3125 C CB  . THR C 1 69  ? 19.129  -32.463 6.993   1.00 71.17  ? 86  THR C CB  1 
ATOM   3126 O OG1 . THR C 1 69  ? 17.975  -32.260 7.823   1.00 70.54  ? 86  THR C OG1 1 
ATOM   3127 C CG2 . THR C 1 69  ? 19.323  -31.238 6.072   1.00 72.63  ? 86  THR C CG2 1 
ATOM   3128 N N   . ILE C 1 70  ? 20.204  -33.775 4.051   1.00 66.57  ? 87  ILE C N   1 
ATOM   3129 C CA  . ILE C 1 70  ? 21.373  -33.920 3.178   1.00 68.57  ? 87  ILE C CA  1 
ATOM   3130 C C   . ILE C 1 70  ? 22.255  -32.669 3.279   1.00 71.84  ? 87  ILE C C   1 
ATOM   3131 O O   . ILE C 1 70  ? 21.821  -31.560 2.943   1.00 73.79  ? 87  ILE C O   1 
ATOM   3132 C CB  . ILE C 1 70  ? 20.974  -34.161 1.706   1.00 66.21  ? 87  ILE C CB  1 
ATOM   3133 N N   . ARG C 1 71  ? 23.490  -32.848 3.748   1.00 71.01  ? 88  ARG C N   1 
ATOM   3134 C CA  . ARG C 1 71  ? 24.387  -31.724 4.022   1.00 71.53  ? 88  ARG C CA  1 
ATOM   3135 C C   . ARG C 1 71  ? 25.334  -31.479 2.867   1.00 71.92  ? 88  ARG C C   1 
ATOM   3136 O O   . ARG C 1 71  ? 25.656  -30.335 2.565   1.00 74.59  ? 88  ARG C O   1 
ATOM   3137 C CB  . ARG C 1 71  ? 25.181  -31.967 5.312   1.00 71.01  ? 88  ARG C CB  1 
ATOM   3138 C CG  . ARG C 1 71  ? 24.320  -32.073 6.556   1.00 71.05  ? 88  ARG C CG  1 
ATOM   3139 C CD  . ARG C 1 71  ? 23.502  -30.812 6.799   1.00 73.83  ? 88  ARG C CD  1 
ATOM   3140 N NE  . ARG C 1 71  ? 22.731  -30.910 8.034   1.00 75.98  ? 88  ARG C NE  1 
ATOM   3141 C CZ  . ARG C 1 71  ? 22.196  -29.881 8.693   1.00 77.88  ? 88  ARG C CZ  1 
ATOM   3142 N NH1 . ARG C 1 71  ? 22.331  -28.634 8.254   1.00 80.11  ? 88  ARG C NH1 1 
ATOM   3143 N NH2 . ARG C 1 71  ? 21.520  -30.104 9.813   1.00 77.27  ? 88  ARG C NH2 1 
ATOM   3144 N N   . VAL C 1 72  ? 25.797  -32.549 2.235   1.00 71.28  ? 89  VAL C N   1 
ATOM   3145 C CA  . VAL C 1 72  ? 26.599  -32.428 1.025   1.00 73.87  ? 89  VAL C CA  1 
ATOM   3146 C C   . VAL C 1 72  ? 25.937  -33.263 -0.059  1.00 75.58  ? 89  VAL C C   1 
ATOM   3147 O O   . VAL C 1 72  ? 25.812  -34.477 0.092   1.00 78.59  ? 89  VAL C O   1 
ATOM   3148 C CB  . VAL C 1 72  ? 28.049  -32.900 1.255   1.00 74.32  ? 89  VAL C CB  1 
ATOM   3149 C CG1 . VAL C 1 72  ? 28.862  -32.797 -0.036  1.00 74.44  ? 89  VAL C CG1 1 
ATOM   3150 C CG2 . VAL C 1 72  ? 28.695  -32.100 2.386   1.00 73.26  ? 89  VAL C CG2 1 
ATOM   3151 N N   . ASN C 1 73  ? 25.494  -32.604 -1.132  1.00 79.38  ? 90  ASN C N   1 
ATOM   3152 C CA  . ASN C 1 73  ? 24.824  -33.275 -2.254  1.00 80.37  ? 90  ASN C CA  1 
ATOM   3153 C C   . ASN C 1 73  ? 25.766  -34.234 -2.989  1.00 79.92  ? 90  ASN C C   1 
ATOM   3154 O O   . ASN C 1 73  ? 26.988  -34.069 -2.965  1.00 79.84  ? 90  ASN C O   1 
ATOM   3155 C CB  . ASN C 1 73  ? 24.255  -32.250 -3.262  1.00 81.80  ? 90  ASN C CB  1 
ATOM   3156 C CG  . ASN C 1 73  ? 23.105  -31.409 -2.700  0.50 82.17  ? 90  ASN C CG  1 
ATOM   3157 O OD1 . ASN C 1 73  ? 22.829  -30.321 -3.206  1.00 86.70  ? 90  ASN C OD1 1 
ATOM   3158 N ND2 . ASN C 1 73  ? 22.424  -31.909 -1.677  1.00 79.48  ? 90  ASN C ND2 1 
ATOM   3159 N N   . GLU C 1 79  ? 21.992  -36.436 -7.858  1.00 88.77  ? 96  GLU C N   1 
ATOM   3160 C CA  . GLU C 1 79  ? 21.393  -36.107 -6.573  1.00 86.71  ? 96  GLU C CA  1 
ATOM   3161 C C   . GLU C 1 79  ? 21.956  -36.991 -5.454  0.50 81.88  ? 96  GLU C C   1 
ATOM   3162 O O   . GLU C 1 79  ? 22.689  -36.491 -4.597  1.00 81.26  ? 96  GLU C O   1 
ATOM   3163 C CB  . GLU C 1 79  ? 19.859  -36.173 -6.640  1.00 90.25  ? 96  GLU C CB  1 
ATOM   3164 C CG  . GLU C 1 79  ? 19.264  -37.457 -7.226  1.00 93.51  ? 96  GLU C CG  1 
ATOM   3165 C CD  . GLU C 1 79  ? 19.814  -37.807 -8.603  1.00 95.16  ? 96  GLU C CD  1 
ATOM   3166 O OE1 . GLU C 1 79  ? 20.789  -38.594 -8.694  1.00 93.19  ? 96  GLU C OE1 1 
ATOM   3167 O OE2 . GLU C 1 79  ? 19.272  -37.280 -9.598  1.00 96.63  ? 96  GLU C OE2 1 
ATOM   3168 N N   . ILE C 1 80  ? 21.653  -38.292 -5.474  1.00 76.09  ? 97  ILE C N   1 
ATOM   3169 C CA  . ILE C 1 80  ? 22.119  -39.198 -4.417  1.00 76.26  ? 97  ILE C CA  1 
ATOM   3170 C C   . ILE C 1 80  ? 23.066  -40.222 -5.012  1.00 72.98  ? 97  ILE C C   1 
ATOM   3171 O O   . ILE C 1 80  ? 22.641  -41.198 -5.631  1.00 73.75  ? 97  ILE C O   1 
ATOM   3172 C CB  . ILE C 1 80  ? 20.972  -39.918 -3.655  1.00 75.40  ? 97  ILE C CB  1 
ATOM   3173 C CG1 . ILE C 1 80  ? 20.067  -38.910 -2.929  1.00 75.34  ? 97  ILE C CG1 1 
ATOM   3174 C CG2 . ILE C 1 80  ? 21.531  -40.918 -2.644  1.00 70.20  ? 97  ILE C CG2 1 
ATOM   3175 C CD1 . ILE C 1 80  ? 20.774  -38.012 -1.941  1.00 74.28  ? 97  ILE C CD1 1 
ATOM   3176 N N   . LYS C 1 81  ? 24.353  -39.976 -4.802  1.00 70.58  ? 98  LYS C N   1 
ATOM   3177 C CA  . LYS C 1 81  ? 25.412  -40.847 -5.279  1.00 68.80  ? 98  LYS C CA  1 
ATOM   3178 C C   . LYS C 1 81  ? 26.478  -40.989 -4.203  1.00 64.87  ? 98  LYS C C   1 
ATOM   3179 O O   . LYS C 1 81  ? 26.418  -40.354 -3.147  1.00 60.39  ? 98  LYS C O   1 
ATOM   3180 C CB  . LYS C 1 81  ? 26.041  -40.287 -6.572  1.00 70.63  ? 98  LYS C CB  1 
ATOM   3181 C CG  . LYS C 1 81  ? 26.864  -39.019 -6.390  1.00 69.70  ? 98  LYS C CG  1 
ATOM   3182 N N   . VAL C 1 82  ? 27.458  -41.833 -4.491  1.00 61.84  ? 99  VAL C N   1 
ATOM   3183 C CA  . VAL C 1 82  ? 28.565  -42.018 -3.597  1.00 59.11  ? 99  VAL C CA  1 
ATOM   3184 C C   . VAL C 1 82  ? 29.190  -40.670 -3.313  1.00 60.70  ? 99  VAL C C   1 
ATOM   3185 O O   . VAL C 1 82  ? 29.478  -39.910 -4.229  1.00 67.45  ? 99  VAL C O   1 
ATOM   3186 C CB  . VAL C 1 82  ? 29.609  -42.948 -4.200  1.00 57.30  ? 99  VAL C CB  1 
ATOM   3187 C CG1 . VAL C 1 82  ? 30.877  -42.941 -3.352  1.00 57.70  ? 99  VAL C CG1 1 
ATOM   3188 C CG2 . VAL C 1 82  ? 29.026  -44.348 -4.328  1.00 55.46  ? 99  VAL C CG2 1 
ATOM   3189 N N   . GLY C 1 83  ? 29.375  -40.375 -2.033  1.00 62.37  ? 100 GLY C N   1 
ATOM   3190 C CA  . GLY C 1 83  ? 29.978  -39.114 -1.599  1.00 61.85  ? 100 GLY C CA  1 
ATOM   3191 C C   . GLY C 1 83  ? 28.997  -38.272 -0.813  1.00 59.88  ? 100 GLY C C   1 
ATOM   3192 O O   . GLY C 1 83  ? 29.400  -37.518 0.062   1.00 61.29  ? 100 GLY C O   1 
ATOM   3193 N N   . THR C 1 84  ? 27.710  -38.409 -1.124  1.00 56.27  ? 101 THR C N   1 
ATOM   3194 C CA  . THR C 1 84  ? 26.661  -37.706 -0.415  1.00 57.24  ? 101 THR C CA  1 
ATOM   3195 C C   . THR C 1 84  ? 26.799  -37.885 1.116   1.00 58.51  ? 101 THR C C   1 
ATOM   3196 O O   . THR C 1 84  ? 27.264  -38.918 1.595   1.00 55.59  ? 101 THR C O   1 
ATOM   3197 C CB  . THR C 1 84  ? 25.293  -38.196 -0.907  1.00 57.71  ? 101 THR C CB  1 
ATOM   3198 O OG1 . THR C 1 84  ? 25.194  -37.971 -2.313  1.00 59.29  ? 101 THR C OG1 1 
ATOM   3199 C CG2 . THR C 1 84  ? 24.155  -37.458 -0.236  1.00 60.30  ? 101 THR C CG2 1 
ATOM   3200 N N   . ILE C 1 85  ? 26.425  -36.864 1.878   1.00 59.97  ? 102 ILE C N   1 
ATOM   3201 C CA  . ILE C 1 85  ? 26.590  -36.911 3.329   1.00 61.72  ? 102 ILE C CA  1 
ATOM   3202 C C   . ILE C 1 85  ? 25.295  -36.568 4.042   1.00 61.89  ? 102 ILE C C   1 
ATOM   3203 O O   . ILE C 1 85  ? 24.661  -35.550 3.748   1.00 61.52  ? 102 ILE C O   1 
ATOM   3204 C CB  . ILE C 1 85  ? 27.719  -35.982 3.809   1.00 62.57  ? 102 ILE C CB  1 
ATOM   3205 C CG1 . ILE C 1 85  ? 29.065  -36.574 3.383   1.00 63.29  ? 102 ILE C CG1 1 
ATOM   3206 C CG2 . ILE C 1 85  ? 27.664  -35.798 5.326   1.00 62.41  ? 102 ILE C CG2 1 
ATOM   3207 C CD1 . ILE C 1 85  ? 30.256  -35.681 3.667   1.00 65.22  ? 102 ILE C CD1 1 
ATOM   3208 N N   . ARG C 1 86  ? 24.937  -37.441 4.984   1.00 62.99  ? 103 ARG C N   1 
ATOM   3209 C CA  . ARG C 1 86  ? 23.704  -37.357 5.773   1.00 62.88  ? 103 ARG C CA  1 
ATOM   3210 C C   . ARG C 1 86  ? 23.987  -36.710 7.098   1.00 63.65  ? 103 ARG C C   1 
ATOM   3211 O O   . ARG C 1 86  ? 25.069  -36.893 7.643   1.00 65.17  ? 103 ARG C O   1 
ATOM   3212 C CB  . ARG C 1 86  ? 23.208  -38.754 6.127   1.00 60.96  ? 103 ARG C CB  1 
ATOM   3213 C CG  . ARG C 1 86  ? 22.111  -39.310 5.268   1.00 61.94  ? 103 ARG C CG  1 
ATOM   3214 C CD  . ARG C 1 86  ? 21.275  -40.286 6.071   1.00 61.62  ? 103 ARG C CD  1 
ATOM   3215 N NE  . ARG C 1 86  ? 22.012  -41.472 6.504   1.00 60.45  ? 103 ARG C NE  1 
ATOM   3216 C CZ  . ARG C 1 86  ? 21.773  -42.715 6.090   1.00 61.83  ? 103 ARG C CZ  1 
ATOM   3217 N NH1 . ARG C 1 86  ? 20.823  -42.975 5.197   1.00 63.87  ? 103 ARG C NH1 1 
ATOM   3218 N NH2 . ARG C 1 86  ? 22.494  -43.717 6.579   1.00 62.49  ? 103 ARG C NH2 1 
ATOM   3219 N N   . GLU C 1 87  ? 23.004  -35.999 7.638   1.00 64.44  ? 104 GLU C N   1 
ATOM   3220 C CA  . GLU C 1 87  ? 22.960  -35.771 9.080   1.00 65.85  ? 104 GLU C CA  1 
ATOM   3221 C C   . GLU C 1 87  ? 21.586  -36.188 9.595   1.00 63.65  ? 104 GLU C C   1 
ATOM   3222 O O   . GLU C 1 87  ? 20.617  -35.430 9.519   1.00 62.97  ? 104 GLU C O   1 
ATOM   3223 C CB  . GLU C 1 87  ? 23.292  -34.324 9.457   1.00 69.39  ? 104 GLU C CB  1 
ATOM   3224 C CG  . GLU C 1 87  ? 23.794  -34.182 10.888  1.00 71.53  ? 104 GLU C CG  1 
ATOM   3225 C CD  . GLU C 1 87  ? 24.064  -32.742 11.307  1.00 75.98  ? 104 GLU C CD  1 
ATOM   3226 O OE1 . GLU C 1 87  ? 24.165  -31.841 10.443  1.00 74.09  ? 104 GLU C OE1 1 
ATOM   3227 O OE2 . GLU C 1 87  ? 24.184  -32.508 12.529  1.00 83.70  ? 104 GLU C OE2 1 
ATOM   3228 N N   . VAL C 1 88  ? 21.510  -37.427 10.077  1.00 63.18  ? 105 VAL C N   1 
ATOM   3229 C CA  . VAL C 1 88  ? 20.331  -37.919 10.784  1.00 63.60  ? 105 VAL C CA  1 
ATOM   3230 C C   . VAL C 1 88  ? 20.254  -37.246 12.148  1.00 65.05  ? 105 VAL C C   1 
ATOM   3231 O O   . VAL C 1 88  ? 21.284  -36.919 12.746  1.00 64.67  ? 105 VAL C O   1 
ATOM   3232 C CB  . VAL C 1 88  ? 20.388  -39.440 10.993  1.00 61.54  ? 105 VAL C CB  1 
ATOM   3233 C CG2 . VAL C 1 88  ? 20.203  -40.155 9.665   1.00 61.56  ? 105 VAL C CG2 1 
ATOM   3234 N N   . SER C 1 89  ? 19.034  -37.011 12.616  1.00 64.58  ? 106 SER C N   1 
ATOM   3235 C CA  . SER C 1 89  ? 18.827  -36.535 13.968  1.00 67.45  ? 106 SER C CA  1 
ATOM   3236 C C   . SER C 1 89  ? 18.045  -37.613 14.747  1.00 64.31  ? 106 SER C C   1 
ATOM   3237 O O   . SER C 1 89  ? 16.928  -37.966 14.374  1.00 63.39  ? 106 SER C O   1 
ATOM   3238 C CB  . SER C 1 89  ? 18.108  -35.183 13.950  1.00 70.74  ? 106 SER C CB  1 
ATOM   3239 O OG  . SER C 1 89  ? 16.724  -35.342 13.716  1.00 75.17  ? 106 SER C OG  1 
ATOM   3240 N N   . VAL C 1 90  ? 18.655  -38.137 15.815  1.00 61.87  ? 107 VAL C N   1 
ATOM   3241 C CA  . VAL C 1 90  ? 18.090  -39.253 16.581  1.00 57.11  ? 107 VAL C CA  1 
ATOM   3242 C C   . VAL C 1 90  ? 16.849  -38.808 17.339  1.00 58.82  ? 107 VAL C C   1 
ATOM   3243 O O   . VAL C 1 90  ? 16.684  -37.638 17.679  1.00 58.45  ? 107 VAL C O   1 
ATOM   3244 C CB  . VAL C 1 90  ? 19.079  -39.842 17.606  1.00 55.63  ? 107 VAL C CB  1 
ATOM   3245 C CG1 . VAL C 1 90  ? 18.552  -41.152 18.177  1.00 55.49  ? 107 VAL C CG1 1 
ATOM   3246 C CG2 . VAL C 1 90  ? 20.434  -40.108 16.985  1.00 56.80  ? 107 VAL C CG2 1 
ATOM   3247 N N   . VAL C 1 91  ? 15.965  -39.759 17.584  1.00 60.21  ? 108 VAL C N   1 
ATOM   3248 C CA  . VAL C 1 91  ? 14.772  -39.512 18.368  1.00 64.25  ? 108 VAL C CA  1 
ATOM   3249 C C   . VAL C 1 91  ? 15.141  -39.342 19.859  1.00 67.14  ? 108 VAL C C   1 
ATOM   3250 O O   . VAL C 1 91  ? 16.200  -39.802 20.316  1.00 68.17  ? 108 VAL C O   1 
ATOM   3251 C CB  . VAL C 1 91  ? 13.776  -40.677 18.154  1.00 64.45  ? 108 VAL C CB  1 
ATOM   3252 C CG1 . VAL C 1 91  ? 14.087  -41.854 19.076  1.00 63.56  ? 108 VAL C CG1 1 
ATOM   3253 C CG2 . VAL C 1 91  ? 12.347  -40.197 18.323  1.00 68.61  ? 108 VAL C CG2 1 
ATOM   3254 N N   . SER C 1 92  ? 14.285  -38.668 20.618  1.00 71.73  ? 109 SER C N   1 
ATOM   3255 C CA  . SER C 1 92  ? 14.495  -38.568 22.073  1.00 75.45  ? 109 SER C CA  1 
ATOM   3256 C C   . SER C 1 92  ? 14.109  -39.901 22.710  1.00 79.00  ? 109 SER C C   1 
ATOM   3257 O O   . SER C 1 92  ? 13.246  -40.618 22.199  1.00 83.99  ? 109 SER C O   1 
ATOM   3258 C CB  . SER C 1 92  ? 13.698  -37.413 22.690  1.00 73.73  ? 109 SER C CB  1 
ATOM   3259 O OG  . SER C 1 92  ? 12.376  -37.804 23.006  1.00 74.34  ? 109 SER C OG  1 
ATOM   3260 N N   . GLY C 1 93  ? 14.746  -40.233 23.823  1.00 81.67  ? 110 GLY C N   1 
ATOM   3261 C CA  . GLY C 1 93  ? 14.542  -41.538 24.446  1.00 83.73  ? 110 GLY C CA  1 
ATOM   3262 C C   . GLY C 1 93  ? 15.816  -42.334 24.329  1.00 83.43  ? 110 GLY C C   1 
ATOM   3263 O O   . GLY C 1 93  ? 16.261  -42.957 25.286  1.00 87.78  ? 110 GLY C O   1 
ATOM   3264 N N   . LEU C 1 94  ? 16.416  -42.307 23.148  1.00 82.87  ? 111 LEU C N   1 
ATOM   3265 C CA  . LEU C 1 94  ? 17.774  -42.790 23.010  1.00 80.50  ? 111 LEU C CA  1 
ATOM   3266 C C   . LEU C 1 94  ? 18.706  -41.652 23.416  1.00 79.26  ? 111 LEU C C   1 
ATOM   3267 O O   . LEU C 1 94  ? 18.431  -40.492 23.095  1.00 78.04  ? 111 LEU C O   1 
ATOM   3268 C CB  . LEU C 1 94  ? 18.049  -43.266 21.580  1.00 79.36  ? 111 LEU C CB  1 
ATOM   3269 C CG  . LEU C 1 94  ? 17.519  -44.673 21.287  1.00 79.26  ? 111 LEU C CG  1 
ATOM   3270 C CD1 . LEU C 1 94  ? 17.549  -44.986 19.801  1.00 79.50  ? 111 LEU C CD1 1 
ATOM   3271 C CD2 . LEU C 1 94  ? 18.323  -45.707 22.054  1.00 80.65  ? 111 LEU C CD2 1 
ATOM   3272 N N   . PRO C 1 95  ? 19.799  -41.976 24.137  1.00 78.22  ? 112 PRO C N   1 
ATOM   3273 C CA  . PRO C 1 95  ? 20.773  -40.969 24.581  1.00 78.05  ? 112 PRO C CA  1 
ATOM   3274 C C   . PRO C 1 95  ? 21.477  -40.264 23.423  1.00 76.86  ? 112 PRO C C   1 
ATOM   3275 O O   . PRO C 1 95  ? 21.671  -39.040 23.474  1.00 81.71  ? 112 PRO C O   1 
ATOM   3276 C CB  . PRO C 1 95  ? 21.783  -41.779 25.407  1.00 78.59  ? 112 PRO C CB  1 
ATOM   3277 C CG  . PRO C 1 95  ? 21.635  -43.184 24.949  1.00 78.22  ? 112 PRO C CG  1 
ATOM   3278 C CD  . PRO C 1 95  ? 20.213  -43.344 24.502  1.00 77.80  ? 112 PRO C CD  1 
ATOM   3279 N N   . ALA C 1 96  ? 21.856  -41.031 22.399  1.00 71.00  ? 113 ALA C N   1 
ATOM   3280 C CA  . ALA C 1 96  ? 22.415  -40.475 21.171  1.00 68.68  ? 113 ALA C CA  1 
ATOM   3281 C C   . ALA C 1 96  ? 21.511  -39.393 20.605  1.00 67.73  ? 113 ALA C C   1 
ATOM   3282 O O   . ALA C 1 96  ? 20.290  -39.494 20.695  1.00 70.28  ? 113 ALA C O   1 
ATOM   3283 C CB  . ALA C 1 96  ? 22.595  -41.576 20.146  1.00 69.32  ? 113 ALA C CB  1 
ATOM   3284 N N   . SER C 1 97  ? 22.105  -38.363 20.018  1.00 67.28  ? 114 SER C N   1 
ATOM   3285 C CA  . SER C 1 97  ? 21.326  -37.245 19.490  1.00 72.62  ? 114 SER C CA  1 
ATOM   3286 C C   . SER C 1 97  ? 21.443  -37.081 17.971  1.00 71.36  ? 114 SER C C   1 
ATOM   3287 O O   . SER C 1 97  ? 20.457  -36.786 17.294  1.00 71.46  ? 114 SER C O   1 
ATOM   3288 C CB  . SER C 1 97  ? 21.728  -35.936 20.186  1.00 75.08  ? 114 SER C CB  1 
ATOM   3289 O OG  . SER C 1 97  ? 23.050  -35.554 19.842  1.00 78.04  ? 114 SER C OG  1 
ATOM   3290 N N   . THR C 1 98  ? 22.638  -37.255 17.428  1.00 70.62  ? 115 THR C N   1 
ATOM   3291 C CA  . THR C 1 98  ? 22.833  -37.037 15.998  1.00 70.86  ? 115 THR C CA  1 
ATOM   3292 C C   . THR C 1 98  ? 23.932  -37.918 15.439  1.00 66.74  ? 115 THR C C   1 
ATOM   3293 O O   . THR C 1 98  ? 24.805  -38.392 16.166  1.00 65.24  ? 115 THR C O   1 
ATOM   3294 C CB  . THR C 1 98  ? 23.146  -35.555 15.677  1.00 75.58  ? 115 THR C CB  1 
ATOM   3295 O OG1 . THR C 1 98  ? 23.488  -35.418 14.291  1.00 76.15  ? 115 THR C OG1 1 
ATOM   3296 C CG2 . THR C 1 98  ? 24.306  -35.025 16.530  1.00 79.15  ? 115 THR C CG2 1 
ATOM   3297 N N   . SER C 1 99  ? 23.859  -38.140 14.135  1.00 65.08  ? 116 SER C N   1 
ATOM   3298 C CA  . SER C 1 99  ? 24.844  -38.943 13.426  1.00 65.83  ? 116 SER C CA  1 
ATOM   3299 C C   . SER C 1 99  ? 24.988  -38.413 12.004  1.00 67.04  ? 116 SER C C   1 
ATOM   3300 O O   . SER C 1 99  ? 24.007  -38.004 11.378  1.00 68.79  ? 116 SER C O   1 
ATOM   3301 C CB  . SER C 1 99  ? 24.426  -40.406 13.410  1.00 65.52  ? 116 SER C CB  1 
ATOM   3302 O OG  . SER C 1 99  ? 25.455  -41.219 12.874  1.00 68.34  ? 116 SER C OG  1 
ATOM   3303 N N   . VAL C 1 100 ? 26.220  -38.398 11.510  1.00 65.56  ? 117 VAL C N   1 
ATOM   3304 C CA  . VAL C 1 100 ? 26.513  -37.826 10.208  1.00 63.08  ? 117 VAL C CA  1 
ATOM   3305 C C   . VAL C 1 100 ? 27.322  -38.863 9.457   1.00 60.45  ? 117 VAL C C   1 
ATOM   3306 O O   . VAL C 1 100 ? 28.294  -39.399 9.994   1.00 55.96  ? 117 VAL C O   1 
ATOM   3307 C CB  . VAL C 1 100 ? 27.199  -36.436 10.308  1.00 65.20  ? 117 VAL C CB  1 
ATOM   3308 C CG1 . VAL C 1 100 ? 27.654  -36.138 11.728  1.00 67.12  ? 117 VAL C CG1 1 
ATOM   3309 C CG2 . VAL C 1 100 ? 28.359  -36.286 9.326   1.00 66.13  ? 117 VAL C CG2 1 
ATOM   3310 N N   . GLU C 1 101 ? 26.896  -39.141 8.223   1.00 57.28  ? 118 GLU C N   1 
ATOM   3311 C CA  . GLU C 1 101 ? 27.277  -40.368 7.542   1.00 57.80  ? 118 GLU C CA  1 
ATOM   3312 C C   . GLU C 1 101 ? 27.369  -40.220 6.005   1.00 59.43  ? 118 GLU C C   1 
ATOM   3313 O O   . GLU C 1 101 ? 26.452  -39.713 5.344   1.00 57.69  ? 118 GLU C O   1 
ATOM   3314 C CB  . GLU C 1 101 ? 26.260  -41.468 7.902   1.00 55.69  ? 118 GLU C CB  1 
ATOM   3315 N N   . ILE C 1 102 ? 28.473  -40.701 5.445   1.00 57.75  ? 119 ILE C N   1 
ATOM   3316 C CA  . ILE C 1 102 ? 28.749  -40.547 4.027   1.00 55.26  ? 119 ILE C CA  1 
ATOM   3317 C C   . ILE C 1 102 ? 28.416  -41.840 3.313   1.00 52.71  ? 119 ILE C C   1 
ATOM   3318 O O   . ILE C 1 102 ? 28.761  -42.909 3.796   1.00 53.04  ? 119 ILE C O   1 
ATOM   3319 C CB  . ILE C 1 102 ? 30.221  -40.160 3.765   1.00 56.03  ? 119 ILE C CB  1 
ATOM   3320 C CG1 . ILE C 1 102 ? 30.414  -39.846 2.265   1.00 59.73  ? 119 ILE C CG1 1 
ATOM   3321 C CG2 . ILE C 1 102 ? 31.160  -41.262 4.233   1.00 55.41  ? 119 ILE C CG2 1 
ATOM   3322 C CD1 . ILE C 1 102 ? 31.810  -39.435 1.854   1.00 60.18  ? 119 ILE C CD1 1 
ATOM   3323 N N   . LEU C 1 103 ? 27.736  -41.739 2.172   1.00 52.00  ? 120 LEU C N   1 
ATOM   3324 C CA  . LEU C 1 103 ? 27.383  -42.920 1.361   1.00 52.98  ? 120 LEU C CA  1 
ATOM   3325 C C   . LEU C 1 103 ? 28.603  -43.419 0.573   1.00 54.95  ? 120 LEU C C   1 
ATOM   3326 O O   . LEU C 1 103 ? 29.181  -42.667 -0.212  1.00 53.61  ? 120 LEU C O   1 
ATOM   3327 C CB  . LEU C 1 103 ? 26.246  -42.570 0.407   1.00 54.07  ? 120 LEU C CB  1 
ATOM   3328 C CG  . LEU C 1 103 ? 25.718  -43.620 -0.569  1.00 56.39  ? 120 LEU C CG  1 
ATOM   3329 C CD1 . LEU C 1 103 ? 25.136  -44.819 0.161   1.00 57.23  ? 120 LEU C CD1 1 
ATOM   3330 C CD2 . LEU C 1 103 ? 24.647  -42.997 -1.450  1.00 57.35  ? 120 LEU C CD2 1 
ATOM   3331 N N   . GLU C 1 104 ? 28.987  -44.680 0.786   1.00 53.95  ? 121 GLU C N   1 
ATOM   3332 C CA  . GLU C 1 104 ? 30.222  -45.233 0.218   1.00 55.05  ? 121 GLU C CA  1 
ATOM   3333 C C   . GLU C 1 104 ? 30.008  -46.120 -1.005  1.00 55.33  ? 121 GLU C C   1 
ATOM   3334 O O   . GLU C 1 104 ? 30.814  -46.124 -1.945  1.00 56.61  ? 121 GLU C O   1 
ATOM   3335 C CB  . GLU C 1 104 ? 30.959  -46.050 1.276   1.00 55.57  ? 121 GLU C CB  1 
ATOM   3336 C CG  . GLU C 1 104 ? 31.332  -45.247 2.515   1.00 56.82  ? 121 GLU C CG  1 
ATOM   3337 C CD  . GLU C 1 104 ? 32.741  -45.534 3.016   1.00 58.59  ? 121 GLU C CD  1 
ATOM   3338 O OE1 . GLU C 1 104 ? 33.093  -46.743 3.177   1.00 57.24  ? 121 GLU C OE1 1 
ATOM   3339 O OE2 . GLU C 1 104 ? 33.483  -44.536 3.243   1.00 57.32  ? 121 GLU C OE2 1 
ATOM   3340 N N   . VAL C 1 105 ? 28.943  -46.907 -0.959  1.00 54.44  ? 122 VAL C N   1 
ATOM   3341 C CA  . VAL C 1 105 ? 28.607  -47.816 -2.031  1.00 53.36  ? 122 VAL C CA  1 
ATOM   3342 C C   . VAL C 1 105 ? 27.122  -47.707 -2.279  1.00 53.40  ? 122 VAL C C   1 
ATOM   3343 O O   . VAL C 1 105 ? 26.338  -47.801 -1.346  1.00 51.90  ? 122 VAL C O   1 
ATOM   3344 C CB  . VAL C 1 105 ? 28.997  -49.263 -1.682  1.00 52.27  ? 122 VAL C CB  1 
ATOM   3345 C CG1 . VAL C 1 105 ? 28.513  -50.243 -2.750  1.00 52.95  ? 122 VAL C CG1 1 
ATOM   3346 C CG2 . VAL C 1 105 ? 30.507  -49.340 -1.514  1.00 51.17  ? 122 VAL C CG2 1 
ATOM   3347 N N   . LEU C 1 106 ? 26.771  -47.459 -3.541  1.00 53.88  ? 123 LEU C N   1 
ATOM   3348 C CA  . LEU C 1 106 ? 25.404  -47.518 -4.029  1.00 53.31  ? 123 LEU C CA  1 
ATOM   3349 C C   . LEU C 1 106 ? 25.445  -48.282 -5.351  1.00 54.92  ? 123 LEU C C   1 
ATOM   3350 O O   . LEU C 1 106 ? 25.731  -47.716 -6.412  1.00 58.85  ? 123 LEU C O   1 
ATOM   3351 C CB  . LEU C 1 106 ? 24.847  -46.106 -4.217  1.00 53.49  ? 123 LEU C CB  1 
ATOM   3352 C CG  . LEU C 1 106 ? 23.451  -45.975 -4.845  1.00 53.68  ? 123 LEU C CG  1 
ATOM   3353 C CD1 . LEU C 1 106 ? 22.422  -46.668 -3.979  1.00 53.45  ? 123 LEU C CD1 1 
ATOM   3354 C CD2 . LEU C 1 106 ? 23.075  -44.513 -5.052  1.00 53.69  ? 123 LEU C CD2 1 
ATOM   3355 N N   . ASP C 1 107 ? 25.199  -49.581 -5.264  1.00 55.26  ? 124 ASP C N   1 
ATOM   3356 C CA  . ASP C 1 107 ? 25.232  -50.470 -6.406  1.00 54.67  ? 124 ASP C CA  1 
ATOM   3357 C C   . ASP C 1 107 ? 23.821  -50.943 -6.700  1.00 54.54  ? 124 ASP C C   1 
ATOM   3358 O O   . ASP C 1 107 ? 23.289  -51.793 -6.000  1.00 51.63  ? 124 ASP C O   1 
ATOM   3359 C CB  . ASP C 1 107 ? 26.134  -51.654 -6.101  1.00 55.96  ? 124 ASP C CB  1 
ATOM   3360 C CG  . ASP C 1 107 ? 26.371  -52.538 -7.308  1.00 60.99  ? 124 ASP C CG  1 
ATOM   3361 O OD1 . ASP C 1 107 ? 25.533  -52.576 -8.241  1.00 63.51  ? 124 ASP C OD1 1 
ATOM   3362 O OD2 . ASP C 1 107 ? 27.417  -53.215 -7.315  1.00 63.17  ? 124 ASP C OD2 1 
ATOM   3363 N N   . GLU C 1 108 ? 23.244  -50.405 -7.774  1.00 56.78  ? 125 GLU C N   1 
ATOM   3364 C CA  . GLU C 1 108 ? 21.836  -50.624 -8.142  1.00 54.33  ? 125 GLU C CA  1 
ATOM   3365 C C   . GLU C 1 108 ? 21.552  -52.030 -8.605  1.00 53.57  ? 125 GLU C C   1 
ATOM   3366 O O   . GLU C 1 108 ? 20.416  -52.496 -8.489  1.00 54.21  ? 125 GLU C O   1 
ATOM   3367 C CB  . GLU C 1 108 ? 21.432  -49.705 -9.303  1.00 55.84  ? 125 GLU C CB  1 
ATOM   3368 C CG  . GLU C 1 108 ? 21.549  -48.219 -9.039  1.00 57.01  ? 125 GLU C CG  1 
ATOM   3369 C CD  . GLU C 1 108 ? 20.482  -47.718 -8.104  1.00 58.08  ? 125 GLU C CD  1 
ATOM   3370 O OE1 . GLU C 1 108 ? 20.749  -46.696 -7.431  1.00 60.84  ? 125 GLU C OE1 1 
ATOM   3371 O OE2 . GLU C 1 108 ? 19.386  -48.333 -8.051  1.00 57.14  ? 125 GLU C OE2 1 
ATOM   3372 N N   . GLU C 1 109 ? 22.549  -52.682 -9.195  1.00 53.82  ? 126 GLU C N   1 
ATOM   3373 C CA  . GLU C 1 109 ? 22.305  -53.940 -9.905  1.00 57.05  ? 126 GLU C CA  1 
ATOM   3374 C C   . GLU C 1 109 ? 22.422  -55.096 -8.924  1.00 58.08  ? 126 GLU C C   1 
ATOM   3375 O O   . GLU C 1 109 ? 21.550  -55.974 -8.864  1.00 55.47  ? 126 GLU C O   1 
ATOM   3376 C CB  . GLU C 1 109 ? 23.263  -54.108 -11.099 1.00 58.26  ? 126 GLU C CB  1 
ATOM   3377 N N   . LYS C 1 110 ? 23.506  -55.074 -8.153  1.00 59.27  ? 127 LYS C N   1 
ATOM   3378 C CA  . LYS C 1 110 ? 23.678  -55.978 -7.022  1.00 59.72  ? 127 LYS C CA  1 
ATOM   3379 C C   . LYS C 1 110 ? 22.746  -55.612 -5.837  1.00 58.14  ? 127 LYS C C   1 
ATOM   3380 O O   . LYS C 1 110 ? 22.467  -56.450 -4.980  1.00 58.73  ? 127 LYS C O   1 
ATOM   3381 C CB  . LYS C 1 110 ? 25.146  -55.943 -6.568  1.00 60.74  ? 127 LYS C CB  1 
ATOM   3382 C CG  . LYS C 1 110 ? 26.109  -56.766 -7.415  1.00 60.92  ? 127 LYS C CG  1 
ATOM   3383 C CD  . LYS C 1 110 ? 27.490  -56.126 -7.500  1.00 61.26  ? 127 LYS C CD  1 
ATOM   3384 C CE  . LYS C 1 110 ? 28.605  -57.147 -7.662  1.00 63.55  ? 127 LYS C CE  1 
ATOM   3385 N NZ  . LYS C 1 110 ? 28.378  -58.064 -8.813  1.00 66.63  ? 127 LYS C NZ  1 
ATOM   3386 N N   . ARG C 1 111 ? 22.281  -54.364 -5.794  1.00 56.24  ? 128 ARG C N   1 
ATOM   3387 C CA  . ARG C 1 111 ? 21.464  -53.858 -4.679  1.00 55.38  ? 128 ARG C CA  1 
ATOM   3388 C C   . ARG C 1 111 ? 22.228  -53.917 -3.353  1.00 53.35  ? 128 ARG C C   1 
ATOM   3389 O O   . ARG C 1 111 ? 21.736  -54.403 -2.346  1.00 53.19  ? 128 ARG C O   1 
ATOM   3390 C CB  . ARG C 1 111 ? 20.140  -54.599 -4.581  1.00 55.80  ? 128 ARG C CB  1 
ATOM   3391 C CG  . ARG C 1 111 ? 19.399  -54.651 -5.903  1.00 56.73  ? 128 ARG C CG  1 
ATOM   3392 C CD  . ARG C 1 111 ? 18.055  -55.309 -5.737  1.00 56.34  ? 128 ARG C CD  1 
ATOM   3393 N NE  . ARG C 1 111 ? 17.140  -54.957 -6.815  1.00 56.89  ? 128 ARG C NE  1 
ATOM   3394 C CZ  . ARG C 1 111 ? 16.612  -55.808 -7.692  1.00 56.47  ? 128 ARG C CZ  1 
ATOM   3395 N NH1 . ARG C 1 111 ? 16.895  -57.105 -7.651  1.00 55.36  ? 128 ARG C NH1 1 
ATOM   3396 N NH2 . ARG C 1 111 ? 15.775  -55.349 -8.612  1.00 56.75  ? 128 ARG C NH2 1 
ATOM   3397 N N   . ILE C 1 112 ? 23.451  -53.422 -3.392  1.00 51.85  ? 129 ILE C N   1 
ATOM   3398 C CA  . ILE C 1 112 ? 24.240  -53.257 -2.219  1.00 51.41  ? 129 ILE C CA  1 
ATOM   3399 C C   . ILE C 1 112 ? 24.217  -51.769 -1.874  1.00 50.80  ? 129 ILE C C   1 
ATOM   3400 O O   . ILE C 1 112 ? 24.231  -50.926 -2.784  1.00 46.73  ? 129 ILE C O   1 
ATOM   3401 C CB  . ILE C 1 112 ? 25.690  -53.736 -2.429  1.00 51.89  ? 129 ILE C CB  1 
ATOM   3402 C CG1 . ILE C 1 112 ? 25.724  -55.187 -2.936  1.00 51.22  ? 129 ILE C CG1 1 
ATOM   3403 C CG2 . ILE C 1 112 ? 26.466  -53.611 -1.121  1.00 53.88  ? 129 ILE C CG2 1 
ATOM   3404 N N   . LEU C 1 113 ? 24.165  -51.470 -0.563  1.00 47.23  ? 130 LEU C N   1 
ATOM   3405 C CA  . LEU C 1 113 ? 24.339  -50.117 -0.048  1.00 45.27  ? 130 LEU C CA  1 
ATOM   3406 C C   . LEU C 1 113 ? 25.212  -50.149 1.192   1.00 48.80  ? 130 LEU C C   1 
ATOM   3407 O O   . LEU C 1 113 ? 25.139  -51.076 2.006   1.00 51.06  ? 130 LEU C O   1 
ATOM   3408 C CB  . LEU C 1 113 ? 23.007  -49.481 0.294   1.00 44.02  ? 130 LEU C CB  1 
ATOM   3409 C CG  . LEU C 1 113 ? 23.019  -47.959 0.444   1.00 43.27  ? 130 LEU C CG  1 
ATOM   3410 C CD2 . LEU C 1 113 ? 23.305  -47.510 1.865   1.00 43.55  ? 130 LEU C CD2 1 
ATOM   3411 N N   . SER C 1 114 ? 26.040  -49.125 1.333   1.00 50.91  ? 131 SER C N   1 
ATOM   3412 C CA  . SER C 1 114 ? 27.030  -49.091 2.382   1.00 51.33  ? 131 SER C CA  1 
ATOM   3413 C C   . SER C 1 114 ? 27.320  -47.670 2.754   1.00 53.20  ? 131 SER C C   1 
ATOM   3414 O O   . SER C 1 114 ? 27.457  -46.829 1.863   1.00 52.94  ? 131 SER C O   1 
ATOM   3415 C CB  . SER C 1 114 ? 28.328  -49.723 1.926   1.00 50.83  ? 131 SER C CB  1 
ATOM   3416 O OG  . SER C 1 114 ? 29.230  -49.743 3.002   1.00 53.72  ? 131 SER C OG  1 
ATOM   3417 N N   . PHE C 1 115 ? 27.429  -47.413 4.060   1.00 52.33  ? 132 PHE C N   1 
ATOM   3418 C CA  . PHE C 1 115 ? 27.714  -46.071 4.543   1.00 55.59  ? 132 PHE C CA  1 
ATOM   3419 C C   . PHE C 1 115 ? 28.627  -46.049 5.777   1.00 57.86  ? 132 PHE C C   1 
ATOM   3420 O O   . PHE C 1 115 ? 28.605  -46.953 6.622   1.00 59.34  ? 132 PHE C O   1 
ATOM   3421 C CB  . PHE C 1 115 ? 26.410  -45.312 4.808   1.00 55.92  ? 132 PHE C CB  1 
ATOM   3422 C CG  . PHE C 1 115 ? 25.756  -45.637 6.128   1.00 56.01  ? 132 PHE C CG  1 
ATOM   3423 C CD1 . PHE C 1 115 ? 26.144  -44.986 7.295   1.00 56.28  ? 132 PHE C CD1 1 
ATOM   3424 C CD2 . PHE C 1 115 ? 24.729  -46.566 6.199   1.00 54.97  ? 132 PHE C CD2 1 
ATOM   3425 C CE1 . PHE C 1 115 ? 25.531  -45.268 8.509   1.00 57.27  ? 132 PHE C CE1 1 
ATOM   3426 C CE2 . PHE C 1 115 ? 24.117  -46.851 7.409   1.00 54.77  ? 132 PHE C CE2 1 
ATOM   3427 C CZ  . PHE C 1 115 ? 24.516  -46.202 8.563   1.00 55.80  ? 132 PHE C CZ  1 
ATOM   3428 N N   . ARG C 1 116 ? 29.429  -45.001 5.861   1.00 57.38  ? 133 ARG C N   1 
ATOM   3429 C CA  . ARG C 1 116 ? 30.333  -44.818 6.960   1.00 60.83  ? 133 ARG C CA  1 
ATOM   3430 C C   . ARG C 1 116 ? 29.848  -43.652 7.804   1.00 60.70  ? 133 ARG C C   1 
ATOM   3431 O O   . ARG C 1 116 ? 29.413  -42.623 7.261   1.00 61.23  ? 133 ARG C O   1 
ATOM   3432 C CB  . ARG C 1 116 ? 31.749  -44.542 6.445   1.00 64.18  ? 133 ARG C CB  1 
ATOM   3433 C CG  . ARG C 1 116 ? 32.796  -44.536 7.552   1.00 68.80  ? 133 ARG C CG  1 
ATOM   3434 C CD  . ARG C 1 116 ? 34.157  -45.041 7.084   1.00 71.27  ? 133 ARG C CD  1 
ATOM   3435 N NE  . ARG C 1 116 ? 34.746  -44.176 6.081   1.00 71.28  ? 133 ARG C NE  1 
ATOM   3436 C CZ  . ARG C 1 116 ? 35.255  -42.969 6.327   1.00 77.09  ? 133 ARG C CZ  1 
ATOM   3437 N NH1 . ARG C 1 116 ? 35.265  -42.438 7.548   1.00 74.87  ? 133 ARG C NH1 1 
ATOM   3438 N N   . VAL C 1 117 ? 29.910  -43.819 9.122   1.00 55.25  ? 134 VAL C N   1 
ATOM   3439 C CA  . VAL C 1 117 ? 29.690  -42.709 10.021  1.00 57.16  ? 134 VAL C CA  1 
ATOM   3440 C C   . VAL C 1 117 ? 30.980  -41.878 10.120  1.00 58.68  ? 134 VAL C C   1 
ATOM   3441 O O   . VAL C 1 117 ? 32.075  -42.424 10.186  1.00 58.83  ? 134 VAL C O   1 
ATOM   3442 C CB  . VAL C 1 117 ? 29.241  -43.199 11.409  1.00 57.19  ? 134 VAL C CB  1 
ATOM   3443 C CG1 . VAL C 1 117 ? 29.248  -42.063 12.423  1.00 58.17  ? 134 VAL C CG1 1 
ATOM   3444 C CG2 . VAL C 1 117 ? 27.857  -43.803 11.314  1.00 56.43  ? 134 VAL C CG2 1 
ATOM   3445 N N   . LEU C 1 118 ? 30.816  -40.557 10.148  1.00 60.32  ? 135 LEU C N   1 
ATOM   3446 C CA  . LEU C 1 118 ? 31.915  -39.586 10.166  1.00 63.40  ? 135 LEU C CA  1 
ATOM   3447 C C   . LEU C 1 118 ? 31.981  -38.757 11.448  1.00 63.66  ? 135 LEU C C   1 
ATOM   3448 O O   . LEU C 1 118 ? 32.892  -37.952 11.619  1.00 63.25  ? 135 LEU C O   1 
ATOM   3449 C CB  . LEU C 1 118 ? 31.719  -38.610 9.007   1.00 65.67  ? 135 LEU C CB  1 
ATOM   3450 C CG  . LEU C 1 118 ? 32.520  -38.745 7.723   1.00 67.32  ? 135 LEU C CG  1 
ATOM   3451 C CD1 . LEU C 1 118 ? 32.900  -40.173 7.381   1.00 66.86  ? 135 LEU C CD1 1 
ATOM   3452 C CD2 . LEU C 1 118 ? 31.696  -38.108 6.621   1.00 68.81  ? 135 LEU C CD2 1 
ATOM   3453 N N   . GLY C 1 119 ? 31.001  -38.933 12.324  1.00 65.44  ? 136 GLY C N   1 
ATOM   3454 C CA  . GLY C 1 119 ? 30.860  -38.106 13.521  1.00 68.03  ? 136 GLY C CA  1 
ATOM   3455 C C   . GLY C 1 119 ? 29.415  -38.033 13.993  1.00 68.57  ? 136 GLY C C   1 
ATOM   3456 O O   . GLY C 1 119 ? 28.559  -38.819 13.554  1.00 62.31  ? 136 GLY C O   1 
ATOM   3457 N N   . GLY C 1 120 ? 29.152  -37.063 14.867  1.00 71.77  ? 137 GLY C N   1 
ATOM   3458 C CA  . GLY C 1 120 ? 27.880  -36.962 15.587  1.00 72.50  ? 137 GLY C CA  1 
ATOM   3459 C C   . GLY C 1 120 ? 28.051  -37.228 17.080  1.00 73.59  ? 137 GLY C C   1 
ATOM   3460 O O   . GLY C 1 120 ? 29.131  -37.610 17.548  1.00 71.57  ? 137 GLY C O   1 
ATOM   3461 N N   . GLU C 1 121 ? 26.973  -37.018 17.827  1.00 74.31  ? 138 GLU C N   1 
ATOM   3462 C CA  . GLU C 1 121 ? 26.967  -37.234 19.261  1.00 75.99  ? 138 GLU C CA  1 
ATOM   3463 C C   . GLU C 1 121 ? 26.323  -38.588 19.535  1.00 73.44  ? 138 GLU C C   1 
ATOM   3464 O O   . GLU C 1 121 ? 25.094  -38.680 19.633  1.00 72.82  ? 138 GLU C O   1 
ATOM   3465 C CB  . GLU C 1 121 ? 26.192  -36.113 19.964  1.00 77.93  ? 138 GLU C CB  1 
ATOM   3466 N N   . HIS C 1 122 ? 27.160  -39.629 19.619  1.00 70.59  ? 139 HIS C N   1 
ATOM   3467 C CA  . HIS C 1 122 ? 26.717  -40.994 19.942  1.00 68.75  ? 139 HIS C CA  1 
ATOM   3468 C C   . HIS C 1 122 ? 27.918  -41.898 20.183  1.00 66.55  ? 139 HIS C C   1 
ATOM   3469 O O   . HIS C 1 122 ? 29.040  -41.471 19.982  1.00 67.56  ? 139 HIS C O   1 
ATOM   3470 C CB  . HIS C 1 122 ? 25.881  -41.563 18.816  1.00 69.55  ? 139 HIS C CB  1 
ATOM   3471 C CG  . HIS C 1 122 ? 26.634  -41.710 17.536  1.00 73.98  ? 139 HIS C CG  1 
ATOM   3472 N ND1 . HIS C 1 122 ? 26.846  -40.658 16.673  1.00 76.00  ? 139 HIS C ND1 1 
ATOM   3473 C CD2 . HIS C 1 122 ? 27.239  -42.782 16.982  1.00 75.86  ? 139 HIS C CD2 1 
ATOM   3474 C CE1 . HIS C 1 122 ? 27.547  -41.082 15.638  1.00 78.96  ? 139 HIS C CE1 1 
ATOM   3475 N NE2 . HIS C 1 122 ? 27.794  -42.369 15.800  1.00 79.42  ? 139 HIS C NE2 1 
ATOM   3476 N N   . ARG C 1 123 ? 27.681  -43.141 20.599  1.00 68.22  ? 140 ARG C N   1 
ATOM   3477 C CA  . ARG C 1 123 ? 28.759  -44.033 21.056  1.00 74.84  ? 140 ARG C CA  1 
ATOM   3478 C C   . ARG C 1 123 ? 29.041  -45.219 20.113  1.00 77.11  ? 140 ARG C C   1 
ATOM   3479 O O   . ARG C 1 123 ? 29.490  -46.283 20.543  1.00 81.42  ? 140 ARG C O   1 
ATOM   3480 C CB  . ARG C 1 123 ? 28.452  -44.532 22.481  1.00 79.44  ? 140 ARG C CB  1 
ATOM   3481 C CG  . ARG C 1 123 ? 28.732  -43.510 23.588  1.00 81.29  ? 140 ARG C CG  1 
ATOM   3482 C CD  . ARG C 1 123 ? 30.141  -43.642 24.156  1.00 82.39  ? 140 ARG C CD  1 
ATOM   3483 N N   . LEU C 1 124 ? 28.791  -45.018 18.826  1.00 74.59  ? 141 LEU C N   1 
ATOM   3484 C CA  . LEU C 1 124 ? 29.125  -45.986 17.794  1.00 72.03  ? 141 LEU C CA  1 
ATOM   3485 C C   . LEU C 1 124 ? 30.056  -45.279 16.819  1.00 73.06  ? 141 LEU C C   1 
ATOM   3486 O O   . LEU C 1 124 ? 29.689  -44.967 15.681  1.00 73.03  ? 141 LEU C O   1 
ATOM   3487 C CB  . LEU C 1 124 ? 27.866  -46.475 17.082  1.00 71.03  ? 141 LEU C CB  1 
ATOM   3488 C CG  . LEU C 1 124 ? 26.803  -47.148 17.951  1.00 70.93  ? 141 LEU C CG  1 
ATOM   3489 C CD1 . LEU C 1 124 ? 25.578  -47.488 17.109  1.00 69.26  ? 141 LEU C CD1 1 
ATOM   3490 C CD2 . LEU C 1 124 ? 27.362  -48.393 18.635  1.00 69.09  ? 141 LEU C CD2 1 
ATOM   3491 N N   . ASN C 1 125 ? 31.264  -44.999 17.285  1.00 72.35  ? 142 ASN C N   1 
ATOM   3492 C CA  . ASN C 1 125 ? 32.226  -44.259 16.479  1.00 71.81  ? 142 ASN C CA  1 
ATOM   3493 C C   . ASN C 1 125 ? 32.839  -45.150 15.415  1.00 66.26  ? 142 ASN C C   1 
ATOM   3494 O O   . ASN C 1 125 ? 33.133  -46.316 15.672  1.00 62.35  ? 142 ASN C O   1 
ATOM   3495 C CB  . ASN C 1 125 ? 33.302  -43.623 17.368  1.00 75.53  ? 142 ASN C CB  1 
ATOM   3496 C CG  . ASN C 1 125 ? 32.725  -42.581 18.311  1.00 78.68  ? 142 ASN C CG  1 
ATOM   3497 O OD1 . ASN C 1 125 ? 32.954  -42.621 19.524  1.00 83.85  ? 142 ASN C OD1 1 
ATOM   3498 N ND2 . ASN C 1 125 ? 31.950  -41.647 17.759  1.00 78.43  ? 142 ASN C ND2 1 
ATOM   3499 N N   . ASN C 1 126 ? 33.002  -44.580 14.221  1.00 63.76  ? 143 ASN C N   1 
ATOM   3500 C CA  . ASN C 1 126 ? 33.499  -45.291 13.031  1.00 63.10  ? 143 ASN C CA  1 
ATOM   3501 C C   . ASN C 1 126 ? 32.636  -46.473 12.582  1.00 61.41  ? 143 ASN C C   1 
ATOM   3502 O O   . ASN C 1 126 ? 33.144  -47.442 12.012  1.00 62.40  ? 143 ASN C O   1 
ATOM   3503 C CB  . ASN C 1 126 ? 34.949  -45.739 13.223  1.00 63.66  ? 143 ASN C CB  1 
ATOM   3504 C CG  . ASN C 1 126 ? 35.872  -44.590 13.582  1.00 64.27  ? 143 ASN C CG  1 
ATOM   3505 O OD1 . ASN C 1 126 ? 35.783  -43.495 13.024  1.00 64.65  ? 143 ASN C OD1 1 
ATOM   3506 N ND2 . ASN C 1 126 ? 36.767  -44.837 14.518  1.00 66.61  ? 143 ASN C ND2 1 
ATOM   3507 N N   . TYR C 1 127 ? 31.332  -46.384 12.827  1.00 58.17  ? 144 TYR C N   1 
ATOM   3508 C CA  . TYR C 1 127 ? 30.398  -47.383 12.334  1.00 57.37  ? 144 TYR C CA  1 
ATOM   3509 C C   . TYR C 1 127 ? 30.388  -47.378 10.802  1.00 58.54  ? 144 TYR C C   1 
ATOM   3510 O O   . TYR C 1 127 ? 30.292  -46.327 10.157  1.00 60.24  ? 144 TYR C O   1 
ATOM   3511 C CB  . TYR C 1 127 ? 28.995  -47.088 12.855  1.00 55.17  ? 144 TYR C CB  1 
ATOM   3512 C CG  . TYR C 1 127 ? 27.943  -48.068 12.412  1.00 54.70  ? 144 TYR C CG  1 
ATOM   3513 C CD1 . TYR C 1 127 ? 27.733  -49.265 13.094  1.00 56.25  ? 144 TYR C CD1 1 
ATOM   3514 C CD2 . TYR C 1 127 ? 27.131  -47.792 11.323  1.00 55.89  ? 144 TYR C CD2 1 
ATOM   3515 C CE1 . TYR C 1 127 ? 26.745  -50.162 12.691  1.00 55.71  ? 144 TYR C CE1 1 
ATOM   3516 C CE2 . TYR C 1 127 ? 26.150  -48.676 10.915  1.00 53.83  ? 144 TYR C CE2 1 
ATOM   3517 C CZ  . TYR C 1 127 ? 25.961  -49.859 11.591  1.00 54.62  ? 144 TYR C CZ  1 
ATOM   3518 O OH  . TYR C 1 127 ? 24.974  -50.721 11.152  1.00 56.53  ? 144 TYR C OH  1 
ATOM   3519 N N   . ARG C 1 128 ? 30.485  -48.562 10.229  1.00 57.76  ? 145 ARG C N   1 
ATOM   3520 C CA  . ARG C 1 128 ? 30.505  -48.724 8.796   1.00 58.31  ? 145 ARG C CA  1 
ATOM   3521 C C   . ARG C 1 128 ? 29.625  -49.928 8.549   1.00 56.35  ? 145 ARG C C   1 
ATOM   3522 O O   . ARG C 1 128 ? 29.792  -50.946 9.220   1.00 57.62  ? 145 ARG C O   1 
ATOM   3523 C CB  . ARG C 1 128 ? 31.947  -48.976 8.345   1.00 62.10  ? 145 ARG C CB  1 
ATOM   3524 C CG  . ARG C 1 128 ? 32.169  -48.991 6.842   1.00 63.95  ? 145 ARG C CG  1 
ATOM   3525 C CD  . ARG C 1 128 ? 33.603  -48.615 6.471   1.00 65.95  ? 145 ARG C CD  1 
ATOM   3526 N NE  . ARG C 1 128 ? 34.504  -49.759 6.309   1.00 66.79  ? 145 ARG C NE  1 
ATOM   3527 C CZ  . ARG C 1 128 ? 35.322  -50.249 7.249   1.00 70.68  ? 145 ARG C CZ  1 
ATOM   3528 N NH1 . ARG C 1 128 ? 35.375  -49.728 8.482   1.00 69.93  ? 145 ARG C NH1 1 
ATOM   3529 N NH2 . ARG C 1 128 ? 36.095  -51.293 6.954   1.00 71.41  ? 145 ARG C NH2 1 
ATOM   3530 N N   . SER C 1 129 ? 28.655  -49.809 7.648   1.00 53.27  ? 146 SER C N   1 
ATOM   3531 C CA  . SER C 1 129 ? 27.760  -50.934 7.361   1.00 51.74  ? 146 SER C CA  1 
ATOM   3532 C C   . SER C 1 129 ? 27.560  -51.162 5.874   1.00 52.23  ? 146 SER C C   1 
ATOM   3533 O O   . SER C 1 129 ? 27.761  -50.269 5.055   1.00 52.82  ? 146 SER C O   1 
ATOM   3534 C CB  . SER C 1 129 ? 26.394  -50.725 8.006   1.00 51.86  ? 146 SER C CB  1 
ATOM   3535 O OG  . SER C 1 129 ? 25.675  -49.694 7.350   1.00 52.18  ? 146 SER C OG  1 
ATOM   3536 N N   . VAL C 1 130 ? 27.156  -52.381 5.551   1.00 51.94  ? 147 VAL C N   1 
ATOM   3537 C CA  . VAL C 1 130 ? 26.903  -52.788 4.191   1.00 52.41  ? 147 VAL C CA  1 
ATOM   3538 C C   . VAL C 1 130 ? 25.567  -53.482 4.211   1.00 51.96  ? 147 VAL C C   1 
ATOM   3539 O O   . VAL C 1 130 ? 25.350  -54.348 5.055   1.00 53.89  ? 147 VAL C O   1 
ATOM   3540 C CB  . VAL C 1 130 ? 27.953  -53.796 3.703   1.00 54.18  ? 147 VAL C CB  1 
ATOM   3541 C CG1 . VAL C 1 130 ? 27.609  -54.289 2.300   1.00 55.27  ? 147 VAL C CG1 1 
ATOM   3542 C CG2 . VAL C 1 130 ? 29.344  -53.171 3.733   1.00 53.46  ? 147 VAL C CG2 1 
ATOM   3543 N N   . THR C 1 131 ? 24.668  -53.089 3.314   1.00 48.94  ? 148 THR C N   1 
ATOM   3544 C CA  . THR C 1 131 ? 23.380  -53.731 3.234   1.00 49.39  ? 148 THR C CA  1 
ATOM   3545 C C   . THR C 1 131 ? 23.166  -54.247 1.808   1.00 50.25  ? 148 THR C C   1 
ATOM   3546 O O   . THR C 1 131 ? 23.615  -53.627 0.848   1.00 51.20  ? 148 THR C O   1 
ATOM   3547 C CB  . THR C 1 131 ? 22.252  -52.783 3.679   1.00 49.18  ? 148 THR C CB  1 
ATOM   3548 O OG1 . THR C 1 131 ? 22.503  -52.295 5.011   1.00 49.30  ? 148 THR C OG1 1 
ATOM   3549 C CG2 . THR C 1 131 ? 20.942  -53.514 3.698   1.00 50.03  ? 148 THR C CG2 1 
ATOM   3550 N N   . SER C 1 132 ? 22.489  -55.383 1.677   1.00 48.55  ? 149 SER C N   1 
ATOM   3551 C CA  . SER C 1 132 ? 22.267  -55.976 0.381   1.00 48.45  ? 149 SER C CA  1 
ATOM   3552 C C   . SER C 1 132 ? 20.970  -56.755 0.302   1.00 47.35  ? 149 SER C C   1 
ATOM   3553 O O   . SER C 1 132 ? 20.689  -57.571 1.158   1.00 47.37  ? 149 SER C O   1 
ATOM   3554 C CB  . SER C 1 132 ? 23.413  -56.922 0.070   1.00 50.63  ? 149 SER C CB  1 
ATOM   3555 O OG  . SER C 1 132 ? 23.311  -58.084 0.873   1.00 49.80  ? 149 SER C OG  1 
ATOM   3556 N N   . VAL C 1 133 ? 20.214  -56.549 -0.767  1.00 47.30  ? 150 VAL C N   1 
ATOM   3557 C CA  . VAL C 1 133 ? 18.931  -57.225 -0.949  1.00 47.46  ? 150 VAL C CA  1 
ATOM   3558 C C   . VAL C 1 133 ? 19.078  -58.372 -1.955  1.00 49.36  ? 150 VAL C C   1 
ATOM   3559 O O   . VAL C 1 133 ? 19.636  -58.180 -3.026  1.00 50.53  ? 150 VAL C O   1 
ATOM   3560 C CB  . VAL C 1 133 ? 17.877  -56.226 -1.432  1.00 46.45  ? 150 VAL C CB  1 
ATOM   3561 C CG1 . VAL C 1 133 ? 16.481  -56.814 -1.332  1.00 47.43  ? 150 VAL C CG1 1 
ATOM   3562 C CG2 . VAL C 1 133 ? 17.956  -54.954 -0.603  1.00 46.22  ? 150 VAL C CG2 1 
ATOM   3563 N N   . ASN C 1 134 ? 18.572  -59.556 -1.614  1.00 50.87  ? 151 ASN C N   1 
ATOM   3564 C CA  . ASN C 1 134 ? 18.770  -60.742 -2.444  1.00 53.24  ? 151 ASN C CA  1 
ATOM   3565 C C   . ASN C 1 134 ? 17.524  -61.575 -2.641  1.00 56.83  ? 151 ASN C C   1 
ATOM   3566 O O   . ASN C 1 134 ? 16.978  -62.090 -1.676  1.00 60.59  ? 151 ASN C O   1 
ATOM   3567 C CB  . ASN C 1 134 ? 19.828  -61.606 -1.818  1.00 53.22  ? 151 ASN C CB  1 
ATOM   3568 C CG  . ASN C 1 134 ? 21.164  -60.927 -1.801  1.00 54.89  ? 151 ASN C CG  1 
ATOM   3569 O OD1 . ASN C 1 134 ? 21.812  -60.829 -2.846  1.00 57.32  ? 151 ASN C OD1 1 
ATOM   3570 N ND2 . ASN C 1 134 ? 21.590  -60.439 -0.618  1.00 52.62  ? 151 ASN C ND2 1 
ATOM   3571 N N   . GLU C 1 135 ? 17.113  -61.748 -3.901  1.00 60.18  ? 152 GLU C N   1 
ATOM   3572 C CA  . GLU C 1 135 ? 15.837  -62.401 -4.239  1.00 62.05  ? 152 GLU C CA  1 
ATOM   3573 C C   . GLU C 1 135 ? 15.975  -63.914 -4.361  1.00 62.68  ? 152 GLU C C   1 
ATOM   3574 O O   . GLU C 1 135 ? 17.015  -64.416 -4.789  1.00 61.24  ? 152 GLU C O   1 
ATOM   3575 C CB  . GLU C 1 135 ? 15.293  -61.841 -5.551  1.00 64.40  ? 152 GLU C CB  1 
ATOM   3576 C CG  . GLU C 1 135 ? 13.774  -61.828 -5.655  1.00 67.07  ? 152 GLU C CG  1 
ATOM   3577 C CD  . GLU C 1 135 ? 13.298  -61.187 -6.955  1.00 66.96  ? 152 GLU C CD  1 
ATOM   3578 O OE1 . GLU C 1 135 ? 13.723  -61.648 -8.039  1.00 67.97  ? 152 GLU C OE1 1 
ATOM   3579 O OE2 . GLU C 1 135 ? 12.513  -60.217 -6.891  1.00 65.40  ? 152 GLU C OE2 1 
ATOM   3580 N N   . PHE C 1 136 ? 14.911  -64.626 -3.988  1.00 63.60  ? 153 PHE C N   1 
ATOM   3581 C CA  . PHE C 1 136 ? 14.873  -66.091 -4.020  1.00 64.99  ? 153 PHE C CA  1 
ATOM   3582 C C   . PHE C 1 136 ? 13.535  -66.575 -4.513  1.00 66.99  ? 153 PHE C C   1 
ATOM   3583 O O   . PHE C 1 136 ? 12.521  -65.901 -4.317  1.00 64.42  ? 153 PHE C O   1 
ATOM   3584 C CB  . PHE C 1 136 ? 15.106  -66.668 -2.622  1.00 65.06  ? 153 PHE C CB  1 
ATOM   3585 C CG  . PHE C 1 136 ? 16.518  -66.549 -2.162  1.00 63.93  ? 153 PHE C CG  1 
ATOM   3586 C CD1 . PHE C 1 136 ? 16.969  -65.381 -1.557  1.00 61.92  ? 153 PHE C CD1 1 
ATOM   3587 C CD2 . PHE C 1 136 ? 17.405  -67.582 -2.370  1.00 63.48  ? 153 PHE C CD2 1 
ATOM   3588 C CE1 . PHE C 1 136 ? 18.278  -65.260 -1.154  1.00 60.50  ? 153 PHE C CE1 1 
ATOM   3589 C CE2 . PHE C 1 136 ? 18.715  -67.468 -1.968  1.00 63.98  ? 153 PHE C CE2 1 
ATOM   3590 C CZ  . PHE C 1 136 ? 19.152  -66.307 -1.357  1.00 61.68  ? 153 PHE C CZ  1 
ATOM   3591 N N   . VAL C 1 137 ? 13.547  -67.759 -5.125  1.00 72.98  ? 154 VAL C N   1 
ATOM   3592 C CA  . VAL C 1 137 ? 12.346  -68.395 -5.671  1.00 77.97  ? 154 VAL C CA  1 
ATOM   3593 C C   . VAL C 1 137 ? 12.210  -69.812 -5.133  1.00 82.78  ? 154 VAL C C   1 
ATOM   3594 O O   . VAL C 1 137 ? 13.165  -70.579 -5.180  1.00 89.23  ? 154 VAL C O   1 
ATOM   3595 C CB  . VAL C 1 137 ? 12.413  -68.485 -7.208  1.00 79.13  ? 154 VAL C CB  1 
ATOM   3596 C CG1 . VAL C 1 137 ? 11.076  -68.956 -7.772  1.00 81.08  ? 154 VAL C CG1 1 
ATOM   3597 C CG2 . VAL C 1 137 ? 12.796  -67.137 -7.804  1.00 78.71  ? 154 VAL C CG2 1 
ATOM   3598 N N   . VAL C 1 138 ? 11.026  -70.164 -4.640  1.00 87.82  ? 155 VAL C N   1 
ATOM   3599 C CA  . VAL C 1 138 ? 10.776  -71.520 -4.138  1.00 91.93  ? 155 VAL C CA  1 
ATOM   3600 C C   . VAL C 1 138 ? 10.354  -72.444 -5.286  1.00 93.66  ? 155 VAL C C   1 
ATOM   3601 O O   . VAL C 1 138 ? 9.205   -72.431 -5.730  1.00 93.48  ? 155 VAL C O   1 
ATOM   3602 C CB  . VAL C 1 138 ? 9.710   -71.536 -3.017  1.00 94.54  ? 155 VAL C CB  1 
ATOM   3603 C CG1 . VAL C 1 138 ? 9.592   -72.930 -2.413  1.00 96.65  ? 155 VAL C CG1 1 
ATOM   3604 C CG2 . VAL C 1 138 ? 10.061  -70.528 -1.927  1.00 93.40  ? 155 VAL C CG2 1 
ATOM   3605 N N   . ARG C 1 146 ? 7.334   -68.946 -2.499  1.00 95.84  ? 163 ARG C N   1 
ATOM   3606 C CA  . ARG C 1 146 ? 7.039   -68.469 -3.855  1.00 96.62  ? 163 ARG C CA  1 
ATOM   3607 C C   . ARG C 1 146 ? 8.125   -67.496 -4.349  1.00 92.28  ? 163 ARG C C   1 
ATOM   3608 O O   . ARG C 1 146 ? 9.000   -67.891 -5.122  1.00 94.63  ? 163 ARG C O   1 
ATOM   3609 C CB  . ARG C 1 146 ? 5.641   -67.840 -3.885  1.00 99.99  ? 163 ARG C CB  1 
ATOM   3610 C CG  . ARG C 1 146 ? 5.168   -67.300 -5.225  1.00 102.79 ? 163 ARG C CG  1 
ATOM   3611 C CD  . ARG C 1 146 ? 5.090   -68.374 -6.304  1.00 105.18 ? 163 ARG C CD  1 
ATOM   3612 N NE  . ARG C 1 146 ? 6.133   -68.214 -7.319  1.00 102.50 ? 163 ARG C NE  1 
ATOM   3613 C CZ  . ARG C 1 146 ? 6.166   -68.873 -8.474  1.00 100.20 ? 163 ARG C CZ  1 
ATOM   3614 N NH1 . ARG C 1 146 ? 5.224   -69.763 -8.778  1.00 101.34 ? 163 ARG C NH1 1 
ATOM   3615 N NH2 . ARG C 1 146 ? 7.154   -68.646 -9.333  1.00 96.94  ? 163 ARG C NH2 1 
ATOM   3616 N N   . VAL C 1 147 ? 8.075   -66.241 -3.900  1.00 84.34  ? 164 VAL C N   1 
ATOM   3617 C CA  . VAL C 1 147 ? 9.101   -65.242 -4.229  1.00 77.32  ? 164 VAL C CA  1 
ATOM   3618 C C   . VAL C 1 147 ? 9.394   -64.380 -3.006  1.00 69.81  ? 164 VAL C C   1 
ATOM   3619 O O   . VAL C 1 147 ? 8.475   -63.860 -2.364  1.00 65.15  ? 164 VAL C O   1 
ATOM   3620 C CB  . VAL C 1 147 ? 8.675   -64.334 -5.403  1.00 79.17  ? 164 VAL C CB  1 
ATOM   3621 C CG1 . VAL C 1 147 ? 9.574   -63.104 -5.505  1.00 77.93  ? 164 VAL C CG1 1 
ATOM   3622 C CG2 . VAL C 1 147 ? 8.702   -65.111 -6.711  1.00 83.44  ? 164 VAL C CG2 1 
ATOM   3623 N N   . TYR C 1 148 ? 10.677  -64.218 -2.697  1.00 64.84  ? 165 TYR C N   1 
ATOM   3624 C CA  . TYR C 1 148 ? 11.079  -63.550 -1.457  1.00 62.39  ? 165 TYR C CA  1 
ATOM   3625 C C   . TYR C 1 148 ? 12.540  -63.138 -1.464  1.00 60.45  ? 165 TYR C C   1 
ATOM   3626 O O   . TYR C 1 148 ? 13.352  -63.748 -2.151  1.00 65.86  ? 165 TYR C O   1 
ATOM   3627 C CB  . TYR C 1 148 ? 10.825  -64.471 -0.267  1.00 59.40  ? 165 TYR C CB  1 
ATOM   3628 C CG  . TYR C 1 148 ? 11.757  -65.666 -0.173  1.00 57.87  ? 165 TYR C CG  1 
ATOM   3629 C CD1 . TYR C 1 148 ? 11.495  -66.833 -0.874  1.00 57.94  ? 165 TYR C CD1 1 
ATOM   3630 C CD2 . TYR C 1 148 ? 12.876  -65.639 0.659   1.00 57.38  ? 165 TYR C CD2 1 
ATOM   3631 C CE1 . TYR C 1 148 ? 12.332  -67.930 -0.779  1.00 58.04  ? 165 TYR C CE1 1 
ATOM   3632 C CE2 . TYR C 1 148 ? 13.708  -66.736 0.772   1.00 58.65  ? 165 TYR C CE2 1 
ATOM   3633 C CZ  . TYR C 1 148 ? 13.430  -67.879 0.041   1.00 58.93  ? 165 TYR C CZ  1 
ATOM   3634 O OH  . TYR C 1 148 ? 14.252  -68.977 0.123   1.00 60.88  ? 165 TYR C OH  1 
ATOM   3635 N N   . SER C 1 149 ? 12.874  -62.105 -0.702  1.00 58.42  ? 166 SER C N   1 
ATOM   3636 C CA  . SER C 1 149 ? 14.271  -61.680 -0.591  1.00 59.38  ? 166 SER C CA  1 
ATOM   3637 C C   . SER C 1 149 ? 14.872  -61.950 0.798   1.00 57.15  ? 166 SER C C   1 
ATOM   3638 O O   . SER C 1 149 ? 14.144  -62.142 1.784   1.00 55.40  ? 166 SER C O   1 
ATOM   3639 C CB  . SER C 1 149 ? 14.422  -60.195 -0.918  1.00 57.94  ? 166 SER C CB  1 
ATOM   3640 O OG  . SER C 1 149 ? 13.577  -59.826 -1.970  1.00 57.65  ? 166 SER C OG  1 
ATOM   3641 N N   . VAL C 1 150 ? 16.204  -61.975 0.832   1.00 53.79  ? 167 VAL C N   1 
ATOM   3642 C CA  . VAL C 1 150 ? 16.967  -61.972 2.063   1.00 52.97  ? 167 VAL C CA  1 
ATOM   3643 C C   . VAL C 1 150 ? 17.789  -60.703 2.108   1.00 52.14  ? 167 VAL C C   1 
ATOM   3644 O O   . VAL C 1 150 ? 18.714  -60.527 1.316   1.00 52.34  ? 167 VAL C O   1 
ATOM   3645 C CB  . VAL C 1 150 ? 17.923  -63.162 2.168   1.00 51.95  ? 167 VAL C CB  1 
ATOM   3646 C CG1 . VAL C 1 150 ? 18.806  -63.014 3.400   1.00 52.39  ? 167 VAL C CG1 1 
ATOM   3647 C CG2 . VAL C 1 150 ? 17.137  -64.454 2.240   1.00 53.26  ? 167 VAL C CG2 1 
ATOM   3648 N N   . VAL C 1 151 ? 17.440  -59.821 3.037   1.00 51.57  ? 168 VAL C N   1 
ATOM   3649 C CA  . VAL C 1 151 ? 18.212  -58.624 3.281   1.00 52.20  ? 168 VAL C CA  1 
ATOM   3650 C C   . VAL C 1 151 ? 19.358  -58.995 4.214   1.00 53.75  ? 168 VAL C C   1 
ATOM   3651 O O   . VAL C 1 151 ? 19.109  -59.511 5.311   1.00 57.83  ? 168 VAL C O   1 
ATOM   3652 C CB  . VAL C 1 151 ? 17.358  -57.539 3.958   1.00 51.80  ? 168 VAL C CB  1 
ATOM   3653 C CG1 . VAL C 1 151 ? 18.212  -56.329 4.322   1.00 50.11  ? 168 VAL C CG1 1 
ATOM   3654 C CG2 . VAL C 1 151 ? 16.192  -57.147 3.060   1.00 52.31  ? 168 VAL C CG2 1 
ATOM   3655 N N   . LEU C 1 152 ? 20.593  -58.752 3.779   1.00 49.70  ? 169 LEU C N   1 
ATOM   3656 C CA  . LEU C 1 152 ? 21.756  -58.912 4.630   1.00 49.73  ? 169 LEU C CA  1 
ATOM   3657 C C   . LEU C 1 152 ? 22.274  -57.562 5.043   1.00 50.65  ? 169 LEU C C   1 
ATOM   3658 O O   . LEU C 1 152 ? 22.345  -56.629 4.239   1.00 47.83  ? 169 LEU C O   1 
ATOM   3659 C CB  . LEU C 1 152 ? 22.872  -59.653 3.917   1.00 49.88  ? 169 LEU C CB  1 
ATOM   3660 C CG  . LEU C 1 152 ? 22.553  -61.102 3.582   1.00 51.70  ? 169 LEU C CG  1 
ATOM   3661 C CD1 . LEU C 1 152 ? 23.530  -61.621 2.542   1.00 51.97  ? 169 LEU C CD1 1 
ATOM   3662 C CD2 . LEU C 1 152 ? 22.579  -61.974 4.836   1.00 53.61  ? 169 LEU C CD2 1 
ATOM   3663 N N   . GLU C 1 153 ? 22.629  -57.455 6.317   1.00 51.95  ? 170 GLU C N   1 
ATOM   3664 C CA  . GLU C 1 153 ? 23.288  -56.262 6.792   1.00 50.83  ? 170 GLU C CA  1 
ATOM   3665 C C   . GLU C 1 153 ? 24.396  -56.658 7.740   1.00 50.29  ? 170 GLU C C   1 
ATOM   3666 O O   . GLU C 1 153 ? 24.165  -57.371 8.701   1.00 54.60  ? 170 GLU C O   1 
ATOM   3667 C CB  . GLU C 1 153 ? 22.290  -55.327 7.465   1.00 50.43  ? 170 GLU C CB  1 
ATOM   3668 C CG  . GLU C 1 153 ? 22.916  -54.003 7.891   1.00 51.17  ? 170 GLU C CG  1 
ATOM   3669 C CD  . GLU C 1 153 ? 21.918  -52.865 7.996   1.00 52.76  ? 170 GLU C CD  1 
ATOM   3670 O OE1 . GLU C 1 153 ? 20.911  -52.880 7.239   1.00 53.46  ? 170 GLU C OE1 1 
ATOM   3671 O OE2 . GLU C 1 153 ? 22.161  -51.941 8.821   1.00 54.60  ? 170 GLU C OE2 1 
ATOM   3672 N N   . SER C 1 154 ? 25.605  -56.216 7.446   1.00 48.82  ? 171 SER C N   1 
ATOM   3673 C CA  . SER C 1 154 ? 26.735  -56.446 8.318   1.00 49.13  ? 171 SER C CA  1 
ATOM   3674 C C   . SER C 1 154 ? 27.307  -55.098 8.731   1.00 48.34  ? 171 SER C C   1 
ATOM   3675 O O   . SER C 1 154 ? 26.964  -54.059 8.150   1.00 45.91  ? 171 SER C O   1 
ATOM   3676 C CB  . SER C 1 154 ? 27.792  -57.228 7.571   1.00 48.83  ? 171 SER C CB  1 
ATOM   3677 O OG  . SER C 1 154 ? 28.252  -56.435 6.499   1.00 49.35  ? 171 SER C OG  1 
ATOM   3678 N N   . TYR C 1 155 ? 28.188  -55.113 9.722   1.00 48.77  ? 172 TYR C N   1 
ATOM   3679 C CA  . TYR C 1 155 ? 28.835  -53.871 10.143  1.00 51.68  ? 172 TYR C CA  1 
ATOM   3680 C C   . TYR C 1 155 ? 30.113  -54.093 10.901  1.00 50.98  ? 172 TYR C C   1 
ATOM   3681 O O   . TYR C 1 155 ? 30.387  -55.191 11.380  1.00 48.39  ? 172 TYR C O   1 
ATOM   3682 C CB  . TYR C 1 155 ? 27.918  -53.058 11.035  1.00 53.40  ? 172 TYR C CB  1 
ATOM   3683 C CG  . TYR C 1 155 ? 27.570  -53.788 12.302  1.00 56.00  ? 172 TYR C CG  1 
ATOM   3684 C CD1 . TYR C 1 155 ? 26.547  -54.728 12.319  1.00 57.52  ? 172 TYR C CD1 1 
ATOM   3685 C CD2 . TYR C 1 155 ? 28.273  -53.554 13.485  1.00 57.80  ? 172 TYR C CD2 1 
ATOM   3686 C CE1 . TYR C 1 155 ? 26.220  -55.412 13.484  1.00 60.01  ? 172 TYR C CE1 1 
ATOM   3687 C CE2 . TYR C 1 155 ? 27.955  -54.234 14.656  1.00 58.23  ? 172 TYR C CE2 1 
ATOM   3688 C CZ  . TYR C 1 155 ? 26.929  -55.161 14.647  1.00 59.03  ? 172 TYR C CZ  1 
ATOM   3689 O OH  . TYR C 1 155 ? 26.592  -55.826 15.794  1.00 60.35  ? 172 TYR C OH  1 
ATOM   3690 N N   . ILE C 1 156 ? 30.886  -53.018 10.980  1.00 52.20  ? 173 ILE C N   1 
ATOM   3691 C CA  . ILE C 1 156 ? 32.011  -52.923 11.884  1.00 54.09  ? 173 ILE C CA  1 
ATOM   3692 C C   . ILE C 1 156 ? 31.889  -51.632 12.703  1.00 52.59  ? 173 ILE C C   1 
ATOM   3693 O O   . ILE C 1 156 ? 31.390  -50.614 12.222  1.00 50.73  ? 173 ILE C O   1 
ATOM   3694 C CB  . ILE C 1 156 ? 33.349  -53.024 11.134  1.00 56.24  ? 173 ILE C CB  1 
ATOM   3695 C CG1 . ILE C 1 156 ? 34.518  -52.977 12.120  1.00 60.09  ? 173 ILE C CG1 1 
ATOM   3696 C CG2 . ILE C 1 156 ? 33.486  -51.914 10.112  1.00 57.94  ? 173 ILE C CG2 1 
ATOM   3697 C CD1 . ILE C 1 156 ? 35.801  -53.573 11.575  1.00 61.60  ? 173 ILE C CD1 1 
ATOM   3698 N N   . VAL C 1 157 ? 32.302  -51.682 13.961  1.00 55.33  ? 174 VAL C N   1 
ATOM   3699 C CA  . VAL C 1 157 ? 32.260  -50.477 14.801  1.00 57.82  ? 174 VAL C CA  1 
ATOM   3700 C C   . VAL C 1 157 ? 33.258  -50.537 15.949  1.00 58.98  ? 174 VAL C C   1 
ATOM   3701 O O   . VAL C 1 157 ? 33.713  -51.611 16.338  1.00 59.52  ? 174 VAL C O   1 
ATOM   3702 C CB  . VAL C 1 157 ? 30.837  -50.225 15.340  1.00 57.78  ? 174 VAL C CB  1 
ATOM   3703 C CG1 . VAL C 1 157 ? 30.472  -51.251 16.409  1.00 59.22  ? 174 VAL C CG1 1 
ATOM   3704 C CG2 . VAL C 1 157 ? 30.689  -48.797 15.855  1.00 58.13  ? 174 VAL C CG2 1 
ATOM   3705 N N   . ASP C 1 158 ? 33.616  -49.375 16.473  1.00 60.42  ? 175 ASP C N   1 
ATOM   3706 C CA  . ASP C 1 158 ? 34.524  -49.325 17.605  1.00 62.75  ? 175 ASP C CA  1 
ATOM   3707 C C   . ASP C 1 158 ? 33.786  -49.682 18.880  1.00 61.38  ? 175 ASP C C   1 
ATOM   3708 O O   . ASP C 1 158 ? 32.645  -49.282 19.086  1.00 56.11  ? 175 ASP C O   1 
ATOM   3709 C CB  . ASP C 1 158 ? 35.158  -47.939 17.743  1.00 65.87  ? 175 ASP C CB  1 
ATOM   3710 C CG  . ASP C 1 158 ? 36.090  -47.600 16.588  1.00 67.02  ? 175 ASP C CG  1 
ATOM   3711 O OD1 . ASP C 1 158 ? 36.748  -48.526 16.067  1.00 68.33  ? 175 ASP C OD1 1 
ATOM   3712 O OD2 . ASP C 1 158 ? 36.178  -46.407 16.215  1.00 67.18  ? 175 ASP C OD2 1 
ATOM   3713 N N   . ILE C 1 159 ? 34.462  -50.441 19.731  1.00 63.71  ? 176 ILE C N   1 
ATOM   3714 C CA  . ILE C 1 159 ? 33.946  -50.781 21.044  1.00 65.10  ? 176 ILE C CA  1 
ATOM   3715 C C   . ILE C 1 159 ? 34.306  -49.637 21.980  1.00 67.13  ? 176 ILE C C   1 
ATOM   3716 O O   . ILE C 1 159 ? 35.489  -49.395 22.220  1.00 72.23  ? 176 ILE C O   1 
ATOM   3717 C CB  . ILE C 1 159 ? 34.603  -52.065 21.580  1.00 65.74  ? 176 ILE C CB  1 
ATOM   3718 C CG1 . ILE C 1 159 ? 34.331  -53.240 20.631  1.00 64.48  ? 176 ILE C CG1 1 
ATOM   3719 C CG2 . ILE C 1 159 ? 34.109  -52.365 22.991  1.00 65.81  ? 176 ILE C CG2 1 
ATOM   3720 C CD1 . ILE C 1 159 ? 35.319  -54.377 20.790  1.00 65.85  ? 176 ILE C CD1 1 
ATOM   3721 N N   . PRO C 1 160 ? 33.305  -48.932 22.526  1.00 68.00  ? 177 PRO C N   1 
ATOM   3722 C CA  . PRO C 1 160 ? 33.685  -47.879 23.481  1.00 72.33  ? 177 PRO C CA  1 
ATOM   3723 C C   . PRO C 1 160 ? 34.391  -48.423 24.737  1.00 72.48  ? 177 PRO C C   1 
ATOM   3724 O O   . PRO C 1 160 ? 34.067  -49.522 25.196  1.00 71.12  ? 177 PRO C O   1 
ATOM   3725 C CB  . PRO C 1 160 ? 32.349  -47.224 23.857  1.00 72.26  ? 177 PRO C CB  1 
ATOM   3726 C CG  . PRO C 1 160 ? 31.312  -47.811 22.944  1.00 70.77  ? 177 PRO C CG  1 
ATOM   3727 C CD  . PRO C 1 160 ? 31.849  -49.110 22.436  1.00 68.56  ? 177 PRO C CD  1 
ATOM   3728 N N   . GLN C 1 161 ? 35.359  -47.671 25.261  0.50 74.32  ? 178 GLN C N   1 
ATOM   3729 C CA  . GLN C 1 161 ? 35.972  -48.006 26.546  1.00 79.44  ? 178 GLN C CA  1 
ATOM   3730 C C   . GLN C 1 161 ? 34.859  -48.085 27.594  1.00 79.35  ? 178 GLN C C   1 
ATOM   3731 O O   . GLN C 1 161 ? 34.080  -47.139 27.745  1.00 76.55  ? 178 GLN C O   1 
ATOM   3732 C CB  . GLN C 1 161 ? 37.015  -46.956 26.956  1.00 80.80  ? 178 GLN C CB  1 
ATOM   3733 N N   . GLY C 1 162 ? 34.760  -49.228 28.271  1.00 78.98  ? 179 GLY C N   1 
ATOM   3734 C CA  . GLY C 1 162 ? 33.704  -49.457 29.262  1.00 81.61  ? 179 GLY C CA  1 
ATOM   3735 C C   . GLY C 1 162 ? 32.642  -50.464 28.850  1.00 82.29  ? 179 GLY C C   1 
ATOM   3736 O O   . GLY C 1 162 ? 31.681  -50.701 29.597  1.00 83.68  ? 179 GLY C O   1 
ATOM   3737 N N   . ASN C 1 163 ? 32.797  -51.044 27.659  1.00 80.70  ? 180 ASN C N   1 
ATOM   3738 C CA  . ASN C 1 163 ? 31.900  -52.095 27.182  1.00 77.48  ? 180 ASN C CA  1 
ATOM   3739 C C   . ASN C 1 163 ? 32.695  -53.196 26.517  1.00 75.93  ? 180 ASN C C   1 
ATOM   3740 O O   . ASN C 1 163 ? 33.874  -53.010 26.204  1.00 77.19  ? 180 ASN C O   1 
ATOM   3741 C CB  . ASN C 1 163 ? 30.880  -51.547 26.185  1.00 76.39  ? 180 ASN C CB  1 
ATOM   3742 C CG  . ASN C 1 163 ? 30.272  -50.233 26.627  1.00 75.34  ? 180 ASN C CG  1 
ATOM   3743 O OD1 . ASN C 1 163 ? 29.201  -50.200 27.240  1.00 78.50  ? 180 ASN C OD1 1 
ATOM   3744 N ND2 . ASN C 1 163 ? 30.958  -49.140 26.323  1.00 74.19  ? 180 ASN C ND2 1 
ATOM   3745 N N   . THR C 1 164 ? 32.045  -54.335 26.295  1.00 73.76  ? 181 THR C N   1 
ATOM   3746 C CA  . THR C 1 164 ? 32.667  -55.443 25.581  1.00 73.60  ? 181 THR C CA  1 
ATOM   3747 C C   . THR C 1 164 ? 32.237  -55.545 24.109  1.00 74.57  ? 181 THR C C   1 
ATOM   3748 O O   . THR C 1 164 ? 31.333  -54.841 23.628  1.00 73.15  ? 181 THR C O   1 
ATOM   3749 C CB  . THR C 1 164 ? 32.354  -56.786 26.252  1.00 73.67  ? 181 THR C CB  1 
ATOM   3750 O OG1 . THR C 1 164 ? 30.942  -56.902 26.448  1.00 77.15  ? 181 THR C OG1 1 
ATOM   3751 C CG2 . THR C 1 164 ? 33.040  -56.877 27.573  1.00 76.27  ? 181 THR C CG2 1 
ATOM   3752 N N   . GLU C 1 165 ? 32.949  -56.415 23.404  1.00 72.93  ? 182 GLU C N   1 
ATOM   3753 C CA  . GLU C 1 165 ? 32.531  -56.922 22.127  1.00 69.63  ? 182 GLU C CA  1 
ATOM   3754 C C   . GLU C 1 165 ? 31.089  -57.420 22.297  1.00 70.71  ? 182 GLU C C   1 
ATOM   3755 O O   . GLU C 1 165 ? 30.165  -56.839 21.729  1.00 73.33  ? 182 GLU C O   1 
ATOM   3756 C CB  . GLU C 1 165 ? 33.476  -58.060 21.691  1.00 69.86  ? 182 GLU C CB  1 
ATOM   3757 C CG  . GLU C 1 165 ? 33.699  -58.220 20.194  1.00 68.81  ? 182 GLU C CG  1 
ATOM   3758 N N   . GLU C 1 166 ? 30.883  -58.441 23.131  1.00 70.51  ? 183 GLU C N   1 
ATOM   3759 C CA  . GLU C 1 166 ? 29.582  -59.120 23.197  1.00 68.59  ? 183 GLU C CA  1 
ATOM   3760 C C   . GLU C 1 166 ? 28.445  -58.144 23.454  1.00 68.33  ? 183 GLU C C   1 
ATOM   3761 O O   . GLU C 1 166 ? 27.362  -58.306 22.915  1.00 70.74  ? 183 GLU C O   1 
ATOM   3762 C CB  . GLU C 1 166 ? 29.577  -60.226 24.250  1.00 67.06  ? 183 GLU C CB  1 
ATOM   3763 N N   . ASP C 1 167 ? 28.699  -57.111 24.245  1.00 69.18  ? 184 ASP C N   1 
ATOM   3764 C CA  . ASP C 1 167 ? 27.656  -56.143 24.567  1.00 70.91  ? 184 ASP C CA  1 
ATOM   3765 C C   . ASP C 1 167 ? 27.448  -55.091 23.488  1.00 69.15  ? 184 ASP C C   1 
ATOM   3766 O O   . ASP C 1 167 ? 26.315  -54.657 23.285  1.00 68.94  ? 184 ASP C O   1 
ATOM   3767 C CB  . ASP C 1 167 ? 27.943  -55.469 25.907  1.00 74.49  ? 184 ASP C CB  1 
ATOM   3768 C CG  . ASP C 1 167 ? 27.634  -56.364 27.078  1.00 78.00  ? 184 ASP C CG  1 
ATOM   3769 O OD1 . ASP C 1 167 ? 27.184  -57.513 26.848  1.00 77.04  ? 184 ASP C OD1 1 
ATOM   3770 O OD2 . ASP C 1 167 ? 27.827  -55.906 28.229  1.00 83.02  ? 184 ASP C OD2 1 
ATOM   3771 N N   . THR C 1 168 ? 28.522  -54.662 22.814  1.00 69.51  ? 185 THR C N   1 
ATOM   3772 C CA  . THR C 1 168 ? 28.380  -53.784 21.630  1.00 67.21  ? 185 THR C CA  1 
ATOM   3773 C C   . THR C 1 168 ? 27.582  -54.523 20.568  1.00 65.48  ? 185 THR C C   1 
ATOM   3774 O O   . THR C 1 168 ? 26.598  -53.990 20.054  1.00 64.95  ? 185 THR C O   1 
ATOM   3775 C CB  . THR C 1 168 ? 29.724  -53.338 21.016  1.00 61.98  ? 185 THR C CB  1 
ATOM   3776 N N   . ARG C 1 169 ? 27.989  -55.762 20.287  1.00 66.61  ? 186 ARG C N   1 
ATOM   3777 C CA  . ARG C 1 169 ? 27.306  -56.619 19.314  1.00 69.22  ? 186 ARG C CA  1 
ATOM   3778 C C   . ARG C 1 169 ? 25.828  -56.835 19.629  1.00 66.72  ? 186 ARG C C   1 
ATOM   3779 O O   . ARG C 1 169 ? 24.998  -56.787 18.732  1.00 65.78  ? 186 ARG C O   1 
ATOM   3780 C CB  . ARG C 1 169 ? 28.012  -57.976 19.187  1.00 72.68  ? 186 ARG C CB  1 
ATOM   3781 C CG  . ARG C 1 169 ? 27.332  -58.948 18.222  1.00 75.30  ? 186 ARG C CG  1 
ATOM   3782 C CD  . ARG C 1 169 ? 28.317  -59.866 17.495  1.00 77.46  ? 186 ARG C CD  1 
ATOM   3783 N NE  . ARG C 1 169 ? 29.306  -60.489 18.382  1.00 77.62  ? 186 ARG C NE  1 
ATOM   3784 C CZ  . ARG C 1 169 ? 30.578  -60.117 18.501  0.50 78.53  ? 186 ARG C CZ  1 
ATOM   3785 N NH1 . ARG C 1 169 ? 31.075  -59.111 17.788  1.00 78.17  ? 186 ARG C NH1 1 
ATOM   3786 N NH2 . ARG C 1 169 ? 31.362  -60.761 19.351  1.00 82.69  ? 186 ARG C NH2 1 
ATOM   3787 N N   . MET C 1 170 ? 25.495  -57.077 20.887  1.00 69.56  ? 187 MET C N   1 
ATOM   3788 C CA  . MET C 1 170 ? 24.088  -57.279 21.257  1.00 72.89  ? 187 MET C CA  1 
ATOM   3789 C C   . MET C 1 170 ? 23.256  -56.018 21.032  1.00 67.21  ? 187 MET C C   1 
ATOM   3790 O O   . MET C 1 170 ? 22.153  -56.073 20.477  1.00 62.21  ? 187 MET C O   1 
ATOM   3791 C CB  . MET C 1 170 ? 23.956  -57.764 22.703  1.00 78.39  ? 187 MET C CB  1 
ATOM   3792 C CG  . MET C 1 170 ? 24.330  -59.225 22.879  1.00 84.77  ? 187 MET C CG  1 
ATOM   3793 S SD  . MET C 1 170 ? 23.318  -60.057 24.118  1.00 102.00 ? 187 MET C SD  1 
ATOM   3794 C CE  . MET C 1 170 ? 24.036  -59.447 25.649  1.00 101.61 ? 187 MET C CE  1 
ATOM   3795 N N   . PHE C 1 171 ? 23.791  -54.875 21.435  1.00 64.37  ? 188 PHE C N   1 
ATOM   3796 C CA  . PHE C 1 171 ? 23.061  -53.637 21.246  1.00 64.55  ? 188 PHE C CA  1 
ATOM   3797 C C   . PHE C 1 171 ? 22.807  -53.411 19.764  1.00 60.50  ? 188 PHE C C   1 
ATOM   3798 O O   . PHE C 1 171 ? 21.651  -53.301 19.350  1.00 61.54  ? 188 PHE C O   1 
ATOM   3799 C CB  . PHE C 1 171 ? 23.798  -52.433 21.840  1.00 65.83  ? 188 PHE C CB  1 
ATOM   3800 C CG  . PHE C 1 171 ? 23.186  -51.116 21.456  1.00 66.67  ? 188 PHE C CG  1 
ATOM   3801 C CD1 . PHE C 1 171 ? 21.899  -50.803 21.852  1.00 66.60  ? 188 PHE C CD1 1 
ATOM   3802 C CD2 . PHE C 1 171 ? 23.884  -50.211 20.662  1.00 69.11  ? 188 PHE C CD2 1 
ATOM   3803 C CE1 . PHE C 1 171 ? 21.315  -49.604 21.486  1.00 69.15  ? 188 PHE C CE1 1 
ATOM   3804 C CE2 . PHE C 1 171 ? 23.312  -49.003 20.297  1.00 72.08  ? 188 PHE C CE2 1 
ATOM   3805 C CZ  . PHE C 1 171 ? 22.020  -48.699 20.708  1.00 71.98  ? 188 PHE C CZ  1 
ATOM   3806 N N   . VAL C 1 172 ? 23.886  -53.351 18.979  1.00 56.30  ? 189 VAL C N   1 
ATOM   3807 C CA  . VAL C 1 172 ? 23.785  -53.024 17.551  1.00 53.50  ? 189 VAL C CA  1 
ATOM   3808 C C   . VAL C 1 172 ? 22.903  -54.016 16.818  1.00 51.76  ? 189 VAL C C   1 
ATOM   3809 O O   . VAL C 1 172 ? 22.013  -53.615 16.075  1.00 49.40  ? 189 VAL C O   1 
ATOM   3810 C CB  . VAL C 1 172 ? 25.156  -52.930 16.841  1.00 52.74  ? 189 VAL C CB  1 
ATOM   3811 C CG1 . VAL C 1 172 ? 24.961  -52.919 15.337  1.00 55.46  ? 189 VAL C CG1 1 
ATOM   3812 C CG2 . VAL C 1 172 ? 25.877  -51.657 17.229  1.00 51.83  ? 189 VAL C CG2 1 
ATOM   3813 N N   . ASP C 1 173 ? 23.125  -55.307 17.032  1.00 52.45  ? 190 ASP C N   1 
ATOM   3814 C CA  . ASP C 1 173 ? 22.279  -56.307 16.369  1.00 55.00  ? 190 ASP C CA  1 
ATOM   3815 C C   . ASP C 1 173 ? 20.781  -55.999 16.559  1.00 55.36  ? 190 ASP C C   1 
ATOM   3816 O O   . ASP C 1 173 ? 20.004  -56.041 15.618  1.00 51.86  ? 190 ASP C O   1 
ATOM   3817 C CB  . ASP C 1 173 ? 22.599  -57.720 16.856  1.00 56.57  ? 190 ASP C CB  1 
ATOM   3818 C CG  . ASP C 1 173 ? 23.886  -58.280 16.260  1.00 57.31  ? 190 ASP C CG  1 
ATOM   3819 O OD1 . ASP C 1 173 ? 24.676  -57.517 15.660  1.00 56.48  ? 190 ASP C OD1 1 
ATOM   3820 O OD2 . ASP C 1 173 ? 24.109  -59.502 16.401  1.00 61.20  ? 190 ASP C OD2 1 
ATOM   3821 N N   . THR C 1 174 ? 20.377  -55.669 17.778  1.00 58.74  ? 191 THR C N   1 
ATOM   3822 C CA  . THR C 1 174 ? 18.967  -55.381 18.024  1.00 59.67  ? 191 THR C CA  1 
ATOM   3823 C C   . THR C 1 174 ? 18.476  -54.213 17.178  1.00 57.56  ? 191 THR C C   1 
ATOM   3824 O O   . THR C 1 174 ? 17.355  -54.234 16.665  1.00 56.37  ? 191 THR C O   1 
ATOM   3825 C CB  . THR C 1 174 ? 18.702  -55.056 19.489  1.00 60.78  ? 191 THR C CB  1 
ATOM   3826 O OG1 . THR C 1 174 ? 19.493  -55.910 20.313  1.00 61.26  ? 191 THR C OG1 1 
ATOM   3827 C CG2 . THR C 1 174 ? 17.248  -55.285 19.796  1.00 65.39  ? 191 THR C CG2 1 
ATOM   3828 N N   . VAL C 1 175 ? 19.323  -53.204 17.038  1.00 54.71  ? 192 VAL C N   1 
ATOM   3829 C CA  . VAL C 1 175 ? 18.965  -52.019 16.286  1.00 54.34  ? 192 VAL C CA  1 
ATOM   3830 C C   . VAL C 1 175 ? 18.760  -52.366 14.823  1.00 55.41  ? 192 VAL C C   1 
ATOM   3831 O O   . VAL C 1 175 ? 17.758  -51.977 14.209  1.00 56.70  ? 192 VAL C O   1 
ATOM   3832 C CB  . VAL C 1 175 ? 20.066  -50.955 16.370  1.00 53.10  ? 192 VAL C CB  1 
ATOM   3833 C CG1 . VAL C 1 175 ? 19.811  -49.836 15.366  1.00 52.54  ? 192 VAL C CG1 1 
ATOM   3834 C CG2 . VAL C 1 175 ? 20.165  -50.417 17.786  1.00 53.69  ? 192 VAL C CG2 1 
ATOM   3835 N N   . VAL C 1 176 ? 19.733  -53.089 14.274  1.00 53.64  ? 193 VAL C N   1 
ATOM   3836 C CA  . VAL C 1 176 ? 19.743  -53.421 12.874  1.00 50.88  ? 193 VAL C CA  1 
ATOM   3837 C C   . VAL C 1 176 ? 18.550  -54.334 12.591  1.00 50.08  ? 193 VAL C C   1 
ATOM   3838 O O   . VAL C 1 176 ? 17.772  -54.094 11.671  1.00 52.75  ? 193 VAL C O   1 
ATOM   3839 C CB  . VAL C 1 176 ? 21.093  -54.055 12.466  1.00 52.02  ? 193 VAL C CB  1 
ATOM   3840 C CG1 . VAL C 1 176 ? 21.085  -54.479 11.003  1.00 52.55  ? 193 VAL C CG1 1 
ATOM   3841 C CG2 . VAL C 1 176 ? 22.222  -53.062 12.679  1.00 52.11  ? 193 VAL C CG2 1 
ATOM   3842 N N   . LYS C 1 177 ? 18.382  -55.355 13.407  1.00 50.17  ? 194 LYS C N   1 
ATOM   3843 C CA  . LYS C 1 177 ? 17.235  -56.245 13.276  1.00 53.11  ? 194 LYS C CA  1 
ATOM   3844 C C   . LYS C 1 177 ? 15.907  -55.475 13.310  1.00 51.39  ? 194 LYS C C   1 
ATOM   3845 O O   . LYS C 1 177 ? 14.983  -55.757 12.553  1.00 53.51  ? 194 LYS C O   1 
ATOM   3846 C CB  . LYS C 1 177 ? 17.261  -57.330 14.364  1.00 55.20  ? 194 LYS C CB  1 
ATOM   3847 C CG  . LYS C 1 177 ? 16.193  -58.396 14.153  1.00 58.00  ? 194 LYS C CG  1 
ATOM   3848 C CD  . LYS C 1 177 ? 16.633  -59.765 14.653  1.00 60.71  ? 194 LYS C CD  1 
ATOM   3849 N N   . SER C 1 178 ? 15.838  -54.481 14.175  1.00 51.27  ? 195 SER C N   1 
ATOM   3850 C CA  . SER C 1 178 ? 14.682  -53.608 14.246  1.00 50.74  ? 195 SER C CA  1 
ATOM   3851 C C   . SER C 1 178 ? 14.432  -52.924 12.893  1.00 49.93  ? 195 SER C C   1 
ATOM   3852 O O   . SER C 1 178 ? 13.300  -52.853 12.422  1.00 51.64  ? 195 SER C O   1 
ATOM   3853 C CB  . SER C 1 178 ? 14.860  -52.596 15.389  1.00 50.57  ? 195 SER C CB  1 
ATOM   3854 O OG  . SER C 1 178 ? 14.414  -51.310 15.012  1.00 53.89  ? 195 SER C OG  1 
ATOM   3855 N N   . ASN C 1 179 ? 15.495  -52.442 12.269  1.00 49.24  ? 196 ASN C N   1 
ATOM   3856 C CA  . ASN C 1 179 ? 15.384  -51.770 10.989  1.00 48.56  ? 196 ASN C CA  1 
ATOM   3857 C C   . ASN C 1 179 ? 14.932  -52.696 9.881   1.00 49.16  ? 196 ASN C C   1 
ATOM   3858 O O   . ASN C 1 179 ? 14.087  -52.321 9.068   1.00 48.33  ? 196 ASN C O   1 
ATOM   3859 C CB  . ASN C 1 179 ? 16.718  -51.142 10.598  1.00 48.51  ? 196 ASN C CB  1 
ATOM   3860 C CG  . ASN C 1 179 ? 17.156  -50.055 11.562  1.00 48.54  ? 196 ASN C CG  1 
ATOM   3861 O OD1 . ASN C 1 179 ? 16.380  -49.605 12.412  1.00 51.13  ? 196 ASN C OD1 1 
ATOM   3862 N ND2 . ASN C 1 179 ? 18.400  -49.627 11.434  1.00 46.48  ? 196 ASN C ND2 1 
ATOM   3863 N N   . LEU C 1 180 ? 15.482  -53.906 9.834   1.00 50.27  ? 197 LEU C N   1 
ATOM   3864 C CA  . LEU C 1 180 ? 15.109  -54.836 8.765   1.00 51.07  ? 197 LEU C CA  1 
ATOM   3865 C C   . LEU C 1 180 ? 13.682  -55.347 8.937   1.00 52.65  ? 197 LEU C C   1 
ATOM   3866 O O   . LEU C 1 180 ? 13.036  -55.658 7.952   1.00 53.72  ? 197 LEU C O   1 
ATOM   3867 C CB  . LEU C 1 180 ? 16.080  -56.017 8.677   1.00 51.98  ? 197 LEU C CB  1 
ATOM   3868 C CG  . LEU C 1 180 ? 17.585  -55.700 8.655   1.00 51.80  ? 197 LEU C CG  1 
ATOM   3869 C CD1 . LEU C 1 180 ? 18.385  -56.951 8.322   1.00 49.86  ? 197 LEU C CD1 1 
ATOM   3870 C CD2 . LEU C 1 180 ? 17.898  -54.579 7.669   1.00 52.34  ? 197 LEU C CD2 1 
ATOM   3871 N N   . GLN C 1 181 ? 13.194  -55.441 10.181  1.00 53.40  ? 198 GLN C N   1 
ATOM   3872 C CA  . GLN C 1 181 ? 11.793  -55.851 10.431  1.00 52.30  ? 198 GLN C CA  1 
ATOM   3873 C C   . GLN C 1 181 ? 10.804  -54.799 9.905   1.00 50.07  ? 198 GLN C C   1 
ATOM   3874 O O   . GLN C 1 181 ? 9.786   -55.139 9.329   1.00 47.13  ? 198 GLN C O   1 
ATOM   3875 C CB  . GLN C 1 181 ? 11.541  -56.088 11.930  1.00 52.34  ? 198 GLN C CB  1 
ATOM   3876 N N   . ASN C 1 182 ? 11.119  -53.526 10.138  1.00 48.59  ? 199 ASN C N   1 
ATOM   3877 C CA  . ASN C 1 182 ? 10.269  -52.423 9.748   1.00 50.37  ? 199 ASN C CA  1 
ATOM   3878 C C   . ASN C 1 182 ? 10.301  -52.331 8.228   1.00 52.44  ? 199 ASN C C   1 
ATOM   3879 O O   . ASN C 1 182 ? 9.274   -52.203 7.556   1.00 53.22  ? 199 ASN C O   1 
ATOM   3880 C CB  . ASN C 1 182 ? 10.762  -51.115 10.396  1.00 51.03  ? 199 ASN C CB  1 
ATOM   3881 C CG  . ASN C 1 182 ? 10.587  -51.089 11.934  1.00 53.00  ? 199 ASN C CG  1 
ATOM   3882 O OD1 . ASN C 1 182 ? 9.694   -51.732 12.499  1.00 53.03  ? 199 ASN C OD1 1 
ATOM   3883 N ND2 . ASN C 1 182 ? 11.440  -50.327 12.607  1.00 51.98  ? 199 ASN C ND2 1 
ATOM   3884 N N   . LEU C 1 183 ? 11.503  -52.444 7.684   1.00 53.76  ? 200 LEU C N   1 
ATOM   3885 C CA  . LEU C 1 183 ? 11.693  -52.507 6.252   1.00 51.53  ? 200 LEU C CA  1 
ATOM   3886 C C   . LEU C 1 183 ? 10.790  -53.594 5.714   1.00 50.66  ? 200 LEU C C   1 
ATOM   3887 O O   . LEU C 1 183 ? 10.064  -53.370 4.762   1.00 52.53  ? 200 LEU C O   1 
ATOM   3888 C CB  . LEU C 1 183 ? 13.164  -52.790 5.934   1.00 50.56  ? 200 LEU C CB  1 
ATOM   3889 C CG  . LEU C 1 183 ? 13.587  -52.865 4.470   1.00 49.51  ? 200 LEU C CG  1 
ATOM   3890 C CD1 . LEU C 1 183 ? 13.475  -51.534 3.745   1.00 49.78  ? 200 LEU C CD1 1 
ATOM   3891 C CD2 . LEU C 1 183 ? 15.007  -53.381 4.419   1.00 48.95  ? 200 LEU C CD2 1 
ATOM   3892 N N   . ALA C 1 184 ? 10.798  -54.752 6.361   1.00 51.77  ? 201 ALA C N   1 
ATOM   3893 C CA  . ALA C 1 184 ? 9.971   -55.882 5.928   1.00 53.59  ? 201 ALA C CA  1 
ATOM   3894 C C   . ALA C 1 184 ? 8.508   -55.499 5.783   1.00 54.98  ? 201 ALA C C   1 
ATOM   3895 O O   . ALA C 1 184 ? 7.864   -55.859 4.800   1.00 61.07  ? 201 ALA C O   1 
ATOM   3896 C CB  . ALA C 1 184 ? 10.109  -57.067 6.876   1.00 53.66  ? 201 ALA C CB  1 
ATOM   3897 N N   . VAL C 1 185 ? 7.989   -54.743 6.736   1.00 53.29  ? 202 VAL C N   1 
ATOM   3898 C CA  . VAL C 1 185 ? 6.575   -54.391 6.701   1.00 53.33  ? 202 VAL C CA  1 
ATOM   3899 C C   . VAL C 1 185 ? 6.331   -53.358 5.619   1.00 51.06  ? 202 VAL C C   1 
ATOM   3900 O O   . VAL C 1 185 ? 5.421   -53.547 4.849   1.00 53.51  ? 202 VAL C O   1 
ATOM   3901 C CB  . VAL C 1 185 ? 6.023   -53.859 8.050   1.00 54.29  ? 202 VAL C CB  1 
ATOM   3902 C CG1 . VAL C 1 185 ? 4.514   -53.824 8.036   1.00 56.31  ? 202 VAL C CG1 1 
ATOM   3903 C CG2 . VAL C 1 185 ? 6.492   -54.691 9.227   1.00 54.77  ? 202 VAL C CG2 1 
ATOM   3904 N N   . ILE C 1 186 ? 7.102   -52.268 5.546   1.00 50.52  ? 203 ILE C N   1 
ATOM   3905 C CA  . ILE C 1 186 ? 6.828   -51.278 4.483   1.00 52.00  ? 203 ILE C CA  1 
ATOM   3906 C C   . ILE C 1 186 ? 7.034   -51.909 3.119   1.00 53.72  ? 203 ILE C C   1 
ATOM   3907 O O   . ILE C 1 186 ? 6.318   -51.592 2.191   1.00 52.97  ? 203 ILE C O   1 
ATOM   3908 C CB  . ILE C 1 186 ? 7.695   -49.991 4.495   1.00 51.72  ? 203 ILE C CB  1 
ATOM   3909 C CG1 . ILE C 1 186 ? 9.178   -50.315 4.697   1.00 49.31  ? 203 ILE C CG1 1 
ATOM   3910 C CG2 . ILE C 1 186 ? 7.159   -48.954 5.473   1.00 52.47  ? 203 ILE C CG2 1 
ATOM   3911 N N   . SER C 1 187 ? 8.017   -52.797 3.013   1.00 56.75  ? 204 SER C N   1 
ATOM   3912 C CA  . SER C 1 187 ? 8.363   -53.452 1.747   1.00 58.53  ? 204 SER C CA  1 
ATOM   3913 C C   . SER C 1 187 ? 7.239   -54.296 1.132   1.00 60.31  ? 204 SER C C   1 
ATOM   3914 O O   . SER C 1 187 ? 7.037   -54.271 -0.077  1.00 56.05  ? 204 SER C O   1 
ATOM   3915 C CB  . SER C 1 187 ? 9.596   -54.331 1.942   1.00 59.65  ? 204 SER C CB  1 
ATOM   3916 O OG  . SER C 1 187 ? 10.747  -53.541 2.217   1.00 61.17  ? 204 SER C OG  1 
ATOM   3917 N N   . THR C 1 188 ? 6.509   -55.043 1.954   1.00 65.43  ? 205 THR C N   1 
ATOM   3918 C CA  . THR C 1 188 ? 5.470   -55.921 1.413   1.00 69.27  ? 205 THR C CA  1 
ATOM   3919 C C   . THR C 1 188 ? 4.133   -55.197 1.254   1.00 72.41  ? 205 THR C C   1 
ATOM   3920 O O   . THR C 1 188 ? 3.359   -55.515 0.340   1.00 71.31  ? 205 THR C O   1 
ATOM   3921 C CB  . THR C 1 188 ? 5.262   -57.185 2.264   1.00 67.75  ? 205 THR C CB  1 
ATOM   3922 O OG1 . THR C 1 188 ? 4.361   -56.893 3.338   1.00 72.60  ? 205 THR C OG1 1 
ATOM   3923 C CG2 . THR C 1 188 ? 6.576   -57.708 2.799   1.00 64.23  ? 205 THR C CG2 1 
ATOM   3924 N N   . ALA C 1 189 ? 3.874   -54.250 2.160   1.00 76.05  ? 206 ALA C N   1 
ATOM   3925 C CA  . ALA C 1 189 ? 2.665   -53.415 2.155   1.00 84.14  ? 206 ALA C CA  1 
ATOM   3926 C C   . ALA C 1 189 ? 1.347   -54.215 2.202   1.00 96.29  ? 206 ALA C C   1 
ATOM   3927 O O   . ALA C 1 189 ? 0.470   -54.044 1.337   1.00 101.96 ? 206 ALA C O   1 
ATOM   3928 C CB  . ALA C 1 189 ? 2.675   -52.470 0.960   1.00 82.69  ? 206 ALA C CB  1 
ATOM   3929 N N   . SER C 1 190 ? 1.220   -55.079 3.214   1.00 97.39  ? 207 SER C N   1 
ATOM   3930 C CA  . SER C 1 190 ? -0.020  -55.815 3.486   1.00 101.20 ? 207 SER C CA  1 
ATOM   3931 C C   . SER C 1 190 ? -0.470  -56.678 2.305   1.00 102.09 ? 207 SER C C   1 
ATOM   3932 O O   . SER C 1 190 ? -1.607  -56.570 1.836   1.00 102.89 ? 207 SER C O   1 
ATOM   3933 C CB  . SER C 1 190 ? -1.143  -54.845 3.917   1.00 105.07 ? 207 SER C CB  1 
ATOM   3934 O OG  . SER C 1 190 ? -1.538  -53.976 2.863   1.00 103.91 ? 207 SER C OG  1 
ATOM   3935 N N   . TYR D 1 6   ? 4.302   -69.817 20.883  1.00 125.10 ? 23  TYR D N   1 
ATOM   3936 C CA  . TYR D 1 6   ? 5.273   -70.845 21.373  1.00 121.75 ? 23  TYR D CA  1 
ATOM   3937 C C   . TYR D 1 6   ? 6.666   -70.638 20.765  1.00 119.01 ? 23  TYR D C   1 
ATOM   3938 O O   . TYR D 1 6   ? 7.290   -71.579 20.276  1.00 124.30 ? 23  TYR D O   1 
ATOM   3939 C CB  . TYR D 1 6   ? 4.752   -72.266 21.082  1.00 125.54 ? 23  TYR D CB  1 
ATOM   3940 C CG  . TYR D 1 6   ? 5.437   -73.358 21.877  1.00 121.26 ? 23  TYR D CG  1 
ATOM   3941 C CD1 . TYR D 1 6   ? 5.097   -73.591 23.208  1.00 120.46 ? 23  TYR D CD1 1 
ATOM   3942 C CD2 . TYR D 1 6   ? 6.418   -74.164 21.298  1.00 121.04 ? 23  TYR D CD2 1 
ATOM   3943 C CE1 . TYR D 1 6   ? 5.719   -74.586 23.944  1.00 119.91 ? 23  TYR D CE1 1 
ATOM   3944 C CE2 . TYR D 1 6   ? 7.048   -75.161 22.026  1.00 120.56 ? 23  TYR D CE2 1 
ATOM   3945 C CZ  . TYR D 1 6   ? 6.695   -75.370 23.349  1.00 119.30 ? 23  TYR D CZ  1 
ATOM   3946 O OH  . TYR D 1 6   ? 7.313   -76.358 24.081  1.00 114.28 ? 23  TYR D OH  1 
ATOM   3947 N N   . GLY D 1 7   ? 7.154   -69.400 20.800  1.00 113.42 ? 24  GLY D N   1 
ATOM   3948 C CA  . GLY D 1 7   ? 8.540   -69.117 20.423  1.00 115.04 ? 24  GLY D CA  1 
ATOM   3949 C C   . GLY D 1 7   ? 9.527   -69.552 21.500  1.00 116.07 ? 24  GLY D C   1 
ATOM   3950 O O   . GLY D 1 7   ? 10.741  -69.561 21.273  1.00 115.46 ? 24  GLY D O   1 
ATOM   3951 N N   . LEU D 1 8   ? 8.995   -69.927 22.666  1.00 115.75 ? 25  LEU D N   1 
ATOM   3952 C CA  . LEU D 1 8   ? 9.778   -70.155 23.871  1.00 110.44 ? 25  LEU D CA  1 
ATOM   3953 C C   . LEU D 1 8   ? 10.354  -71.563 23.929  1.00 114.74 ? 25  LEU D C   1 
ATOM   3954 O O   . LEU D 1 8   ? 10.024  -72.416 23.103  1.00 114.49 ? 25  LEU D O   1 
ATOM   3955 C CB  . LEU D 1 8   ? 8.894   -69.902 25.096  1.00 105.90 ? 25  LEU D CB  1 
ATOM   3956 N N   . THR D 1 9   ? 11.213  -71.793 24.921  1.00 120.34 ? 26  THR D N   1 
ATOM   3957 C CA  . THR D 1 9   ? 11.844  -73.098 25.147  1.00 123.72 ? 26  THR D CA  1 
ATOM   3958 C C   . THR D 1 9   ? 11.155  -73.846 26.298  1.00 126.37 ? 26  THR D C   1 
ATOM   3959 O O   . THR D 1 9   ? 10.113  -73.406 26.791  1.00 129.43 ? 26  THR D O   1 
ATOM   3960 C CB  . THR D 1 9   ? 13.349  -72.932 25.440  1.00 125.12 ? 26  THR D CB  1 
ATOM   3961 O OG1 . THR D 1 9   ? 13.525  -71.965 26.483  1.00 122.66 ? 26  THR D OG1 1 
ATOM   3962 C CG2 . THR D 1 9   ? 14.096  -72.484 24.183  1.00 127.12 ? 26  THR D CG2 1 
ATOM   3963 N N   . LYS D 1 10  ? 11.738  -74.975 26.711  1.00 129.25 ? 27  LYS D N   1 
ATOM   3964 C CA  . LYS D 1 10  ? 11.137  -75.881 27.701  1.00 125.75 ? 27  LYS D CA  1 
ATOM   3965 C C   . LYS D 1 10  ? 10.818  -75.210 29.036  1.00 127.90 ? 27  LYS D C   1 
ATOM   3966 O O   . LYS D 1 10  ? 9.654   -75.136 29.432  1.00 129.18 ? 27  LYS D O   1 
ATOM   3967 C CB  . LYS D 1 10  ? 12.054  -77.092 27.934  1.00 123.70 ? 27  LYS D CB  1 
ATOM   3968 C CG  . LYS D 1 10  ? 11.452  -78.186 28.804  1.00 123.72 ? 27  LYS D CG  1 
ATOM   3969 N N   . ASP D 1 11  ? 11.853  -74.715 29.715  1.00 130.81 ? 28  ASP D N   1 
ATOM   3970 C CA  . ASP D 1 11  ? 11.718  -74.183 31.081  1.00 131.30 ? 28  ASP D CA  1 
ATOM   3971 C C   . ASP D 1 11  ? 10.914  -72.882 31.162  1.00 127.39 ? 28  ASP D C   1 
ATOM   3972 O O   . ASP D 1 11  ? 10.249  -72.628 32.170  1.00 130.04 ? 28  ASP D O   1 
ATOM   3973 C CB  . ASP D 1 11  ? 13.099  -73.970 31.713  1.00 133.68 ? 28  ASP D CB  1 
ATOM   3974 N N   . GLU D 1 12  ? 10.983  -72.061 30.114  1.00 119.72 ? 29  GLU D N   1 
ATOM   3975 C CA  . GLU D 1 12  ? 10.266  -70.778 30.080  1.00 114.39 ? 29  GLU D CA  1 
ATOM   3976 C C   . GLU D 1 12  ? 8.749   -70.967 29.982  1.00 111.97 ? 29  GLU D C   1 
ATOM   3977 O O   . GLU D 1 12  ? 7.989   -70.300 30.688  1.00 109.63 ? 29  GLU D O   1 
ATOM   3978 C CB  . GLU D 1 12  ? 10.743  -69.914 28.907  1.00 110.26 ? 29  GLU D CB  1 
ATOM   3979 C CG  . GLU D 1 12  ? 12.082  -69.221 29.111  1.00 107.61 ? 29  GLU D CG  1 
ATOM   3980 C CD  . GLU D 1 12  ? 12.479  -68.364 27.918  1.00 101.93 ? 29  GLU D CD  1 
ATOM   3981 O OE1 . GLU D 1 12  ? 12.084  -68.699 26.781  1.00 95.94  ? 29  GLU D OE1 1 
ATOM   3982 O OE2 . GLU D 1 12  ? 13.189  -67.355 28.110  1.00 100.27 ? 29  GLU D OE2 1 
ATOM   3983 N N   . PHE D 1 13  ? 8.318   -71.863 29.095  1.00 109.51 ? 30  PHE D N   1 
ATOM   3984 C CA  . PHE D 1 13  ? 6.897   -72.162 28.931  1.00 111.87 ? 30  PHE D CA  1 
ATOM   3985 C C   . PHE D 1 13  ? 6.307   -72.698 30.227  1.00 112.93 ? 30  PHE D C   1 
ATOM   3986 O O   . PHE D 1 13  ? 5.210   -72.313 30.624  1.00 113.43 ? 30  PHE D O   1 
ATOM   3987 C CB  . PHE D 1 13  ? 6.672   -73.177 27.804  1.00 116.26 ? 30  PHE D CB  1 
ATOM   3988 C CG  . PHE D 1 13  ? 5.281   -73.749 27.780  1.00 121.60 ? 30  PHE D CG  1 
ATOM   3989 C CD1 . PHE D 1 13  ? 4.190   -72.938 27.490  1.00 121.96 ? 30  PHE D CD1 1 
ATOM   3990 C CD2 . PHE D 1 13  ? 5.061   -75.092 28.068  1.00 126.09 ? 30  PHE D CD2 1 
ATOM   3991 C CE1 . PHE D 1 13  ? 2.907   -73.455 27.479  1.00 129.73 ? 30  PHE D CE1 1 
ATOM   3992 C CE2 . PHE D 1 13  ? 3.779   -75.617 28.056  1.00 133.84 ? 30  PHE D CE2 1 
ATOM   3993 C CZ  . PHE D 1 13  ? 2.700   -74.797 27.761  1.00 135.93 ? 30  PHE D CZ  1 
ATOM   3994 N N   . SER D 1 14  ? 7.051   -73.590 30.872  1.00 115.41 ? 31  SER D N   1 
ATOM   3995 C CA  . SER D 1 14  ? 6.669   -74.147 32.163  1.00 116.79 ? 31  SER D CA  1 
ATOM   3996 C C   . SER D 1 14  ? 6.045   -73.094 33.075  1.00 117.56 ? 31  SER D C   1 
ATOM   3997 O O   . SER D 1 14  ? 4.968   -73.315 33.626  1.00 124.71 ? 31  SER D O   1 
ATOM   3998 C CB  . SER D 1 14  ? 7.885   -74.774 32.856  1.00 114.13 ? 31  SER D CB  1 
ATOM   3999 N N   . THR D 1 15  ? 6.703   -71.943 33.209  1.00 114.82 ? 32  THR D N   1 
ATOM   4000 C CA  . THR D 1 15  ? 6.265   -70.904 34.152  1.00 113.16 ? 32  THR D CA  1 
ATOM   4001 C C   . THR D 1 15  ? 5.467   -69.784 33.475  1.00 108.12 ? 32  THR D C   1 
ATOM   4002 O O   . THR D 1 15  ? 5.622   -68.610 33.826  1.00 108.08 ? 32  THR D O   1 
ATOM   4003 C CB  . THR D 1 15  ? 7.468   -70.279 34.893  1.00 114.46 ? 32  THR D CB  1 
ATOM   4004 O OG1 . THR D 1 15  ? 8.225   -69.466 33.985  1.00 112.25 ? 32  THR D OG1 1 
ATOM   4005 C CG2 . THR D 1 15  ? 8.370   -71.369 35.502  1.00 115.08 ? 32  THR D CG2 1 
ATOM   4006 N N   . LEU D 1 16  ? 4.609   -70.150 32.522  1.00 101.18 ? 33  LEU D N   1 
ATOM   4007 C CA  . LEU D 1 16  ? 3.866   -69.162 31.735  1.00 96.02  ? 33  LEU D CA  1 
ATOM   4008 C C   . LEU D 1 16  ? 2.534   -69.635 31.142  1.00 94.22  ? 33  LEU D C   1 
ATOM   4009 O O   . LEU D 1 16  ? 1.724   -68.796 30.734  1.00 90.98  ? 33  LEU D O   1 
ATOM   4010 C CB  . LEU D 1 16  ? 4.749   -68.636 30.601  1.00 92.90  ? 33  LEU D CB  1 
ATOM   4011 N N   . ASP D 1 17  ? 2.298   -70.948 31.078  1.00 93.75  ? 34  ASP D N   1 
ATOM   4012 C CA  . ASP D 1 17  ? 1.071   -71.464 30.463  1.00 95.15  ? 34  ASP D CA  1 
ATOM   4013 C C   . ASP D 1 17  ? -0.159  -70.810 31.086  1.00 92.21  ? 34  ASP D C   1 
ATOM   4014 O O   . ASP D 1 17  ? -1.072  -70.363 30.376  1.00 83.43  ? 34  ASP D O   1 
ATOM   4015 C CB  . ASP D 1 17  ? 0.972   -72.990 30.596  1.00 97.03  ? 34  ASP D CB  1 
ATOM   4016 C CG  . ASP D 1 17  ? -0.198  -73.576 29.793  0.50 100.95 ? 34  ASP D CG  1 
ATOM   4017 O OD1 . ASP D 1 17  ? -0.742  -72.885 28.889  1.00 105.98 ? 34  ASP D OD1 1 
ATOM   4018 O OD2 . ASP D 1 17  ? -0.573  -74.736 30.065  1.00 100.99 ? 34  ASP D OD2 1 
ATOM   4019 N N   . SER D 1 18  ? -0.158  -70.767 32.419  1.00 90.97  ? 35  SER D N   1 
ATOM   4020 C CA  . SER D 1 18  ? -1.195  -70.102 33.200  1.00 89.85  ? 35  SER D CA  1 
ATOM   4021 C C   . SER D 1 18  ? -1.503  -68.704 32.674  1.00 88.57  ? 35  SER D C   1 
ATOM   4022 O O   . SER D 1 18  ? -2.655  -68.359 32.446  1.00 88.03  ? 35  SER D O   1 
ATOM   4023 C CB  . SER D 1 18  ? -0.738  -69.985 34.643  1.00 90.28  ? 35  SER D CB  1 
ATOM   4024 O OG  . SER D 1 18  ? 0.511   -69.326 34.688  1.00 91.22  ? 35  SER D OG  1 
ATOM   4025 N N   . ILE D 1 19  ? -0.463  -67.905 32.474  1.00 87.64  ? 36  ILE D N   1 
ATOM   4026 C CA  . ILE D 1 19  ? -0.641  -66.528 32.008  1.00 85.11  ? 36  ILE D CA  1 
ATOM   4027 C C   . ILE D 1 19  ? -1.169  -66.523 30.580  1.00 80.83  ? 36  ILE D C   1 
ATOM   4028 O O   . ILE D 1 19  ? -2.065  -65.748 30.257  1.00 81.27  ? 36  ILE D O   1 
ATOM   4029 C CB  . ILE D 1 19  ? 0.668   -65.714 32.110  1.00 84.86  ? 36  ILE D CB  1 
ATOM   4030 C CG1 . ILE D 1 19  ? 1.136   -65.662 33.571  1.00 84.07  ? 36  ILE D CG1 1 
ATOM   4031 C CG2 . ILE D 1 19  ? 0.476   -64.302 31.563  1.00 82.38  ? 36  ILE D CG2 1 
ATOM   4032 C CD1 . ILE D 1 19  ? 2.613   -65.391 33.727  1.00 85.62  ? 36  ILE D CD1 1 
ATOM   4033 N N   . ILE D 1 20  ? -0.630  -67.398 29.736  1.00 77.75  ? 37  ILE D N   1 
ATOM   4034 C CA  . ILE D 1 20  ? -1.160  -67.562 28.383  1.00 77.33  ? 37  ILE D CA  1 
ATOM   4035 C C   . ILE D 1 20  ? -2.619  -68.010 28.441  1.00 77.85  ? 37  ILE D C   1 
ATOM   4036 O O   . ILE D 1 20  ? -3.480  -67.436 27.760  1.00 80.42  ? 37  ILE D O   1 
ATOM   4037 C CB  . ILE D 1 20  ? -0.353  -68.584 27.555  1.00 78.09  ? 37  ILE D CB  1 
ATOM   4038 C CG1 . ILE D 1 20  ? 1.114   -68.141 27.434  1.00 76.99  ? 37  ILE D CG1 1 
ATOM   4039 C CG2 . ILE D 1 20  ? -0.976  -68.775 26.169  1.00 76.35  ? 37  ILE D CG2 1 
ATOM   4040 N N   . ARG D 1 21  ? -2.883  -69.029 29.258  1.00 76.12  ? 38  ARG D N   1 
ATOM   4041 C CA  . ARG D 1 21  ? -4.235  -69.536 29.469  1.00 73.47  ? 38  ARG D CA  1 
ATOM   4042 C C   . ARG D 1 21  ? -5.143  -68.486 30.108  1.00 71.66  ? 38  ARG D C   1 
ATOM   4043 O O   . ARG D 1 21  ? -6.218  -68.215 29.600  1.00 71.44  ? 38  ARG D O   1 
ATOM   4044 C CB  . ARG D 1 21  ? -4.208  -70.796 30.335  1.00 73.29  ? 38  ARG D CB  1 
ATOM   4045 N N   . THR D 1 22  ? -4.708  -67.884 31.207  1.00 72.03  ? 39  THR D N   1 
ATOM   4046 C CA  . THR D 1 22  ? -5.566  -66.958 31.951  1.00 73.23  ? 39  THR D CA  1 
ATOM   4047 C C   . THR D 1 22  ? -5.817  -65.658 31.202  1.00 72.66  ? 39  THR D C   1 
ATOM   4048 O O   . THR D 1 22  ? -6.899  -65.094 31.309  1.00 73.22  ? 39  THR D O   1 
ATOM   4049 C CB  . THR D 1 22  ? -4.993  -66.589 33.347  1.00 76.87  ? 39  THR D CB  1 
ATOM   4050 O OG1 . THR D 1 22  ? -4.494  -67.757 34.015  1.00 79.01  ? 39  THR D OG1 1 
ATOM   4051 C CG2 . THR D 1 22  ? -6.071  -65.932 34.232  1.00 76.11  ? 39  THR D CG2 1 
ATOM   4052 N N   . HIS D 1 23  ? -4.834  -65.167 30.454  1.00 71.93  ? 40  HIS D N   1 
ATOM   4053 C CA  . HIS D 1 23  ? -4.933  -63.810 29.920  1.00 69.39  ? 40  HIS D CA  1 
ATOM   4054 C C   . HIS D 1 23  ? -4.824  -63.622 28.417  1.00 67.84  ? 40  HIS D C   1 
ATOM   4055 O O   . HIS D 1 23  ? -5.294  -62.602 27.916  1.00 65.95  ? 40  HIS D O   1 
ATOM   4056 C CB  . HIS D 1 23  ? -3.894  -62.927 30.584  1.00 70.07  ? 40  HIS D CB  1 
ATOM   4057 C CG  . HIS D 1 23  ? -4.111  -62.761 32.048  1.00 72.91  ? 40  HIS D CG  1 
ATOM   4058 N ND1 . HIS D 1 23  ? -5.148  -62.013 32.561  1.00 72.88  ? 40  HIS D ND1 1 
ATOM   4059 C CD2 . HIS D 1 23  ? -3.429  -63.250 33.112  1.00 73.01  ? 40  HIS D CD2 1 
ATOM   4060 C CE1 . HIS D 1 23  ? -5.093  -62.046 33.882  1.00 74.54  ? 40  HIS D CE1 1 
ATOM   4061 N NE2 . HIS D 1 23  ? -4.057  -62.784 34.240  1.00 74.19  ? 40  HIS D NE2 1 
ATOM   4062 N N   . HIS D 1 24  ? -4.202  -64.556 27.700  1.00 67.57  ? 41  HIS D N   1 
ATOM   4063 C CA  . HIS D 1 24  ? -3.861  -64.305 26.281  1.00 67.93  ? 41  HIS D CA  1 
ATOM   4064 C C   . HIS D 1 24  ? -4.699  -65.073 25.286  1.00 67.86  ? 41  HIS D C   1 
ATOM   4065 O O   . HIS D 1 24  ? -4.697  -64.740 24.114  1.00 64.87  ? 41  HIS D O   1 
ATOM   4066 C CB  . HIS D 1 24  ? -2.380  -64.595 25.993  1.00 65.64  ? 41  HIS D CB  1 
ATOM   4067 C CG  . HIS D 1 24  ? -1.444  -63.582 26.565  1.00 61.40  ? 41  HIS D CG  1 
ATOM   4068 N ND1 . HIS D 1 24  ? -1.094  -62.429 25.899  1.00 60.16  ? 41  HIS D ND1 1 
ATOM   4069 C CD2 . HIS D 1 24  ? -0.779  -63.557 27.742  1.00 60.09  ? 41  HIS D CD2 1 
ATOM   4070 C CE1 . HIS D 1 24  ? -0.251  -61.736 26.644  1.00 60.59  ? 41  HIS D CE1 1 
ATOM   4071 N NE2 . HIS D 1 24  ? -0.049  -62.396 27.769  1.00 59.91  ? 41  HIS D NE2 1 
ATOM   4072 N N   . THR D 1 25  ? -5.387  -66.111 25.748  1.00 71.78  ? 42  THR D N   1 
ATOM   4073 C CA  . THR D 1 25  ? -6.171  -66.953 24.858  1.00 72.59  ? 42  THR D CA  1 
ATOM   4074 C C   . THR D 1 25  ? -7.367  -66.188 24.306  1.00 73.95  ? 42  THR D C   1 
ATOM   4075 O O   . THR D 1 25  ? -7.850  -65.220 24.905  1.00 70.61  ? 42  THR D O   1 
ATOM   4076 C CB  . THR D 1 25  ? -6.668  -68.220 25.570  1.00 73.75  ? 42  THR D CB  1 
ATOM   4077 O OG1 . THR D 1 25  ? -5.757  -68.569 26.618  1.00 74.66  ? 42  THR D OG1 1 
ATOM   4078 C CG2 . THR D 1 25  ? -6.777  -69.374 24.582  1.00 73.78  ? 42  THR D CG2 1 
ATOM   4079 N N   . PHE D 1 26  ? -7.832  -66.610 23.138  1.00 75.73  ? 43  PHE D N   1 
ATOM   4080 C CA  . PHE D 1 26  ? -8.999  -65.992 22.561  1.00 74.58  ? 43  PHE D CA  1 
ATOM   4081 C C   . PHE D 1 26  ? -10.000 -67.042 22.143  1.00 75.57  ? 43  PHE D C   1 
ATOM   4082 O O   . PHE D 1 26  ? -9.615  -68.129 21.717  1.00 76.10  ? 43  PHE D O   1 
ATOM   4083 C CB  . PHE D 1 26  ? -8.605  -65.101 21.398  1.00 73.83  ? 43  PHE D CB  1 
ATOM   4084 C CG  . PHE D 1 26  ? -8.031  -63.791 21.827  1.00 72.54  ? 43  PHE D CG  1 
ATOM   4085 C CD1 . PHE D 1 26  ? -8.865  -62.752 22.190  1.00 71.30  ? 43  PHE D CD1 1 
ATOM   4086 C CD2 . PHE D 1 26  ? -6.655  -63.594 21.872  1.00 72.66  ? 43  PHE D CD2 1 
ATOM   4087 C CE1 . PHE D 1 26  ? -8.345  -61.537 22.594  1.00 71.17  ? 43  PHE D CE1 1 
ATOM   4088 C CE2 . PHE D 1 26  ? -6.126  -62.375 22.267  1.00 71.13  ? 43  PHE D CE2 1 
ATOM   4089 C CZ  . PHE D 1 26  ? -6.975  -61.346 22.634  1.00 71.27  ? 43  PHE D CZ  1 
ATOM   4090 N N   . PRO D 1 27  ? -11.293 -66.722 22.276  0.50 78.09  ? 44  PRO D N   1 
ATOM   4091 C CA  . PRO D 1 27  ? -12.286 -67.705 21.923  1.00 80.78  ? 44  PRO D CA  1 
ATOM   4092 C C   . PRO D 1 27  ? -12.384 -67.800 20.409  1.00 81.92  ? 44  PRO D C   1 
ATOM   4093 O O   . PRO D 1 27  ? -12.481 -66.774 19.740  1.00 84.57  ? 44  PRO D O   1 
ATOM   4094 C CB  . PRO D 1 27  ? -13.581 -67.138 22.529  1.00 81.57  ? 44  PRO D CB  1 
ATOM   4095 C CG  . PRO D 1 27  ? -13.247 -65.770 23.061  1.00 80.77  ? 44  PRO D CG  1 
ATOM   4096 C CD  . PRO D 1 27  ? -11.906 -65.406 22.515  1.00 79.45  ? 44  PRO D CD  1 
ATOM   4097 N N   . ARG D 1 28  ? -12.324 -69.018 19.881  1.00 83.16  ? 45  ARG D N   1 
ATOM   4098 C CA  . ARG D 1 28  ? -12.519 -69.245 18.462  1.00 84.38  ? 45  ARG D CA  1 
ATOM   4099 C C   . ARG D 1 28  ? -13.784 -68.498 18.029  1.00 87.10  ? 45  ARG D C   1 
ATOM   4100 O O   . ARG D 1 28  ? -14.846 -68.681 18.620  1.00 87.68  ? 45  ARG D O   1 
ATOM   4101 C CB  . ARG D 1 28  ? -12.643 -70.747 18.176  1.00 81.22  ? 45  ARG D CB  1 
ATOM   4102 N N   . SER D 1 29  ? -13.649 -67.612 17.046  1.00 89.08  ? 46  SER D N   1 
ATOM   4103 C CA  . SER D 1 29  ? -14.799 -66.950 16.423  1.00 95.14  ? 46  SER D CA  1 
ATOM   4104 C C   . SER D 1 29  ? -14.873 -67.322 14.931  1.00 98.14  ? 46  SER D C   1 
ATOM   4105 O O   . SER D 1 29  ? -13.898 -67.838 14.368  1.00 97.43  ? 46  SER D O   1 
ATOM   4106 C CB  . SER D 1 29  ? -14.716 -65.423 16.594  1.00 95.46  ? 46  SER D CB  1 
ATOM   4107 O OG  . SER D 1 29  ? -15.277 -64.991 17.823  1.00 92.53  ? 46  SER D OG  1 
ATOM   4108 N N   . PRO D 1 30  ? -16.036 -67.085 14.289  1.00 103.40 ? 47  PRO D N   1 
ATOM   4109 C CA  . PRO D 1 30  ? -16.133 -67.363 12.846  1.00 103.49 ? 47  PRO D CA  1 
ATOM   4110 C C   . PRO D 1 30  ? -15.457 -66.274 12.025  1.00 101.07 ? 47  PRO D C   1 
ATOM   4111 O O   . PRO D 1 30  ? -15.583 -65.088 12.347  1.00 100.47 ? 47  PRO D O   1 
ATOM   4112 C CB  . PRO D 1 30  ? -17.651 -67.385 12.570  1.00 104.27 ? 47  PRO D CB  1 
ATOM   4113 C CG  . PRO D 1 30  ? -18.322 -67.285 13.903  1.00 106.51 ? 47  PRO D CG  1 
ATOM   4114 C CD  . PRO D 1 30  ? -17.333 -66.657 14.846  1.00 104.66 ? 47  PRO D CD  1 
ATOM   4115 N N   . ASN D 1 31  ? -14.750 -66.675 10.972  1.00 97.30  ? 48  ASN D N   1 
ATOM   4116 C CA  . ASN D 1 31  ? -14.057 -65.728 10.109  1.00 94.10  ? 48  ASN D CA  1 
ATOM   4117 C C   . ASN D 1 31  ? -13.139 -64.811 10.918  1.00 89.17  ? 48  ASN D C   1 
ATOM   4118 O O   . ASN D 1 31  ? -13.099 -63.599 10.707  1.00 91.70  ? 48  ASN D O   1 
ATOM   4119 C CB  . ASN D 1 31  ? -15.060 -64.902 9.285   1.00 95.43  ? 48  ASN D CB  1 
ATOM   4120 C CG  . ASN D 1 31  ? -15.827 -65.741 8.279   1.00 97.11  ? 48  ASN D CG  1 
ATOM   4121 O OD1 . ASN D 1 31  ? -15.593 -65.646 7.074   1.00 98.09  ? 48  ASN D OD1 1 
ATOM   4122 N ND2 . ASN D 1 31  ? -16.744 -66.568 8.767   1.00 95.94  ? 48  ASN D ND2 1 
ATOM   4123 N N   . THR D 1 32  ? -12.410 -65.398 11.855  1.00 68.89  ? 49  THR D N   1 
ATOM   4124 C CA  . THR D 1 32  ? -11.425 -64.654 12.629  1.00 69.07  ? 49  THR D CA  1 
ATOM   4125 C C   . THR D 1 32  ? -10.064 -65.322 12.566  1.00 68.87  ? 49  THR D C   1 
ATOM   4126 O O   . THR D 1 32  ? -9.905  -66.424 12.032  1.00 69.00  ? 49  THR D O   1 
ATOM   4127 C CB  . THR D 1 32  ? -11.826 -64.519 14.119  1.00 67.44  ? 49  THR D CB  1 
ATOM   4128 O OG1 . THR D 1 32  ? -11.960 -65.820 14.698  1.00 66.87  ? 49  THR D OG1 1 
ATOM   4129 C CG2 . THR D 1 32  ? -13.118 -63.742 14.261  1.00 66.26  ? 49  THR D CG2 1 
ATOM   4130 N N   . CYS D 1 33  ? -9.090  -64.636 13.145  1.00 68.98  ? 50  CYS D N   1 
ATOM   4131 C CA  . CYS D 1 33  ? -7.706  -65.052 13.108  1.00 69.27  ? 50  CYS D CA  1 
ATOM   4132 C C   . CYS D 1 33  ? -7.040  -64.653 14.424  1.00 67.71  ? 50  CYS D C   1 
ATOM   4133 O O   . CYS D 1 33  ? -7.256  -63.543 14.916  1.00 65.83  ? 50  CYS D O   1 
ATOM   4134 C CB  . CYS D 1 33  ? -7.033  -64.375 11.918  1.00 68.63  ? 50  CYS D CB  1 
ATOM   4135 S SG  . CYS D 1 33  ? -5.251  -64.357 12.008  1.00 70.56  ? 50  CYS D SG  1 
ATOM   4136 N N   . THR D 1 34  ? -6.250  -65.559 14.998  1.00 66.51  ? 51  THR D N   1 
ATOM   4137 C CA  . THR D 1 34  ? -5.594  -65.300 16.276  1.00 67.05  ? 51  THR D CA  1 
ATOM   4138 C C   . THR D 1 34  ? -4.184  -65.903 16.303  1.00 68.55  ? 51  THR D C   1 
ATOM   4139 O O   . THR D 1 34  ? -3.929  -66.935 15.665  1.00 71.16  ? 51  THR D O   1 
ATOM   4140 C CB  . THR D 1 34  ? -6.462  -65.824 17.464  1.00 69.02  ? 51  THR D CB  1 
ATOM   4141 O OG1 . THR D 1 34  ? -6.137  -65.119 18.664  1.00 68.81  ? 51  THR D OG1 1 
ATOM   4142 C CG2 . THR D 1 34  ? -6.287  -67.320 17.709  1.00 68.36  ? 51  THR D CG2 1 
ATOM   4143 N N   . SER D 1 35  ? -3.272  -65.239 17.018  1.00 68.32  ? 52  SER D N   1 
ATOM   4144 C CA  . SER D 1 35  ? -1.956  -65.813 17.354  1.00 66.85  ? 52  SER D CA  1 
ATOM   4145 C C   . SER D 1 35  ? -1.261  -65.077 18.516  1.00 65.68  ? 52  SER D C   1 
ATOM   4146 O O   . SER D 1 35  ? -1.731  -64.038 18.995  1.00 61.95  ? 52  SER D O   1 
ATOM   4147 C CB  . SER D 1 35  ? -1.043  -65.865 16.128  1.00 64.15  ? 52  SER D CB  1 
ATOM   4148 O OG  . SER D 1 35  ? -0.944  -64.593 15.537  1.00 65.01  ? 52  SER D OG  1 
ATOM   4149 N N   . LEU D 1 36  ? -0.149  -65.653 18.966  1.00 64.90  ? 53  LEU D N   1 
ATOM   4150 C CA  . LEU D 1 36  ? 0.612   -65.143 20.098  1.00 64.47  ? 53  LEU D CA  1 
ATOM   4151 C C   . LEU D 1 36  ? 2.059   -65.012 19.643  1.00 62.66  ? 53  LEU D C   1 
ATOM   4152 O O   . LEU D 1 36  ? 2.605   -65.929 19.023  1.00 62.45  ? 53  LEU D O   1 
ATOM   4153 C CB  . LEU D 1 36  ? 0.515   -66.121 21.274  1.00 65.33  ? 53  LEU D CB  1 
ATOM   4154 C CG  . LEU D 1 36  ? 0.911   -65.739 22.710  1.00 64.79  ? 53  LEU D CG  1 
ATOM   4155 C CD1 . LEU D 1 36  ? 1.003   -67.021 23.522  1.00 66.17  ? 53  LEU D CD1 1 
ATOM   4156 C CD2 . LEU D 1 36  ? 2.212   -64.966 22.842  1.00 63.51  ? 53  LEU D CD2 1 
ATOM   4157 N N   . ILE D 1 37  ? 2.659   -63.861 19.927  1.00 59.66  ? 54  ILE D N   1 
ATOM   4158 C CA  . ILE D 1 37  ? 4.049   -63.606 19.611  1.00 58.56  ? 54  ILE D CA  1 
ATOM   4159 C C   . ILE D 1 37  ? 4.783   -63.363 20.918  1.00 58.62  ? 54  ILE D C   1 
ATOM   4160 O O   . ILE D 1 37  ? 4.307   -62.614 21.774  1.00 55.70  ? 54  ILE D O   1 
ATOM   4161 C CB  . ILE D 1 37  ? 4.207   -62.398 18.662  1.00 58.95  ? 54  ILE D CB  1 
ATOM   4162 C CG1 . ILE D 1 37  ? 4.117   -62.836 17.206  1.00 59.55  ? 54  ILE D CG1 1 
ATOM   4163 C CG2 . ILE D 1 37  ? 5.571   -61.751 18.810  1.00 60.08  ? 54  ILE D CG2 1 
ATOM   4164 C CD1 . ILE D 1 37  ? 2.888   -63.644 16.879  1.00 62.11  ? 54  ILE D CD1 1 
ATOM   4165 N N   . ALA D 1 38  ? 5.943   -64.002 21.052  1.00 59.34  ? 55  ALA D N   1 
ATOM   4166 C CA  . ALA D 1 38  ? 6.771   -63.895 22.247  1.00 58.41  ? 55  ALA D CA  1 
ATOM   4167 C C   . ALA D 1 38  ? 8.161   -63.435 21.857  1.00 56.82  ? 55  ALA D C   1 
ATOM   4168 O O   . ALA D 1 38  ? 8.797   -64.045 21.032  1.00 58.73  ? 55  ALA D O   1 
ATOM   4169 C CB  . ALA D 1 38  ? 6.843   -65.234 22.954  1.00 59.04  ? 55  ALA D CB  1 
ATOM   4170 N N   . HIS D 1 39  ? 8.640   -62.370 22.473  1.00 58.63  ? 56  HIS D N   1 
ATOM   4171 C CA  . HIS D 1 39  ? 9.912   -61.794 22.108  1.00 60.21  ? 56  HIS D CA  1 
ATOM   4172 C C   . HIS D 1 39  ? 10.778  -61.479 23.329  1.00 61.50  ? 56  HIS D C   1 
ATOM   4173 O O   . HIS D 1 39  ? 10.405  -60.635 24.131  1.00 64.65  ? 56  HIS D O   1 
ATOM   4174 C CB  . HIS D 1 39  ? 9.646   -60.516 21.325  1.00 61.42  ? 56  HIS D CB  1 
ATOM   4175 C CG  . HIS D 1 39  ? 10.866  -59.963 20.679  1.00 63.93  ? 56  HIS D CG  1 
ATOM   4176 N ND1 . HIS D 1 39  ? 11.625  -58.970 21.256  1.00 64.99  ? 56  HIS D ND1 1 
ATOM   4177 C CD2 . HIS D 1 39  ? 11.494  -60.304 19.530  1.00 63.77  ? 56  HIS D CD2 1 
ATOM   4178 C CE1 . HIS D 1 39  ? 12.661  -58.710 20.480  1.00 66.35  ? 56  HIS D CE1 1 
ATOM   4179 N NE2 . HIS D 1 39  ? 12.606  -59.509 19.430  1.00 65.44  ? 56  HIS D NE2 1 
ATOM   4180 N N   . ARG D 1 40  ? 11.933  -62.137 23.459  1.00 63.94  ? 57  ARG D N   1 
ATOM   4181 C CA  . ARG D 1 40  ? 12.829  -61.926 24.615  1.00 64.48  ? 57  ARG D CA  1 
ATOM   4182 C C   . ARG D 1 40  ? 13.460  -60.551 24.621  1.00 64.19  ? 57  ARG D C   1 
ATOM   4183 O O   . ARG D 1 40  ? 13.965  -60.110 23.603  1.00 68.89  ? 57  ARG D O   1 
ATOM   4184 C CB  . ARG D 1 40  ? 13.947  -62.959 24.645  1.00 67.09  ? 57  ARG D CB  1 
ATOM   4185 C CG  . ARG D 1 40  ? 13.645  -64.149 25.537  1.00 72.94  ? 57  ARG D CG  1 
ATOM   4186 C CD  . ARG D 1 40  ? 14.631  -65.298 25.358  1.00 76.90  ? 57  ARG D CD  1 
ATOM   4187 N NE  . ARG D 1 40  ? 13.901  -66.556 25.158  1.00 80.85  ? 57  ARG D NE  1 
ATOM   4188 C CZ  . ARG D 1 40  ? 13.832  -67.242 24.015  1.00 84.42  ? 57  ARG D CZ  1 
ATOM   4189 N NH1 . ARG D 1 40  ? 14.476  -66.837 22.920  1.00 86.94  ? 57  ARG D NH1 1 
ATOM   4190 N NH2 . ARG D 1 40  ? 13.117  -68.365 23.973  1.00 86.92  ? 57  ARG D NH2 1 
ATOM   4191 N N   . VAL D 1 41  ? 13.436  -59.885 25.775  1.00 65.05  ? 58  VAL D N   1 
ATOM   4192 C CA  . VAL D 1 41  ? 14.008  -58.544 25.932  1.00 65.24  ? 58  VAL D CA  1 
ATOM   4193 C C   . VAL D 1 41  ? 15.036  -58.535 27.060  1.00 69.89  ? 58  VAL D C   1 
ATOM   4194 O O   . VAL D 1 41  ? 14.708  -58.825 28.214  1.00 72.72  ? 58  VAL D O   1 
ATOM   4195 C CB  . VAL D 1 41  ? 12.933  -57.502 26.277  1.00 63.11  ? 58  VAL D CB  1 
ATOM   4196 C CG1 . VAL D 1 41  ? 13.530  -56.100 26.272  1.00 62.54  ? 58  VAL D CG1 1 
ATOM   4197 C CG2 . VAL D 1 41  ? 11.775  -57.608 25.309  1.00 62.33  ? 58  VAL D CG2 1 
ATOM   4198 N N   . ASP D 1 42  ? 16.275  -58.187 26.728  1.00 72.93  ? 59  ASP D N   1 
ATOM   4199 C CA  . ASP D 1 42  ? 17.352  -58.168 27.707  1.00 74.09  ? 59  ASP D CA  1 
ATOM   4200 C C   . ASP D 1 42  ? 17.291  -56.879 28.540  1.00 73.38  ? 59  ASP D C   1 
ATOM   4201 O O   . ASP D 1 42  ? 18.122  -55.981 28.422  1.00 74.98  ? 59  ASP D O   1 
ATOM   4202 C CB  . ASP D 1 42  ? 18.706  -58.388 27.016  1.00 73.97  ? 59  ASP D CB  1 
ATOM   4203 C CG  . ASP D 1 42  ? 18.891  -59.835 26.563  1.00 74.22  ? 59  ASP D CG  1 
ATOM   4204 O OD1 . ASP D 1 42  ? 19.058  -60.716 27.436  0.50 72.56  ? 59  ASP D OD1 1 
ATOM   4205 O OD2 . ASP D 1 42  ? 18.861  -60.091 25.341  0.50 73.27  ? 59  ASP D OD2 1 
ATOM   4206 N N   . ALA D 1 43  ? 16.272  -56.831 29.391  1.00 70.66  ? 60  ALA D N   1 
ATOM   4207 C CA  . ALA D 1 43  ? 16.019  -55.732 30.305  1.00 67.20  ? 60  ALA D CA  1 
ATOM   4208 C C   . ALA D 1 43  ? 14.938  -56.218 31.268  1.00 67.43  ? 60  ALA D C   1 
ATOM   4209 O O   . ALA D 1 43  ? 14.293  -57.237 31.011  1.00 67.36  ? 60  ALA D O   1 
ATOM   4210 C CB  . ALA D 1 43  ? 15.553  -54.506 29.549  1.00 66.17  ? 60  ALA D CB  1 
ATOM   4211 N N   . PRO D 1 44  ? 14.741  -55.508 32.389  1.00 68.03  ? 61  PRO D N   1 
ATOM   4212 C CA  . PRO D 1 44  ? 13.781  -55.998 33.365  1.00 66.09  ? 61  PRO D CA  1 
ATOM   4213 C C   . PRO D 1 44  ? 12.380  -55.453 33.125  1.00 63.92  ? 61  PRO D C   1 
ATOM   4214 O O   . PRO D 1 44  ? 12.212  -54.329 32.680  1.00 64.24  ? 61  PRO D O   1 
ATOM   4215 C CB  . PRO D 1 44  ? 14.349  -55.479 34.683  1.00 69.22  ? 61  PRO D CB  1 
ATOM   4216 C CG  . PRO D 1 44  ? 15.051  -54.205 34.312  1.00 69.27  ? 61  PRO D CG  1 
ATOM   4217 C CD  . PRO D 1 44  ? 15.421  -54.286 32.858  1.00 67.89  ? 61  PRO D CD  1 
ATOM   4218 N N   . ALA D 1 45  ? 11.382  -56.258 33.444  1.00 62.73  ? 62  ALA D N   1 
ATOM   4219 C CA  . ALA D 1 45  ? 9.999   -55.903 33.238  1.00 61.48  ? 62  ALA D CA  1 
ATOM   4220 C C   . ALA D 1 45  ? 9.679   -54.415 33.406  1.00 61.40  ? 62  ALA D C   1 
ATOM   4221 O O   . ALA D 1 45  ? 9.075   -53.806 32.529  1.00 65.62  ? 62  ALA D O   1 
ATOM   4222 C CB  . ALA D 1 45  ? 9.123   -56.731 34.151  1.00 60.74  ? 62  ALA D CB  1 
ATOM   4223 N N   . HIS D 1 46  ? 10.088  -53.815 34.506  1.00 59.73  ? 63  HIS D N   1 
ATOM   4224 C CA  . HIS D 1 46  ? 9.597   -52.477 34.824  1.00 60.16  ? 63  HIS D CA  1 
ATOM   4225 C C   . HIS D 1 46  ? 10.021  -51.398 33.829  1.00 58.14  ? 63  HIS D C   1 
ATOM   4226 O O   . HIS D 1 46  ? 9.319   -50.404 33.683  1.00 59.50  ? 63  HIS D O   1 
ATOM   4227 C CB  . HIS D 1 46  ? 10.000  -52.067 36.252  1.00 62.87  ? 63  HIS D CB  1 
ATOM   4228 C CG  . HIS D 1 46  ? 11.432  -51.663 36.388  1.00 60.79  ? 63  HIS D CG  1 
ATOM   4229 N ND1 . HIS D 1 46  ? 12.391  -52.500 36.912  1.00 61.50  ? 63  HIS D ND1 1 
ATOM   4230 C CD2 . HIS D 1 46  ? 12.069  -50.513 36.067  1.00 60.75  ? 63  HIS D CD2 1 
ATOM   4231 C CE1 . HIS D 1 46  ? 13.560  -51.883 36.911  1.00 61.96  ? 63  HIS D CE1 1 
ATOM   4232 N NE2 . HIS D 1 46  ? 13.391  -50.676 36.402  1.00 62.24  ? 63  HIS D NE2 1 
ATOM   4233 N N   . ALA D 1 47  ? 11.164  -51.572 33.173  1.00 56.81  ? 64  ALA D N   1 
ATOM   4234 C CA  . ALA D 1 47  ? 11.631  -50.591 32.178  1.00 57.91  ? 64  ALA D CA  1 
ATOM   4235 C C   . ALA D 1 47  ? 10.916  -50.761 30.841  1.00 58.80  ? 64  ALA D C   1 
ATOM   4236 O O   . ALA D 1 47  ? 10.761  -49.802 30.083  1.00 60.13  ? 64  ALA D O   1 
ATOM   4237 C CB  . ALA D 1 47  ? 13.133  -50.684 31.976  1.00 57.08  ? 64  ALA D CB  1 
ATOM   4238 N N   . ILE D 1 48  ? 10.490  -51.988 30.565  1.00 58.65  ? 65  ILE D N   1 
ATOM   4239 C CA  . ILE D 1 48  ? 9.699   -52.299 29.387  1.00 57.95  ? 65  ILE D CA  1 
ATOM   4240 C C   . ILE D 1 48  ? 8.258   -51.815 29.564  1.00 59.56  ? 65  ILE D C   1 
ATOM   4241 O O   . ILE D 1 48  ? 7.669   -51.205 28.662  1.00 59.89  ? 65  ILE D O   1 
ATOM   4242 C CB  . ILE D 1 48  ? 9.681   -53.815 29.145  1.00 57.83  ? 65  ILE D CB  1 
ATOM   4243 C CG1 . ILE D 1 48  ? 11.103  -54.340 28.939  1.00 58.02  ? 65  ILE D CG1 1 
ATOM   4244 C CG2 . ILE D 1 48  ? 8.812   -54.151 27.944  1.00 58.51  ? 65  ILE D CG2 1 
ATOM   4245 C CD1 . ILE D 1 48  ? 11.242  -55.829 29.173  1.00 59.94  ? 65  ILE D CD1 1 
ATOM   4246 N N   . TRP D 1 49  ? 7.690   -52.109 30.730  1.00 59.99  ? 66  TRP D N   1 
ATOM   4247 C CA  . TRP D 1 49  ? 6.322   -51.722 31.052  1.00 59.35  ? 66  TRP D CA  1 
ATOM   4248 C C   . TRP D 1 49  ? 6.127   -50.226 30.911  1.00 58.52  ? 66  TRP D C   1 
ATOM   4249 O O   . TRP D 1 49  ? 5.057   -49.775 30.521  1.00 55.62  ? 66  TRP D O   1 
ATOM   4250 C CB  . TRP D 1 49  ? 6.006   -52.133 32.490  1.00 63.90  ? 66  TRP D CB  1 
ATOM   4251 C CG  . TRP D 1 49  ? 4.606   -51.830 32.951  1.00 64.35  ? 66  TRP D CG  1 
ATOM   4252 C CD1 . TRP D 1 49  ? 4.242   -51.049 34.003  1.00 63.65  ? 66  TRP D CD1 1 
ATOM   4253 C CD2 . TRP D 1 49  ? 3.392   -52.313 32.365  1.00 64.30  ? 66  TRP D CD2 1 
ATOM   4254 N NE1 . TRP D 1 49  ? 2.876   -51.020 34.118  1.00 66.56  ? 66  TRP D NE1 1 
ATOM   4255 C CE2 . TRP D 1 49  ? 2.330   -51.788 33.124  1.00 65.93  ? 66  TRP D CE2 1 
ATOM   4256 C CE3 . TRP D 1 49  ? 3.102   -53.153 31.286  1.00 61.67  ? 66  TRP D CE3 1 
ATOM   4257 C CZ2 . TRP D 1 49  ? 0.998   -52.056 32.821  1.00 66.37  ? 66  TRP D CZ2 1 
ATOM   4258 C CZ3 . TRP D 1 49  ? 1.788   -53.428 30.993  1.00 61.54  ? 66  TRP D CZ3 1 
ATOM   4259 C CH2 . TRP D 1 49  ? 0.747   -52.884 31.754  1.00 64.16  ? 66  TRP D CH2 1 
ATOM   4260 N N   . ARG D 1 50  ? 7.161   -49.457 31.247  1.00 59.89  ? 67  ARG D N   1 
ATOM   4261 C CA  . ARG D 1 50  ? 7.082   -48.004 31.173  1.00 59.62  ? 67  ARG D CA  1 
ATOM   4262 C C   . ARG D 1 50  ? 6.503   -47.639 29.840  1.00 58.38  ? 67  ARG D C   1 
ATOM   4263 O O   . ARG D 1 50  ? 5.709   -46.713 29.747  1.00 59.42  ? 67  ARG D O   1 
ATOM   4264 C CB  . ARG D 1 50  ? 8.465   -47.356 31.302  1.00 61.43  ? 67  ARG D CB  1 
ATOM   4265 C CG  . ARG D 1 50  ? 9.068   -47.402 32.694  1.00 63.99  ? 67  ARG D CG  1 
ATOM   4266 N N   . PHE D 1 51  ? 6.920   -48.376 28.805  1.00 56.88  ? 68  PHE D N   1 
ATOM   4267 C CA  . PHE D 1 51  ? 6.528   -48.083 27.431  1.00 53.86  ? 68  PHE D CA  1 
ATOM   4268 C C   . PHE D 1 51  ? 5.173   -48.682 27.092  1.00 54.36  ? 68  PHE D C   1 
ATOM   4269 O O   . PHE D 1 51  ? 4.276   -47.965 26.654  1.00 55.37  ? 68  PHE D O   1 
ATOM   4270 C CB  . PHE D 1 51  ? 7.614   -48.544 26.463  1.00 51.54  ? 68  PHE D CB  1 
ATOM   4271 C CG  . PHE D 1 51  ? 8.906   -47.814 26.652  1.00 50.54  ? 68  PHE D CG  1 
ATOM   4272 C CD1 . PHE D 1 51  ? 9.022   -46.479 26.265  1.00 50.01  ? 68  PHE D CD1 1 
ATOM   4273 C CD2 . PHE D 1 51  ? 9.995   -48.440 27.241  1.00 49.66  ? 68  PHE D CD2 1 
ATOM   4274 C CE1 . PHE D 1 51  ? 10.201  -45.780 26.461  1.00 50.63  ? 68  PHE D CE1 1 
ATOM   4275 C CE2 . PHE D 1 51  ? 11.185  -47.755 27.431  1.00 50.98  ? 68  PHE D CE2 1 
ATOM   4276 C CZ  . PHE D 1 51  ? 11.291  -46.419 27.041  1.00 50.72  ? 68  PHE D CZ  1 
ATOM   4277 N N   . VAL D 1 52  ? 5.009   -49.979 27.331  1.00 53.98  ? 69  VAL D N   1 
ATOM   4278 C CA  . VAL D 1 52  ? 3.731   -50.646 27.071  1.00 53.97  ? 69  VAL D CA  1 
ATOM   4279 C C   . VAL D 1 52  ? 2.535   -49.871 27.631  1.00 56.57  ? 69  VAL D C   1 
ATOM   4280 O O   . VAL D 1 52  ? 1.552   -49.656 26.925  1.00 60.33  ? 69  VAL D O   1 
ATOM   4281 C CB  . VAL D 1 52  ? 3.706   -52.061 27.646  1.00 54.79  ? 69  VAL D CB  1 
ATOM   4282 C CG1 . VAL D 1 52  ? 2.407   -52.756 27.264  1.00 56.36  ? 69  VAL D CG1 1 
ATOM   4283 C CG2 . VAL D 1 52  ? 4.914   -52.852 27.164  1.00 54.89  ? 69  VAL D CG2 1 
ATOM   4284 N N   . ARG D 1 53  ? 2.629   -49.432 28.883  1.00 59.00  ? 70  ARG D N   1 
ATOM   4285 C CA  . ARG D 1 53  ? 1.542   -48.691 29.537  1.00 60.50  ? 70  ARG D CA  1 
ATOM   4286 C C   . ARG D 1 53  ? 1.314   -47.279 28.979  1.00 60.03  ? 70  ARG D C   1 
ATOM   4287 O O   . ARG D 1 53  ? 0.257   -46.703 29.185  1.00 62.01  ? 70  ARG D O   1 
ATOM   4288 C CB  . ARG D 1 53  ? 1.787   -48.603 31.052  1.00 62.06  ? 70  ARG D CB  1 
ATOM   4289 C CG  . ARG D 1 53  ? 2.879   -47.625 31.457  1.00 64.37  ? 70  ARG D CG  1 
ATOM   4290 C CD  . ARG D 1 53  ? 3.335   -47.840 32.895  1.00 67.53  ? 70  ARG D CD  1 
ATOM   4291 N NE  . ARG D 1 53  ? 2.268   -47.519 33.849  1.00 69.62  ? 70  ARG D NE  1 
ATOM   4292 C CZ  . ARG D 1 53  ? 1.981   -46.294 34.299  1.00 69.58  ? 70  ARG D CZ  1 
ATOM   4293 N NH1 . ARG D 1 53  ? 2.665   -45.224 33.917  1.00 69.31  ? 70  ARG D NH1 1 
ATOM   4294 N NH2 . ARG D 1 53  ? 0.987   -46.132 35.146  1.00 72.26  ? 70  ARG D NH2 1 
ATOM   4295 N N   . ASP D 1 54  ? 2.292   -46.719 28.280  1.00 60.05  ? 71  ASP D N   1 
ATOM   4296 C CA  . ASP D 1 54  ? 2.221   -45.330 27.836  1.00 60.32  ? 71  ASP D CA  1 
ATOM   4297 C C   . ASP D 1 54  ? 1.242   -45.213 26.685  1.00 60.98  ? 71  ASP D C   1 
ATOM   4298 O O   . ASP D 1 54  ? 1.597   -44.837 25.578  1.00 61.18  ? 71  ASP D O   1 
ATOM   4299 C CB  . ASP D 1 54  ? 3.612   -44.836 27.431  1.00 61.01  ? 71  ASP D CB  1 
ATOM   4300 C CG  . ASP D 1 54  ? 3.729   -43.328 27.459  1.00 62.02  ? 71  ASP D CG  1 
ATOM   4301 O OD1 . ASP D 1 54  ? 2.711   -42.655 27.195  1.00 62.00  ? 71  ASP D OD1 1 
ATOM   4302 O OD2 . ASP D 1 54  ? 4.844   -42.821 27.742  1.00 62.49  ? 71  ASP D OD2 1 
ATOM   4303 N N   . PHE D 1 55  ? -0.013  -45.510 26.988  1.00 62.86  ? 72  PHE D N   1 
ATOM   4304 C CA  . PHE D 1 55  ? -1.070  -45.690 26.000  1.00 64.82  ? 72  PHE D CA  1 
ATOM   4305 C C   . PHE D 1 55  ? -1.297  -44.474 25.105  1.00 67.51  ? 72  PHE D C   1 
ATOM   4306 O O   . PHE D 1 55  ? -1.839  -44.596 24.007  1.00 67.45  ? 72  PHE D O   1 
ATOM   4307 C CB  . PHE D 1 55  ? -2.362  -46.004 26.751  1.00 66.47  ? 72  PHE D CB  1 
ATOM   4308 C CG  . PHE D 1 55  ? -3.523  -46.350 25.868  1.00 65.03  ? 72  PHE D CG  1 
ATOM   4309 C CD1 . PHE D 1 55  ? -3.605  -47.601 25.279  1.00 63.09  ? 72  PHE D CD1 1 
ATOM   4310 C CD2 . PHE D 1 55  ? -4.547  -45.437 25.667  1.00 64.29  ? 72  PHE D CD2 1 
ATOM   4311 C CE1 . PHE D 1 55  ? -4.678  -47.931 24.487  1.00 65.25  ? 72  PHE D CE1 1 
ATOM   4312 C CE2 . PHE D 1 55  ? -5.632  -45.760 24.882  1.00 66.37  ? 72  PHE D CE2 1 
ATOM   4313 C CZ  . PHE D 1 55  ? -5.696  -47.009 24.283  1.00 67.54  ? 72  PHE D CZ  1 
ATOM   4314 N N   . ALA D 1 56  ? -0.906  -43.298 25.577  1.00 70.35  ? 73  ALA D N   1 
ATOM   4315 C CA  . ALA D 1 56  ? -1.108  -42.078 24.811  1.00 71.08  ? 73  ALA D CA  1 
ATOM   4316 C C   . ALA D 1 56  ? 0.048   -41.827 23.850  1.00 68.84  ? 73  ALA D C   1 
ATOM   4317 O O   . ALA D 1 56  ? 0.022   -40.842 23.112  1.00 71.31  ? 73  ALA D O   1 
ATOM   4318 C CB  . ALA D 1 56  ? -1.284  -40.894 25.753  1.00 72.77  ? 73  ALA D CB  1 
ATOM   4319 N N   . ASN D 1 57  ? 1.055   -42.705 23.870  1.00 65.68  ? 74  ASN D N   1 
ATOM   4320 C CA  . ASN D 1 57  ? 2.242   -42.560 23.033  1.00 65.26  ? 74  ASN D CA  1 
ATOM   4321 C C   . ASN D 1 57  ? 2.784   -43.905 22.516  1.00 63.79  ? 74  ASN D C   1 
ATOM   4322 O O   . ASN D 1 57  ? 3.893   -44.310 22.873  1.00 62.24  ? 74  ASN D O   1 
ATOM   4323 C CB  . ASN D 1 57  ? 3.361   -41.839 23.802  1.00 68.27  ? 74  ASN D CB  1 
ATOM   4324 C CG  . ASN D 1 57  ? 2.906   -40.549 24.464  1.00 72.90  ? 74  ASN D CG  1 
ATOM   4325 O OD1 . ASN D 1 57  ? 2.282   -39.689 23.841  1.00 76.17  ? 74  ASN D OD1 1 
ATOM   4326 N ND2 . ASN D 1 57  ? 3.238   -40.403 25.742  1.00 75.55  ? 74  ASN D ND2 1 
ATOM   4327 N N   . PRO D 1 58  ? 2.012   -44.604 21.667  1.00 64.72  ? 75  PRO D N   1 
ATOM   4328 C CA  . PRO D 1 58  ? 2.539   -45.816 21.021  1.00 63.91  ? 75  PRO D CA  1 
ATOM   4329 C C   . PRO D 1 58  ? 3.633   -45.530 19.982  1.00 63.83  ? 75  PRO D C   1 
ATOM   4330 O O   . PRO D 1 58  ? 4.482   -46.388 19.716  1.00 59.40  ? 75  PRO D O   1 
ATOM   4331 C CB  . PRO D 1 58  ? 1.304   -46.439 20.363  1.00 64.88  ? 75  PRO D CB  1 
ATOM   4332 C CG  . PRO D 1 58  ? 0.348   -45.311 20.186  1.00 66.04  ? 75  PRO D CG  1 
ATOM   4333 C CD  . PRO D 1 58  ? 0.599   -44.364 21.328  1.00 65.98  ? 75  PRO D CD  1 
ATOM   4334 N N   . ASN D 1 59  ? 3.634   -44.330 19.409  1.00 68.11  ? 76  ASN D N   1 
ATOM   4335 C CA  . ASN D 1 59  ? 4.743   -43.912 18.519  1.00 69.85  ? 76  ASN D CA  1 
ATOM   4336 C C   . ASN D 1 59  ? 6.145   -43.999 19.161  1.00 66.76  ? 76  ASN D C   1 
ATOM   4337 O O   . ASN D 1 59  ? 7.155   -43.855 18.477  1.00 65.49  ? 76  ASN D O   1 
ATOM   4338 C CB  . ASN D 1 59  ? 4.503   -42.498 17.970  1.00 72.55  ? 76  ASN D CB  1 
ATOM   4339 C CG  . ASN D 1 59  ? 4.355   -41.449 19.071  1.00 75.38  ? 76  ASN D CG  1 
ATOM   4340 O OD1 . ASN D 1 59  ? 5.310   -40.737 19.402  0.50 70.63  ? 76  ASN D OD1 1 
ATOM   4341 N ND2 . ASN D 1 59  ? 3.148   -41.349 19.640  1.00 74.74  ? 76  ASN D ND2 1 
ATOM   4342 N N   . LYS D 1 60  ? 6.197   -44.213 20.474  1.00 67.15  ? 77  LYS D N   1 
ATOM   4343 C CA  . LYS D 1 60  ? 7.462   -44.411 21.197  1.00 65.79  ? 77  LYS D CA  1 
ATOM   4344 C C   . LYS D 1 60  ? 8.103   -45.700 20.726  1.00 64.03  ? 77  LYS D C   1 
ATOM   4345 O O   . LYS D 1 60  ? 9.321   -45.778 20.610  1.00 67.02  ? 77  LYS D O   1 
ATOM   4346 C CB  . LYS D 1 60  ? 7.230   -44.491 22.716  1.00 66.21  ? 77  LYS D CB  1 
ATOM   4347 C CG  . LYS D 1 60  ? 8.166   -43.647 23.570  1.00 68.42  ? 77  LYS D CG  1 
ATOM   4348 C CD  . LYS D 1 60  ? 7.523   -42.329 24.016  1.00 68.59  ? 77  LYS D CD  1 
ATOM   4349 N N   . TYR D 1 61  ? 7.279   -46.712 20.460  1.00 61.77  ? 78  TYR D N   1 
ATOM   4350 C CA  . TYR D 1 61  ? 7.782   -48.017 20.007  1.00 60.99  ? 78  TYR D CA  1 
ATOM   4351 C C   . TYR D 1 61  ? 7.042   -48.650 18.818  1.00 57.63  ? 78  TYR D C   1 
ATOM   4352 O O   . TYR D 1 61  ? 7.456   -49.687 18.327  1.00 52.83  ? 78  TYR D O   1 
ATOM   4353 C CB  . TYR D 1 61  ? 7.862   -48.998 21.195  1.00 59.28  ? 78  TYR D CB  1 
ATOM   4354 C CG  . TYR D 1 61  ? 6.589   -49.722 21.604  1.00 60.32  ? 78  TYR D CG  1 
ATOM   4355 C CD1 . TYR D 1 61  ? 6.251   -50.942 21.040  1.00 61.51  ? 78  TYR D CD1 1 
ATOM   4356 C CD2 . TYR D 1 61  ? 5.758   -49.218 22.603  1.00 62.45  ? 78  TYR D CD2 1 
ATOM   4357 C CE1 . TYR D 1 61  ? 5.110   -51.631 21.436  1.00 61.11  ? 78  TYR D CE1 1 
ATOM   4358 C CE2 . TYR D 1 61  ? 4.615   -49.899 23.001  1.00 61.52  ? 78  TYR D CE2 1 
ATOM   4359 C CZ  . TYR D 1 61  ? 4.299   -51.109 22.414  1.00 60.30  ? 78  TYR D CZ  1 
ATOM   4360 O OH  . TYR D 1 61  ? 3.168   -51.802 22.793  1.00 59.33  ? 78  TYR D OH  1 
ATOM   4361 N N   . LYS D 1 62  ? 5.963   -48.030 18.361  1.00 59.63  ? 79  LYS D N   1 
ATOM   4362 C CA  . LYS D 1 62  ? 5.268   -48.483 17.160  1.00 60.35  ? 79  LYS D CA  1 
ATOM   4363 C C   . LYS D 1 62  ? 5.589   -47.548 16.005  1.00 59.62  ? 79  LYS D C   1 
ATOM   4364 O O   . LYS D 1 62  ? 5.196   -46.372 15.999  1.00 57.22  ? 79  LYS D O   1 
ATOM   4365 C CB  . LYS D 1 62  ? 3.771   -48.526 17.400  1.00 62.36  ? 79  LYS D CB  1 
ATOM   4366 C CG  . LYS D 1 62  ? 3.374   -49.448 18.533  1.00 63.80  ? 79  LYS D CG  1 
ATOM   4367 C CD  . LYS D 1 62  ? 1.868   -49.675 18.562  1.00 63.68  ? 79  LYS D CD  1 
ATOM   4368 C CE  . LYS D 1 62  ? 1.444   -50.292 19.886  1.00 63.26  ? 79  LYS D CE  1 
ATOM   4369 N NZ  . LYS D 1 62  ? -0.028  -50.490 19.946  1.00 66.23  ? 79  LYS D NZ  1 
ATOM   4370 N N   . HIS D 1 63  ? 6.308   -48.088 15.029  1.00 59.86  ? 80  HIS D N   1 
ATOM   4371 C CA  . HIS D 1 63  ? 6.883   -47.290 13.963  1.00 59.44  ? 80  HIS D CA  1 
ATOM   4372 C C   . HIS D 1 63  ? 5.881   -46.847 12.921  1.00 59.55  ? 80  HIS D C   1 
ATOM   4373 O O   . HIS D 1 63  ? 6.059   -45.807 12.298  1.00 62.82  ? 80  HIS D O   1 
ATOM   4374 C CB  . HIS D 1 63  ? 8.024   -48.042 13.284  1.00 59.87  ? 80  HIS D CB  1 
ATOM   4375 C CG  . HIS D 1 63  ? 8.626   -47.301 12.133  1.00 62.12  ? 80  HIS D CG  1 
ATOM   4376 N ND1 . HIS D 1 63  ? 8.487   -47.721 10.828  1.00 64.66  ? 80  HIS D ND1 1 
ATOM   4377 C CD2 . HIS D 1 63  ? 9.325   -46.145 12.084  1.00 61.82  ? 80  HIS D CD2 1 
ATOM   4378 C CE1 . HIS D 1 63  ? 9.103   -46.873 10.028  1.00 64.81  ? 80  HIS D CE1 1 
ATOM   4379 N NE2 . HIS D 1 63  ? 9.620   -45.907 10.765  1.00 66.43  ? 80  HIS D NE2 1 
ATOM   4380 N N   . PHE D 1 64  ? 4.830   -47.626 12.724  1.00 60.79  ? 81  PHE D N   1 
ATOM   4381 C CA  . PHE D 1 64  ? 3.842   -47.294 11.707  1.00 62.68  ? 81  PHE D CA  1 
ATOM   4382 C C   . PHE D 1 64  ? 2.746   -46.363 12.234  1.00 63.81  ? 81  PHE D C   1 
ATOM   4383 O O   . PHE D 1 64  ? 1.780   -46.072 11.528  1.00 65.29  ? 81  PHE D O   1 
ATOM   4384 C CB  . PHE D 1 64  ? 3.303   -48.581 11.076  1.00 62.60  ? 81  PHE D CB  1 
ATOM   4385 C CG  . PHE D 1 64  ? 4.395   -49.436 10.509  1.00 63.05  ? 81  PHE D CG  1 
ATOM   4386 C CD1 . PHE D 1 64  ? 5.071   -49.039 9.360   1.00 65.43  ? 81  PHE D CD1 1 
ATOM   4387 C CD2 . PHE D 1 64  ? 4.814   -50.588 11.165  1.00 62.34  ? 81  PHE D CD2 1 
ATOM   4388 C CE1 . PHE D 1 64  ? 6.117   -49.799 8.859   1.00 65.41  ? 81  PHE D CE1 1 
ATOM   4389 C CE2 . PHE D 1 64  ? 5.848   -51.363 10.657  1.00 61.17  ? 81  PHE D CE2 1 
ATOM   4390 C CZ  . PHE D 1 64  ? 6.504   -50.964 9.511   1.00 63.67  ? 81  PHE D CZ  1 
ATOM   4391 N N   . ILE D 1 65  ? 2.922   -45.861 13.456  1.00 65.40  ? 82  ILE D N   1 
ATOM   4392 C CA  . ILE D 1 65  ? 2.013   -44.857 14.014  1.00 66.01  ? 82  ILE D CA  1 
ATOM   4393 C C   . ILE D 1 65  ? 2.672   -43.481 13.906  1.00 67.02  ? 82  ILE D C   1 
ATOM   4394 O O   . ILE D 1 65  ? 3.644   -43.195 14.602  1.00 66.18  ? 82  ILE D O   1 
ATOM   4395 C CB  . ILE D 1 65  ? 1.600   -45.190 15.473  1.00 61.82  ? 82  ILE D CB  1 
ATOM   4396 C CG1 . ILE D 1 65  ? 0.800   -46.495 15.523  1.00 56.44  ? 82  ILE D CG1 1 
ATOM   4397 C CG2 . ILE D 1 65  ? 0.714   -44.094 16.042  1.00 63.62  ? 82  ILE D CG2 1 
ATOM   4398 N N   . LYS D 1 66  ? 2.153   -42.640 13.013  1.00 69.43  ? 83  LYS D N   1 
ATOM   4399 C CA  . LYS D 1 66  ? 2.719   -41.307 12.818  1.00 71.31  ? 83  LYS D CA  1 
ATOM   4400 C C   . LYS D 1 66  ? 2.574   -40.504 14.114  1.00 70.69  ? 83  LYS D C   1 
ATOM   4401 O O   . LYS D 1 66  ? 3.563   -40.036 14.681  1.00 70.86  ? 83  LYS D O   1 
ATOM   4402 C CB  . LYS D 1 66  ? 2.043   -40.588 11.636  1.00 73.35  ? 83  LYS D CB  1 
ATOM   4403 C CG  . LYS D 1 66  ? 2.698   -39.272 11.207  1.00 72.59  ? 83  LYS D CG  1 
ATOM   4404 N N   . SER D 1 67  ? 1.337   -40.379 14.583  1.00 70.30  ? 84  SER D N   1 
ATOM   4405 C CA  . SER D 1 67  ? 1.029   -39.672 15.826  1.00 69.44  ? 84  SER D CA  1 
ATOM   4406 C C   . SER D 1 67  ? -0.245  -40.223 16.494  1.00 69.85  ? 84  SER D C   1 
ATOM   4407 O O   . SER D 1 67  ? -1.001  -41.007 15.901  1.00 66.49  ? 84  SER D O   1 
ATOM   4408 C CB  . SER D 1 67  ? 0.846   -38.190 15.546  1.00 68.17  ? 84  SER D CB  1 
ATOM   4409 O OG  . SER D 1 67  ? -0.459  -37.972 15.045  1.00 69.62  ? 84  SER D OG  1 
ATOM   4410 N N   . CYS D 1 68  ? -0.479  -39.780 17.726  1.00 71.90  ? 85  CYS D N   1 
ATOM   4411 C CA  . CYS D 1 68  ? -1.588  -40.268 18.542  1.00 70.74  ? 85  CYS D CA  1 
ATOM   4412 C C   . CYS D 1 68  ? -2.286  -39.131 19.284  1.00 69.79  ? 85  CYS D C   1 
ATOM   4413 O O   . CYS D 1 68  ? -1.636  -38.212 19.765  1.00 68.21  ? 85  CYS D O   1 
ATOM   4414 C CB  . CYS D 1 68  ? -1.058  -41.277 19.553  1.00 69.59  ? 85  CYS D CB  1 
ATOM   4415 S SG  . CYS D 1 68  ? -2.359  -42.146 20.437  1.00 71.73  ? 85  CYS D SG  1 
ATOM   4416 N N   . THR D 1 69  ? -3.610  -39.202 19.384  1.00 71.57  ? 86  THR D N   1 
ATOM   4417 C CA  . THR D 1 69  ? -4.369  -38.219 20.161  1.00 73.71  ? 86  THR D CA  1 
ATOM   4418 C C   . THR D 1 69  ? -5.421  -38.886 21.044  1.00 74.21  ? 86  THR D C   1 
ATOM   4419 O O   . THR D 1 69  ? -6.211  -39.711 20.575  1.00 72.71  ? 86  THR D O   1 
ATOM   4420 C CB  . THR D 1 69  ? -5.033  -37.169 19.253  1.00 75.27  ? 86  THR D CB  1 
ATOM   4421 O OG1 . THR D 1 69  ? -4.021  -36.309 18.715  1.00 81.20  ? 86  THR D OG1 1 
ATOM   4422 C CG2 . THR D 1 69  ? -6.019  -36.316 20.026  1.00 76.74  ? 86  THR D CG2 1 
ATOM   4423 N N   . ILE D 1 70  ? -5.410  -38.522 22.326  1.00 74.25  ? 87  ILE D N   1 
ATOM   4424 C CA  . ILE D 1 70  ? -6.430  -38.965 23.262  1.00 75.24  ? 87  ILE D CA  1 
ATOM   4425 C C   . ILE D 1 70  ? -7.708  -38.213 22.958  1.00 78.63  ? 87  ILE D C   1 
ATOM   4426 O O   . ILE D 1 70  ? -7.705  -36.988 22.870  1.00 82.84  ? 87  ILE D O   1 
ATOM   4427 C CB  . ILE D 1 70  ? -6.014  -38.718 24.726  1.00 73.47  ? 87  ILE D CB  1 
ATOM   4428 C CG1 . ILE D 1 70  ? -4.836  -39.621 25.091  1.00 71.96  ? 87  ILE D CG1 1 
ATOM   4429 C CG2 . ILE D 1 70  ? -7.177  -38.967 25.676  1.00 72.35  ? 87  ILE D CG2 1 
ATOM   4430 C CD1 . ILE D 1 70  ? -5.078  -41.092 24.813  1.00 71.11  ? 87  ILE D CD1 1 
ATOM   4431 N N   . ARG D 1 71  ? -8.792  -38.964 22.803  1.00 81.60  ? 88  ARG D N   1 
ATOM   4432 C CA  . ARG D 1 71  ? -10.075 -38.430 22.369  1.00 83.40  ? 88  ARG D CA  1 
ATOM   4433 C C   . ARG D 1 71  ? -11.068 -38.257 23.506  1.00 87.96  ? 88  ARG D C   1 
ATOM   4434 O O   . ARG D 1 71  ? -11.955 -37.416 23.421  1.00 94.59  ? 88  ARG D O   1 
ATOM   4435 C CB  . ARG D 1 71  ? -10.697 -39.385 21.363  1.00 82.15  ? 88  ARG D CB  1 
ATOM   4436 C CG  . ARG D 1 71  ? -9.833  -39.667 20.153  1.00 82.96  ? 88  ARG D CG  1 
ATOM   4437 C CD  . ARG D 1 71  ? -10.239 -38.836 18.950  1.00 84.03  ? 88  ARG D CD  1 
ATOM   4438 N NE  . ARG D 1 71  ? -9.485  -37.592 18.835  1.00 84.24  ? 88  ARG D NE  1 
ATOM   4439 C CZ  . ARG D 1 71  ? -9.175  -37.001 17.681  1.00 83.71  ? 88  ARG D CZ  1 
ATOM   4440 N NH1 . ARG D 1 71  ? -9.531  -37.544 16.517  1.00 83.74  ? 88  ARG D NH1 1 
ATOM   4441 N NH2 . ARG D 1 71  ? -8.488  -35.864 17.687  1.00 82.24  ? 88  ARG D NH2 1 
ATOM   4442 N N   . VAL D 1 72  ? -10.945 -39.061 24.556  1.00 92.19  ? 89  VAL D N   1 
ATOM   4443 C CA  . VAL D 1 72  ? -11.986 -39.115 25.579  1.00 99.13  ? 89  VAL D CA  1 
ATOM   4444 C C   . VAL D 1 72  ? -11.657 -38.321 26.855  1.00 102.95 ? 89  VAL D C   1 
ATOM   4445 O O   . VAL D 1 72  ? -12.494 -37.536 27.329  1.00 103.11 ? 89  VAL D O   1 
ATOM   4446 C CB  . VAL D 1 72  ? -12.320 -40.573 25.940  1.00 97.98  ? 89  VAL D CB  1 
ATOM   4447 C CG1 . VAL D 1 72  ? -11.199 -41.196 26.758  1.00 99.02  ? 89  VAL D CG1 1 
ATOM   4448 C CG2 . VAL D 1 72  ? -13.641 -40.652 26.693  1.00 94.75  ? 89  VAL D CG2 1 
ATOM   4449 N N   . ASN D 1 73  ? -10.451 -38.511 27.395  1.00 100.97 ? 90  ASN D N   1 
ATOM   4450 C CA  . ASN D 1 73  ? -10.114 -38.001 28.732  1.00 102.67 ? 90  ASN D CA  1 
ATOM   4451 C C   . ASN D 1 73  ? -9.095  -36.852 28.722  1.00 104.25 ? 90  ASN D C   1 
ATOM   4452 O O   . ASN D 1 73  ? -7.965  -37.016 28.263  1.00 102.89 ? 90  ASN D O   1 
ATOM   4453 C CB  . ASN D 1 73  ? -9.607  -39.147 29.614  1.00 99.71  ? 90  ASN D CB  1 
ATOM   4454 C CG  . ASN D 1 73  ? -10.707 -40.123 30.007  0.50 99.22  ? 90  ASN D CG  1 
ATOM   4455 O OD1 . ASN D 1 73  ? -10.470 -41.328 30.090  1.00 94.93  ? 90  ASN D OD1 1 
ATOM   4456 N ND2 . ASN D 1 73  ? -11.915 -39.610 30.250  1.00 101.30 ? 90  ASN D ND2 1 
ATOM   4457 N N   . GLY D 1 74  ? -9.505  -35.692 29.235  1.00 106.51 ? 91  GLY D N   1 
ATOM   4458 C CA  . GLY D 1 74  ? -8.631  -34.520 29.292  1.00 108.20 ? 91  GLY D CA  1 
ATOM   4459 C C   . GLY D 1 74  ? -9.218  -33.390 30.117  1.00 111.15 ? 91  GLY D C   1 
ATOM   4460 O O   . GLY D 1 74  ? -9.572  -32.338 29.584  1.00 113.13 ? 91  GLY D O   1 
ATOM   4461 N N   . GLU D 1 79  ? -5.969  -38.937 33.618  1.00 99.56  ? 96  GLU D N   1 
ATOM   4462 C CA  . GLU D 1 79  ? -5.204  -39.142 32.392  1.00 101.17 ? 96  GLU D CA  1 
ATOM   4463 C C   . GLU D 1 79  ? -5.487  -40.516 31.744  0.50 93.59  ? 96  GLU D C   1 
ATOM   4464 O O   . GLU D 1 79  ? -6.418  -40.619 30.941  1.00 90.69  ? 96  GLU D O   1 
ATOM   4465 C CB  . GLU D 1 79  ? -3.702  -38.875 32.625  1.00 105.17 ? 96  GLU D CB  1 
ATOM   4466 C CG  . GLU D 1 79  ? -3.048  -39.570 33.825  1.00 109.56 ? 96  GLU D CG  1 
ATOM   4467 C CD  . GLU D 1 79  ? -3.983  -39.815 35.005  1.00 109.03 ? 96  GLU D CD  1 
ATOM   4468 O OE1 . GLU D 1 79  ? -4.589  -40.907 35.073  1.00 107.20 ? 96  GLU D OE1 1 
ATOM   4469 O OE2 . GLU D 1 79  ? -4.113  -38.918 35.865  1.00 112.68 ? 96  GLU D OE2 1 
ATOM   4470 N N   . ILE D 1 80  ? -4.723  -41.556 32.094  1.00 88.26  ? 97  ILE D N   1 
ATOM   4471 C CA  . ILE D 1 80  ? -4.859  -42.884 31.473  1.00 85.11  ? 97  ILE D CA  1 
ATOM   4472 C C   . ILE D 1 80  ? -5.476  -43.903 32.437  1.00 82.50  ? 97  ILE D C   1 
ATOM   4473 O O   . ILE D 1 80  ? -4.846  -44.325 33.404  1.00 84.86  ? 97  ILE D O   1 
ATOM   4474 C CB  . ILE D 1 80  ? -3.499  -43.419 30.941  1.00 85.34  ? 97  ILE D CB  1 
ATOM   4475 C CG1 . ILE D 1 80  ? -2.995  -42.561 29.767  1.00 86.05  ? 97  ILE D CG1 1 
ATOM   4476 C CG2 . ILE D 1 80  ? -3.591  -44.884 30.506  1.00 82.34  ? 97  ILE D CG2 1 
ATOM   4477 C CD1 . ILE D 1 80  ? -3.891  -42.545 28.545  1.00 84.91  ? 97  ILE D CD1 1 
ATOM   4478 N N   . LYS D 1 81  ? -6.717  -44.282 32.145  1.00 79.64  ? 98  LYS D N   1 
ATOM   4479 C CA  . LYS D 1 81  ? -7.446  -45.320 32.870  1.00 79.18  ? 98  LYS D CA  1 
ATOM   4480 C C   . LYS D 1 81  ? -8.069  -46.264 31.849  1.00 74.06  ? 98  LYS D C   1 
ATOM   4481 O O   . LYS D 1 81  ? -8.112  -45.963 30.654  1.00 76.43  ? 98  LYS D O   1 
ATOM   4482 C CB  . LYS D 1 81  ? -8.554  -44.705 33.750  1.00 78.86  ? 98  LYS D CB  1 
ATOM   4483 N N   . VAL D 1 82  ? -8.552  -47.406 32.318  1.00 69.11  ? 99  VAL D N   1 
ATOM   4484 C CA  . VAL D 1 82  ? -9.318  -48.296 31.471  1.00 65.61  ? 99  VAL D CA  1 
ATOM   4485 C C   . VAL D 1 82  ? -10.497 -47.497 30.945  1.00 67.30  ? 99  VAL D C   1 
ATOM   4486 O O   . VAL D 1 82  ? -11.085 -46.697 31.670  1.00 69.91  ? 99  VAL D O   1 
ATOM   4487 C CB  . VAL D 1 82  ? -9.776  -49.564 32.229  1.00 63.66  ? 99  VAL D CB  1 
ATOM   4488 C CG1 . VAL D 1 82  ? -10.994 -50.196 31.581  1.00 63.18  ? 99  VAL D CG1 1 
ATOM   4489 C CG2 . VAL D 1 82  ? -8.637  -50.572 32.281  1.00 62.75  ? 99  VAL D CG2 1 
ATOM   4490 N N   . GLY D 1 83  ? -10.819 -47.691 29.672  1.00 67.12  ? 100 GLY D N   1 
ATOM   4491 C CA  . GLY D 1 83  ? -11.914 -46.960 29.042  1.00 66.94  ? 100 GLY D CA  1 
ATOM   4492 C C   . GLY D 1 83  ? -11.470 -45.699 28.329  1.00 65.27  ? 100 GLY D C   1 
ATOM   4493 O O   . GLY D 1 83  ? -12.283 -45.011 27.725  1.00 64.68  ? 100 GLY D O   1 
ATOM   4494 N N   . THR D 1 84  ? -10.184 -45.384 28.416  1.00 65.27  ? 101 THR D N   1 
ATOM   4495 C CA  . THR D 1 84  ? -9.613  -44.287 27.661  1.00 67.24  ? 101 THR D CA  1 
ATOM   4496 C C   . THR D 1 84  ? -9.557  -44.711 26.191  1.00 67.23  ? 101 THR D C   1 
ATOM   4497 O O   . THR D 1 84  ? -9.015  -45.769 25.875  1.00 67.38  ? 101 THR D O   1 
ATOM   4498 C CB  . THR D 1 84  ? -8.200  -43.955 28.181  1.00 68.81  ? 101 THR D CB  1 
ATOM   4499 O OG1 . THR D 1 84  ? -8.283  -43.533 29.539  1.00 69.12  ? 101 THR D OG1 1 
ATOM   4500 C CG2 . THR D 1 84  ? -7.556  -42.847 27.374  1.00 73.01  ? 101 THR D CG2 1 
ATOM   4501 N N   . ILE D 1 85  ? -10.146 -43.905 25.310  1.00 68.07  ? 102 ILE D N   1 
ATOM   4502 C CA  . ILE D 1 85  ? -10.088 -44.125 23.865  1.00 67.02  ? 102 ILE D CA  1 
ATOM   4503 C C   . ILE D 1 85  ? -9.034  -43.209 23.222  1.00 65.83  ? 102 ILE D C   1 
ATOM   4504 O O   . ILE D 1 85  ? -9.028  -42.005 23.466  1.00 65.78  ? 102 ILE D O   1 
ATOM   4505 C CB  . ILE D 1 85  ? -11.464 -43.866 23.212  1.00 65.22  ? 102 ILE D CB  1 
ATOM   4506 N N   . ARG D 1 86  ? -8.143  -43.774 22.408  1.00 65.05  ? 103 ARG D N   1 
ATOM   4507 C CA  . ARG D 1 86  ? -7.184  -42.960 21.629  1.00 66.21  ? 103 ARG D CA  1 
ATOM   4508 C C   . ARG D 1 86  ? -7.428  -43.052 20.116  1.00 66.94  ? 103 ARG D C   1 
ATOM   4509 O O   . ARG D 1 86  ? -7.945  -44.060 19.618  1.00 65.35  ? 103 ARG D O   1 
ATOM   4510 C CB  . ARG D 1 86  ? -5.749  -43.382 21.923  1.00 63.64  ? 103 ARG D CB  1 
ATOM   4511 C CG  . ARG D 1 86  ? -5.377  -44.711 21.307  1.00 62.09  ? 103 ARG D CG  1 
ATOM   4512 C CD  . ARG D 1 86  ? -3.958  -45.122 21.648  1.00 62.72  ? 103 ARG D CD  1 
ATOM   4513 N NE  . ARG D 1 86  ? -3.749  -46.519 21.284  1.00 62.79  ? 103 ARG D NE  1 
ATOM   4514 C CZ  . ARG D 1 86  ? -2.814  -47.308 21.791  1.00 63.66  ? 103 ARG D CZ  1 
ATOM   4515 N NH1 . ARG D 1 86  ? -1.962  -46.852 22.697  1.00 64.79  ? 103 ARG D NH1 1 
ATOM   4516 N NH2 . ARG D 1 86  ? -2.735  -48.568 21.387  1.00 65.65  ? 103 ARG D NH2 1 
ATOM   4517 N N   . GLU D 1 87  ? -7.040  -42.000 19.396  1.00 68.66  ? 104 GLU D N   1 
ATOM   4518 C CA  . GLU D 1 87  ? -7.160  -41.971 17.936  1.00 69.36  ? 104 GLU D CA  1 
ATOM   4519 C C   . GLU D 1 87  ? -5.778  -41.928 17.323  1.00 66.90  ? 104 GLU D C   1 
ATOM   4520 O O   . GLU D 1 87  ? -5.016  -40.983 17.526  1.00 66.57  ? 104 GLU D O   1 
ATOM   4521 C CB  . GLU D 1 87  ? -7.989  -40.782 17.466  1.00 71.11  ? 104 GLU D CB  1 
ATOM   4522 N N   . VAL D 1 88  ? -5.472  -42.968 16.564  1.00 66.64  ? 105 VAL D N   1 
ATOM   4523 C CA  . VAL D 1 88  ? -4.131  -43.205 16.066  1.00 68.32  ? 105 VAL D CA  1 
ATOM   4524 C C   . VAL D 1 88  ? -4.098  -42.947 14.558  1.00 69.14  ? 105 VAL D C   1 
ATOM   4525 O O   . VAL D 1 88  ? -5.002  -43.364 13.827  1.00 67.87  ? 105 VAL D O   1 
ATOM   4526 C CB  . VAL D 1 88  ? -3.691  -44.643 16.435  1.00 67.09  ? 105 VAL D CB  1 
ATOM   4527 C CG1 . VAL D 1 88  ? -2.667  -45.192 15.465  1.00 67.19  ? 105 VAL D CG1 1 
ATOM   4528 C CG2 . VAL D 1 88  ? -3.154  -44.676 17.864  1.00 66.38  ? 105 VAL D CG2 1 
ATOM   4529 N N   . SER D 1 89  ? -3.059  -42.241 14.112  1.00 69.49  ? 106 SER D N   1 
ATOM   4530 C CA  . SER D 1 89  ? -2.903  -41.863 12.702  1.00 68.03  ? 106 SER D CA  1 
ATOM   4531 C C   . SER D 1 89  ? -1.675  -42.539 12.115  1.00 65.88  ? 106 SER D C   1 
ATOM   4532 O O   . SER D 1 89  ? -0.569  -42.428 12.658  1.00 63.94  ? 106 SER D O   1 
ATOM   4533 C CB  . SER D 1 89  ? -2.787  -40.339 12.542  1.00 69.31  ? 106 SER D CB  1 
ATOM   4534 O OG  . SER D 1 89  ? -1.742  -39.808 13.344  1.00 67.13  ? 106 SER D OG  1 
ATOM   4535 N N   . VAL D 1 90  ? -1.886  -43.206 10.982  1.00 66.12  ? 107 VAL D N   1 
ATOM   4536 C CA  . VAL D 1 90  ? -0.895  -44.087 10.361  1.00 65.98  ? 107 VAL D CA  1 
ATOM   4537 C C   . VAL D 1 90  ? 0.027   -43.343 9.380   1.00 68.20  ? 107 VAL D C   1 
ATOM   4538 O O   . VAL D 1 90  ? -0.331  -42.292 8.823   1.00 65.96  ? 107 VAL D O   1 
ATOM   4539 C CB  . VAL D 1 90  ? -1.609  -45.259 9.654   1.00 65.11  ? 107 VAL D CB  1 
ATOM   4540 C CG1 . VAL D 1 90  ? -0.619  -46.267 9.103   1.00 64.79  ? 107 VAL D CG1 1 
ATOM   4541 C CG2 . VAL D 1 90  ? -2.563  -45.946 10.630  1.00 65.68  ? 107 VAL D CG2 1 
ATOM   4542 N N   . VAL D 1 91  ? 1.227   -43.897 9.204   1.00 71.04  ? 108 VAL D N   1 
ATOM   4543 C CA  . VAL D 1 91  ? 2.222   -43.394 8.248   1.00 72.99  ? 108 VAL D CA  1 
ATOM   4544 C C   . VAL D 1 91  ? 1.749   -43.630 6.800   1.00 73.44  ? 108 VAL D C   1 
ATOM   4545 O O   . VAL D 1 91  ? 1.062   -44.610 6.515   1.00 74.27  ? 108 VAL D O   1 
ATOM   4546 C CB  . VAL D 1 91  ? 3.595   -44.060 8.504   1.00 73.65  ? 108 VAL D CB  1 
ATOM   4547 C CG1 . VAL D 1 91  ? 4.607   -43.690 7.429   1.00 80.84  ? 108 VAL D CG1 1 
ATOM   4548 C CG2 . VAL D 1 91  ? 4.135   -43.647 9.863   1.00 74.09  ? 108 VAL D CG2 1 
ATOM   4549 N N   . SER D 1 92  ? 2.117   -42.731 5.889   1.00 74.99  ? 109 SER D N   1 
ATOM   4550 C CA  . SER D 1 92  ? 1.645   -42.802 4.502   1.00 75.42  ? 109 SER D CA  1 
ATOM   4551 C C   . SER D 1 92  ? 2.018   -44.100 3.777   1.00 76.85  ? 109 SER D C   1 
ATOM   4552 O O   . SER D 1 92  ? 1.357   -44.480 2.817   1.00 83.01  ? 109 SER D O   1 
ATOM   4553 C CB  . SER D 1 92  ? 2.151   -41.611 3.694   1.00 75.00  ? 109 SER D CB  1 
ATOM   4554 O OG  . SER D 1 92  ? 3.518   -41.762 3.378   1.00 76.35  ? 109 SER D OG  1 
ATOM   4555 N N   . GLY D 1 93  ? 3.062   -44.780 4.235   1.00 78.89  ? 110 GLY D N   1 
ATOM   4556 C CA  . GLY D 1 93  ? 3.525   -46.015 3.596   1.00 81.98  ? 110 GLY D CA  1 
ATOM   4557 C C   . GLY D 1 93  ? 2.579   -47.210 3.612   1.00 82.70  ? 110 GLY D C   1 
ATOM   4558 O O   . GLY D 1 93  ? 2.850   -48.220 2.953   1.00 84.81  ? 110 GLY D O   1 
ATOM   4559 N N   . LEU D 1 94  ? 1.482   -47.109 4.362   1.00 81.35  ? 111 LEU D N   1 
ATOM   4560 C CA  . LEU D 1 94  ? 0.501   -48.184 4.453   1.00 78.55  ? 111 LEU D CA  1 
ATOM   4561 C C   . LEU D 1 94  ? -0.869  -47.698 4.003   1.00 78.44  ? 111 LEU D C   1 
ATOM   4562 O O   . LEU D 1 94  ? -1.223  -46.540 4.257   1.00 78.21  ? 111 LEU D O   1 
ATOM   4563 C CB  . LEU D 1 94  ? 0.381   -48.667 5.892   1.00 75.87  ? 111 LEU D CB  1 
ATOM   4564 C CG  . LEU D 1 94  ? 1.590   -49.333 6.535   1.00 74.82  ? 111 LEU D CG  1 
ATOM   4565 C CD1 . LEU D 1 94  ? 1.401   -49.323 8.042   1.00 75.13  ? 111 LEU D CD1 1 
ATOM   4566 C CD2 . LEU D 1 94  ? 1.776   -50.752 6.031   1.00 75.03  ? 111 LEU D CD2 1 
ATOM   4567 N N   . PRO D 1 95  ? -1.659  -48.588 3.366   1.00 76.69  ? 112 PRO D N   1 
ATOM   4568 C CA  . PRO D 1 95  ? -3.027  -48.240 2.985   1.00 77.54  ? 112 PRO D CA  1 
ATOM   4569 C C   . PRO D 1 95  ? -3.883  -47.750 4.155   1.00 81.53  ? 112 PRO D C   1 
ATOM   4570 O O   . PRO D 1 95  ? -4.726  -46.879 3.955   1.00 91.07  ? 112 PRO D O   1 
ATOM   4571 C CB  . PRO D 1 95  ? -3.593  -49.554 2.419   1.00 76.78  ? 112 PRO D CB  1 
ATOM   4572 C CG  . PRO D 1 95  ? -2.661  -50.629 2.853   1.00 75.68  ? 112 PRO D CG  1 
ATOM   4573 C CD  . PRO D 1 95  ? -1.322  -49.974 2.990   1.00 76.11  ? 112 PRO D CD  1 
ATOM   4574 N N   . ALA D 1 96  ? -3.682  -48.306 5.352   1.00 81.94  ? 113 ALA D N   1 
ATOM   4575 C CA  . ALA D 1 96  ? -4.408  -47.858 6.556   1.00 82.46  ? 113 ALA D CA  1 
ATOM   4576 C C   . ALA D 1 96  ? -4.063  -46.407 6.906   1.00 81.38  ? 113 ALA D C   1 
ATOM   4577 O O   . ALA D 1 96  ? -2.956  -45.943 6.626   1.00 86.70  ? 113 ALA D O   1 
ATOM   4578 C CB  . ALA D 1 96  ? -4.097  -48.769 7.737   1.00 81.36  ? 113 ALA D CB  1 
ATOM   4579 N N   . SER D 1 97  ? -5.007  -45.693 7.512   1.00 78.52  ? 114 SER D N   1 
ATOM   4580 C CA  . SER D 1 97  ? -4.787  -44.281 7.845   1.00 79.82  ? 114 SER D CA  1 
ATOM   4581 C C   . SER D 1 97  ? -5.254  -43.842 9.231   1.00 76.53  ? 114 SER D C   1 
ATOM   4582 O O   . SER D 1 97  ? -4.745  -42.854 9.753   1.00 79.95  ? 114 SER D O   1 
ATOM   4583 C CB  . SER D 1 97  ? -5.409  -43.366 6.775   1.00 83.49  ? 114 SER D CB  1 
ATOM   4584 O OG  . SER D 1 97  ? -6.799  -43.576 6.624   1.00 83.99  ? 114 SER D OG  1 
ATOM   4585 N N   . THR D 1 98  ? -6.206  -44.550 9.829   1.00 72.70  ? 115 THR D N   1 
ATOM   4586 C CA  . THR D 1 98  ? -6.687  -44.176 11.163  1.00 70.05  ? 115 THR D CA  1 
ATOM   4587 C C   . THR D 1 98  ? -7.130  -45.395 11.986  1.00 66.63  ? 115 THR D C   1 
ATOM   4588 O O   . THR D 1 98  ? -7.530  -46.426 11.449  1.00 65.22  ? 115 THR D O   1 
ATOM   4589 C CB  . THR D 1 98  ? -7.779  -43.071 11.058  1.00 70.51  ? 115 THR D CB  1 
ATOM   4590 O OG1 . THR D 1 98  ? -7.165  -41.787 11.232  1.00 70.88  ? 115 THR D OG1 1 
ATOM   4591 C CG2 . THR D 1 98  ? -8.886  -43.212 12.098  1.00 70.61  ? 115 THR D CG2 1 
ATOM   4592 N N   . SER D 1 99  ? -7.000  -45.281 13.300  1.00 65.85  ? 116 SER D N   1 
ATOM   4593 C CA  . SER D 1 99  ? -7.476  -46.323 14.206  1.00 64.03  ? 116 SER D CA  1 
ATOM   4594 C C   . SER D 1 99  ? -7.851  -45.737 15.559  1.00 62.00  ? 116 SER D C   1 
ATOM   4595 O O   . SER D 1 99  ? -7.130  -44.896 16.106  1.00 59.54  ? 116 SER D O   1 
ATOM   4596 C CB  . SER D 1 99  ? -6.430  -47.417 14.375  1.00 60.56  ? 116 SER D CB  1 
ATOM   4597 O OG  . SER D 1 99  ? -7.066  -48.618 14.759  1.00 60.23  ? 116 SER D OG  1 
ATOM   4598 N N   . VAL D 1 100 ? -8.989  -46.194 16.076  1.00 63.11  ? 117 VAL D N   1 
ATOM   4599 C CA  . VAL D 1 100 ? -9.567  -45.672 17.324  1.00 64.96  ? 117 VAL D CA  1 
ATOM   4600 C C   . VAL D 1 100 ? -9.616  -46.799 18.360  1.00 62.50  ? 117 VAL D C   1 
ATOM   4601 O O   . VAL D 1 100 ? -10.454 -47.691 18.292  1.00 61.71  ? 117 VAL D O   1 
ATOM   4602 C CB  . VAL D 1 100 ? -10.955 -45.012 17.079  1.00 66.86  ? 117 VAL D CB  1 
ATOM   4603 C CG1 . VAL D 1 100 ? -11.713 -45.729 15.984  1.00 67.05  ? 117 VAL D CG1 1 
ATOM   4604 C CG2 . VAL D 1 100 ? -11.785 -44.930 18.359  1.00 68.34  ? 117 VAL D CG2 1 
ATOM   4605 N N   . GLU D 1 101 ? -8.685  -46.763 19.303  1.00 62.29  ? 118 GLU D N   1 
ATOM   4606 C CA  . GLU D 1 101 ? -8.500  -47.868 20.229  1.00 61.70  ? 118 GLU D CA  1 
ATOM   4607 C C   . GLU D 1 101 ? -9.009  -47.531 21.631  1.00 62.72  ? 118 GLU D C   1 
ATOM   4608 O O   . GLU D 1 101 ? -8.651  -46.485 22.186  1.00 63.37  ? 118 GLU D O   1 
ATOM   4609 C CB  . GLU D 1 101 ? -7.022  -48.222 20.291  1.00 58.69  ? 118 GLU D CB  1 
ATOM   4610 N N   . ILE D 1 102 ? -9.840  -48.416 22.189  1.00 62.35  ? 119 ILE D N   1 
ATOM   4611 C CA  . ILE D 1 102 ? -10.222 -48.359 23.617  1.00 61.57  ? 119 ILE D CA  1 
ATOM   4612 C C   . ILE D 1 102 ? -9.278  -49.219 24.452  1.00 58.81  ? 119 ILE D C   1 
ATOM   4613 O O   . ILE D 1 102 ? -8.978  -50.350 24.100  1.00 55.15  ? 119 ILE D O   1 
ATOM   4614 C CB  . ILE D 1 102 ? -11.686 -48.810 23.865  1.00 64.02  ? 119 ILE D CB  1 
ATOM   4615 C CG1 . ILE D 1 102 ? -12.164 -48.453 25.277  1.00 67.36  ? 119 ILE D CG1 1 
ATOM   4616 C CG2 . ILE D 1 102 ? -11.870 -50.303 23.638  1.00 64.65  ? 119 ILE D CG2 1 
ATOM   4617 C CD1 . ILE D 1 102 ? -12.538 -47.001 25.450  1.00 69.60  ? 119 ILE D CD1 1 
ATOM   4618 N N   . LEU D 1 103 ? -8.818  -48.653 25.560  1.00 60.79  ? 120 LEU D N   1 
ATOM   4619 C CA  . LEU D 1 103 ? -8.010  -49.365 26.535  1.00 60.92  ? 120 LEU D CA  1 
ATOM   4620 C C   . LEU D 1 103 ? -8.946  -50.182 27.410  1.00 60.81  ? 120 LEU D C   1 
ATOM   4621 O O   . LEU D 1 103 ? -9.857  -49.631 28.034  1.00 63.70  ? 120 LEU D O   1 
ATOM   4622 C CB  . LEU D 1 103 ? -7.222  -48.355 27.379  1.00 62.59  ? 120 LEU D CB  1 
ATOM   4623 C CG  . LEU D 1 103 ? -6.302  -48.816 28.518  1.00 62.90  ? 120 LEU D CG  1 
ATOM   4624 C CD1 . LEU D 1 103 ? -5.604  -50.130 28.209  1.00 63.58  ? 120 LEU D CD1 1 
ATOM   4625 C CD2 . LEU D 1 103 ? -5.267  -47.736 28.808  1.00 63.31  ? 120 LEU D CD2 1 
ATOM   4626 N N   . GLU D 1 104 ? -8.737  -51.491 27.442  1.00 58.98  ? 121 GLU D N   1 
ATOM   4627 C CA  . GLU D 1 104 ? -9.629  -52.387 28.171  1.00 61.03  ? 121 GLU D CA  1 
ATOM   4628 C C   . GLU D 1 104 ? -9.057  -52.841 29.515  1.00 62.41  ? 121 GLU D C   1 
ATOM   4629 O O   . GLU D 1 104 ? -9.766  -52.862 30.531  1.00 62.03  ? 121 GLU D O   1 
ATOM   4630 C CB  . GLU D 1 104 ? -9.949  -53.609 27.321  1.00 60.89  ? 121 GLU D CB  1 
ATOM   4631 C CG  . GLU D 1 104 ? -10.499 -53.253 25.953  1.00 61.42  ? 121 GLU D CG  1 
ATOM   4632 C CD  . GLU D 1 104 ? -11.726 -54.061 25.577  1.00 61.50  ? 121 GLU D CD  1 
ATOM   4633 O OE1 . GLU D 1 104 ? -11.670 -55.312 25.684  1.00 61.65  ? 121 GLU D OE1 1 
ATOM   4634 O OE2 . GLU D 1 104 ? -12.739 -53.434 25.175  1.00 60.27  ? 121 GLU D OE2 1 
ATOM   4635 N N   . VAL D 1 105 ? -7.773  -53.193 29.510  1.00 61.80  ? 122 VAL D N   1 
ATOM   4636 C CA  . VAL D 1 105 ? -7.112  -53.779 30.672  1.00 61.08  ? 122 VAL D CA  1 
ATOM   4637 C C   . VAL D 1 105 ? -5.782  -53.087 30.908  1.00 61.75  ? 122 VAL D C   1 
ATOM   4638 O O   . VAL D 1 105 ? -4.961  -53.033 30.010  1.00 64.94  ? 122 VAL D O   1 
ATOM   4639 C CB  . VAL D 1 105 ? -6.880  -55.283 30.440  1.00 58.92  ? 122 VAL D CB  1 
ATOM   4640 C CG1 . VAL D 1 105 ? -5.973  -55.879 31.499  1.00 59.02  ? 122 VAL D CG1 1 
ATOM   4641 C CG2 . VAL D 1 105 ? -8.223  -56.009 30.343  1.00 58.28  ? 122 VAL D CG2 1 
ATOM   4642 N N   . LEU D 1 106 ? -5.586  -52.557 32.114  1.00 64.02  ? 123 LEU D N   1 
ATOM   4643 C CA  . LEU D 1 106 ? -4.328  -51.918 32.510  1.00 64.84  ? 123 LEU D CA  1 
ATOM   4644 C C   . LEU D 1 106 ? -3.948  -52.384 33.914  1.00 68.62  ? 123 LEU D C   1 
ATOM   4645 O O   . LEU D 1 106 ? -4.274  -51.737 34.913  1.00 74.55  ? 123 LEU D O   1 
ATOM   4646 C CB  . LEU D 1 106 ? -4.462  -50.394 32.476  1.00 64.89  ? 123 LEU D CB  1 
ATOM   4647 C CG  . LEU D 1 106 ? -3.214  -49.576 32.832  1.00 65.08  ? 123 LEU D CG  1 
ATOM   4648 C CD1 . LEU D 1 106 ? -2.170  -49.715 31.735  1.00 64.01  ? 123 LEU D CD1 1 
ATOM   4649 C CD2 . LEU D 1 106 ? -3.557  -48.112 33.067  1.00 64.82  ? 123 LEU D CD2 1 
ATOM   4650 N N   . ASP D 1 107 ? -3.264  -53.520 33.974  1.00 68.65  ? 124 ASP D N   1 
ATOM   4651 C CA  . ASP D 1 107 ? -2.866  -54.141 35.225  1.00 65.79  ? 124 ASP D CA  1 
ATOM   4652 C C   . ASP D 1 107 ? -1.406  -53.817 35.548  1.00 63.27  ? 124 ASP D C   1 
ATOM   4653 O O   . ASP D 1 107 ? -0.492  -54.507 35.104  1.00 58.81  ? 124 ASP D O   1 
ATOM   4654 C CB  . ASP D 1 107 ? -3.068  -55.652 35.111  1.00 67.77  ? 124 ASP D CB  1 
ATOM   4655 C CG  . ASP D 1 107 ? -3.108  -56.345 36.457  1.00 71.67  ? 124 ASP D CG  1 
ATOM   4656 O OD1 . ASP D 1 107 ? -2.235  -56.072 37.325  1.00 74.55  ? 124 ASP D OD1 1 
ATOM   4657 O OD2 . ASP D 1 107 ? -4.022  -57.180 36.634  1.00 71.87  ? 124 ASP D OD2 1 
ATOM   4658 N N   . GLU D 1 108 ? -1.206  -52.772 36.345  1.00 65.97  ? 125 GLU D N   1 
ATOM   4659 C CA  . GLU D 1 108 ? 0.127   -52.381 36.852  1.00 67.52  ? 125 GLU D CA  1 
ATOM   4660 C C   . GLU D 1 108 ? 0.874   -53.463 37.633  1.00 67.54  ? 125 GLU D C   1 
ATOM   4661 O O   . GLU D 1 108 ? 2.096   -53.443 37.688  1.00 66.27  ? 125 GLU D O   1 
ATOM   4662 C CB  . GLU D 1 108 ? 0.003   -51.165 37.771  1.00 69.65  ? 125 GLU D CB  1 
ATOM   4663 C CG  . GLU D 1 108 ? -0.440  -49.881 37.089  1.00 72.67  ? 125 GLU D CG  1 
ATOM   4664 C CD  . GLU D 1 108 ? 0.640   -49.266 36.210  1.00 75.45  ? 125 GLU D CD  1 
ATOM   4665 O OE1 . GLU D 1 108 ? 0.267   -48.662 35.177  1.00 74.52  ? 125 GLU D OE1 1 
ATOM   4666 O OE2 . GLU D 1 108 ? 1.852   -49.366 36.544  1.00 80.41  ? 125 GLU D OE2 1 
ATOM   4667 N N   . GLU D 1 109 ? 0.153   -54.378 38.273  1.00 71.91  ? 126 GLU D N   1 
ATOM   4668 C CA  . GLU D 1 109 ? 0.803   -55.380 39.125  1.00 74.94  ? 126 GLU D CA  1 
ATOM   4669 C C   . GLU D 1 109 ? 1.300   -56.552 38.271  1.00 74.46  ? 126 GLU D C   1 
ATOM   4670 O O   . GLU D 1 109 ? 2.471   -56.918 38.349  1.00 74.60  ? 126 GLU D O   1 
ATOM   4671 C CB  . GLU D 1 109 ? -0.124  -55.843 40.266  1.00 73.28  ? 126 GLU D CB  1 
ATOM   4672 N N   . LYS D 1 110 ? 0.420   -57.122 37.448  1.00 73.19  ? 127 LYS D N   1 
ATOM   4673 C CA  . LYS D 1 110 ? 0.805   -58.230 36.563  1.00 73.76  ? 127 LYS D CA  1 
ATOM   4674 C C   . LYS D 1 110 ? 1.546   -57.741 35.323  1.00 70.02  ? 127 LYS D C   1 
ATOM   4675 O O   . LYS D 1 110 ? 2.111   -58.553 34.597  1.00 69.86  ? 127 LYS D O   1 
ATOM   4676 C CB  . LYS D 1 110 ? -0.423  -59.044 36.119  1.00 74.90  ? 127 LYS D CB  1 
ATOM   4677 C CG  . LYS D 1 110 ? -1.169  -59.737 37.249  1.00 78.39  ? 127 LYS D CG  1 
ATOM   4678 C CD  . LYS D 1 110 ? -2.515  -60.294 36.796  1.00 79.94  ? 127 LYS D CD  1 
ATOM   4679 C CE  . LYS D 1 110 ? -3.376  -60.737 37.977  1.00 82.85  ? 127 LYS D CE  1 
ATOM   4680 N NZ  . LYS D 1 110 ? -3.717  -59.643 38.941  1.00 81.75  ? 127 LYS D NZ  1 
ATOM   4681 N N   . ARG D 1 111 ? 1.520   -56.428 35.081  1.00 68.22  ? 128 ARG D N   1 
ATOM   4682 C CA  . ARG D 1 111 ? 2.103   -55.798 33.868  1.00 69.49  ? 128 ARG D CA  1 
ATOM   4683 C C   . ARG D 1 111 ? 1.479   -56.237 32.527  1.00 64.88  ? 128 ARG D C   1 
ATOM   4684 O O   . ARG D 1 111 ? 2.173   -56.651 31.612  1.00 60.45  ? 128 ARG D O   1 
ATOM   4685 C CB  . ARG D 1 111 ? 3.628   -55.950 33.829  1.00 70.76  ? 128 ARG D CB  1 
ATOM   4686 C CG  . ARG D 1 111 ? 4.331   -54.841 34.565  1.00 72.42  ? 128 ARG D CG  1 
ATOM   4687 C CD  . ARG D 1 111 ? 5.815   -55.033 34.466  1.00 75.45  ? 128 ARG D CD  1 
ATOM   4688 N NE  . ARG D 1 111 ? 6.295   -55.863 35.564  1.00 79.34  ? 128 ARG D NE  1 
ATOM   4689 C CZ  . ARG D 1 111 ? 6.722   -55.396 36.733  1.00 77.46  ? 128 ARG D CZ  1 
ATOM   4690 N NH1 . ARG D 1 111 ? 6.728   -54.091 36.994  1.00 76.33  ? 128 ARG D NH1 1 
ATOM   4691 N NH2 . ARG D 1 111 ? 7.158   -56.247 37.643  1.00 79.83  ? 128 ARG D NH2 1 
ATOM   4692 N N   . ILE D 1 112 ? 0.161   -56.111 32.443  1.00 63.99  ? 129 ILE D N   1 
ATOM   4693 C CA  . ILE D 1 112 ? -0.601  -56.512 31.282  1.00 61.75  ? 129 ILE D CA  1 
ATOM   4694 C C   . ILE D 1 112 ? -1.462  -55.368 30.814  1.00 60.36  ? 129 ILE D C   1 
ATOM   4695 O O   . ILE D 1 112 ? -2.151  -54.731 31.608  1.00 56.88  ? 129 ILE D O   1 
ATOM   4696 C CB  . ILE D 1 112 ? -1.532  -57.674 31.616  1.00 62.86  ? 129 ILE D CB  1 
ATOM   4697 C CG1 . ILE D 1 112 ? -0.743  -58.976 31.676  1.00 64.51  ? 129 ILE D CG1 1 
ATOM   4698 C CG2 . ILE D 1 112 ? -2.649  -57.791 30.591  1.00 62.14  ? 129 ILE D CG2 1 
ATOM   4699 C CD1 . ILE D 1 112 ? -1.323  -59.974 32.647  1.00 67.51  ? 129 ILE D CD1 1 
ATOM   4700 N N   . LEU D 1 113 ? -1.415  -55.134 29.505  1.00 62.35  ? 130 LEU D N   1 
ATOM   4701 C CA  . LEU D 1 113 ? -2.242  -54.131 28.842  1.00 61.36  ? 130 LEU D CA  1 
ATOM   4702 C C   . LEU D 1 113 ? -3.069  -54.829 27.779  1.00 60.15  ? 130 LEU D C   1 
ATOM   4703 O O   . LEU D 1 113 ? -2.659  -55.875 27.262  1.00 59.24  ? 130 LEU D O   1 
ATOM   4704 C CB  . LEU D 1 113 ? -1.363  -53.046 28.230  1.00 61.18  ? 130 LEU D CB  1 
ATOM   4705 C CG  . LEU D 1 113 ? -2.093  -51.848 27.623  1.00 61.30  ? 130 LEU D CG  1 
ATOM   4706 C CD1 . LEU D 1 113 ? -1.351  -50.557 27.946  1.00 60.11  ? 130 LEU D CD1 1 
ATOM   4707 C CD2 . LEU D 1 113 ? -2.271  -52.027 26.111  1.00 60.79  ? 130 LEU D CD2 1 
ATOM   4708 N N   . SER D 1 114 ? -4.236  -54.265 27.479  1.00 59.04  ? 131 SER D N   1 
ATOM   4709 C CA  . SER D 1 114 ? -5.136  -54.842 26.494  1.00 61.35  ? 131 SER D CA  1 
ATOM   4710 C C   . SER D 1 114 ? -6.028  -53.780 25.858  1.00 62.15  ? 131 SER D C   1 
ATOM   4711 O O   . SER D 1 114 ? -6.762  -53.090 26.563  1.00 62.39  ? 131 SER D O   1 
ATOM   4712 C CB  . SER D 1 114 ? -6.012  -55.897 27.151  1.00 61.68  ? 131 SER D CB  1 
ATOM   4713 O OG  . SER D 1 114 ? -6.842  -56.542 26.210  1.00 66.72  ? 131 SER D OG  1 
ATOM   4714 N N   . PHE D 1 115 ? -5.981  -53.659 24.531  1.00 61.34  ? 132 PHE D N   1 
ATOM   4715 C CA  . PHE D 1 115 ? -6.844  -52.696 23.841  1.00 62.34  ? 132 PHE D CA  1 
ATOM   4716 C C   . PHE D 1 115 ? -7.642  -53.332 22.709  1.00 62.16  ? 132 PHE D C   1 
ATOM   4717 O O   . PHE D 1 115 ? -7.290  -54.377 22.171  1.00 60.68  ? 132 PHE D O   1 
ATOM   4718 C CB  . PHE D 1 115 ? -6.064  -51.458 23.357  1.00 61.19  ? 132 PHE D CB  1 
ATOM   4719 C CG  . PHE D 1 115 ? -5.289  -51.670 22.094  1.00 60.50  ? 132 PHE D CG  1 
ATOM   4720 C CD1 . PHE D 1 115 ? -5.879  -51.437 20.842  1.00 62.83  ? 132 PHE D CD1 1 
ATOM   4721 C CD2 . PHE D 1 115 ? -3.976  -52.083 22.136  1.00 58.65  ? 132 PHE D CD2 1 
ATOM   4722 C CE1 . PHE D 1 115 ? -5.167  -51.628 19.666  1.00 57.58  ? 132 PHE D CE1 1 
ATOM   4723 C CE2 . PHE D 1 115 ? -3.264  -52.279 20.963  1.00 58.74  ? 132 PHE D CE2 1 
ATOM   4724 C CZ  . PHE D 1 115 ? -3.858  -52.048 19.733  1.00 57.34  ? 132 PHE D CZ  1 
ATOM   4725 N N   . ARG D 1 116 ? -8.743  -52.680 22.385  1.00 63.15  ? 133 ARG D N   1 
ATOM   4726 C CA  . ARG D 1 116 ? -9.683  -53.178 21.409  1.00 66.70  ? 133 ARG D CA  1 
ATOM   4727 C C   . ARG D 1 116 ? -9.843  -52.064 20.382  1.00 64.80  ? 133 ARG D C   1 
ATOM   4728 O O   . ARG D 1 116 ? -9.865  -50.875 20.747  1.00 62.35  ? 133 ARG D O   1 
ATOM   4729 C CB  . ARG D 1 116 ? -11.010 -53.515 22.114  1.00 70.54  ? 133 ARG D CB  1 
ATOM   4730 C CG  . ARG D 1 116 ? -12.211 -53.711 21.205  1.00 75.68  ? 133 ARG D CG  1 
ATOM   4731 C CD  . ARG D 1 116 ? -13.524 -53.618 21.974  1.00 81.47  ? 133 ARG D CD  1 
ATOM   4732 N NE  . ARG D 1 116 ? -13.966 -54.916 22.472  1.00 86.68  ? 133 ARG D NE  1 
ATOM   4733 C CZ  . ARG D 1 116 ? -14.518 -55.866 21.713  1.00 96.37  ? 133 ARG D CZ  1 
ATOM   4734 N NH1 . ARG D 1 116 ? -14.687 -55.678 20.397  1.00 98.93  ? 133 ARG D NH1 1 
ATOM   4735 N NH2 . ARG D 1 116 ? -14.900 -57.020 22.265  1.00 95.87  ? 133 ARG D NH2 1 
ATOM   4736 N N   . VAL D 1 117 ? -9.919  -52.440 19.106  1.00 62.96  ? 134 VAL D N   1 
ATOM   4737 C CA  . VAL D 1 117 ? -10.208 -51.472 18.059  1.00 64.31  ? 134 VAL D CA  1 
ATOM   4738 C C   . VAL D 1 117 ? -11.708 -51.287 17.961  1.00 64.53  ? 134 VAL D C   1 
ATOM   4739 O O   . VAL D 1 117 ? -12.465 -52.261 17.914  1.00 67.55  ? 134 VAL D O   1 
ATOM   4740 C CB  . VAL D 1 117 ? -9.606  -51.878 16.704  1.00 67.77  ? 134 VAL D CB  1 
ATOM   4741 C CG1 . VAL D 1 117 ? -10.272 -51.134 15.558  1.00 68.87  ? 134 VAL D CG1 1 
ATOM   4742 C CG2 . VAL D 1 117 ? -8.114  -51.576 16.702  1.00 68.55  ? 134 VAL D CG2 1 
ATOM   4743 N N   . LEU D 1 118 ? -12.113 -50.022 17.945  1.00 65.88  ? 135 LEU D N   1 
ATOM   4744 C CA  . LEU D 1 118 ? -13.521 -49.602 17.965  1.00 66.87  ? 135 LEU D CA  1 
ATOM   4745 C C   . LEU D 1 118 ? -14.021 -49.150 16.598  1.00 69.46  ? 135 LEU D C   1 
ATOM   4746 O O   . LEU D 1 118 ? -15.227 -49.155 16.344  1.00 74.93  ? 135 LEU D O   1 
ATOM   4747 C CB  . LEU D 1 118 ? -13.703 -48.445 18.964  1.00 64.90  ? 135 LEU D CB  1 
ATOM   4748 C CG  . LEU D 1 118 ? -14.411 -48.686 20.311  1.00 66.77  ? 135 LEU D CG  1 
ATOM   4749 C CD1 . LEU D 1 118 ? -14.449 -50.135 20.799  1.00 65.78  ? 135 LEU D CD1 1 
ATOM   4750 C CD2 . LEU D 1 118 ? -13.764 -47.795 21.359  1.00 67.09  ? 135 LEU D CD2 1 
ATOM   4751 N N   . GLY D 1 119 ? -13.095 -48.738 15.738  1.00 73.14  ? 136 GLY D N   1 
ATOM   4752 C CA  . GLY D 1 119 ? -13.421 -48.229 14.406  1.00 77.19  ? 136 GLY D CA  1 
ATOM   4753 C C   . GLY D 1 119 ? -12.177 -47.753 13.666  1.00 78.36  ? 136 GLY D C   1 
ATOM   4754 O O   . GLY D 1 119 ? -11.055 -48.079 14.064  1.00 80.14  ? 136 GLY D O   1 
ATOM   4755 N N   . GLY D 1 120 ? -12.377 -46.983 12.596  1.00 79.22  ? 137 GLY D N   1 
ATOM   4756 C CA  . GLY D 1 120 ? -11.278 -46.386 11.834  1.00 79.92  ? 137 GLY D CA  1 
ATOM   4757 C C   . GLY D 1 120 ? -11.205 -46.781 10.364  1.00 80.44  ? 137 GLY D C   1 
ATOM   4758 O O   . GLY D 1 120 ? -11.979 -47.610 9.876   1.00 79.47  ? 137 GLY D O   1 
ATOM   4759 N N   . GLU D 1 121 ? -10.255 -46.169 9.662   1.00 81.41  ? 138 GLU D N   1 
ATOM   4760 C CA  . GLU D 1 121 ? -10.012 -46.452 8.253   1.00 82.79  ? 138 GLU D CA  1 
ATOM   4761 C C   . GLU D 1 121 ? -8.793  -47.360 8.105   1.00 80.50  ? 138 GLU D C   1 
ATOM   4762 O O   . GLU D 1 121 ? -7.652  -46.886 8.080   1.00 79.13  ? 138 GLU D O   1 
ATOM   4763 C CB  . GLU D 1 121 ? -9.810  -45.146 7.479   1.00 84.91  ? 138 GLU D CB  1 
ATOM   4764 N N   . HIS D 1 122 ? -9.059  -48.666 8.041   1.00 80.06  ? 139 HIS D N   1 
ATOM   4765 C CA  . HIS D 1 122 ? -8.043  -49.708 7.818   1.00 78.74  ? 139 HIS D CA  1 
ATOM   4766 C C   . HIS D 1 122 ? -8.778  -51.045 7.666   1.00 77.26  ? 139 HIS D C   1 
ATOM   4767 O O   . HIS D 1 122 ? -9.999  -51.046 7.527   1.00 78.59  ? 139 HIS D O   1 
ATOM   4768 C CB  . HIS D 1 122 ? -7.068  -49.769 8.981   1.00 79.94  ? 139 HIS D CB  1 
ATOM   4769 C CG  . HIS D 1 122 ? -7.715  -50.154 10.266  1.00 82.24  ? 139 HIS D CG  1 
ATOM   4770 N ND1 . HIS D 1 122 ? -8.239  -49.231 11.141  1.00 84.64  ? 139 HIS D ND1 1 
ATOM   4771 C CD2 . HIS D 1 122 ? -7.953  -51.369 10.807  1.00 82.42  ? 139 HIS D CD2 1 
ATOM   4772 C CE1 . HIS D 1 122 ? -8.763  -49.863 12.175  1.00 86.25  ? 139 HIS D CE1 1 
ATOM   4773 N NE2 . HIS D 1 122 ? -8.601  -51.162 11.996  1.00 84.12  ? 139 HIS D NE2 1 
ATOM   4774 N N   . ARG D 1 123 ? -8.060  -52.169 7.708   1.00 77.51  ? 140 ARG D N   1 
ATOM   4775 C CA  . ARG D 1 123 ? -8.653  -53.476 7.376   1.00 80.92  ? 140 ARG D CA  1 
ATOM   4776 C C   . ARG D 1 123 ? -8.338  -54.556 8.419   1.00 76.68  ? 140 ARG D C   1 
ATOM   4777 O O   . ARG D 1 123 ? -7.894  -55.658 8.092   1.00 73.72  ? 140 ARG D O   1 
ATOM   4778 C CB  . ARG D 1 123 ? -8.188  -53.922 5.976   1.00 86.32  ? 140 ARG D CB  1 
ATOM   4779 C CG  . ARG D 1 123 ? -8.793  -53.131 4.812   1.00 90.24  ? 140 ARG D CG  1 
ATOM   4780 C CD  . ARG D 1 123 ? -10.253 -53.503 4.554   1.00 90.76  ? 140 ARG D CD  1 
ATOM   4781 N N   . LEU D 1 124 ? -8.609  -54.225 9.675   1.00 75.30  ? 141 LEU D N   1 
ATOM   4782 C CA  . LEU D 1 124 ? -8.335  -55.098 10.826  1.00 73.54  ? 141 LEU D CA  1 
ATOM   4783 C C   . LEU D 1 124 ? -9.449  -54.840 11.840  1.00 73.01  ? 141 LEU D C   1 
ATOM   4784 O O   . LEU D 1 124 ? -9.243  -54.285 12.924  1.00 70.14  ? 141 LEU D O   1 
ATOM   4785 C CB  . LEU D 1 124 ? -6.933  -54.860 11.415  1.00 69.44  ? 141 LEU D CB  1 
ATOM   4786 C CG  . LEU D 1 124 ? -5.739  -55.352 10.570  1.00 70.09  ? 141 LEU D CG  1 
ATOM   4787 C CD1 . LEU D 1 124 ? -4.396  -54.885 11.136  1.00 72.21  ? 141 LEU D CD1 1 
ATOM   4788 C CD2 . LEU D 1 124 ? -5.714  -56.865 10.405  1.00 67.59  ? 141 LEU D CD2 1 
ATOM   4789 N N   . ASN D 1 125 ? -10.647 -55.253 11.436  1.00 73.05  ? 142 ASN D N   1 
ATOM   4790 C CA  . ASN D 1 125 ? -11.867 -54.933 12.144  1.00 72.70  ? 142 ASN D CA  1 
ATOM   4791 C C   . ASN D 1 125 ? -11.976 -55.770 13.402  1.00 71.44  ? 142 ASN D C   1 
ATOM   4792 O O   . ASN D 1 125 ? -11.715 -56.980 13.392  1.00 65.96  ? 142 ASN D O   1 
ATOM   4793 C CB  . ASN D 1 125 ? -13.088 -55.155 11.245  1.00 76.19  ? 142 ASN D CB  1 
ATOM   4794 C CG  . ASN D 1 125 ? -12.960 -54.445 9.905   1.00 78.34  ? 142 ASN D CG  1 
ATOM   4795 O OD1 . ASN D 1 125 ? -13.130 -55.052 8.843   1.00 78.79  ? 142 ASN D OD1 1 
ATOM   4796 N ND2 . ASN D 1 125 ? -12.633 -53.157 9.949   1.00 78.67  ? 142 ASN D ND2 1 
ATOM   4797 N N   . ASN D 1 126 ? -12.354 -55.103 14.486  1.00 70.32  ? 143 ASN D N   1 
ATOM   4798 C CA  . ASN D 1 126 ? -12.430 -55.739 15.780  1.00 71.20  ? 143 ASN D CA  1 
ATOM   4799 C C   . ASN D 1 126 ? -11.121 -56.434 16.092  1.00 68.07  ? 143 ASN D C   1 
ATOM   4800 O O   . ASN D 1 126 ? -11.098 -57.603 16.457  1.00 73.38  ? 143 ASN D O   1 
ATOM   4801 C CB  . ASN D 1 126 ? -13.611 -56.712 15.829  1.00 71.67  ? 143 ASN D CB  1 
ATOM   4802 C CG  . ASN D 1 126 ? -14.900 -56.064 15.372  1.00 74.47  ? 143 ASN D CG  1 
ATOM   4803 O OD1 . ASN D 1 126 ? -15.479 -55.241 16.075  1.00 72.93  ? 143 ASN D OD1 1 
ATOM   4804 N ND2 . ASN D 1 126 ? -15.341 -56.413 14.172  1.00 77.67  ? 143 ASN D ND2 1 
ATOM   4805 N N   . TYR D 1 127 ? -10.025 -55.712 15.918  0.50 65.70  ? 144 TYR D N   1 
ATOM   4806 C CA  . TYR D 1 127 ? -8.746  -56.206 16.374  1.00 65.97  ? 144 TYR D CA  1 
ATOM   4807 C C   . TYR D 1 127 ? -8.724  -56.034 17.886  1.00 64.57  ? 144 TYR D C   1 
ATOM   4808 O O   . TYR D 1 127 ? -9.134  -54.989 18.395  1.00 63.06  ? 144 TYR D O   1 
ATOM   4809 C CB  . TYR D 1 127 ? -7.596  -55.442 15.710  1.00 65.00  ? 144 TYR D CB  1 
ATOM   4810 C CG  . TYR D 1 127 ? -6.216  -55.823 16.207  1.00 62.45  ? 144 TYR D CG  1 
ATOM   4811 C CD1 . TYR D 1 127 ? -5.566  -56.954 15.731  1.00 60.97  ? 144 TYR D CD1 1 
ATOM   4812 C CD2 . TYR D 1 127 ? -5.550  -55.035 17.141  1.00 62.35  ? 144 TYR D CD2 1 
ATOM   4813 C CE1 . TYR D 1 127 ? -4.298  -57.296 16.187  1.00 60.40  ? 144 TYR D CE1 1 
ATOM   4814 C CE2 . TYR D 1 127 ? -4.279  -55.366 17.592  1.00 59.42  ? 144 TYR D CE2 1 
ATOM   4815 C CZ  . TYR D 1 127 ? -3.662  -56.501 17.123  1.00 58.67  ? 144 TYR D CZ  1 
ATOM   4816 O OH  . TYR D 1 127 ? -2.402  -56.833 17.587  1.00 60.78  ? 144 TYR D OH  1 
ATOM   4817 N N   . ARG D 1 128 ? -8.287  -57.070 18.597  1.00 64.29  ? 145 ARG D N   1 
ATOM   4818 C CA  . ARG D 1 128 ? -8.136  -57.008 20.058  1.00 64.16  ? 145 ARG D CA  1 
ATOM   4819 C C   . ARG D 1 128 ? -6.799  -57.614 20.388  1.00 61.69  ? 145 ARG D C   1 
ATOM   4820 O O   . ARG D 1 128 ? -6.430  -58.627 19.813  1.00 62.24  ? 145 ARG D O   1 
ATOM   4821 C CB  . ARG D 1 128 ? -9.236  -57.788 20.776  1.00 65.77  ? 145 ARG D CB  1 
ATOM   4822 C CG  . ARG D 1 128 ? -9.720  -57.144 22.068  1.00 68.14  ? 145 ARG D CG  1 
ATOM   4823 C CD  . ARG D 1 128 ? -10.303 -58.163 23.062  1.00 70.91  ? 145 ARG D CD  1 
ATOM   4824 N NE  . ARG D 1 128 ? -11.308 -59.057 22.479  1.00 70.97  ? 145 ARG D NE  1 
ATOM   4825 N N   . SER D 1 129 ? -6.089  -56.991 21.319  1.00 61.25  ? 146 SER D N   1 
ATOM   4826 C CA  . SER D 1 129 ? -4.729  -57.370 21.664  1.00 58.96  ? 146 SER D CA  1 
ATOM   4827 C C   . SER D 1 129 ? -4.523  -57.462 23.182  1.00 59.51  ? 146 SER D C   1 
ATOM   4828 O O   . SER D 1 129 ? -5.260  -56.842 23.962  1.00 60.23  ? 146 SER D O   1 
ATOM   4829 C CB  . SER D 1 129 ? -3.789  -56.331 21.099  1.00 59.00  ? 146 SER D CB  1 
ATOM   4830 O OG  . SER D 1 129 ? -2.462  -56.819 21.098  1.00 64.88  ? 146 SER D OG  1 
ATOM   4831 N N   . VAL D 1 130 ? -3.519  -58.234 23.587  1.00 59.50  ? 147 VAL D N   1 
ATOM   4832 C CA  . VAL D 1 130 ? -3.180  -58.423 24.997  1.00 60.79  ? 147 VAL D CA  1 
ATOM   4833 C C   . VAL D 1 130 ? -1.673  -58.603 25.180  1.00 63.55  ? 147 VAL D C   1 
ATOM   4834 O O   . VAL D 1 130 ? -1.136  -59.671 24.904  1.00 67.17  ? 147 VAL D O   1 
ATOM   4835 C CB  . VAL D 1 130 ? -3.888  -59.659 25.592  1.00 61.60  ? 147 VAL D CB  1 
ATOM   4836 C CG1 . VAL D 1 130 ? -3.458  -59.877 27.043  1.00 64.12  ? 147 VAL D CG1 1 
ATOM   4837 C CG2 . VAL D 1 130 ? -5.402  -59.515 25.511  1.00 60.75  ? 147 VAL D CG2 1 
ATOM   4838 N N   . THR D 1 131 ? -0.998  -57.558 25.653  1.00 65.71  ? 148 THR D N   1 
ATOM   4839 C CA  . THR D 1 131 ? 0.453   -57.590 25.894  1.00 62.89  ? 148 THR D CA  1 
ATOM   4840 C C   . THR D 1 131 ? 0.671   -57.810 27.377  1.00 62.93  ? 148 THR D C   1 
ATOM   4841 O O   . THR D 1 131 ? -0.160  -57.422 28.189  1.00 64.80  ? 148 THR D O   1 
ATOM   4842 C CB  . THR D 1 131 ? 1.130   -56.263 25.460  1.00 60.82  ? 148 THR D CB  1 
ATOM   4843 O OG1 . THR D 1 131 ? 1.073   -56.138 24.036  1.00 62.88  ? 148 THR D OG1 1 
ATOM   4844 C CG2 . THR D 1 131 ? 2.574   -56.202 25.865  1.00 59.75  ? 148 THR D CG2 1 
ATOM   4845 N N   . SER D 1 132 ? 1.796   -58.430 27.717  1.00 62.72  ? 149 SER D N   1 
ATOM   4846 C CA  . SER D 1 132 ? 2.163   -58.702 29.100  1.00 59.34  ? 149 SER D CA  1 
ATOM   4847 C C   . SER D 1 132 ? 3.679   -58.835 29.195  1.00 60.74  ? 149 SER D C   1 
ATOM   4848 O O   . SER D 1 132 ? 4.291   -59.507 28.360  1.00 60.19  ? 149 SER D O   1 
ATOM   4849 C CB  . SER D 1 132 ? 1.529   -60.003 29.538  1.00 56.62  ? 149 SER D CB  1 
ATOM   4850 O OG  . SER D 1 132 ? 2.220   -61.107 28.982  1.00 55.46  ? 149 SER D OG  1 
ATOM   4851 N N   . VAL D 1 133 ? 4.281   -58.211 30.207  1.00 62.30  ? 150 VAL D N   1 
ATOM   4852 C CA  . VAL D 1 133 ? 5.739   -58.310 30.434  1.00 61.08  ? 150 VAL D CA  1 
ATOM   4853 C C   . VAL D 1 133 ? 6.024   -59.276 31.577  1.00 61.90  ? 150 VAL D C   1 
ATOM   4854 O O   . VAL D 1 133 ? 5.326   -59.271 32.581  1.00 65.74  ? 150 VAL D O   1 
ATOM   4855 C CB  . VAL D 1 133 ? 6.363   -56.964 30.814  1.00 59.21  ? 150 VAL D CB  1 
ATOM   4856 C CG1 . VAL D 1 133 ? 7.858   -57.010 30.598  1.00 60.39  ? 150 VAL D CG1 1 
ATOM   4857 C CG2 . VAL D 1 133 ? 5.750   -55.832 30.012  1.00 60.19  ? 150 VAL D CG2 1 
ATOM   4858 N N   . ASN D 1 134 ? 7.066   -60.080 31.432  1.00 61.43  ? 151 ASN D N   1 
ATOM   4859 C CA  . ASN D 1 134 ? 7.343   -61.164 32.358  1.00 61.57  ? 151 ASN D CA  1 
ATOM   4860 C C   . ASN D 1 134 ? 8.828   -61.274 32.648  1.00 62.02  ? 151 ASN D C   1 
ATOM   4861 O O   . ASN D 1 134 ? 9.575   -61.786 31.841  1.00 64.98  ? 151 ASN D O   1 
ATOM   4862 C CB  . ASN D 1 134 ? 6.834   -62.468 31.758  1.00 60.55  ? 151 ASN D CB  1 
ATOM   4863 C CG  . ASN D 1 134 ? 5.364   -62.411 31.447  1.00 62.11  ? 151 ASN D CG  1 
ATOM   4864 O OD1 . ASN D 1 134 ? 4.977   -62.130 30.314  1.00 62.02  ? 151 ASN D OD1 1 
ATOM   4865 N ND2 . ASN D 1 134 ? 4.526   -62.622 32.467  1.00 64.34  ? 151 ASN D ND2 1 
ATOM   4866 N N   . GLU D 1 135 ? 9.254   -60.812 33.812  1.00 64.24  ? 152 GLU D N   1 
ATOM   4867 C CA  . GLU D 1 135 ? 10.668  -60.865 34.178  1.00 64.62  ? 152 GLU D CA  1 
ATOM   4868 C C   . GLU D 1 135 ? 11.103  -62.294 34.527  1.00 64.93  ? 152 GLU D C   1 
ATOM   4869 O O   . GLU D 1 135 ? 10.280  -63.165 34.818  1.00 64.97  ? 152 GLU D O   1 
ATOM   4870 C CB  . GLU D 1 135 ? 10.945  -59.903 35.331  1.00 65.62  ? 152 GLU D CB  1 
ATOM   4871 C CG  . GLU D 1 135 ? 12.326  -59.284 35.320  1.00 67.12  ? 152 GLU D CG  1 
ATOM   4872 C CD  . GLU D 1 135 ? 12.435  -58.117 36.294  1.00 68.84  ? 152 GLU D CD  1 
ATOM   4873 O OE1 . GLU D 1 135 ? 13.128  -58.277 37.314  1.00 72.87  ? 152 GLU D OE1 1 
ATOM   4874 O OE2 . GLU D 1 135 ? 11.812  -57.054 36.059  1.00 67.02  ? 152 GLU D OE2 1 
ATOM   4875 N N   . PHE D 1 136 ? 12.409  -62.516 34.451  1.00 67.02  ? 153 PHE D N   1 
ATOM   4876 C CA  . PHE D 1 136 ? 13.031  -63.817 34.703  1.00 69.57  ? 153 PHE D CA  1 
ATOM   4877 C C   . PHE D 1 136 ? 14.425  -63.597 35.259  1.00 71.13  ? 153 PHE D C   1 
ATOM   4878 O O   . PHE D 1 136 ? 15.087  -62.618 34.896  1.00 69.67  ? 153 PHE D O   1 
ATOM   4879 C CB  . PHE D 1 136 ? 13.172  -64.611 33.408  1.00 70.33  ? 153 PHE D CB  1 
ATOM   4880 C CG  . PHE D 1 136 ? 11.885  -65.147 32.887  1.00 70.00  ? 153 PHE D CG  1 
ATOM   4881 C CD1 . PHE D 1 136 ? 11.100  -64.382 32.051  1.00 69.07  ? 153 PHE D CD1 1 
ATOM   4882 C CD2 . PHE D 1 136 ? 11.468  -66.423 33.219  1.00 73.01  ? 153 PHE D CD2 1 
ATOM   4883 C CE1 . PHE D 1 136 ? 9.908   -64.870 31.556  1.00 71.76  ? 153 PHE D CE1 1 
ATOM   4884 C CE2 . PHE D 1 136 ? 10.273  -66.923 32.736  1.00 75.65  ? 153 PHE D CE2 1 
ATOM   4885 C CZ  . PHE D 1 136 ? 9.491   -66.144 31.897  1.00 75.64  ? 153 PHE D CZ  1 
ATOM   4886 N N   . VAL D 1 137 ? 14.881  -64.531 36.092  1.00 74.27  ? 154 VAL D N   1 
ATOM   4887 C CA  . VAL D 1 137 ? 16.167  -64.399 36.794  1.00 78.14  ? 154 VAL D CA  1 
ATOM   4888 C C   . VAL D 1 137 ? 17.122  -65.562 36.490  1.00 78.72  ? 154 VAL D C   1 
ATOM   4889 O O   . VAL D 1 137 ? 17.046  -66.200 35.437  1.00 80.83  ? 154 VAL D O   1 
ATOM   4890 C CB  . VAL D 1 137 ? 15.933  -64.281 38.320  1.00 80.93  ? 154 VAL D CB  1 
ATOM   4891 C CG1 . VAL D 1 137 ? 17.231  -64.454 39.100  1.00 83.24  ? 154 VAL D CG1 1 
ATOM   4892 C CG2 . VAL D 1 137 ? 15.274  -62.946 38.653  1.00 79.99  ? 154 VAL D CG2 1 
ATOM   4893 N N   . LYS D 1 145 ? 21.481  -64.505 30.085  1.00 94.24  ? 162 LYS D N   1 
ATOM   4894 C CA  . LYS D 1 145 ? 21.451  -63.229 30.784  1.00 97.48  ? 162 LYS D CA  1 
ATOM   4895 C C   . LYS D 1 145 ? 21.008  -63.440 32.224  1.00 100.39 ? 162 LYS D C   1 
ATOM   4896 O O   . LYS D 1 145 ? 20.238  -64.364 32.507  1.00 103.05 ? 162 LYS D O   1 
ATOM   4897 C CB  . LYS D 1 145 ? 20.482  -62.267 30.091  1.00 96.43  ? 162 LYS D CB  1 
ATOM   4898 N N   . ARG D 1 146 ? 21.482  -62.579 33.128  1.00 99.20  ? 163 ARG D N   1 
ATOM   4899 C CA  . ARG D 1 146 ? 21.051  -62.619 34.532  1.00 99.54  ? 163 ARG D CA  1 
ATOM   4900 C C   . ARG D 1 146 ? 19.560  -62.286 34.635  1.00 95.42  ? 163 ARG D C   1 
ATOM   4901 O O   . ARG D 1 146 ? 18.756  -63.138 35.028  1.00 97.52  ? 163 ARG D O   1 
ATOM   4902 C CB  . ARG D 1 146 ? 21.878  -61.660 35.404  1.00 100.07 ? 163 ARG D CB  1 
ATOM   4903 N N   . VAL D 1 147 ? 19.198  -61.059 34.260  1.00 88.59  ? 164 VAL D N   1 
ATOM   4904 C CA  . VAL D 1 147 ? 17.799  -60.630 34.282  1.00 86.68  ? 164 VAL D CA  1 
ATOM   4905 C C   . VAL D 1 147 ? 17.332  -60.173 32.902  1.00 81.99  ? 164 VAL D C   1 
ATOM   4906 O O   . VAL D 1 147 ? 17.934  -59.298 32.271  1.00 81.46  ? 164 VAL D O   1 
ATOM   4907 C CB  . VAL D 1 147 ? 17.519  -59.530 35.343  1.00 87.69  ? 164 VAL D CB  1 
ATOM   4908 C CG1 . VAL D 1 147 ? 18.417  -58.309 35.152  1.00 88.35  ? 164 VAL D CG1 1 
ATOM   4909 C CG2 . VAL D 1 147 ? 16.046  -59.131 35.322  1.00 87.55  ? 164 VAL D CG2 1 
ATOM   4910 N N   . TYR D 1 148 ? 16.256  -60.797 32.440  1.00 77.23  ? 165 TYR D N   1 
ATOM   4911 C CA  . TYR D 1 148 ? 15.582  -60.379 31.224  1.00 73.04  ? 165 TYR D CA  1 
ATOM   4912 C C   . TYR D 1 148 ? 14.098  -60.634 31.377  1.00 73.56  ? 165 TYR D C   1 
ATOM   4913 O O   . TYR D 1 148 ? 13.670  -61.321 32.310  1.00 76.91  ? 165 TYR D O   1 
ATOM   4914 C CB  . TYR D 1 148 ? 16.112  -61.156 30.033  1.00 71.06  ? 165 TYR D CB  1 
ATOM   4915 C CG  . TYR D 1 148 ? 15.758  -62.622 30.038  1.00 69.67  ? 165 TYR D CG  1 
ATOM   4916 C CD1 . TYR D 1 148 ? 16.600  -63.550 30.623  1.00 70.84  ? 165 TYR D CD1 1 
ATOM   4917 C CD2 . TYR D 1 148 ? 14.590  -63.083 29.435  1.00 68.72  ? 165 TYR D CD2 1 
ATOM   4918 C CE1 . TYR D 1 148 ? 16.296  -64.896 30.612  1.00 71.52  ? 165 TYR D CE1 1 
ATOM   4919 C CE2 . TYR D 1 148 ? 14.269  -64.429 29.427  1.00 68.29  ? 165 TYR D CE2 1 
ATOM   4920 C CZ  . TYR D 1 148 ? 15.133  -65.327 30.016  1.00 71.81  ? 165 TYR D CZ  1 
ATOM   4921 O OH  . TYR D 1 148 ? 14.852  -66.666 30.028  1.00 76.67  ? 165 TYR D OH  1 
ATOM   4922 N N   . SER D 1 149 ? 13.318  -60.102 30.444  1.00 69.71  ? 166 SER D N   1 
ATOM   4923 C CA  . SER D 1 149 ? 11.877  -60.306 30.450  1.00 66.81  ? 166 SER D CA  1 
ATOM   4924 C C   . SER D 1 149 ? 11.395  -60.977 29.151  1.00 65.47  ? 166 SER D C   1 
ATOM   4925 O O   . SER D 1 149 ? 12.168  -61.146 28.200  1.00 63.45  ? 166 SER D O   1 
ATOM   4926 C CB  . SER D 1 149 ? 11.181  -58.962 30.665  1.00 66.14  ? 166 SER D CB  1 
ATOM   4927 O OG  . SER D 1 149 ? 11.907  -58.177 31.600  1.00 65.83  ? 166 SER D OG  1 
ATOM   4928 N N   . VAL D 1 150 ? 10.123  -61.376 29.130  1.00 62.96  ? 167 VAL D N   1 
ATOM   4929 C CA  . VAL D 1 150 ? 9.487   -61.849 27.910  1.00 62.04  ? 167 VAL D CA  1 
ATOM   4930 C C   . VAL D 1 150 ? 8.202   -61.101 27.696  1.00 63.42  ? 167 VAL D C   1 
ATOM   4931 O O   . VAL D 1 150 ? 7.319   -61.134 28.549  1.00 67.23  ? 167 VAL D O   1 
ATOM   4932 C CB  . VAL D 1 150 ? 9.155   -63.345 27.947  1.00 61.82  ? 167 VAL D CB  1 
ATOM   4933 C CG1 . VAL D 1 150 ? 8.404   -63.755 26.677  1.00 60.91  ? 167 VAL D CG1 1 
ATOM   4934 C CG2 . VAL D 1 150 ? 10.433  -64.152 28.097  1.00 62.36  ? 167 VAL D CG2 1 
ATOM   4935 N N   . VAL D 1 151 ? 8.099   -60.425 26.551  1.00 64.53  ? 168 VAL D N   1 
ATOM   4936 C CA  . VAL D 1 151 ? 6.848   -59.791 26.150  1.00 62.88  ? 168 VAL D CA  1 
ATOM   4937 C C   . VAL D 1 151 ? 6.057   -60.854 25.424  1.00 60.09  ? 168 VAL D C   1 
ATOM   4938 O O   . VAL D 1 151 ? 6.604   -61.580 24.621  1.00 60.53  ? 168 VAL D O   1 
ATOM   4939 C CB  . VAL D 1 151 ? 7.070   -58.576 25.235  1.00 61.89  ? 168 VAL D CB  1 
ATOM   4940 C CG2 . VAL D 1 151 ? 8.087   -57.634 25.871  1.00 62.75  ? 168 VAL D CG2 1 
ATOM   4941 N N   . LEU D 1 152 ? 4.793   -60.991 25.780  1.00 60.79  ? 169 LEU D N   1 
ATOM   4942 C CA  . LEU D 1 152 ? 3.881   -61.883 25.096  1.00 61.26  ? 169 LEU D CA  1 
ATOM   4943 C C   . LEU D 1 152 ? 2.782   -60.981 24.606  1.00 58.71  ? 169 LEU D C   1 
ATOM   4944 O O   . LEU D 1 152 ? 2.064   -60.404 25.408  1.00 59.87  ? 169 LEU D O   1 
ATOM   4945 C CB  . LEU D 1 152 ? 3.306   -62.944 26.052  1.00 63.25  ? 169 LEU D CB  1 
ATOM   4946 C CG  . LEU D 1 152 ? 4.181   -64.156 26.415  1.00 63.40  ? 169 LEU D CG  1 
ATOM   4947 N N   . GLU D 1 153 ? 2.687   -60.798 23.297  1.00 57.18  ? 170 GLU D N   1 
ATOM   4948 C CA  . GLU D 1 153 ? 1.536   -60.123 22.740  1.00 57.08  ? 170 GLU D CA  1 
ATOM   4949 C C   . GLU D 1 153 ? 0.643   -61.174 22.072  1.00 57.20  ? 170 GLU D C   1 
ATOM   4950 O O   . GLU D 1 153 ? 1.131   -62.048 21.358  1.00 58.86  ? 170 GLU D O   1 
ATOM   4951 C CB  . GLU D 1 153 ? 1.934   -58.982 21.789  1.00 56.43  ? 170 GLU D CB  1 
ATOM   4952 C CG  . GLU D 1 153 ? 0.753   -58.055 21.473  1.00 58.09  ? 170 GLU D CG  1 
ATOM   4953 C CD  . GLU D 1 153 ? 1.121   -56.636 21.054  1.00 57.13  ? 170 GLU D CD  1 
ATOM   4954 O OE1 . GLU D 1 153 ? 2.205   -56.145 21.385  1.00 56.66  ? 170 GLU D OE1 1 
ATOM   4955 O OE2 . GLU D 1 153 ? 0.279   -55.980 20.410  1.00 64.54  ? 170 GLU D OE2 1 
ATOM   4956 N N   . SER D 1 154 ? -0.657  -61.122 22.350  1.00 55.90  ? 171 SER D N   1 
ATOM   4957 C CA  . SER D 1 154 ? -1.599  -61.986 21.665  1.00 57.64  ? 171 SER D CA  1 
ATOM   4958 C C   . SER D 1 154 ? -2.707  -61.115 21.108  1.00 58.62  ? 171 SER D C   1 
ATOM   4959 O O   . SER D 1 154 ? -3.010  -60.065 21.688  1.00 59.53  ? 171 SER D O   1 
ATOM   4960 C CB  . SER D 1 154 ? -2.164  -63.040 22.612  1.00 58.58  ? 171 SER D CB  1 
ATOM   4961 O OG  . SER D 1 154 ? -3.027  -62.453 23.567  1.00 60.20  ? 171 SER D OG  1 
ATOM   4962 N N   . TYR D 1 155 ? -3.302  -61.541 19.992  1.00 56.65  ? 172 TYR D N   1 
ATOM   4963 C CA  . TYR D 1 155 ? -4.384  -60.782 19.389  1.00 58.92  ? 172 TYR D CA  1 
ATOM   4964 C C   . TYR D 1 155 ? -5.440  -61.638 18.716  1.00 60.09  ? 172 TYR D C   1 
ATOM   4965 O O   . TYR D 1 155 ? -5.230  -62.820 18.460  1.00 59.56  ? 172 TYR D O   1 
ATOM   4966 C CB  . TYR D 1 155 ? -3.833  -59.820 18.341  1.00 60.73  ? 172 TYR D CB  1 
ATOM   4967 C CG  . TYR D 1 155 ? -3.307  -60.526 17.121  1.00 61.12  ? 172 TYR D CG  1 
ATOM   4968 C CD1 . TYR D 1 155 ? -2.010  -60.980 17.081  1.00 61.23  ? 172 TYR D CD1 1 
ATOM   4969 C CD2 . TYR D 1 155 ? -4.121  -60.763 16.013  1.00 64.49  ? 172 TYR D CD2 1 
ATOM   4970 C CE1 . TYR D 1 155 ? -1.520  -61.643 15.974  1.00 63.45  ? 172 TYR D CE1 1 
ATOM   4971 C CE2 . TYR D 1 155 ? -3.636  -61.429 14.895  1.00 63.55  ? 172 TYR D CE2 1 
ATOM   4972 C CZ  . TYR D 1 155 ? -2.333  -61.867 14.889  1.00 62.92  ? 172 TYR D CZ  1 
ATOM   4973 O OH  . TYR D 1 155 ? -1.813  -62.517 13.802  1.00 64.64  ? 172 TYR D OH  1 
ATOM   4974 N N   . ILE D 1 156 ? -6.570  -61.004 18.418  1.00 59.43  ? 173 ILE D N   1 
ATOM   4975 C CA  . ILE D 1 156 ? -7.572  -61.574 17.536  1.00 61.39  ? 173 ILE D CA  1 
ATOM   4976 C C   . ILE D 1 156 ? -8.093  -60.482 16.593  1.00 62.08  ? 173 ILE D C   1 
ATOM   4977 O O   . ILE D 1 156 ? -8.175  -59.303 16.978  1.00 59.99  ? 173 ILE D O   1 
ATOM   4978 C CB  . ILE D 1 156 ? -8.732  -62.229 18.321  1.00 62.52  ? 173 ILE D CB  1 
ATOM   4979 C CG1 . ILE D 1 156 ? -9.594  -63.080 17.379  1.00 62.75  ? 173 ILE D CG1 1 
ATOM   4980 C CG2 . ILE D 1 156 ? -9.572  -61.177 19.042  1.00 62.27  ? 173 ILE D CG2 1 
ATOM   4981 C CD1 . ILE D 1 156 ? -10.676 -63.879 18.068  1.00 63.67  ? 173 ILE D CD1 1 
ATOM   4982 N N   . VAL D 1 157 ? -8.450  -60.885 15.372  1.00 62.68  ? 174 VAL D N   1 
ATOM   4983 C CA  . VAL D 1 157 ? -8.875  -59.943 14.332  1.00 64.36  ? 174 VAL D CA  1 
ATOM   4984 C C   . VAL D 1 157 ? -9.759  -60.586 13.268  1.00 64.72  ? 174 VAL D C   1 
ATOM   4985 O O   . VAL D 1 157 ? -9.597  -61.760 12.946  1.00 62.48  ? 174 VAL D O   1 
ATOM   4986 C CB  . VAL D 1 157 ? -7.659  -59.347 13.611  1.00 63.78  ? 174 VAL D CB  1 
ATOM   4987 C CG1 . VAL D 1 157 ? -6.890  -60.442 12.877  1.00 63.71  ? 174 VAL D CG1 1 
ATOM   4988 C CG2 . VAL D 1 157 ? -8.085  -58.217 12.670  1.00 63.74  ? 174 VAL D CG2 1 
ATOM   4989 N N   . ASP D 1 158 ? -10.680 -59.796 12.723  1.00 66.49  ? 175 ASP D N   1 
ATOM   4990 C CA  . ASP D 1 158 ? -11.590 -60.271 11.693  1.00 69.26  ? 175 ASP D CA  1 
ATOM   4991 C C   . ASP D 1 158 ? -10.835 -60.392 10.403  1.00 67.47  ? 175 ASP D C   1 
ATOM   4992 O O   . ASP D 1 158 ? -10.183 -59.448 9.987   1.00 67.03  ? 175 ASP D O   1 
ATOM   4993 C CB  . ASP D 1 158 ? -12.741 -59.288 11.469  1.00 74.78  ? 175 ASP D CB  1 
ATOM   4994 C CG  . ASP D 1 158 ? -13.946 -59.552 12.370  1.00 79.24  ? 175 ASP D CG  1 
ATOM   4995 O OD1 . ASP D 1 158 ? -13.781 -59.784 13.595  1.00 78.95  ? 175 ASP D OD1 1 
ATOM   4996 O OD2 . ASP D 1 158 ? -15.077 -59.507 11.830  1.00 83.87  ? 175 ASP D OD2 1 
ATOM   4997 N N   . ILE D 1 159 ? -10.952 -61.553 9.768   1.00 69.69  ? 176 ILE D N   1 
ATOM   4998 C CA  . ILE D 1 159 ? -10.381 -61.793 8.444   1.00 68.85  ? 176 ILE D CA  1 
ATOM   4999 C C   . ILE D 1 159 ? -11.268 -61.146 7.380   1.00 71.79  ? 176 ILE D C   1 
ATOM   5000 O O   . ILE D 1 159 ? -12.427 -61.530 7.237   1.00 74.07  ? 176 ILE D O   1 
ATOM   5001 C CB  . ILE D 1 159 ? -10.326 -63.299 8.116   1.00 67.22  ? 176 ILE D CB  1 
ATOM   5002 C CG1 . ILE D 1 159 ? -9.557  -64.078 9.189   1.00 65.98  ? 176 ILE D CG1 1 
ATOM   5003 C CG2 . ILE D 1 159 ? -9.703  -63.509 6.741   1.00 67.86  ? 176 ILE D CG2 1 
ATOM   5004 C CD1 . ILE D 1 159 ? -9.796  -65.571 9.125   1.00 66.42  ? 176 ILE D CD1 1 
ATOM   5005 N N   . PRO D 1 160 ? -10.744 -60.162 6.627   1.00 75.34  ? 177 PRO D N   1 
ATOM   5006 C CA  . PRO D 1 160 ? -11.559 -59.646 5.513   1.00 79.12  ? 177 PRO D CA  1 
ATOM   5007 C C   . PRO D 1 160 ? -11.861 -60.731 4.457   1.00 82.20  ? 177 PRO D C   1 
ATOM   5008 O O   . PRO D 1 160 ? -11.018 -61.603 4.218   1.00 82.89  ? 177 PRO D O   1 
ATOM   5009 C CB  . PRO D 1 160 ? -10.679 -58.531 4.923   1.00 78.67  ? 177 PRO D CB  1 
ATOM   5010 C CG  . PRO D 1 160 ? -9.725  -58.158 6.018   1.00 75.26  ? 177 PRO D CG  1 
ATOM   5011 C CD  . PRO D 1 160 ? -9.467  -59.435 6.758   1.00 73.72  ? 177 PRO D CD  1 
ATOM   5012 N N   . GLN D 1 161 ? -13.048 -60.685 3.849   0.50 85.73  ? 178 GLN D N   1 
ATOM   5013 C CA  . GLN D 1 161 ? -13.432 -61.678 2.834   1.00 90.96  ? 178 GLN D CA  1 
ATOM   5014 C C   . GLN D 1 161 ? -12.515 -61.581 1.611   1.00 97.35  ? 178 GLN D C   1 
ATOM   5015 O O   . GLN D 1 161 ? -12.180 -60.481 1.161   1.00 100.42 ? 178 GLN D O   1 
ATOM   5016 C CB  . GLN D 1 161 ? -14.889 -61.494 2.402   1.00 91.27  ? 178 GLN D CB  1 
ATOM   5017 N N   . GLY D 1 162 ? -12.100 -62.733 1.087   1.00 98.98  ? 179 GLY D N   1 
ATOM   5018 C CA  . GLY D 1 162 ? -11.120 -62.778 -0.001  1.00 100.91 ? 179 GLY D CA  1 
ATOM   5019 C C   . GLY D 1 162 ? -9.698  -62.988 0.502   1.00 100.37 ? 179 GLY D C   1 
ATOM   5020 O O   . GLY D 1 162 ? -8.899  -63.680 -0.147  1.00 99.29  ? 179 GLY D O   1 
ATOM   5021 N N   . ASN D 1 163 ? -9.371  -62.382 1.647   1.00 96.80  ? 180 ASN D N   1 
ATOM   5022 C CA  . ASN D 1 163 ? -8.114  -62.683 2.348   1.00 93.86  ? 180 ASN D CA  1 
ATOM   5023 C C   . ASN D 1 163 ? -8.303  -63.977 3.132   1.00 89.13  ? 180 ASN D C   1 
ATOM   5024 O O   . ASN D 1 163 ? -9.375  -64.205 3.690   1.00 84.30  ? 180 ASN D O   1 
ATOM   5025 C CB  . ASN D 1 163 ? -7.710  -61.552 3.305   1.00 92.56  ? 180 ASN D CB  1 
ATOM   5026 C CG  . ASN D 1 163 ? -7.759  -60.176 2.658   1.00 93.57  ? 180 ASN D CG  1 
ATOM   5027 O OD1 . ASN D 1 163 ? -7.998  -60.046 1.459   1.00 97.55  ? 180 ASN D OD1 1 
ATOM   5028 N ND2 . ASN D 1 163 ? -7.547  -59.140 3.459   1.00 93.37  ? 180 ASN D ND2 1 
ATOM   5029 N N   . THR D 1 164 ? -7.280  -64.830 3.149   1.00 86.88  ? 181 THR D N   1 
ATOM   5030 C CA  . THR D 1 164 ? -7.329  -66.062 3.933   1.00 85.79  ? 181 THR D CA  1 
ATOM   5031 C C   . THR D 1 164 ? -6.772  -65.802 5.329   1.00 87.08  ? 181 THR D C   1 
ATOM   5032 O O   . THR D 1 164 ? -6.131  -64.776 5.583   1.00 86.86  ? 181 THR D O   1 
ATOM   5033 C CB  . THR D 1 164 ? -6.532  -67.214 3.279   1.00 85.46  ? 181 THR D CB  1 
ATOM   5034 O OG1 . THR D 1 164 ? -5.134  -66.922 3.308   1.00 86.00  ? 181 THR D OG1 1 
ATOM   5035 C CG2 . THR D 1 164 ? -6.959  -67.426 1.844   1.00 87.23  ? 181 THR D CG2 1 
ATOM   5036 N N   . GLU D 1 165 ? -7.033  -66.747 6.226   1.00 87.75  ? 182 GLU D N   1 
ATOM   5037 C CA  . GLU D 1 165 ? -6.498  -66.727 7.582   1.00 85.84  ? 182 GLU D CA  1 
ATOM   5038 C C   . GLU D 1 165 ? -5.000  -66.444 7.570   1.00 84.97  ? 182 GLU D C   1 
ATOM   5039 O O   . GLU D 1 165 ? -4.527  -65.496 8.222   1.00 80.29  ? 182 GLU D O   1 
ATOM   5040 C CB  . GLU D 1 165 ? -6.755  -68.084 8.234   1.00 90.16  ? 182 GLU D CB  1 
ATOM   5041 C CG  . GLU D 1 165 ? -6.146  -68.284 9.613   1.00 94.42  ? 182 GLU D CG  1 
ATOM   5042 C CD  . GLU D 1 165 ? -6.340  -69.705 10.120  1.00 103.13 ? 182 GLU D CD  1 
ATOM   5043 O OE1 . GLU D 1 165 ? -6.083  -70.652 9.342   1.00 107.60 ? 182 GLU D OE1 1 
ATOM   5044 O OE2 . GLU D 1 165 ? -6.742  -69.879 11.297  1.00 108.18 ? 182 GLU D OE2 1 
ATOM   5045 N N   . GLU D 1 166 ? -4.284  -67.274 6.804   1.00 83.35  ? 183 GLU D N   1 
ATOM   5046 C CA  . GLU D 1 166 ? -2.821  -67.306 6.771   1.00 78.30  ? 183 GLU D CA  1 
ATOM   5047 C C   . GLU D 1 166 ? -2.211  -66.006 6.269   1.00 75.06  ? 183 GLU D C   1 
ATOM   5048 O O   . GLU D 1 166 ? -1.148  -65.606 6.724   1.00 74.69  ? 183 GLU D O   1 
ATOM   5049 C CB  . GLU D 1 166 ? -2.341  -68.471 5.904   1.00 78.46  ? 183 GLU D CB  1 
ATOM   5050 N N   . ASP D 1 167 ? -2.878  -65.342 5.336   1.00 72.32  ? 184 ASP D N   1 
ATOM   5051 C CA  . ASP D 1 167 ? -2.415  -64.031 4.896   1.00 72.11  ? 184 ASP D CA  1 
ATOM   5052 C C   . ASP D 1 167 ? -2.592  -62.970 5.970   1.00 69.54  ? 184 ASP D C   1 
ATOM   5053 O O   . ASP D 1 167 ? -1.797  -62.037 6.052   1.00 68.85  ? 184 ASP D O   1 
ATOM   5054 C CB  . ASP D 1 167 ? -3.134  -63.604 3.622   1.00 72.92  ? 184 ASP D CB  1 
ATOM   5055 C CG  . ASP D 1 167 ? -2.573  -64.278 2.409   1.00 74.33  ? 184 ASP D CG  1 
ATOM   5056 O OD1 . ASP D 1 167 ? -1.470  -63.882 1.978   1.00 77.49  ? 184 ASP D OD1 1 
ATOM   5057 O OD2 . ASP D 1 167 ? -3.222  -65.206 1.898   1.00 74.87  ? 184 ASP D OD2 1 
ATOM   5058 N N   . THR D 1 168 ? -3.644  -63.112 6.772   1.00 69.92  ? 185 THR D N   1 
ATOM   5059 C CA  . THR D 1 168 ? -3.943  -62.171 7.846   1.00 67.99  ? 185 THR D CA  1 
ATOM   5060 C C   . THR D 1 168 ? -2.902  -62.320 8.947   1.00 67.14  ? 185 THR D C   1 
ATOM   5061 O O   . THR D 1 168 ? -2.263  -61.352 9.340   1.00 67.72  ? 185 THR D O   1 
ATOM   5062 C CB  . THR D 1 168 ? -5.366  -62.379 8.417   1.00 64.44  ? 185 THR D CB  1 
ATOM   5063 N N   . ARG D 1 169 ? -2.707  -63.541 9.420   1.00 69.85  ? 186 ARG D N   1 
ATOM   5064 C CA  . ARG D 1 169 ? -1.747  -63.794 10.493  1.00 72.63  ? 186 ARG D CA  1 
ATOM   5065 C C   . ARG D 1 169 ? -0.325  -63.373 10.098  1.00 71.79  ? 186 ARG D C   1 
ATOM   5066 O O   . ARG D 1 169 ? 0.410   -62.792 10.899  1.00 71.02  ? 186 ARG D O   1 
ATOM   5067 C CB  . ARG D 1 169 ? -1.778  -65.273 10.873  1.00 76.89  ? 186 ARG D CB  1 
ATOM   5068 C CG  . ARG D 1 169 ? -0.885  -65.661 12.039  1.00 81.31  ? 186 ARG D CG  1 
ATOM   5069 C CD  . ARG D 1 169 ? -1.242  -67.044 12.571  1.00 86.84  ? 186 ARG D CD  1 
ATOM   5070 N NE  . ARG D 1 169 ? -1.544  -67.991 11.491  1.00 89.95  ? 186 ARG D NE  1 
ATOM   5071 C CZ  . ARG D 1 169 ? -2.739  -68.535 11.241  0.50 92.95  ? 186 ARG D CZ  1 
ATOM   5072 N NH1 . ARG D 1 169 ? -3.807  -68.263 12.002  1.00 92.80  ? 186 ARG D NH1 1 
ATOM   5073 N NH2 . ARG D 1 169 ? -2.862  -69.374 10.213  1.00 95.38  ? 186 ARG D NH2 1 
ATOM   5074 N N   . MET D 1 170 ? 0.048   -63.669 8.859   1.00 73.00  ? 187 MET D N   1 
ATOM   5075 C CA  . MET D 1 170 ? 1.362   -63.320 8.325   1.00 71.12  ? 187 MET D CA  1 
ATOM   5076 C C   . MET D 1 170 ? 1.604   -61.831 8.537   1.00 66.64  ? 187 MET D C   1 
ATOM   5077 O O   . MET D 1 170 ? 2.627   -61.421 9.104   1.00 68.49  ? 187 MET D O   1 
ATOM   5078 C CB  . MET D 1 170 ? 1.399   -63.661 6.836   1.00 77.03  ? 187 MET D CB  1 
ATOM   5079 C CG  . MET D 1 170 ? 2.779   -63.830 6.227   1.00 84.09  ? 187 MET D CG  1 
ATOM   5080 S SD  . MET D 1 170 ? 2.670   -64.663 4.621   1.00 93.75  ? 187 MET D SD  1 
ATOM   5081 C CE  . MET D 1 170 ? 2.341   -66.362 5.116   1.00 92.46  ? 187 MET D CE  1 
ATOM   5082 N N   . PHE D 1 171 ? 0.631   -61.027 8.120   1.00 59.44  ? 188 PHE D N   1 
ATOM   5083 C CA  . PHE D 1 171 ? 0.747   -59.569 8.192   1.00 56.34  ? 188 PHE D CA  1 
ATOM   5084 C C   . PHE D 1 171 ? 0.747   -59.051 9.623   1.00 55.17  ? 188 PHE D C   1 
ATOM   5085 O O   . PHE D 1 171 ? 1.551   -58.192 9.977   1.00 55.70  ? 188 PHE D O   1 
ATOM   5086 C CB  . PHE D 1 171 ? -0.385  -58.901 7.405   1.00 53.31  ? 188 PHE D CB  1 
ATOM   5087 C CG  . PHE D 1 171 ? -0.406  -57.402 7.512   1.00 50.32  ? 188 PHE D CG  1 
ATOM   5088 C CD1 . PHE D 1 171 ? 0.593   -56.641 6.950   1.00 50.24  ? 188 PHE D CD1 1 
ATOM   5089 C CD2 . PHE D 1 171 ? -1.447  -56.756 8.151   1.00 50.67  ? 188 PHE D CD2 1 
ATOM   5090 C CE1 . PHE D 1 171 ? 0.576   -55.259 7.040   1.00 51.07  ? 188 PHE D CE1 1 
ATOM   5091 C CE2 . PHE D 1 171 ? -1.483  -55.371 8.237   1.00 51.48  ? 188 PHE D CE2 1 
ATOM   5092 C CZ  . PHE D 1 171 ? -0.468  -54.621 7.682   1.00 51.49  ? 188 PHE D CZ  1 
ATOM   5093 N N   . VAL D 1 172 ? -0.162  -59.556 10.440  1.00 53.31  ? 189 VAL D N   1 
ATOM   5094 C CA  . VAL D 1 172 ? -0.275  -59.042 11.779  1.00 53.46  ? 189 VAL D CA  1 
ATOM   5095 C C   . VAL D 1 172 ? 0.959   -59.426 12.601  1.00 53.51  ? 189 VAL D C   1 
ATOM   5096 O O   . VAL D 1 172 ? 1.468   -58.586 13.354  1.00 54.28  ? 189 VAL D O   1 
ATOM   5097 C CB  . VAL D 1 172 ? -1.564  -59.497 12.486  1.00 55.05  ? 189 VAL D CB  1 
ATOM   5098 C CG1 . VAL D 1 172 ? -1.609  -58.927 13.904  1.00 56.11  ? 189 VAL D CG1 1 
ATOM   5099 C CG2 . VAL D 1 172 ? -2.793  -59.042 11.719  1.00 54.10  ? 189 VAL D CG2 1 
ATOM   5100 N N   . ASP D 1 173 ? 1.456   -60.659 12.454  1.00 52.47  ? 190 ASP D N   1 
ATOM   5101 C CA  . ASP D 1 173 ? 2.643   -61.086 13.219  1.00 53.13  ? 190 ASP D CA  1 
ATOM   5102 C C   . ASP D 1 173 ? 3.822   -60.168 12.878  1.00 53.23  ? 190 ASP D C   1 
ATOM   5103 O O   . ASP D 1 173 ? 4.517   -59.651 13.756  1.00 54.41  ? 190 ASP D O   1 
ATOM   5104 C CB  . ASP D 1 173 ? 3.013   -62.550 12.954  1.00 55.02  ? 190 ASP D CB  1 
ATOM   5105 C CG  . ASP D 1 173 ? 2.063   -63.552 13.632  1.00 59.26  ? 190 ASP D CG  1 
ATOM   5106 O OD1 . ASP D 1 173 ? 0.957   -63.162 14.094  1.00 60.04  ? 190 ASP D OD1 1 
ATOM   5107 O OD2 . ASP D 1 173 ? 2.426   -64.757 13.701  1.00 62.12  ? 190 ASP D OD2 1 
ATOM   5108 N N   . THR D 1 174 ? 4.023   -59.962 11.587  1.00 52.54  ? 191 THR D N   1 
ATOM   5109 C CA  . THR D 1 174 ? 4.990   -58.998 11.093  1.00 50.66  ? 191 THR D CA  1 
ATOM   5110 C C   . THR D 1 174 ? 4.914   -57.647 11.857  1.00 49.68  ? 191 THR D C   1 
ATOM   5111 O O   . THR D 1 174 ? 5.933   -57.115 12.306  1.00 48.99  ? 191 THR D O   1 
ATOM   5112 C CB  . THR D 1 174 ? 4.809   -58.857 9.554   1.00 51.12  ? 191 THR D CB  1 
ATOM   5113 O OG1 . THR D 1 174 ? 5.577   -59.877 8.884   1.00 50.67  ? 191 THR D OG1 1 
ATOM   5114 C CG2 . THR D 1 174 ? 5.245   -57.532 9.058   1.00 51.16  ? 191 THR D CG2 1 
ATOM   5115 N N   . VAL D 1 175 ? 3.719   -57.106 12.033  1.00 49.74  ? 192 VAL D N   1 
ATOM   5116 C CA  . VAL D 1 175 ? 3.580   -55.801 12.671  1.00 53.54  ? 192 VAL D CA  1 
ATOM   5117 C C   . VAL D 1 175 ? 3.867   -55.876 14.189  1.00 55.73  ? 192 VAL D C   1 
ATOM   5118 O O   . VAL D 1 175 ? 4.491   -54.979 14.787  1.00 57.59  ? 192 VAL D O   1 
ATOM   5119 C CB  . VAL D 1 175 ? 2.171   -55.215 12.459  1.00 54.58  ? 192 VAL D CB  1 
ATOM   5120 C CG1 . VAL D 1 175 ? 1.999   -53.916 13.246  1.00 54.89  ? 192 VAL D CG1 1 
ATOM   5121 C CG2 . VAL D 1 175 ? 1.909   -54.982 10.978  1.00 56.45  ? 192 VAL D CG2 1 
ATOM   5122 N N   . VAL D 1 176 ? 3.384   -56.933 14.818  1.00 54.58  ? 193 VAL D N   1 
ATOM   5123 C CA  . VAL D 1 176 ? 3.614   -57.106 16.227  1.00 53.42  ? 193 VAL D CA  1 
ATOM   5124 C C   . VAL D 1 176 ? 5.108   -57.295 16.444  1.00 54.11  ? 193 VAL D C   1 
ATOM   5125 O O   . VAL D 1 176 ? 5.705   -56.616 17.288  1.00 53.10  ? 193 VAL D O   1 
ATOM   5126 C CB  . VAL D 1 176 ? 2.794   -58.285 16.769  1.00 54.98  ? 193 VAL D CB  1 
ATOM   5127 C CG1 . VAL D 1 176 ? 3.277   -58.697 18.154  1.00 58.41  ? 193 VAL D CG1 1 
ATOM   5128 C CG2 . VAL D 1 176 ? 1.325   -57.898 16.813  1.00 54.72  ? 193 VAL D CG2 1 
ATOM   5129 N N   . LYS D 1 177 ? 5.710   -58.195 15.666  1.00 53.94  ? 194 LYS D N   1 
ATOM   5130 C CA  . LYS D 1 177 ? 7.140   -58.444 15.767  1.00 55.77  ? 194 LYS D CA  1 
ATOM   5131 C C   . LYS D 1 177 ? 7.894   -57.140 15.575  1.00 54.76  ? 194 LYS D C   1 
ATOM   5132 O O   . LYS D 1 177 ? 8.829   -56.846 16.306  1.00 54.95  ? 194 LYS D O   1 
ATOM   5133 C CB  . LYS D 1 177 ? 7.601   -59.509 14.763  1.00 59.88  ? 194 LYS D CB  1 
ATOM   5134 C CG  . LYS D 1 177 ? 7.140   -60.922 15.109  1.00 63.53  ? 194 LYS D CG  1 
ATOM   5135 C CD  . LYS D 1 177 ? 7.113   -61.858 13.898  1.00 67.45  ? 194 LYS D CD  1 
ATOM   5136 N N   . SER D 1 178 ? 7.465   -56.336 14.611  1.00 55.94  ? 195 SER D N   1 
ATOM   5137 C CA  . SER D 1 178 ? 8.098   -55.040 14.388  1.00 56.02  ? 195 SER D CA  1 
ATOM   5138 C C   . SER D 1 178 ? 8.009   -54.151 15.625  1.00 55.39  ? 195 SER D C   1 
ATOM   5139 O O   . SER D 1 178 ? 8.979   -53.487 15.979  1.00 54.45  ? 195 SER D O   1 
ATOM   5140 C CB  . SER D 1 178 ? 7.465   -54.326 13.196  1.00 57.97  ? 195 SER D CB  1 
ATOM   5141 O OG  . SER D 1 178 ? 7.741   -52.934 13.247  1.00 60.32  ? 195 SER D OG  1 
ATOM   5142 N N   . ASN D 1 179 ? 6.836   -54.130 16.257  1.00 55.39  ? 196 ASN D N   1 
ATOM   5143 C CA  . ASN D 1 179 ? 6.618   -53.348 17.467  1.00 56.49  ? 196 ASN D CA  1 
ATOM   5144 C C   . ASN D 1 179 ? 7.463   -53.850 18.640  1.00 56.04  ? 196 ASN D C   1 
ATOM   5145 O O   . ASN D 1 179 ? 8.054   -53.065 19.370  1.00 51.97  ? 196 ASN D O   1 
ATOM   5146 C CB  . ASN D 1 179 ? 5.134   -53.374 17.871  1.00 59.54  ? 196 ASN D CB  1 
ATOM   5147 C CG  . ASN D 1 179 ? 4.260   -52.497 16.993  1.00 59.48  ? 196 ASN D CG  1 
ATOM   5148 O OD1 . ASN D 1 179 ? 4.745   -51.675 16.225  1.00 63.46  ? 196 ASN D OD1 1 
ATOM   5149 N ND2 . ASN D 1 179 ? 2.958   -52.661 17.122  1.00 60.59  ? 196 ASN D ND2 1 
ATOM   5150 N N   . LEU D 1 180 ? 7.516   -55.162 18.825  1.00 56.53  ? 197 LEU D N   1 
ATOM   5151 C CA  . LEU D 1 180 ? 8.228   -55.708 19.965  1.00 57.86  ? 197 LEU D CA  1 
ATOM   5152 C C   . LEU D 1 180 ? 9.723   -55.472 19.823  1.00 58.35  ? 197 LEU D C   1 
ATOM   5153 O O   . LEU D 1 180 ? 10.411  -55.143 20.800  1.00 59.50  ? 197 LEU D O   1 
ATOM   5154 C CB  . LEU D 1 180 ? 7.939   -57.200 20.133  1.00 58.87  ? 197 LEU D CB  1 
ATOM   5155 C CG  . LEU D 1 180 ? 6.509   -57.531 20.550  1.00 59.85  ? 197 LEU D CG  1 
ATOM   5156 C CD1 . LEU D 1 180 ? 6.368   -59.028 20.717  1.00 60.61  ? 197 LEU D CD1 1 
ATOM   5157 C CD2 . LEU D 1 180 ? 6.107   -56.805 21.832  1.00 60.11  ? 197 LEU D CD2 1 
ATOM   5158 N N   . GLN D 1 181 ? 10.226  -55.637 18.607  1.00 56.65  ? 198 GLN D N   1 
ATOM   5159 C CA  . GLN D 1 181 ? 11.647  -55.484 18.365  1.00 56.98  ? 198 GLN D CA  1 
ATOM   5160 C C   . GLN D 1 181 ? 12.078  -54.042 18.661  1.00 53.34  ? 198 GLN D C   1 
ATOM   5161 O O   . GLN D 1 181 ? 13.156  -53.802 19.189  1.00 53.08  ? 198 GLN D O   1 
ATOM   5162 C CB  . GLN D 1 181 ? 11.985  -55.882 16.926  1.00 60.19  ? 198 GLN D CB  1 
ATOM   5163 C CG  . GLN D 1 181 ? 13.454  -56.240 16.733  1.00 65.15  ? 198 GLN D CG  1 
ATOM   5164 C CD  . GLN D 1 181 ? 13.733  -57.735 16.685  1.00 66.56  ? 198 GLN D CD  1 
ATOM   5165 O OE1 . GLN D 1 181 ? 13.006  -58.502 16.034  1.00 65.03  ? 198 GLN D OE1 1 
ATOM   5166 N NE2 . GLN D 1 181 ? 14.829  -58.151 17.328  1.00 67.73  ? 198 GLN D NE2 1 
ATOM   5167 N N   . ASN D 1 182 ? 11.211  -53.090 18.347  1.00 52.52  ? 199 ASN D N   1 
ATOM   5168 C CA  . ASN D 1 182 ? 11.470  -51.680 18.625  1.00 53.10  ? 199 ASN D CA  1 
ATOM   5169 C C   . ASN D 1 182 ? 11.386  -51.384 20.100  1.00 52.31  ? 199 ASN D C   1 
ATOM   5170 O O   . ASN D 1 182 ? 12.202  -50.640 20.630  1.00 52.84  ? 199 ASN D O   1 
ATOM   5171 C CB  . ASN D 1 182 ? 10.461  -50.796 17.883  1.00 54.54  ? 199 ASN D CB  1 
ATOM   5172 C CG  . ASN D 1 182 ? 10.781  -50.673 16.413  1.00 55.16  ? 199 ASN D CG  1 
ATOM   5173 O OD1 . ASN D 1 182 ? 11.949  -50.686 16.025  1.00 56.07  ? 199 ASN D OD1 1 
ATOM   5174 N ND2 . ASN D 1 182 ? 9.756   -50.574 15.592  1.00 54.38  ? 199 ASN D ND2 1 
ATOM   5175 N N   . LEU D 1 183 ? 10.361  -51.957 20.730  1.00 53.70  ? 200 LEU D N   1 
ATOM   5176 C CA  . LEU D 1 183 ? 10.184  -51.966 22.187  1.00 52.95  ? 200 LEU D CA  1 
ATOM   5177 C C   . LEU D 1 183 ? 11.467  -52.442 22.853  1.00 52.64  ? 200 LEU D C   1 
ATOM   5178 O O   . LEU D 1 183 ? 11.933  -51.823 23.794  1.00 51.90  ? 200 LEU D O   1 
ATOM   5179 C CB  . LEU D 1 183 ? 8.996   -52.878 22.572  1.00 52.92  ? 200 LEU D CB  1 
ATOM   5180 C CG  . LEU D 1 183 ? 8.497   -52.990 24.019  1.00 53.56  ? 200 LEU D CG  1 
ATOM   5181 C CD1 . LEU D 1 183 ? 8.160   -51.618 24.581  1.00 54.30  ? 200 LEU D CD1 1 
ATOM   5182 N N   . ALA D 1 184 ? 12.053  -53.511 22.323  1.00 52.65  ? 201 ALA D N   1 
ATOM   5183 C CA  . ALA D 1 184 ? 13.250  -54.097 22.906  1.00 55.33  ? 201 ALA D CA  1 
ATOM   5184 C C   . ALA D 1 184 ? 14.395  -53.083 22.988  1.00 57.76  ? 201 ALA D C   1 
ATOM   5185 O O   . ALA D 1 184 ? 15.079  -52.982 24.018  1.00 61.70  ? 201 ALA D O   1 
ATOM   5186 C CB  . ALA D 1 184 ? 13.675  -55.336 22.122  1.00 54.99  ? 201 ALA D CB  1 
ATOM   5187 N N   . VAL D 1 185 ? 14.573  -52.312 21.920  1.00 56.56  ? 202 VAL D N   1 
ATOM   5188 C CA  . VAL D 1 185 ? 15.698  -51.371 21.817  1.00 55.28  ? 202 VAL D CA  1 
ATOM   5189 C C   . VAL D 1 185 ? 15.590  -50.202 22.807  1.00 54.06  ? 202 VAL D C   1 
ATOM   5190 O O   . VAL D 1 185 ? 16.516  -49.996 23.605  1.00 50.88  ? 202 VAL D O   1 
ATOM   5191 C CB  . VAL D 1 185 ? 15.837  -50.839 20.367  1.00 54.65  ? 202 VAL D CB  1 
ATOM   5192 C CG1 . VAL D 1 185 ? 16.843  -49.700 20.274  1.00 54.51  ? 202 VAL D CG1 1 
ATOM   5193 C CG2 . VAL D 1 185 ? 16.235  -51.968 19.429  1.00 56.05  ? 202 VAL D CG2 1 
ATOM   5194 N N   . ILE D 1 186 ? 14.486  -49.440 22.737  1.00 53.14  ? 203 ILE D N   1 
ATOM   5195 C CA  . ILE D 1 186 ? 14.252  -48.322 23.677  1.00 55.76  ? 203 ILE D CA  1 
ATOM   5196 C C   . ILE D 1 186 ? 14.275  -48.702 25.142  1.00 57.84  ? 203 ILE D C   1 
ATOM   5197 O O   . ILE D 1 186 ? 14.660  -47.873 25.964  1.00 64.18  ? 203 ILE D O   1 
ATOM   5198 C CB  . ILE D 1 186 ? 12.885  -47.618 23.546  1.00 56.25  ? 203 ILE D CB  1 
ATOM   5199 C CG1 . ILE D 1 186 ? 11.807  -48.607 23.126  1.00 56.34  ? 203 ILE D CG1 1 
ATOM   5200 C CG2 . ILE D 1 186 ? 12.962  -46.397 22.646  1.00 57.77  ? 203 ILE D CG2 1 
ATOM   5201 C CD1 . ILE D 1 186 ? 10.490  -48.348 23.809  1.00 56.05  ? 203 ILE D CD1 1 
ATOM   5202 N N   . SER D 1 187 ? 13.832  -49.907 25.489  1.00 57.30  ? 204 SER D N   1 
ATOM   5203 C CA  . SER D 1 187 ? 13.775  -50.292 26.895  1.00 62.24  ? 204 SER D CA  1 
ATOM   5204 C C   . SER D 1 187 ? 15.042  -51.050 27.271  1.00 64.22  ? 204 SER D C   1 
ATOM   5205 O O   . SER D 1 187 ? 15.001  -52.190 27.693  1.00 66.82  ? 204 SER D O   1 
ATOM   5206 C CB  . SER D 1 187 ? 12.499  -51.094 27.192  1.00 63.78  ? 204 SER D CB  1 
ATOM   5207 O OG  . SER D 1 187 ? 12.422  -52.269 26.413  1.00 64.48  ? 204 SER D OG  1 
ATOM   5208 N N   . THR D 1 188 ? 16.175  -50.380 27.128  1.00 67.60  ? 205 THR D N   1 
ATOM   5209 C CA  . THR D 1 188 ? 17.475  -51.037 27.158  1.00 69.77  ? 205 THR D CA  1 
ATOM   5210 C C   . THR D 1 188 ? 18.568  -49.968 27.117  1.00 72.82  ? 205 THR D C   1 
ATOM   5211 O O   . THR D 1 188 ? 18.322  -48.848 26.665  1.00 68.58  ? 205 THR D O   1 
ATOM   5212 C CB  . THR D 1 188 ? 17.584  -52.042 25.983  1.00 70.12  ? 205 THR D CB  1 
ATOM   5213 O OG1 . THR D 1 188 ? 17.216  -53.348 26.438  1.00 66.81  ? 205 THR D OG1 1 
ATOM   5214 C CG2 . THR D 1 188 ? 18.982  -52.114 25.388  1.00 72.85  ? 205 THR D CG2 1 
ATOM   5215 N N   . ALA D 1 189 ? 19.755  -50.304 27.626  1.00 81.93  ? 206 ALA D N   1 
ATOM   5216 C CA  . ALA D 1 189 ? 20.916  -49.396 27.594  1.00 88.85  ? 206 ALA D CA  1 
ATOM   5217 C C   . ALA D 1 189 ? 21.727  -49.553 26.283  1.00 92.78  ? 206 ALA D C   1 
ATOM   5218 O O   . ALA D 1 189 ? 21.675  -50.611 25.644  1.00 89.64  ? 206 ALA D O   1 
ATOM   5219 C CB  . ALA D 1 189 ? 21.799  -49.631 28.818  1.00 89.45  ? 206 ALA D CB  1 
ATOM   5220 N N   . SER D 1 190 ? 22.472  -48.506 25.898  1.00 96.83  ? 207 SER D N   1 
ATOM   5221 C CA  . SER D 1 190 ? 23.190  -48.470 24.602  1.00 100.67 ? 207 SER D CA  1 
ATOM   5222 C C   . SER D 1 190 ? 24.691  -48.164 24.713  1.00 100.03 ? 207 SER D C   1 
ATOM   5223 O O   . SER D 1 190 ? 25.422  -48.194 23.710  1.00 93.85  ? 207 SER D O   1 
ATOM   5224 C CB  . SER D 1 190 ? 22.529  -47.459 23.648  1.00 101.33 ? 207 SER D CB  1 
ATOM   5225 O OG  . SER D 1 190 ? 22.554  -46.138 24.159  1.00 103.15 ? 207 SER D OG  1 
HETATM 5226 O O3  . A9S E 2 .   ? 48.423  -76.259 12.184  1.00 60.61  ? 301 A9S A O3  1 
HETATM 5227 C C10 . A9S E 2 .   ? 48.247  -76.590 13.364  1.00 56.78  ? 301 A9S A C10 1 
HETATM 5228 O O1  . A9S E 2 .   ? 48.546  -77.751 13.732  1.00 59.96  ? 301 A9S A O1  1 
HETATM 5229 C C11 . A9S E 2 .   ? 47.647  -75.560 14.247  1.00 53.56  ? 301 A9S A C11 1 
HETATM 5230 C C12 . A9S E 2 .   ? 47.265  -75.748 15.520  1.00 55.88  ? 301 A9S A C12 1 
HETATM 5231 C C15 . A9S E 2 .   ? 46.647  -74.565 16.220  1.00 55.47  ? 301 A9S A C15 1 
HETATM 5232 C C8  . A9S E 2 .   ? 47.463  -77.048 16.221  1.00 61.36  ? 301 A9S A C8  1 
HETATM 5233 C C9  . A9S E 2 .   ? 47.162  -77.227 17.509  1.00 64.90  ? 301 A9S A C9  1 
HETATM 5234 C C5  . A9S E 2 .   ? 47.398  -78.552 18.189  1.00 68.35  ? 301 A9S A C5  1 
HETATM 5235 O O4  . A9S E 2 .   ? 48.056  -79.464 17.316  1.00 69.89  ? 301 A9S A O4  1 
HETATM 5236 C C6  . A9S E 2 .   ? 48.262  -78.428 19.447  1.00 71.62  ? 301 A9S A C6  1 
HETATM 5237 C C14 . A9S E 2 .   ? 49.575  -77.729 19.121  1.00 74.63  ? 301 A9S A C14 1 
HETATM 5238 C C13 . A9S E 2 .   ? 48.630  -79.812 19.981  1.00 76.77  ? 301 A9S A C13 1 
HETATM 5239 C C1  . A9S E 2 .   ? 47.542  -77.630 20.528  1.00 71.34  ? 301 A9S A C1  1 
HETATM 5240 C C4  . A9S E 2 .   ? 46.036  -79.108 18.483  1.00 72.38  ? 301 A9S A C4  1 
HETATM 5241 C C7  . A9S E 2 .   ? 45.294  -79.803 17.379  1.00 74.46  ? 301 A9S A C7  1 
HETATM 5242 C C3  . A9S E 2 .   ? 45.484  -78.972 19.701  1.00 74.67  ? 301 A9S A C3  1 
HETATM 5243 C C2  . A9S E 2 .   ? 46.177  -78.234 20.774  1.00 74.41  ? 301 A9S A C2  1 
HETATM 5244 O O2  . A9S E 2 .   ? 45.639  -78.110 21.861  1.00 82.93  ? 301 A9S A O2  1 
HETATM 5245 O O3  . A9S F 2 .   ? 70.604  -71.995 19.448  0.80 52.71  ? 301 A9S B O3  1 
HETATM 5246 C C10 . A9S F 2 .   ? 70.417  -70.777 19.585  0.80 50.83  ? 301 A9S B C10 1 
HETATM 5247 O O1  . A9S F 2 .   ? 70.015  -70.355 20.680  0.80 54.95  ? 301 A9S B O1  1 
HETATM 5248 C C11 . A9S F 2 .   ? 70.652  -69.794 18.497  0.80 50.68  ? 301 A9S B C11 1 
HETATM 5249 C C12 . A9S F 2 .   ? 71.121  -70.074 17.261  0.80 50.89  ? 301 A9S B C12 1 
HETATM 5250 C C15 . A9S F 2 .   ? 71.265  -68.918 16.326  0.80 50.47  ? 301 A9S B C15 1 
HETATM 5251 C C8  . A9S F 2 .   ? 71.437  -71.450 16.834  0.80 55.59  ? 301 A9S B C8  1 
HETATM 5252 C C9  . A9S F 2 .   ? 71.845  -71.778 15.616  0.80 57.56  ? 301 A9S B C9  1 
HETATM 5253 C C5  . A9S F 2 .   ? 72.102  -73.233 15.303  0.80 61.66  ? 301 A9S B C5  1 
HETATM 5254 O O4  . A9S F 2 .   ? 71.742  -74.021 16.440  0.80 60.42  ? 301 A9S B O4  1 
HETATM 5255 C C6  . A9S F 2 .   ? 71.287  -73.726 14.101  0.80 64.19  ? 301 A9S B C6  1 
HETATM 5256 C C14 . A9S F 2 .   ? 69.791  -73.478 14.315  0.80 65.30  ? 301 A9S B C14 1 
HETATM 5257 C C13 . A9S F 2 .   ? 71.474  -75.232 13.871  0.80 64.15  ? 301 A9S B C13 1 
HETATM 5258 C C1  . A9S F 2 .   ? 71.708  -72.963 12.850  0.80 65.98  ? 301 A9S B C1  1 
HETATM 5259 C C4  . A9S F 2 .   ? 73.580  -73.372 15.066  0.80 66.09  ? 301 A9S B C4  1 
HETATM 5260 C C7  . A9S F 2 .   ? 74.490  -73.559 16.250  0.80 64.27  ? 301 A9S B C7  1 
HETATM 5261 C C3  . A9S F 2 .   ? 74.075  -73.310 13.813  0.80 68.29  ? 301 A9S B C3  1 
HETATM 5262 C C2  . A9S F 2 .   ? 73.192  -73.091 12.646  0.80 66.86  ? 301 A9S B C2  1 
HETATM 5263 O O2  . A9S F 2 .   ? 73.654  -73.010 11.519  0.80 72.94  ? 301 A9S B O2  1 
HETATM 5264 O O3  . A9S G 2 .   ? 21.514  -48.303 9.898   0.80 52.23  ? 301 A9S C O3  1 
HETATM 5265 C C10 . A9S G 2 .   ? 21.640  -47.754 11.012  0.80 54.80  ? 301 A9S C C10 1 
HETATM 5266 O O1  . A9S G 2 .   ? 21.264  -46.573 11.167  0.80 56.14  ? 301 A9S C O1  1 
HETATM 5267 C C11 . A9S G 2 .   ? 22.237  -48.578 12.102  0.80 55.59  ? 301 A9S C C11 1 
HETATM 5268 C C12 . A9S G 2 .   ? 22.507  -48.204 13.382  0.80 56.22  ? 301 A9S C C12 1 
HETATM 5269 C C15 . A9S G 2 .   ? 23.117  -49.249 14.277  0.80 57.16  ? 301 A9S C C15 1 
HETATM 5270 C C8  . A9S G 2 .   ? 22.228  -46.859 13.929  0.80 57.47  ? 301 A9S C C8  1 
HETATM 5271 C C9  . A9S G 2 .   ? 22.487  -46.534 15.200  0.80 59.29  ? 301 A9S C C9  1 
HETATM 5272 C C5  . A9S G 2 .   ? 22.184  -45.153 15.746  0.80 60.98  ? 301 A9S C C5  1 
HETATM 5273 O O4  . A9S G 2 .   ? 21.539  -44.355 14.745  0.80 61.50  ? 301 A9S C O4  1 
HETATM 5274 C C6  . A9S G 2 .   ? 21.264  -45.213 16.965  0.80 62.68  ? 301 A9S C C6  1 
HETATM 5275 C C14 . A9S G 2 .   ? 20.042  -46.072 16.636  0.80 62.70  ? 301 A9S C C14 1 
HETATM 5276 C C13 . A9S G 2 .   ? 20.779  -43.807 17.331  0.80 63.58  ? 301 A9S C C13 1 
HETATM 5277 C C1  . A9S G 2 .   ? 21.967  -45.838 18.170  0.80 64.69  ? 301 A9S C C1  1 
HETATM 5278 C C4  . A9S G 2 .   ? 23.508  -44.513 16.065  0.80 63.69  ? 301 A9S C C4  1 
HETATM 5279 C C7  . A9S G 2 .   ? 24.268  -43.864 14.946  0.80 65.72  ? 301 A9S C C7  1 
HETATM 5280 C C3  . A9S G 2 .   ? 24.018  -44.530 17.307  0.80 64.23  ? 301 A9S C C3  1 
HETATM 5281 C C2  . A9S G 2 .   ? 23.306  -45.193 18.411  0.80 65.20  ? 301 A9S C C2  1 
HETATM 5282 O O2  . A9S G 2 .   ? 23.806  -45.238 19.517  0.80 68.00  ? 301 A9S C O2  1 
HETATM 5283 O O3  . A9S H 2 .   ? -0.823  -51.451 17.085  0.80 58.03  ? 301 A9S D O3  1 
HETATM 5284 C C10 . A9S H 2 .   ? -0.659  -52.638 17.420  0.80 53.48  ? 301 A9S D C10 1 
HETATM 5285 O O1  . A9S H 2 .   ? -0.298  -52.904 18.583  0.80 51.64  ? 301 A9S D O1  1 
HETATM 5286 C C11 . A9S H 2 .   ? -0.888  -53.776 16.495  0.80 52.65  ? 301 A9S D C11 1 
HETATM 5287 C C12 . A9S H 2 .   ? -1.316  -53.719 15.215  0.80 51.60  ? 301 A9S D C12 1 
HETATM 5288 C C15 . A9S H 2 .   ? -1.490  -55.017 14.475  0.80 51.70  ? 301 A9S D C15 1 
HETATM 5289 C C8  . A9S H 2 .   ? -1.614  -52.458 14.515  0.80 56.00  ? 301 A9S D C8  1 
HETATM 5290 C C9  . A9S H 2 .   ? -2.022  -52.445 13.246  0.80 61.47  ? 301 A9S D C9  1 
HETATM 5291 C C5  . A9S H 2 .   ? -2.310  -51.132 12.560  0.80 65.84  ? 301 A9S D C5  1 
HETATM 5292 O O4  . A9S H 2 .   ? -2.013  -50.060 13.466  0.80 70.54  ? 301 A9S D O4  1 
HETATM 5293 C C6  . A9S H 2 .   ? -1.493  -50.916 11.283  0.80 65.98  ? 301 A9S D C6  1 
HETATM 5294 C C14 . A9S H 2 .   ? -0.002  -51.139 11.547  0.80 68.62  ? 301 A9S D C14 1 
HETATM 5295 C C13 . A9S H 2 .   ? -1.652  -49.477 10.788  0.80 66.61  ? 301 A9S D C13 1 
HETATM 5296 C C1  . A9S H 2 .   ? -1.921  -51.900 10.201  0.80 64.96  ? 301 A9S D C1  1 
HETATM 5297 C C4  . A9S H 2 .   ? -3.784  -51.122 12.287  0.80 67.45  ? 301 A9S D C4  1 
HETATM 5298 C C7  . A9S H 2 .   ? -4.719  -50.775 13.403  0.80 70.23  ? 301 A9S D C7  1 
HETATM 5299 C C3  . A9S H 2 .   ? -4.278  -51.428 11.083  0.80 67.59  ? 301 A9S D C3  1 
HETATM 5300 C C2  . A9S H 2 .   ? -3.402  -51.819 9.980   0.80 65.07  ? 301 A9S D C2  1 
HETATM 5301 O O2  . A9S H 2 .   ? -3.886  -52.062 8.894   0.80 68.03  ? 301 A9S D O2  1 
HETATM 5302 O O   . HOH I 3 .   ? 73.844  -69.161 7.385   1.00 54.96  ? 401 HOH A O   1 
HETATM 5303 O O   . HOH I 3 .   ? 44.858  -48.831 8.819   1.00 64.49  ? 402 HOH A O   1 
HETATM 5304 O O   . HOH I 3 .   ? 51.812  -67.931 -4.486  1.00 54.36  ? 403 HOH A O   1 
HETATM 5305 O O   . HOH I 3 .   ? 43.123  -61.643 13.763  1.00 64.30  ? 404 HOH A O   1 
HETATM 5306 O O   . HOH I 3 .   ? 45.758  -82.134 13.036  1.00 49.71  ? 405 HOH A O   1 
HETATM 5307 O O   . HOH I 3 .   ? 65.329  -51.167 -8.682  1.00 65.60  ? 406 HOH A O   1 
HETATM 5308 O O   . HOH I 3 .   ? 53.689  -93.924 0.489   1.00 93.40  ? 407 HOH A O   1 
HETATM 5309 O O   . HOH I 3 .   ? 58.322  -85.765 23.069  1.00 74.52  ? 408 HOH A O   1 
HETATM 5310 O O   . HOH I 3 .   ? 69.436  -57.376 -4.524  1.00 78.74  ? 409 HOH A O   1 
HETATM 5311 O O   . HOH I 3 .   ? 46.250  -78.620 -7.213  1.00 57.56  ? 410 HOH A O   1 
HETATM 5312 O O   . HOH I 3 .   ? 38.912  -83.513 22.795  1.00 51.47  ? 411 HOH A O   1 
HETATM 5313 O O   . HOH I 3 .   ? 31.022  -80.253 9.958   1.00 72.51  ? 412 HOH A O   1 
HETATM 5314 O O   . HOH I 3 .   ? 24.398  -64.778 20.405  1.00 74.20  ? 413 HOH A O   1 
HETATM 5315 O O   . HOH I 3 .   ? 50.084  -69.372 24.378  1.00 61.68  ? 414 HOH A O   1 
HETATM 5316 O O   . HOH I 3 .   ? 44.381  -59.733 9.029   1.00 60.36  ? 415 HOH A O   1 
HETATM 5317 O O   . HOH I 3 .   ? 48.921  -85.656 27.667  1.00 75.53  ? 416 HOH A O   1 
HETATM 5318 O O   . HOH I 3 .   ? 27.577  -66.369 23.680  1.00 72.68  ? 417 HOH A O   1 
HETATM 5319 O O   . HOH I 3 .   ? 43.549  -77.483 -7.432  1.00 66.39  ? 418 HOH A O   1 
HETATM 5320 O O   . HOH I 3 .   ? 43.746  -73.276 25.776  1.00 55.22  ? 419 HOH A O   1 
HETATM 5321 O O   . HOH I 3 .   ? 44.838  -64.836 31.755  1.00 63.02  ? 420 HOH A O   1 
HETATM 5322 O O   . HOH J 3 .   ? 59.913  -62.424 18.548  1.00 61.73  ? 401 HOH B O   1 
HETATM 5323 O O   . HOH J 3 .   ? 70.504  -73.048 45.740  1.00 49.25  ? 402 HOH B O   1 
HETATM 5324 O O   . HOH J 3 .   ? 68.354  -71.474 43.032  1.00 72.32  ? 403 HOH B O   1 
HETATM 5325 O O   . HOH J 3 .   ? 58.074  -65.446 38.222  1.00 55.23  ? 404 HOH B O   1 
HETATM 5326 O O   . HOH J 3 .   ? 84.353  -69.701 23.507  1.00 59.79  ? 405 HOH B O   1 
HETATM 5327 O O   . HOH J 3 .   ? 68.067  -53.721 20.523  1.00 76.70  ? 406 HOH B O   1 
HETATM 5328 O O   . HOH J 3 .   ? 65.982  -40.505 34.571  1.00 59.52  ? 407 HOH B O   1 
HETATM 5329 O O   . HOH J 3 .   ? 73.208  -87.518 35.092  1.00 60.79  ? 408 HOH B O   1 
HETATM 5330 O O   . HOH J 3 .   ? 82.824  -53.930 13.345  1.00 62.17  ? 409 HOH B O   1 
HETATM 5331 O O   . HOH J 3 .   ? 57.897  -74.159 33.244  1.00 53.39  ? 410 HOH B O   1 
HETATM 5332 O O   . HOH J 3 .   ? 75.900  -56.782 4.823   1.00 75.20  ? 411 HOH B O   1 
HETATM 5333 O O   . HOH J 3 .   ? 74.909  -75.146 21.140  1.00 64.17  ? 412 HOH B O   1 
HETATM 5334 O O   . HOH J 3 .   ? 63.812  -62.267 36.162  1.00 58.19  ? 413 HOH B O   1 
HETATM 5335 O O   . HOH J 3 .   ? 60.696  -50.096 20.623  1.00 72.23  ? 414 HOH B O   1 
HETATM 5336 O O   . HOH J 3 .   ? 47.393  -69.680 27.380  1.00 64.98  ? 415 HOH B O   1 
HETATM 5337 O O   . HOH J 3 .   ? 59.771  -45.883 17.848  1.00 82.71  ? 416 HOH B O   1 
HETATM 5338 O O   . HOH J 3 .   ? 66.535  -73.764 42.390  1.00 55.83  ? 417 HOH B O   1 
HETATM 5339 O O   . HOH J 3 .   ? 40.015  -53.777 37.765  1.00 72.18  ? 418 HOH B O   1 
HETATM 5340 O O   . HOH J 3 .   ? 84.293  -70.159 20.228  1.00 54.47  ? 419 HOH B O   1 
HETATM 5341 O O   . HOH J 3 .   ? 58.209  -74.223 36.518  1.00 67.46  ? 420 HOH B O   1 
HETATM 5342 O O   . HOH J 3 .   ? 46.110  -74.905 29.617  1.00 65.50  ? 421 HOH B O   1 
HETATM 5343 O O   . HOH J 3 .   ? 52.268  -74.695 32.962  1.00 67.42  ? 422 HOH B O   1 
HETATM 5344 O O   . HOH K 3 .   ? 2.527   -52.182 -4.068  1.00 64.72  ? 401 HOH C O   1 
HETATM 5345 O O   . HOH K 3 .   ? 30.814  -47.336 -4.675  1.00 60.83  ? 402 HOH C O   1 
HETATM 5346 O O   . HOH K 3 .   ? 16.130  -60.604 12.122  1.00 55.83  ? 403 HOH C O   1 
HETATM 5347 O O   . HOH K 3 .   ? 24.737  -49.001 -9.949  1.00 58.49  ? 404 HOH C O   1 
HETATM 5348 O O   . HOH K 3 .   ? 19.100  -53.789 22.768  1.00 79.32  ? 405 HOH C O   1 
HETATM 5349 O O   . HOH K 3 .   ? 23.714  -42.349 9.396   1.00 55.49  ? 406 HOH C O   1 
HETATM 5350 O O   . HOH K 3 .   ? -4.123  -55.856 5.659   1.00 65.96  ? 407 HOH C O   1 
HETATM 5351 O O   . HOH K 3 .   ? 4.517   -51.926 -1.216  1.00 75.69  ? 408 HOH C O   1 
HETATM 5352 O O   . HOH K 3 .   ? 24.140  -74.184 7.876   1.00 61.60  ? 409 HOH C O   1 
HETATM 5353 O O   . HOH K 3 .   ? 25.683  -77.062 9.392   1.00 76.67  ? 410 HOH C O   1 
HETATM 5354 O O   . HOH K 3 .   ? 42.047  -59.857 9.168   1.00 48.22  ? 411 HOH C O   1 
HETATM 5355 O O   . HOH K 3 .   ? 8.735   -68.600 0.546   1.00 58.83  ? 412 HOH C O   1 
HETATM 5356 O O   . HOH K 3 .   ? 7.348   -74.947 -2.350  1.00 77.33  ? 413 HOH C O   1 
HETATM 5357 O O   . HOH K 3 .   ? 26.217  -65.229 8.785   1.00 58.29  ? 414 HOH C O   1 
HETATM 5358 O O   . HOH K 3 .   ? 41.200  -55.712 20.396  1.00 84.30  ? 415 HOH C O   1 
HETATM 5359 O O   . HOH K 3 .   ? 22.046  -44.238 -8.184  1.00 80.57  ? 416 HOH C O   1 
HETATM 5360 O O   . HOH K 3 .   ? 16.729  -32.016 -4.097  1.00 55.74  ? 417 HOH C O   1 
HETATM 5361 O O   . HOH K 3 .   ? 28.575  -47.203 -6.195  1.00 64.15  ? 418 HOH C O   1 
HETATM 5362 O O   . HOH K 3 .   ? 27.361  -43.948 -7.375  1.00 74.72  ? 419 HOH C O   1 
HETATM 5363 O O   . HOH K 3 .   ? 24.788  -24.494 8.825   1.00 63.76  ? 420 HOH C O   1 
HETATM 5364 O O   . HOH K 3 .   ? 36.306  -49.231 2.462   1.00 57.05  ? 421 HOH C O   1 
HETATM 5365 O O   . HOH K 3 .   ? 33.823  -41.680 -4.582  1.00 68.20  ? 422 HOH C O   1 
HETATM 5366 O O   . HOH K 3 .   ? 4.427   -59.144 -1.685  1.00 70.44  ? 423 HOH C O   1 
HETATM 5367 O O   . HOH K 3 .   ? 1.808   -76.758 -6.800  1.00 71.24  ? 424 HOH C O   1 
HETATM 5368 O O   . HOH K 3 .   ? 30.104  -57.039 -3.425  1.00 39.72  ? 425 HOH C O   1 
HETATM 5369 O O   . HOH K 3 .   ? 38.552  -42.280 12.325  1.00 70.66  ? 426 HOH C O   1 
HETATM 5370 O O   . HOH K 3 .   ? 3.081   -74.090 -5.846  1.00 71.61  ? 427 HOH C O   1 
HETATM 5371 O O   . HOH K 3 .   ? 24.545  -28.345 12.875  1.00 86.50  ? 428 HOH C O   1 
HETATM 5372 O O   . HOH K 3 .   ? 30.161  -43.895 -7.451  1.00 73.21  ? 429 HOH C O   1 
HETATM 5373 O O   . HOH K 3 .   ? 32.856  -38.780 -8.936  1.00 64.61  ? 430 HOH C O   1 
HETATM 5374 O O   . HOH K 3 .   ? 17.449  -40.617 -1.314  1.00 54.14  ? 431 HOH C O   1 
HETATM 5375 O O   . HOH K 3 .   ? 23.985  -76.185 11.668  1.00 72.31  ? 432 HOH C O   1 
HETATM 5376 O O   . HOH K 3 .   ? 24.429  -79.732 12.126  1.00 67.69  ? 433 HOH C O   1 
HETATM 5377 O O   . HOH L 3 .   ? -9.267  -40.073 14.887  1.00 80.83  ? 401 HOH D O   1 
HETATM 5378 O O   . HOH L 3 .   ? -18.206 -55.661 15.172  1.00 59.56  ? 402 HOH D O   1 
HETATM 5379 O O   . HOH L 3 .   ? -16.778 -53.630 13.881  1.00 90.00  ? 403 HOH D O   1 
HETATM 5380 O O   . HOH L 3 .   ? 9.717   -61.242 16.851  1.00 62.80  ? 404 HOH D O   1 
HETATM 5381 O O   . HOH L 3 .   ? 6.314   -66.617 30.244  1.00 59.44  ? 405 HOH D O   1 
HETATM 5382 O O   . HOH L 3 .   ? 8.379   -43.333 13.393  1.00 73.57  ? 406 HOH D O   1 
HETATM 5383 O O   . HOH L 3 .   ? 9.766   -58.435 11.678  1.00 57.44  ? 407 HOH D O   1 
HETATM 5384 O O   . HOH L 3 .   ? -5.673  -31.639 29.344  1.00 66.36  ? 408 HOH D O   1 
HETATM 5385 O O   . HOH L 3 .   ? -3.784  -33.441 29.485  1.00 69.67  ? 409 HOH D O   1 
HETATM 5386 O O   . HOH L 3 .   ? -4.101  -35.453 31.780  1.00 84.28  ? 410 HOH D O   1 
HETATM 5387 O O   . HOH L 3 .   ? 14.071  -68.576 15.444  1.00 73.68  ? 411 HOH D O   1 
HETATM 5388 O O   . HOH L 3 .   ? -1.292  -39.581 36.455  1.00 67.30  ? 412 HOH D O   1 
HETATM 5389 O O   . HOH L 3 .   ? -0.740  -65.028 -4.433  1.00 80.31  ? 413 HOH D O   1 
HETATM 5390 O O   . HOH L 3 .   ? 11.988  -58.735 13.433  1.00 57.06  ? 414 HOH D O   1 
HETATM 5391 O O   . HOH L 3 .   ? -3.427  -74.042 29.393  1.00 87.91  ? 415 HOH D O   1 
HETATM 5392 O O   . HOH L 3 .   ? -1.328  -43.827 5.765   1.00 70.95  ? 416 HOH D O   1 
HETATM 5393 O O   . HOH L 3 .   ? -11.541 -62.222 31.543  1.00 68.48  ? 417 HOH D O   1 
HETATM 5394 O O   . HOH L 3 .   ? -7.335  -75.576 7.692   1.00 63.77  ? 418 HOH D O   1 
HETATM 5395 O O   . HOH L 3 .   ? 24.613  -65.122 36.795  1.00 67.96  ? 419 HOH D O   1 
HETATM 5396 O O   . HOH L 3 .   ? 26.886  -62.761 39.199  1.00 68.84  ? 420 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . TYR A 6   ? 1.0916 1.2158 1.0401 -0.0044 0.0190  0.0207  23  TYR A N   
2    C CA  . TYR A 6   ? 1.0114 1.1317 0.9564 -0.0108 0.0212  0.0243  23  TYR A CA  
3    C C   . TYR A 6   ? 0.9472 1.0651 0.8972 -0.0132 0.0225  0.0185  23  TYR A C   
4    O O   . TYR A 6   ? 0.9076 1.0266 0.8549 -0.0160 0.0238  0.0180  23  TYR A O   
5    C CB  . TYR A 6   ? 1.0089 1.1233 0.9522 -0.0148 0.0218  0.0313  23  TYR A CB  
6    C CG  . TYR A 6   ? 1.0161 1.1257 0.9664 -0.0134 0.0203  0.0317  23  TYR A CG  
7    C CD1 . TYR A 6   ? 1.0706 1.1761 1.0299 -0.0138 0.0205  0.0271  23  TYR A CD1 
8    C CD2 . TYR A 6   ? 1.0187 1.1273 0.9686 -0.0119 0.0179  0.0367  23  TYR A CD2 
9    C CE1 . TYR A 6   ? 1.0850 1.1852 1.0525 -0.0128 0.0183  0.0276  23  TYR A CE1 
10   C CE2 . TYR A 6   ? 1.0380 1.1413 0.9957 -0.0106 0.0155  0.0370  23  TYR A CE2 
11   C CZ  . TYR A 6   ? 1.0742 1.1730 1.0406 -0.0111 0.0156  0.0326  23  TYR A CZ  
12   O OH  . TYR A 6   ? 1.1510 1.2437 1.1272 -0.0100 0.0125  0.0327  23  TYR A OH  
13   N N   . GLY A 7   ? 0.8900 1.0052 0.8494 -0.0118 0.0218  0.0136  24  GLY A N   
14   C CA  . GLY A 7   ? 0.8565 0.9694 0.8242 -0.0145 0.0231  0.0080  24  GLY A CA  
15   C C   . GLY A 7   ? 0.8326 0.9401 0.8019 -0.0217 0.0276  0.0125  24  GLY A C   
16   O O   . GLY A 7   ? 0.7880 0.8944 0.7657 -0.0248 0.0301  0.0086  24  GLY A O   
17   N N   . LEU A 8   ? 0.8205 0.9251 0.7819 -0.0242 0.0288  0.0209  25  LEU A N   
18   C CA  . LEU A 8   ? 0.8335 0.9331 0.7916 -0.0309 0.0332  0.0268  25  LEU A CA  
19   C C   . LEU A 8   ? 0.8311 0.9234 0.7977 -0.0334 0.0339  0.0295  25  LEU A C   
20   O O   . LEU A 8   ? 0.8161 0.9064 0.7896 -0.0294 0.0298  0.0284  25  LEU A O   
21   C CB  . LEU A 8   ? 0.8309 0.9298 0.7756 -0.0320 0.0325  0.0346  25  LEU A CB  
22   C CG  . LEU A 8   ? 0.8151 0.9181 0.7503 -0.0338 0.0339  0.0350  25  LEU A CG  
23   C CD1 . LEU A 8   ? 0.7891 0.8981 0.7288 -0.0317 0.0336  0.0272  25  LEU A CD1 
24   C CD2 . LEU A 8   ? 0.7873 0.8910 0.7139 -0.0318 0.0302  0.0405  25  LEU A CD2 
25   N N   . THR A 9   ? 0.8322 0.9210 0.7987 -0.0400 0.0394  0.0329  26  THR A N   
26   C CA  . THR A 9   ? 0.8263 0.9070 0.7986 -0.0440 0.0408  0.0388  26  THR A CA  
27   C C   . THR A 9   ? 0.8208 0.8959 0.7801 -0.0452 0.0390  0.0489  26  THR A C   
28   O O   . THR A 9   ? 0.8355 0.9132 0.7809 -0.0451 0.0391  0.0515  26  THR A O   
29   C CB  . THR A 9   ? 0.8365 0.9162 0.8118 -0.0514 0.0487  0.0400  26  THR A CB  
30   O OG1 . THR A 9   ? 0.8734 0.9555 0.8325 -0.0548 0.0531  0.0440  26  THR A OG1 
31   C CG2 . THR A 9   ? 0.8227 0.9081 0.8127 -0.0506 0.0502  0.0294  26  THR A CG2 
32   N N   . LYS A 10  ? 0.8223 0.8891 0.7870 -0.0461 0.0365  0.0545  27  LYS A N   
33   C CA  . LYS A 10  ? 0.8258 0.8857 0.7789 -0.0474 0.0338  0.0647  27  LYS A CA  
34   C C   . LYS A 10  ? 0.8432 0.9026 0.7787 -0.0530 0.0392  0.0711  27  LYS A C   
35   O O   . LYS A 10  ? 0.8425 0.9014 0.7644 -0.0518 0.0362  0.0754  27  LYS A O   
36   C CB  . LYS A 10  ? 0.8408 0.8903 0.8037 -0.0490 0.0309  0.0705  27  LYS A CB  
37   C CG  . LYS A 10  ? 0.8323 0.8818 0.8105 -0.0421 0.0236  0.0644  27  LYS A CG  
38   N N   . ASP A 11  ? 0.8731 0.9334 0.8096 -0.0588 0.0470  0.0708  28  ASP A N   
39   C CA  . ASP A 11  ? 0.9180 0.9793 0.8375 -0.0637 0.0531  0.0751  28  ASP A CA  
40   C C   . ASP A 11  ? 0.8945 0.9643 0.8047 -0.0604 0.0520  0.0693  28  ASP A C   
41   O O   . ASP A 11  ? 0.9074 0.9763 0.8011 -0.0612 0.0513  0.0737  28  ASP A O   
42   C CB  . ASP A 11  ? 0.9726 1.0357 0.8979 -0.0702 0.0628  0.0741  28  ASP A CB  
43   N N   . GLU A 12  ? 0.8539 0.9313 0.7748 -0.0567 0.0512  0.0595  29  GLU A N   
44   C CA  . GLU A 12  ? 0.8107 0.8956 0.7251 -0.0540 0.0500  0.0541  29  GLU A CA  
45   C C   . GLU A 12  ? 0.8193 0.9036 0.7264 -0.0494 0.0427  0.0573  29  GLU A C   
46   O O   . GLU A 12  ? 0.8484 0.9350 0.7444 -0.0493 0.0415  0.0581  29  GLU A O   
47   C CB  . GLU A 12  ? 0.7729 0.8648 0.7007 -0.0509 0.0499  0.0440  29  GLU A CB  
48   C CG  . GLU A 12  ? 0.7487 0.8437 0.6847 -0.0551 0.0570  0.0387  29  GLU A CG  
49   C CD  . GLU A 12  ? 0.7399 0.8386 0.6927 -0.0518 0.0550  0.0295  29  GLU A CD  
50   O OE1 . GLU A 12  ? 0.7559 0.8536 0.7131 -0.0467 0.0489  0.0284  29  GLU A OE1 
51   O OE2 . GLU A 12  ? 0.7402 0.8431 0.7021 -0.0541 0.0594  0.0230  29  GLU A OE2 
52   N N   . PHE A 13  ? 0.8328 0.9146 0.7474 -0.0456 0.0376  0.0585  30  PHE A N   
53   C CA  . PHE A 13  ? 0.8418 0.9241 0.7523 -0.0413 0.0311  0.0611  30  PHE A CA  
54   C C   . PHE A 13  ? 0.8316 0.9065 0.7300 -0.0436 0.0289  0.0701  30  PHE A C   
55   O O   . PHE A 13  ? 0.8017 0.8778 0.6931 -0.0416 0.0245  0.0722  30  PHE A O   
56   C CB  . PHE A 13  ? 0.8549 0.9379 0.7776 -0.0360 0.0269  0.0586  30  PHE A CB  
57   C CG  . PHE A 13  ? 0.8359 0.9209 0.7567 -0.0316 0.0212  0.0610  30  PHE A CG  
58   C CD1 . PHE A 13  ? 0.7805 0.8729 0.6981 -0.0294 0.0203  0.0587  30  PHE A CD1 
59   C CD2 . PHE A 13  ? 0.8428 0.9221 0.7666 -0.0299 0.0166  0.0656  30  PHE A CD2 
60   C CE1 . PHE A 13  ? 0.7753 0.8702 0.6933 -0.0260 0.0157  0.0612  30  PHE A CE1 
61   C CE2 . PHE A 13  ? 0.8045 0.8865 0.7288 -0.0259 0.0116  0.0672  30  PHE A CE2 
62   C CZ  . PHE A 13  ? 0.7764 0.8667 0.6981 -0.0241 0.0116  0.0650  30  PHE A CZ  
63   N N   . SER A 14  ? 0.8764 0.9436 0.7726 -0.0480 0.0315  0.0757  31  SER A N   
64   C CA  . SER A 14  ? 0.8778 0.9369 0.7597 -0.0506 0.0292  0.0851  31  SER A CA  
65   C C   . SER A 14  ? 0.8616 0.9247 0.7285 -0.0512 0.0297  0.0844  31  SER A C   
66   O O   . SER A 14  ? 0.8786 0.9395 0.7372 -0.0492 0.0234  0.0880  31  SER A O   
67   C CB  . SER A 14  ? 0.8891 0.9403 0.7680 -0.0567 0.0344  0.0917  31  SER A CB  
68   N N   . THR A 15  ? 0.8187 0.8882 0.6844 -0.0535 0.0362  0.0785  32  THR A N   
69   C CA  . THR A 15  ? 0.7829 0.8559 0.6347 -0.0544 0.0370  0.0769  32  THR A CA  
70   C C   . THR A 15  ? 0.7284 0.8088 0.5849 -0.0499 0.0324  0.0706  32  THR A C   
71   O O   . THR A 15  ? 0.7518 0.8333 0.5984 -0.0492 0.0291  0.0705  32  THR A O   
72   C CB  . THR A 15  ? 0.8080 0.8846 0.6553 -0.0593 0.0465  0.0735  32  THR A CB  
73   O OG1 . THR A 15  ? 0.8001 0.8858 0.6520 -0.0574 0.0473  0.0640  32  THR A OG1 
74   C CG2 . THR A 15  ? 0.8080 0.8828 0.6664 -0.0630 0.0533  0.0742  32  THR A CG2 
75   N N   . LEU A 16  ? 0.6755 0.7608 0.5469 -0.0469 0.0317  0.0655  33  LEU A N   
76   C CA  . LEU A 16  ? 0.6246 0.7168 0.5011 -0.0429 0.0277  0.0607  33  LEU A CA  
77   C C   . LEU A 16  ? 0.5831 0.6750 0.4631 -0.0388 0.0207  0.0644  33  LEU A C   
78   O O   . LEU A 16  ? 0.5401 0.6364 0.4212 -0.0366 0.0169  0.0631  33  LEU A O   
79   C CB  . LEU A 16  ? 0.6357 0.7336 0.5246 -0.0416 0.0306  0.0537  33  LEU A CB  
80   C CG  . LEU A 16  ? 0.6546 0.7571 0.5454 -0.0438 0.0355  0.0467  33  LEU A CG  
81   C CD1 . LEU A 16  ? 0.6857 0.7864 0.5663 -0.0485 0.0407  0.0474  33  LEU A CD1 
82   C CD2 . LEU A 16  ? 0.6480 0.7520 0.5514 -0.0432 0.0384  0.0419  33  LEU A CD2 
83   N N   . ASP A 17  ? 0.5776 0.6644 0.4610 -0.0378 0.0188  0.0687  34  ASP A N   
84   C CA  . ASP A 17  ? 0.5848 0.6717 0.4731 -0.0338 0.0125  0.0716  34  ASP A CA  
85   C C   . ASP A 17  ? 0.6049 0.6934 0.4867 -0.0333 0.0077  0.0732  34  ASP A C   
86   O O   . ASP A 17  ? 0.6127 0.7075 0.5013 -0.0306 0.0053  0.0712  34  ASP A O   
87   C CB  . ASP A 17  ? 0.5891 0.6677 0.4779 -0.0338 0.0098  0.0773  34  ASP A CB  
88   C CG  . ASP A 17  ? 0.5966 0.6762 0.4942 -0.0291 0.0036  0.0787  34  ASP A CG  
89   O OD1 . ASP A 17  ? 0.6264 0.7137 0.5287 -0.0264 0.0021  0.0762  34  ASP A OD1 
90   O OD2 . ASP A 17  ? 0.5933 0.6664 0.4944 -0.0282 0.0002  0.0824  34  ASP A OD2 
91   N N   . SER A 18  ? 0.6618 0.7445 0.5304 -0.0360 0.0065  0.0766  35  SER A N   
92   C CA  . SER A 18  ? 0.6816 0.7647 0.5429 -0.0355 0.0010  0.0772  35  SER A CA  
93   C C   . SER A 18  ? 0.6530 0.7444 0.5196 -0.0347 0.0015  0.0713  35  SER A C   
94   O O   . SER A 18  ? 0.6151 0.7099 0.4880 -0.0323 -0.0037 0.0714  35  SER A O   
95   C CB  . SER A 18  ? 0.7202 0.7967 0.5633 -0.0390 0.0018  0.0800  35  SER A CB  
96   O OG  . SER A 18  ? 0.7757 0.8527 0.6109 -0.0381 -0.0038 0.0789  35  SER A OG  
97   N N   . ILE A 19  ? 0.6810 0.7754 0.5464 -0.0368 0.0075  0.0663  36  ILE A N   
98   C CA  . ILE A 19  ? 0.6891 0.7902 0.5594 -0.0363 0.0074  0.0605  36  ILE A CA  
99   C C   . ILE A 19  ? 0.7232 0.8301 0.6076 -0.0333 0.0063  0.0598  36  ILE A C   
100  O O   . ILE A 19  ? 0.7578 0.8690 0.6477 -0.0322 0.0029  0.0584  36  ILE A O   
101  C CB  . ILE A 19  ? 0.7028 0.8059 0.5709 -0.0389 0.0142  0.0547  36  ILE A CB  
102  C CG1 . ILE A 19  ? 0.6916 0.7906 0.5446 -0.0422 0.0172  0.0551  36  ILE A CG1 
103  C CG2 . ILE A 19  ? 0.6842 0.7935 0.5594 -0.0380 0.0129  0.0485  36  ILE A CG2 
104  N N   . ILE A 20  ? 0.7113 0.8184 0.6016 -0.0321 0.0092  0.0607  37  ILE A N   
105  C CA  . ILE A 20  ? 0.7054 0.8185 0.6067 -0.0288 0.0086  0.0603  37  ILE A CA  
106  C C   . ILE A 20  ? 0.7104 0.8249 0.6157 -0.0269 0.0032  0.0647  37  ILE A C   
107  O O   . ILE A 20  ? 0.7040 0.8237 0.6155 -0.0260 0.0011  0.0649  37  ILE A O   
108  C CB  . ILE A 20  ? 0.7063 0.8192 0.6125 -0.0270 0.0118  0.0595  37  ILE A CB  
109  C CG1 . ILE A 20  ? 0.7048 0.8171 0.6105 -0.0287 0.0167  0.0544  37  ILE A CG1 
110  C CG2 . ILE A 20  ? 0.6676 0.7872 0.5828 -0.0230 0.0113  0.0593  37  ILE A CG2 
111  C CD1 . ILE A 20  ? 0.7229 0.8316 0.6318 -0.0283 0.0191  0.0540  37  ILE A CD1 
112  N N   . ARG A 21  ? 0.6947 0.8043 0.5978 -0.0265 0.0007  0.0684  38  ARG A N   
113  C CA  . ARG A 21  ? 0.6771 0.7883 0.5868 -0.0242 -0.0045 0.0720  38  ARG A CA  
114  C C   . ARG A 21  ? 0.6811 0.7940 0.5908 -0.0250 -0.0092 0.0722  38  ARG A C   
115  O O   . ARG A 21  ? 0.7257 0.8449 0.6463 -0.0236 -0.0110 0.0732  38  ARG A O   
116  C CB  . ARG A 21  ? 0.6782 0.7822 0.5848 -0.0236 -0.0078 0.0757  38  ARG A CB  
117  C CG  . ARG A 21  ? 0.6906 0.7928 0.6004 -0.0225 -0.0041 0.0751  38  ARG A CG  
118  C CD  . ARG A 21  ? 0.7112 0.8052 0.6196 -0.0220 -0.0085 0.0794  38  ARG A CD  
119  N NE  . ARG A 21  ? 0.7454 0.8430 0.6658 -0.0181 -0.0132 0.0804  38  ARG A NE  
120  C CZ  . ARG A 21  ? 0.7541 0.8540 0.6855 -0.0146 -0.0128 0.0790  38  ARG A CZ  
121  N NH1 . ARG A 21  ? 0.7467 0.8448 0.6790 -0.0145 -0.0087 0.0766  38  ARG A NH1 
122  N NH2 . ARG A 21  ? 0.7637 0.8684 0.7069 -0.0111 -0.0167 0.0794  38  ARG A NH2 
123  N N   . THR A 22  ? 0.6735 0.7816 0.5721 -0.0274 -0.0108 0.0709  39  THR A N   
124  C CA  . THR A 22  ? 0.6740 0.7832 0.5736 -0.0276 -0.0169 0.0701  39  THR A CA  
125  C C   . THR A 22  ? 0.6486 0.7638 0.5551 -0.0282 -0.0156 0.0666  39  THR A C   
126  O O   . THR A 22  ? 0.6237 0.7425 0.5401 -0.0276 -0.0202 0.0675  39  THR A O   
127  C CB  . THR A 22  ? 0.6837 0.7860 0.5683 -0.0289 -0.0213 0.0696  39  THR A CB  
128  O OG1 . THR A 22  ? 0.6737 0.7780 0.5560 -0.0300 -0.0225 0.0644  39  THR A OG1 
129  C CG2 . THR A 22  ? 0.6872 0.7831 0.5576 -0.0308 -0.0168 0.0706  39  THR A CG2 
130  N N   . HIS A 23  ? 0.6547 0.7707 0.5576 -0.0295 -0.0099 0.0628  40  HIS A N   
131  C CA  . HIS A 23  ? 0.6802 0.8005 0.5891 -0.0300 -0.0098 0.0592  40  HIS A CA  
132  C C   . HIS A 23  ? 0.6773 0.8031 0.5956 -0.0288 -0.0063 0.0601  40  HIS A C   
133  O O   . HIS A 23  ? 0.6753 0.8045 0.6016 -0.0289 -0.0087 0.0603  40  HIS A O   
134  C CB  . HIS A 23  ? 0.7129 0.8312 0.6132 -0.0319 -0.0069 0.0531  40  HIS A CB  
135  C CG  . HIS A 23  ? 0.7497 0.8643 0.6400 -0.0328 -0.0106 0.0509  40  HIS A CG  
136  N ND1 . HIS A 23  ? 0.7652 0.8806 0.6594 -0.0323 -0.0177 0.0490  40  HIS A ND1 
137  C CD2 . HIS A 23  ? 0.7839 0.8940 0.6599 -0.0342 -0.0084 0.0502  40  HIS A CD2 
138  C CE1 . HIS A 23  ? 0.7990 0.9108 0.6809 -0.0326 -0.0201 0.0464  40  HIS A CE1 
139  N NE2 . HIS A 23  ? 0.8165 0.9250 0.6861 -0.0340 -0.0140 0.0476  40  HIS A NE2 
140  N N   . HIS A 24  ? 0.6671 0.7933 0.5842 -0.0277 -0.0013 0.0605  41  HIS A N   
141  C CA  . HIS A 24  ? 0.6694 0.8004 0.5921 -0.0261 0.0020  0.0600  41  HIS A CA  
142  C C   . HIS A 24  ? 0.6515 0.7879 0.5816 -0.0235 0.0027  0.0647  41  HIS A C   
143  O O   . HIS A 24  ? 0.6643 0.8055 0.5981 -0.0222 0.0046  0.0653  41  HIS A O   
144  C CB  . HIS A 24  ? 0.6708 0.7998 0.5889 -0.0260 0.0069  0.0558  41  HIS A CB  
145  C CG  . HIS A 24  ? 0.6763 0.8031 0.5906 -0.0283 0.0079  0.0502  41  HIS A CG  
146  N ND1 . HIS A 24  ? 0.6896 0.8186 0.6078 -0.0284 0.0064  0.0471  41  HIS A ND1 
147  C CD2 . HIS A 24  ? 0.6747 0.7975 0.5825 -0.0305 0.0106  0.0471  41  HIS A CD2 
148  C CE1 . HIS A 24  ? 0.6691 0.7963 0.5844 -0.0303 0.0080  0.0413  41  HIS A CE1 
149  N NE2 . HIS A 24  ? 0.6502 0.7740 0.5588 -0.0317 0.0112  0.0414  41  HIS A NE2 
150  N N   . THR A 25  ? 0.6834 0.8191 0.6152 -0.0226 0.0012  0.0676  42  THR A N   
151  C CA  . THR A 25  ? 0.6737 0.8156 0.6142 -0.0200 0.0021  0.0713  42  THR A CA  
152  C C   . THR A 25  ? 0.6900 0.8384 0.6398 -0.0205 0.0009  0.0750  42  THR A C   
153  O O   . THR A 25  ? 0.7128 0.8595 0.6652 -0.0227 -0.0035 0.0760  42  THR A O   
154  C CB  . THR A 25  ? 0.6937 0.8327 0.6362 -0.0193 -0.0013 0.0734  42  THR A CB  
155  O OG1 . THR A 25  ? 0.7000 0.8368 0.6402 -0.0172 0.0011  0.0718  42  THR A OG1 
156  C CG2 . THR A 25  ? 0.7140 0.8598 0.6694 -0.0179 -0.0031 0.0773  42  THR A CG2 
157  N N   . PHE A 26  ? 0.6874 0.8435 0.6426 -0.0183 0.0051  0.0772  43  PHE A N   
158  C CA  . PHE A 26  ? 0.6691 0.8323 0.6350 -0.0190 0.0049  0.0826  43  PHE A CA  
159  C C   . PHE A 26  ? 0.6798 0.8506 0.6544 -0.0164 0.0079  0.0849  43  PHE A C   
160  O O   . PHE A 26  ? 0.7445 0.9177 0.7157 -0.0132 0.0121  0.0823  43  PHE A O   
161  C CB  . PHE A 26  ? 0.6421 0.8088 0.6062 -0.0193 0.0080  0.0842  43  PHE A CB  
162  C CG  . PHE A 26  ? 0.6101 0.7705 0.5690 -0.0216 0.0045  0.0816  43  PHE A CG  
163  C CD1 . PHE A 26  ? 0.5910 0.7500 0.5569 -0.0245 -0.0004 0.0840  43  PHE A CD1 
164  C CD2 . PHE A 26  ? 0.5954 0.7515 0.5445 -0.0208 0.0059  0.0759  43  PHE A CD2 
165  C CE1 . PHE A 26  ? 0.5904 0.7439 0.5529 -0.0262 -0.0039 0.0804  43  PHE A CE1 
166  C CE2 . PHE A 26  ? 0.5859 0.7371 0.5320 -0.0227 0.0029  0.0726  43  PHE A CE2 
167  C CZ  . PHE A 26  ? 0.5979 0.7479 0.5505 -0.0252 -0.0019 0.0746  43  PHE A CZ  
168  N N   . PRO A 27  ? 0.6769 0.8521 0.6645 -0.0176 0.0056  0.0892  44  PRO A N   
169  C CA  . PRO A 27  ? 0.7026 0.8866 0.7010 -0.0150 0.0090  0.0909  44  PRO A CA  
170  C C   . PRO A 27  ? 0.7303 0.9252 0.7303 -0.0136 0.0172  0.0936  44  PRO A C   
171  O O   . PRO A 27  ? 0.7264 0.9243 0.7285 -0.0162 0.0186  0.0986  44  PRO A O   
172  C CB  . PRO A 27  ? 0.6820 0.8672 0.6952 -0.0172 0.0036  0.0945  44  PRO A CB  
173  C CG  . PRO A 27  ? 0.6742 0.8549 0.6860 -0.0210 -0.0003 0.0964  44  PRO A CG  
174  C CD  . PRO A 27  ? 0.6680 0.8408 0.6627 -0.0210 -0.0001 0.0920  44  PRO A CD  
175  N N   . ARG A 28  ? 0.7655 0.9657 0.7641 -0.0094 0.0222  0.0904  45  ARG A N   
176  C CA  . ARG A 28  ? 0.8235 1.0353 0.8224 -0.0071 0.0305  0.0921  45  ARG A CA  
177  C C   . ARG A 28  ? 0.8474 1.0687 0.8606 -0.0099 0.0332  0.0998  45  ARG A C   
178  O O   . ARG A 28  ? 0.8593 1.0826 0.8874 -0.0110 0.0303  0.1013  45  ARG A O   
179  C CB  . ARG A 28  ? 0.8411 1.0585 0.8417 -0.0017 0.0341  0.0862  45  ARG A CB  
180  C CG  . ARG A 28  ? 0.8630 1.0950 0.8658 0.0014  0.0432  0.0871  45  ARG A CG  
181  C CD  . ARG A 28  ? 0.8595 1.0953 0.8601 0.0078  0.0460  0.0786  45  ARG A CD  
182  N NE  . ARG A 28  ? 0.8755 1.1098 0.8596 0.0106  0.0484  0.0744  45  ARG A NE  
183  N N   . SER A 29  ? 0.9002 1.1267 0.9092 -0.0113 0.0382  0.1052  46  SER A N   
184  C CA  . SER A 29  ? 0.9057 1.1427 0.9279 -0.0141 0.0430  0.1137  46  SER A CA  
185  C C   . SER A 29  ? 0.9105 1.1587 0.9242 -0.0109 0.0532  0.1150  46  SER A C   
186  O O   . SER A 29  ? 0.9203 1.1656 0.9177 -0.0072 0.0542  0.1095  46  SER A O   
187  C CB  . SER A 29  ? 0.9111 1.1425 0.9355 -0.0196 0.0386  0.1208  46  SER A CB  
188  O OG  . SER A 29  ? 0.9269 1.1454 0.9498 -0.0213 0.0288  0.1168  46  SER A OG  
189  N N   . PRO A 30  ? 0.9326 1.1941 0.9574 -0.0122 0.0608  0.1220  47  PRO A N   
190  C CA  . PRO A 30  ? 0.8877 1.1601 0.9011 -0.0092 0.0710  0.1236  47  PRO A CA  
191  C C   . PRO A 30  ? 0.8529 1.1190 0.8492 -0.0109 0.0701  0.1287  47  PRO A C   
192  O O   . PRO A 30  ? 0.8253 1.0844 0.8262 -0.0162 0.0650  0.1356  47  PRO A O   
193  C CB  . PRO A 30  ? 0.9031 1.1907 0.9342 -0.0116 0.0795  0.1315  47  PRO A CB  
194  C CG  . PRO A 30  ? 0.9186 1.2007 0.9690 -0.0175 0.0723  0.1367  47  PRO A CG  
195  C CD  . PRO A 30  ? 0.9277 1.1956 0.9758 -0.0162 0.0610  0.1281  47  PRO A CD  
196  N N   . ASN A 31  ? 0.8356 1.1036 0.8130 -0.0061 0.0740  0.1245  48  ASN A N   
197  C CA  . ASN A 31  ? 0.8431 1.1052 0.8028 -0.0066 0.0725  0.1285  48  ASN A CA  
198  C C   . ASN A 31  ? 0.8024 1.0480 0.7588 -0.0092 0.0615  0.1264  48  ASN A C   
199  O O   . ASN A 31  ? 0.7978 1.0377 0.7485 -0.0122 0.0584  0.1328  48  ASN A O   
200  C CB  . ASN A 31  ? 0.8869 1.1570 0.8486 -0.0108 0.0790  0.1423  48  ASN A CB  
201  C CG  . ASN A 31  ? 0.9198 1.2064 0.8756 -0.0070 0.0913  0.1436  48  ASN A CG  
202  O OD1 . ASN A 31  ? 0.9639 1.2524 0.8996 -0.0017 0.0941  0.1394  48  ASN A OD1 
203  N ND2 . ASN A 31  ? 0.9167 1.2160 0.8905 -0.0094 0.0988  0.1489  48  ASN A ND2 
204  N N   . THR A 32  ? 0.7707 1.0089 0.7306 -0.0080 0.0557  0.1173  49  THR A N   
205  C CA  . THR A 32  ? 0.7494 0.9734 0.7046 -0.0096 0.0466  0.1132  49  THR A CA  
206  C C   . THR A 32  ? 0.7368 0.9559 0.6804 -0.0047 0.0450  0.1022  49  THR A C   
207  O O   . THR A 32  ? 0.7531 0.9775 0.6969 -0.0004 0.0485  0.0964  49  THR A O   
208  C CB  . THR A 32  ? 0.7084 0.9259 0.6778 -0.0136 0.0401  0.1131  49  THR A CB  
209  O OG1 . THR A 32  ? 0.7126 0.9343 0.6907 -0.0115 0.0416  0.1086  49  THR A OG1 
210  C CG2 . THR A 32  ? 0.7014 0.9211 0.6835 -0.0190 0.0393  0.1234  49  THR A CG2 
211  N N   . CYS A 33  ? 0.7344 0.9433 0.6695 -0.0053 0.0392  0.0992  50  CYS A N   
212  C CA  . CYS A 33  ? 0.6983 0.9018 0.6239 -0.0013 0.0371  0.0891  50  CYS A CA  
213  C C   . CYS A 33  ? 0.6632 0.8559 0.5935 -0.0045 0.0306  0.0853  50  CYS A C   
214  O O   . CYS A 33  ? 0.6559 0.8435 0.5895 -0.0087 0.0264  0.0891  50  CYS A O   
215  C CB  . CYS A 33  ? 0.6706 0.8722 0.5823 0.0008  0.0361  0.0886  50  CYS A CB  
216  S SG  . CYS A 33  ? 0.6397 0.8354 0.5423 0.0059  0.0331  0.0757  50  CYS A SG  
217  N N   . THR A 34  ? 0.6581 0.8477 0.5892 -0.0026 0.0299  0.0780  51  THR A N   
218  C CA  . THR A 34  ? 0.6678 0.8477 0.6012 -0.0056 0.0249  0.0744  51  THR A CA  
219  C C   . THR A 34  ? 0.6557 0.8307 0.5832 -0.0028 0.0242  0.0658  51  THR A C   
220  O O   . THR A 34  ? 0.6455 0.8246 0.5706 0.0016  0.0270  0.0618  51  THR A O   
221  C CB  . THR A 34  ? 0.6875 0.8669 0.6305 -0.0077 0.0237  0.0764  51  THR A CB  
222  O OG1 . THR A 34  ? 0.7053 0.8757 0.6482 -0.0110 0.0188  0.0744  51  THR A OG1 
223  C CG2 . THR A 34  ? 0.6925 0.8747 0.6378 -0.0040 0.0260  0.0724  51  THR A CG2 
224  N N   . SER A 35  ? 0.6624 0.8291 0.5886 -0.0054 0.0206  0.0624  52  SER A N   
225  C CA  . SER A 35  ? 0.6712 0.8327 0.5941 -0.0038 0.0200  0.0546  52  SER A CA  
226  C C   . SER A 35  ? 0.6386 0.7923 0.5625 -0.0080 0.0173  0.0523  52  SER A C   
227  O O   . SER A 35  ? 0.6021 0.7542 0.5275 -0.0114 0.0150  0.0554  52  SER A O   
228  C CB  . SER A 35  ? 0.6951 0.8580 0.6118 -0.0005 0.0197  0.0508  52  SER A CB  
229  O OG  . SER A 35  ? 0.7180 0.8764 0.6343 0.0011  0.0187  0.0426  52  SER A OG  
230  N N   . LEU A 36  ? 0.6366 0.7858 0.5602 -0.0076 0.0176  0.0465  53  LEU A N   
231  C CA  . LEU A 36  ? 0.6449 0.7877 0.5688 -0.0114 0.0166  0.0435  53  LEU A CA  
232  C C   . LEU A 36  ? 0.6402 0.7808 0.5643 -0.0099 0.0168  0.0362  53  LEU A C   
233  O O   . LEU A 36  ? 0.6387 0.7804 0.5637 -0.0063 0.0176  0.0330  53  LEU A O   
234  C CB  . LEU A 36  ? 0.6573 0.7961 0.5820 -0.0135 0.0173  0.0451  53  LEU A CB  
235  C CG  . LEU A 36  ? 0.6442 0.7770 0.5671 -0.0179 0.0173  0.0437  53  LEU A CG  
236  C CD1 . LEU A 36  ? 0.6816 0.8113 0.6033 -0.0192 0.0168  0.0481  53  LEU A CD1 
237  C CD2 . LEU A 36  ? 0.6517 0.7812 0.5759 -0.0184 0.0193  0.0376  53  LEU A CD2 
238  N N   . ILE A 37  ? 0.6283 0.7661 0.5532 -0.0124 0.0156  0.0329  54  ILE A N   
239  C CA  . ILE A 37  ? 0.6298 0.7655 0.5577 -0.0116 0.0154  0.0253  54  ILE A CA  
240  C C   . ILE A 37  ? 0.6293 0.7609 0.5599 -0.0164 0.0173  0.0229  54  ILE A C   
241  O O   . ILE A 37  ? 0.6189 0.7501 0.5479 -0.0194 0.0169  0.0252  54  ILE A O   
242  C CB  . ILE A 37  ? 0.6227 0.7601 0.5500 -0.0095 0.0118  0.0229  54  ILE A CB  
243  C CG1 . ILE A 37  ? 0.6120 0.7535 0.5346 -0.0042 0.0108  0.0242  54  ILE A CG1 
244  C CG2 . ILE A 37  ? 0.6388 0.7735 0.5717 -0.0098 0.0107  0.0144  54  ILE A CG2 
245  N N   . ALA A 38  ? 0.6491 0.7781 0.5843 -0.0170 0.0195  0.0180  55  ALA A N   
246  C CA  . ALA A 38  ? 0.6333 0.7591 0.5710 -0.0220 0.0230  0.0161  55  ALA A CA  
247  C C   . ALA A 38  ? 0.6412 0.7670 0.5874 -0.0223 0.0235  0.0078  55  ALA A C   
248  O O   . ALA A 38  ? 0.6562 0.7814 0.6082 -0.0198 0.0227  0.0037  55  ALA A O   
249  C CB  . ALA A 38  ? 0.6207 0.7428 0.5580 -0.0235 0.0259  0.0196  55  ALA A CB  
250  N N   . HIS A 39  ? 0.6677 0.7943 0.6162 -0.0253 0.0247  0.0044  56  HIS A N   
251  C CA  . HIS A 39  ? 0.6838 0.8113 0.6429 -0.0255 0.0248  -0.0041 56  HIS A CA  
252  C C   . HIS A 39  ? 0.6846 0.8124 0.6480 -0.0308 0.0308  -0.0070 56  HIS A C   
253  O O   . HIS A 39  ? 0.7597 0.8886 0.7179 -0.0333 0.0322  -0.0056 56  HIS A O   
254  C CB  . HIS A 39  ? 0.6940 0.8237 0.6551 -0.0223 0.0188  -0.0080 56  HIS A CB  
255  C CG  . HIS A 39  ? 0.7247 0.8549 0.6973 -0.0204 0.0165  -0.0172 56  HIS A CG  
256  N ND1 . HIS A 39  ? 0.7413 0.8731 0.7244 -0.0231 0.0183  -0.0244 56  HIS A ND1 
257  C CD2 . HIS A 39  ? 0.7302 0.8598 0.7061 -0.0158 0.0122  -0.0210 56  HIS A CD2 
258  C CE1 . HIS A 39  ? 0.7344 0.8663 0.7282 -0.0205 0.0148  -0.0321 56  HIS A CE1 
259  N NE2 . HIS A 39  ? 0.7391 0.8694 0.7281 -0.0159 0.0106  -0.0303 56  HIS A NE2 
260  N N   . ARG A 40  ? 0.6753 0.8026 0.6489 -0.0324 0.0342  -0.0115 57  ARG A N   
261  C CA  . ARG A 40  ? 0.6884 0.8170 0.6678 -0.0379 0.0414  -0.0143 57  ARG A CA  
262  C C   . ARG A 40  ? 0.6860 0.8190 0.6762 -0.0377 0.0406  -0.0239 57  ARG A C   
263  O O   . ARG A 40  ? 0.7284 0.8621 0.7282 -0.0340 0.0353  -0.0301 57  ARG A O   
264  C CB  . ARG A 40  ? 0.6926 0.8187 0.6813 -0.0402 0.0456  -0.0145 57  ARG A CB  
265  C CG  . ARG A 40  ? 0.7340 0.8550 0.7135 -0.0414 0.0472  -0.0051 57  ARG A CG  
266  C CD  . ARG A 40  ? 0.7638 0.8816 0.7538 -0.0450 0.0518  -0.0043 57  ARG A CD  
267  N NE  . ARG A 40  ? 0.7953 0.9073 0.7792 -0.0444 0.0503  0.0036  57  ARG A NE  
268  C CZ  . ARG A 40  ? 0.7967 0.9069 0.7828 -0.0389 0.0440  0.0029  57  ARG A CZ  
269  N NH1 . ARG A 40  ? 0.8054 0.9188 0.7976 -0.0336 0.0386  -0.0048 57  ARG A NH1 
270  N NH2 . ARG A 40  ? 0.8123 0.9175 0.7941 -0.0385 0.0428  0.0097  57  ARG A NH2 
271  N N   . VAL A 41  ? 0.6735 0.8098 0.6625 -0.0415 0.0457  -0.0257 58  VAL A N   
272  C CA  . VAL A 41  ? 0.6508 0.7923 0.6524 -0.0420 0.0463  -0.0358 58  VAL A CA  
273  C C   . VAL A 41  ? 0.6867 0.8315 0.6934 -0.0479 0.0570  -0.0378 58  VAL A C   
274  O O   . VAL A 41  ? 0.7366 0.8805 0.7306 -0.0514 0.0629  -0.0311 58  VAL A O   
275  C CB  . VAL A 41  ? 0.6395 0.7831 0.6351 -0.0407 0.0426  -0.0374 58  VAL A CB  
276  C CG1 . VAL A 41  ? 0.6320 0.7810 0.6429 -0.0405 0.0422  -0.0491 58  VAL A CG1 
277  C CG2 . VAL A 41  ? 0.6436 0.7838 0.6319 -0.0359 0.0332  -0.0325 58  VAL A CG2 
278  N N   . ASP A 42  ? 0.7254 0.8743 0.7505 -0.0489 0.0596  -0.0468 59  ASP A N   
279  C CA  . ASP A 42  ? 0.7538 0.9074 0.7860 -0.0551 0.0713  -0.0489 59  ASP A CA  
280  C C   . ASP A 42  ? 0.7216 0.8824 0.7532 -0.0563 0.0749  -0.0555 59  ASP A C   
281  O O   . ASP A 42  ? 0.7194 0.8868 0.7683 -0.0570 0.0775  -0.0660 59  ASP A O   
282  C CB  . ASP A 42  ? 0.7774 0.9328 0.8325 -0.0562 0.0730  -0.0558 59  ASP A CB  
283  C CG  . ASP A 42  ? 0.8131 0.9614 0.8695 -0.0549 0.0695  -0.0500 59  ASP A CG  
284  O OD1 . ASP A 42  ? 0.8020 0.9460 0.8469 -0.0581 0.0740  -0.0399 59  ASP A OD1 
285  O OD2 . ASP A 42  ? 0.7974 0.9444 0.8661 -0.0504 0.0616  -0.0560 59  ASP A OD2 
286  N N   . ALA A 43  ? 0.6893 0.8488 0.7018 -0.0562 0.0745  -0.0500 60  ALA A N   
287  C CA  . ALA A 43  ? 0.6778 0.8436 0.6873 -0.0568 0.0772  -0.0563 60  ALA A CA  
288  C C   . ALA A 43  ? 0.6911 0.8540 0.6774 -0.0579 0.0787  -0.0476 60  ALA A C   
289  O O   . ALA A 43  ? 0.6890 0.8447 0.6637 -0.0564 0.0734  -0.0381 60  ALA A O   
290  C CB  . ALA A 43  ? 0.6694 0.8365 0.6877 -0.0514 0.0667  -0.0645 60  ALA A CB  
291  N N   . PRO A 44  ? 0.7177 0.8866 0.6975 -0.0604 0.0858  -0.0515 61  PRO A N   
292  C CA  . PRO A 44  ? 0.7093 0.8757 0.6661 -0.0613 0.0868  -0.0444 61  PRO A CA  
293  C C   . PRO A 44  ? 0.7002 0.8630 0.6506 -0.0563 0.0748  -0.0437 61  PRO A C   
294  O O   . PRO A 44  ? 0.7230 0.8877 0.6859 -0.0526 0.0674  -0.0512 61  PRO A O   
295  C CB  . PRO A 44  ? 0.7433 0.9190 0.6980 -0.0640 0.0966  -0.0524 61  PRO A CB  
296  C CG  . PRO A 44  ? 0.7361 0.9196 0.7150 -0.0632 0.0977  -0.0655 61  PRO A CG  
297  C CD  . PRO A 44  ? 0.7210 0.9000 0.7146 -0.0629 0.0945  -0.0627 61  PRO A CD  
298  N N   . ALA A 45  ? 0.6795 0.8369 0.6112 -0.0564 0.0727  -0.0344 62  ALA A N   
299  C CA  . ALA A 45  ? 0.6672 0.8202 0.5940 -0.0522 0.0614  -0.0312 62  ALA A CA  
300  C C   . ALA A 45  ? 0.6747 0.8322 0.6069 -0.0493 0.0558  -0.0411 62  ALA A C   
301  O O   . ALA A 45  ? 0.6991 0.8540 0.6369 -0.0457 0.0457  -0.0409 62  ALA A O   
302  C CB  . ALA A 45  ? 0.6731 0.8205 0.5802 -0.0531 0.0607  -0.0208 62  ALA A CB  
303  N N   . HIS A 46  ? 0.6928 0.8572 0.6238 -0.0507 0.0621  -0.0497 63  HIS A N   
304  C CA  . HIS A 46  ? 0.6789 0.8474 0.6151 -0.0475 0.0559  -0.0599 63  HIS A CA  
305  C C   . HIS A 46  ? 0.6449 0.8156 0.6037 -0.0449 0.0504  -0.0683 63  HIS A C   
306  O O   . HIS A 46  ? 0.6308 0.8010 0.5970 -0.0414 0.0407  -0.0731 63  HIS A O   
307  C CB  . HIS A 46  ? 0.6929 0.8690 0.6211 -0.0490 0.0642  -0.0682 63  HIS A CB  
308  C CG  . HIS A 46  ? 0.6942 0.8789 0.6345 -0.0517 0.0751  -0.0768 63  HIS A CG  
309  N ND1 . HIS A 46  ? 0.7180 0.9052 0.6503 -0.0567 0.0882  -0.0724 63  HIS A ND1 
310  C CD2 . HIS A 46  ? 0.6958 0.8874 0.6575 -0.0502 0.0747  -0.0895 63  HIS A CD2 
311  C CE1 . HIS A 46  ? 0.7188 0.9147 0.6675 -0.0584 0.0963  -0.0821 63  HIS A CE1 
312  N NE2 . HIS A 46  ? 0.7132 0.9119 0.6803 -0.0543 0.0880  -0.0930 63  HIS A NE2 
313  N N   . ALA A 47  ? 0.6130 0.7854 0.5832 -0.0466 0.0558  -0.0695 64  ALA A N   
314  C CA  . ALA A 47  ? 0.5933 0.7675 0.5849 -0.0441 0.0503  -0.0778 64  ALA A CA  
315  C C   . ALA A 47  ? 0.5925 0.7588 0.5857 -0.0406 0.0383  -0.0709 64  ALA A C   
316  O O   . ALA A 47  ? 0.5790 0.7448 0.5844 -0.0372 0.0292  -0.0764 64  ALA A O   
317  C CB  . ALA A 47  ? 0.5800 0.7575 0.5833 -0.0467 0.0586  -0.0805 64  ALA A CB  
318  N N   . ILE A 48  ? 0.6028 0.7631 0.5838 -0.0414 0.0386  -0.0588 65  ILE A N   
319  C CA  . ILE A 48  ? 0.5939 0.7479 0.5749 -0.0384 0.0291  -0.0514 65  ILE A CA  
320  C C   . ILE A 48  ? 0.5954 0.7469 0.5700 -0.0366 0.0213  -0.0480 65  ILE A C   
321  O O   . ILE A 48  ? 0.6390 0.7873 0.6191 -0.0338 0.0121  -0.0458 65  ILE A O   
322  C CB  . ILE A 48  ? 0.5795 0.7290 0.5510 -0.0395 0.0322  -0.0406 65  ILE A CB  
323  C CG1 . ILE A 48  ? 0.5637 0.7148 0.5440 -0.0412 0.0388  -0.0438 65  ILE A CG1 
324  C CG2 . ILE A 48  ? 0.5717 0.7162 0.5421 -0.0361 0.0232  -0.0335 65  ILE A CG2 
325  C CD1 . ILE A 48  ? 0.5703 0.7170 0.5425 -0.0425 0.0422  -0.0343 65  ILE A CD1 
326  N N   . TRP A 49  ? 0.5951 0.7478 0.5582 -0.0382 0.0247  -0.0473 66  TRP A N   
327  C CA  . TRP A 49  ? 0.5934 0.7436 0.5511 -0.0366 0.0170  -0.0443 66  TRP A CA  
328  C C   . TRP A 49  ? 0.5741 0.7265 0.5456 -0.0341 0.0092  -0.0541 66  TRP A C   
329  O O   . TRP A 49  ? 0.5444 0.6934 0.5188 -0.0321 -0.0001 -0.0511 66  TRP A O   
330  C CB  . TRP A 49  ? 0.6236 0.7746 0.5650 -0.0387 0.0223  -0.0426 66  TRP A CB  
331  C CG  . TRP A 49  ? 0.6322 0.7812 0.5686 -0.0370 0.0144  -0.0413 66  TRP A CG  
332  C CD1 . TRP A 49  ? 0.6269 0.7793 0.5616 -0.0360 0.0127  -0.0501 66  TRP A CD1 
333  C CD2 . TRP A 49  ? 0.6500 0.7936 0.5841 -0.0358 0.0069  -0.0314 66  TRP A CD2 
334  N NE1 . TRP A 49  ? 0.6534 0.8021 0.5855 -0.0343 0.0036  -0.0463 66  TRP A NE1 
335  C CE2 . TRP A 49  ? 0.6678 0.8113 0.6000 -0.0344 0.0003  -0.0344 66  TRP A CE2 
336  C CE3 . TRP A 49  ? 0.6571 0.7967 0.5914 -0.0356 0.0053  -0.0209 66  TRP A CE3 
337  C CZ2 . TRP A 49  ? 0.6762 0.8155 0.6085 -0.0334 -0.0078 -0.0267 66  TRP A CZ2 
338  C CZ3 . TRP A 49  ? 0.6594 0.7957 0.5927 -0.0346 -0.0016 -0.0132 66  TRP A CZ3 
339  C CH2 . TRP A 49  ? 0.6786 0.8146 0.6117 -0.0337 -0.0082 -0.0158 66  TRP A CH2 
340  N N   . ARG A 50  ? 0.5889 0.7470 0.5707 -0.0341 0.0129  -0.0658 67  ARG A N   
341  C CA  . ARG A 50  ? 0.6099 0.7699 0.6072 -0.0313 0.0049  -0.0762 67  ARG A CA  
342  C C   . ARG A 50  ? 0.6360 0.7896 0.6419 -0.0289 -0.0063 -0.0701 67  ARG A C   
343  O O   . ARG A 50  ? 0.6728 0.8242 0.6858 -0.0269 -0.0160 -0.0717 67  ARG A O   
344  C CB  . ARG A 50  ? 0.6232 0.7902 0.6342 -0.0314 0.0103  -0.0890 67  ARG A CB  
345  C CG  . ARG A 50  ? 0.6454 0.8138 0.6759 -0.0280 0.0007  -0.1003 67  ARG A CG  
346  N N   . PHE A 51  ? 0.6147 0.7653 0.6198 -0.0291 -0.0050 -0.0631 68  PHE A N   
347  C CA  . PHE A 51  ? 0.5643 0.7094 0.5755 -0.0267 -0.0145 -0.0570 68  PHE A CA  
348  C C   . PHE A 51  ? 0.5620 0.7022 0.5619 -0.0270 -0.0175 -0.0435 68  PHE A C   
349  O O   . PHE A 51  ? 0.5594 0.6959 0.5641 -0.0256 -0.0265 -0.0392 68  PHE A O   
350  C CB  . PHE A 51  ? 0.5440 0.6887 0.5592 -0.0260 -0.0123 -0.0571 68  PHE A CB  
351  C CG  . PHE A 51  ? 0.5128 0.6623 0.5430 -0.0255 -0.0105 -0.0707 68  PHE A CG  
352  C CD1 . PHE A 51  ? 0.5004 0.6499 0.5460 -0.0230 -0.0194 -0.0792 68  PHE A CD1 
353  C CD2 . PHE A 51  ? 0.4985 0.6526 0.5292 -0.0277 -0.0002 -0.0750 68  PHE A CD2 
354  C CE1 . PHE A 51  ? 0.4958 0.6505 0.5573 -0.0222 -0.0179 -0.0926 68  PHE A CE1 
355  C CE2 . PHE A 51  ? 0.4936 0.6532 0.5405 -0.0275 0.0019  -0.0877 68  PHE A CE2 
356  C CZ  . PHE A 51  ? 0.4924 0.6527 0.5549 -0.0246 -0.0068 -0.0970 68  PHE A CZ  
357  N N   . VAL A 52  ? 0.5447 0.6851 0.5310 -0.0290 -0.0100 -0.0368 69  VAL A N   
358  C CA  . VAL A 52  ? 0.5474 0.6843 0.5246 -0.0291 -0.0121 -0.0244 69  VAL A CA  
359  C C   . VAL A 52  ? 0.5813 0.7169 0.5609 -0.0289 -0.0194 -0.0231 69  VAL A C   
360  O O   . VAL A 52  ? 0.5849 0.7173 0.5659 -0.0283 -0.0252 -0.0144 69  VAL A O   
361  C CB  . VAL A 52  ? 0.5532 0.6906 0.5168 -0.0312 -0.0037 -0.0192 69  VAL A CB  
362  C CG1 . VAL A 52  ? 0.5529 0.6875 0.5093 -0.0312 -0.0064 -0.0080 69  VAL A CG1 
363  C CG2 . VAL A 52  ? 0.5490 0.6867 0.5117 -0.0314 0.0024  -0.0191 69  VAL A CG2 
364  N N   . ARG A 53  ? 0.6116 0.7499 0.5923 -0.0293 -0.0189 -0.0322 70  ARG A N   
365  C CA  . ARG A 53  ? 0.6232 0.7606 0.6069 -0.0287 -0.0262 -0.0335 70  ARG A CA  
366  C C   . ARG A 53  ? 0.6196 0.7551 0.6204 -0.0268 -0.0368 -0.0380 70  ARG A C   
367  O O   . ARG A 53  ? 0.6353 0.7691 0.6415 -0.0263 -0.0445 -0.0382 70  ARG A O   
368  C CB  . ARG A 53  ? 0.6316 0.7731 0.6082 -0.0293 -0.0215 -0.0428 70  ARG A CB  
369  C CG  . ARG A 53  ? 0.6651 0.8115 0.6514 -0.0282 -0.0204 -0.0574 70  ARG A CG  
370  C CD  . ARG A 53  ? 0.7136 0.8654 0.6893 -0.0290 -0.0131 -0.0658 70  ARG A CD  
371  N NE  . ARG A 53  ? 0.7200 0.8710 0.6935 -0.0275 -0.0203 -0.0684 70  ARG A NE  
372  C CZ  . ARG A 53  ? 0.7117 0.8645 0.6976 -0.0249 -0.0280 -0.0795 70  ARG A CZ  
373  N NH1 . ARG A 53  ? 0.6971 0.8530 0.6990 -0.0235 -0.0294 -0.0894 70  ARG A NH1 
374  N NH2 . ARG A 53  ? 0.7381 0.8895 0.7219 -0.0234 -0.0351 -0.0813 70  ARG A NH2 
375  N N   . ASP A 54  ? 0.6081 0.7435 0.6181 -0.0256 -0.0381 -0.0418 71  ASP A N   
376  C CA  . ASP A 54  ? 0.5869 0.7202 0.6143 -0.0236 -0.0485 -0.0478 71  ASP A CA  
377  C C   . ASP A 54  ? 0.6006 0.7277 0.6318 -0.0234 -0.0567 -0.0353 71  ASP A C   
378  O O   . ASP A 54  ? 0.5868 0.7110 0.6217 -0.0224 -0.0596 -0.0317 71  ASP A O   
379  C CB  . ASP A 54  ? 0.5662 0.7019 0.6026 -0.0222 -0.0470 -0.0575 71  ASP A CB  
380  C CG  . ASP A 54  ? 0.5464 0.6798 0.6021 -0.0197 -0.0585 -0.0652 71  ASP A CG  
381  O OD1 . ASP A 54  ? 0.5380 0.6663 0.6001 -0.0192 -0.0683 -0.0599 71  ASP A OD1 
382  O OD2 . ASP A 54  ? 0.5312 0.6679 0.5971 -0.0182 -0.0578 -0.0767 71  ASP A OD2 
383  N N   . PHE A 55  ? 0.6243 0.7496 0.6545 -0.0245 -0.0605 -0.0288 72  PHE A N   
384  C CA  . PHE A 55  ? 0.6370 0.7577 0.6680 -0.0254 -0.0651 -0.0142 72  PHE A CA  
385  C C   . PHE A 55  ? 0.6627 0.7781 0.7081 -0.0244 -0.0757 -0.0116 72  PHE A C   
386  O O   . PHE A 55  ? 0.6638 0.7758 0.7079 -0.0252 -0.0779 0.0012  72  PHE A O   
387  C CB  . PHE A 55  ? 0.6228 0.7433 0.6534 -0.0268 -0.0674 -0.0098 72  PHE A CB  
388  C CG  . PHE A 55  ? 0.6059 0.7237 0.6370 -0.0284 -0.0696 0.0054  72  PHE A CG  
389  C CD1 . PHE A 55  ? 0.5992 0.7188 0.6174 -0.0292 -0.0614 0.0147  72  PHE A CD1 
390  C CD2 . PHE A 55  ? 0.6037 0.7176 0.6495 -0.0291 -0.0796 0.0101  72  PHE A CD2 
391  C CE1 . PHE A 55  ? 0.6031 0.7218 0.6223 -0.0307 -0.0623 0.0282  72  PHE A CE1 
392  C CE2 . PHE A 55  ? 0.6079 0.7203 0.6553 -0.0312 -0.0804 0.0248  72  PHE A CE2 
393  C CZ  . PHE A 55  ? 0.6111 0.7265 0.6449 -0.0319 -0.0713 0.0337  72  PHE A CZ  
394  N N   . ALA A 56  ? 0.6818 0.7965 0.7407 -0.0226 -0.0823 -0.0235 73  ALA A N   
395  C CA  . ALA A 56  ? 0.7127 0.8213 0.7867 -0.0214 -0.0940 -0.0216 73  ALA A CA  
396  C C   . ALA A 56  ? 0.7377 0.8454 0.8123 -0.0193 -0.0939 -0.0252 73  ALA A C   
397  O O   . ALA A 56  ? 0.7621 0.8639 0.8476 -0.0180 -0.1040 -0.0232 73  ALA A O   
398  C CB  . ALA A 56  ? 0.7330 0.8406 0.8248 -0.0202 -0.1035 -0.0330 73  ALA A CB  
399  N N   . ASN A 57  ? 0.7326 0.8457 0.7966 -0.0190 -0.0835 -0.0307 74  ASN A N   
400  C CA  . ASN A 57  ? 0.7192 0.8321 0.7841 -0.0169 -0.0830 -0.0350 74  ASN A CA  
401  C C   . ASN A 57  ? 0.7069 0.8226 0.7549 -0.0176 -0.0722 -0.0293 74  ASN A C   
402  O O   . ASN A 57  ? 0.7233 0.8440 0.7689 -0.0175 -0.0643 -0.0380 74  ASN A O   
403  C CB  . ASN A 57  ? 0.7248 0.8422 0.8023 -0.0152 -0.0828 -0.0529 74  ASN A CB  
404  C CG  . ASN A 57  ? 0.7443 0.8600 0.8394 -0.0140 -0.0931 -0.0611 74  ASN A CG  
405  O OD1 . ASN A 57  ? 0.7745 0.8841 0.8829 -0.0122 -0.1049 -0.0607 74  ASN A OD1 
406  N ND2 . ASN A 57  ? 0.7524 0.8732 0.8475 -0.0148 -0.0892 -0.0688 74  ASN A ND2 
407  N N   . PRO A 58  ? 0.6911 0.8038 0.7283 -0.0183 -0.0718 -0.0147 75  PRO A N   
408  C CA  . PRO A 58  ? 0.6799 0.7947 0.7024 -0.0182 -0.0635 -0.0090 75  PRO A CA  
409  C C   . PRO A 58  ? 0.7114 0.8239 0.7342 -0.0152 -0.0666 -0.0113 75  PRO A C   
410  O O   . PRO A 58  ? 0.7044 0.8191 0.7178 -0.0143 -0.0602 -0.0110 75  PRO A O   
411  C CB  . PRO A 58  ? 0.6934 0.8063 0.7075 -0.0196 -0.0637 0.0063  75  PRO A CB  
412  C CG  . PRO A 58  ? 0.7013 0.8088 0.7269 -0.0197 -0.0748 0.0104  75  PRO A CG  
413  C CD  . PRO A 58  ? 0.7008 0.8088 0.7405 -0.0196 -0.0788 -0.0028 75  PRO A CD  
414  N N   . ASN A 59  ? 0.7579 0.8655 0.7921 -0.0133 -0.0775 -0.0137 76  ASN A N   
415  C CA  . ASN A 59  ? 0.7717 0.8766 0.8078 -0.0098 -0.0824 -0.0176 76  ASN A CA  
416  C C   . ASN A 59  ? 0.7654 0.8755 0.8077 -0.0089 -0.0768 -0.0321 76  ASN A C   
417  O O   . ASN A 59  ? 0.7941 0.9034 0.8354 -0.0063 -0.0780 -0.0353 76  ASN A O   
418  C CB  . ASN A 59  ? 0.8231 0.9207 0.8716 -0.0079 -0.0966 -0.0174 76  ASN A CB  
419  C CG  . ASN A 59  ? 0.8387 0.9368 0.9052 -0.0088 -0.1015 -0.0267 76  ASN A CG  
420  O OD1 . ASN A 59  ? 0.8298 0.9285 0.9112 -0.0068 -0.1061 -0.0400 76  ASN A OD1 
421  N ND2 . ASN A 59  ? 0.8204 0.9183 0.8868 -0.0116 -0.1011 -0.0204 76  ASN A ND2 
422  N N   . LYS A 60  ? 0.7489 0.8645 0.7973 -0.0111 -0.0706 -0.0410 77  LYS A N   
423  C CA  . LYS A 60  ? 0.7137 0.8354 0.7683 -0.0112 -0.0633 -0.0540 77  LYS A CA  
424  C C   . LYS A 60  ? 0.6885 0.8125 0.7310 -0.0117 -0.0542 -0.0506 77  LYS A C   
425  O O   . LYS A 60  ? 0.6807 0.8073 0.7298 -0.0108 -0.0514 -0.0594 77  LYS A O   
426  C CB  . LYS A 60  ? 0.7248 0.8525 0.7848 -0.0138 -0.0572 -0.0624 77  LYS A CB  
427  C CG  . LYS A 60  ? 0.7580 0.8866 0.8378 -0.0120 -0.0648 -0.0753 77  LYS A CG  
428  C CD  . LYS A 60  ? 0.7631 0.8954 0.8457 -0.0137 -0.0631 -0.0802 77  LYS A CD  
429  N N   . TYR A 61  ? 0.6671 0.7901 0.6937 -0.0130 -0.0498 -0.0386 78  TYR A N   
430  C CA  . TYR A 61  ? 0.6425 0.7671 0.6587 -0.0128 -0.0425 -0.0356 78  TYR A CA  
431  C C   . TYR A 61  ? 0.6274 0.7488 0.6298 -0.0111 -0.0445 -0.0233 78  TYR A C   
432  O O   . TYR A 61  ? 0.6015 0.7242 0.5954 -0.0104 -0.0389 -0.0212 78  TYR A O   
433  C CB  . TYR A 61  ? 0.6615 0.7909 0.6723 -0.0164 -0.0309 -0.0363 78  TYR A CB  
434  C CG  . TYR A 61  ? 0.6648 0.7940 0.6647 -0.0187 -0.0282 -0.0264 78  TYR A CG  
435  C CD1 . TYR A 61  ? 0.6554 0.7842 0.6424 -0.0189 -0.0240 -0.0166 78  TYR A CD1 
436  C CD2 . TYR A 61  ? 0.6883 0.8184 0.6923 -0.0205 -0.0297 -0.0285 78  TYR A CD2 
437  C CE1 . TYR A 61  ? 0.6662 0.7952 0.6456 -0.0209 -0.0219 -0.0084 78  TYR A CE1 
438  C CE2 . TYR A 61  ? 0.6977 0.8276 0.6933 -0.0224 -0.0279 -0.0206 78  TYR A CE2 
439  C CZ  . TYR A 61  ? 0.6954 0.8248 0.6792 -0.0227 -0.0240 -0.0104 78  TYR A CZ  
440  O OH  . TYR A 61  ? 0.6721 0.8015 0.6499 -0.0245 -0.0231 -0.0032 78  TYR A OH  
441  N N   . LYS A 62  ? 0.6364 0.7536 0.6371 -0.0103 -0.0521 -0.0152 79  LYS A N   
442  C CA  . LYS A 62  ? 0.6392 0.7542 0.6267 -0.0087 -0.0536 -0.0030 79  LYS A CA  
443  C C   . LYS A 62  ? 0.6609 0.7705 0.6500 -0.0051 -0.0643 -0.0022 79  LYS A C   
444  O O   . LYS A 62  ? 0.6656 0.7710 0.6627 -0.0053 -0.0728 -0.0006 79  LYS A O   
445  C CB  . LYS A 62  ? 0.6310 0.7458 0.6143 -0.0115 -0.0529 0.0081  79  LYS A CB  
446  C CG  . LYS A 62  ? 0.6138 0.7329 0.5948 -0.0147 -0.0442 0.0082  79  LYS A CG  
447  C CD  . LYS A 62  ? 0.6083 0.7273 0.5859 -0.0168 -0.0446 0.0201  79  LYS A CD  
448  C CE  . LYS A 62  ? 0.5942 0.7167 0.5693 -0.0196 -0.0375 0.0202  79  LYS A CE  
449  N NZ  . LYS A 62  ? 0.6106 0.7332 0.5850 -0.0215 -0.0386 0.0312  79  LYS A NZ  
450  N N   . HIS A 63  ? 0.6795 0.7887 0.6608 -0.0015 -0.0646 -0.0031 80  HIS A N   
451  C CA  . HIS A 63  ? 0.6940 0.7979 0.6772 0.0026  -0.0753 -0.0056 80  HIS A CA  
452  C C   . HIS A 63  ? 0.7030 0.8017 0.6761 0.0038  -0.0825 0.0076  80  HIS A C   
453  O O   . HIS A 63  ? 0.7203 0.8128 0.6987 0.0059  -0.0937 0.0071  80  HIS A O   
454  C CB  . HIS A 63  ? 0.7232 0.8285 0.7019 0.0064  -0.0739 -0.0124 80  HIS A CB  
455  C CG  . HIS A 63  ? 0.7690 0.8686 0.7467 0.0116  -0.0856 -0.0146 80  HIS A CG  
456  N ND1 . HIS A 63  ? 0.7776 0.8758 0.7384 0.0159  -0.0878 -0.0092 80  HIS A ND1 
457  C CD2 . HIS A 63  ? 0.7927 0.8877 0.7840 0.0136  -0.0965 -0.0220 80  HIS A CD2 
458  C CE1 . HIS A 63  ? 0.7932 0.8855 0.7557 0.0203  -0.0998 -0.0127 80  HIS A CE1 
459  N NE2 . HIS A 63  ? 0.7910 0.8811 0.7728 0.0189  -0.1055 -0.0204 80  HIS A NE2 
460  N N   . PHE A 64  ? 0.7089 0.8102 0.6684 0.0023  -0.0762 0.0196  81  PHE A N   
461  C CA  . PHE A 64  ? 0.7432 0.8407 0.6914 0.0030  -0.0809 0.0338  81  PHE A CA  
462  C C   . PHE A 64  ? 0.7637 0.8585 0.7206 -0.0012 -0.0841 0.0422  81  PHE A C   
463  O O   . PHE A 64  ? 0.7662 0.8599 0.7150 -0.0026 -0.0841 0.0561  81  PHE A O   
464  C CB  . PHE A 64  ? 0.7494 0.8521 0.6791 0.0041  -0.0722 0.0420  81  PHE A CB  
465  C CG  . PHE A 64  ? 0.7610 0.8656 0.6828 0.0090  -0.0709 0.0334  81  PHE A CG  
466  C CD1 . PHE A 64  ? 0.7885 0.8881 0.7039 0.0141  -0.0802 0.0314  81  PHE A CD1 
467  C CD2 . PHE A 64  ? 0.7689 0.8793 0.6915 0.0087  -0.0618 0.0264  81  PHE A CD2 
468  C CE1 . PHE A 64  ? 0.7932 0.8943 0.7034 0.0190  -0.0803 0.0221  81  PHE A CE1 
469  C CE2 . PHE A 64  ? 0.7811 0.8927 0.6995 0.0132  -0.0616 0.0177  81  PHE A CE2 
470  C CZ  . PHE A 64  ? 0.8109 0.9180 0.7233 0.0185  -0.0710 0.0151  81  PHE A CZ  
471  N N   . ILE A 65  ? 0.7626 0.8599 0.6755 -0.0733 -0.0851 0.0082  82  ILE A N   
472  C CA  . ILE A 65  ? 0.7804 0.8684 0.7022 -0.0588 -0.0850 0.0077  82  ILE A CA  
473  C C   . ILE A 65  ? 0.8010 0.9185 0.7420 -0.0398 -0.0949 -0.0053 82  ILE A C   
474  O O   . ILE A 65  ? 0.7624 0.9268 0.7230 -0.0432 -0.0923 -0.0214 82  ILE A O   
475  C CB  . ILE A 65  ? 0.7638 0.8521 0.6861 -0.0692 -0.0746 0.0042  82  ILE A CB  
476  C CG1 . ILE A 65  ? 0.7487 0.8046 0.6490 -0.0772 -0.0706 0.0140  82  ILE A CG1 
477  C CG2 . ILE A 65  ? 0.7585 0.8437 0.6916 -0.0549 -0.0752 0.0000  82  ILE A CG2 
478  N N   . LYS A 66  ? 0.8647 0.9542 0.7952 -0.0199 -0.1073 -0.0004 83  LYS A N   
479  C CA  . LYS A 66  ? 0.9075 1.0118 0.8464 0.0080  -0.1233 -0.0143 83  LYS A CA  
480  C C   . LYS A 66  ? 0.9008 1.0161 0.8527 0.0169  -0.1196 -0.0266 83  LYS A C   
481  O O   . LYS A 66  ? 0.9107 1.0816 0.8890 0.0268  -0.1211 -0.0483 83  LYS A O   
482  C CB  . LYS A 66  ? 0.9678 1.0135 0.8723 0.0252  -0.1397 -0.0030 83  LYS A CB  
483  C CG  . LYS A 66  ? 1.0293 1.0746 0.9284 0.0623  -0.1646 -0.0172 83  LYS A CG  
484  C CD  . LYS A 66  ? 1.1036 1.0687 0.9491 0.0728  -0.1816 -0.0019 83  LYS A CD  
485  C CE  . LYS A 66  ? 1.1543 1.0924 0.9769 0.1168  -0.2118 -0.0159 83  LYS A CE  
486  N N   . SER A 67  ? 0.8794 0.9489 0.8135 0.0106  -0.1133 -0.0152 84  SER A N   
487  C CA  . SER A 67  ? 0.8657 0.9308 0.8034 0.0210  -0.1124 -0.0250 84  SER A CA  
488  C C   . SER A 67  ? 0.8548 0.8853 0.7788 0.0014  -0.0997 -0.0126 84  SER A C   
489  O O   . SER A 67  ? 0.8208 0.8265 0.7293 -0.0154 -0.0944 0.0025  84  SER A O   
490  C CB  . SER A 67  ? 0.9022 0.9294 0.8179 0.0542  -0.1341 -0.0313 84  SER A CB  
491  O OG  . SER A 67  ? 0.9226 0.8755 0.7948 0.0464  -0.1382 -0.0121 84  SER A OG  
492  N N   . CYS A 68  ? 0.8520 0.8874 0.7829 0.0054  -0.0957 -0.0224 85  CYS A N   
493  C CA  . CYS A 68  ? 0.8523 0.8677 0.7754 -0.0124 -0.0842 -0.0152 85  CYS A CA  
494  C C   . CYS A 68  ? 0.8713 0.8619 0.7843 -0.0005 -0.0883 -0.0235 85  CYS A C   
495  O O   . CYS A 68  ? 0.8763 0.8952 0.8052 0.0147  -0.0899 -0.0407 85  CYS A O   
496  C CB  . CYS A 68  ? 0.8295 0.8828 0.7696 -0.0303 -0.0705 -0.0180 85  CYS A CB  
497  S SG  . CYS A 68  ? 0.8828 0.9244 0.8178 -0.0426 -0.0606 -0.0180 85  CYS A SG  
498  N N   . THR A 69  ? 0.9093 0.8491 0.7934 -0.0099 -0.0895 -0.0133 86  THR A N   
499  C CA  . THR A 69  ? 0.9401 0.8447 0.8051 -0.0047 -0.0931 -0.0194 86  THR A CA  
500  C C   . THR A 69  ? 0.9102 0.8245 0.7815 -0.0289 -0.0784 -0.0168 86  THR A C   
501  O O   . THR A 69  ? 0.8574 0.7851 0.7331 -0.0488 -0.0698 -0.0077 86  THR A O   
502  C CB  . THR A 69  ? 1.0190 0.8481 0.8327 -0.0039 -0.1067 -0.0111 86  THR A CB  
503  O OG1 . THR A 69  ? 1.0534 0.8685 0.8553 0.0206  -0.1237 -0.0123 86  THR A OG1 
504  C CG2 . THR A 69  ? 1.0965 0.8773 0.8806 0.0045  -0.1143 -0.0195 86  THR A CG2 
505  N N   . ILE A 70  ? 0.9167 0.8273 0.7879 -0.0238 -0.0773 -0.0276 87  ILE A N   
506  C CA  . ILE A 70  ? 0.8996 0.8148 0.7719 -0.0443 -0.0668 -0.0267 87  ILE A CA  
507  C C   . ILE A 70  ? 0.9567 0.8174 0.7914 -0.0591 -0.0706 -0.0218 87  ILE A C   
508  O O   . ILE A 70  ? 1.0482 0.8591 0.8523 -0.0470 -0.0818 -0.0261 87  ILE A O   
509  C CB  . ILE A 70  ? 0.8768 0.8172 0.7649 -0.0366 -0.0620 -0.0409 87  ILE A CB  
510  C CG1 . ILE A 70  ? 0.7955 0.7877 0.7096 -0.0405 -0.0532 -0.0430 87  ILE A CG1 
511  C CG2 . ILE A 70  ? 0.8953 0.8223 0.7726 -0.0535 -0.0568 -0.0415 87  ILE A CG2 
512  N N   . ARG A 71  ? 0.9731 0.8441 0.8061 -0.0858 -0.0623 -0.0152 88  ARG A N   
513  C CA  . ARG A 71  ? 1.0373 0.8674 0.8326 -0.1123 -0.0621 -0.0114 88  ARG A CA  
514  C C   . ARG A 71  ? 1.0627 0.8941 0.8536 -0.1289 -0.0570 -0.0196 88  ARG A C   
515  O O   . ARG A 71  ? 1.1221 0.8992 0.8714 -0.1433 -0.0612 -0.0205 88  ARG A O   
516  C CB  . ARG A 71  ? 1.0431 0.8985 0.8407 -0.1349 -0.0549 -0.0044 88  ARG A CB  
517  C CG  . ARG A 71  ? 1.0565 0.8969 0.8452 -0.1251 -0.0607 0.0050  88  ARG A CG  
518  C CD  . ARG A 71  ? 1.1542 0.9172 0.8933 -0.1173 -0.0750 0.0092  88  ARG A CD  
519  N NE  . ARG A 71  ? 1.2133 0.9527 0.9301 -0.1162 -0.0816 0.0193  88  ARG A NE  
520  C CZ  . ARG A 71  ? 1.2891 0.9547 0.9546 -0.1048 -0.0987 0.0240  88  ARG A CZ  
521  N NH1 . ARG A 71  ? 1.3464 0.9517 0.9758 -0.0912 -0.1120 0.0183  88  ARG A NH1 
522  N NH2 . ARG A 71  ? 1.3449 0.9920 0.9897 -0.1044 -0.1050 0.0334  88  ARG A NH2 
523  N N   . VAL A 72  ? 1.0365 0.9226 0.8624 -0.1283 -0.0499 -0.0255 89  VAL A N   
524  C CA  . VAL A 72  ? 1.0426 0.9331 0.8669 -0.1382 -0.0472 -0.0351 89  VAL A CA  
525  C C   . VAL A 72  ? 1.0024 0.9179 0.8515 -0.1159 -0.0468 -0.0414 89  VAL A C   
526  O O   . VAL A 72  ? 0.9404 0.8911 0.8122 -0.1062 -0.0449 -0.0394 89  VAL A O   
527  C CB  . VAL A 72  ? 1.0209 0.9520 0.8524 -0.1652 -0.0408 -0.0400 89  VAL A CB  
528  C CG1 . VAL A 72  ? 1.0306 0.9569 0.8442 -0.1893 -0.0374 -0.0346 89  VAL A CG1 
529  C CG2 . VAL A 72  ? 0.9964 0.9860 0.8631 -0.1509 -0.0399 -0.0444 89  VAL A CG2 
530  N N   . ASN A 73  ? 1.0882 0.9794 0.9251 -0.1103 -0.0488 -0.0497 90  ASN A N   
531  C CA  . ASN A 73  ? 1.0988 1.0113 0.9520 -0.0931 -0.0467 -0.0580 90  ASN A CA  
532  C C   . ASN A 73  ? 1.1107 1.0517 0.9717 -0.1043 -0.0427 -0.0625 90  ASN A C   
533  O O   . ASN A 73  ? 1.0795 1.0516 0.9537 -0.1048 -0.0417 -0.0590 90  ASN A O   
534  C CB  . ASN A 73  ? 1.1355 1.0115 0.9703 -0.0780 -0.0518 -0.0689 90  ASN A CB  
535  C CG  . ASN A 73  ? 1.1374 0.9893 0.9642 -0.0552 -0.0608 -0.0692 90  ASN A CG  
536  O OD1 . ASN A 73  ? 1.1543 0.9473 0.9449 -0.0503 -0.0716 -0.0699 90  ASN A OD1 
537  N ND2 . ASN A 73  ? 1.1087 1.0017 0.9631 -0.0414 -0.0585 -0.0696 90  ASN A ND2 
538  N N   . LYS A 78  ? 1.4547 1.3952 1.3189 -0.0272 -0.0440 -0.1145 95  LYS A N   
539  C CA  . LYS A 78  ? 1.4406 1.4348 1.3261 -0.0154 -0.0365 -0.1317 95  LYS A CA  
540  C C   . LYS A 78  ? 1.3772 1.4151 1.2795 -0.0348 -0.0258 -0.1223 95  LYS A C   
541  O O   . LYS A 78  ? 1.2851 1.3484 1.2031 -0.0284 -0.0264 -0.1220 95  LYS A O   
542  C CB  . LYS A 78  ? 1.4542 1.4565 1.3321 -0.0152 -0.0304 -0.1493 95  LYS A CB  
543  N N   . GLU A 79  ? 1.3309 1.3701 1.2230 -0.0577 -0.0186 -0.1150 96  GLU A N   
544  C CA  . GLU A 79  ? 1.2794 1.3440 1.1692 -0.0775 -0.0103 -0.1086 96  GLU A CA  
545  C C   . GLU A 79  ? 1.1642 1.2056 1.0460 -0.0866 -0.0167 -0.0877 96  GLU A C   
546  O O   . GLU A 79  ? 1.1175 1.1345 0.9943 -0.0862 -0.0235 -0.0811 96  GLU A O   
547  C CB  . GLU A 79  ? 1.3733 1.4446 1.2429 -0.0941 -0.0015 -0.1165 96  GLU A CB  
548  C CG  . GLU A 79  ? 1.4489 1.5624 1.3144 -0.1109 0.0121  -0.1284 96  GLU A CG  
549  C CD  . GLU A 79  ? 1.5220 1.6266 1.3652 -0.1345 0.0136  -0.1131 96  GLU A CD  
550  O OE1 . GLU A 79  ? 1.5636 1.6619 1.4180 -0.1282 0.0070  -0.1011 96  GLU A OE1 
551  O OE2 . GLU A 79  ? 1.5432 1.6406 1.3500 -0.1603 0.0207  -0.1134 96  GLU A OE2 
552  N N   . ILE A 80  ? 1.0732 1.1262 0.9523 -0.0960 -0.0145 -0.0804 97  ILE A N   
553  C CA  . ILE A 80  ? 0.9954 1.0288 0.8654 -0.0993 -0.0221 -0.0641 97  ILE A CA  
554  C C   . ILE A 80  ? 0.9985 1.0101 0.8402 -0.1069 -0.0273 -0.0605 97  ILE A C   
555  O O   . ILE A 80  ? 1.0195 1.0250 0.8343 -0.1196 -0.0235 -0.0641 97  ILE A O   
556  C CB  . ILE A 80  ? 0.9679 1.0122 0.8352 -0.1069 -0.0199 -0.0589 97  ILE A CB  
557  C CG1 . ILE A 80  ? 0.9440 1.0081 0.8406 -0.0933 -0.0205 -0.0612 97  ILE A CG1 
558  C CG2 . ILE A 80  ? 0.9386 0.9566 0.7845 -0.1095 -0.0289 -0.0453 97  ILE A CG2 
559  N N   . LYS A 81  ? 0.9585 0.9608 0.8037 -0.0997 -0.0368 -0.0554 98  LYS A N   
560  C CA  . LYS A 81  ? 0.9500 0.9396 0.7731 -0.0990 -0.0467 -0.0560 98  LYS A CA  
561  C C   . LYS A 81  ? 0.9282 0.9218 0.7556 -0.0890 -0.0577 -0.0515 98  LYS A C   
562  O O   . LYS A 81  ? 0.9399 0.9464 0.7904 -0.0868 -0.0551 -0.0478 98  LYS A O   
563  C CB  . LYS A 81  ? 0.9212 0.9152 0.7516 -0.0997 -0.0466 -0.0650 98  LYS A CB  
564  N N   . VAL A 82  ? 0.9172 0.8997 0.7190 -0.0807 -0.0716 -0.0538 99  VAL A N   
565  C CA  . VAL A 82  ? 0.8691 0.8669 0.6773 -0.0653 -0.0842 -0.0567 99  VAL A CA  
566  C C   . VAL A 82  ? 0.8737 0.9109 0.7205 -0.0705 -0.0783 -0.0632 99  VAL A C   
567  O O   . VAL A 82  ? 0.8831 0.9250 0.7372 -0.0809 -0.0726 -0.0682 99  VAL A O   
568  C CB  . VAL A 82  ? 0.8566 0.8390 0.6294 -0.0481 -0.1048 -0.0642 99  VAL A CB  
569  C CG1 . VAL A 82  ? 0.8454 0.8660 0.6359 -0.0275 -0.1186 -0.0765 99  VAL A CG1 
570  C CG2 . VAL A 82  ? 0.8956 0.8224 0.6145 -0.0465 -0.1130 -0.0553 99  VAL A CG2 
571  N N   . GLY A 83  ? 0.9083 0.9687 0.7733 -0.0673 -0.0785 -0.0633 100 GLY A N   
572  C CA  . GLY A 83  ? 0.8878 0.9795 0.7787 -0.0815 -0.0707 -0.0683 100 GLY A CA  
573  C C   . GLY A 83  ? 0.9041 0.9752 0.8015 -0.0945 -0.0583 -0.0569 100 GLY A C   
574  O O   . GLY A 83  ? 0.8926 0.9738 0.7979 -0.1090 -0.0528 -0.0576 100 GLY A O   
575  N N   . THR A 84  ? 0.9112 0.9540 0.8009 -0.0903 -0.0549 -0.0484 101 THR A N   
576  C CA  . THR A 84  ? 0.8879 0.9147 0.7833 -0.0939 -0.0480 -0.0411 101 THR A CA  
577  C C   . THR A 84  ? 0.8655 0.9000 0.7671 -0.0936 -0.0484 -0.0346 101 THR A C   
578  O O   . THR A 84  ? 0.8522 0.8973 0.7525 -0.0852 -0.0530 -0.0333 101 THR A O   
579  C CB  . THR A 84  ? 0.8875 0.9029 0.7790 -0.0878 -0.0449 -0.0386 101 THR A CB  
580  O OG1 . THR A 84  ? 0.8859 0.8960 0.7702 -0.0899 -0.0424 -0.0461 101 THR A OG1 
581  C CG2 . THR A 84  ? 0.8987 0.9064 0.7986 -0.0841 -0.0422 -0.0352 101 THR A CG2 
582  N N   . ILE A 85  ? 0.8600 0.8809 0.7603 -0.1024 -0.0451 -0.0310 102 ILE A N   
583  C CA  . ILE A 85  ? 0.8494 0.8734 0.7500 -0.1057 -0.0447 -0.0245 102 ILE A CA  
584  C C   . ILE A 85  ? 0.8463 0.8418 0.7415 -0.0982 -0.0460 -0.0164 102 ILE A C   
585  O O   . ILE A 85  ? 0.8251 0.7919 0.7097 -0.0962 -0.0477 -0.0176 102 ILE A O   
586  C CB  . ILE A 85  ? 0.8770 0.9080 0.7695 -0.1282 -0.0410 -0.0280 102 ILE A CB  
587  C CG1 . ILE A 85  ? 0.8722 0.9470 0.7756 -0.1341 -0.0410 -0.0420 102 ILE A CG1 
588  C CG2 . ILE A 85  ? 0.8641 0.9017 0.7538 -0.1336 -0.0392 -0.0223 102 ILE A CG2 
589  C CD1 . ILE A 85  ? 0.8764 0.9719 0.7729 -0.1646 -0.0346 -0.0505 102 ILE A CD1 
590  N N   . ARG A 86  ? 0.8238 0.8273 0.7241 -0.0913 -0.0474 -0.0104 103 ARG A N   
591  C CA  . ARG A 86  ? 0.8110 0.7970 0.7085 -0.0822 -0.0510 -0.0048 103 ARG A CA  
592  C C   . ARG A 86  ? 0.8347 0.8156 0.7232 -0.0886 -0.0520 0.0028  103 ARG A C   
593  O O   . ARG A 86  ? 0.7954 0.7993 0.6876 -0.0958 -0.0488 0.0022  103 ARG A O   
594  C CB  . ARG A 86  ? 0.7690 0.7731 0.6790 -0.0717 -0.0512 -0.0064 103 ARG A CB  
595  C CG  . ARG A 86  ? 0.7674 0.7855 0.6770 -0.0739 -0.0512 -0.0025 103 ARG A CG  
596  C CD  . ARG A 86  ? 0.7571 0.7832 0.6658 -0.0732 -0.0506 -0.0041 103 ARG A CD  
597  N NE  . ARG A 86  ? 0.7311 0.7535 0.6258 -0.0747 -0.0538 -0.0003 103 ARG A NE  
598  C CZ  . ARG A 86  ? 0.7288 0.7441 0.6061 -0.0810 -0.0544 -0.0006 103 ARG A CZ  
599  N NH1 . ARG A 86  ? 0.7287 0.7522 0.6058 -0.0904 -0.0489 -0.0057 103 ARG A NH1 
600  N NH2 . ARG A 86  ? 0.7639 0.7619 0.6182 -0.0796 -0.0608 0.0023  103 ARG A NH2 
601  N N   . GLU A 87  ? 0.8539 0.8047 0.7273 -0.0836 -0.0581 0.0078  104 GLU A N   
602  C CA  . GLU A 87  ? 0.8819 0.8223 0.7411 -0.0894 -0.0601 0.0160  104 GLU A CA  
603  C C   . GLU A 87  ? 0.8721 0.8214 0.7431 -0.0709 -0.0665 0.0175  104 GLU A C   
604  O O   . GLU A 87  ? 0.9024 0.8473 0.7784 -0.0543 -0.0731 0.0121  104 GLU A O   
605  C CB  . GLU A 87  ? 0.9743 0.8613 0.7928 -0.1007 -0.0651 0.0211  104 GLU A CB  
606  C CG  . GLU A 87  ? 1.0560 0.9226 0.8504 -0.1065 -0.0691 0.0305  104 GLU A CG  
607  C CD  . GLU A 87  ? 1.1605 0.9812 0.9047 -0.1368 -0.0673 0.0361  104 GLU A CD  
608  O OE1 . GLU A 87  ? 1.1462 0.9297 0.8636 -0.1486 -0.0685 0.0339  104 GLU A OE1 
609  O OE2 . GLU A 87  ? 1.1818 1.0018 0.9085 -0.1524 -0.0641 0.0420  104 GLU A OE2 
610  N N   . VAL A 88  ? 0.8495 0.8165 0.7252 -0.0738 -0.0648 0.0219  105 VAL A N   
611  C CA  . VAL A 88  ? 0.8490 0.8287 0.7346 -0.0619 -0.0700 0.0225  105 VAL A CA  
612  C C   . VAL A 88  ? 0.9135 0.8742 0.7804 -0.0620 -0.0764 0.0305  105 VAL A C   
613  O O   . VAL A 88  ? 0.9070 0.8647 0.7609 -0.0757 -0.0716 0.0355  105 VAL A O   
614  C CB  . VAL A 88  ? 0.8105 0.8182 0.7092 -0.0650 -0.0648 0.0200  105 VAL A CB  
615  C CG1 . VAL A 88  ? 0.8182 0.8293 0.7102 -0.0668 -0.0665 0.0249  105 VAL A CG1 
616  C CG2 . VAL A 88  ? 0.8337 0.8587 0.7453 -0.0606 -0.0648 0.0126  105 VAL A CG2 
617  N N   . SER A 89  ? 0.9070 0.8587 0.7713 -0.0458 -0.0880 0.0292  106 SER A N   
618  C CA  . SER A 89  ? 0.9111 0.8382 0.7517 -0.0429 -0.0977 0.0366  106 SER A CA  
619  C C   . SER A 89  ? 0.8846 0.8465 0.7442 -0.0389 -0.0988 0.0349  106 SER A C   
620  O O   . SER A 89  ? 0.8340 0.8286 0.7175 -0.0292 -0.1012 0.0251  106 SER A O   
621  C CB  . SER A 89  ? 0.9446 0.8313 0.7606 -0.0225 -0.1156 0.0344  106 SER A CB  
622  O OG  . SER A 89  ? 0.9213 0.8437 0.7656 0.0019  -0.1243 0.0205  106 SER A OG  
623  N N   . VAL A 90  ? 0.9311 0.8875 0.7769 -0.0497 -0.0963 0.0428  107 VAL A N   
624  C CA  . VAL A 90  ? 0.9292 0.9109 0.7853 -0.0506 -0.0964 0.0421  107 VAL A CA  
625  C C   . VAL A 90  ? 0.9819 0.9629 0.8332 -0.0372 -0.1112 0.0413  107 VAL A C   
626  O O   . VAL A 90  ? 1.0250 0.9719 0.8516 -0.0274 -0.1232 0.0454  107 VAL A O   
627  C CB  . VAL A 90  ? 0.9327 0.9117 0.7753 -0.0641 -0.0883 0.0474  107 VAL A CB  
628  C CG1 . VAL A 90  ? 0.9251 0.9179 0.7686 -0.0642 -0.0906 0.0467  107 VAL A CG1 
629  C CG2 . VAL A 90  ? 0.9476 0.9386 0.7987 -0.0712 -0.0773 0.0428  107 VAL A CG2 
630  N N   . VAL A 91  ? 0.9970 1.0126 0.8664 -0.0379 -0.1120 0.0348  108 VAL A N   
631  C CA  . VAL A 91  ? 1.0178 1.0492 0.8897 -0.0261 -0.1262 0.0296  108 VAL A CA  
632  C C   . VAL A 91  ? 1.0175 1.0159 0.8586 -0.0263 -0.1337 0.0409  108 VAL A C   
633  O O   . VAL A 91  ? 1.0119 0.9893 0.8352 -0.0409 -0.1238 0.0503  108 VAL A O   
634  C CB  . VAL A 91  ? 0.9944 1.0738 0.8881 -0.0377 -0.1220 0.0189  108 VAL A CB  
635  C CG1 . VAL A 91  ? 1.0162 1.0970 0.8974 -0.0454 -0.1268 0.0224  108 VAL A CG1 
636  C CG2 . VAL A 91  ? 0.9625 1.0904 0.8845 -0.0253 -0.1284 0.0000  108 VAL A CG2 
637  N N   . SER A 92  ? 1.0583 1.0566 0.8923 -0.0085 -0.1522 0.0370  109 SER A N   
638  C CA  . SER A 92  ? 1.0629 1.0191 0.8577 -0.0056 -0.1636 0.0478  109 SER A CA  
639  C C   . SER A 92  ? 1.0367 1.0017 0.8258 -0.0237 -0.1558 0.0534  109 SER A C   
640  O O   . SER A 92  ? 1.0258 0.9552 0.7802 -0.0321 -0.1555 0.0642  109 SER A O   
641  C CB  . SER A 92  ? 1.1158 1.0726 0.9040 0.0244  -0.1903 0.0386  109 SER A CB  
642  O OG  . SER A 92  ? 1.1174 1.0886 0.9240 0.0470  -0.1983 0.0248  109 SER A OG  
643  N N   . GLY A 93  ? 0.9933 1.0020 0.8102 -0.0322 -0.1495 0.0449  110 GLY A N   
644  C CA  . GLY A 93  ? 0.9587 0.9707 0.7656 -0.0470 -0.1450 0.0476  110 GLY A CA  
645  C C   . GLY A 93  ? 0.9487 0.9450 0.7453 -0.0615 -0.1285 0.0529  110 GLY A C   
646  O O   . GLY A 93  ? 0.9770 0.9759 0.7662 -0.0711 -0.1249 0.0511  110 GLY A O   
647  N N   . LEU A 94  ? 0.9403 0.9203 0.7332 -0.0619 -0.1203 0.0571  111 LEU A N   
648  C CA  . LEU A 94  ? 0.9437 0.9231 0.7337 -0.0705 -0.1064 0.0562  111 LEU A CA  
649  C C   . LEU A 94  ? 0.9544 0.9185 0.7280 -0.0767 -0.0995 0.0608  111 LEU A C   
650  O O   . LEU A 94  ? 0.9850 0.9331 0.7551 -0.0757 -0.1020 0.0645  111 LEU A O   
651  C CB  . LEU A 94  ? 0.9446 0.9373 0.7559 -0.0701 -0.1005 0.0501  111 LEU A CB  
652  C CG  . LEU A 94  ? 0.9091 0.9082 0.7212 -0.0753 -0.1005 0.0442  111 LEU A CG  
653  C CD1 . LEU A 94  ? 0.9237 0.9234 0.7439 -0.0757 -0.0939 0.0403  111 LEU A CD1 
654  C CD2 . LEU A 94  ? 0.9271 0.9117 0.7145 -0.0771 -0.1011 0.0431  111 LEU A CD2 
655  N N   . PRO A 95  ? 0.9297 0.9000 0.6900 -0.0846 -0.0905 0.0580  112 PRO A N   
656  C CA  . PRO A 95  ? 0.9594 0.9260 0.7005 -0.0998 -0.0807 0.0590  112 PRO A CA  
657  C C   . PRO A 95  ? 0.9710 0.9402 0.7234 -0.1051 -0.0741 0.0572  112 PRO A C   
658  O O   . PRO A 95  ? 1.0256 0.9670 0.7546 -0.1177 -0.0742 0.0641  112 PRO A O   
659  C CB  . PRO A 95  ? 0.9554 0.9518 0.6952 -0.1019 -0.0710 0.0472  112 PRO A CB  
660  C CG  . PRO A 95  ? 0.9299 0.9321 0.6840 -0.0845 -0.0777 0.0412  112 PRO A CG  
661  C CD  . PRO A 95  ? 0.9178 0.9003 0.6766 -0.0806 -0.0894 0.0505  112 PRO A CD  
662  N N   . ALA A 96  ? 0.9457 0.9398 0.7259 -0.0960 -0.0704 0.0483  113 ALA A N   
663  C CA  . ALA A 96  ? 0.9103 0.9085 0.7044 -0.0985 -0.0659 0.0459  113 ALA A CA  
664  C C   . ALA A 96  ? 0.9343 0.8975 0.7194 -0.0978 -0.0742 0.0556  113 ALA A C   
665  O O   . ALA A 96  ? 1.0161 0.9660 0.8006 -0.0858 -0.0859 0.0600  113 ALA A O   
666  C CB  . ALA A 96  ? 0.8851 0.9002 0.7034 -0.0841 -0.0673 0.0382  113 ALA A CB  
667  N N   . SER A 97  ? 0.9533 0.9024 0.7286 -0.1093 -0.0699 0.0563  114 SER A N   
668  C CA  . SER A 97  ? 0.9925 0.8987 0.7511 -0.1032 -0.0812 0.0630  114 SER A CA  
669  C C   . SER A 97  ? 0.9286 0.8394 0.7065 -0.0988 -0.0789 0.0576  114 SER A C   
670  O O   . SER A 97  ? 0.8843 0.7732 0.6615 -0.0831 -0.0900 0.0578  114 SER A O   
671  C CB  . SER A 97  ? 1.0836 0.9384 0.7876 -0.1235 -0.0834 0.0719  114 SER A CB  
672  O OG  . SER A 97  ? 1.1112 0.9603 0.8004 -0.1487 -0.0717 0.0693  114 SER A OG  
673  N N   . THR A 98  ? 0.9374 0.8804 0.7325 -0.1097 -0.0660 0.0501  115 THR A N   
674  C CA  . THR A 98  ? 0.9264 0.8695 0.7310 -0.1121 -0.0626 0.0452  115 THR A CA  
675  C C   . THR A 98  ? 0.8560 0.8470 0.6889 -0.1130 -0.0531 0.0339  115 THR A C   
676  O O   . THR A 98  ? 0.8884 0.9103 0.7232 -0.1202 -0.0465 0.0273  115 THR A O   
677  C CB  . THR A 98  ? 0.9934 0.8963 0.7572 -0.1366 -0.0603 0.0493  115 THR A CB  
678  O OG1 . THR A 98  ? 1.0248 0.8686 0.7588 -0.1242 -0.0760 0.0570  115 THR A OG1 
679  C CG2 . THR A 98  ? 1.0263 0.9443 0.7985 -0.1507 -0.0513 0.0409  115 THR A CG2 
680  N N   . SER A 99  ? 0.8367 0.8344 0.6887 -0.1032 -0.0541 0.0293  116 SER A N   
681  C CA  . SER A 99  ? 0.8179 0.8513 0.6872 -0.1031 -0.0486 0.0178  116 SER A CA  
682  C C   . SER A 99  ? 0.7679 0.7947 0.6426 -0.1055 -0.0475 0.0145  116 SER A C   
683  O O   . SER A 99  ? 0.7314 0.7357 0.6077 -0.0964 -0.0523 0.0184  116 SER A O   
684  C CB  . SER A 99  ? 0.8053 0.8529 0.6858 -0.0846 -0.0535 0.0140  116 SER A CB  
685  O OG  . SER A 99  ? 0.8373 0.9137 0.7251 -0.0787 -0.0532 0.0010  116 SER A OG  
686  N N   . VAL A 100 ? 0.7660 0.8192 0.6446 -0.1176 -0.0415 0.0043  117 VAL A N   
687  C CA  . VAL A 100 ? 0.7742 0.8255 0.6581 -0.1204 -0.0407 -0.0007 117 VAL A CA  
688  C C   . VAL A 100 ? 0.7309 0.8176 0.6331 -0.1054 -0.0435 -0.0125 117 VAL A C   
689  O O   . VAL A 100 ? 0.6870 0.8142 0.5962 -0.1040 -0.0429 -0.0247 117 VAL A O   
690  C CB  . VAL A 100 ? 0.8150 0.8588 0.6801 -0.1500 -0.0337 -0.0035 117 VAL A CB  
691  C CG1 . VAL A 100 ? 0.8527 0.9135 0.7023 -0.1738 -0.0261 -0.0054 117 VAL A CG1 
692  C CG2 . VAL A 100 ? 0.8009 0.8754 0.6793 -0.1561 -0.0309 -0.0170 117 VAL A CG2 
693  N N   . GLU A 101 ? 0.7412 0.8114 0.6467 -0.0930 -0.0480 -0.0106 118 GLU A N   
694  C CA  . GLU A 101 ? 0.7253 0.8074 0.6328 -0.0771 -0.0547 -0.0184 118 GLU A CA  
695  C C   . GLU A 101 ? 0.7276 0.8080 0.6367 -0.0785 -0.0552 -0.0240 118 GLU A C   
696  O O   . GLU A 101 ? 0.7206 0.7794 0.6290 -0.0853 -0.0514 -0.0189 118 GLU A O   
697  C CB  . GLU A 101 ? 0.6933 0.7500 0.5904 -0.0664 -0.0597 -0.0104 118 GLU A CB  
698  N N   . ILE A 102 ? 0.6978 0.8014 0.6072 -0.0686 -0.0620 -0.0366 119 ILE A N   
699  C CA  . ILE A 102 ? 0.6612 0.7619 0.5680 -0.0678 -0.0648 -0.0425 119 ILE A CA  
700  C C   . ILE A 102 ? 0.6568 0.7327 0.5407 -0.0501 -0.0764 -0.0426 119 ILE A C   
701  O O   . ILE A 102 ? 0.6426 0.7165 0.5116 -0.0322 -0.0880 -0.0473 119 ILE A O   
702  C CB  . ILE A 102 ? 0.6550 0.8014 0.5746 -0.0733 -0.0654 -0.0595 119 ILE A CB  
703  C CG1 . ILE A 102 ? 0.6672 0.8049 0.5846 -0.0805 -0.0649 -0.0626 119 ILE A CG1 
704  C CG2 . ILE A 102 ? 0.6636 0.8454 0.5833 -0.0491 -0.0791 -0.0763 119 ILE A CG2 
705  C CD1 . ILE A 102 ? 0.6610 0.8443 0.5914 -0.0963 -0.0621 -0.0787 119 ILE A CD1 
706  N N   . LEU A 103 ? 0.6671 0.7187 0.5413 -0.0562 -0.0740 -0.0385 120 LEU A N   
707  C CA  . LEU A 103 ? 0.6968 0.7137 0.5373 -0.0494 -0.0825 -0.0366 120 LEU A CA  
708  C C   . LEU A 103 ? 0.7330 0.7546 0.5587 -0.0347 -0.0968 -0.0491 120 LEU A C   
709  O O   . LEU A 103 ? 0.7339 0.7759 0.5745 -0.0407 -0.0937 -0.0560 120 LEU A O   
710  C CB  . LEU A 103 ? 0.7041 0.7050 0.5430 -0.0654 -0.0713 -0.0308 120 LEU A CB  
711  C CG  . LEU A 103 ? 0.7395 0.7096 0.5426 -0.0711 -0.0739 -0.0307 120 LEU A CG  
712  C CD1 . LEU A 103 ? 0.7993 0.7292 0.5550 -0.0657 -0.0868 -0.0270 120 LEU A CD1 
713  C CD2 . LEU A 103 ? 0.7502 0.7249 0.5631 -0.0880 -0.0587 -0.0285 120 LEU A CD2 
714  N N   . GLU A 104 ? 0.6524 0.8436 0.6242 -0.0929 -0.0584 0.0007  121 GLU A N   
715  C CA  . GLU A 104 ? 0.6937 0.9024 0.6628 -0.0926 -0.0586 0.0018  121 GLU A CA  
716  C C   . GLU A 104 ? 0.7010 0.9238 0.6585 -0.0890 -0.0572 -0.0016 121 GLU A C   
717  O O   . GLU A 104 ? 0.7284 0.9691 0.6861 -0.0893 -0.0590 -0.0043 121 GLU A O   
718  C CB  . GLU A 104 ? 0.7024 0.9097 0.6666 -0.0905 -0.0553 0.0151  121 GLU A CB  
719  C CG  . GLU A 104 ? 0.7278 0.9286 0.7050 -0.0945 -0.0568 0.0187  121 GLU A CG  
720  C CD  . GLU A 104 ? 0.7448 0.9478 0.7181 -0.0926 -0.0534 0.0309  121 GLU A CD  
721  O OE1 . GLU A 104 ? 0.7496 0.9534 0.7094 -0.0877 -0.0492 0.0373  121 GLU A OE1 
722  O OE2 . GLU A 104 ? 0.7409 0.9446 0.7261 -0.0961 -0.0543 0.0339  121 GLU A OE2 
723  N N   . VAL A 105 ? 0.6806 0.8963 0.6287 -0.0855 -0.0539 -0.0008 122 VAL A N   
724  C CA  . VAL A 105 ? 0.6595 0.8870 0.5970 -0.0817 -0.0514 -0.0023 122 VAL A CA  
725  C C   . VAL A 105 ? 0.6676 0.8867 0.6045 -0.0814 -0.0505 -0.0098 122 VAL A C   
726  O O   . VAL A 105 ? 0.6803 0.8829 0.6182 -0.0812 -0.0492 -0.0072 122 VAL A O   
727  C CB  . VAL A 105 ? 0.6525 0.8801 0.5784 -0.0763 -0.0456 0.0106  122 VAL A CB  
728  C CG1 . VAL A 105 ? 0.6426 0.8808 0.5586 -0.0718 -0.0418 0.0112  122 VAL A CG1 
729  C CG2 . VAL A 105 ? 0.6629 0.8999 0.5903 -0.0761 -0.0461 0.0181  122 VAL A CG2 
730  N N   . LEU A 106 ? 0.6930 0.9247 0.6288 -0.0814 -0.0514 -0.0194 123 LEU A N   
731  C CA  . LEU A 106 ? 0.6945 0.9211 0.6295 -0.0806 -0.0496 -0.0265 123 LEU A CA  
732  C C   . LEU A 106 ? 0.7180 0.9634 0.6431 -0.0773 -0.0471 -0.0291 123 LEU A C   
733  O O   . LEU A 106 ? 0.7684 1.0283 0.6959 -0.0791 -0.0501 -0.0402 123 LEU A O   
734  C CB  . LEU A 106 ? 0.6910 0.9113 0.6404 -0.0854 -0.0542 -0.0393 123 LEU A CB  
735  C CG  . LEU A 106 ? 0.6918 0.9057 0.6431 -0.0847 -0.0526 -0.0473 123 LEU A CG  
736  C CD1 . LEU A 106 ? 0.7053 0.9025 0.6530 -0.0822 -0.0492 -0.0384 123 LEU A CD1 
737  C CD2 . LEU A 106 ? 0.6839 0.8929 0.6517 -0.0892 -0.0568 -0.0602 123 LEU A CD2 
738  N N   . ASP A 107 ? 0.7310 0.9769 0.6454 -0.0723 -0.0412 -0.0184 124 ASP A N   
739  C CA  . ASP A 107 ? 0.7397 1.0034 0.6439 -0.0681 -0.0375 -0.0167 124 ASP A CA  
740  C C   . ASP A 107 ? 0.7351 0.9929 0.6371 -0.0663 -0.0327 -0.0196 124 ASP A C   
741  O O   . ASP A 107 ? 0.7341 0.9820 0.6329 -0.0632 -0.0269 -0.0105 124 ASP A O   
742  C CB  . ASP A 107 ? 0.7596 1.0281 0.6559 -0.0634 -0.0333 -0.0013 124 ASP A CB  
743  C CG  . ASP A 107 ? 0.8068 1.0971 0.6930 -0.0585 -0.0300 0.0027  124 ASP A CG  
744  O OD1 . ASP A 107 ? 0.8525 1.1453 0.7344 -0.0563 -0.0257 0.0006  124 ASP A OD1 
745  O OD2 . ASP A 107 ? 0.8200 1.1260 0.7029 -0.0565 -0.0315 0.0087  124 ASP A OD2 
746  N N   . GLU A 108 ? 0.7518 1.0166 0.6569 -0.0682 -0.0347 -0.0330 125 GLU A N   
747  C CA  . GLU A 108 ? 0.7576 1.0178 0.6624 -0.0668 -0.0301 -0.0373 125 GLU A CA  
748  C C   . GLU A 108 ? 0.7439 1.0154 0.6369 -0.0610 -0.0223 -0.0279 125 GLU A C   
749  O O   . GLU A 108 ? 0.7584 1.0226 0.6517 -0.0592 -0.0166 -0.0262 125 GLU A O   
750  C CB  . GLU A 108 ? 0.7685 1.0360 0.6795 -0.0698 -0.0335 -0.0545 125 GLU A CB  
751  C CG  . GLU A 108 ? 0.7951 1.0518 0.7205 -0.0755 -0.0405 -0.0643 125 GLU A CG  
752  C CD  . GLU A 108 ? 0.8295 1.0635 0.7652 -0.0769 -0.0404 -0.0649 125 GLU A CD  
753  O OE1 . GLU A 108 ? 0.8521 1.0759 0.8005 -0.0809 -0.0454 -0.0702 125 GLU A OE1 
754  O OE2 . GLU A 108 ? 0.8469 1.0739 0.7790 -0.0741 -0.0352 -0.0597 125 GLU A OE2 
755  N N   . GLU A 109 ? 0.7423 1.0324 0.6265 -0.0580 -0.0220 -0.0211 126 GLU A N   
756  C CA  . GLU A 109 ? 0.7516 1.0544 0.6252 -0.0517 -0.0144 -0.0097 126 GLU A CA  
757  C C   . GLU A 109 ? 0.7361 1.0239 0.6103 -0.0488 -0.0083 0.0057  126 GLU A C   
758  O O   . GLU A 109 ? 0.6886 0.9710 0.5620 -0.0458 -0.0006 0.0117  126 GLU A O   
759  C CB  . GLU A 109 ? 0.7676 1.0974 0.6322 -0.0490 -0.0168 -0.0072 126 GLU A CB  
760  N N   . LYS A 110 ? 0.7319 1.0128 0.6085 -0.0498 -0.0114 0.0116  127 LYS A N   
761  C CA  . LYS A 110 ? 0.7341 0.9995 0.6125 -0.0476 -0.0061 0.0241  127 LYS A CA  
762  C C   . LYS A 110 ? 0.7071 0.9483 0.5938 -0.0513 -0.0067 0.0195  127 LYS A C   
763  O O   . LYS A 110 ? 0.7026 0.9308 0.5913 -0.0498 -0.0020 0.0273  127 LYS A O   
764  C CB  . LYS A 110 ? 0.7411 1.0106 0.6184 -0.0465 -0.0083 0.0326  127 LYS A CB  
765  C CG  . LYS A 110 ? 0.7851 1.0782 0.6547 -0.0413 -0.0065 0.0414  127 LYS A CG  
766  C CD  . LYS A 110 ? 0.8187 1.1233 0.6890 -0.0431 -0.0139 0.0402  127 LYS A CD  
767  C CE  . LYS A 110 ? 0.8488 1.1646 0.7159 -0.0374 -0.0105 0.0557  127 LYS A CE  
768  N NZ  . LYS A 110 ? 0.8910 1.2323 0.7495 -0.0319 -0.0086 0.0611  127 LYS A NZ  
769  N N   . ARG A 111 ? 0.6995 0.9354 0.5917 -0.0560 -0.0126 0.0067  128 ARG A N   
770  C CA  . ARG A 111 ? 0.7234 0.9383 0.6235 -0.0592 -0.0145 0.0028  128 ARG A CA  
771  C C   . ARG A 111 ? 0.6912 0.8951 0.5928 -0.0602 -0.0166 0.0093  128 ARG A C   
772  O O   . ARG A 111 ? 0.6638 0.8547 0.5666 -0.0593 -0.0131 0.0143  128 ARG A O   
773  C CB  . ARG A 111 ? 0.7419 0.9476 0.6440 -0.0574 -0.0078 0.0045  128 ARG A CB  
774  C CG  . ARG A 111 ? 0.7493 0.9668 0.6494 -0.0557 -0.0040 0.0000  128 ARG A CG  
775  C CD  . ARG A 111 ? 0.7523 0.9588 0.6586 -0.0555 0.0009  -0.0015 128 ARG A CD  
776  N NE  . ARG A 111 ? 0.7719 0.9891 0.6778 -0.0547 0.0039  -0.0080 128 ARG A NE  
777  C CZ  . ARG A 111 ? 0.7732 1.0034 0.6730 -0.0505 0.0114  -0.0017 128 ARG A CZ  
778  N NH1 . ARG A 111 ? 0.7599 0.9939 0.6548 -0.0467 0.0169  0.0119  128 ARG A NH1 
779  N NH2 . ARG A 111 ? 0.8104 1.0506 0.7098 -0.0499 0.0140  -0.0086 128 ARG A NH2 
780  N N   . ILE A 112 ? 0.6700 0.8801 0.5720 -0.0622 -0.0220 0.0086  129 ILE A N   
781  C CA  . ILE A 112 ? 0.6590 0.8619 0.5619 -0.0627 -0.0233 0.0154  129 ILE A CA  
782  C C   . ILE A 112 ? 0.6464 0.8441 0.5566 -0.0677 -0.0307 0.0084  129 ILE A C   
783  O O   . ILE A 112 ? 0.6199 0.8287 0.5331 -0.0699 -0.0350 0.0025  129 ILE A O   
784  C CB  . ILE A 112 ? 0.6820 0.8993 0.5798 -0.0598 -0.0218 0.0242  129 ILE A CB  
785  C CG1 . ILE A 112 ? 0.7180 0.9402 0.6098 -0.0541 -0.0136 0.0335  129 ILE A CG1 
786  C CG2 . ILE A 112 ? 0.6607 0.8713 0.5604 -0.0607 -0.0232 0.0302  129 ILE A CG2 
787  C CD1 . ILE A 112 ? 0.7152 0.9554 0.6023 -0.0502 -0.0121 0.0425  129 ILE A CD1 
788  N N   . LEU A 113 ? 0.6795 0.8614 0.5937 -0.0693 -0.0320 0.0089  130 LEU A N   
789  C CA  . LEU A 113 ? 0.6863 0.8632 0.6083 -0.0734 -0.0380 0.0057  130 LEU A CA  
790  C C   . LEU A 113 ? 0.6851 0.8592 0.6049 -0.0729 -0.0373 0.0150  130 LEU A C   
791  O O   . LEU A 113 ? 0.7399 0.9095 0.6535 -0.0699 -0.0326 0.0222  130 LEU A O   
792  C CB  . LEU A 113 ? 0.6823 0.8453 0.6106 -0.0752 -0.0404 0.0007  130 LEU A CB  
793  C CG  . LEU A 113 ? 0.6860 0.8450 0.6253 -0.0792 -0.0464 -0.0038 130 LEU A CG  
794  C CD1 . LEU A 113 ? 0.6820 0.8336 0.6297 -0.0805 -0.0488 -0.0121 130 LEU A CD1 
795  C CD2 . LEU A 113 ? 0.7094 0.8598 0.6494 -0.0798 -0.0476 0.0044  130 LEU A CD2 
796  N N   . SER A 114 ? 0.6839 0.8612 0.6099 -0.0760 -0.0416 0.0145  131 SER A N   
797  C CA  . SER A 114 ? 0.6790 0.8516 0.6051 -0.0763 -0.0413 0.0228  131 SER A CA  
798  C C   . SER A 114 ? 0.6655 0.8344 0.6030 -0.0808 -0.0465 0.0200  131 SER A C   
799  O O   . SER A 114 ? 0.6167 0.7925 0.5627 -0.0839 -0.0502 0.0121  131 SER A O   
800  C CB  . SER A 114 ? 0.6905 0.8754 0.6127 -0.0743 -0.0388 0.0295  131 SER A CB  
801  O OG  . SER A 114 ? 0.7131 0.8958 0.6385 -0.0755 -0.0393 0.0358  131 SER A OG  
802  N N   . PHE A 115 ? 0.6591 0.8176 0.5971 -0.0811 -0.0463 0.0262  132 PHE A N   
803  C CA  . PHE A 115 ? 0.6758 0.8302 0.6254 -0.0849 -0.0500 0.0268  132 PHE A CA  
804  C C   . PHE A 115 ? 0.6698 0.8227 0.6174 -0.0844 -0.0479 0.0374  132 PHE A C   
805  O O   . PHE A 115 ? 0.6404 0.7928 0.5773 -0.0810 -0.0437 0.0435  132 PHE A O   
806  C CB  . PHE A 115 ? 0.6833 0.8259 0.6389 -0.0859 -0.0529 0.0231  132 PHE A CB  
807  C CG  . PHE A 115 ? 0.7100 0.8428 0.6572 -0.0830 -0.0512 0.0290  132 PHE A CG  
808  C CD1 . PHE A 115 ? 0.6886 0.8189 0.6269 -0.0800 -0.0490 0.0265  132 PHE A CD1 
809  C CD2 . PHE A 115 ? 0.7352 0.8620 0.6838 -0.0832 -0.0518 0.0371  132 PHE A CD2 
810  C CE1 . PHE A 115 ? 0.7103 0.8329 0.6418 -0.0778 -0.0480 0.0302  132 PHE A CE1 
811  C CE2 . PHE A 115 ? 0.7258 0.8458 0.6656 -0.0804 -0.0508 0.0415  132 PHE A CE2 
812  C CZ  . PHE A 115 ? 0.7334 0.8514 0.6649 -0.0779 -0.0492 0.0372  132 PHE A CZ  
813  N N   . ARG A 116 ? 0.6821 0.8345 0.6415 -0.0879 -0.0503 0.0392  133 ARG A N   
814  C CA  . ARG A 116 ? 0.7074 0.8595 0.6668 -0.0879 -0.0480 0.0494  133 ARG A CA  
815  C C   . ARG A 116 ? 0.7147 0.8570 0.6831 -0.0898 -0.0499 0.0530  133 ARG A C   
816  O O   . ARG A 116 ? 0.6732 0.8131 0.6555 -0.0931 -0.0536 0.0473  133 ARG A O   
817  C CB  . ARG A 116 ? 0.7479 0.9125 0.7154 -0.0904 -0.0481 0.0498  133 ARG A CB  
818  C CG  . ARG A 116 ? 0.7959 0.9610 0.7682 -0.0914 -0.0459 0.0597  133 ARG A CG  
819  C CD  . ARG A 116 ? 0.8662 1.0452 0.8487 -0.0942 -0.0466 0.0587  133 ARG A CD  
820  N NE  . ARG A 116 ? 0.9151 1.1042 0.8872 -0.0904 -0.0432 0.0625  133 ARG A NE  
821  C CZ  . ARG A 116 ? 1.0257 1.2301 1.0031 -0.0913 -0.0442 0.0609  133 ARG A CZ  
822  N NH1 . ARG A 116 ? 1.0841 1.2963 1.0771 -0.0965 -0.0488 0.0539  133 ARG A NH1 
823  N NH2 . ARG A 116 ? 1.0453 1.2579 1.0134 -0.0869 -0.0407 0.0660  133 ARG A NH2 
824  N N   . VAL A 117 ? 0.7149 0.8522 0.6757 -0.0875 -0.0472 0.0626  134 VAL A N   
825  C CA  . VAL A 117 ? 0.7294 0.8594 0.6971 -0.0884 -0.0482 0.0694  134 VAL A CA  
826  C C   . VAL A 117 ? 0.7354 0.8698 0.7169 -0.0919 -0.0473 0.0750  134 VAL A C   
827  O O   . VAL A 117 ? 0.7867 0.9275 0.7640 -0.0912 -0.0436 0.0809  134 VAL A O   
828  C CB  . VAL A 117 ? 0.7443 0.8700 0.6970 -0.0842 -0.0455 0.0774  134 VAL A CB  
829  C CG1 . VAL A 117 ? 0.7526 0.8737 0.7114 -0.0845 -0.0459 0.0872  134 VAL A CG1 
830  C CG2 . VAL A 117 ? 0.7619 0.8827 0.7046 -0.0814 -0.0471 0.0711  134 VAL A CG2 
831  N N   . LEU A 118 ? 0.7259 0.8568 0.7257 -0.0957 -0.0502 0.0730  135 LEU A N   
832  C CA  . LEU A 118 ? 0.7339 0.8678 0.7513 -0.0998 -0.0493 0.0778  135 LEU A CA  
833  C C   . LEU A 118 ? 0.7544 0.8818 0.7754 -0.0990 -0.0468 0.0916  135 LEU A C   
834  O O   . LEU A 118 ? 0.7538 0.8844 0.7860 -0.1015 -0.0441 0.0990  135 LEU A O   
835  C CB  . LEU A 118 ? 0.7281 0.8612 0.7665 -0.1047 -0.0533 0.0672  135 LEU A CB  
836  C CG  . LEU A 118 ? 0.7258 0.8707 0.7710 -0.1082 -0.0553 0.0554  135 LEU A CG  
837  C CD1 . LEU A 118 ? 0.7333 0.8885 0.7598 -0.1050 -0.0537 0.0544  135 LEU A CD1 
838  C CD2 . LEU A 118 ? 0.7251 0.8674 0.7802 -0.1104 -0.0595 0.0415  135 LEU A CD2 
839  N N   . GLY A 119 ? 0.7828 0.9024 0.7952 -0.0954 -0.0478 0.0954  136 GLY A N   
840  C CA  . GLY A 119 ? 0.7832 0.8982 0.7974 -0.0937 -0.0458 0.1094  136 GLY A CA  
841  C C   . GLY A 119 ? 0.7911 0.8997 0.7948 -0.0893 -0.0483 0.1115  136 GLY A C   
842  O O   . GLY A 119 ? 0.7795 0.8873 0.7715 -0.0873 -0.0507 0.1025  136 GLY A O   
843  N N   . GLY A 120 ? 0.8321 0.9371 0.8409 -0.0878 -0.0477 0.1240  137 GLY A N   
844  C CA  . GLY A 120 ? 0.8662 0.9671 0.8667 -0.0833 -0.0505 0.1281  137 GLY A CA  
845  C C   . GLY A 120 ? 0.8988 1.0043 0.8813 -0.0788 -0.0476 0.1406  137 GLY A C   
846  O O   . GLY A 120 ? 0.8826 0.9940 0.8571 -0.0788 -0.0427 0.1453  137 GLY A O   
847  N N   . GLU A 121 ? 0.9277 1.0316 0.9041 -0.0746 -0.0506 0.1459  138 GLU A N   
848  C CA  . GLU A 121 ? 0.9629 1.0731 0.9200 -0.0697 -0.0487 0.1560  138 GLU A CA  
849  C C   . GLU A 121 ? 0.9075 1.0206 0.8432 -0.0668 -0.0511 0.1455  138 GLU A C   
850  O O   . GLU A 121 ? 0.8837 0.9938 0.8194 -0.0654 -0.0564 0.1389  138 GLU A O   
851  C CB  . GLU A 121 ? 1.0586 1.1678 1.0226 -0.0666 -0.0507 0.1701  138 GLU A CB  
852  C CG  . GLU A 121 ? 1.1121 1.2178 1.0995 -0.0694 -0.0473 0.1821  138 GLU A CG  
853  C CD  . GLU A 121 ? 1.1923 1.2935 1.1942 -0.0668 -0.0502 0.1932  138 GLU A CD  
854  O OE1 . GLU A 121 ? 1.1549 1.2508 1.1631 -0.0662 -0.0559 0.1851  138 GLU A OE1 
855  O OE2 . GLU A 121 ? 1.2543 1.3577 1.2622 -0.0651 -0.0463 0.2108  138 GLU A OE2 
856  N N   . HIS A 122 ? 0.8583 0.9772 0.7780 -0.0659 -0.0466 0.1437  139 HIS A N   
857  C CA  . HIS A 122 ? 0.8306 0.9524 0.7311 -0.0635 -0.0470 0.1336  139 HIS A CA  
858  C C   . HIS A 122 ? 0.8235 0.9506 0.7145 -0.0636 -0.0401 0.1343  139 HIS A C   
859  O O   . HIS A 122 ? 0.7838 0.9123 0.6837 -0.0656 -0.0361 0.1421  139 HIS A O   
860  C CB  . HIS A 122 ? 0.8340 0.9504 0.7394 -0.0656 -0.0505 0.1189  139 HIS A CB  
861  C CG  . HIS A 122 ? 0.8323 0.9462 0.7507 -0.0699 -0.0485 0.1144  139 HIS A CG  
862  N ND1 . HIS A 122 ? 0.8270 0.9359 0.7645 -0.0731 -0.0516 0.1122  139 HIS A ND1 
863  C CD2 . HIS A 122 ? 0.8122 0.9294 0.7281 -0.0713 -0.0438 0.1121  139 HIS A CD2 
864  C CE1 . HIS A 122 ? 0.8361 0.9462 0.7811 -0.0766 -0.0493 0.1078  139 HIS A CE1 
865  N NE2 . HIS A 122 ? 0.8381 0.9535 0.7703 -0.0754 -0.0447 0.1084  139 HIS A NE2 
866  N N   . ARG A 123 ? 0.8645 0.9944 0.7394 -0.0615 -0.0383 0.1261  140 ARG A N   
867  C CA  . ARG A 123 ? 0.9040 1.0393 0.7692 -0.0606 -0.0311 0.1271  140 ARG A CA  
868  C C   . ARG A 123 ? 0.9168 1.0499 0.7823 -0.0619 -0.0289 0.1157  140 ARG A C   
869  O O   . ARG A 123 ? 0.9589 1.0944 0.8124 -0.0596 -0.0250 0.1102  140 ARG A O   
870  C CB  . ARG A 123 ? 0.9037 1.0458 0.7496 -0.0561 -0.0293 0.1286  140 ARG A CB  
871  N N   . LEU A 124 ? 0.9068 1.0359 0.7866 -0.0654 -0.0309 0.1123  141 LEU A N   
872  C CA  . LEU A 124 ? 0.8911 1.0196 0.7727 -0.0664 -0.0291 0.1033  141 LEU A CA  
873  C C   . LEU A 124 ? 0.8646 0.9943 0.7621 -0.0702 -0.0293 0.1054  141 LEU A C   
874  O O   . LEU A 124 ? 0.8325 0.9598 0.7388 -0.0725 -0.0328 0.0984  141 LEU A O   
875  C CB  . LEU A 124 ? 0.8912 1.0146 0.7718 -0.0663 -0.0334 0.0925  141 LEU A CB  
876  C CG  . LEU A 124 ? 0.8831 1.0057 0.7505 -0.0633 -0.0341 0.0874  141 LEU A CG  
877  C CD1 . LEU A 124 ? 0.8711 0.9888 0.7421 -0.0639 -0.0383 0.0773  141 LEU A CD1 
878  C CD2 . LEU A 124 ? 0.8851 1.0108 0.7414 -0.0609 -0.0274 0.0850  141 LEU A CD2 
879  N N   . ASN A 125 ? 0.8469 0.9813 0.7484 -0.0709 -0.0255 0.1144  142 ASN A N   
880  C CA  . ASN A 125 ? 0.8403 0.9772 0.7588 -0.0750 -0.0259 0.1163  142 ASN A CA  
881  C C   . ASN A 125 ? 0.8027 0.9438 0.7225 -0.0756 -0.0248 0.1090  142 ASN A C   
882  O O   . ASN A 125 ? 0.7846 0.9278 0.6932 -0.0725 -0.0208 0.1069  142 ASN A O   
883  C CB  . ASN A 125 ? 0.8680 1.0101 0.7920 -0.0758 -0.0213 0.1279  142 ASN A CB  
884  C CG  . ASN A 125 ? 0.8747 1.0155 0.7924 -0.0736 -0.0202 0.1378  142 ASN A CG  
885  O OD1 . ASN A 125 ? 0.8807 1.0261 0.7862 -0.0704 -0.0150 0.1432  142 ASN A OD1 
886  N ND2 . ASN A 125 ? 0.8634 0.9988 0.7894 -0.0747 -0.0249 0.1404  142 ASN A ND2 
887  N N   . ASN A 126 ? 0.7778 0.9205 0.7121 -0.0795 -0.0282 0.1051  143 ASN A N   
888  C CA  . ASN A 126 ? 0.7617 0.9107 0.6984 -0.0801 -0.0282 0.0985  143 ASN A CA  
889  C C   . ASN A 126 ? 0.7235 0.8698 0.6485 -0.0770 -0.0283 0.0909  143 ASN A C   
890  O O   . ASN A 126 ? 0.7426 0.8943 0.6640 -0.0752 -0.0255 0.0890  143 ASN A O   
891  C CB  . ASN A 126 ? 0.7430 0.9011 0.6805 -0.0793 -0.0229 0.1046  143 ASN A CB  
892  C CG  . ASN A 126 ? 0.7285 0.8904 0.6811 -0.0831 -0.0228 0.1114  143 ASN A CG  
893  O OD1 . ASN A 126 ? 0.6920 0.8506 0.6576 -0.0870 -0.0269 0.1099  143 ASN A OD1 
894  N ND2 . ASN A 126 ? 0.7371 0.9058 0.6898 -0.0821 -0.0174 0.1187  143 ASN A ND2 
895  N N   . TYR A 127 ? 0.7047 0.8430 0.6254 -0.0764 -0.0312 0.0872  144 TYR A N   
896  C CA  . TYR A 127 ? 0.7018 0.8374 0.6145 -0.0742 -0.0314 0.0796  144 TYR A CA  
897  C C   . TYR A 127 ? 0.6857 0.8253 0.6065 -0.0763 -0.0341 0.0726  144 TYR A C   
898  O O   . TYR A 127 ? 0.6436 0.7840 0.5761 -0.0799 -0.0383 0.0702  144 TYR A O   
899  C CB  . TYR A 127 ? 0.7090 0.8364 0.6173 -0.0733 -0.0346 0.0768  144 TYR A CB  
900  C CG  . TYR A 127 ? 0.6927 0.8169 0.5951 -0.0716 -0.0346 0.0686  144 TYR A CG  
901  C CD1 . TYR A 127 ? 0.6995 0.8223 0.5908 -0.0684 -0.0304 0.0676  144 TYR A CD1 
902  C CD2 . TYR A 127 ? 0.6933 0.8162 0.6025 -0.0733 -0.0383 0.0612  144 TYR A CD2 
903  C CE1 . TYR A 127 ? 0.6813 0.8010 0.5698 -0.0671 -0.0298 0.0602  144 TYR A CE1 
904  C CE2 . TYR A 127 ? 0.6587 0.7792 0.5636 -0.0717 -0.0375 0.0544  144 TYR A CE2 
905  C CZ  . TYR A 127 ? 0.6489 0.7675 0.5442 -0.0688 -0.0333 0.0543  144 TYR A CZ  
906  O OH  . TYR A 127 ? 0.6594 0.7754 0.5529 -0.0676 -0.0319 0.0478  144 TYR A OH  
907  N N   . ARG A 128 ? 0.6978 0.8410 0.6129 -0.0740 -0.0313 0.0694  145 ARG A N   
908  C CA  . ARG A 128 ? 0.7030 0.8502 0.6223 -0.0750 -0.0338 0.0622  145 ARG A CA  
909  C C   . ARG A 128 ? 0.6764 0.8227 0.5869 -0.0714 -0.0300 0.0599  145 ARG A C   
910  O O   . ARG A 128 ? 0.6668 0.8128 0.5705 -0.0683 -0.0247 0.0643  145 ARG A O   
911  C CB  . ARG A 128 ? 0.7364 0.8955 0.6641 -0.0772 -0.0350 0.0623  145 ARG A CB  
912  C CG  . ARG A 128 ? 0.7759 0.9444 0.6992 -0.0740 -0.0304 0.0668  145 ARG A CG  
913  C CD  . ARG A 128 ? 0.8016 0.9828 0.7349 -0.0766 -0.0324 0.0681  145 ARG A CD  
914  N NE  . ARG A 128 ? 0.8262 1.0121 0.7586 -0.0746 -0.0278 0.0770  145 ARG A NE  
915  C CZ  . ARG A 128 ? 0.8280 1.0231 0.7572 -0.0709 -0.0241 0.0808  145 ARG A CZ  
916  N NH1 . ARG A 128 ? 0.8615 1.0630 0.7876 -0.0687 -0.0244 0.0775  145 ARG A NH1 
917  N NH2 . ARG A 128 ? 0.8133 1.0121 0.7434 -0.0691 -0.0198 0.0887  145 ARG A NH2 
918  N N   . SER A 129 ? 0.6473 0.7930 0.5592 -0.0719 -0.0321 0.0528  146 SER A N   
919  C CA  . SER A 129 ? 0.6071 0.7505 0.5129 -0.0689 -0.0285 0.0501  146 SER A CA  
920  C C   . SER A 129 ? 0.5896 0.7411 0.4981 -0.0691 -0.0294 0.0455  146 SER A C   
921  O O   . SER A 129 ? 0.5586 0.7162 0.4737 -0.0720 -0.0338 0.0418  146 SER A O   
922  C CB  . SER A 129 ? 0.5786 0.7115 0.4829 -0.0692 -0.0303 0.0457  146 SER A CB  
923  O OG  . SER A 129 ? 0.5645 0.6963 0.4763 -0.0722 -0.0360 0.0404  146 SER A OG  
924  N N   . VAL A 130 ? 0.6013 0.7529 0.5053 -0.0660 -0.0247 0.0453  147 VAL A N   
925  C CA  . VAL A 130 ? 0.6062 0.7668 0.5105 -0.0650 -0.0239 0.0425  147 VAL A CA  
926  C C   . VAL A 130 ? 0.6090 0.7625 0.5112 -0.0631 -0.0203 0.0397  147 VAL A C   
927  O O   . VAL A 130 ? 0.6403 0.7879 0.5395 -0.0606 -0.0150 0.0435  147 VAL A O   
928  C CB  . VAL A 130 ? 0.6091 0.7813 0.5109 -0.0616 -0.0197 0.0499  147 VAL A CB  
929  C CG1 . VAL A 130 ? 0.6012 0.7830 0.5012 -0.0592 -0.0175 0.0489  147 VAL A CG1 
930  C CG2 . VAL A 130 ? 0.6075 0.7893 0.5132 -0.0637 -0.0235 0.0522  147 VAL A CG2 
931  N N   . THR A 131 ? 0.5919 0.7464 0.4968 -0.0645 -0.0227 0.0326  148 THR A N   
932  C CA  . THR A 131 ? 0.5901 0.7383 0.4951 -0.0634 -0.0196 0.0290  148 THR A CA  
933  C C   . THR A 131 ? 0.5865 0.7453 0.4908 -0.0616 -0.0166 0.0280  148 THR A C   
934  O O   . THR A 131 ? 0.5590 0.7280 0.4641 -0.0629 -0.0202 0.0246  148 THR A O   
935  C CB  . THR A 131 ? 0.5825 0.7229 0.4927 -0.0665 -0.0250 0.0211  148 THR A CB  
936  O OG1 . THR A 131 ? 0.6131 0.7478 0.5243 -0.0684 -0.0293 0.0227  148 THR A OG1 
937  C CG2 . THR A 131 ? 0.5829 0.7153 0.4943 -0.0656 -0.0222 0.0178  148 THR A CG2 
938  N N   . SER A 132 ? 0.5804 0.7369 0.4838 -0.0587 -0.0099 0.0306  149 SER A N   
939  C CA  . SER A 132 ? 0.5739 0.7410 0.4759 -0.0563 -0.0057 0.0316  149 SER A CA  
940  C C   . SER A 132 ? 0.5998 0.7597 0.5052 -0.0553 -0.0002 0.0300  149 SER A C   
941  O O   . SER A 132 ? 0.6545 0.8039 0.5623 -0.0546 0.0036  0.0323  149 SER A O   
942  C CB  . SER A 132 ? 0.5601 0.7374 0.4582 -0.0522 -0.0009 0.0421  149 SER A CB  
943  O OG  . SER A 132 ? 0.5385 0.7071 0.4380 -0.0493 0.0063  0.0488  149 SER A OG  
944  N N   . VAL A 133 ? 0.6216 0.7880 0.5281 -0.0552 0.0004  0.0255  150 VAL A N   
945  C CA  . VAL A 133 ? 0.6179 0.7787 0.5293 -0.0546 0.0059  0.0235  150 VAL A CA  
946  C C   . VAL A 133 ? 0.6019 0.7734 0.5108 -0.0503 0.0142  0.0316  150 VAL A C   
947  O O   . VAL A 133 ? 0.6245 0.8108 0.5280 -0.0489 0.0131  0.0324  150 VAL A O   
948  C CB  . VAL A 133 ? 0.6228 0.7834 0.5382 -0.0575 0.0013  0.0126  150 VAL A CB  
949  C CG1 . VAL A 133 ? 0.6183 0.7728 0.5407 -0.0572 0.0067  0.0101  150 VAL A CG1 
950  C CG2 . VAL A 133 ? 0.6179 0.7701 0.5361 -0.0612 -0.0073 0.0064  150 VAL A CG2 
951  N N   . ASN A 134 ? 0.6194 0.7842 0.5331 -0.0480 0.0225  0.0375  151 ASN A N   
952  C CA  . ASN A 134 ? 0.6681 0.8421 0.5810 -0.0432 0.0316  0.0479  151 ASN A CA  
953  C C   . ASN A 134 ? 0.6763 0.8442 0.5980 -0.0426 0.0398  0.0482  151 ASN A C   
954  O O   . ASN A 134 ? 0.7183 0.8722 0.6485 -0.0439 0.0429  0.0473  151 ASN A O   
955  C CB  . ASN A 134 ? 0.7196 0.8919 0.6322 -0.0400 0.0360  0.0587  151 ASN A CB  
956  C CG  . ASN A 134 ? 0.7534 0.9331 0.6586 -0.0402 0.0289  0.0598  151 ASN A CG  
957  O OD1 . ASN A 134 ? 0.7716 0.9679 0.6705 -0.0378 0.0277  0.0639  151 ASN A OD1 
958  N ND2 . ASN A 134 ? 0.7563 0.9251 0.6625 -0.0431 0.0242  0.0559  151 ASN A ND2 
959  N N   . GLU A 135 ? 0.6687 0.8483 0.5889 -0.0406 0.0439  0.0498  152 GLU A N   
960  C CA  . GLU A 135 ? 0.6416 0.8167 0.5713 -0.0405 0.0518  0.0494  152 GLU A CA  
961  C C   . GLU A 135 ? 0.6382 0.8129 0.5736 -0.0360 0.0637  0.0633  152 GLU A C   
962  O O   . GLU A 135 ? 0.6690 0.8523 0.5988 -0.0317 0.0664  0.0745  152 GLU A O   
963  C CB  . GLU A 135 ? 0.6380 0.8259 0.5641 -0.0404 0.0515  0.0444  152 GLU A CB  
964  C CG  . GLU A 135 ? 0.6391 0.8201 0.5766 -0.0422 0.0565  0.0392  152 GLU A CG  
965  C CD  . GLU A 135 ? 0.6568 0.8490 0.5912 -0.0428 0.0547  0.0311  152 GLU A CD  
966  O OE1 . GLU A 135 ? 0.7475 0.9477 0.6841 -0.0402 0.0636  0.0358  152 GLU A OE1 
967  O OE2 . GLU A 135 ? 0.6584 0.8517 0.5892 -0.0458 0.0451  0.0201  152 GLU A OE2 
968  N N   . PHE A 136 ? 0.6330 0.7976 0.5815 -0.0370 0.0709  0.0626  153 PHE A N   
969  C CA  . PHE A 136 ? 0.6447 0.8063 0.6031 -0.0333 0.0835  0.0751  153 PHE A CA  
970  C C   . PHE A 136 ? 0.6730 0.8337 0.6426 -0.0339 0.0916  0.0742  153 PHE A C   
971  O O   . PHE A 136 ? 0.6618 0.8189 0.6349 -0.0382 0.0869  0.0618  153 PHE A O   
972  C CB  . PHE A 136 ? 0.6420 0.7866 0.6102 -0.0349 0.0848  0.0741  153 PHE A CB  
973  C CG  . PHE A 136 ? 0.6222 0.7681 0.5815 -0.0330 0.0803  0.0785  153 PHE A CG  
974  C CD1 . PHE A 136 ? 0.6040 0.7482 0.5542 -0.0365 0.0685  0.0688  153 PHE A CD1 
975  C CD2 . PHE A 136 ? 0.6134 0.7622 0.5750 -0.0276 0.0885  0.0929  153 PHE A CD2 
976  C CE1 . PHE A 136 ? 0.6139 0.7598 0.5572 -0.0350 0.0649  0.0730  153 PHE A CE1 
977  C CE2 . PHE A 136 ? 0.6293 0.7800 0.5840 -0.0258 0.0846  0.0969  153 PHE A CE2 
978  C CZ  . PHE A 136 ? 0.6205 0.7698 0.5660 -0.0297 0.0729  0.0866  153 PHE A CZ  
979  N N   . VAL A 137 ? 0.7165 0.8810 0.6931 -0.0293 0.1042  0.0883  154 VAL A N   
980  C CA  . VAL A 137 ? 0.7510 0.9160 0.7396 -0.0291 0.1141  0.0906  154 VAL A CA  
981  C C   . VAL A 137 ? 0.7891 0.9422 0.7963 -0.0276 0.1264  0.1004  154 VAL A C   
982  O O   . VAL A 137 ? 0.8273 0.9817 0.8336 -0.0230 0.1310  0.1130  154 VAL A O   
983  C CB  . VAL A 137 ? 0.7647 0.9513 0.7418 -0.0240 0.1185  0.1002  154 VAL A CB  
984  C CG1 . VAL A 137 ? 0.7648 0.9535 0.7551 -0.0212 0.1335  0.1110  154 VAL A CG1 
985  C CG2 . VAL A 137 ? 0.7584 0.9547 0.7229 -0.0268 0.1082  0.0865  154 VAL A CG2 
986  N N   . VAL A 138 ? 0.8525 0.9942 0.8782 -0.0313 0.1319  0.0944  155 VAL A N   
987  C CA  . VAL A 138 ? 0.9231 1.0531 0.9704 -0.0304 0.1449  0.1029  155 VAL A CA  
988  C C   . VAL A 138 ? 0.9616 1.0927 1.0251 -0.0310 0.1560  0.1057  155 VAL A C   
989  O O   . VAL A 138 ? 0.9353 1.0701 0.9973 -0.0344 0.1514  0.0951  155 VAL A O   
990  C CB  . VAL A 138 ? 0.9355 1.0468 0.9946 -0.0355 0.1409  0.0906  155 VAL A CB  
991  C CG1 . VAL A 138 ? 0.9468 1.0571 0.9920 -0.0339 0.1330  0.0911  155 VAL A CG1 
992  C CG2 . VAL A 138 ? 0.9371 1.0430 0.9993 -0.0424 0.1315  0.0716  155 VAL A CG2 
993  N N   . LEU A 139 ? 1.0228 1.1504 1.1031 -0.0275 0.1710  0.1205  156 LEU A N   
994  C CA  . LEU A 139 ? 1.0766 1.2057 1.1744 -0.0275 0.1839  0.1264  156 LEU A CA  
995  C C   . LEU A 139 ? 1.0957 1.2057 1.2238 -0.0322 0.1918  0.1209  156 LEU A C   
996  O O   . LEU A 139 ? 1.0949 1.1918 1.2316 -0.0334 0.1914  0.1182  156 LEU A O   
997  C CB  . LEU A 139 ? 1.0806 1.2237 1.1754 -0.0191 0.1967  0.1500  156 LEU A CB  
998  N N   . LYS A 144 ? 1.0548 1.2028 1.1870 -0.0410 0.1926  0.0937  161 LYS A N   
999  C CA  . LYS A 144 ? 1.0958 1.2329 1.2257 -0.0467 0.1769  0.0748  161 LYS A CA  
1000 C C   . LYS A 144 ? 1.1331 1.2683 1.2433 -0.0444 0.1676  0.0767  161 LYS A C   
1001 O O   . LYS A 144 ? 1.1367 1.2582 1.2546 -0.0466 0.1654  0.0738  161 LYS A O   
1002 C CB  . LYS A 144 ? 1.0652 1.1855 1.2237 -0.0527 0.1797  0.0660  161 LYS A CB  
1003 N N   . LYS A 145 ? 1.1555 1.3053 1.2408 -0.0401 0.1624  0.0810  162 LYS A N   
1004 C CA  . LYS A 145 ? 1.1277 1.2782 1.1938 -0.0381 0.1529  0.0823  162 LYS A CA  
1005 C C   . LYS A 145 ? 1.1216 1.2680 1.1782 -0.0429 0.1363  0.0640  162 LYS A C   
1006 O O   . LYS A 145 ? 1.1398 1.2958 1.1869 -0.0435 0.1302  0.0563  162 LYS A O   
1007 C CB  . LYS A 145 ? 1.1337 1.3034 1.1788 -0.0314 0.1549  0.0953  162 LYS A CB  
1008 N N   . ARG A 146 ? 1.0880 1.2208 1.1481 -0.0460 0.1295  0.0572  163 ARG A N   
1009 C CA  . ARG A 146 ? 1.0501 1.1786 1.1019 -0.0502 0.1140  0.0416  163 ARG A CA  
1010 C C   . ARG A 146 ? 1.0138 1.1477 1.0438 -0.0476 0.1054  0.0445  163 ARG A C   
1011 O O   . ARG A 146 ? 1.1053 1.2403 1.1309 -0.0438 0.1104  0.0564  163 ARG A O   
1012 C CB  . ARG A 146 ? 1.0257 1.1382 1.0929 -0.0552 0.1107  0.0312  163 ARG A CB  
1013 C CG  . ARG A 146 ? 0.9976 1.1005 1.0661 -0.0543 0.1126  0.0360  163 ARG A CG  
1014 C CD  . ARG A 146 ? 0.9786 1.0695 1.0545 -0.0595 0.1043  0.0216  163 ARG A CD  
1015 N NE  . ARG A 146 ? 0.9610 1.0440 1.0348 -0.0586 0.1045  0.0242  163 ARG A NE  
1016 C CZ  . ARG A 146 ? 0.8777 0.9609 0.9345 -0.0582 0.0945  0.0218  163 ARG A CZ  
1017 N N   . VAL A 147 ? 0.9291 1.0665 0.9474 -0.0497 0.0930  0.0338  164 VAL A N   
1018 C CA  . VAL A 147 ? 0.8954 1.0375 0.8954 -0.0482 0.0842  0.0349  164 VAL A CA  
1019 C C   . VAL A 147 ? 0.8379 0.9685 0.8371 -0.0522 0.0730  0.0246  164 VAL A C   
1020 O O   . VAL A 147 ? 0.7784 0.9036 0.7845 -0.0561 0.0668  0.0130  164 VAL A O   
1021 C CB  . VAL A 147 ? 0.9217 1.0790 0.9075 -0.0468 0.0792  0.0322  164 VAL A CB  
1022 C CG1 . VAL A 147 ? 0.9408 1.1109 0.9276 -0.0431 0.0904  0.0405  164 VAL A CG1 
1023 C CG2 . VAL A 147 ? 0.9332 1.0876 0.9208 -0.0511 0.0691  0.0168  164 VAL A CG2 
1024 N N   . TYR A 148 ? 0.7849 0.9132 0.7759 -0.0507 0.0707  0.0298  165 TYR A N   
1025 C CA  . TYR A 148 ? 0.7281 0.8488 0.7143 -0.0535 0.0601  0.0222  165 TYR A CA  
1026 C C   . TYR A 148 ? 0.7294 0.8570 0.6996 -0.0512 0.0552  0.0278  165 TYR A C   
1027 O O   . TYR A 148 ? 0.7126 0.8493 0.6775 -0.0471 0.0611  0.0385  165 TYR A O   
1028 C CB  . TYR A 148 ? 0.7070 0.8147 0.7038 -0.0550 0.0634  0.0210  165 TYR A CB  
1029 C CG  . TYR A 148 ? 0.7000 0.8064 0.6966 -0.0513 0.0715  0.0328  165 TYR A CG  
1030 C CD1 . TYR A 148 ? 0.7106 0.8186 0.7168 -0.0482 0.0842  0.0431  165 TYR A CD1 
1031 C CD2 . TYR A 148 ? 0.7076 0.8111 0.6957 -0.0506 0.0670  0.0342  165 TYR A CD2 
1032 C CE1 . TYR A 148 ? 0.7413 0.8478 0.7492 -0.0442 0.0921  0.0549  165 TYR A CE1 
1033 C CE2 . TYR A 148 ? 0.7056 0.8078 0.6949 -0.0468 0.0748  0.0450  165 TYR A CE2 
1034 C CZ  . TYR A 148 ? 0.7414 0.8449 0.7411 -0.0435 0.0873  0.0554  165 TYR A CZ  
1035 O OH  . TYR A 148 ? 0.7531 0.8553 0.7562 -0.0391 0.0956  0.0673  165 TYR A OH  
1036 N N   . SER A 149 ? 0.7216 0.8457 0.6853 -0.0537 0.0446  0.0209  166 SER A N   
1037 C CA  . SER A 149 ? 0.7091 0.8389 0.6600 -0.0522 0.0397  0.0254  166 SER A CA  
1038 C C   . SER A 149 ? 0.7129 0.8332 0.6634 -0.0528 0.0379  0.0262  166 SER A C   
1039 O O   . SER A 149 ? 0.6873 0.7970 0.6453 -0.0552 0.0372  0.0199  166 SER A O   
1040 C CB  . SER A 149 ? 0.7130 0.8479 0.6570 -0.0544 0.0292  0.0176  166 SER A CB  
1041 O OG  . SER A 149 ? 0.7392 0.8824 0.6846 -0.0542 0.0307  0.0143  166 SER A OG  
1042 N N   . VAL A 150 ? 0.6808 0.8062 0.6224 -0.0504 0.0371  0.0335  167 VAL A N   
1043 C CA  . VAL A 150 ? 0.6250 0.7435 0.5641 -0.0508 0.0347  0.0340  167 VAL A CA  
1044 C C   . VAL A 150 ? 0.6051 0.7292 0.5341 -0.0521 0.0250  0.0321  167 VAL A C   
1045 O O   . VAL A 150 ? 0.6212 0.7564 0.5439 -0.0502 0.0243  0.0374  167 VAL A O   
1046 C CB  . VAL A 150 ? 0.6310 0.7506 0.5710 -0.0465 0.0433  0.0453  167 VAL A CB  
1047 C CG1 . VAL A 150 ? 0.6323 0.7478 0.5678 -0.0465 0.0402  0.0460  167 VAL A CG1 
1048 C CG2 . VAL A 150 ? 0.6296 0.7415 0.5829 -0.0455 0.0538  0.0471  167 VAL A CG2 
1049 N N   . VAL A 151 ? 0.6070 0.7241 0.5353 -0.0553 0.0176  0.0246  168 VAL A N   
1050 C CA  . VAL A 151 ? 0.6011 0.7216 0.5222 -0.0568 0.0090  0.0234  168 VAL A CA  
1051 C C   . VAL A 151 ? 0.6180 0.7362 0.5348 -0.0555 0.0101  0.0291  168 VAL A C   
1052 O O   . VAL A 151 ? 0.6463 0.7561 0.5656 -0.0555 0.0129  0.0278  168 VAL A O   
1053 C CB  . VAL A 151 ? 0.5798 0.6949 0.5032 -0.0604 0.0008  0.0143  168 VAL A CB  
1054 C CG1 . VAL A 151 ? 0.5701 0.6886 0.4884 -0.0620 -0.0071 0.0141  168 VAL A CG1 
1055 C CG2 . VAL A 151 ? 0.5708 0.6875 0.5004 -0.0614 0.0008  0.0084  168 VAL A CG2 
1056 N N   . LEU A 152 ? 0.6082 0.7349 0.5193 -0.0543 0.0084  0.0347  169 LEU A N   
1057 C CA  . LEU A 152 ? 0.6207 0.7467 0.5281 -0.0531 0.0090  0.0401  169 LEU A CA  
1058 C C   . LEU A 152 ? 0.6335 0.7612 0.5371 -0.0560 0.0003  0.0375  169 LEU A C   
1059 O O   . LEU A 152 ? 0.6345 0.7701 0.5374 -0.0573 -0.0041 0.0363  169 LEU A O   
1060 C CB  . LEU A 152 ? 0.6371 0.7732 0.5430 -0.0492 0.0142  0.0498  169 LEU A CB  
1061 C CG  . LEU A 152 ? 0.6481 0.7856 0.5585 -0.0454 0.0237  0.0558  169 LEU A CG  
1062 C CD1 . LEU A 152 ? 0.6433 0.7932 0.5510 -0.0412 0.0266  0.0665  169 LEU A CD1 
1063 C CD2 . LEU A 152 ? 0.6684 0.7934 0.5855 -0.0445 0.0306  0.0553  169 LEU A CD2 
1064 N N   . GLU A 153 ? 0.6556 0.7762 0.5574 -0.0571 -0.0016 0.0363  170 GLU A N   
1065 C CA  . GLU A 153 ? 0.6612 0.7833 0.5599 -0.0592 -0.0081 0.0369  170 GLU A CA  
1066 C C   . GLU A 153 ? 0.6549 0.7766 0.5500 -0.0573 -0.0047 0.0429  170 GLU A C   
1067 O O   . GLU A 153 ? 0.6575 0.7729 0.5521 -0.0559 -0.0002 0.0421  170 GLU A O   
1068 C CB  . GLU A 153 ? 0.6986 0.8139 0.5983 -0.0620 -0.0144 0.0305  170 GLU A CB  
1069 C CG  . GLU A 153 ? 0.7194 0.8367 0.6187 -0.0643 -0.0213 0.0317  170 GLU A CG  
1070 C CD  . GLU A 153 ? 0.7695 0.8832 0.6734 -0.0667 -0.0279 0.0258  170 GLU A CD  
1071 O OE1 . GLU A 153 ? 0.7124 0.8288 0.6212 -0.0676 -0.0292 0.0215  170 GLU A OE1 
1072 O OE2 . GLU A 153 ? 0.8080 0.9170 0.7109 -0.0674 -0.0316 0.0256  170 GLU A OE2 
1073 N N   . SER A 154 ? 0.6357 0.7652 0.5297 -0.0574 -0.0065 0.0481  171 SER A N   
1074 C CA  . SER A 154 ? 0.6236 0.7546 0.5151 -0.0557 -0.0034 0.0544  171 SER A CA  
1075 C C   . SER A 154 ? 0.6048 0.7388 0.4960 -0.0585 -0.0095 0.0557  171 SER A C   
1076 O O   . SER A 154 ? 0.5679 0.7049 0.4622 -0.0613 -0.0152 0.0528  171 SER A O   
1077 C CB  . SER A 154 ? 0.6308 0.7707 0.5237 -0.0523 0.0018  0.0615  171 SER A CB  
1078 O OG  . SER A 154 ? 0.6243 0.7753 0.5188 -0.0536 -0.0028 0.0623  171 SER A OG  
1079 N N   . TYR A 155 ? 0.6113 0.7446 0.4997 -0.0578 -0.0077 0.0600  172 TYR A N   
1080 C CA  . TYR A 155 ? 0.6411 0.7768 0.5304 -0.0604 -0.0124 0.0626  172 TYR A CA  
1081 C C   . TYR A 155 ? 0.6518 0.7919 0.5399 -0.0588 -0.0084 0.0698  172 TYR A C   
1082 O O   . TYR A 155 ? 0.6571 0.7966 0.5427 -0.0553 -0.0018 0.0721  172 TYR A O   
1083 C CB  . TYR A 155 ? 0.6746 0.8025 0.5614 -0.0622 -0.0165 0.0590  172 TYR A CB  
1084 C CG  . TYR A 155 ? 0.7068 0.8292 0.5868 -0.0600 -0.0124 0.0580  172 TYR A CG  
1085 C CD1 . TYR A 155 ? 0.7432 0.8671 0.6186 -0.0588 -0.0095 0.0630  172 TYR A CD1 
1086 C CD2 . TYR A 155 ? 0.7020 0.8185 0.5807 -0.0591 -0.0110 0.0515  172 TYR A CD2 
1087 C CE1 . TYR A 155 ? 0.7544 0.8746 0.6232 -0.0567 -0.0055 0.0605  172 TYR A CE1 
1088 C CE2 . TYR A 155 ? 0.7442 0.8565 0.6177 -0.0574 -0.0072 0.0487  172 TYR A CE2 
1089 C CZ  . TYR A 155 ? 0.7611 0.8755 0.6291 -0.0561 -0.0046 0.0528  172 TYR A CZ  
1090 O OH  . TYR A 155 ? 0.7929 0.9045 0.6553 -0.0544 -0.0009 0.0485  172 TYR A OH  
1091 N N   . ILE A 156 ? 0.6528 0.7975 0.5445 -0.0613 -0.0119 0.0733  173 ILE A N   
1092 C CA  . ILE A 156 ? 0.6685 0.8161 0.5592 -0.0604 -0.0086 0.0801  173 ILE A CA  
1093 C C   . ILE A 156 ? 0.6726 0.8173 0.5638 -0.0633 -0.0127 0.0818  173 ILE A C   
1094 O O   . ILE A 156 ? 0.6515 0.7959 0.5490 -0.0668 -0.0186 0.0799  173 ILE A O   
1095 C CB  . ILE A 156 ? 0.6579 0.8170 0.5549 -0.0598 -0.0069 0.0855  173 ILE A CB  
1096 C CG1 . ILE A 156 ? 0.6588 0.8209 0.5556 -0.0587 -0.0026 0.0926  173 ILE A CG1 
1097 C CG2 . ILE A 156 ? 0.6510 0.8167 0.5566 -0.0639 -0.0136 0.0835  173 ILE A CG2 
1098 C CD1 . ILE A 156 ? 0.6492 0.8228 0.5521 -0.0569 0.0004  0.0984  173 ILE A CD1 
1099 N N   . VAL A 157 ? 0.6996 0.8424 0.5845 -0.0617 -0.0091 0.0856  174 VAL A N   
1100 C CA  . VAL A 157 ? 0.7234 0.8644 0.6078 -0.0636 -0.0121 0.0894  174 VAL A CA  
1101 C C   . VAL A 157 ? 0.7130 0.8584 0.5943 -0.0620 -0.0066 0.0971  174 VAL A C   
1102 O O   . VAL A 157 ? 0.6989 0.8457 0.5746 -0.0587 -0.0004 0.0970  174 VAL A O   
1103 C CB  . VAL A 157 ? 0.7005 0.8341 0.5775 -0.0631 -0.0150 0.0847  174 VAL A CB  
1104 C CG1 . VAL A 157 ? 0.6953 0.8274 0.5611 -0.0595 -0.0097 0.0826  174 VAL A CG1 
1105 C CG2 . VAL A 157 ? 0.7169 0.8495 0.5961 -0.0650 -0.0194 0.0897  174 VAL A CG2 
1106 N N   . ASP A 158 ? 0.7256 0.8733 0.6118 -0.0643 -0.0083 0.1038  175 ASP A N   
1107 C CA  . ASP A 158 ? 0.7477 0.8998 0.6303 -0.0627 -0.0028 0.1118  175 ASP A CA  
1108 C C   . ASP A 158 ? 0.7601 0.9090 0.6278 -0.0594 -0.0004 0.1098  175 ASP A C   
1109 O O   . ASP A 158 ? 0.7079 0.8515 0.5705 -0.0595 -0.0049 0.1050  175 ASP A O   
1110 C CB  . ASP A 158 ? 0.7501 0.9046 0.6422 -0.0660 -0.0049 0.1202  175 ASP A CB  
1111 C CG  . ASP A 158 ? 0.7456 0.9068 0.6533 -0.0691 -0.0050 0.1229  175 ASP A CG  
1112 O OD1 . ASP A 158 ? 0.7667 0.9310 0.6779 -0.0691 -0.0057 0.1177  175 ASP A OD1 
1113 O OD2 . ASP A 158 ? 0.7417 0.9061 0.6590 -0.0717 -0.0045 0.1305  175 ASP A OD2 
1114 N N   . ILE A 159 ? 0.8014 0.9545 0.6624 -0.0564 0.0067  0.1128  176 ILE A N   
1115 C CA  . ILE A 159 ? 0.8488 1.0015 0.6953 -0.0533 0.0094  0.1106  176 ILE A CA  
1116 C C   . ILE A 159 ? 0.8842 1.0415 0.7281 -0.0536 0.0095  0.1207  176 ILE A C   
1117 O O   . ILE A 159 ? 0.9109 1.0743 0.7580 -0.0532 0.0150  0.1285  176 ILE A O   
1118 C CB  . ILE A 159 ? 0.8517 1.0068 0.6930 -0.0496 0.0180  0.1075  176 ILE A CB  
1119 C CG1 . ILE A 159 ? 0.8676 1.0181 0.7141 -0.0490 0.0186  0.0999  176 ILE A CG1 
1120 C CG2 . ILE A 159 ? 0.8431 0.9990 0.6694 -0.0466 0.0207  0.1030  176 ILE A CG2 
1121 C CD1 . ILE A 159 ? 0.8696 1.0220 0.7158 -0.0452 0.0275  0.0981  176 ILE A CD1 
1122 N N   . PRO A 160 ? 0.9306 1.0857 0.7697 -0.0541 0.0038  0.1215  177 PRO A N   
1123 C CA  . PRO A 160 ? 0.9744 1.1343 0.8119 -0.0539 0.0042  0.1332  177 PRO A CA  
1124 C C   . PRO A 160 ? 1.0105 1.1784 0.8340 -0.0500 0.0116  0.1367  177 PRO A C   
1125 O O   . PRO A 160 ? 1.0353 1.2039 0.8479 -0.0472 0.0149  0.1276  177 PRO A O   
1126 C CB  . PRO A 160 ? 0.9628 1.1191 0.7971 -0.0541 -0.0035 0.1321  177 PRO A CB  
1127 C CG  . PRO A 160 ? 0.9544 1.1064 0.7817 -0.0530 -0.0059 0.1183  177 PRO A CG  
1128 C CD  . PRO A 160 ? 0.9437 1.0928 0.7790 -0.0543 -0.0026 0.1127  177 PRO A CD  
1129 N N   . GLN A 161 ? 1.0362 1.2102 0.8612 -0.0499 0.0147  0.1496  178 GLN A N   
1130 C CA  . GLN A 161 ? 1.0675 1.2506 0.8798 -0.0462 0.0226  0.1543  178 GLN A CA  
1131 C C   . GLN A 161 ? 1.0824 1.2687 0.8746 -0.0424 0.0215  0.1469  178 GLN A C   
1132 O O   . GLN A 161 ? 1.0816 1.2681 0.8687 -0.0420 0.0150  0.1488  178 GLN A O   
1133 C CB  . GLN A 161 ? 1.0650 1.2541 0.8826 -0.0468 0.0253  0.1709  178 GLN A CB  
1134 N N   . GLY A 162 ? 1.0908 1.2803 0.8731 -0.0395 0.0277  0.1379  179 GLY A N   
1135 C CA  . GLY A 162 ? 1.1128 1.3075 0.8763 -0.0360 0.0277  0.1289  179 GLY A CA  
1136 C C   . GLY A 162 ? 1.1218 1.3089 0.8841 -0.0368 0.0215  0.1138  179 GLY A C   
1137 O O   . GLY A 162 ? 1.1710 1.3607 0.9232 -0.0358 0.0156  0.1096  179 GLY A O   
1138 N N   . ASN A 163 ? 1.0899 1.2686 0.8634 -0.0384 0.0230  0.1065  180 ASN A N   
1139 C CA  . ASN A 163 ? 1.0445 1.2155 0.8196 -0.0393 0.0190  0.0926  180 ASN A CA  
1140 C C   . ASN A 163 ? 0.9861 1.1520 0.7698 -0.0390 0.0257  0.0867  180 ASN A C   
1141 O O   . ASN A 163 ? 0.9791 1.1451 0.7728 -0.0397 0.0293  0.0947  180 ASN A O   
1142 C CB  . ASN A 163 ? 1.0618 1.2256 0.8470 -0.0427 0.0098  0.0945  180 ASN A CB  
1143 C CG  . ASN A 163 ? 1.0938 1.2611 0.8716 -0.0424 0.0020  0.0971  180 ASN A CG  
1144 O OD1 . ASN A 163 ? 1.0957 1.2589 0.8822 -0.0447 -0.0044 0.1026  180 ASN A OD1 
1145 N ND2 . ASN A 163 ? 1.1289 1.3044 0.8908 -0.0394 0.0026  0.0929  180 ASN A ND2 
1146 N N   . THR A 164 ? 0.9574 1.1195 0.7387 -0.0379 0.0277  0.0731  181 THR A N   
1147 C CA  . THR A 164 ? 0.9747 1.1313 0.7662 -0.0372 0.0344  0.0683  181 THR A CA  
1148 C C   . THR A 164 ? 0.9562 1.1042 0.7608 -0.0398 0.0298  0.0683  181 THR A C   
1149 O O   . THR A 164 ? 0.9929 1.1381 0.7986 -0.0424 0.0215  0.0681  181 THR A O   
1150 C CB  . THR A 164 ? 0.9896 1.1446 0.7763 -0.0350 0.0395  0.0535  181 THR A CB  
1151 O OG1 . THR A 164 ? 1.0144 1.1669 0.7965 -0.0366 0.0322  0.0438  181 THR A OG1 
1152 C CG2 . THR A 164 ? 1.0045 1.1688 0.7793 -0.0317 0.0464  0.0524  181 THR A CG2 
1153 N N   . GLU A 165 ? 0.9365 1.0814 0.7515 -0.0388 0.0356  0.0685  182 GLU A N   
1154 C CA  . GLU A 165 ? 0.9385 1.0768 0.7646 -0.0406 0.0324  0.0675  182 GLU A CA  
1155 C C   . GLU A 165 ? 0.9002 1.0322 0.7242 -0.0415 0.0290  0.0557  182 GLU A C   
1156 O O   . GLU A 165 ? 0.8391 0.9682 0.6652 -0.0442 0.0214  0.0551  182 GLU A O   
1157 C CB  . GLU A 165 ? 0.9753 1.1126 0.8119 -0.0382 0.0401  0.0696  182 GLU A CB  
1158 C CG  . GLU A 165 ? 1.0002 1.1348 0.8477 -0.0397 0.0367  0.0726  182 GLU A CG  
1159 C CD  . GLU A 165 ? 1.0419 1.1764 0.8993 -0.0364 0.0444  0.0751  182 GLU A CD  
1160 O OE2 . GLU A 165 ? 1.0801 1.2209 0.9441 -0.0361 0.0446  0.0842  182 GLU A OE2 
1161 N N   . GLU A 166 ? 0.9169 1.0473 0.7378 -0.0394 0.0348  0.0458  183 GLU A N   
1162 C CA  . GLU A 166 ? 0.9317 1.0566 0.7528 -0.0404 0.0327  0.0330  183 GLU A CA  
1163 C C   . GLU A 166 ? 0.9201 1.0472 0.7335 -0.0428 0.0225  0.0307  183 GLU A C   
1164 O O   . GLU A 166 ? 0.9661 1.0883 0.7842 -0.0448 0.0180  0.0244  183 GLU A O   
1165 C CB  . GLU A 166 ? 0.9374 1.0623 0.7555 -0.0380 0.0403  0.0215  183 GLU A CB  
1166 N N   . ASP A 167 ? 0.9188 1.0536 0.7215 -0.0425 0.0192  0.0368  184 ASP A N   
1167 C CA  . ASP A 167 ? 0.9615 1.0993 0.7578 -0.0440 0.0096  0.0363  184 ASP A CA  
1168 C C   . ASP A 167 ? 0.9239 1.0584 0.7281 -0.0466 0.0029  0.0452  184 ASP A C   
1169 O O   . ASP A 167 ? 0.9677 1.1006 0.7730 -0.0482 -0.0045 0.0422  184 ASP A O   
1170 C CB  . ASP A 167 ? 1.0086 1.1569 0.7900 -0.0421 0.0088  0.0399  184 ASP A CB  
1171 C CG  . ASP A 167 ? 1.0344 1.1874 0.8065 -0.0398 0.0140  0.0276  184 ASP A CG  
1172 O OD1 . ASP A 167 ? 1.0571 1.2057 0.8332 -0.0406 0.0141  0.0140  184 ASP A OD1 
1173 O OD2 . ASP A 167 ? 1.0820 1.2436 0.8436 -0.0373 0.0184  0.0312  184 ASP A OD2 
1174 N N   . THR A 168 ? 0.8900 1.0243 0.7008 -0.0470 0.0055  0.0554  185 THR A N   
1175 C CA  . THR A 168 ? 0.8579 0.9889 0.6786 -0.0497 0.0000  0.0612  185 THR A CA  
1176 C C   . THR A 168 ? 0.8451 0.9690 0.6745 -0.0509 -0.0005 0.0533  185 THR A C   
1177 O O   . THR A 168 ? 0.8471 0.9679 0.6807 -0.0529 -0.0071 0.0514  185 THR A O   
1178 C CB  . THR A 168 ? 0.8114 0.9452 0.6384 -0.0502 0.0029  0.0722  185 THR A CB  
1179 N N   . ARG A 169 ? 0.8449 0.9720 0.6553 0.0246  -0.0429 -0.0608 186 ARG A N   
1180 C CA  . ARG A 169 ? 0.8679 0.9587 0.6816 0.0209  -0.0370 -0.0571 186 ARG A CA  
1181 C C   . ARG A 169 ? 0.8373 0.9453 0.6545 0.0056  -0.0334 -0.0702 186 ARG A C   
1182 O O   . ARG A 169 ? 0.8285 0.9284 0.6397 0.0030  -0.0351 -0.0576 186 ARG A O   
1183 C CB  . ARG A 169 ? 0.9320 0.9868 0.7634 0.0261  -0.0246 -0.0618 186 ARG A CB  
1184 C CG  . ARG A 169 ? 0.9703 0.9909 0.8082 0.0304  -0.0165 -0.0423 186 ARG A CG  
1185 C CD  . ARG A 169 ? 1.0204 1.0146 0.8769 0.0471  -0.0037 -0.0263 186 ARG A CD  
1186 N NE  . ARG A 169 ? 1.0448 1.0198 0.9346 0.0429  0.0158  -0.0498 186 ARG A NE  
1187 C CZ  . ARG A 169 ? 1.0706 1.0507 0.9683 0.0491  0.0182  -0.0614 186 ARG A CZ  
1188 N NH1 . ARG A 169 ? 1.0852 1.0884 0.9589 0.0608  0.0012  -0.0488 186 ARG A NH1 
1189 N NH2 . ARG A 169 ? 1.0948 1.0581 1.0301 0.0420  0.0404  -0.0897 186 ARG A NH2 
1190 N N   . MET A 170 ? 0.8622 1.0036 0.6902 -0.0055 -0.0281 -0.0988 187 MET A N   
1191 C CA  . MET A 170 ? 0.8647 1.0423 0.6979 -0.0225 -0.0243 -0.1180 187 MET A CA  
1192 C C   . MET A 170 ? 0.7979 1.0085 0.6145 -0.0189 -0.0344 -0.0926 187 MET A C   
1193 O O   . MET A 170 ? 0.7883 0.9970 0.6046 -0.0271 -0.0326 -0.0909 187 MET A O   
1194 C CB  . MET A 170 ? 0.9446 1.1837 0.7898 -0.0342 -0.0196 -0.1555 187 MET A CB  
1195 C CG  . MET A 170 ? 1.0036 1.2943 0.8614 -0.0566 -0.0118 -0.1897 187 MET A CG  
1196 S SD  . MET A 170 ? 1.1208 1.5245 0.9855 -0.0676 -0.0112 -0.2304 187 MET A SD  
1197 C CE  . MET A 170 ? 1.1240 1.4785 1.0123 -0.0670 0.0019  -0.2592 187 MET A CE  
1198 N N   . PHE A 171 ? 0.7282 0.9673 0.5370 -0.0060 -0.0416 -0.0710 188 PHE A N   
1199 C CA  . PHE A 171 ? 0.6911 0.9586 0.4966 0.0006  -0.0441 -0.0422 188 PHE A CA  
1200 C C   . PHE A 171 ? 0.7168 0.9302 0.5194 0.0034  -0.0440 -0.0245 188 PHE A C   
1201 O O   . PHE A 171 ? 0.7253 0.9475 0.5281 0.0000  -0.0423 -0.0154 188 PHE A O   
1202 C CB  . PHE A 171 ? 0.6472 0.9485 0.4577 0.0157  -0.0444 -0.0184 188 PHE A CB  
1203 C CG  . PHE A 171 ? 0.6204 0.9445 0.4415 0.0255  -0.0387 0.0162  188 PHE A CG  
1204 C CD1 . PHE A 171 ? 0.6317 1.0181 0.4552 0.0242  -0.0362 0.0251  188 PHE A CD1 
1205 C CD2 . PHE A 171 ? 0.6084 0.8956 0.4428 0.0354  -0.0324 0.0380  188 PHE A CD2 
1206 C CE1 . PHE A 171 ? 0.6238 1.0308 0.4642 0.0368  -0.0265 0.0629  188 PHE A CE1 
1207 C CE2 . PHE A 171 ? 0.6188 0.9208 0.4754 0.0445  -0.0199 0.0689  188 PHE A CE2 
1208 C CZ  . PHE A 171 ? 0.6117 0.9711 0.4718 0.0473  -0.0164 0.0854  188 PHE A CZ  
1209 N N   . VAL A 172 ? 0.7196 0.8880 0.5202 0.0099  -0.0454 -0.0205 189 VAL A N   
1210 C CA  . VAL A 172 ? 0.7108 0.8490 0.5107 0.0127  -0.0448 -0.0072 189 VAL A CA  
1211 C C   . VAL A 172 ? 0.6947 0.8097 0.4888 0.0044  -0.0440 -0.0119 189 VAL A C   
1212 O O   . VAL A 172 ? 0.6516 0.7643 0.4453 0.0023  -0.0428 -0.0028 189 VAL A O   
1213 C CB  . VAL A 172 ? 0.7371 0.8540 0.5371 0.0203  -0.0465 -0.0062 189 VAL A CB  
1214 C CG1 . VAL A 172 ? 0.7453 0.8485 0.5463 0.0196  -0.0449 -0.0016 189 VAL A CG1 
1215 N N   . ASP A 173 ? 0.6945 0.7924 0.4901 0.0000  -0.0412 -0.0256 190 ASP A N   
1216 C CA  . ASP A 173 ? 0.7211 0.7948 0.5202 -0.0071 -0.0352 -0.0273 190 ASP A CA  
1217 C C   . ASP A 173 ? 0.7148 0.8133 0.5129 -0.0180 -0.0351 -0.0302 190 ASP A C   
1218 O O   . ASP A 173 ? 0.7867 0.8753 0.5807 -0.0194 -0.0351 -0.0190 190 ASP A O   
1219 C CB  . ASP A 173 ? 0.7372 0.7909 0.5540 -0.0121 -0.0236 -0.0448 190 ASP A CB  
1220 C CG  . ASP A 173 ? 0.7685 0.7946 0.5905 0.0026  -0.0200 -0.0330 190 ASP A CG  
1221 O OD1 . ASP A 173 ? 0.7725 0.8016 0.5807 0.0146  -0.0286 -0.0138 190 ASP A OD1 
1222 O OD2 . ASP A 173 ? 0.7993 0.8059 0.6438 0.0018  -0.0062 -0.0449 190 ASP A OD2 
1223 N N   . THR A 174 ? 0.7031 0.8445 0.5049 -0.0246 -0.0350 -0.0449 191 THR A N   
1224 C CA  . THR A 174 ? 0.6910 0.8787 0.4926 -0.0327 -0.0352 -0.0461 191 THR A CA  
1225 C C   . THR A 174 ? 0.6590 0.8480 0.4554 -0.0242 -0.0376 -0.0179 191 THR A C   
1226 O O   . THR A 174 ? 0.6392 0.8338 0.4350 -0.0308 -0.0359 -0.0154 191 THR A O   
1227 C CB  . THR A 174 ? 0.6782 0.9365 0.4830 -0.0339 -0.0364 -0.0576 191 THR A CB  
1228 O OG1 . THR A 174 ? 0.6790 0.9513 0.4957 -0.0509 -0.0296 -0.0972 191 THR A OG1 
1229 C CG2 . THR A 174 ? 0.6758 0.9995 0.4800 -0.0322 -0.0373 -0.0424 191 THR A CG2 
1230 N N   . VAL A 175 ? 0.6424 0.8264 0.4410 -0.0107 -0.0385 0.0000  192 VAL A N   
1231 C CA  . VAL A 175 ? 0.6547 0.8352 0.4610 -0.0038 -0.0340 0.0210  192 VAL A CA  
1232 C C   . VAL A 175 ? 0.6906 0.8291 0.4904 -0.0083 -0.0347 0.0177  192 VAL A C   
1233 O O   . VAL A 175 ? 0.7366 0.8766 0.5393 -0.0104 -0.0312 0.0249  192 VAL A O   
1234 C CB  . VAL A 175 ? 0.6524 0.8321 0.4743 0.0085  -0.0283 0.0346  192 VAL A CB  
1235 C CG1 . VAL A 175 ? 0.6441 0.8168 0.4876 0.0132  -0.0159 0.0501  192 VAL A CG1 
1236 C CG2 . VAL A 175 ? 0.6490 0.8784 0.4790 0.0165  -0.0263 0.0452  192 VAL A CG2 
1237 N N   . VAL A 176 ? 0.6646 0.7740 0.4569 -0.0080 -0.0382 0.0096  193 VAL A N   
1238 C CA  . VAL A 176 ? 0.6499 0.7384 0.4361 -0.0095 -0.0384 0.0116  193 VAL A CA  
1239 C C   . VAL A 176 ? 0.6543 0.7386 0.4374 -0.0187 -0.0365 0.0112  193 VAL A C   
1240 O O   . VAL A 176 ? 0.6725 0.7570 0.4536 -0.0210 -0.0352 0.0173  193 VAL A O   
1241 C CB  . VAL A 176 ? 0.6291 0.7025 0.4106 -0.0031 -0.0406 0.0111  193 VAL A CB  
1242 C CG2 . VAL A 176 ? 0.6029 0.6870 0.3890 0.0031  -0.0417 0.0081  193 VAL A CG2 
1243 N N   . LYS A 177 ? 0.6429 0.7266 0.4297 -0.0260 -0.0340 0.0000  194 LYS A N   
1244 C CA  . LYS A 177 ? 0.6665 0.7481 0.4578 -0.0383 -0.0284 -0.0055 194 LYS A CA  
1245 C C   . LYS A 177 ? 0.6422 0.7550 0.4302 -0.0420 -0.0305 -0.0004 194 LYS A C   
1246 O O   . LYS A 177 ? 0.6365 0.7440 0.4229 -0.0465 -0.0285 0.0053  194 LYS A O   
1247 C CB  . LYS A 177 ? 0.6710 0.7551 0.4773 -0.0506 -0.0203 -0.0294 194 LYS A CB  
1248 C CG  . LYS A 177 ? 0.6837 0.7234 0.5077 -0.0508 -0.0070 -0.0293 194 LYS A CG  
1249 N N   . SER A 178 ? 0.6401 0.7896 0.4301 -0.0374 -0.0327 0.0020  195 SER A N   
1250 C CA  . SER A 178 ? 0.6265 0.8105 0.4203 -0.0341 -0.0309 0.0166  195 SER A CA  
1251 C C   . SER A 178 ? 0.6269 0.7853 0.4227 -0.0284 -0.0280 0.0299  195 SER A C   
1252 O O   . SER A 178 ? 0.6206 0.7889 0.4180 -0.0315 -0.0251 0.0361  195 SER A O   
1253 C CB  . SER A 178 ? 0.6088 0.8371 0.4120 -0.0229 -0.0292 0.0288  195 SER A CB  
1254 O OG  . SER A 178 ? 0.6063 0.8616 0.4232 -0.0128 -0.0214 0.0539  195 SER A OG  
1255 N N   . ASN A 179 ? 0.6313 0.7652 0.4296 -0.0215 -0.0275 0.0303  196 ASN A N   
1256 C CA  . ASN A 179 ? 0.6314 0.7540 0.4367 -0.0197 -0.0223 0.0324  196 ASN A CA  
1257 C C   . ASN A 179 ? 0.6402 0.7530 0.4318 -0.0272 -0.0257 0.0298  196 ASN A C   
1258 O O   . ASN A 179 ? 0.6232 0.7429 0.4191 -0.0294 -0.0213 0.0326  196 ASN A O   
1259 C CB  . ASN A 179 ? 0.6318 0.7432 0.4432 -0.0152 -0.0210 0.0241  196 ASN A CB  
1260 C CG  . ASN A 179 ? 0.6347 0.7531 0.4672 -0.0075 -0.0132 0.0289  196 ASN A CG  
1261 O OD1 . ASN A 179 ? 0.6492 0.7829 0.5029 -0.0021 -0.0022 0.0437  196 ASN A OD1 
1262 N N   . LEU A 180 ? 0.6483 0.7460 0.4286 -0.0296 -0.0304 0.0271  197 LEU A N   
1263 C CA  . LEU A 180 ? 0.6525 0.7419 0.4259 -0.0327 -0.0297 0.0326  197 LEU A CA  
1264 C C   . LEU A 180 ? 0.6768 0.7684 0.4516 -0.0432 -0.0266 0.0335  197 LEU A C   
1265 O O   . LEU A 180 ? 0.6761 0.7684 0.4484 -0.0460 -0.0243 0.0407  197 LEU A O   
1266 C CB  . LEU A 180 ? 0.6599 0.7319 0.4326 -0.0280 -0.0288 0.0373  197 LEU A CB  
1267 C CG  . LEU A 180 ? 0.6434 0.7221 0.4132 -0.0172 -0.0325 0.0375  197 LEU A CG  
1268 C CD1 . LEU A 180 ? 0.6628 0.7273 0.4364 -0.0092 -0.0285 0.0488  197 LEU A CD1 
1269 C CD2 . LEU A 180 ? 0.6672 0.7748 0.4329 -0.0145 -0.0338 0.0373  197 LEU A CD2 
1270 N N   . GLN A 181 ? 0.6991 0.8022 0.4789 -0.0498 -0.0261 0.0248  198 GLN A N   
1271 C CA  . GLN A 181 ? 0.6928 0.8099 0.4761 -0.0623 -0.0225 0.0202  198 GLN A CA  
1272 C C   . GLN A 181 ? 0.6465 0.7885 0.4283 -0.0595 -0.0230 0.0303  198 GLN A C   
1273 O O   . GLN A 181 ? 0.6519 0.8017 0.4335 -0.0671 -0.0206 0.0320  198 GLN A O   
1274 C CB  . GLN A 181 ? 0.7164 0.8567 0.5080 -0.0730 -0.0204 0.0008  198 GLN A CB  
1275 C CG  . GLN A 181 ? 0.7645 0.9115 0.5676 -0.0920 -0.0119 -0.0150 198 GLN A CG  
1276 C CD  . GLN A 181 ? 0.7980 0.9126 0.6220 -0.1025 0.0008  -0.0335 198 GLN A CD  
1277 O OE1 . GLN A 181 ? 0.7905 0.8928 0.6191 -0.0976 0.0016  -0.0409 198 GLN A OE1 
1278 N NE2 . GLN A 181 ? 0.8363 0.9366 0.6796 -0.1173 0.0146  -0.0414 198 GLN A NE2 
1279 N N   . ASN A 182 ? 0.6191 0.7714 0.4060 -0.0480 -0.0226 0.0379  199 ASN A N   
1280 C CA  . ASN A 182 ? 0.6195 0.7899 0.4166 -0.0427 -0.0165 0.0493  199 ASN A CA  
1281 C C   . ASN A 182 ? 0.6221 0.7741 0.4172 -0.0436 -0.0144 0.0474  199 ASN A C   
1282 O O   . ASN A 182 ? 0.6353 0.7980 0.4335 -0.0459 -0.0104 0.0516  199 ASN A O   
1283 C CB  . ASN A 182 ? 0.6192 0.8008 0.4361 -0.0291 -0.0087 0.0599  199 ASN A CB  
1284 C CG  . ASN A 182 ? 0.6032 0.8252 0.4238 -0.0248 -0.0094 0.0685  199 ASN A CG  
1285 O OD1 . ASN A 182 ? 0.5898 0.8481 0.4034 -0.0320 -0.0128 0.0668  199 ASN A OD1 
1286 N ND2 . ASN A 182 ? 0.6099 0.8346 0.4429 -0.0140 -0.0053 0.0758  199 ASN A ND2 
1287 N N   . LEU A 183 ? 0.6280 0.7627 0.4184 -0.0413 -0.0171 0.0403  200 LEU A N   
1288 C CA  . LEU A 183 ? 0.6300 0.7675 0.4171 -0.0420 -0.0160 0.0351  200 LEU A CA  
1289 C C   . LEU A 183 ? 0.6554 0.7948 0.4298 -0.0481 -0.0186 0.0433  200 LEU A C   
1290 O O   . LEU A 183 ? 0.6540 0.8095 0.4284 -0.0498 -0.0157 0.0425  200 LEU A O   
1291 C CB  . LEU A 183 ? 0.5993 0.7353 0.3813 -0.0375 -0.0199 0.0286  200 LEU A CB  
1292 C CG  . LEU A 183 ? 0.5831 0.7469 0.3613 -0.0371 -0.0196 0.0211  200 LEU A CG  
1293 C CD1 . LEU A 183 ? 0.5756 0.7597 0.3756 -0.0410 -0.0089 -0.0015 200 LEU A CD1 
1294 C CD2 . LEU A 183 ? 0.5772 0.7481 0.3480 -0.0304 -0.0249 0.0218  200 LEU A CD2 
1295 N N   . ALA A 184 ? 0.6758 0.8000 0.4451 -0.0523 -0.0207 0.0488  201 ALA A N   
1296 C CA  . ALA A 184 ? 0.7098 0.8297 0.4774 -0.0595 -0.0174 0.0576  201 ALA A CA  
1297 C C   . ALA A 184 ? 0.7150 0.8512 0.4843 -0.0673 -0.0154 0.0571  201 ALA A C   
1298 O O   . ALA A 184 ? 0.7974 0.9385 0.5648 -0.0711 -0.0124 0.0653  201 ALA A O   
1299 C CB  . ALA A 184 ? 0.7150 0.8125 0.4915 -0.0658 -0.0127 0.0554  201 ALA A CB  
1300 N N   . VAL A 185 ? 0.6973 0.8484 0.4718 -0.0676 -0.0157 0.0519  202 VAL A N   
1301 C CA  . VAL A 185 ? 0.6976 0.8729 0.4758 -0.0719 -0.0128 0.0553  202 VAL A CA  
1302 C C   . VAL A 185 ? 0.7017 0.8849 0.4844 -0.0652 -0.0084 0.0589  202 VAL A C   
1303 O O   . VAL A 185 ? 0.6838 0.8763 0.4635 -0.0703 -0.0068 0.0623  202 VAL A O   
1304 C CB  . VAL A 185 ? 0.6777 0.8840 0.4641 -0.0702 -0.0121 0.0558  202 VAL A CB  
1305 C CG1 . VAL A 185 ? 0.6721 0.9140 0.4650 -0.0700 -0.0076 0.0653  202 VAL A CG1 
1306 C CG2 . VAL A 185 ? 0.6884 0.9020 0.4736 -0.0823 -0.0145 0.0417  202 VAL A CG2 
1307 N N   . ILE A 186 ? 0.6896 0.8709 0.4850 -0.0557 -0.0035 0.0549  203 ILE A N   
1308 C CA  . ILE A 186 ? 0.7006 0.8917 0.5119 -0.0527 0.0068  0.0490  203 ILE A CA  
1309 C C   . ILE A 186 ? 0.7474 0.9471 0.5457 -0.0579 0.0034  0.0399  203 ILE A C   
1310 O O   . ILE A 186 ? 0.8042 1.0220 0.6101 -0.0600 0.0102  0.0334  203 ILE A O   
1311 C CB  . ILE A 186 ? 0.6981 0.8844 0.5390 -0.0450 0.0203  0.0389  203 ILE A CB  
1312 C CG1 . ILE A 186 ? 0.6873 0.8604 0.5220 -0.0437 0.0141  0.0305  203 ILE A CG1 
1313 C CG2 . ILE A 186 ? 0.7135 0.9056 0.5849 -0.0343 0.0351  0.0562  203 ILE A CG2 
1314 C CD1 . ILE A 186 ? 0.6852 0.8545 0.5556 -0.0394 0.0311  0.0162  203 ILE A CD1 
1315 N N   . SER A 187 ? 0.7817 0.9764 0.5632 -0.0582 -0.0052 0.0416  204 SER A N   
1316 C CA  . SER A 187 ? 0.8131 1.0344 0.5843 -0.0584 -0.0071 0.0401  204 SER A CA  
1317 C C   . SER A 187 ? 0.8264 1.0522 0.5856 -0.0618 -0.0090 0.0600  204 SER A C   
1318 O O   . SER A 187 ? 0.8180 1.0770 0.5700 -0.0598 -0.0089 0.0667  204 SER A O   
1319 C CB  . SER A 187 ? 0.8353 1.0611 0.5997 -0.0525 -0.0121 0.0396  204 SER A CB  
1320 O OG  . SER A 187 ? 0.8758 1.0691 0.6339 -0.0506 -0.0161 0.0564  204 SER A OG  
1321 N N   . THR A 188 ? 0.8552 1.0569 0.6156 -0.0676 -0.0089 0.0688  205 THR A N   
1322 C CA  . THR A 188 ? 0.8944 1.0978 0.6520 -0.0742 -0.0062 0.0838  205 THR A CA  
1323 C C   . THR A 188 ? 0.9259 1.1428 0.6872 -0.0808 -0.0037 0.0799  205 THR A C   
1324 O O   . THR A 188 ? 0.9362 1.1568 0.7056 -0.0787 -0.0024 0.0708  205 THR A O   
1325 C CB  . THR A 188 ? 0.9126 1.0853 0.6767 -0.0799 -0.0029 0.0917  205 THR A CB  
1326 O OG1 . THR A 188 ? 0.9384 1.1112 0.7089 -0.0841 0.0056  0.1100  205 THR A OG1 
1327 C CG2 . THR A 188 ? 0.9039 1.0695 0.6747 -0.0900 -0.0034 0.0768  205 THR A CG2 
1328 N N   . ALA A 189 ? 1.0306 1.2578 0.7900 -0.0867 -0.0006 0.0913  206 ALA A N   
1329 C CA  . ALA A 189 ? 1.1063 1.3536 0.8680 -0.0918 0.0018  0.0894  206 ALA A CA  
1330 C C   . ALA A 189 ? 1.2083 1.4534 0.9767 -0.1011 0.0026  0.0864  206 ALA A C   
1331 O O   . ALA A 189 ? 1.2101 1.4397 0.9826 -0.1093 0.0032  0.0835  206 ALA A O   
1332 C CB  . ALA A 189 ? 1.0925 1.3590 0.8498 -0.0945 0.0052  0.1036  206 ALA A CB  
1333 N N   . SER A 190 ? 1.2943 1.5637 1.0676 -0.0997 0.0049  0.0854  207 SER A N   
1334 C CA  . SER A 190 ? 1.3229 1.6153 1.1023 -0.1063 0.0057  0.0850  207 SER A CA  
1335 C C   . SER A 190 ? 1.3244 1.6467 1.1070 -0.1073 0.0098  0.0914  207 SER A C   
1336 O O   . SER A 190 ? 1.3538 1.6876 1.1346 -0.1209 0.0107  0.0916  207 SER A O   
1337 C CB  . SER A 190 ? 1.3377 1.6424 1.1262 -0.0949 0.0060  0.0857  207 SER A CB  
1338 O OG  . SER A 190 ? 1.3255 1.6372 1.1282 -0.0797 0.0143  0.0929  207 SER A OG  
1339 N N   . TYR B 6   ? 1.2023 1.2513 0.7483 0.0032  0.0360  0.0804  23  TYR B N   
1340 C CA  . TYR B 6   ? 1.2702 1.2999 0.8633 -0.0052 0.0153  0.1226  23  TYR B CA  
1341 C C   . TYR B 6   ? 1.2752 1.3378 0.8568 -0.0155 -0.0024 0.1399  23  TYR B C   
1342 O O   . TYR B 6   ? 1.2928 1.4137 0.8831 -0.0372 -0.0208 0.1951  23  TYR B O   
1343 C CB  . TYR B 6   ? 1.3320 1.3877 0.9730 -0.0188 0.0064  0.1782  23  TYR B CB  
1344 C CG  . TYR B 6   ? 1.3818 1.4207 1.1117 -0.0281 -0.0203 0.2236  23  TYR B CG  
1345 C CD1 . TYR B 6   ? 1.4075 1.3782 1.1961 -0.0172 -0.0202 0.1913  23  TYR B CD1 
1346 C CD2 . TYR B 6   ? 1.4250 1.5246 1.1942 -0.0521 -0.0466 0.2990  23  TYR B CD2 
1347 C CE1 . TYR B 6   ? 1.4142 1.3701 1.3175 -0.0238 -0.0425 0.2209  23  TYR B CE1 
1348 C CE2 . TYR B 6   ? 1.4538 1.5359 1.3409 -0.0609 -0.0786 0.3458  23  TYR B CE2 
1349 C CZ  . TYR B 6   ? 1.4435 1.4499 1.4072 -0.0436 -0.0750 0.3005  23  TYR B CZ  
1350 O OH  . TYR B 6   ? 1.4712 1.4606 1.5837 -0.0503 -0.1044 0.3349  23  TYR B OH  
1351 N N   . GLY B 7   ? 1.2839 1.3144 0.8497 -0.0043 -0.0014 0.1000  24  GLY B N   
1352 C CA  . GLY B 7   ? 1.3077 1.3582 0.8737 -0.0134 -0.0230 0.1141  24  GLY B CA  
1353 C C   . GLY B 7   ? 1.3117 1.2971 0.9340 -0.0026 -0.0279 0.1011  24  GLY B C   
1354 O O   . GLY B 7   ? 1.2955 1.2774 0.9106 -0.0007 -0.0369 0.0856  24  GLY B O   
1355 N N   . LEU B 8   ? 1.3304 1.2714 1.0151 0.0017  -0.0204 0.1024  25  LEU B N   
1356 C CA  . LEU B 8   ? 1.3323 1.2211 1.0649 0.0094  -0.0103 0.0697  25  LEU B CA  
1357 C C   . LEU B 8   ? 1.3595 1.2331 1.2124 0.0039  -0.0210 0.0908  25  LEU B C   
1358 O O   . LEU B 8   ? 1.4398 1.3382 1.3483 -0.0052 -0.0513 0.1395  25  LEU B O   
1359 C CB  . LEU B 8   ? 1.3537 1.2102 1.0467 0.0151  0.0164  0.0242  25  LEU B CB  
1360 C CG  . LEU B 8   ? 1.3477 1.1970 1.0332 0.0117  0.0271  0.0206  25  LEU B CG  
1361 C CD1 . LEU B 8   ? 1.3168 1.1719 0.9328 0.0155  0.0332  0.0072  25  LEU B CD1 
1362 C CD2 . LEU B 8   ? 1.3841 1.2557 1.1168 0.0064  0.0138  0.0628  25  LEU B CD2 
1363 N N   . THR B 9   ? 1.3517 1.1910 1.2558 0.0058  0.0007  0.0531  26  THR B N   
1364 C CA  . THR B 9   ? 1.3746 1.1998 1.4246 0.0022  -0.0048 0.0537  26  THR B CA  
1365 C C   . THR B 9   ? 1.4114 1.2253 1.5042 -0.0014 0.0060  0.0352  26  THR B C   
1366 O O   . THR B 9   ? 1.4395 1.2538 1.4397 -0.0021 0.0189  0.0218  26  THR B O   
1367 C CB  . THR B 9   ? 1.3461 1.1486 1.4527 0.0047  0.0182  -0.0003 26  THR B CB  
1368 O OG1 . THR B 9   ? 1.2654 1.0569 1.2985 0.0008  0.0563  -0.0621 26  THR B OG1 
1369 C CG2 . THR B 9   ? 1.3440 1.1541 1.4210 0.0084  0.0039  0.0182  26  THR B CG2 
1370 N N   . LYS B 10  ? 1.4622 1.2662 1.7128 -0.0044 -0.0026 0.0326  27  LYS B N   
1371 C CA  . LYS B 10  ? 1.5104 1.3042 1.8306 -0.0090 0.0027  0.0099  27  LYS B CA  
1372 C C   . LYS B 10  ? 1.5225 1.3013 1.7942 -0.0146 0.0460  -0.0830 27  LYS B C   
1373 O O   . LYS B 10  ? 1.5348 1.3120 1.7627 -0.0213 0.0518  -0.0989 27  LYS B O   
1374 C CB  . LYS B 10  ? 1.5074 1.2961 2.0460 -0.0114 -0.0230 0.0287  27  LYS B CB  
1375 N N   . ASP B 11  ? 1.4992 1.2754 1.7788 -0.0170 0.0748  -0.1405 28  ASP B N   
1376 C CA  . ASP B 11  ? 1.5103 1.2931 1.7297 -0.0338 0.1175  -0.2251 28  ASP B CA  
1377 C C   . ASP B 11  ? 1.4973 1.2869 1.5305 -0.0414 0.1205  -0.2085 28  ASP B C   
1378 O O   . ASP B 11  ? 1.5565 1.3556 1.5267 -0.0610 0.1348  -0.2445 28  ASP B O   
1379 C CB  . ASP B 11  ? 1.5087 1.3016 1.7845 -0.0392 0.1505  -0.2841 28  ASP B CB  
1380 N N   . GLU B 12  ? 1.4425 1.2308 1.4024 -0.0284 0.1032  -0.1547 29  GLU B N   
1381 C CA  . GLU B 12  ? 1.4267 1.2195 1.2491 -0.0319 0.0998  -0.1354 29  GLU B CA  
1382 C C   . GLU B 12  ? 1.4448 1.2370 1.2341 -0.0303 0.0823  -0.1047 29  GLU B C   
1383 O O   . GLU B 12  ? 1.4669 1.2623 1.1748 -0.0409 0.0826  -0.1057 29  GLU B O   
1384 C CB  . GLU B 12  ? 1.4080 1.2020 1.1896 -0.0169 0.0853  -0.0985 29  GLU B CB  
1385 C CG  . GLU B 12  ? 1.3799 1.1752 1.1701 -0.0208 0.1014  -0.1240 29  GLU B CG  
1386 C CD  . GLU B 12  ? 1.3249 1.1197 1.1065 -0.0047 0.0804  -0.0898 29  GLU B CD  
1387 O OE1 . GLU B 12  ? 1.2826 1.0838 1.0801 0.0061  0.0554  -0.0510 29  GLU B OE1 
1388 O OE2 . GLU B 12  ? 1.2928 1.0881 1.0526 -0.0075 0.0876  -0.1010 29  GLU B OE2 
1389 N N   . PHE B 13  ? 1.4386 1.2313 1.3018 -0.0202 0.0638  -0.0701 30  PHE B N   
1390 C CA  . PHE B 13  ? 1.4283 1.2275 1.2722 -0.0193 0.0491  -0.0360 30  PHE B CA  
1391 C C   . PHE B 13  ? 1.4308 1.2204 1.2966 -0.0348 0.0560  -0.0738 30  PHE B C   
1392 O O   . PHE B 13  ? 1.4186 1.2103 1.2219 -0.0414 0.0514  -0.0659 30  PHE B O   
1393 C CB  . PHE B 13  ? 1.4495 1.2661 1.3665 -0.0118 0.0248  0.0242  30  PHE B CB  
1394 C CG  . PHE B 13  ? 1.4788 1.3165 1.3639 -0.0122 0.0142  0.0658  30  PHE B CG  
1395 C CD1 . PHE B 13  ? 1.4768 1.3435 1.2743 -0.0068 0.0152  0.0894  30  PHE B CD1 
1396 C CD2 . PHE B 13  ? 1.4799 1.3125 1.4347 -0.0186 0.0056  0.0742  30  PHE B CD2 
1397 C CE1 . PHE B 13  ? 1.4932 1.3885 1.2723 -0.0084 0.0127  0.1200  30  PHE B CE1 
1398 C CE2 . PHE B 13  ? 1.5014 1.3576 1.4343 -0.0199 -0.0019 0.1147  30  PHE B CE2 
1399 C CZ  . PHE B 13  ? 1.5087 1.3987 1.3528 -0.0151 0.0040  0.1373  30  PHE B CZ  
1400 N N   . SER B 14  ? 1.4471 1.2295 1.4139 -0.0422 0.0658  -0.1192 31  SER B N   
1401 C CA  . SER B 14  ? 1.4594 1.2398 1.4568 -0.0614 0.0742  -0.1734 31  SER B CA  
1402 C C   . SER B 14  ? 1.4833 1.2788 1.3694 -0.0880 0.0980  -0.2271 31  SER B C   
1403 O O   . SER B 14  ? 1.5442 1.3551 1.4607 -0.1090 0.1245  -0.3020 31  SER B O   
1404 C CB  . SER B 14  ? 1.4441 1.2186 1.6118 -0.0616 0.0792  -0.2187 31  SER B CB  
1405 N N   . THR B 15  ? 1.4161 1.2154 1.1845 -0.0912 0.0874  -0.1875 32  THR B N   
1406 C CA  . THR B 15  ? 1.3999 1.2198 1.0625 -0.1194 0.0982  -0.2068 32  THR B CA  
1407 C C   . THR B 15  ? 1.3909 1.2066 0.9770 -0.1146 0.0730  -0.1456 32  THR B C   
1408 O O   . THR B 15  ? 1.3952 1.2226 0.9251 -0.1412 0.0593  -0.1383 32  THR B O   
1409 C CB  . THR B 15  ? 1.3884 1.2183 1.0474 -0.1188 0.1213  -0.2272 32  THR B CB  
1410 O OG1 . THR B 15  ? 1.3831 1.2212 1.1358 -0.1238 0.1487  -0.2929 32  THR B OG1 
1411 C CG2 . THR B 15  ? 1.4130 1.2730 0.9666 -0.1532 0.1272  -0.2290 32  THR B CG2 
1412 N N   . LEU B 16  ? 1.3556 1.1597 0.9517 -0.0834 0.0652  -0.1047 33  LEU B N   
1413 C CA  . LEU B 16  ? 1.3180 1.1217 0.8727 -0.0743 0.0463  -0.0613 33  LEU B CA  
1414 C C   . LEU B 16  ? 1.2971 1.0994 0.8796 -0.0610 0.0322  -0.0311 33  LEU B C   
1415 O O   . LEU B 16  ? 1.2587 1.0653 0.8265 -0.0559 0.0194  -0.0051 33  LEU B O   
1416 C CB  . LEU B 16  ? 1.2834 1.0867 0.8347 -0.0520 0.0481  -0.0475 33  LEU B CB  
1417 C CG  . LEU B 16  ? 1.2790 1.0864 0.7945 -0.0666 0.0516  -0.0568 33  LEU B CG  
1418 N N   . ASP B 17  ? 1.3389 1.1386 0.9787 -0.0569 0.0336  -0.0339 34  ASP B N   
1419 C CA  . ASP B 17  ? 1.4091 1.2160 1.0812 -0.0463 0.0216  0.0027  34  ASP B CA  
1420 C C   . ASP B 17  ? 1.4148 1.2182 1.0700 -0.0644 0.0066  0.0059  34  ASP B C   
1421 O O   . ASP B 17  ? 1.4469 1.2598 1.1157 -0.0556 -0.0021 0.0381  34  ASP B O   
1422 C CB  . ASP B 17  ? 1.4017 1.2114 1.1599 -0.0391 0.0195  0.0158  34  ASP B CB  
1423 C CG  . ASP B 17  ? 1.4220 1.2172 1.2355 -0.0559 0.0142  -0.0140 34  ASP B CG  
1424 O OD1 . ASP B 17  ? 1.5161 1.3036 1.3099 -0.0746 0.0244  -0.0685 34  ASP B OD1 
1425 O OD2 . ASP B 17  ? 1.3976 1.1965 1.2778 -0.0535 0.0008  0.0143  34  ASP B OD2 
1426 N N   . SER B 18  ? 1.4227 1.2211 1.0497 -0.0936 0.0041  -0.0283 35  SER B N   
1427 C CA  . SER B 18  ? 1.4357 1.2372 1.0369 -0.1201 -0.0182 -0.0200 35  SER B CA  
1428 C C   . SER B 18  ? 1.3961 1.2023 0.9634 -0.1208 -0.0338 0.0160  35  SER B C   
1429 O O   . SER B 18  ? 1.4218 1.2293 1.0039 -0.1289 -0.0578 0.0457  35  SER B O   
1430 C CB  . SER B 18  ? 1.4882 1.3016 1.0507 -0.1621 -0.0169 -0.0690 35  SER B CB  
1431 O OG  . SER B 18  ? 1.5554 1.3837 1.0612 -0.1768 -0.0021 -0.0873 35  SER B OG  
1432 N N   . ILE B 19  ? 1.3472 1.1554 0.8892 -0.1122 -0.0231 0.0136  36  ILE B N   
1433 C CA  . ILE B 19  ? 1.3279 1.1387 0.8721 -0.1076 -0.0394 0.0443  36  ILE B CA  
1434 C C   . ILE B 19  ? 1.2494 1.0633 0.8472 -0.0703 -0.0318 0.0572  36  ILE B C   
1435 O O   . ILE B 19  ? 1.2424 1.0610 0.8815 -0.0663 -0.0476 0.0778  36  ILE B O   
1436 C CB  . ILE B 19  ? 1.3446 1.1585 0.8580 -0.1117 -0.0328 0.0365  36  ILE B CB  
1437 C CG1 . ILE B 19  ? 1.4053 1.2366 0.8589 -0.1590 -0.0371 0.0263  36  ILE B CG1 
1438 C CG2 . ILE B 19  ? 1.3330 1.1467 0.8847 -0.1015 -0.0527 0.0649  36  ILE B CG2 
1439 C CD1 . ILE B 19  ? 1.4216 1.2586 0.8549 -0.1629 -0.0031 -0.0255 36  ILE B CD1 
1440 N N   . ILE B 20  ? 1.1915 1.0115 0.7976 -0.0476 -0.0085 0.0455  37  ILE B N   
1441 C CA  . ILE B 20  ? 1.1397 0.9844 0.7796 -0.0219 0.0036  0.0554  37  ILE B CA  
1442 C C   . ILE B 20  ? 1.1214 0.9764 0.8055 -0.0237 -0.0044 0.0767  37  ILE B C   
1443 O O   . ILE B 20  ? 1.0849 0.9608 0.8080 -0.0125 -0.0014 0.0798  37  ILE B O   
1444 C CB  . ILE B 20  ? 1.1403 1.0022 0.7784 -0.0095 0.0213  0.0555  37  ILE B CB  
1445 C CG1 . ILE B 20  ? 1.0707 0.9246 0.6785 -0.0054 0.0273  0.0357  37  ILE B CG1 
1446 C CG2 . ILE B 20  ? 1.1386 1.0485 0.7962 0.0039  0.0347  0.0698  37  ILE B CG2 
1447 N N   . ARG B 21  ? 1.1784 1.0203 0.8698 -0.0386 -0.0142 0.0850  38  ARG B N   
1448 C CA  . ARG B 21  ? 1.1967 1.0434 0.9350 -0.0444 -0.0277 0.1080  38  ARG B CA  
1449 C C   . ARG B 21  ? 1.2069 1.0435 0.9602 -0.0598 -0.0551 0.1199  38  ARG B C   
1450 O O   . ARG B 21  ? 1.1983 1.0513 1.0116 -0.0489 -0.0565 0.1344  38  ARG B O   
1451 C CB  . ARG B 21  ? 1.2529 1.0846 1.0040 -0.0598 -0.0371 0.1064  38  ARG B CB  
1452 C CG  . ARG B 21  ? 1.3172 1.1635 1.1028 -0.0462 -0.0213 0.1155  38  ARG B CG  
1453 C CD  . ARG B 21  ? 1.3875 1.2109 1.2027 -0.0603 -0.0299 0.0940  38  ARG B CD  
1454 N NE  . ARG B 21  ? 1.4464 1.2845 1.3267 -0.0493 -0.0246 0.1174  38  ARG B NE  
1455 C CZ  . ARG B 21  ? 1.5364 1.3581 1.4827 -0.0554 -0.0307 0.0991  38  ARG B CZ  
1456 N NH1 . ARG B 21  ? 1.5946 1.3902 1.5377 -0.0729 -0.0336 0.0411  38  ARG B NH1 
1457 N NH2 . ARG B 21  ? 1.5536 1.3930 1.5795 -0.0483 -0.0352 0.1383  38  ARG B NH2 
1458 N N   . THR B 22  ? 1.2099 1.0281 0.9184 -0.0894 -0.0779 0.1158  39  THR B N   
1459 C CA  . THR B 22  ? 1.2712 1.0869 1.0000 -0.1147 -0.1163 0.1447  39  THR B CA  
1460 C C   . THR B 22  ? 1.2201 1.0411 1.0023 -0.1000 -0.1226 0.1575  39  THR B C   
1461 O O   . THR B 22  ? 1.2411 1.0621 1.0863 -0.1149 -0.1581 0.1907  39  THR B O   
1462 C CB  . THR B 22  ? 1.3589 1.1736 1.0151 -0.1632 -0.1427 0.1445  39  THR B CB  
1463 O OG1 . THR B 22  ? 1.4183 1.2350 1.0111 -0.1646 -0.1185 0.1132  39  THR B OG1 
1464 C CG2 . THR B 22  ? 1.4141 1.2287 1.0537 -0.1873 -0.1519 0.1308  39  THR B CG2 
1465 N N   . HIS B 23  ? 1.1408 0.9677 0.9151 -0.0729 -0.0931 0.1312  40  HIS B N   
1466 C CA  . HIS B 23  ? 1.1054 0.9368 0.9434 -0.0609 -0.1009 0.1310  40  HIS B CA  
1467 C C   . HIS B 23  ? 1.0509 0.9075 0.9301 -0.0225 -0.0628 0.0924  40  HIS B C   
1468 O O   . HIS B 23  ? 0.9953 0.8645 0.9723 -0.0095 -0.0665 0.0814  40  HIS B O   
1469 C CB  . HIS B 23  ? 1.1257 0.9459 0.9156 -0.0818 -0.1171 0.1373  40  HIS B CB  
1470 C CG  . HIS B 23  ? 1.1987 1.0164 0.9517 -0.1311 -0.1576 0.1775  40  HIS B CG  
1471 N ND1 . HIS B 23  ? 1.2388 1.0597 1.0635 -0.1577 -0.2078 0.2286  40  HIS B ND1 
1472 C CD2 . HIS B 23  ? 1.2291 1.0516 0.8861 -0.1643 -0.1568 0.1722  40  HIS B CD2 
1473 C CE1 . HIS B 23  ? 1.2721 1.1053 1.0272 -0.2102 -0.2387 0.2609  40  HIS B CE1 
1474 N NE2 . HIS B 23  ? 1.2846 1.1213 0.9341 -0.2148 -0.2042 0.2190  40  HIS B NE2 
1475 N N   . HIS B 24  ? 1.0237 0.8945 0.8390 -0.0089 -0.0290 0.0705  41  HIS B N   
1476 C CA  . HIS B 24  ? 1.0068 0.9154 0.8325 0.0158  0.0045  0.0343  41  HIS B CA  
1477 C C   . HIS B 24  ? 1.0280 0.9859 0.8745 0.0253  0.0335  0.0308  41  HIS B C   
1478 O O   . HIS B 24  ? 1.0116 1.0207 0.8812 0.0384  0.0622  -0.0043 41  HIS B O   
1479 C CB  . HIS B 24  ? 0.9901 0.8945 0.7372 0.0184  0.0165  0.0208  41  HIS B CB  
1480 C CG  . HIS B 24  ? 0.9833 0.8589 0.7248 0.0133  -0.0016 0.0142  41  HIS B CG  
1481 N ND1 . HIS B 24  ? 0.9716 0.8552 0.7760 0.0249  -0.0058 -0.0105 41  HIS B ND1 
1482 C CD2 . HIS B 24  ? 0.9981 0.8437 0.6896 -0.0051 -0.0158 0.0282  41  HIS B CD2 
1483 C CE1 . HIS B 24  ? 0.9884 0.8442 0.7828 0.0138  -0.0269 -0.0002 41  HIS B CE1 
1484 N NE2 . HIS B 24  ? 0.9973 0.8342 0.7160 -0.0059 -0.0305 0.0234  41  HIS B NE2 
1485 N N   . THR B 25  ? 1.0452 0.9962 0.8863 0.0147  0.0268  0.0644  42  THR B N   
1486 C CA  . THR B 25  ? 1.0540 1.0569 0.9164 0.0182  0.0520  0.0747  42  THR B CA  
1487 C C   . THR B 25  ? 1.0798 1.1161 1.0393 0.0253  0.0625  0.0615  42  THR B C   
1488 O O   . THR B 25  ? 1.0770 1.0800 1.0972 0.0193  0.0343  0.0797  42  THR B O   
1489 C CB  . THR B 25  ? 1.0497 1.0316 0.8979 0.0046  0.0370  0.1153  42  THR B CB  
1490 O OG1 . THR B 25  ? 1.0260 0.9887 0.8140 0.0005  0.0342  0.1175  42  THR B OG1 
1491 C CG2 . THR B 25  ? 1.0738 1.1138 0.9592 0.0041  0.0580  0.1397  42  THR B CG2 
1492 N N   . PHE B 26  ? 0.9204 1.1727 0.8266 -0.1663 0.0007  -0.0402 43  PHE B N   
1493 C CA  . PHE B 26  ? 0.9900 1.2780 0.8835 -0.1622 -0.0071 -0.0367 43  PHE B CA  
1494 C C   . PHE B 26  ? 1.0355 1.3342 0.9307 -0.1796 0.0008  -0.0430 43  PHE B C   
1495 O O   . PHE B 26  ? 1.0676 1.3344 0.9716 -0.1872 0.0081  -0.0392 43  PHE B O   
1496 C CB  . PHE B 26  ? 0.9798 1.2566 0.8666 -0.1420 -0.0189 -0.0191 43  PHE B CB  
1497 C CG  . PHE B 26  ? 0.9714 1.2455 0.8531 -0.1248 -0.0276 -0.0129 43  PHE B CG  
1498 C CD1 . PHE B 26  ? 0.9549 1.2621 0.8277 -0.1156 -0.0339 -0.0127 43  PHE B CD1 
1499 C CD2 . PHE B 26  ? 0.9787 1.2179 0.8656 -0.1177 -0.0291 -0.0057 43  PHE B CD2 
1500 C CE1 . PHE B 26  ? 0.9530 1.2539 0.8212 -0.1004 -0.0408 -0.0052 43  PHE B CE1 
1501 C CE2 . PHE B 26  ? 0.9588 1.1947 0.8405 -0.1041 -0.0361 -0.0003 43  PHE B CE2 
1502 C CZ  . PHE B 26  ? 0.9471 1.2113 0.8188 -0.0957 -0.0415 0.0000  43  PHE B CZ  
1503 N N   . PRO B 27  ? 1.0946 1.4402 0.9824 -0.1857 -0.0006 -0.0508 44  PRO B N   
1504 C CA  . PRO B 27  ? 1.1333 1.4929 1.0220 -0.2033 0.0068  -0.0569 44  PRO B CA  
1505 C C   . PRO B 27  ? 1.1313 1.4771 1.0166 -0.1946 0.0020  -0.0414 44  PRO B C   
1506 O O   . PRO B 27  ? 1.0653 1.4293 0.9426 -0.1774 -0.0085 -0.0329 44  PRO B O   
1507 C CB  . PRO B 27  ? 1.1455 1.5667 1.0273 -0.2079 0.0037  -0.0669 44  PRO B CB  
1508 C CG  . PRO B 27  ? 1.1178 1.5538 0.9939 -0.1851 -0.0086 -0.0582 44  PRO B CG  
1509 C CD  . PRO B 27  ? 1.1196 1.5097 0.9996 -0.1781 -0.0082 -0.0538 44  PRO B CD  
1510 N N   . ARG B 28  ? 1.1780 1.4913 1.0701 -0.2070 0.0108  -0.0376 45  ARG B N   
1511 C CA  . ARG B 28  ? 1.1666 1.4690 1.0548 -0.2041 0.0079  -0.0225 45  ARG B CA  
1512 C C   . ARG B 28  ? 1.1051 1.4544 0.9829 -0.2041 0.0036  -0.0253 45  ARG B C   
1513 O O   . ARG B 28  ? 1.0815 1.4650 0.9595 -0.2195 0.0095  -0.0391 45  ARG B O   
1514 C CB  . ARG B 28  ? 1.1743 1.4440 1.0725 -0.2232 0.0212  -0.0198 45  ARG B CB  
1515 C CG  . ARG B 28  ? 1.1925 1.4500 1.0868 -0.2234 0.0192  -0.0014 45  ARG B CG  
1516 C CD  . ARG B 28  ? 1.2279 1.4686 1.1299 -0.2475 0.0343  -0.0018 45  ARG B CD  
1517 N N   . SER B 29  ? 1.0559 1.4088 0.9257 -0.1873 -0.0059 -0.0137 46  SER B N   
1518 C CA  . SER B 29  ? 1.0515 1.4471 0.9138 -0.1838 -0.0093 -0.0162 46  SER B CA  
1519 C C   . SER B 29  ? 1.0836 1.4686 0.9392 -0.1849 -0.0101 -0.0043 46  SER B C   
1520 O O   . SER B 29  ? 1.0349 1.3823 0.8906 -0.1825 -0.0117 0.0087  46  SER B O   
1521 C CB  . SER B 29  ? 1.0302 1.4466 0.8895 -0.1603 -0.0190 -0.0167 46  SER B CB  
1522 O OG  . SER B 29  ? 1.0219 1.4762 0.8773 -0.1524 -0.0215 -0.0182 46  SER B OG  
1523 N N   . PRO B 30  ? 1.1357 1.5580 0.9861 -0.1894 -0.0087 -0.0083 47  PRO B N   
1524 C CA  . PRO B 30  ? 1.1535 1.5691 0.9955 -0.1906 -0.0096 0.0026  47  PRO B CA  
1525 C C   . PRO B 30  ? 1.1106 1.5226 0.9463 -0.1678 -0.0188 0.0071  47  PRO B C   
1526 O O   . PRO B 30  ? 1.0838 1.5108 0.9218 -0.1508 -0.0230 0.0001  47  PRO B O   
1527 C CB  . PRO B 30  ? 1.1511 1.6115 0.9902 -0.2034 -0.0040 -0.0057 47  PRO B CB  
1528 C CG  . PRO B 30  ? 1.1537 1.6522 0.9999 -0.2006 -0.0035 -0.0207 47  PRO B CG  
1529 C CD  . PRO B 30  ? 1.1235 1.5989 0.9753 -0.1913 -0.0072 -0.0216 47  PRO B CD  
1530 N N   . ASN B 31  ? 1.0630 1.4555 0.8912 -0.1684 -0.0212 0.0191  48  ASN B N   
1531 C CA  . ASN B 31  ? 1.0393 1.4269 0.8603 -0.1510 -0.0282 0.0213  48  ASN B CA  
1532 C C   . ASN B 31  ? 0.9968 1.3609 0.8228 -0.1338 -0.0341 0.0210  48  ASN B C   
1533 O O   . ASN B 31  ? 1.0160 1.3849 0.8390 -0.1174 -0.0377 0.0163  48  ASN B O   
1534 C CB  . ASN B 31  ? 1.0425 1.4694 0.8591 -0.1431 -0.0267 0.0098  48  ASN B CB  
1535 C CG  . ASN B 31  ? 1.0938 1.5457 0.9031 -0.1603 -0.0211 0.0102  48  ASN B CG  
1536 O OD1 . ASN B 31  ? 1.1522 1.5919 0.9522 -0.1700 -0.0217 0.0212  48  ASN B OD1 
1537 N ND2 . ASN B 31  ? 1.0625 1.5534 0.8761 -0.1647 -0.0156 -0.0008 48  ASN B ND2 
1538 N N   . THR B 32  ? 0.9362 1.2744 0.7706 -0.1382 -0.0336 0.0253  49  THR B N   
1539 C CA  . THR B 32  ? 0.9110 1.2261 0.7495 -0.1243 -0.0387 0.0261  49  THR B CA  
1540 C C   . THR B 32  ? 0.8724 1.1510 0.7154 -0.1278 -0.0404 0.0390  49  THR B C   
1541 O O   . THR B 32  ? 0.8948 1.1638 0.7397 -0.1405 -0.0372 0.0488  49  THR B O   
1542 C CB  . THR B 32  ? 0.9199 1.2443 0.7664 -0.1222 -0.0367 0.0163  49  THR B CB  
1543 O OG1 . THR B 32  ? 0.9090 1.2267 0.7634 -0.1400 -0.0294 0.0143  49  THR B OG1 
1544 C CG2 . THR B 32  ? 0.9110 1.2766 0.7560 -0.1148 -0.0367 0.0066  49  THR B CG2 
1545 N N   . CYS B 33  ? 0.8248 1.0846 0.6706 -0.1160 -0.0451 0.0400  50  CYS B N   
1546 C CA  . CYS B 33  ? 0.8027 1.0319 0.6556 -0.1160 -0.0473 0.0516  50  CYS B CA  
1547 C C   . CYS B 33  ? 0.8087 1.0244 0.6704 -0.1093 -0.0470 0.0456  50  CYS B C   
1548 O O   . CYS B 33  ? 0.7875 1.0119 0.6445 -0.0984 -0.0502 0.0383  50  CYS B O   
1549 C CB  . CYS B 33  ? 0.7663 0.9914 0.6101 -0.1093 -0.0548 0.0598  50  CYS B CB  
1550 S SG  . CYS B 33  ? 0.7555 0.9518 0.6085 -0.1045 -0.0600 0.0722  50  CYS B SG  
1551 N N   . THR B 34  ? 0.8057 1.0003 0.6812 -0.1157 -0.0422 0.0492  51  THR B N   
1552 C CA  . THR B 34  ? 0.7995 0.9823 0.6841 -0.1116 -0.0403 0.0425  51  THR B CA  
1553 C C   . THR B 34  ? 0.7909 0.9446 0.6904 -0.1108 -0.0391 0.0527  51  THR B C   
1554 O O   . THR B 34  ? 0.8019 0.9430 0.7100 -0.1171 -0.0358 0.0639  51  THR B O   
1555 C CB  . THR B 34  ? 0.8119 1.0065 0.7017 -0.1224 -0.0312 0.0280  51  THR B CB  
1556 O OG1 . THR B 34  ? 0.8317 1.0209 0.7272 -0.1189 -0.0299 0.0202  51  THR B OG1 
1557 C CG2 . THR B 34  ? 0.7934 0.9737 0.6953 -0.1381 -0.0206 0.0294  51  THR B CG2 
1558 N N   . SER B 35  ? 0.7873 0.9320 0.6910 -0.1026 -0.0415 0.0501  52  SER B N   
1559 C CA  . SER B 35  ? 0.8049 0.9259 0.7273 -0.1015 -0.0380 0.0558  52  SER B CA  
1560 C C   . SER B 35  ? 0.7686 0.8869 0.6950 -0.0969 -0.0368 0.0454  52  SER B C   
1561 O O   . SER B 35  ? 0.7173 0.8512 0.6309 -0.0939 -0.0398 0.0365  52  SER B O   
1562 C CB  . SER B 35  ? 0.7978 0.9105 0.7227 -0.0954 -0.0459 0.0745  52  SER B CB  
1563 O OG  . SER B 35  ? 0.7952 0.9154 0.7074 -0.0870 -0.0553 0.0741  52  SER B OG  
1564 N N   . LEU B 36  ? 0.7811 0.8806 0.7268 -0.0960 -0.0318 0.0480  53  LEU B N   
1565 C CA  . LEU B 36  ? 0.7912 0.8879 0.7433 -0.0935 -0.0288 0.0381  53  LEU B CA  
1566 C C   . LEU B 36  ? 0.7895 0.8736 0.7536 -0.0844 -0.0336 0.0505  53  LEU B C   
1567 O O   . LEU B 36  ? 0.8390 0.9095 0.8215 -0.0831 -0.0308 0.0621  53  LEU B O   
1568 C CB  . LEU B 36  ? 0.8083 0.8977 0.7764 -0.1041 -0.0137 0.0238  53  LEU B CB  
1569 C CG  . LEU B 36  ? 0.8200 0.9060 0.7996 -0.1057 -0.0056 0.0103  53  LEU B CG  
1570 C CD1 . LEU B 36  ? 0.8237 0.8908 0.8247 -0.0969 -0.0045 0.0196  53  LEU B CD1 
1571 C CD2 . LEU B 36  ? 0.8475 0.9553 0.8075 -0.1040 -0.0122 0.0028  53  LEU B CD2 
1572 N N   . ILE B 37  ? 0.7538 0.8439 0.7082 -0.0785 -0.0406 0.0492  54  ILE B N   
1573 C CA  . ILE B 37  ? 0.7365 0.8202 0.7016 -0.0718 -0.0450 0.0581  54  ILE B CA  
1574 C C   . ILE B 37  ? 0.7485 0.8297 0.7247 -0.0723 -0.0379 0.0466  54  ILE B C   
1575 O O   . ILE B 37  ? 0.7607 0.8501 0.7256 -0.0764 -0.0348 0.0336  54  ILE B O   
1576 C CB  . ILE B 37  ? 0.7212 0.8131 0.6669 -0.0674 -0.0569 0.0641  54  ILE B CB  
1577 C CG1 . ILE B 37  ? 0.7300 0.8277 0.6650 -0.0683 -0.0630 0.0739  54  ILE B CG1 
1578 C CG2 . ILE B 37  ? 0.7185 0.8085 0.6743 -0.0634 -0.0611 0.0711  54  ILE B CG2 
1579 N N   . ALA B 38  ? 0.7384 0.8116 0.7372 -0.0683 -0.0352 0.0523  55  ALA B N   
1580 C CA  . ALA B 38  ? 0.7048 0.7768 0.7176 -0.0691 -0.0268 0.0408  55  ALA B CA  
1581 C C   . ALA B 38  ? 0.6980 0.7738 0.7176 -0.0627 -0.0338 0.0499  55  ALA B C   
1582 O O   . ALA B 38  ? 0.7292 0.8042 0.7617 -0.0570 -0.0388 0.0654  55  ALA B O   
1583 C CB  . ALA B 38  ? 0.7011 0.7595 0.7427 -0.0709 -0.0121 0.0356  55  ALA B CB  
1584 N N   . HIS B 39  ? 0.7431 0.8257 0.7547 -0.0646 -0.0339 0.0412  56  HIS B N   
1585 C CA  . HIS B 39  ? 0.7615 0.8498 0.7792 -0.0609 -0.0396 0.0481  56  HIS B CA  
1586 C C   . HIS B 39  ? 0.7776 0.8702 0.8065 -0.0637 -0.0309 0.0360  56  HIS B C   
1587 O O   . HIS B 39  ? 0.8561 0.9530 0.8675 -0.0698 -0.0286 0.0251  56  HIS B O   
1588 C CB  . HIS B 39  ? 0.7761 0.8690 0.7660 -0.0621 -0.0511 0.0524  56  HIS B CB  
1589 C CG  . HIS B 39  ? 0.7936 0.8938 0.7877 -0.0613 -0.0575 0.0594  56  HIS B CG  
1590 N ND1 . HIS B 39  ? 0.8342 0.9371 0.8174 -0.0655 -0.0579 0.0535  56  HIS B ND1 
1591 C CD2 . HIS B 39  ? 0.8058 0.9142 0.8141 -0.0580 -0.0636 0.0724  56  HIS B CD2 
1592 C CE1 . HIS B 39  ? 0.8385 0.9503 0.8288 -0.0660 -0.0635 0.0604  56  HIS B CE1 
1593 N NE2 . HIS B 39  ? 0.8286 0.9464 0.8343 -0.0613 -0.0676 0.0721  56  HIS B NE2 
1594 N N   . ARG B 40  ? 0.7926 0.8865 0.8515 -0.0589 -0.0259 0.0388  57  ARG B N   
1595 C CA  . ARG B 40  ? 0.8244 0.9257 0.8964 -0.0617 -0.0169 0.0268  57  ARG B CA  
1596 C C   . ARG B 40  ? 0.8182 0.9309 0.8734 -0.0651 -0.0254 0.0291  57  ARG B C   
1597 O O   . ARG B 40  ? 0.8852 1.0023 0.9365 -0.0623 -0.0365 0.0421  57  ARG B O   
1598 C CB  . ARG B 40  ? 0.8573 0.9586 0.9699 -0.0534 -0.0087 0.0301  57  ARG B CB  
1599 C CG  . ARG B 40  ? 0.9176 1.0064 1.0531 -0.0540 0.0092  0.0162  57  ARG B CG  
1600 C CD  . ARG B 40  ? 0.9630 1.0488 1.1434 -0.0424 0.0183  0.0222  57  ARG B CD  
1601 N NE  . ARG B 40  ? 0.9996 1.0660 1.1996 -0.0353 0.0231  0.0327  57  ARG B NE  
1602 C CZ  . ARG B 40  ? 1.0514 1.1159 1.2479 -0.0287 0.0105  0.0562  57  ARG B CZ  
1603 N NH1 . ARG B 40  ? 1.0634 1.1449 1.2377 -0.0288 -0.0076 0.0698  57  ARG B NH1 
1604 N NH2 . ARG B 40  ? 1.0923 1.1376 1.3073 -0.0236 0.0171  0.0658  57  ARG B NH2 
1605 N N   . VAL B 41  ? 0.8102 0.9285 0.8550 -0.0729 -0.0194 0.0161  58  VAL B N   
1606 C CA  . VAL B 41  ? 0.7918 0.9186 0.8221 -0.0784 -0.0240 0.0168  58  VAL B CA  
1607 C C   . VAL B 41  ? 0.7946 0.9337 0.8430 -0.0830 -0.0123 0.0045  58  VAL B C   
1608 O O   . VAL B 41  ? 0.7840 0.9251 0.8360 -0.0877 -0.0008 -0.0095 58  VAL B O   
1609 C CB  . VAL B 41  ? 0.8122 0.9349 0.8073 -0.0844 -0.0279 0.0154  58  VAL B CB  
1610 C CG1 . VAL B 41  ? 0.8293 0.9551 0.8091 -0.0904 -0.0318 0.0184  58  VAL B CG1 
1611 C CG2 . VAL B 41  ? 0.8138 0.9259 0.7934 -0.0795 -0.0366 0.0239  58  VAL B CG2 
1612 N N   . ASP B 42  ? 0.8238 0.9743 0.8836 -0.0833 -0.0145 0.0084  59  ASP B N   
1613 C CA  . ASP B 42  ? 0.8587 1.0242 0.9329 -0.0892 -0.0034 -0.0037 59  ASP B CA  
1614 C C   . ASP B 42  ? 0.8700 1.0389 0.9123 -0.1018 -0.0046 -0.0071 59  ASP B C   
1615 O O   . ASP B 42  ? 0.8216 0.9965 0.8563 -0.1072 -0.0093 -0.0020 59  ASP B O   
1616 C CB  . ASP B 42  ? 0.8672 1.0484 0.9718 -0.0839 -0.0040 0.0017  59  ASP B CB  
1617 C CG  . ASP B 42  ? 0.9128 1.1104 1.0426 -0.0869 0.0111  -0.0134 59  ASP B CG  
1618 O OD1 . ASP B 42  ? 0.8964 1.0891 1.0440 -0.0841 0.0243  -0.0258 59  ASP B OD1 
1619 O OD2 . ASP B 42  ? 0.8901 1.1056 1.0223 -0.0931 0.0109  -0.0144 59  ASP B OD2 
1620 N N   . ALA B 43  ? 0.8548 1.0205 0.8784 -0.1070 -0.0002 -0.0147 60  ALA B N   
1621 C CA  . ALA B 43  ? 0.8651 1.0347 0.8582 -0.1175 -0.0010 -0.0147 60  ALA B CA  
1622 C C   . ALA B 43  ? 0.8509 1.0285 0.8354 -0.1232 0.0071  -0.0264 60  ALA B C   
1623 O O   . ALA B 43  ? 0.9016 1.0730 0.8919 -0.1184 0.0083  -0.0299 60  ALA B O   
1624 C CB  . ALA B 43  ? 0.8713 1.0249 0.8379 -0.1147 -0.0139 0.0005  60  ALA B CB  
1625 N N   . PRO B 44  ? 0.8222 1.0163 0.7920 -0.1354 0.0129  -0.0324 61  PRO B N   
1626 C CA  . PRO B 44  ? 0.8135 1.0218 0.7734 -0.1431 0.0199  -0.0438 61  PRO B CA  
1627 C C   . PRO B 44  ? 0.7937 0.9950 0.7293 -0.1385 0.0095  -0.0319 61  PRO B C   
1628 O O   . PRO B 44  ? 0.8200 1.0064 0.7409 -0.1317 -0.0016 -0.0150 61  PRO B O   
1629 C CB  . PRO B 44  ? 0.8346 1.0659 0.7809 -0.1578 0.0262  -0.0484 61  PRO B CB  
1630 C CG  . PRO B 44  ? 0.8345 1.0552 0.7702 -0.1563 0.0176  -0.0317 61  PRO B CG  
1631 C CD  . PRO B 44  ? 0.8439 1.0461 0.8022 -0.1442 0.0126  -0.0275 61  PRO B CD  
1632 N N   . ALA B 45  ? 0.7675 0.9806 0.7003 -0.1428 0.0144  -0.0423 62  ALA B N   
1633 C CA  . ALA B 45  ? 0.7538 0.9641 0.6691 -0.1374 0.0055  -0.0328 62  ALA B CA  
1634 C C   . ALA B 45  ? 0.7503 0.9694 0.6362 -0.1380 -0.0031 -0.0163 62  ALA B C   
1635 O O   . ALA B 45  ? 0.7728 0.9830 0.6463 -0.1286 -0.0127 -0.0029 62  ALA B O   
1636 C CB  . ALA B 45  ? 0.7573 0.9839 0.6768 -0.1454 0.0141  -0.0499 62  ALA B CB  
1637 N N   . HIS B 46  ? 0.7297 0.9668 0.6053 -0.1488 0.0009  -0.0164 63  HIS B N   
1638 C CA  . HIS B 46  ? 0.7174 0.9635 0.5661 -0.1491 -0.0062 0.0023  63  HIS B CA  
1639 C C   . HIS B 46  ? 0.6903 0.9039 0.5342 -0.1377 -0.0150 0.0208  63  HIS B C   
1640 O O   . HIS B 46  ? 0.7036 0.9077 0.5333 -0.1281 -0.0231 0.0372  63  HIS B O   
1641 C CB  . HIS B 46  ? 0.7145 0.9905 0.5521 -0.1656 0.0008  -0.0010 63  HIS B CB  
1642 C CG  . HIS B 46  ? 0.7009 0.9663 0.5441 -0.1702 0.0046  -0.0001 63  HIS B CG  
1643 N ND1 . HIS B 46  ? 0.6861 0.9529 0.5533 -0.1756 0.0148  -0.0196 63  HIS B ND1 
1644 C CD2 . HIS B 46  ? 0.6981 0.9505 0.5280 -0.1700 0.0002  0.0180  63  HIS B CD2 
1645 C CE1 . HIS B 46  ? 0.6846 0.9441 0.5524 -0.1790 0.0155  -0.0137 63  HIS B CE1 
1646 N NE2 . HIS B 46  ? 0.6820 0.9313 0.5264 -0.1769 0.0071  0.0084  63  HIS B NE2 
1647 N N   . ALA B 47  ? 0.6743 0.8724 0.5321 -0.1388 -0.0124 0.0167  64  ALA B N   
1648 C CA  . ALA B 47  ? 0.6764 0.8460 0.5304 -0.1320 -0.0190 0.0302  64  ALA B CA  
1649 C C   . ALA B 47  ? 0.6568 0.8058 0.5110 -0.1180 -0.0271 0.0362  64  ALA B C   
1650 O O   . ALA B 47  ? 0.6396 0.7686 0.4811 -0.1116 -0.0327 0.0497  64  ALA B O   
1651 C CB  . ALA B 47  ? 0.6659 0.8308 0.5386 -0.1368 -0.0149 0.0220  64  ALA B CB  
1652 N N   . ILE B 48  ? 0.6458 0.7996 0.5148 -0.1142 -0.0263 0.0256  65  ILE B N   
1653 C CA  . ILE B 48  ? 0.6549 0.7938 0.5244 -0.1028 -0.0331 0.0300  65  ILE B CA  
1654 C C   . ILE B 48  ? 0.6806 0.8268 0.5320 -0.0976 -0.0371 0.0388  65  ILE B C   
1655 O O   . ILE B 48  ? 0.7243 0.8544 0.5653 -0.0884 -0.0430 0.0506  65  ILE B O   
1656 C CB  . ILE B 48  ? 0.6338 0.7750 0.5247 -0.1011 -0.0302 0.0181  65  ILE B CB  
1657 C CG1 . ILE B 48  ? 0.6179 0.7561 0.5313 -0.1038 -0.0259 0.0117  65  ILE B CG1 
1658 C CG2 . ILE B 48  ? 0.6343 0.7610 0.5243 -0.0909 -0.0376 0.0243  65  ILE B CG2 
1659 C CD1 . ILE B 48  ? 0.6132 0.7552 0.5517 -0.1029 -0.0191 0.0001  65  ILE B CD1 
1660 N N   . TRP B 49  ? 0.7145 0.8879 0.5633 -0.1039 -0.0331 0.0323  66  TRP B N   
1661 C CA  . TRP B 49  ? 0.7037 0.8941 0.5374 -0.0996 -0.0373 0.0410  66  TRP B CA  
1662 C C   . TRP B 49  ? 0.6998 0.8808 0.5165 -0.0922 -0.0424 0.0617  66  TRP B C   
1663 O O   . TRP B 49  ? 0.6846 0.8635 0.4942 -0.0805 -0.0477 0.0731  66  TRP B O   
1664 C CB  . TRP B 49  ? 0.7312 0.9591 0.5622 -0.1124 -0.0314 0.0305  66  TRP B CB  
1665 C CG  . TRP B 49  ? 0.7614 1.0162 0.5780 -0.1092 -0.0364 0.0402  66  TRP B CG  
1666 C CD1 . TRP B 49  ? 0.7485 1.0302 0.5489 -0.1128 -0.0382 0.0528  66  TRP B CD1 
1667 C CD2 . TRP B 49  ? 0.7702 1.0310 0.5883 -0.1012 -0.0408 0.0403  66  TRP B CD2 
1668 N NE1 . TRP B 49  ? 0.7898 1.0961 0.5828 -0.1064 -0.0439 0.0614  66  TRP B NE1 
1669 C CE2 . TRP B 49  ? 0.7755 1.0699 0.5793 -0.0997 -0.0452 0.0527  66  TRP B CE2 
1670 C CE3 . TRP B 49  ? 0.7791 1.0232 0.6093 -0.0959 -0.0412 0.0321  66  TRP B CE3 
1671 C CZ2 . TRP B 49  ? 0.7649 1.0783 0.5676 -0.0927 -0.0499 0.0556  66  TRP B CZ2 
1672 C CZ3 . TRP B 49  ? 0.7703 1.0309 0.5976 -0.0904 -0.0453 0.0343  66  TRP B CZ3 
1673 C CH2 . TRP B 49  ? 0.7564 1.0521 0.5708 -0.0888 -0.0494 0.0451  66  TRP B CH2 
1674 N N   . ARG B 50  ? 0.7117 0.8857 0.5235 -0.0986 -0.0397 0.0669  67  ARG B N   
1675 C CA  . ARG B 50  ? 0.7686 0.9268 0.5658 -0.0925 -0.0424 0.0875  67  ARG B CA  
1676 C C   . ARG B 50  ? 0.7285 0.8535 0.5267 -0.0780 -0.0467 0.0942  67  ARG B C   
1677 O O   . ARG B 50  ? 0.7487 0.8636 0.5372 -0.0677 -0.0487 0.1112  67  ARG B O   
1678 C CB  . ARG B 50  ? 0.8539 1.0038 0.6478 -0.1039 -0.0376 0.0896  67  ARG B CB  
1679 C CG  . ARG B 50  ? 0.9583 1.0970 0.7356 -0.1015 -0.0380 0.1126  67  ARG B CG  
1680 C CD  . ARG B 50  ? 1.0460 1.1416 0.8224 -0.0900 -0.0395 0.1217  67  ARG B CD  
1681 N NE  . ARG B 50  ? 1.0609 1.1334 0.8456 -0.0980 -0.0366 0.1099  67  ARG B NE  
1682 C CZ  . ARG B 50  ? 1.1105 1.1688 0.8903 -0.1088 -0.0319 0.1141  67  ARG B CZ  
1683 N NH1 . ARG B 50  ? 1.1650 1.2254 0.9308 -0.1127 -0.0290 0.1315  67  ARG B NH1 
1684 N NH2 . ARG B 50  ? 1.0995 1.1440 0.8885 -0.1167 -0.0300 0.1020  67  ARG B NH2 
1685 N N   . PHE B 51  ? 0.6285 0.7873 0.4849 -0.0080 -0.0210 0.0963  68  PHE B N   
1686 C CA  . PHE B 51  ? 0.5827 0.7377 0.4438 -0.0107 -0.0205 0.0940  68  PHE B CA  
1687 C C   . PHE B 51  ? 0.5928 0.7520 0.4502 -0.0114 -0.0246 0.0933  68  PHE B C   
1688 O O   . PHE B 51  ? 0.5857 0.7457 0.4449 -0.0102 -0.0230 0.0951  68  PHE B O   
1689 C CB  . PHE B 51  ? 0.5584 0.7089 0.4227 -0.0147 -0.0216 0.0883  68  PHE B CB  
1690 C CG  . PHE B 51  ? 0.5224 0.6679 0.3937 -0.0145 -0.0171 0.0883  68  PHE B CG  
1691 C CD1 . PHE B 51  ? 0.5153 0.6578 0.3963 -0.0129 -0.0121 0.0900  68  PHE B CD1 
1692 C CD2 . PHE B 51  ? 0.5069 0.6510 0.3771 -0.0158 -0.0177 0.0868  68  PHE B CD2 
1693 C CE1 . PHE B 51  ? 0.5219 0.6598 0.4129 -0.0128 -0.0078 0.0905  68  PHE B CE1 
1694 C CE2 . PHE B 51  ? 0.5111 0.6510 0.3894 -0.0156 -0.0133 0.0873  68  PHE B CE2 
1695 C CZ  . PHE B 51  ? 0.5163 0.6531 0.4059 -0.0141 -0.0083 0.0894  68  PHE B CZ  
1696 N N   . VAL B 52  ? 0.6093 0.7715 0.4631 -0.0133 -0.0299 0.0908  69  VAL B N   
1697 C CA  . VAL B 52  ? 0.6445 0.8111 0.4974 -0.0142 -0.0338 0.0908  69  VAL B CA  
1698 C C   . VAL B 52  ? 0.6744 0.8453 0.5258 -0.0104 -0.0326 0.0947  69  VAL B C   
1699 O O   . VAL B 52  ? 0.7135 0.8861 0.5660 -0.0107 -0.0329 0.0958  69  VAL B O   
1700 C CB  . VAL B 52  ? 0.6729 0.8425 0.5256 -0.0160 -0.0396 0.0880  69  VAL B CB  
1701 C CG1 . VAL B 52  ? 0.6962 0.8706 0.5514 -0.0168 -0.0433 0.0888  69  VAL B CG1 
1702 C CG2 . VAL B 52  ? 0.6649 0.8307 0.5195 -0.0197 -0.0408 0.0849  69  VAL B CG2 
1703 N N   . ARG B 53  ? 0.7141 0.8882 0.5628 -0.0063 -0.0311 0.0970  70  ARG B N   
1704 C CA  . ARG B 53  ? 0.7339 0.9140 0.5805 -0.0017 -0.0299 0.1011  70  ARG B CA  
1705 C C   . ARG B 53  ? 0.7347 0.9118 0.5845 -0.0001 -0.0242 0.1055  70  ARG B C   
1706 O O   . ARG B 53  ? 0.7374 0.9188 0.5862 0.0025  -0.0237 0.1085  70  ARG B O   
1707 C CB  . ARG B 53  ? 0.7530 0.9400 0.5957 0.0037  -0.0293 0.1029  70  ARG B CB  
1708 C CG  . ARG B 53  ? 0.7752 0.9594 0.6194 0.0065  -0.0228 0.1076  70  ARG B CG  
1709 C CD  . ARG B 53  ? 0.7603 0.9537 0.5998 0.0121  -0.0231 0.1088  70  ARG B CD  
1710 N NE  . ARG B 53  ? 0.7628 0.9672 0.5984 0.0185  -0.0233 0.1120  70  ARG B NE  
1711 C CZ  . ARG B 53  ? 0.7500 0.9585 0.5863 0.0243  -0.0170 0.1205  70  ARG B CZ  
1712 N NH1 . ARG B 53  ? 0.7500 0.9519 0.5928 0.0244  -0.0098 0.1269  70  ARG B NH1 
1713 N NH2 . ARG B 53  ? 0.7486 0.9685 0.5808 0.0303  -0.0178 0.1227  70  ARG B NH2 
1714 N N   . ASP B 54  ? 0.7374 0.9074 0.5923 -0.0016 -0.0203 0.1053  71  ASP B N   
1715 C CA  . ASP B 54  ? 0.7197 0.8862 0.5811 0.0002  -0.0146 0.1087  71  ASP B CA  
1716 C C   . ASP B 54  ? 0.7479 0.9145 0.6107 -0.0012 -0.0160 0.1066  71  ASP B C   
1717 O O   . ASP B 54  ? 0.7685 0.9311 0.6367 -0.0032 -0.0153 0.1027  71  ASP B O   
1718 C CB  . ASP B 54  ? 0.7007 0.8600 0.5700 -0.0012 -0.0109 0.1073  71  ASP B CB  
1719 C CG  . ASP B 54  ? 0.7164 0.8724 0.5965 0.0017  -0.0042 0.1119  71  ASP B CG  
1720 O OD1 . ASP B 54  ? 0.7345 0.8925 0.6160 0.0043  -0.0025 0.1152  71  ASP B OD1 
1721 O OD2 . ASP B 54  ? 0.7302 0.8814 0.6191 0.0014  -0.0004 0.1124  71  ASP B OD2 
1722 N N   . PHE B 55  ? 0.7379 0.9104 0.5961 0.0005  -0.0181 0.1089  72  PHE B N   
1723 C CA  . PHE B 55  ? 0.7373 0.9116 0.5961 -0.0002 -0.0195 0.1079  72  PHE B CA  
1724 C C   . PHE B 55  ? 0.7632 0.9337 0.6294 0.0010  -0.0151 0.1078  72  PHE B C   
1725 O O   . PHE B 55  ? 0.8042 0.9755 0.6722 0.0000  -0.0163 0.1043  72  PHE B O   
1726 C CB  . PHE B 55  ? 0.7571 0.9385 0.6115 0.0023  -0.0214 0.1114  72  PHE B CB  
1727 C CG  . PHE B 55  ? 0.7651 0.9501 0.6194 0.0010  -0.0241 0.1106  72  PHE B CG  
1728 C CD1 . PHE B 55  ? 0.7418 0.9294 0.5956 -0.0025 -0.0289 0.1080  72  PHE B CD1 
1729 C CD2 . PHE B 55  ? 0.7649 0.9514 0.6207 0.0037  -0.0214 0.1133  72  PHE B CD2 
1730 C CE1 . PHE B 55  ? 0.7440 0.9363 0.5988 -0.0032 -0.0308 0.1089  72  PHE B CE1 
1731 C CE2 . PHE B 55  ? 0.7548 0.9458 0.6103 0.0030  -0.0237 0.1131  72  PHE B CE2 
1732 C CZ  . PHE B 55  ? 0.7541 0.9484 0.6091 -0.0003 -0.0283 0.1113  72  PHE B CZ  
1733 N N   . ALA B 56  ? 0.8079 0.9751 0.6798 0.0039  -0.0098 0.1117  73  ALA B N   
1734 C CA  . ALA B 56  ? 0.8419 1.0049 0.7246 0.0056  -0.0053 0.1115  73  ALA B CA  
1735 C C   . ALA B 56  ? 0.8288 0.9865 0.7199 0.0028  -0.0053 0.1041  73  ALA B C   
1736 O O   . ALA B 56  ? 0.8893 1.0454 0.7893 0.0037  -0.0039 0.1001  73  ALA B O   
1737 C CB  . ALA B 56  ? 0.8604 1.0220 0.7496 0.0099  0.0008  0.1196  73  ALA B CB  
1738 N N   . ASN B 57  ? 0.7955 0.9511 0.6846 0.0000  -0.0069 0.1014  74  ASN B N   
1739 C CA  . ASN B 57  ? 0.7719 0.9233 0.6692 -0.0021 -0.0069 0.0939  74  ASN B CA  
1740 C C   . ASN B 57  ? 0.7501 0.9043 0.6393 -0.0055 -0.0121 0.0885  74  ASN B C   
1741 O O   . ASN B 57  ? 0.7658 0.9173 0.6548 -0.0076 -0.0125 0.0870  74  ASN B O   
1742 C CB  . ASN B 57  ? 0.7753 0.9208 0.6819 -0.0017 -0.0022 0.0968  74  ASN B CB  
1743 C CG  . ASN B 57  ? 0.7930 0.9364 0.7103 0.0021  0.0038  0.1041  74  ASN B CG  
1744 O OD1 . ASN B 57  ? 0.7682 0.9085 0.6992 0.0030  0.0062  0.1011  74  ASN B OD1 
1745 N ND2 . ASN B 57  ? 0.7897 0.9358 0.7020 0.0049  0.0065  0.1136  74  ASN B ND2 
1746 N N   . PRO B 58  ? 0.7388 0.8991 0.6222 -0.0058 -0.0158 0.0863  75  PRO B N   
1747 C CA  . PRO B 58  ? 0.7310 0.8953 0.6088 -0.0084 -0.0201 0.0827  75  PRO B CA  
1748 C C   . PRO B 58  ? 0.7252 0.8885 0.6093 -0.0091 -0.0202 0.0747  75  PRO B C   
1749 O O   . PRO B 58  ? 0.6745 0.8385 0.5554 -0.0113 -0.0224 0.0726  75  PRO B O   
1750 C CB  . PRO B 58  ? 0.7473 0.9197 0.6211 -0.0072 -0.0226 0.0835  75  PRO B CB  
1751 C CG  . PRO B 58  ? 0.7524 0.9245 0.6317 -0.0040 -0.0197 0.0832  75  PRO B CG  
1752 C CD  . PRO B 58  ? 0.7631 0.9276 0.6469 -0.0033 -0.0156 0.0873  75  PRO B CD  
1753 N N   . ASN B 59  ? 0.7283 0.8906 0.6225 -0.0069 -0.0179 0.0697  76  ASN B N   
1754 C CA  . ASN B 59  ? 0.7382 0.9000 0.6418 -0.0068 -0.0180 0.0603  76  ASN B CA  
1755 C C   . ASN B 59  ? 0.7401 0.8954 0.6470 -0.0095 -0.0169 0.0595  76  ASN B C   
1756 O O   . ASN B 59  ? 0.7815 0.9381 0.6936 -0.0099 -0.0181 0.0515  76  ASN B O   
1757 C CB  . ASN B 59  ? 0.7586 0.9184 0.6769 -0.0039 -0.0153 0.0552  76  ASN B CB  
1758 C CG  . ASN B 59  ? 0.7735 0.9250 0.6990 -0.0035 -0.0103 0.0630  76  ASN B CG  
1759 O OD1 . ASN B 59  ? 0.7633 0.9078 0.6984 -0.0045 -0.0071 0.0642  76  ASN B OD1 
1760 N ND2 . ASN B 59  ? 0.7859 0.9392 0.7071 -0.0015 -0.0094 0.0692  76  ASN B ND2 
1761 N N   . LYS B 60  ? 0.7393 0.8890 0.6433 -0.0108 -0.0147 0.0674  77  LYS B N   
1762 C CA  . LYS B 60  ? 0.7296 0.8743 0.6356 -0.0130 -0.0137 0.0673  77  LYS B CA  
1763 C C   . LYS B 60  ? 0.7131 0.8616 0.6109 -0.0153 -0.0181 0.0633  77  LYS B C   
1764 O O   . LYS B 60  ? 0.6925 0.8385 0.5946 -0.0169 -0.0180 0.0590  77  LYS B O   
1765 C CB  . LYS B 60  ? 0.7296 0.8708 0.6321 -0.0126 -0.0110 0.0767  77  LYS B CB  
1766 C CG  . LYS B 60  ? 0.7460 0.8815 0.6625 -0.0109 -0.0050 0.0802  77  LYS B CG  
1767 C CD  . LYS B 60  ? 0.7529 0.8880 0.6790 -0.0081 -0.0022 0.0812  77  LYS B CD  
1768 N N   . TYR B 61  ? 0.7037 0.8584 0.5912 -0.0156 -0.0216 0.0653  78  TYR B N   
1769 C CA  . TYR B 61  ? 0.7006 0.8599 0.5820 -0.0173 -0.0253 0.0630  78  TYR B CA  
1770 C C   . TYR B 61  ? 0.6655 0.8350 0.5434 -0.0157 -0.0281 0.0614  78  TYR B C   
1771 O O   . TYR B 61  ? 0.6675 0.8424 0.5420 -0.0163 -0.0305 0.0604  78  TYR B O   
1772 C CB  . TYR B 61  ? 0.6913 0.8482 0.5653 -0.0197 -0.0268 0.0687  78  TYR B CB  
1773 C CG  . TYR B 61  ? 0.6941 0.8541 0.5623 -0.0194 -0.0286 0.0748  78  TYR B CG  
1774 C CD1 . TYR B 61  ? 0.7196 0.8772 0.5873 -0.0179 -0.0266 0.0793  78  TYR B CD1 
1775 C CD2 . TYR B 61  ? 0.7067 0.8727 0.5713 -0.0205 -0.0322 0.0764  78  TYR B CD2 
1776 C CE1 . TYR B 61  ? 0.7092 0.8704 0.5723 -0.0174 -0.0287 0.0838  78  TYR B CE1 
1777 C CE2 . TYR B 61  ? 0.7101 0.8788 0.5721 -0.0205 -0.0341 0.0814  78  TYR B CE2 
1778 C CZ  . TYR B 61  ? 0.7181 0.8844 0.5790 -0.0190 -0.0327 0.0844  78  TYR B CZ  
1779 O OH  . TYR B 61  ? 0.6745 0.8446 0.5338 -0.0187 -0.0350 0.0882  78  TYR B OH  
1780 N N   . LYS B 62  ? 0.6590 0.8321 0.5381 -0.0130 -0.0274 0.0620  79  LYS B N   
1781 C CA  . LYS B 62  ? 0.6503 0.8350 0.5266 -0.0103 -0.0295 0.0611  79  LYS B CA  
1782 C C   . LYS B 62  ? 0.6388 0.8285 0.5223 -0.0068 -0.0291 0.0515  79  LYS B C   
1783 O O   . LYS B 62  ? 0.6297 0.8166 0.5199 -0.0049 -0.0272 0.0488  79  LYS B O   
1784 C CB  . LYS B 62  ? 0.6734 0.8603 0.5465 -0.0093 -0.0293 0.0677  79  LYS B CB  
1785 C CG  . LYS B 62  ? 0.6869 0.8710 0.5546 -0.0123 -0.0306 0.0757  79  LYS B CG  
1786 C CD  . LYS B 62  ? 0.6948 0.8832 0.5604 -0.0110 -0.0310 0.0815  79  LYS B CD  
1787 C CE  . LYS B 62  ? 0.7048 0.8910 0.5676 -0.0136 -0.0330 0.0875  79  LYS B CE  
1788 N NZ  . LYS B 62  ? 0.7308 0.9212 0.5928 -0.0124 -0.0335 0.0924  79  LYS B NZ  
1789 N N   . HIS B 63  ? 0.6395 0.8374 0.5228 -0.0053 -0.0311 0.0458  80  HIS B N   
1790 C CA  . HIS B 63  ? 0.6529 0.8562 0.5446 -0.0017 -0.0314 0.0340  80  HIS B CA  
1791 C C   . HIS B 63  ? 0.6606 0.8752 0.5540 0.0038  -0.0322 0.0299  80  HIS B C   
1792 O O   . HIS B 63  ? 0.6575 0.8732 0.5614 0.0067  -0.0321 0.0197  80  HIS B O   
1793 C CB  . HIS B 63  ? 0.6634 0.8747 0.5534 -0.0008 -0.0336 0.0288  80  HIS B CB  
1794 C CG  . HIS B 63  ? 0.6815 0.9019 0.5802 0.0039  -0.0350 0.0149  80  HIS B CG  
1795 N ND1 . HIS B 63  ? 0.6558 0.8952 0.5510 0.0101  -0.0376 0.0101  80  HIS B ND1 
1796 C CD2 . HIS B 63  ? 0.6783 0.8928 0.5907 0.0040  -0.0344 0.0044  80  HIS B CD2 
1797 C CE1 . HIS B 63  ? 0.6514 0.8968 0.5568 0.0140  -0.0391 -0.0041 80  HIS B CE1 
1798 N NE2 . HIS B 63  ? 0.6699 0.8995 0.5870 0.0100  -0.0372 -0.0080 80  HIS B NE2 
1799 N N   . PHE B 64  ? 0.6830 0.9060 0.5678 0.0053  -0.0329 0.0377  81  PHE B N   
1800 C CA  . PHE B 64  ? 0.7043 0.9408 0.5892 0.0114  -0.0338 0.0346  81  PHE B CA  
1801 C C   . PHE B 64  ? 0.7285 0.9584 0.6167 0.0115  -0.0319 0.0369  81  PHE B C   
1802 O O   . PHE B 64  ? 0.6989 0.9388 0.5887 0.0166  -0.0326 0.0330  81  PHE B O   
1803 C CB  . PHE B 64  ? 0.6954 0.9469 0.5711 0.0140  -0.0351 0.0424  81  PHE B CB  
1804 C CG  . PHE B 64  ? 0.7284 0.9895 0.6021 0.0156  -0.0367 0.0396  81  PHE B CG  
1805 C CD1 . PHE B 64  ? 0.7273 1.0022 0.6045 0.0220  -0.0384 0.0274  81  PHE B CD1 
1806 C CD2 . PHE B 64  ? 0.7348 0.9910 0.6044 0.0110  -0.0367 0.0478  81  PHE B CD2 
1807 C CE1 . PHE B 64  ? 0.6988 0.9837 0.5740 0.0242  -0.0398 0.0245  81  PHE B CE1 
1808 C CE2 . PHE B 64  ? 0.7168 0.9817 0.5850 0.0128  -0.0378 0.0455  81  PHE B CE2 
1809 C CZ  . PHE B 64  ? 0.7209 1.0005 0.5913 0.0194  -0.0393 0.0341  81  PHE B CZ  
1810 N N   . ILE B 65  ? 0.7543 0.9685 0.6435 0.0064  -0.0297 0.0430  82  ILE B N   
1811 C CA  . ILE B 65  ? 0.7527 0.9591 0.6467 0.0064  -0.0272 0.0455  82  ILE B CA  
1812 C C   . ILE B 65  ? 0.7634 0.9617 0.6720 0.0068  -0.0253 0.0365  82  ILE B C   
1813 O O   . ILE B 65  ? 0.7565 0.9443 0.6696 0.0032  -0.0236 0.0373  82  ILE B O   
1814 C CB  . ILE B 65  ? 0.7439 0.9405 0.6317 0.0020  -0.0256 0.0570  82  ILE B CB  
1815 C CG1 . ILE B 65  ? 0.7211 0.9261 0.5993 0.0023  -0.0275 0.0650  82  ILE B CG1 
1816 C CG2 . ILE B 65  ? 0.7546 0.9417 0.6490 0.0021  -0.0222 0.0595  82  ILE B CG2 
1817 C CD1 . ILE B 65  ? 0.7171 0.9304 0.5899 0.0017  -0.0300 0.0666  82  ILE B CD1 
1818 N N   . LYS B 66  ? 0.7797 0.9836 0.6972 0.0114  -0.0257 0.0279  83  LYS B N   
1819 C CA  . LYS B 66  ? 0.8449 1.0422 0.7811 0.0122  -0.0242 0.0181  83  LYS B CA  
1820 C C   . LYS B 66  ? 0.9073 1.0900 0.8513 0.0097  -0.0195 0.0262  83  LYS B C   
1821 O O   . LYS B 66  ? 0.9352 1.1080 0.8929 0.0077  -0.0168 0.0246  83  LYS B O   
1822 C CB  . LYS B 66  ? 0.8636 1.0730 0.8083 0.0187  -0.0267 0.0053  83  LYS B CB  
1823 C CG  . LYS B 66  ? 0.8496 1.0523 0.8107 0.0205  -0.0243 0.0022  83  LYS B CG  
1824 N N   . SER B 67  ? 0.9101 1.0929 0.8461 0.0103  -0.0183 0.0354  84  SER B N   
1825 C CA  . SER B 67  ? 0.8909 1.0628 0.8313 0.0088  -0.0137 0.0450  84  SER B CA  
1826 C C   . SER B 67  ? 0.8887 1.0637 0.8142 0.0090  -0.0138 0.0557  84  SER B C   
1827 O O   . SER B 67  ? 0.8633 1.0486 0.7800 0.0110  -0.0168 0.0546  84  SER B O   
1828 C CB  . SER B 67  ? 0.9135 1.0812 0.8740 0.0117  -0.0110 0.0395  84  SER B CB  
1829 O OG  . SER B 67  ? 0.9424 1.1193 0.9020 0.0160  -0.0132 0.0347  84  SER B OG  
1830 N N   . CYS B 68  ? 0.8718 1.0391 0.7955 0.0073  -0.0104 0.0661  85  CYS B N   
1831 C CA  . CYS B 68  ? 0.8191 0.9889 0.7304 0.0074  -0.0105 0.0759  85  CYS B CA  
1832 C C   . CYS B 68  ? 0.8060 0.9712 0.7247 0.0100  -0.0060 0.0819  85  CYS B C   
1833 O O   . CYS B 68  ? 0.8121 0.9704 0.7457 0.0108  -0.0021 0.0813  85  CYS B O   
1834 C CB  . CYS B 68  ? 0.8184 0.9858 0.7195 0.0041  -0.0112 0.0824  85  CYS B CB  
1835 S SG  . CYS B 68  ? 0.7995 0.9698 0.6886 0.0045  -0.0116 0.0932  85  CYS B SG  
1836 N N   . THR B 69  ? 0.7978 0.9674 0.7078 0.0115  -0.0064 0.0883  86  THR B N   
1837 C CA  . THR B 69  ? 0.8330 0.9996 0.7490 0.0145  -0.0019 0.0952  86  THR B CA  
1838 C C   . THR B 69  ? 0.8342 1.0055 0.7371 0.0152  -0.0027 0.1039  86  THR B C   
1839 O O   . THR B 69  ? 0.8516 1.0300 0.7456 0.0151  -0.0063 0.1031  86  THR B O   
1840 C CB  . THR B 69  ? 0.8483 1.0158 0.7761 0.0178  -0.0009 0.0895  86  THR B CB  
1841 O OG1 . THR B 69  ? 0.8761 1.0390 0.8201 0.0176  -0.0001 0.0805  86  THR B OG1 
1842 C CG2 . THR B 69  ? 0.8517 1.0166 0.7857 0.0211  0.0038  0.0978  86  THR B CG2 
1843 N N   . ILE B 70  ? 0.8139 0.9826 0.7165 0.0164  0.0007  0.1124  87  ILE B N   
1844 C CA  . ILE B 70  ? 0.8014 0.9758 0.6930 0.0180  0.0000  0.1197  87  ILE B CA  
1845 C C   . ILE B 70  ? 0.8049 0.9822 0.6993 0.0215  0.0015  0.1219  87  ILE B C   
1846 O O   . ILE B 70  ? 0.8321 1.0052 0.7388 0.0243  0.0062  0.1233  87  ILE B O   
1847 C CB  . ILE B 70  ? 0.7877 0.9613 0.6785 0.0199  0.0033  0.1276  87  ILE B CB  
1848 C CG1 . ILE B 70  ? 0.7887 0.9600 0.6762 0.0164  0.0011  0.1244  87  ILE B CG1 
1849 C CG2 . ILE B 70  ? 0.8058 0.9876 0.6856 0.0226  0.0019  0.1337  87  ILE B CG2 
1850 N N   . ARG B 71  ? 0.8129 0.9974 0.6976 0.0214  -0.0023 0.1219  88  ARG B N   
1851 C CA  . ARG B 71  ? 0.8620 1.0503 0.7479 0.0246  -0.0014 0.1235  88  ARG B CA  
1852 C C   . ARG B 71  ? 0.8798 1.0736 0.7583 0.0273  -0.0010 0.1316  88  ARG B C   
1853 O O   . ARG B 71  ? 0.8970 1.0924 0.7786 0.0311  0.0018  0.1356  88  ARG B O   
1854 C CB  . ARG B 71  ? 0.8822 1.0766 0.7639 0.0232  -0.0060 0.1175  88  ARG B CB  
1855 C CG  . ARG B 71  ? 0.9041 1.0976 0.7956 0.0250  -0.0052 0.1100  88  ARG B CG  
1856 C CD  . ARG B 71  ? 0.9333 1.1223 0.8314 0.0229  -0.0056 0.1025  88  ARG B CD  
1857 N NE  . ARG B 71  ? 0.9771 1.1685 0.8841 0.0252  -0.0063 0.0930  88  ARG B NE  
1858 C CZ  . ARG B 71  ? 1.0043 1.1911 0.9263 0.0281  -0.0031 0.0895  88  ARG B CZ  
1859 N NH1 . ARG B 71  ? 1.0639 1.2430 0.9939 0.0290  0.0018  0.0967  88  ARG B NH1 
1860 N NH2 . ARG B 71  ? 0.9902 1.1812 0.9206 0.0307  -0.0049 0.0787  88  ARG B NH2 
1861 N N   . VAL B 72  ? 0.8754 1.0731 0.7448 0.0255  -0.0042 0.1332  89  VAL B N   
1862 C CA  . VAL B 72  ? 0.8665 1.0709 0.7294 0.0286  -0.0044 0.1394  89  VAL B CA  
1863 C C   . VAL B 72  ? 0.8645 1.0687 0.7248 0.0289  -0.0040 0.1414  89  VAL B C   
1864 O O   . VAL B 72  ? 0.8408 1.0450 0.6975 0.0251  -0.0082 0.1371  89  VAL B O   
1865 C CB  . VAL B 72  ? 0.8748 1.0870 0.7305 0.0267  -0.0103 0.1378  89  VAL B CB  
1866 C CG1 . VAL B 72  ? 0.8779 1.0982 0.7279 0.0300  -0.0116 0.1419  89  VAL B CG1 
1867 C CG2 . VAL B 72  ? 0.8778 1.0923 0.7352 0.0274  -0.0104 0.1370  89  VAL B CG2 
1868 N N   . ASN B 73  ? 0.9115 1.1167 0.7746 0.0340  0.0012  0.1484  90  ASN B N   
1869 C CA  . ASN B 73  ? 0.9111 1.1186 0.7718 0.0361  0.0025  0.1516  90  ASN B CA  
1870 C C   . ASN B 73  ? 0.8852 1.1028 0.7353 0.0367  -0.0033 0.1496  90  ASN B C   
1871 O O   . ASN B 73  ? 0.8708 1.0968 0.7162 0.0393  -0.0056 0.1506  90  ASN B O   
1872 C CB  . ASN B 73  ? 0.9155 1.1250 0.7822 0.0430  0.0101  0.1617  90  ASN B CB  
1873 C CG  . ASN B 73  ? 0.9356 1.1344 0.8173 0.0422  0.0161  0.1632  90  ASN B CG  
1874 O OD1 . ASN B 73  ? 1.0125 1.2031 0.8990 0.0374  0.0150  0.1571  90  ASN B OD1 
1875 N ND2 . ASN B 73  ? 0.9331 1.1322 0.8236 0.0473  0.0222  0.1711  90  ASN B ND2 
1876 N N   . GLU B 79  ? 0.9629 1.1822 0.8244 0.0498  0.0154  0.1703  96  GLU B N   
1877 C CA  . GLU B 79  ? 0.9769 1.2024 0.8282 0.0490  0.0092  0.1639  96  GLU B CA  
1878 C C   . GLU B 79  ? 0.9078 1.1303 0.7535 0.0421  0.0005  0.1526  96  GLU B C   
1879 O O   . GLU B 79  ? 0.8270 1.0522 0.6706 0.0421  -0.0018 0.1515  96  GLU B O   
1880 C CB  . GLU B 79  ? 1.0341 1.2779 0.8769 0.0585  0.0092  0.1689  96  GLU B CB  
1881 C CG  . GLU B 79  ? 1.0710 1.3226 0.9063 0.0599  0.0046  0.1637  96  GLU B CG  
1882 C CD  . GLU B 79  ? 1.0999 1.3576 0.9378 0.0666  0.0116  0.1732  96  GLU B CD  
1883 O OE1 . GLU B 79  ? 1.1546 1.4250 0.9926 0.0762  0.0174  0.1841  96  GLU B OE1 
1884 O OE2 . GLU B 79  ? 1.0921 1.3430 0.9324 0.0628  0.0115  0.1706  96  GLU B OE2 
1885 N N   . ILE B 80  ? 0.8904 1.1081 0.7345 0.0367  -0.0038 0.1452  97  ILE B N   
1886 C CA  . ILE B 80  ? 0.8569 1.0701 0.6992 0.0296  -0.0109 0.1360  97  ILE B CA  
1887 C C   . ILE B 80  ? 0.8503 1.0742 0.6859 0.0307  -0.0182 0.1308  97  ILE B C   
1888 O O   . ILE B 80  ? 0.8859 1.1141 0.7186 0.0315  -0.0214 0.1270  97  ILE B O   
1889 C CB  . ILE B 80  ? 0.8325 1.0359 0.6779 0.0234  -0.0120 0.1309  97  ILE B CB  
1890 C CG1 . ILE B 80  ? 0.8357 1.0290 0.6903 0.0221  -0.0055 0.1341  97  ILE B CG1 
1891 C CG2 . ILE B 80  ? 0.8512 1.0515 0.6956 0.0168  -0.0186 0.1232  97  ILE B CG2 
1892 C CD1 . ILE B 80  ? 0.8415 1.0302 0.7011 0.0202  -0.0045 0.1334  97  ILE B CD1 
1893 N N   . LYS B 81  ? 0.8079 1.0363 0.6426 0.0310  -0.0210 0.1299  98  LYS B N   
1894 C CA  . LYS B 81  ? 0.7947 1.0322 0.6269 0.0311  -0.0286 0.1236  98  LYS B CA  
1895 C C   . LYS B 81  ? 0.7530 0.9849 0.5897 0.0237  -0.0333 0.1189  98  LYS B C   
1896 O O   . LYS B 81  ? 0.7239 0.9474 0.5633 0.0201  -0.0304 0.1210  98  LYS B O   
1897 C CB  . LYS B 81  ? 0.7865 1.0372 0.6152 0.0386  -0.0284 0.1268  98  LYS B CB  
1898 N N   . VAL B 82  ? 0.6985 0.9361 0.5374 0.0220  -0.0405 0.1124  99  VAL B N   
1899 C CA  . VAL B 82  ? 0.6858 0.9227 0.5306 0.0171  -0.0446 0.1103  99  VAL B CA  
1900 C C   . VAL B 82  ? 0.7012 0.9401 0.5446 0.0195  -0.0413 0.1156  99  VAL B C   
1901 O O   . VAL B 82  ? 0.6991 0.9461 0.5384 0.0258  -0.0398 0.1181  99  VAL B O   
1902 C CB  . VAL B 82  ? 0.6865 0.9327 0.5366 0.0173  -0.0525 0.1034  99  VAL B CB  
1903 C CG1 . VAL B 82  ? 0.6754 0.9227 0.5334 0.0135  -0.0555 0.1036  99  VAL B CG1 
1904 C CG2 . VAL B 82  ? 0.6992 0.9427 0.5534 0.0140  -0.0566 0.0972  99  VAL B CG2 
1905 N N   . GLY B 83  ? 0.6896 0.9224 0.5362 0.0152  -0.0402 0.1175  100 GLY B N   
1906 C CA  . GLY B 83  ? 0.6819 0.9164 0.5278 0.0172  -0.0373 0.1221  100 GLY B CA  
1907 C C   . GLY B 83  ? 0.6858 0.9125 0.5302 0.0180  -0.0305 0.1261  100 GLY B C   
1908 O O   . GLY B 83  ? 0.7003 0.9268 0.5454 0.0188  -0.0282 0.1290  100 GLY B O   
1909 N N   . THR B 84  ? 0.6817 0.9023 0.5254 0.0180  -0.0275 0.1260  101 THR B N   
1910 C CA  . THR B 84  ? 0.7072 0.9194 0.5535 0.0177  -0.0220 0.1280  101 THR B CA  
1911 C C   . THR B 84  ? 0.7267 0.9350 0.5762 0.0131  -0.0233 0.1248  101 THR B C   
1912 O O   . THR B 84  ? 0.7186 0.9271 0.5688 0.0090  -0.0274 0.1215  101 THR B O   
1913 C CB  . THR B 84  ? 0.7237 0.9302 0.5708 0.0176  -0.0192 0.1276  101 THR B CB  
1914 O OG1 . THR B 84  ? 0.7282 0.9409 0.5718 0.0228  -0.0180 0.1310  101 THR B OG1 
1915 C CG2 . THR B 84  ? 0.7575 0.9560 0.6107 0.0179  -0.0134 0.1292  101 THR B CG2 
1916 N N   . ILE B 85  ? 0.7400 0.9461 0.5922 0.0145  -0.0199 0.1260  102 ILE B N   
1917 C CA  . ILE B 85  ? 0.7561 0.9612 0.6110 0.0119  -0.0208 0.1227  102 ILE B CA  
1918 C C   . ILE B 85  ? 0.7493 0.9470 0.6094 0.0121  -0.0170 0.1195  102 ILE B C   
1919 O O   . ILE B 85  ? 0.7245 0.9187 0.5890 0.0152  -0.0125 0.1214  102 ILE B O   
1920 C CB  . ILE B 85  ? 0.7293 0.9404 0.5842 0.0138  -0.0210 0.1246  102 ILE B CB  
1921 N N   . ARG B 86  ? 0.7706 0.9666 0.6319 0.0090  -0.0188 0.1146  103 ARG B N   
1922 C CA  . ARG B 86  ? 0.7958 0.9866 0.6637 0.0091  -0.0162 0.1096  103 ARG B CA  
1923 C C   . ARG B 86  ? 0.7970 0.9931 0.6664 0.0098  -0.0178 0.1048  103 ARG B C   
1924 O O   . ARG B 86  ? 0.8130 1.0168 0.6779 0.0092  -0.0208 0.1064  103 ARG B O   
1925 C CB  . ARG B 86  ? 0.8064 0.9922 0.6748 0.0061  -0.0168 0.1067  103 ARG B CB  
1926 C CG  . ARG B 86  ? 0.8199 1.0095 0.6840 0.0027  -0.0213 0.1045  103 ARG B CG  
1927 C CD  . ARG B 86  ? 0.8509 1.0350 0.7172 0.0004  -0.0211 0.1004  103 ARG B CD  
1928 N NE  . ARG B 86  ? 0.8939 1.0780 0.7561 -0.0026 -0.0242 0.1013  103 ARG B NE  
1929 C CZ  . ARG B 86  ? 0.9935 1.1818 0.8542 -0.0051 -0.0277 0.1002  103 ARG B CZ  
1930 N NH1 . ARG B 86  ? 1.0094 1.2042 0.8711 -0.0042 -0.0285 0.0989  103 ARG B NH1 
1931 N NH2 . ARG B 86  ? 1.0062 1.1933 0.8653 -0.0077 -0.0303 0.1007  103 ARG B NH2 
1932 N N   . GLU B 87  ? 0.7961 0.9895 0.6733 0.0116  -0.0156 0.0990  104 GLU B N   
1933 C CA  . GLU B 87  ? 0.8326 1.0332 0.7117 0.0133  -0.0175 0.0923  104 GLU B CA  
1934 C C   . GLU B 87  ? 0.8518 1.0496 0.7367 0.0125  -0.0177 0.0841  104 GLU B C   
1935 O O   . GLU B 87  ? 0.8330 1.0233 0.7279 0.0130  -0.0149 0.0804  104 GLU B O   
1936 C CB  . GLU B 87  ? 0.8483 1.0519 0.7326 0.0177  -0.0158 0.0903  104 GLU B CB  
1937 C CG  . GLU B 87  ? 0.8514 1.0670 0.7343 0.0207  -0.0185 0.0848  104 GLU B CG  
1938 C CD  . GLU B 87  ? 0.8858 1.1057 0.7731 0.0255  -0.0174 0.0827  104 GLU B CD  
1939 O OE1 . GLU B 87  ? 0.9166 1.1287 0.8096 0.0262  -0.0142 0.0854  104 GLU B OE1 
1940 O OE2 . GLU B 87  ? 0.8746 1.1066 0.7601 0.0291  -0.0195 0.0788  104 GLU B OE2 
1941 N N   . VAL B 88  ? 0.8839 1.0886 0.7640 0.0114  -0.0208 0.0818  105 VAL B N   
1942 C CA  . VAL B 88  ? 0.8798 1.0843 0.7643 0.0110  -0.0217 0.0735  105 VAL B CA  
1943 C C   . VAL B 88  ? 0.8426 1.0567 0.7325 0.0160  -0.0227 0.0641  105 VAL B C   
1944 O O   . VAL B 88  ? 0.8058 1.0306 0.6916 0.0194  -0.0239 0.0654  105 VAL B O   
1945 C CB  . VAL B 88  ? 0.8533 1.0623 0.7306 0.0083  -0.0244 0.0756  105 VAL B CB  
1946 C CG2 . VAL B 88  ? 0.8715 1.0725 0.7444 0.0039  -0.0243 0.0833  105 VAL B CG2 
1947 N N   . SER B 89  ? 0.7987 1.0097 0.6988 0.0169  -0.0223 0.0542  106 SER B N   
1948 C CA  . SER B 89  ? 0.8076 1.0295 0.7139 0.0223  -0.0243 0.0425  106 SER B CA  
1949 C C   . SER B 89  ? 0.8168 1.0438 0.7225 0.0220  -0.0267 0.0357  106 SER B C   
1950 O O   . SER B 89  ? 0.8174 1.0344 0.7290 0.0185  -0.0257 0.0333  106 SER B O   
1951 C CB  . SER B 89  ? 0.8009 1.0163 0.7236 0.0246  -0.0223 0.0346  106 SER B CB  
1952 O OG  . SER B 89  ? 0.8051 1.0092 0.7399 0.0217  -0.0207 0.0304  106 SER B OG  
1953 N N   . VAL B 90  ? 0.7992 1.0431 0.6978 0.0261  -0.0295 0.0337  107 VAL B N   
1954 C CA  . VAL B 90  ? 0.7935 1.0453 0.6877 0.0263  -0.0317 0.0311  107 VAL B CA  
1955 C C   . VAL B 90  ? 0.7951 1.0536 0.6994 0.0306  -0.0336 0.0151  107 VAL B C   
1956 O O   . VAL B 90  ? 0.8036 1.0678 0.7167 0.0357  -0.0345 0.0050  107 VAL B O   
1957 C CB  . VAL B 90  ? 0.7961 1.0652 0.6791 0.0297  -0.0331 0.0383  107 VAL B CB  
1958 C CG1 . VAL B 90  ? 0.7872 1.0663 0.6663 0.0307  -0.0349 0.0369  107 VAL B CG1 
1959 C CG2 . VAL B 90  ? 0.7987 1.0610 0.6748 0.0250  -0.0317 0.0531  107 VAL B CG2 
1960 N N   . VAL B 91  ? 0.7986 1.0565 0.7027 0.0287  -0.0346 0.0121  108 VAL B N   
1961 C CA  . VAL B 91  ? 0.8109 1.0766 0.7246 0.0328  -0.0371 -0.0036 108 VAL B CA  
1962 C C   . VAL B 91  ? 0.8096 1.0998 0.7198 0.0422  -0.0402 -0.0110 108 VAL B C   
1963 O O   . VAL B 91  ? 0.8178 1.1212 0.7154 0.0448  -0.0404 -0.0018 108 VAL B O   
1964 C CB  . VAL B 91  ? 0.8208 1.0829 0.7320 0.0289  -0.0375 -0.0031 108 VAL B CB  
1965 C CG1 . VAL B 91  ? 0.8527 1.1321 0.7669 0.0352  -0.0410 -0.0169 108 VAL B CG1 
1966 C CG2 . VAL B 91  ? 0.8231 1.0635 0.7442 0.0221  -0.0349 -0.0027 108 VAL B CG2 
1967 N N   . SER B 92  ? 0.8275 1.1248 0.7506 0.0479  -0.0425 -0.0278 109 SER B N   
1968 C CA  . SER B 92  ? 0.8310 1.1532 0.7522 0.0583  -0.0457 -0.0369 109 SER B CA  
1969 C C   . SER B 92  ? 0.8383 1.1830 0.7482 0.0641  -0.0480 -0.0367 109 SER B C   
1970 O O   . SER B 92  ? 0.8785 1.2467 0.7818 0.0731  -0.0497 -0.0381 109 SER B O   
1971 C CB  . SER B 92  ? 0.8315 1.1565 0.7720 0.0632  -0.0485 -0.0574 109 SER B CB  
1972 O OG  . SER B 92  ? 0.8487 1.1764 0.7979 0.0639  -0.0510 -0.0702 109 SER B OG  
1973 N N   . GLY B 93  ? 0.8437 1.1822 0.7514 0.0594  -0.0477 -0.0342 110 GLY B N   
1974 C CA  . GLY B 93  ? 0.8763 1.2346 0.7734 0.0642  -0.0490 -0.0314 110 GLY B CA  
1975 C C   . GLY B 93  ? 0.8806 1.2478 0.7630 0.0647  -0.0468 -0.0122 110 GLY B C   
1976 O O   . GLY B 93  ? 0.8828 1.2662 0.7576 0.0686  -0.0472 -0.0073 110 GLY B O   
1977 N N   . LEU B 94  ? 0.8875 1.2446 0.7673 0.0608  -0.0445 -0.0010 111 LEU B N   
1978 C CA  . LEU B 94  ? 0.9172 1.2826 0.7865 0.0612  -0.0425 0.0167  111 LEU B CA  
1979 C C   . LEU B 94  ? 0.9499 1.3233 0.8184 0.0659  -0.0421 0.0183  111 LEU B C   
1980 O O   . LEU B 94  ? 0.9225 1.2836 0.7980 0.0641  -0.0422 0.0108  111 LEU B O   
1981 C CB  . LEU B 94  ? 0.9239 1.2666 0.7909 0.0502  -0.0399 0.0309  111 LEU B CB  
1982 C CG  . LEU B 94  ? 0.9252 1.2608 0.7915 0.0454  -0.0400 0.0323  111 LEU B CG  
1983 C CD1 . LEU B 94  ? 0.9051 1.2167 0.7713 0.0348  -0.0382 0.0423  111 LEU B CD1 
1984 C CD2 . LEU B 94  ? 0.9305 1.2879 0.7906 0.0511  -0.0401 0.0401  111 LEU B CD2 
1985 N N   . PRO B 95  ? 0.9888 1.3829 0.8496 0.0720  -0.0413 0.0292  112 PRO B N   
1986 C CA  . PRO B 95  ? 0.9742 1.3794 0.8336 0.0776  -0.0409 0.0314  112 PRO B CA  
1987 C C   . PRO B 95  ? 0.9238 1.3064 0.7846 0.0691  -0.0388 0.0397  112 PRO B C   
1988 O O   . PRO B 95  ? 0.8860 1.2685 0.7496 0.0717  -0.0391 0.0347  112 PRO B O   
1989 C CB  . PRO B 95  ? 0.9713 1.4018 0.8231 0.0845  -0.0395 0.0454  112 PRO B CB  
1990 C CG  . PRO B 95  ? 0.9867 1.4106 0.8369 0.0787  -0.0381 0.0557  112 PRO B CG  
1991 C CD  . PRO B 95  ? 0.9864 1.3940 0.8410 0.0737  -0.0401 0.0420  112 PRO B CD  
1992 N N   . ALA B 96  ? 0.9047 1.2693 0.7642 0.0596  -0.0370 0.0514  113 ALA B N   
1993 C CA  . ALA B 96  ? 0.8856 1.2288 0.7468 0.0516  -0.0354 0.0577  113 ALA B CA  
1994 C C   . ALA B 96  ? 0.8786 1.2055 0.7474 0.0494  -0.0358 0.0446  113 ALA B C   
1995 O O   . ALA B 96  ? 0.8897 1.2129 0.7637 0.0493  -0.0370 0.0333  113 ALA B O   
1996 C CB  . ALA B 96  ? 0.8712 1.2000 0.7309 0.0429  -0.0343 0.0695  113 ALA B CB  
1997 N N   . SER B 97  ? 0.8577 1.1757 0.7286 0.0479  -0.0346 0.0465  114 SER B N   
1998 C CA  . SER B 97  ? 0.8695 1.1735 0.7501 0.0467  -0.0342 0.0359  114 SER B CA  
1999 C C   . SER B 97  ? 0.8621 1.1435 0.7442 0.0386  -0.0316 0.0439  114 SER B C   
2000 O O   . SER B 97  ? 0.8550 1.1215 0.7456 0.0354  -0.0305 0.0384  114 SER B O   
2001 C CB  . SER B 97  ? 0.8770 1.1924 0.7611 0.0542  -0.0350 0.0287  114 SER B CB  
2002 O OG  . SER B 97  ? 0.9148 1.2345 0.7919 0.0546  -0.0337 0.0408  114 SER B OG  
2003 N N   . THR B 98  ? 0.8536 1.1338 0.7285 0.0358  -0.0305 0.0572  115 THR B N   
2004 C CA  . THR B 98  ? 0.8269 1.0897 0.7024 0.0298  -0.0284 0.0643  115 THR B CA  
2005 C C   . THR B 98  ? 0.8014 1.0642 0.6695 0.0257  -0.0286 0.0774  115 THR B C   
2006 O O   . THR B 98  ? 0.7406 1.0176 0.6047 0.0282  -0.0296 0.0829  115 THR B O   
2007 C CB  . THR B 98  ? 0.8381 1.0986 0.7175 0.0325  -0.0270 0.0631  115 THR B CB  
2008 O OG1 . THR B 98  ? 0.8724 1.1176 0.7523 0.0276  -0.0247 0.0703  115 THR B OG1 
2009 C CG2 . THR B 98  ? 0.8392 1.1151 0.7129 0.0369  -0.0278 0.0684  115 THR B CG2 
2010 N N   . SER B 99  ? 0.7928 1.0407 0.6608 0.0199  -0.0276 0.0822  116 SER B N   
2011 C CA  . SER B 99  ? 0.7794 1.0259 0.6432 0.0159  -0.0282 0.0929  116 SER B CA  
2012 C C   . SER B 99  ? 0.7562 0.9909 0.6204 0.0133  -0.0268 0.0964  116 SER B C   
2013 O O   . SER B 99  ? 0.7794 1.0032 0.6467 0.0123  -0.0250 0.0926  116 SER B O   
2014 C CB  . SER B 99  ? 0.7655 1.0090 0.6284 0.0118  -0.0296 0.0945  116 SER B CB  
2015 O OG  . SER B 99  ? 0.7841 1.0310 0.6458 0.0093  -0.0309 0.1038  116 SER B OG  
2016 N N   . VAL B 100 ? 0.7365 0.9744 0.5983 0.0129  -0.0273 0.1040  117 VAL B N   
2017 C CA  . VAL B 100 ? 0.7419 0.9711 0.6032 0.0113  -0.0263 0.1076  117 VAL B CA  
2018 C C   . VAL B 100 ? 0.7339 0.9622 0.5939 0.0071  -0.0287 0.1134  117 VAL B C   
2019 O O   . VAL B 100 ? 0.7021 0.9388 0.5629 0.0065  -0.0307 0.1181  117 VAL B O   
2020 C CB  . VAL B 100 ? 0.7368 0.9697 0.5982 0.0149  -0.0248 0.1096  117 VAL B CB  
2021 C CG1 . VAL B 100 ? 0.7511 0.9964 0.6128 0.0192  -0.0252 0.1076  117 VAL B CG1 
2022 C CG2 . VAL B 100 ? 0.7464 0.9804 0.6056 0.0135  -0.0259 0.1170  117 VAL B CG2 
2023 N N   . GLU B 101 ? 0.7332 0.9522 0.5927 0.0048  -0.0284 0.1128  118 GLU B N   
2024 C CA  . GLU B 101 ? 0.7250 0.9427 0.5846 0.0011  -0.0313 0.1152  118 GLU B CA  
2025 C C   . GLU B 101 ? 0.7460 0.9589 0.6040 0.0011  -0.0312 0.1165  118 GLU B C   
2026 O O   . GLU B 101 ? 0.7748 0.9817 0.6316 0.0028  -0.0282 0.1151  118 GLU B O   
2027 C CB  . GLU B 101 ? 0.6843 0.8979 0.5445 -0.0012 -0.0318 0.1114  118 GLU B CB  
2028 N N   . ILE B 102 ? 0.7508 0.9677 0.6101 -0.0002 -0.0345 0.1192  119 ILE B N   
2029 C CA  . ILE B 102 ? 0.7542 0.9706 0.6119 0.0010  -0.0354 0.1198  119 ILE B CA  
2030 C C   . ILE B 102 ? 0.7577 0.9717 0.6164 -0.0013 -0.0384 0.1171  119 ILE B C   
2031 O O   . ILE B 102 ? 0.7610 0.9762 0.6244 -0.0047 -0.0415 0.1164  119 ILE B O   
2032 C CB  . ILE B 102 ? 0.7796 1.0039 0.6400 0.0016  -0.0380 0.1230  119 ILE B CB  
2033 C CG1 . ILE B 102 ? 0.8424 1.0687 0.7001 0.0047  -0.0385 0.1230  119 ILE B CG1 
2034 C CG2 . ILE B 102 ? 0.7557 0.9843 0.6238 -0.0020 -0.0424 0.1237  119 ILE B CG2 
2035 C CD1 . ILE B 102 ? 0.8473 1.0730 0.7004 0.0092  -0.0339 0.1256  119 ILE B CD1 
2036 N N   . LEU B 103 ? 0.7850 0.9966 0.6400 0.0009  -0.0372 0.1160  120 LEU B N   
2037 C CA  . LEU B 103 ? 0.7864 0.9975 0.6417 -0.0001 -0.0403 0.1127  120 LEU B CA  
2038 C C   . LEU B 103 ? 0.7734 0.9921 0.6326 0.0001  -0.0457 0.1113  120 LEU B C   
2039 O O   . LEU B 103 ? 0.7893 1.0135 0.6474 0.0032  -0.0457 0.1130  120 LEU B O   
2040 C CB  . LEU B 103 ? 0.7721 0.9805 0.6223 0.0035  -0.0368 0.1130  120 LEU B CB  
2041 C CG  . LEU B 103 ? 0.7804 0.9886 0.6296 0.0033  -0.0390 0.1094  120 LEU B CG  
2042 C CD1 . LEU B 103 ? 0.7844 0.9882 0.6375 -0.0019 -0.0419 0.1059  120 LEU B CD1 
2043 C CD2 . LEU B 103 ? 0.7897 0.9947 0.6351 0.0069  -0.0336 0.1119  120 LEU B CD2 
2044 N N   . GLU B 104 ? 0.7782 0.9974 0.6434 -0.0030 -0.0504 0.1076  121 GLU B N   
2045 C CA  . GLU B 104 ? 0.7748 1.0012 0.6487 -0.0036 -0.0563 0.1050  121 GLU B CA  
2046 C C   . GLU B 104 ? 0.7778 1.0064 0.6547 -0.0031 -0.0611 0.0982  121 GLU B C   
2047 O O   . GLU B 104 ? 0.8612 1.0978 0.7431 -0.0009 -0.0658 0.0940  121 GLU B O   
2048 C CB  . GLU B 104 ? 0.7928 1.0197 0.6776 -0.0082 -0.0583 0.1076  121 GLU B CB  
2049 C CG  . GLU B 104 ? 0.8225 1.0511 0.7056 -0.0077 -0.0547 0.1137  121 GLU B CG  
2050 C CD  . GLU B 104 ? 0.8599 1.0937 0.7557 -0.0106 -0.0571 0.1175  121 GLU B CD  
2051 O OE1 . GLU B 104 ? 0.8823 1.1159 0.7888 -0.0140 -0.0603 0.1166  121 GLU B OE1 
2052 O OE2 . GLU B 104 ? 0.9107 1.1492 0.8068 -0.0092 -0.0556 0.1220  121 GLU B OE2 
2053 N N   . VAL B 105 ? 0.7482 0.9709 0.6233 -0.0049 -0.0605 0.0962  122 VAL B N   
2054 C CA  . VAL B 105 ? 0.7324 0.9578 0.6091 -0.0036 -0.0647 0.0894  122 VAL B CA  
2055 C C   . VAL B 105 ? 0.7445 0.9649 0.6109 -0.0017 -0.0604 0.0900  122 VAL B C   
2056 O O   . VAL B 105 ? 0.7663 0.9787 0.6319 -0.0052 -0.0576 0.0920  122 VAL B O   
2057 C CB  . VAL B 105 ? 0.7237 0.9474 0.6137 -0.0087 -0.0699 0.0857  122 VAL B CB  
2058 C CG1 . VAL B 105 ? 0.7268 0.9540 0.6191 -0.0067 -0.0748 0.0771  122 VAL B CG1 
2059 C CG2 . VAL B 105 ? 0.7210 0.9494 0.6249 -0.0110 -0.0735 0.0868  122 VAL B CG2 
2060 N N   . LEU B 106 ? 0.7500 0.9764 0.6093 0.0042  -0.0596 0.0886  123 LEU B N   
2061 C CA  . LEU B 106 ? 0.7231 0.9468 0.5746 0.0069  -0.0556 0.0897  123 LEU B CA  
2062 C C   . LEU B 106 ? 0.7362 0.9696 0.5870 0.0116  -0.0603 0.0829  123 LEU B C   
2063 O O   . LEU B 106 ? 0.7724 1.0170 0.6194 0.0183  -0.0609 0.0823  123 LEU B O   
2064 C CB  . LEU B 106 ? 0.7139 0.9373 0.5580 0.0112  -0.0483 0.0971  123 LEU B CB  
2065 C CG  . LEU B 106 ? 0.7290 0.9490 0.5679 0.0138  -0.0428 0.1003  123 LEU B CG  
2066 C CD1 . LEU B 106 ? 0.7510 0.9603 0.5926 0.0078  -0.0422 0.0987  123 LEU B CD1 
2067 C CD2 . LEU B 106 ? 0.7100 0.9287 0.5463 0.0175  -0.0353 0.1085  123 LEU B CD2 
2068 N N   . ASP B 107 ? 0.7457 0.9760 0.6007 0.0085  -0.0638 0.0776  124 ASP B N   
2069 C CA  . ASP B 107 ? 0.7375 0.9771 0.5948 0.0122  -0.0699 0.0688  124 ASP B CA  
2070 C C   . ASP B 107 ? 0.7400 0.9769 0.5908 0.0137  -0.0671 0.0690  124 ASP B C   
2071 O O   . ASP B 107 ? 0.7491 0.9784 0.6041 0.0087  -0.0687 0.0663  124 ASP B O   
2072 C CB  . ASP B 107 ? 0.7506 0.9889 0.6225 0.0068  -0.0773 0.0617  124 ASP B CB  
2073 C CG  . ASP B 107 ? 0.7812 1.0293 0.6588 0.0104  -0.0849 0.0503  124 ASP B CG  
2074 O OD1 . ASP B 107 ? 0.7755 1.0271 0.6455 0.0148  -0.0841 0.0479  124 ASP B OD1 
2075 O OD2 . ASP B 107 ? 0.8307 1.0834 0.7224 0.0090  -0.0918 0.0433  124 ASP B OD2 
2076 N N   . GLU B 108 ? 0.7489 0.9931 0.5901 0.0211  -0.0626 0.0729  125 GLU B N   
2077 C CA  . GLU B 108 ? 0.7377 0.9805 0.5728 0.0235  -0.0584 0.0754  125 GLU B CA  
2078 C C   . GLU B 108 ? 0.7357 0.9825 0.5730 0.0241  -0.0644 0.0662  125 GLU B C   
2079 O O   . GLU B 108 ? 0.7369 0.9782 0.5719 0.0228  -0.0616 0.0676  125 GLU B O   
2080 C CB  . GLU B 108 ? 0.7436 0.9977 0.5701 0.0331  -0.0529 0.0821  125 GLU B CB  
2081 C CG  . GLU B 108 ? 0.7364 0.9859 0.5612 0.0334  -0.0455 0.0926  125 GLU B CG  
2082 C CD  . GLU B 108 ? 0.7525 0.9869 0.5790 0.0281  -0.0386 0.0993  125 GLU B CD  
2083 O OE1 . GLU B 108 ? 0.7502 0.9791 0.5780 0.0272  -0.0334 0.1060  125 GLU B OE1 
2084 O OE2 . GLU B 108 ? 0.7465 0.9749 0.5738 0.0250  -0.0385 0.0972  125 GLU B OE2 
2085 N N   . GLU B 109 ? 0.7576 1.0148 0.6007 0.0264  -0.0726 0.0563  126 GLU B N   
2086 C CA  . GLU B 109 ? 0.7777 1.0411 0.6243 0.0285  -0.0791 0.0458  126 GLU B CA  
2087 C C   . GLU B 109 ? 0.7822 1.0332 0.6409 0.0191  -0.0834 0.0410  126 GLU B C   
2088 O O   . GLU B 109 ? 0.7522 0.9990 0.6114 0.0173  -0.0841 0.0382  126 GLU B O   
2089 C CB  . GLU B 109 ? 0.8051 1.0875 0.6544 0.0365  -0.0865 0.0356  126 GLU B CB  
2090 N N   . LYS B 110 ? 0.8967 0.9677 0.5690 -0.0520 -0.0625 -0.0095 127 LYS B N   
2091 C CA  . LYS B 110 ? 0.9104 0.9776 0.5993 -0.0580 -0.0604 -0.0104 127 LYS B CA  
2092 C C   . LYS B 110 ? 0.8873 0.9542 0.5878 -0.0563 -0.0552 -0.0013 127 LYS B C   
2093 O O   . LYS B 110 ? 0.8480 0.9108 0.5599 -0.0592 -0.0512 -0.0002 127 LYS B O   
2094 C CB  . LYS B 110 ? 0.9200 0.9970 0.6193 -0.0647 -0.0683 -0.0147 127 LYS B CB  
2095 C CG  . LYS B 110 ? 0.9378 1.0168 0.6286 -0.0687 -0.0742 -0.0253 127 LYS B CG  
2096 N N   . ARG B 111 ? 0.8837 0.9553 0.5811 -0.0515 -0.0553 0.0048  128 ARG B N   
2097 C CA  . ARG B 111 ? 0.8758 0.9474 0.5828 -0.0503 -0.0508 0.0122  128 ARG B CA  
2098 C C   . ARG B 111 ? 0.8527 0.9324 0.5758 -0.0547 -0.0540 0.0130  128 ARG B C   
2099 O O   . ARG B 111 ? 0.8312 0.9095 0.5650 -0.0572 -0.0504 0.0147  128 ARG B O   
2100 C CB  . ARG B 111 ? 0.8758 0.9384 0.5842 -0.0498 -0.0423 0.0142  128 ARG B CB  
2101 C CG  . ARG B 111 ? 0.8918 0.9470 0.5850 -0.0451 -0.0375 0.0145  128 ARG B CG  
2102 C CD  . ARG B 111 ? 0.9058 0.9562 0.6036 -0.0441 -0.0288 0.0195  128 ARG B CD  
2103 N NE  . ARG B 111 ? 0.8967 0.9408 0.5805 -0.0394 -0.0232 0.0211  128 ARG B NE  
2104 C CZ  . ARG B 111 ? 0.8459 0.8838 0.5223 -0.0378 -0.0188 0.0177  128 ARG B CZ  
2105 N NH1 . ARG B 111 ? 0.8010 0.8363 0.4829 -0.0406 -0.0190 0.0124  128 ARG B NH1 
2106 N NH2 . ARG B 111 ? 0.8708 0.9045 0.5341 -0.0330 -0.0134 0.0201  128 ARG B NH2 
2107 N N   . ILE B 112 ? 0.8483 0.9379 0.5727 -0.0549 -0.0608 0.0123  129 ILE B N   
2108 C CA  . ILE B 112 ? 0.8348 0.9336 0.5737 -0.0590 -0.0642 0.0127  129 ILE B CA  
2109 C C   . ILE B 112 ? 0.8180 0.9263 0.5580 -0.0552 -0.0674 0.0166  129 ILE B C   
2110 O O   . ILE B 112 ? 0.8338 0.9470 0.5655 -0.0518 -0.0718 0.0159  129 ILE B O   
2111 C CB  . ILE B 112 ? 0.8671 0.9702 0.6089 -0.0646 -0.0696 0.0065  129 ILE B CB  
2112 C CG1 . ILE B 112 ? 0.8753 0.9662 0.6154 -0.0680 -0.0655 0.0020  129 ILE B CG1 
2113 C CG2 . ILE B 112 ? 0.8748 0.9887 0.6324 -0.0689 -0.0724 0.0082  129 ILE B CG2 
2114 C CD1 . ILE B 112 ? 0.8800 0.9721 0.6241 -0.0748 -0.0697 -0.0050 129 ILE B CD1 
2115 N N   . LEU B 113 ? 0.7866 0.8979 0.5365 -0.0551 -0.0651 0.0205  130 LEU B N   
2116 C CA  . LEU B 113 ? 0.7547 0.8750 0.5075 -0.0516 -0.0678 0.0234  130 LEU B CA  
2117 C C   . LEU B 113 ? 0.7238 0.8567 0.4897 -0.0556 -0.0717 0.0228  130 LEU B C   
2118 O O   . LEU B 113 ? 0.6866 0.8193 0.4606 -0.0610 -0.0705 0.0217  130 LEU B O   
2119 C CB  . LEU B 113 ? 0.7431 0.8579 0.4967 -0.0486 -0.0624 0.0272  130 LEU B CB  
2120 C CG  . LEU B 113 ? 0.7428 0.8607 0.4943 -0.0427 -0.0633 0.0301  130 LEU B CG  
2121 C CD1 . LEU B 113 ? 0.7607 0.8661 0.5059 -0.0394 -0.0570 0.0328  130 LEU B CD1 
2122 C CD2 . LEU B 113 ? 0.7495 0.8776 0.5124 -0.0434 -0.0645 0.0305  130 LEU B CD2 
2123 N N   . SER B 114 ? 0.7086 0.8529 0.4769 -0.0525 -0.0757 0.0242  131 SER B N   
2124 C CA  . SER B 114 ? 0.7174 0.8751 0.4988 -0.0551 -0.0780 0.0251  131 SER B CA  
2125 C C   . SER B 114 ? 0.7309 0.8978 0.5135 -0.0487 -0.0794 0.0281  131 SER B C   
2126 O O   . SER B 114 ? 0.7866 0.9551 0.5612 -0.0431 -0.0819 0.0289  131 SER B O   
2127 C CB  . SER B 114 ? 0.7167 0.8830 0.5038 -0.0611 -0.0832 0.0218  131 SER B CB  
2128 O OG  . SER B 114 ? 0.7134 0.8942 0.5135 -0.0633 -0.0850 0.0236  131 SER B OG  
2129 N N   . PHE B 115 ? 0.7268 0.8999 0.5185 -0.0487 -0.0774 0.0300  132 PHE B N   
2130 C CA  . PHE B 115 ? 0.7450 0.9274 0.5388 -0.0423 -0.0781 0.0323  132 PHE B CA  
2131 C C   . PHE B 115 ? 0.7262 0.9245 0.5330 -0.0446 -0.0792 0.0334  132 PHE B C   
2132 O O   . PHE B 115 ? 0.7004 0.9011 0.5150 -0.0511 -0.0783 0.0332  132 PHE B O   
2133 C CB  . PHE B 115 ? 0.7669 0.9375 0.5545 -0.0370 -0.0728 0.0333  132 PHE B CB  
2134 C CG  . PHE B 115 ? 0.8075 0.9768 0.6011 -0.0402 -0.0685 0.0326  132 PHE B CG  
2135 C CD1 . PHE B 115 ? 0.8073 0.9679 0.6005 -0.0454 -0.0656 0.0315  132 PHE B CD1 
2136 C CD2 . PHE B 115 ? 0.8195 0.9973 0.6186 -0.0373 -0.0674 0.0329  132 PHE B CD2 
2137 C CE1 . PHE B 115 ? 0.7889 0.9513 0.5876 -0.0479 -0.0624 0.0311  132 PHE B CE1 
2138 C CE2 . PHE B 115 ? 0.8075 0.9861 0.6109 -0.0401 -0.0640 0.0318  132 PHE B CE2 
2139 C CZ  . PHE B 115 ? 0.8117 0.9833 0.6150 -0.0454 -0.0619 0.0310  132 PHE B CZ  
2140 N N   . ARG B 116 ? 0.7041 0.9135 0.5132 -0.0385 -0.0806 0.0352  133 ARG B N   
2141 C CA  . ARG B 116 ? 0.6934 0.9205 0.5144 -0.0391 -0.0815 0.0369  133 ARG B CA  
2142 C C   . ARG B 116 ? 0.7020 0.9297 0.5213 -0.0309 -0.0779 0.0381  133 ARG B C   
2143 O O   . ARG B 116 ? 0.6993 0.9190 0.5101 -0.0237 -0.0770 0.0384  133 ARG B O   
2144 C CB  . ARG B 116 ? 0.7038 0.9479 0.5304 -0.0393 -0.0877 0.0376  133 ARG B CB  
2145 N N   . VAL B 117 ? 0.7238 0.9606 0.5509 -0.0317 -0.0754 0.0387  134 VAL B N   
2146 C CA  . VAL B 117 ? 0.7547 0.9929 0.5803 -0.0241 -0.0717 0.0385  134 VAL B CA  
2147 C C   . VAL B 117 ? 0.7725 1.0292 0.6047 -0.0183 -0.0739 0.0413  134 VAL B C   
2148 O O   . VAL B 117 ? 0.7884 1.0617 0.6307 -0.0227 -0.0772 0.0434  134 VAL B O   
2149 C CB  . VAL B 117 ? 0.7830 1.0232 0.6122 -0.0273 -0.0677 0.0373  134 VAL B CB  
2150 C CG1 . VAL B 117 ? 0.7889 1.0338 0.6173 -0.0198 -0.0641 0.0360  134 VAL B CG1 
2151 C CG2 . VAL B 117 ? 0.7961 1.0195 0.6190 -0.0318 -0.0653 0.0347  134 VAL B CG2 
2152 N N   . LEU B 118 ? 0.8054 1.0592 0.6324 -0.0084 -0.0716 0.0414  135 LEU B N   
2153 C CA  . LEU B 118 ? 0.8219 1.0928 0.6541 -0.0005 -0.0736 0.0447  135 LEU B CA  
2154 C C   . LEU B 118 ? 0.8220 1.0993 0.6567 0.0066  -0.0686 0.0444  135 LEU B C   
2155 O O   . LEU B 118 ? 0.8105 1.1042 0.6508 0.0140  -0.0691 0.0474  135 LEU B O   
2156 C CB  . LEU B 118 ? 0.8149 1.0776 0.6382 0.0075  -0.0750 0.0465  135 LEU B CB  
2157 C CG  . LEU B 118 ? 0.8100 1.0817 0.6338 0.0055  -0.0821 0.0487  135 LEU B CG  
2158 C CD1 . LEU B 118 ? 0.7852 1.0625 0.6153 -0.0074 -0.0864 0.0466  135 LEU B CD1 
2159 C CD2 . LEU B 118 ? 0.8284 1.0816 0.6384 0.0107  -0.0814 0.0494  135 LEU B CD2 
2160 N N   . GLY B 119 ? 0.8526 1.1181 0.6829 0.0047  -0.0638 0.0404  136 GLY B N   
2161 C CA  . GLY B 119 ? 0.8805 1.1490 0.7105 0.0113  -0.0585 0.0380  136 GLY B CA  
2162 C C   . GLY B 119 ? 0.8876 1.1355 0.7083 0.0096  -0.0538 0.0319  136 GLY B C   
2163 O O   . GLY B 119 ? 0.8605 1.0955 0.6774 0.0023  -0.0547 0.0303  136 GLY B O   
2164 N N   . GLY B 120 ? 0.9126 1.1580 0.7299 0.0166  -0.0486 0.0280  137 GLY B N   
2165 C CA  . GLY B 120 ? 0.9246 1.1540 0.7344 0.0143  -0.0441 0.0205  137 GLY B CA  
2166 C C   . GLY B 120 ? 0.9601 1.2046 0.7731 0.0119  -0.0425 0.0174  137 GLY B C   
2167 O O   . GLY B 120 ? 0.9239 1.1888 0.7452 0.0091  -0.0451 0.0221  137 GLY B O   
2168 N N   . GLU B 121 ? 0.9852 1.2198 0.7914 0.0129  -0.0380 0.0093  138 GLU B N   
2169 C CA  . GLU B 121 ? 0.9754 1.2235 0.7818 0.0105  -0.0364 0.0050  138 GLU B CA  
2170 C C   . GLU B 121 ? 0.9713 1.2211 0.7787 -0.0004 -0.0392 0.0047  138 GLU B C   
2171 O O   . GLU B 121 ? 0.9335 1.1683 0.7353 -0.0052 -0.0383 -0.0013 138 GLU B O   
2172 C CB  . GLU B 121 ? 0.9886 1.2255 0.7864 0.0157  -0.0307 -0.0050 138 GLU B CB  
2173 N N   . HIS B 122 ? 0.9637 1.2320 0.7791 -0.0041 -0.0422 0.0118  139 HIS B N   
2174 C CA  . HIS B 122 ? 0.9569 1.2306 0.7746 -0.0128 -0.0443 0.0136  139 HIS B CA  
2175 C C   . HIS B 122 ? 0.9235 1.2189 0.7510 -0.0143 -0.0459 0.0225  139 HIS B C   
2176 O O   . HIS B 122 ? 1.0073 1.3143 0.8395 -0.0091 -0.0452 0.0260  139 HIS B O   
2177 C CB  . HIS B 122 ? 0.9371 1.1937 0.7538 -0.0189 -0.0467 0.0143  139 HIS B CB  
2178 C CG  . HIS B 122 ? 0.9466 1.2013 0.7679 -0.0188 -0.0497 0.0209  139 HIS B CG  
2179 N ND1 . HIS B 122 ? 0.9726 1.2195 0.7917 -0.0126 -0.0496 0.0211  139 HIS B ND1 
2180 C CD2 . HIS B 122 ? 0.9370 1.1973 0.7651 -0.0241 -0.0529 0.0272  139 HIS B CD2 
2181 C CE1 . HIS B 122 ? 0.9908 1.2405 0.8147 -0.0144 -0.0534 0.0268  139 HIS B CE1 
2182 N NE2 . HIS B 122 ? 0.9851 1.2419 0.8145 -0.0218 -0.0553 0.0300  139 HIS B NE2 
2183 N N   . ARG B 123 ? 0.9207 1.2215 0.7520 -0.0210 -0.0473 0.0266  140 ARG B N   
2184 C CA  . ARG B 123 ? 0.9511 1.2705 0.7921 -0.0229 -0.0476 0.0356  140 ARG B CA  
2185 C C   . ARG B 123 ? 0.9439 1.2579 0.7914 -0.0300 -0.0504 0.0418  140 ARG B C   
2186 O O   . ARG B 123 ? 0.9990 1.3211 0.8516 -0.0340 -0.0498 0.0475  140 ARG B O   
2187 C CB  . ARG B 123 ? 0.9976 1.3334 0.8373 -0.0223 -0.0451 0.0364  140 ARG B CB  
2188 C CG  . ARG B 123 ? 1.0401 1.3930 0.8799 -0.0151 -0.0419 0.0362  140 ARG B CG  
2189 C CD  . ARG B 123 ? 1.0230 1.3938 0.8601 -0.0142 -0.0394 0.0373  140 ARG B CD  
2190 N N   . LEU B 124 ? 0.9109 1.2113 0.7580 -0.0310 -0.0530 0.0407  141 LEU B N   
2191 C CA  . LEU B 124 ? 0.9008 1.1942 0.7527 -0.0373 -0.0556 0.0447  141 LEU B CA  
2192 C C   . LEU B 124 ? 0.9212 1.2140 0.7762 -0.0359 -0.0585 0.0455  141 LEU B C   
2193 O O   . LEU B 124 ? 0.8783 1.1571 0.7292 -0.0370 -0.0610 0.0434  141 LEU B O   
2194 C CB  . LEU B 124 ? 0.8995 1.1747 0.7445 -0.0406 -0.0561 0.0410  141 LEU B CB  
2195 C CG  . LEU B 124 ? 0.9036 1.1809 0.7466 -0.0428 -0.0541 0.0405  141 LEU B CG  
2196 C CD1 . LEU B 124 ? 0.8974 1.1579 0.7343 -0.0456 -0.0543 0.0363  141 LEU B CD1 
2197 C CD2 . LEU B 124 ? 0.9024 1.1905 0.7539 -0.0465 -0.0534 0.0485  141 LEU B CD2 
2198 N N   . ASN B 125 ? 0.9381 1.2482 0.8004 -0.0330 -0.0582 0.0489  142 ASN B N   
2199 C CA  . ASN B 125 ? 0.8913 1.2062 0.7574 -0.0302 -0.0610 0.0497  142 ASN B CA  
2200 C C   . ASN B 125 ? 0.8482 1.1606 0.7204 -0.0377 -0.0651 0.0521  142 ASN B C   
2201 O O   . ASN B 125 ? 0.7922 1.1073 0.6713 -0.0448 -0.0647 0.0557  142 ASN B O   
2202 C CB  . ASN B 125 ? 0.9432 1.2802 0.8174 -0.0256 -0.0591 0.0532  142 ASN B CB  
2203 C CG  . ASN B 125 ? 1.0185 1.3560 0.8848 -0.0161 -0.0553 0.0489  142 ASN B CG  
2204 O OD1 . ASN B 125 ? 0.9705 1.3174 0.8362 -0.0143 -0.0515 0.0490  142 ASN B OD1 
2205 N ND2 . ASN B 125 ? 1.0468 1.3735 0.9062 -0.0098 -0.0560 0.0450  142 ASN B ND2 
2206 N N   . ASN B 126 ? 0.8397 1.1463 0.7086 -0.0357 -0.0689 0.0499  143 ASN B N   
2207 C CA  . ASN B 126 ? 0.8331 1.1369 0.7054 -0.0424 -0.0735 0.0502  143 ASN B CA  
2208 C C   . ASN B 126 ? 0.7815 1.0687 0.6499 -0.0493 -0.0728 0.0489  143 ASN B C   
2209 O O   . ASN B 126 ? 0.7597 1.0464 0.6341 -0.0569 -0.0746 0.0499  143 ASN B O   
2210 C CB  . ASN B 126 ? 0.8719 1.1961 0.7592 -0.0472 -0.0752 0.0544  143 ASN B CB  
2211 C CG  . ASN B 126 ? 0.8870 1.2304 0.7795 -0.0398 -0.0754 0.0564  143 ASN B CG  
2212 O OD1 . ASN B 126 ? 0.9120 1.2580 0.8020 -0.0348 -0.0790 0.0550  143 ASN B OD1 
2213 N ND2 . ASN B 126 ? 0.9163 1.2743 0.8158 -0.0380 -0.0712 0.0601  143 ASN B ND2 
2214 N N   . TYR B 127 ? 0.7700 1.0435 0.6287 -0.0466 -0.0700 0.0463  144 TYR B N   
2215 C CA  . TYR B 127 ? 0.7711 1.0291 0.6254 -0.0516 -0.0691 0.0450  144 TYR B CA  
2216 C C   . TYR B 127 ? 0.7851 1.0315 0.6337 -0.0531 -0.0727 0.0423  144 TYR B C   
2217 O O   . TYR B 127 ? 0.8127 1.0558 0.6544 -0.0476 -0.0743 0.0404  144 TYR B O   
2218 C CB  . TYR B 127 ? 0.7707 1.0192 0.6166 -0.0482 -0.0657 0.0423  144 TYR B CB  
2219 C CG  . TYR B 127 ? 0.7545 0.9886 0.5961 -0.0524 -0.0644 0.0413  144 TYR B CG  
2220 C CD1 . TYR B 127 ? 0.7365 0.9737 0.5830 -0.0562 -0.0621 0.0443  144 TYR B CD1 
2221 C CD2 . TYR B 127 ? 0.7624 0.9805 0.5950 -0.0516 -0.0650 0.0380  144 TYR B CD2 
2222 C CE1 . TYR B 127 ? 0.7217 0.9473 0.5651 -0.0590 -0.0606 0.0438  144 TYR B CE1 
2223 C CE2 . TYR B 127 ? 0.7361 0.9426 0.5654 -0.0550 -0.0632 0.0373  144 TYR B CE2 
2224 C CZ  . TYR B 127 ? 0.7078 0.9185 0.5430 -0.0585 -0.0611 0.0401  144 TYR B CZ  
2225 O OH  . TYR B 127 ? 0.7031 0.9037 0.5358 -0.0609 -0.0591 0.0400  144 TYR B OH  
2226 N N   . ARG B 128 ? 0.7653 1.0051 0.6160 -0.0599 -0.0734 0.0423  145 ARG B N   
2227 C CA  . ARG B 128 ? 0.7771 1.0046 0.6201 -0.0612 -0.0762 0.0388  145 ARG B CA  
2228 C C   . ARG B 128 ? 0.7737 0.9871 0.6142 -0.0656 -0.0734 0.0381  145 ARG B C   
2229 O O   . ARG B 128 ? 0.7661 0.9818 0.6142 -0.0694 -0.0707 0.0411  145 ARG B O   
2230 C CB  . ARG B 128 ? 0.7811 1.0178 0.6294 -0.0649 -0.0815 0.0377  145 ARG B CB  
2231 N N   . SER B 129 ? 0.7844 0.9837 0.6143 -0.0642 -0.0736 0.0351  146 SER B N   
2232 C CA  . SER B 129 ? 0.7435 0.9290 0.5696 -0.0667 -0.0701 0.0344  146 SER B CA  
2233 C C   . SER B 129 ? 0.7513 0.9249 0.5684 -0.0676 -0.0718 0.0307  146 SER B C   
2234 O O   . SER B 129 ? 0.6994 0.8736 0.5096 -0.0646 -0.0752 0.0287  146 SER B O   
2235 C CB  . SER B 129 ? 0.7192 0.8997 0.5404 -0.0627 -0.0663 0.0348  146 SER B CB  
2236 O OG  . SER B 129 ? 0.7263 0.8940 0.5427 -0.0641 -0.0634 0.0340  146 SER B OG  
2237 N N   . VAL B 130 ? 0.7548 0.9180 0.5713 -0.0711 -0.0690 0.0299  147 VAL B N   
2238 C CA  . VAL B 130 ? 0.7836 0.9346 0.5906 -0.0718 -0.0695 0.0259  147 VAL B CA  
2239 C C   . VAL B 130 ? 0.7979 0.9368 0.6014 -0.0710 -0.0638 0.0267  147 VAL B C   
2240 O O   . VAL B 130 ? 0.8342 0.9727 0.6454 -0.0733 -0.0604 0.0293  147 VAL B O   
2241 C CB  . VAL B 130 ? 0.7994 0.9504 0.6104 -0.0780 -0.0723 0.0225  147 VAL B CB  
2242 C CG1 . VAL B 130 ? 0.8209 0.9587 0.6204 -0.0784 -0.0723 0.0172  147 VAL B CG1 
2243 C CG2 . VAL B 130 ? 0.7635 0.9296 0.5794 -0.0793 -0.0784 0.0216  147 VAL B CG2 
2244 N N   . THR B 131 ? 0.7731 0.9032 0.5655 -0.0675 -0.0623 0.0254  148 THR B N   
2245 C CA  . THR B 131 ? 0.7852 0.9053 0.5743 -0.0666 -0.0567 0.0262  148 THR B CA  
2246 C C   . THR B 131 ? 0.8057 0.9140 0.5838 -0.0660 -0.0558 0.0226  148 THR B C   
2247 O O   . THR B 131 ? 0.8473 0.9548 0.6163 -0.0643 -0.0592 0.0200  148 THR B O   
2248 C CB  . THR B 131 ? 0.7780 0.8981 0.5645 -0.0630 -0.0541 0.0283  148 THR B CB  
2249 O OG1 . THR B 131 ? 0.8048 0.9358 0.5979 -0.0625 -0.0561 0.0299  148 THR B OG1 
2250 C CG2 . THR B 131 ? 0.7960 0.9124 0.5851 -0.0635 -0.0486 0.0302  148 THR B CG2 
2251 N N   . SER B 132 ? 0.7871 0.8871 0.5655 -0.0667 -0.0509 0.0226  149 SER B N   
2252 C CA  . SER B 132 ? 0.7887 0.8774 0.5565 -0.0658 -0.0490 0.0188  149 SER B CA  
2253 C C   . SER B 132 ? 0.7988 0.8806 0.5660 -0.0636 -0.0418 0.0212  149 SER B C   
2254 O O   . SER B 132 ? 0.7801 0.8640 0.5573 -0.0645 -0.0386 0.0243  149 SER B O   
2255 C CB  . SER B 132 ? 0.8230 0.9080 0.5929 -0.0701 -0.0509 0.0141  149 SER B CB  
2256 O OG  . SER B 132 ? 0.8213 0.9025 0.6007 -0.0718 -0.0462 0.0164  149 SER B OG  
2257 N N   . VAL B 133 ? 0.8341 0.9089 0.5900 -0.0604 -0.0391 0.0202  150 VAL B N   
2258 C CA  . VAL B 133 ? 0.8502 0.9197 0.6056 -0.0582 -0.0319 0.0225  150 VAL B CA  
2259 C C   . VAL B 133 ? 0.8851 0.9439 0.6331 -0.0573 -0.0290 0.0182  150 VAL B C   
2260 O O   . VAL B 133 ? 0.9920 1.0457 0.7274 -0.0562 -0.0309 0.0137  150 VAL B O   
2261 C CB  . VAL B 133 ? 0.8512 0.9196 0.5995 -0.0553 -0.0292 0.0250  150 VAL B CB  
2262 C CG1 . VAL B 133 ? 0.8802 0.9462 0.6308 -0.0537 -0.0215 0.0280  150 VAL B CG1 
2263 C CG2 . VAL B 133 ? 0.8300 0.9064 0.5839 -0.0561 -0.0320 0.0277  150 VAL B CG2 
2264 N N   . ASN B 134 ? 0.8971 0.9528 0.6525 -0.0571 -0.0241 0.0195  151 ASN B N   
2265 C CA  . ASN B 134 ? 0.9269 0.9706 0.6765 -0.0561 -0.0206 0.0147  151 ASN B CA  
2266 C C   . ASN B 134 ? 0.9262 0.9660 0.6759 -0.0515 -0.0121 0.0178  151 ASN B C   
2267 O O   . ASN B 134 ? 0.9156 0.9606 0.6773 -0.0506 -0.0086 0.0234  151 ASN B O   
2268 C CB  . ASN B 134 ? 0.9466 0.9875 0.7057 -0.0597 -0.0217 0.0133  151 ASN B CB  
2269 C CG  . ASN B 134 ? 0.9645 1.0097 0.7241 -0.0649 -0.0298 0.0094  151 ASN B CG  
2270 O OD1 . ASN B 134 ? 0.9497 0.9898 0.6994 -0.0667 -0.0332 0.0020  151 ASN B OD1 
2271 N ND2 . ASN B 134 ? 0.9669 1.0233 0.7383 -0.0672 -0.0329 0.0142  151 ASN B ND2 
2272 N N   . GLU B 135 ? 0.9979 1.0300 0.7342 -0.0482 -0.0086 0.0145  152 GLU B N   
2273 C CA  . GLU B 135 ? 1.0264 1.0564 0.7621 -0.0433 0.0000  0.0178  152 GLU B CA  
2274 C C   . GLU B 135 ? 1.0270 1.0464 0.7636 -0.0406 0.0057  0.0151  152 GLU B C   
2275 O O   . GLU B 135 ? 1.0506 1.0595 0.7806 -0.0422 0.0038  0.0077  152 GLU B O   
2276 C CB  . GLU B 135 ? 1.0632 1.0903 0.7836 -0.0403 0.0020  0.0166  152 GLU B CB  
2277 C CG  . GLU B 135 ? 1.1021 1.1308 0.8238 -0.0359 0.0111  0.0216  152 GLU B CG  
2278 C CD  . GLU B 135 ? 1.1787 1.2063 0.8868 -0.0334 0.0134  0.0224  152 GLU B CD  
2279 O OE1 . GLU B 135 ? 1.2347 1.2539 0.9272 -0.0302 0.0151  0.0173  152 GLU B OE1 
2280 O OE2 . GLU B 135 ? 1.1694 1.2044 0.8822 -0.0349 0.0136  0.0281  152 GLU B OE2 
2281 N N   . PHE B 136 ? 1.0019 1.0245 0.7468 -0.0364 0.0131  0.0210  153 PHE B N   
2282 C CA  . PHE B 136 ? 1.0382 1.0515 0.7862 -0.0321 0.0200  0.0204  153 PHE B CA  
2283 C C   . PHE B 136 ? 1.0671 1.0801 0.8112 -0.0254 0.0291  0.0228  153 PHE B C   
2284 O O   . PHE B 136 ? 1.0702 1.0966 0.8226 -0.0241 0.0316  0.0301  153 PHE B O   
2285 C CB  . PHE B 136 ? 1.0380 1.0584 0.8037 -0.0323 0.0204  0.0273  153 PHE B CB  
2286 C CG  . PHE B 136 ? 1.0211 1.0382 0.7911 -0.0380 0.0140  0.0248  153 PHE B CG  
2287 C CD1 . PHE B 136 ? 1.0143 1.0423 0.7875 -0.0434 0.0059  0.0259  153 PHE B CD1 
2288 C CD2 . PHE B 136 ? 1.0027 1.0050 0.7736 -0.0379 0.0168  0.0211  153 PHE B CD2 
2289 C CE1 . PHE B 136 ? 1.0052 1.0318 0.7830 -0.0485 0.0006  0.0240  153 PHE B CE1 
2290 C CE2 . PHE B 136 ? 1.0123 1.0120 0.7883 -0.0439 0.0115  0.0191  153 PHE B CE2 
2291 C CZ  . PHE B 136 ? 1.0147 1.0276 0.7944 -0.0492 0.0033  0.0208  153 PHE B CZ  
2292 N N   . VAL B 137 ? 1.1076 1.1062 0.8397 -0.0215 0.0341  0.0163  154 VAL B N   
2293 C CA  . VAL B 137 ? 1.1611 1.1588 0.8879 -0.0142 0.0437  0.0180  154 VAL B CA  
2294 C C   . VAL B 137 ? 1.1891 1.1814 0.9249 -0.0078 0.0521  0.0206  154 VAL B C   
2295 O O   . VAL B 137 ? 1.1912 1.1674 0.9235 -0.0071 0.0534  0.0142  154 VAL B O   
2296 C CB  . VAL B 137 ? 1.1592 1.1450 0.8644 -0.0124 0.0449  0.0089  154 VAL B CB  
2297 N N   . VAL B 138 ? 1.2370 1.2427 0.9848 -0.0031 0.0580  0.0299  155 VAL B N   
2298 C CA  . VAL B 138 ? 1.2772 1.2813 1.0350 0.0048  0.0668  0.0346  155 VAL B CA  
2299 C C   . VAL B 138 ? 1.2908 1.2912 1.0406 0.0134  0.0775  0.0339  155 VAL B C   
2300 O O   . VAL B 138 ? 1.2823 1.2700 1.0308 0.0208  0.0855  0.0320  155 VAL B O   
2301 C CB  . VAL B 138 ? 1.2094 1.2348 0.9876 0.0053  0.0662  0.0462  155 VAL B CB  
2302 C CG1 . VAL B 138 ? 1.2036 1.2304 0.9924 0.0152  0.0757  0.0528  155 VAL B CG1 
2303 C CG2 . VAL B 138 ? 1.1890 1.2174 0.9745 -0.0018 0.0569  0.0469  155 VAL B CG2 
2304 N N   . VAL B 147 ? 1.0379 1.0962 0.8019 -0.0148 0.0521  0.0475  164 VAL B N   
2305 C CA  . VAL B 147 ? 1.0395 1.0951 0.7977 -0.0216 0.0430  0.0441  164 VAL B CA  
2306 C C   . VAL B 147 ? 0.9892 1.0567 0.7621 -0.0270 0.0360  0.0472  164 VAL B C   
2307 O O   . VAL B 147 ? 0.9979 1.0808 0.7834 -0.0287 0.0372  0.0526  164 VAL B O   
2308 C CB  . VAL B 147 ? 1.0764 1.1338 0.8267 -0.0238 0.0440  0.0453  164 VAL B CB  
2309 C CG2 . VAL B 147 ? 1.0664 1.1395 0.8303 -0.0251 0.0492  0.0525  164 VAL B CG2 
2310 N N   . TYR B 148 ? 0.9444 1.0057 0.7154 -0.0298 0.0290  0.0433  165 TYR B N   
2311 C CA  . TYR B 148 ? 0.9117 0.9835 0.6929 -0.0351 0.0218  0.0453  165 TYR B CA  
2312 C C   . TYR B 148 ? 0.9011 0.9642 0.6760 -0.0385 0.0142  0.0400  165 TYR B C   
2313 O O   . TYR B 148 ? 0.9553 1.0052 0.7215 -0.0368 0.0147  0.0350  165 TYR B O   
2314 C CB  . TYR B 148 ? 0.9022 0.9864 0.6996 -0.0333 0.0234  0.0512  165 TYR B CB  
2315 C CG  . TYR B 148 ? 0.8980 0.9736 0.6973 -0.0301 0.0241  0.0508  165 TYR B CG  
2316 C CD1 . TYR B 148 ? 0.8829 0.9495 0.6805 -0.0235 0.0319  0.0511  165 TYR B CD1 
2317 C CD2 . TYR B 148 ? 0.8959 0.9720 0.6995 -0.0337 0.0178  0.0504  165 TYR B CD2 
2318 C CE1 . TYR B 148 ? 0.8852 0.9414 0.6852 -0.0207 0.0334  0.0508  165 TYR B CE1 
2319 C CE2 . TYR B 148 ? 0.8772 0.9442 0.6837 -0.0314 0.0193  0.0508  165 TYR B CE2 
2320 C CZ  . TYR B 148 ? 0.8866 0.9427 0.6913 -0.0251 0.0272  0.0509  165 TYR B CZ  
2321 O OH  . TYR B 148 ? 0.8965 0.9409 0.7043 -0.0230 0.0297  0.0511  165 TYR B OH  
2322 N N   . SER B 149 ? 0.8520 0.9230 0.6315 -0.0432 0.0076  0.0407  166 SER B N   
2323 C CA  . SER B 149 ? 0.8222 0.8885 0.5982 -0.0465 0.0004  0.0365  166 SER B CA  
2324 C C   . SER B 149 ? 0.7911 0.8667 0.5802 -0.0486 -0.0030 0.0398  166 SER B C   
2325 O O   . SER B 149 ? 0.7335 0.8215 0.5336 -0.0478 -0.0011 0.0451  166 SER B O   
2326 C CB  . SER B 149 ? 0.8100 0.8765 0.5780 -0.0493 -0.0046 0.0343  166 SER B CB  
2327 O OG  . SER B 149 ? 0.8108 0.8760 0.5723 -0.0477 -0.0004 0.0355  166 SER B OG  
2328 N N   . VAL B 150 ? 0.7579 0.8287 0.5457 -0.0511 -0.0079 0.0365  167 VAL B N   
2329 C CA  . VAL B 150 ? 0.7665 0.8463 0.5649 -0.0537 -0.0118 0.0395  167 VAL B CA  
2330 C C   . VAL B 150 ? 0.7967 0.8786 0.5906 -0.0575 -0.0190 0.0360  167 VAL B C   
2331 O O   . VAL B 150 ? 0.8006 0.8736 0.5850 -0.0586 -0.0216 0.0306  167 VAL B O   
2332 C CB  . VAL B 150 ? 0.7410 0.8128 0.5437 -0.0535 -0.0103 0.0396  167 VAL B CB  
2333 C CG1 . VAL B 150 ? 0.7296 0.8098 0.5412 -0.0569 -0.0149 0.0423  167 VAL B CG1 
2334 C CG2 . VAL B 150 ? 0.7504 0.8215 0.5597 -0.0483 -0.0028 0.0449  167 VAL B CG2 
2335 N N   . VAL B 151 ? 0.7965 0.8912 0.5973 -0.0592 -0.0223 0.0388  168 VAL B N   
2336 C CA  . VAL B 151 ? 0.7895 0.8875 0.5876 -0.0618 -0.0285 0.0363  168 VAL B CA  
2337 C C   . VAL B 151 ? 0.7767 0.8812 0.5835 -0.0640 -0.0316 0.0380  168 VAL B C   
2338 O O   . VAL B 151 ? 0.7983 0.9130 0.6145 -0.0636 -0.0305 0.0428  168 VAL B O   
2339 C CB  . VAL B 151 ? 0.7965 0.9031 0.5954 -0.0620 -0.0295 0.0374  168 VAL B CB  
2340 C CG1 . VAL B 151 ? 0.7917 0.9014 0.5882 -0.0633 -0.0352 0.0352  168 VAL B CG1 
2341 C CG2 . VAL B 151 ? 0.8347 0.9348 0.6262 -0.0605 -0.0255 0.0366  168 VAL B CG2 
2342 N N   . LEU B 152 ? 0.7556 0.8555 0.5593 -0.0664 -0.0355 0.0343  169 LEU B N   
2343 C CA  . LEU B 152 ? 0.7341 0.8408 0.5463 -0.0693 -0.0385 0.0359  169 LEU B CA  
2344 C C   . LEU B 152 ? 0.7172 0.8341 0.5288 -0.0700 -0.0438 0.0351  169 LEU B C   
2345 O O   . LEU B 152 ? 0.7064 0.8202 0.5092 -0.0693 -0.0466 0.0313  169 LEU B O   
2346 C CB  . LEU B 152 ? 0.7458 0.8426 0.5566 -0.0727 -0.0397 0.0316  169 LEU B CB  
2347 C CG  . LEU B 152 ? 0.7768 0.8600 0.5876 -0.0722 -0.0340 0.0310  169 LEU B CG  
2348 C CD2 . LEU B 152 ? 0.7554 0.8425 0.5769 -0.0695 -0.0286 0.0389  169 LEU B CD2 
2349 N N   . GLU B 153 ? 0.7246 0.8538 0.5450 -0.0704 -0.0447 0.0391  170 GLU B N   
2350 C CA  . GLU B 153 ? 0.7303 0.8695 0.5512 -0.0706 -0.0492 0.0383  170 GLU B CA  
2351 C C   . GLU B 153 ? 0.7310 0.8801 0.5624 -0.0729 -0.0502 0.0419  170 GLU B C   
2352 O O   . GLU B 153 ? 0.7148 0.8692 0.5535 -0.0724 -0.0471 0.0471  170 GLU B O   
2353 C CB  . GLU B 153 ? 0.7107 0.8562 0.5299 -0.0679 -0.0486 0.0389  170 GLU B CB  
2354 C CG  . GLU B 153 ? 0.7282 0.8800 0.5454 -0.0668 -0.0525 0.0370  170 GLU B CG  
2355 C CD  . GLU B 153 ? 0.7328 0.8801 0.5424 -0.0642 -0.0517 0.0346  170 GLU B CD  
2356 O OE2 . GLU B 153 ? 0.7325 0.8854 0.5444 -0.0637 -0.0501 0.0348  170 GLU B OE2 
2357 N N   . SER B 154 ? 0.7378 0.8904 0.5701 -0.0751 -0.0545 0.0398  171 SER B N   
2358 C CA  . SER B 154 ? 0.7398 0.9013 0.5827 -0.0783 -0.0551 0.0431  171 SER B CA  
2359 C C   . SER B 154 ? 0.7150 0.8895 0.5592 -0.0775 -0.0594 0.0424  171 SER B C   
2360 O O   . SER B 154 ? 0.7308 0.9036 0.5674 -0.0759 -0.0629 0.0381  171 SER B O   
2361 C CB  . SER B 154 ? 0.7558 0.9080 0.6007 -0.0835 -0.0557 0.0403  171 SER B CB  
2362 O OG  . SER B 154 ? 0.7901 0.9413 0.6282 -0.0846 -0.0609 0.0340  171 SER B OG  
2363 N N   . TYR B 155 ? 0.6682 0.8560 0.5216 -0.0779 -0.0587 0.0473  172 TYR B N   
2364 C CA  . TYR B 155 ? 0.6694 0.8708 0.5246 -0.0760 -0.0619 0.0471  172 TYR B CA  
2365 C C   . TYR B 155 ? 0.6892 0.9036 0.5565 -0.0794 -0.0619 0.0515  172 TYR B C   
2366 O O   . TYR B 155 ? 0.6668 0.8794 0.5417 -0.0831 -0.0588 0.0557  172 TYR B O   
2367 C CB  . TYR B 155 ? 0.6653 0.8732 0.5170 -0.0707 -0.0603 0.0480  172 TYR B CB  
2368 C CG  . TYR B 155 ? 0.6699 0.8865 0.5281 -0.0704 -0.0566 0.0538  172 TYR B CG  
2369 C CD1 . TYR B 155 ? 0.6712 0.9035 0.5375 -0.0702 -0.0560 0.0584  172 TYR B CD1 
2370 C CD2 . TYR B 155 ? 0.6604 0.8712 0.5171 -0.0699 -0.0533 0.0555  172 TYR B CD2 
2371 C CE1 . TYR B 155 ? 0.6740 0.9153 0.5451 -0.0692 -0.0524 0.0646  172 TYR B CE1 
2372 C CE2 . TYR B 155 ? 0.6620 0.8827 0.5242 -0.0687 -0.0502 0.0616  172 TYR B CE2 
2373 C CZ  . TYR B 155 ? 0.6569 0.8927 0.5256 -0.0682 -0.0497 0.0662  172 TYR B CZ  
2374 O OH  . TYR B 155 ? 0.6580 0.9044 0.5310 -0.0662 -0.0464 0.0730  172 TYR B OH  
2375 N N   . ILE B 156 ? 0.7102 0.9374 0.5794 -0.0776 -0.0649 0.0509  173 ILE B N   
2376 C CA  . ILE B 156 ? 0.7247 0.9682 0.6055 -0.0795 -0.0645 0.0557  173 ILE B CA  
2377 C C   . ILE B 156 ? 0.7099 0.9666 0.5885 -0.0729 -0.0650 0.0558  173 ILE B C   
2378 O O   . ILE B 156 ? 0.7109 0.9635 0.5805 -0.0683 -0.0673 0.0513  173 ILE B O   
2379 C CB  . ILE B 156 ? 0.7690 1.0163 0.6571 -0.0857 -0.0683 0.0536  173 ILE B CB  
2380 C CG1 . ILE B 156 ? 0.7756 1.0401 0.6780 -0.0888 -0.0666 0.0597  173 ILE B CG1 
2381 C CG2 . ILE B 156 ? 0.7703 1.0209 0.6516 -0.0823 -0.0739 0.0482  173 ILE B CG2 
2382 C CD1 . ILE B 156 ? 0.7962 1.0633 0.7086 -0.0976 -0.0694 0.0580  173 ILE B CD1 
2383 N N   . VAL B 157 ? 0.7267 0.9987 0.6131 -0.0720 -0.0623 0.0613  174 VAL B N   
2384 C CA  . VAL B 157 ? 0.7179 1.0024 0.6017 -0.0651 -0.0620 0.0610  174 VAL B CA  
2385 C C   . VAL B 157 ? 0.7429 1.0472 0.6376 -0.0652 -0.0594 0.0675  174 VAL B C   
2386 O O   . VAL B 157 ? 0.7186 1.0256 0.6219 -0.0700 -0.0566 0.0735  174 VAL B O   
2387 C CB  . VAL B 157 ? 0.7011 0.9794 0.5751 -0.0606 -0.0597 0.0588  174 VAL B CB  
2388 C CG1 . VAL B 157 ? 0.6930 0.9758 0.5710 -0.0620 -0.0556 0.0647  174 VAL B CG1 
2389 C CG2 . VAL B 157 ? 0.7013 0.9869 0.5698 -0.0536 -0.0596 0.0555  174 VAL B CG2 
2390 N N   . ASP B 158 ? 0.7823 1.0998 0.6767 -0.0595 -0.0597 0.0666  175 ASP B N   
2391 C CA  . ASP B 158 ? 0.7991 1.1370 0.7026 -0.0581 -0.0565 0.0728  175 ASP B CA  
2392 C C   . ASP B 158 ? 0.7852 1.1267 0.6847 -0.0551 -0.0520 0.0759  175 ASP B C   
2393 O O   . ASP B 158 ? 0.7617 1.0997 0.6505 -0.0496 -0.0517 0.0710  175 ASP B O   
2394 C CB  . ASP B 158 ? 0.8306 1.1818 0.7337 -0.0511 -0.0575 0.0706  175 ASP B CB  
2395 C CG  . ASP B 158 ? 0.8336 1.1903 0.7443 -0.0536 -0.0619 0.0699  175 ASP B CG  
2396 O OD1 . ASP B 158 ? 0.8514 1.2039 0.7690 -0.0621 -0.0642 0.0709  175 ASP B OD1 
2397 O OD2 . ASP B 158 ? 0.8184 1.1843 0.7281 -0.0468 -0.0631 0.0680  175 ASP B OD2 
2398 N N   . ILE B 159 ? 0.7841 1.1328 0.6923 -0.0589 -0.0484 0.0841  176 ILE B N   
2399 C CA  . ILE B 159 ? 0.7966 1.1564 0.7029 -0.0549 -0.0439 0.0892  176 ILE B CA  
2400 C C   . ILE B 159 ? 0.8214 1.1976 0.7249 -0.0478 -0.0430 0.0870  176 ILE B C   
2401 O O   . ILE B 159 ? 0.8455 1.2333 0.7574 -0.0479 -0.0430 0.0892  176 ILE B O   
2402 C CB  . ILE B 159 ? 0.7902 1.1583 0.7083 -0.0592 -0.0393 0.1005  176 ILE B CB  
2403 C CG1 . ILE B 159 ? 0.7798 1.1298 0.7000 -0.0652 -0.0390 0.1027  176 ILE B CG1 
2404 C CG2 . ILE B 159 ? 0.7925 1.1777 0.7078 -0.0533 -0.0346 0.1066  176 ILE B CG2 
2405 C CD1 . ILE B 159 ? 0.7718 1.1238 0.7059 -0.0714 -0.0347 0.1127  176 ILE B CD1 
2406 N N   . PRO B 160 ? 0.8348 1.2121 0.7267 -0.0417 -0.0423 0.0820  177 PRO B N   
2407 C CA  . PRO B 160 ? 0.8833 1.2750 0.7719 -0.0343 -0.0406 0.0792  177 PRO B CA  
2408 C C   . PRO B 160 ? 0.9684 1.3827 0.8635 -0.0324 -0.0356 0.0883  177 PRO B C   
2409 O O   . PRO B 160 ? 1.0078 1.4254 0.9068 -0.0356 -0.0331 0.0964  177 PRO B O   
2410 C CB  . PRO B 160 ? 0.8665 1.2509 0.7407 -0.0299 -0.0411 0.0701  177 PRO B CB  
2411 C CG  . PRO B 160 ? 0.8552 1.2235 0.7264 -0.0351 -0.0431 0.0691  177 PRO B CG  
2412 C CD  . PRO B 160 ? 0.8421 1.2098 0.7244 -0.0413 -0.0426 0.0786  177 PRO B CD  
2413 N N   . GLN B 161 ? 1.0188 1.4485 0.9154 -0.0267 -0.0335 0.0880  178 GLN B N   
2414 C CA  . GLN B 161 ? 1.0781 1.5308 0.9788 -0.0233 -0.0280 0.0961  178 GLN B CA  
2415 C C   . GLN B 161 ? 1.1030 1.5587 0.9906 -0.0190 -0.0263 0.0934  178 GLN B C   
2416 O O   . GLN B 161 ? 1.1161 1.5616 0.9916 -0.0158 -0.0287 0.0825  178 GLN B O   
2417 C CB  . GLN B 161 ? 1.1050 1.5737 1.0083 -0.0166 -0.0258 0.0949  178 GLN B CB  
2418 N N   . GLY B 162 ? 1.0845 1.5542 0.9750 -0.0191 -0.0221 0.1036  179 GLY B N   
2419 C CA  . GLY B 162 ? 1.0698 1.5466 0.9486 -0.0152 -0.0209 0.1026  179 GLY B CA  
2420 C C   . GLY B 162 ? 1.0788 1.5426 0.9558 -0.0199 -0.0233 0.1041  179 GLY B C   
2421 O O   . GLY B 162 ? 1.1383 1.6095 1.0063 -0.0169 -0.0230 0.1036  179 GLY B O   
2422 N N   . ASN B 163 ? 1.0232 1.4689 0.9083 -0.0268 -0.0257 0.1058  180 ASN B N   
2423 C CA  . ASN B 163 ? 0.9592 1.3911 0.8429 -0.0307 -0.0276 0.1069  180 ASN B CA  
2424 C C   . ASN B 163 ? 0.9317 1.3566 0.8282 -0.0367 -0.0254 0.1181  180 ASN B C   
2425 O O   . ASN B 163 ? 0.9096 1.3342 0.8168 -0.0405 -0.0244 0.1216  180 ASN B O   
2426 C CB  . ASN B 163 ? 0.9612 1.3723 0.8384 -0.0330 -0.0330 0.0944  180 ASN B CB  
2427 C CG  . ASN B 163 ? 0.9899 1.4031 0.8535 -0.0287 -0.0347 0.0838  180 ASN B CG  
2428 O OD1 . ASN B 163 ? 1.0076 1.4317 0.8660 -0.0266 -0.0339 0.0856  180 ASN B OD1 
2429 N ND2 . ASN B 163 ? 1.0016 1.4045 0.8597 -0.0276 -0.0372 0.0727  180 ASN B ND2 
2430 N N   . THR B 164 ? 0.9359 1.3555 0.8318 -0.0377 -0.0245 0.1233  181 THR B N   
2431 C CA  . THR B 164 ? 0.9355 1.3446 0.8427 -0.0430 -0.0217 0.1334  181 THR B CA  
2432 C C   . THR B 164 ? 0.9230 1.3077 0.8296 -0.0482 -0.0259 0.1257  181 THR B C   
2433 O O   . THR B 164 ? 0.8598 1.2372 0.7568 -0.0470 -0.0304 0.1148  181 THR B O   
2434 C CB  . THR B 164 ? 0.9273 1.3449 0.8351 -0.0396 -0.0170 0.1458  181 THR B CB  
2435 O OG1 . THR B 164 ? 0.8764 1.2843 0.7771 -0.0386 -0.0198 0.1416  181 THR B OG1 
2436 C CG2 . THR B 164 ? 0.9402 1.3844 0.8425 -0.0322 -0.0140 0.1506  181 THR B CG2 
2437 N N   . GLU B 165 ? 0.9359 1.3074 0.8525 -0.0541 -0.0240 0.1313  182 GLU B N   
2438 C CA  . GLU B 165 ? 0.9275 1.2762 0.8436 -0.0592 -0.0276 0.1239  182 GLU B CA  
2439 C C   . GLU B 165 ? 0.9058 1.2453 0.8147 -0.0568 -0.0280 0.1227  182 GLU B C   
2440 O O   . GLU B 165 ? 0.9524 1.2797 0.8543 -0.0576 -0.0322 0.1128  182 GLU B O   
2441 C CB  . GLU B 165 ? 0.9281 1.2656 0.8568 -0.0667 -0.0250 0.1292  182 GLU B CB  
2442 C CG  . GLU B 165 ? 0.9266 1.2413 0.8542 -0.0721 -0.0287 0.1208  182 GLU B CG  
2443 C CD  . GLU B 165 ? 0.9319 1.2315 0.8683 -0.0773 -0.0241 0.1275  182 GLU B CD  
2444 O OE1 . GLU B 165 ? 0.8977 1.1861 0.8301 -0.0749 -0.0224 0.1290  182 GLU B OE1 
2445 O OE2 . GLU B 165 ? 0.9628 1.2623 0.9108 -0.0836 -0.0219 0.1313  182 GLU B OE2 
2446 N N   . GLU B 166 ? 0.8690 1.2152 0.7801 -0.0534 -0.0233 0.1335  183 GLU B N   
2447 C CA  . GLU B 166 ? 0.8415 1.1834 0.7470 -0.0501 -0.0234 0.1339  183 GLU B CA  
2448 C C   . GLU B 166 ? 0.7916 1.1414 0.6855 -0.0468 -0.0284 0.1233  183 GLU B C   
2449 O O   . GLU B 166 ? 0.8111 1.1503 0.7002 -0.0474 -0.0309 0.1168  183 GLU B O   
2450 C CB  . GLU B 166 ? 0.8506 1.2046 0.7598 -0.0450 -0.0176 0.1485  183 GLU B CB  
2451 N N   . ASP B 167 ? 0.7810 1.1486 0.6708 -0.0437 -0.0292 0.1211  184 ASP B N   
2452 C CA  . ASP B 167 ? 0.8211 1.1965 0.6998 -0.0408 -0.0332 0.1107  184 ASP B CA  
2453 C C   . ASP B 167 ? 0.8361 1.1958 0.7104 -0.0442 -0.0375 0.0975  184 ASP B C   
2454 O O   . ASP B 167 ? 0.8787 1.2365 0.7451 -0.0436 -0.0404 0.0883  184 ASP B O   
2455 C CB  . ASP B 167 ? 0.8470 1.2464 0.7216 -0.0358 -0.0320 0.1120  184 ASP B CB  
2456 C CG  . ASP B 167 ? 0.8674 1.2852 0.7443 -0.0311 -0.0277 0.1257  184 ASP B CG  
2457 O OD1 . ASP B 167 ? 0.8488 1.2630 0.7280 -0.0305 -0.0266 0.1320  184 ASP B OD1 
2458 O OD2 . ASP B 167 ? 0.9220 1.3584 0.7983 -0.0273 -0.0250 0.1308  184 ASP B OD2 
2459 N N   . THR B 168 ? 0.8630 1.2121 0.7426 -0.0477 -0.0378 0.0969  185 THR B N   
2460 C CA  . THR B 168 ? 0.8280 1.1610 0.7038 -0.0503 -0.0416 0.0863  185 THR B CA  
2461 C C   . THR B 168 ? 0.8447 1.1581 0.7203 -0.0539 -0.0426 0.0846  185 THR B C   
2462 O O   . THR B 168 ? 0.8171 1.1203 0.6857 -0.0543 -0.0452 0.0762  185 THR B O   
2463 C CB  . THR B 168 ? 0.8058 1.1383 0.6874 -0.0522 -0.0422 0.0864  185 THR B CB  
2464 O OG1 . THR B 168 ? 0.8296 1.1817 0.7124 -0.0483 -0.0403 0.0892  185 THR B OG1 
2465 C CG2 . THR B 168 ? 0.8106 1.1304 0.6866 -0.0527 -0.0462 0.0761  185 THR B CG2 
2466 N N   . ARG B 169 ? 0.8535 1.1613 0.7366 -0.0563 -0.0399 0.0927  186 ARG B N   
2467 C CA  . ARG B 169 ? 0.8683 1.1576 0.7511 -0.0590 -0.0399 0.0914  186 ARG B CA  
2468 C C   . ARG B 169 ? 0.8634 1.1538 0.7401 -0.0562 -0.0402 0.0891  186 ARG B C   
2469 O O   . ARG B 169 ? 0.8313 1.1085 0.7033 -0.0577 -0.0419 0.0824  186 ARG B O   
2470 C CB  . ARG B 169 ? 0.9017 1.1848 0.7938 -0.0613 -0.0356 0.1009  186 ARG B CB  
2471 C CG  . ARG B 169 ? 0.9219 1.1830 0.8139 -0.0647 -0.0355 0.0978  186 ARG B CG  
2472 C CD  . ARG B 169 ? 0.9175 1.1693 0.8192 -0.0680 -0.0310 0.1054  186 ARG B CD  
2473 N NE  . ARG B 169 ? 0.9178 1.1774 0.8240 -0.0636 -0.0255 0.1171  186 ARG B NE  
2474 C CZ  . ARG B 169 ? 0.9085 1.1786 0.8226 -0.0630 -0.0214 0.1275  186 ARG B CZ  
2475 N NH1 . ARG B 169 ? 0.8874 1.1620 0.8071 -0.0673 -0.0219 0.1276  186 ARG B NH1 
2476 N NH2 . ARG B 169 ? 0.9250 1.2022 0.8418 -0.0576 -0.0163 0.1388  186 ARG B NH2 
2477 N N   . MET B 170 ? 0.9079 1.2157 0.7848 -0.0522 -0.0384 0.0947  187 MET B N   
2478 C CA  . MET B 170 ? 0.9120 1.2247 0.7846 -0.0501 -0.0392 0.0925  187 MET B CA  
2479 C C   . MET B 170 ? 0.8251 1.1349 0.6894 -0.0515 -0.0431 0.0798  187 MET B C   
2480 O O   . MET B 170 ? 0.6887 0.9899 0.5502 -0.0530 -0.0440 0.0749  187 MET B O   
2481 C CB  . MET B 170 ? 0.9698 1.3053 0.8435 -0.0451 -0.0373 0.1008  187 MET B CB  
2482 C CG  . MET B 170 ? 1.0776 1.4323 0.9474 -0.0427 -0.0384 0.0989  187 MET B CG  
2483 S SD  . MET B 170 ? 1.2489 1.6326 1.1188 -0.0361 -0.0361 0.1100  187 MET B SD  
2484 C CE  . MET B 170 ? 1.1609 1.5523 1.0257 -0.0356 -0.0395 0.1034  187 MET B CE  
2485 N N   . PHE B 171 ? 0.7756 1.0915 0.6365 -0.0509 -0.0447 0.0748  188 PHE B N   
2486 C CA  . PHE B 171 ? 0.7523 1.0645 0.6054 -0.0516 -0.0474 0.0632  188 PHE B CA  
2487 C C   . PHE B 171 ? 0.7834 1.0733 0.6344 -0.0547 -0.0485 0.0576  188 PHE B C   
2488 O O   . PHE B 171 ? 0.8477 1.1301 0.6942 -0.0562 -0.0494 0.0507  188 PHE B O   
2489 C CB  . PHE B 171 ? 0.7145 1.0367 0.5645 -0.0491 -0.0478 0.0595  188 PHE B CB  
2490 C CG  . PHE B 171 ? 0.7116 1.0243 0.5543 -0.0495 -0.0496 0.0479  188 PHE B CG  
2491 C CD1 . PHE B 171 ? 0.7120 1.0271 0.5491 -0.0505 -0.0505 0.0400  188 PHE B CD1 
2492 C CD2 . PHE B 171 ? 0.7251 1.0264 0.5670 -0.0491 -0.0502 0.0450  188 PHE B CD2 
2493 C CE1 . PHE B 171 ? 0.7174 1.0210 0.5483 -0.0512 -0.0510 0.0294  188 PHE B CE1 
2494 C CE2 . PHE B 171 ? 0.7280 1.0190 0.5632 -0.0484 -0.0509 0.0355  188 PHE B CE2 
2495 C CZ  . PHE B 171 ? 0.7227 1.0135 0.5524 -0.0495 -0.0509 0.0277  188 PHE B CZ  
2496 N N   . VAL B 172 ? 0.7691 1.0496 0.6236 -0.0559 -0.0485 0.0605  189 VAL B N   
2497 C CA  . VAL B 172 ? 0.7433 1.0047 0.5948 -0.0582 -0.0499 0.0556  189 VAL B CA  
2498 C C   . VAL B 172 ? 0.7276 0.9774 0.5793 -0.0602 -0.0486 0.0568  189 VAL B C   
2499 O O   . VAL B 172 ? 0.7355 0.9732 0.5819 -0.0612 -0.0492 0.0512  189 VAL B O   
2500 C CB  . VAL B 172 ? 0.7527 1.0104 0.6078 -0.0591 -0.0509 0.0576  189 VAL B CB  
2501 C CG1 . VAL B 172 ? 0.7633 1.0035 0.6142 -0.0609 -0.0528 0.0527  189 VAL B CG1 
2502 C CG2 . VAL B 172 ? 0.7591 1.0291 0.6141 -0.0562 -0.0517 0.0561  189 VAL B CG2 
2503 N N   . ASP B 173 ? 0.6880 0.9415 0.5458 -0.0600 -0.0462 0.0646  190 ASP B N   
2504 C CA  . ASP B 173 ? 0.6846 0.9290 0.5431 -0.0606 -0.0442 0.0664  190 ASP B CA  
2505 C C   . ASP B 173 ? 0.6609 0.9097 0.5157 -0.0601 -0.0445 0.0621  190 ASP B C   
2506 O O   . ASP B 173 ? 0.6685 0.9074 0.5219 -0.0610 -0.0434 0.0603  190 ASP B O   
2507 C CB  . ASP B 173 ? 0.6875 0.9379 0.5535 -0.0588 -0.0407 0.0765  190 ASP B CB  
2508 C CG  . ASP B 173 ? 0.7358 0.9778 0.6070 -0.0608 -0.0393 0.0808  190 ASP B CG  
2509 O OD1 . ASP B 173 ? 0.7883 1.0267 0.6583 -0.0633 -0.0419 0.0765  190 ASP B OD1 
2510 O OD2 . ASP B 173 ? 0.7637 1.0031 0.6408 -0.0599 -0.0354 0.0885  190 ASP B OD2 
2511 N N   . THR B 174 ? 0.6536 0.9186 0.5074 -0.0589 -0.0457 0.0604  191 THR B N   
2512 C CA  . THR B 174 ? 0.6332 0.9058 0.4846 -0.0596 -0.0464 0.0554  191 THR B CA  
2513 C C   . THR B 174 ? 0.6306 0.8890 0.4758 -0.0624 -0.0475 0.0459  191 THR B C   
2514 O O   . THR B 174 ? 0.6461 0.9017 0.4903 -0.0646 -0.0470 0.0420  191 THR B O   
2515 C CB  . THR B 174 ? 0.6048 0.8998 0.4560 -0.0576 -0.0477 0.0554  191 THR B CB  
2516 O OG1 . THR B 174 ? 0.6025 0.9102 0.4594 -0.0543 -0.0459 0.0661  191 THR B OG1 
2517 C CG2 . THR B 174 ? 0.6133 0.9182 0.4626 -0.0594 -0.0490 0.0491  191 THR B CG2 
2518 N N   . VAL B 175 ? 0.6283 0.8785 0.4701 -0.0620 -0.0486 0.0430  192 VAL B N   
2519 C CA  . VAL B 175 ? 0.6399 0.8755 0.4754 -0.0633 -0.0491 0.0355  192 VAL B CA  
2520 C C   . VAL B 175 ? 0.6751 0.8933 0.5092 -0.0645 -0.0479 0.0366  192 VAL B C   
2521 O O   . VAL B 175 ? 0.6740 0.8821 0.5046 -0.0663 -0.0467 0.0326  192 VAL B O   
2522 C CB  . VAL B 175 ? 0.6329 0.8671 0.4655 -0.0610 -0.0504 0.0331  192 VAL B CB  
2523 C CG1 . VAL B 175 ? 0.6426 0.8601 0.4687 -0.0610 -0.0502 0.0271  192 VAL B CG1 
2524 C CG2 . VAL B 175 ? 0.6401 0.8911 0.4726 -0.0592 -0.0509 0.0308  192 VAL B CG2 
2525 N N   . VAL B 176 ? 0.6593 0.8739 0.4961 -0.0639 -0.0479 0.0420  193 VAL B N   
2526 C CA  . VAL B 176 ? 0.6641 0.8626 0.4981 -0.0648 -0.0471 0.0420  193 VAL B CA  
2527 C C   . VAL B 176 ? 0.6427 0.8395 0.4783 -0.0656 -0.0442 0.0435  193 VAL B C   
2528 O O   . VAL B 176 ? 0.6508 0.8359 0.4821 -0.0664 -0.0427 0.0410  193 VAL B O   
2529 C CB  . VAL B 176 ? 0.6815 0.8763 0.5182 -0.0648 -0.0479 0.0458  193 VAL B CB  
2530 C CG1 . VAL B 176 ? 0.6888 0.8672 0.5209 -0.0658 -0.0472 0.0443  193 VAL B CG1 
2531 C CG2 . VAL B 176 ? 0.6797 0.8786 0.5159 -0.0641 -0.0508 0.0444  193 VAL B CG2 
2532 N N   . LYS B 177 ? 0.6373 0.8475 0.4793 -0.0648 -0.0431 0.0482  194 LYS B N   
2533 C CA  . LYS B 177 ? 0.6459 0.8581 0.4909 -0.0646 -0.0403 0.0506  194 LYS B CA  
2534 C C   . LYS B 177 ? 0.6253 0.8407 0.4686 -0.0670 -0.0403 0.0449  194 LYS B C   
2535 O O   . LYS B 177 ? 0.6258 0.8386 0.4702 -0.0679 -0.0378 0.0450  194 LYS B O   
2536 C CB  . LYS B 177 ? 0.6570 0.8851 0.5096 -0.0620 -0.0392 0.0582  194 LYS B CB  
2537 C CG  . LYS B 177 ? 0.6917 0.9229 0.5486 -0.0603 -0.0359 0.0622  194 LYS B CG  
2538 N N   . SER B 178 ? 0.6100 0.8308 0.4508 -0.0683 -0.0426 0.0397  195 SER B N   
2539 C CA  . SER B 178 ? 0.5917 0.8141 0.4312 -0.0718 -0.0424 0.0330  195 SER B CA  
2540 C C   . SER B 178 ? 0.5719 0.7738 0.4054 -0.0732 -0.0405 0.0296  195 SER B C   
2541 O O   . SER B 178 ? 0.5491 0.7472 0.3832 -0.0761 -0.0381 0.0275  195 SER B O   
2542 C CB  . SER B 178 ? 0.5852 0.8178 0.4231 -0.0722 -0.0449 0.0279  195 SER B CB  
2543 O OG  . SER B 178 ? 0.6129 0.8468 0.4501 -0.0765 -0.0445 0.0203  195 SER B OG  
2544 N N   . ASN B 179 ? 0.5961 0.7866 0.4243 -0.0709 -0.0416 0.0295  196 ASN B N   
2545 C CA  . ASN B 179 ? 0.6165 0.7883 0.4378 -0.0707 -0.0401 0.0280  196 ASN B CA  
2546 C C   . ASN B 179 ? 0.6194 0.7839 0.4406 -0.0708 -0.0371 0.0313  196 ASN B C   
2547 O O   . ASN B 179 ? 0.6468 0.8024 0.4652 -0.0723 -0.0341 0.0298  196 ASN B O   
2548 C CB  . ASN B 179 ? 0.6213 0.7867 0.4380 -0.0675 -0.0426 0.0285  196 ASN B CB  
2549 C CG  . ASN B 179 ? 0.6337 0.8036 0.4492 -0.0663 -0.0444 0.0249  196 ASN B CG  
2550 O OD1 . ASN B 179 ? 0.7031 0.8794 0.5202 -0.0681 -0.0437 0.0209  196 ASN B OD1 
2551 N ND2 . ASN B 179 ? 0.6255 0.7929 0.4383 -0.0631 -0.0466 0.0257  196 ASN B ND2 
2552 N N   . LEU B 180 ? 0.5993 0.7675 0.4239 -0.0691 -0.0372 0.0359  197 LEU B N   
2553 C CA  . LEU B 180 ? 0.6159 0.7756 0.4393 -0.0684 -0.0338 0.0384  197 LEU B CA  
2554 C C   . LEU B 180 ? 0.6399 0.8057 0.4682 -0.0699 -0.0302 0.0392  197 LEU B C   
2555 O O   . LEU B 180 ? 0.6657 0.8227 0.4914 -0.0695 -0.0265 0.0399  197 LEU B O   
2556 C CB  . LEU B 180 ? 0.6108 0.7708 0.4371 -0.0662 -0.0340 0.0427  197 LEU B CB  
2557 C CG  . LEU B 180 ? 0.5999 0.7550 0.4231 -0.0657 -0.0375 0.0420  197 LEU B CG  
2558 C CD1 . LEU B 180 ? 0.6073 0.7576 0.4328 -0.0649 -0.0363 0.0452  197 LEU B CD1 
2559 C CD2 . LEU B 180 ? 0.5905 0.7338 0.4043 -0.0656 -0.0388 0.0379  197 LEU B CD2 
2560 N N   . GLN B 181 ? 0.6631 0.8456 0.4986 -0.0715 -0.0313 0.0392  198 GLN B N   
2561 C CA  . GLN B 181 ? 0.6741 0.8667 0.5160 -0.0736 -0.0285 0.0398  198 GLN B CA  
2562 C C   . GLN B 181 ? 0.6736 0.8583 0.5127 -0.0780 -0.0266 0.0345  198 GLN B C   
2563 O O   . GLN B 181 ? 0.6595 0.8423 0.5007 -0.0794 -0.0225 0.0356  198 GLN B O   
2564 C CB  . GLN B 181 ? 0.7004 0.9157 0.5503 -0.0742 -0.0310 0.0407  198 GLN B CB  
2565 C CG  . GLN B 181 ? 0.7418 0.9721 0.6001 -0.0760 -0.0289 0.0419  198 GLN B CG  
2566 C CD  . GLN B 181 ? 0.7685 0.9989 0.6306 -0.0712 -0.0250 0.0493  198 GLN B CD  
2567 O OE1 . GLN B 181 ? 0.7624 0.9986 0.6273 -0.0663 -0.0252 0.0553  198 GLN B OE1 
2568 N NE2 . GLN B 181 ? 0.8261 1.0491 0.6884 -0.0723 -0.0206 0.0491  198 GLN B NE2 
2569 N N   . ASN B 182 ? 0.6683 0.8480 0.5030 -0.0799 -0.0288 0.0294  199 ASN B N   
2570 C CA  . ASN B 182 ? 0.6905 0.8591 0.5220 -0.0839 -0.0263 0.0248  199 ASN B CA  
2571 C C   . ASN B 182 ? 0.6930 0.8431 0.5171 -0.0815 -0.0226 0.0275  199 ASN B C   
2572 O O   . ASN B 182 ? 0.6997 0.8425 0.5233 -0.0843 -0.0182 0.0270  199 ASN B O   
2573 C CB  . ASN B 182 ? 0.7073 0.8717 0.5345 -0.0844 -0.0289 0.0194  199 ASN B CB  
2574 C CG  . ASN B 182 ? 0.7267 0.9092 0.5599 -0.0876 -0.0318 0.0147  199 ASN B CG  
2575 O OD1 . ASN B 182 ? 0.7418 0.9367 0.5821 -0.0922 -0.0310 0.0130  199 ASN B OD1 
2576 N ND2 . ASN B 182 ? 0.7014 0.8871 0.5317 -0.0851 -0.0351 0.0126  199 ASN B ND2 
2577 N N   . LEU B 183 ? 0.6907 0.8343 0.5090 -0.0767 -0.0245 0.0303  200 LEU B N   
2578 C CA  . LEU B 183 ? 0.6962 0.8240 0.5056 -0.0738 -0.0221 0.0322  200 LEU B CA  
2579 C C   . LEU B 183 ? 0.7000 0.8285 0.5119 -0.0739 -0.0173 0.0353  200 LEU B C   
2580 O O   . LEU B 183 ? 0.7620 0.8806 0.5693 -0.0741 -0.0127 0.0361  200 LEU B O   
2581 C CB  . LEU B 183 ? 0.6989 0.8233 0.5032 -0.0697 -0.0259 0.0334  200 LEU B CB  
2582 C CG  . LEU B 183 ? 0.7169 0.8279 0.5113 -0.0664 -0.0246 0.0346  200 LEU B CG  
2583 C CD1 . LEU B 183 ? 0.7345 0.8333 0.5199 -0.0654 -0.0229 0.0339  200 LEU B CD1 
2584 C CD2 . LEU B 183 ? 0.7153 0.8266 0.5076 -0.0643 -0.0293 0.0345  200 LEU B CD2 
2585 N N   . ALA B 184 ? 0.6788 0.8195 0.4983 -0.0731 -0.0176 0.0377  201 ALA B N   
2586 C CA  . ALA B 184 ? 0.6889 0.8313 0.5115 -0.0718 -0.0126 0.0411  201 ALA B CA  
2587 C C   . ALA B 184 ? 0.6953 0.8425 0.5234 -0.0763 -0.0083 0.0406  201 ALA B C   
2588 O O   . ALA B 184 ? 0.7335 0.8768 0.5608 -0.0753 -0.0027 0.0432  201 ALA B O   
2589 C CB  . ALA B 184 ? 0.6837 0.8392 0.5144 -0.0693 -0.0134 0.0447  201 ALA B CB  
2590 N N   . VAL B 185 ? 0.6593 0.8148 0.4929 -0.0815 -0.0104 0.0370  202 VAL B N   
2591 C CA  . VAL B 185 ? 0.6424 0.8032 0.4829 -0.0876 -0.0067 0.0353  202 VAL B CA  
2592 C C   . VAL B 185 ? 0.6312 0.7728 0.4637 -0.0890 -0.0021 0.0348  202 VAL B C   
2593 O O   . VAL B 185 ? 0.5898 0.7300 0.4248 -0.0909 0.0037  0.0371  202 VAL B O   
2594 C CB  . VAL B 185 ? 0.6265 0.8015 0.4747 -0.0936 -0.0106 0.0298  202 VAL B CB  
2595 C CG1 . VAL B 185 ? 0.6251 0.8022 0.4800 -0.1017 -0.0067 0.0264  202 VAL B CG1 
2596 C CG2 . VAL B 185 ? 0.6079 0.8055 0.4647 -0.0920 -0.0142 0.0318  202 VAL B CG2 
2597 N N   . ILE B 186 ? 0.6305 0.7586 0.4542 -0.0879 -0.0045 0.0323  203 ILE B N   
2598 C CA  . ILE B 186 ? 0.6545 0.7636 0.4693 -0.0875 0.0000  0.0333  203 ILE B CA  
2599 C C   . ILE B 186 ? 0.6876 0.7878 0.4935 -0.0817 0.0033  0.0384  203 ILE B C   
2600 O O   . ILE B 186 ? 0.6915 0.7817 0.4931 -0.0817 0.0094  0.0412  203 ILE B O   
2601 C CB  . ILE B 186 ? 0.6542 0.7507 0.4602 -0.0850 -0.0029 0.0310  203 ILE B CB  
2602 C CG1 . ILE B 186 ? 0.6492 0.7524 0.4533 -0.0808 -0.0099 0.0300  203 ILE B CG1 
2603 C CG2 . ILE B 186 ? 0.6574 0.7504 0.4675 -0.0908 -0.0016 0.0261  203 ILE B CG2 
2604 C CD1 . ILE B 186 ? 0.6728 0.7635 0.4656 -0.0752 -0.0122 0.0308  203 ILE B CD1 
2605 N N   . SER B 187 ? 0.6998 0.8033 0.5027 -0.0767 -0.0003 0.0394  204 SER B N   
2606 C CA  . SER B 187 ? 0.7340 0.8289 0.5273 -0.0713 0.0022  0.0425  204 SER B CA  
2607 C C   . SER B 187 ? 0.7337 0.8336 0.5319 -0.0714 0.0089  0.0457  204 SER B C   
2608 O O   . SER B 187 ? 0.7400 0.8307 0.5295 -0.0680 0.0138  0.0483  204 SER B O   
2609 C CB  . SER B 187 ? 0.7433 0.8396 0.5334 -0.0671 -0.0031 0.0415  204 SER B CB  
2610 O OG  . SER B 187 ? 0.7519 0.8421 0.5352 -0.0659 -0.0083 0.0394  204 SER B OG  
2611 N N   . THR B 188 ? 0.7440 0.8598 0.5558 -0.0749 0.0092  0.0458  205 THR B N   
2612 C CA  . THR B 188 ? 0.7825 0.9067 0.6013 -0.0747 0.0154  0.0493  205 THR B CA  
2613 C C   . THR B 188 ? 0.8083 0.9322 0.6317 -0.0804 0.0215  0.0503  205 THR B C   
2614 O O   . THR B 188 ? 0.8542 0.9776 0.6777 -0.0792 0.0285  0.0541  205 THR B O   
2615 C CB  . THR B 188 ? 0.7778 0.9222 0.6103 -0.0751 0.0130  0.0500  205 THR B CB  
2616 O OG1 . THR B 188 ? 0.7717 0.9140 0.6001 -0.0694 0.0091  0.0504  205 THR B OG1 
2617 C CG2 . THR B 188 ? 0.7730 0.9291 0.6147 -0.0745 0.0196  0.0541  205 THR B CG2 
2618 N N   . ALA B 189 ? 0.8479 0.9713 0.6750 -0.0868 0.0192  0.0467  206 ALA B N   
2619 C CA  . ALA B 189 ? 0.9087 1.0312 0.7422 -0.0942 0.0249  0.0466  206 ALA B CA  
2620 C C   . ALA B 189 ? 0.9668 1.0684 0.7879 -0.0920 0.0306  0.0499  206 ALA B C   
2621 O O   . ALA B 189 ? 1.0001 1.0957 0.8246 -0.0978 0.0361  0.0506  206 ALA B O   
2622 C CB  . ALA B 189 ? 0.9136 1.0411 0.7547 -0.1018 0.0205  0.0403  206 ALA B CB  
2623 N N   . TYR C 6   ? 0.9433 1.3304 0.9366 -0.0177 0.0061  0.1644  23  TYR C N   
2624 C CA  . TYR C 6   ? 0.9089 1.2583 0.8946 -0.0243 -0.0041 0.1348  23  TYR C CA  
2625 C C   . TYR C 6   ? 0.8626 1.1949 0.8768 -0.0253 -0.0035 0.1301  23  TYR C C   
2626 O O   . TYR C 6   ? 0.8328 1.1461 0.8337 -0.0292 -0.0118 0.1084  23  TYR C O   
2627 C CB  . TYR C 6   ? 0.9325 1.2600 0.9212 -0.0265 -0.0097 0.1251  23  TYR C CB  
2628 C CG  . TYR C 6   ? 0.9372 1.2634 0.9698 -0.0233 -0.0032 0.1418  23  TYR C CG  
2629 C CD1 . TYR C 6   ? 0.9662 1.2923 1.0484 -0.0204 0.0045  0.1561  23  TYR C CD1 
2630 C CD2 . TYR C 6   ? 0.9474 1.2711 0.9790 -0.0233 -0.0042 0.1421  23  TYR C CD2 
2631 C CE1 . TYR C 6   ? 0.9891 1.3136 1.1227 -0.0176 0.0116  0.1707  23  TYR C CE1 
2632 C CE2 . TYR C 6   ? 0.9429 1.2648 1.0220 -0.0205 0.0022  0.1558  23  TYR C CE2 
2633 C CZ  . TYR C 6   ? 0.9745 1.2968 1.1066 -0.0178 0.0103  0.1699  23  TYR C CZ  
2634 O OH  . TYR C 6   ? 1.0359 1.3563 1.2272 -0.0150 0.0183  0.1835  23  TYR C OH  
2635 N N   . GLY C 7   ? 0.8598 1.2008 0.9172 -0.0210 0.0066  0.1520  24  GLY C N   
2636 C CA  . GLY C 7   ? 0.8508 1.1779 0.9454 -0.0215 0.0084  0.1486  24  GLY C CA  
2637 C C   . GLY C 7   ? 0.8419 1.1374 0.9603 -0.0251 -0.0012 0.1246  24  GLY C C   
2638 O O   . GLY C 7   ? 0.8565 1.1402 1.0008 -0.0261 -0.0037 0.1142  24  GLY C O   
2639 N N   . LEU C 8   ? 0.8429 1.1284 0.9538 -0.0263 -0.0068 0.1145  25  LEU C N   
2640 C CA  . LEU C 8   ? 0.8460 1.1088 0.9685 -0.0287 -0.0174 0.0867  25  LEU C CA  
2641 C C   . LEU C 8   ? 0.8572 1.1152 1.0470 -0.0269 -0.0120 0.0882  25  LEU C C   
2642 O O   . LEU C 8   ? 0.8792 1.1481 1.1008 -0.0240 -0.0003 0.1127  25  LEU C O   
2643 C CB  . LEU C 8   ? 0.8258 1.0831 0.9057 -0.0304 -0.0247 0.0734  25  LEU C CB  
2644 C CG  . LEU C 8   ? 0.8086 1.0565 0.8417 -0.0328 -0.0365 0.0525  25  LEU C CG  
2645 C CD1 . LEU C 8   ? 0.8124 1.0666 0.8215 -0.0340 -0.0363 0.0576  25  LEU C CD1 
2646 C CD2 . LEU C 8   ? 0.7905 1.0374 0.7891 -0.0334 -0.0386 0.0483  25  LEU C CD2 
2647 N N   . THR C 9   ? 0.8445 1.0887 1.0596 -0.0282 -0.0208 0.0608  26  THR C N   
2648 C CA  . THR C 9   ? 0.8563 1.0956 1.1414 -0.0272 -0.0177 0.0516  26  THR C CA  
2649 C C   . THR C 9   ? 0.8617 1.0970 1.1380 -0.0277 -0.0223 0.0329  26  THR C C   
2650 O O   . THR C 9   ? 0.8277 1.0611 1.0436 -0.0288 -0.0314 0.0196  26  THR C O   
2651 C CB  . THR C 9   ? 0.8477 1.0791 1.1684 -0.0280 -0.0268 0.0237  26  THR C CB  
2652 O OG1 . THR C 9   ? 0.8488 1.0762 1.1193 -0.0291 -0.0439 -0.0073 26  THR C OG1 
2653 C CG2 . THR C 9   ? 0.8311 1.0654 1.1638 -0.0277 -0.0217 0.0408  26  THR C CG2 
2654 N N   . LYS C 10  ? 0.8692 1.1041 1.2119 -0.0265 -0.0146 0.0324  27  LYS C N   
2655 C CA  . LYS C 10  ? 0.8741 1.1064 1.2208 -0.0268 -0.0173 0.0113  27  LYS C CA  
2656 C C   . LYS C 10  ? 0.8790 1.1087 1.1882 -0.0276 -0.0338 -0.0311 27  LYS C C   
2657 O O   . LYS C 10  ? 0.9327 1.1636 1.1996 -0.0274 -0.0375 -0.0417 27  LYS C O   
2658 C CB  . LYS C 10  ? 0.8535 1.0854 1.2953 -0.0256 -0.0067 0.0108  27  LYS C CB  
2659 N N   . ASP C 11  ? 0.8895 1.1189 1.2136 -0.0275 -0.0435 -0.0536 28  ASP C N   
2660 C CA  . ASP C 11  ? 0.9118 1.1465 1.1971 -0.0262 -0.0602 -0.0909 28  ASP C CA  
2661 C C   . ASP C 11  ? 0.8619 1.0967 1.0597 -0.0260 -0.0661 -0.0795 28  ASP C C   
2662 O O   . ASP C 11  ? 0.8754 1.1160 1.0302 -0.0241 -0.0723 -0.0946 28  ASP C O   
2663 C CB  . ASP C 11  ? 0.9351 1.1733 1.2564 -0.0254 -0.0708 -0.1159 28  ASP C CB  
2664 C CG  . ASP C 11  ? 0.9532 1.1958 1.3617 -0.0249 -0.0699 -0.1460 28  ASP C CG  
2665 O OD1 . ASP C 11  ? 0.9410 1.1810 1.3919 -0.0255 -0.0580 -0.1403 28  ASP C OD1 
2666 O OD2 . ASP C 11  ? 1.0035 1.2536 1.4440 -0.0238 -0.0814 -0.1767 28  ASP C OD2 
2667 N N   . GLU C 12  ? 0.8125 1.0429 0.9893 -0.0276 -0.0628 -0.0531 29  GLU C N   
2668 C CA  . GLU C 12  ? 0.7933 1.0234 0.8998 -0.0279 -0.0671 -0.0425 29  GLU C CA  
2669 C C   . GLU C 12  ? 0.7989 1.0293 0.8706 -0.0284 -0.0608 -0.0306 29  GLU C C   
2670 O O   . GLU C 12  ? 0.8078 1.0404 0.8351 -0.0269 -0.0664 -0.0397 29  GLU C O   
2671 C CB  . GLU C 12  ? 0.7635 0.9914 0.8651 -0.0298 -0.0626 -0.0193 29  GLU C CB  
2672 C CG  . GLU C 12  ? 0.7631 0.9900 0.8902 -0.0294 -0.0702 -0.0314 29  GLU C CG  
2673 C CD  . GLU C 12  ? 0.7399 0.9662 0.8806 -0.0310 -0.0615 -0.0083 29  GLU C CD  
2674 O OE1 . GLU C 12  ? 0.7136 0.9444 0.8529 -0.0315 -0.0487 0.0169  29  GLU C OE1 
2675 O OE2 . GLU C 12  ? 0.7060 0.9308 0.8588 -0.0310 -0.0677 -0.0160 29  GLU C OE2 
2676 N N   . PHE C 13  ? 0.7823 1.0129 0.8780 -0.0295 -0.0488 -0.0089 30  PHE C N   
2677 C CA  . PHE C 13  ? 0.7962 1.0287 0.8660 -0.0299 -0.0430 0.0027  30  PHE C CA  
2678 C C   . PHE C 13  ? 0.8197 1.0520 0.8938 -0.0285 -0.0447 -0.0188 30  PHE C C   
2679 O O   . PHE C 13  ? 0.7904 1.0234 0.8285 -0.0284 -0.0435 -0.0165 30  PHE C O   
2680 C CB  . PHE C 13  ? 0.7744 1.0132 0.8716 -0.0299 -0.0307 0.0325  30  PHE C CB  
2681 C CG  . PHE C 13  ? 0.7615 1.0049 0.8350 -0.0300 -0.0262 0.0440  30  PHE C CG  
2682 C CD1 . PHE C 13  ? 0.7608 1.0064 0.7796 -0.0312 -0.0295 0.0471  30  PHE C CD1 
2683 C CD2 . PHE C 13  ? 0.7777 1.0230 0.8894 -0.0288 -0.0189 0.0499  30  PHE C CD2 
2684 C CE1 . PHE C 13  ? 0.7806 1.0311 0.7818 -0.0314 -0.0259 0.0555  30  PHE C CE1 
2685 C CE2 . PHE C 13  ? 0.7700 1.0200 0.8615 -0.0287 -0.0155 0.0599  30  PHE C CE2 
2686 C CZ  . PHE C 13  ? 0.7737 1.0267 0.8090 -0.0301 -0.0194 0.0622  30  PHE C CZ  
2687 N N   . SER C 14  ? 0.8732 1.1062 0.9948 -0.0272 -0.0469 -0.0417 31  SER C N   
2688 C CA  . SER C 14  ? 0.9008 1.1388 1.0249 -0.0252 -0.0498 -0.0705 31  SER C CA  
2689 C C   . SER C 14  ? 0.8980 1.1421 0.9547 -0.0226 -0.0590 -0.0821 31  SER C C   
2690 O O   . SER C 14  ? 0.9146 1.1630 0.9457 -0.0210 -0.0566 -0.0876 31  SER C O   
2691 C CB  . SER C 14  ? 0.8953 1.1381 1.0814 -0.0239 -0.0539 -0.1020 31  SER C CB  
2692 N N   . THR C 15  ? 0.8870 1.1324 0.9187 -0.0218 -0.0681 -0.0824 32  THR C N   
2693 C CA  . THR C 15  ? 0.9057 1.1589 0.8799 -0.0182 -0.0758 -0.0868 32  THR C CA  
2694 C C   . THR C 15  ? 0.8846 1.1300 0.8179 -0.0204 -0.0696 -0.0583 32  THR C C   
2695 O O   . THR C 15  ? 0.9376 1.1875 0.8348 -0.0179 -0.0681 -0.0565 32  THR C O   
2696 C CB  . THR C 15  ? 0.9572 1.2162 0.9271 -0.0159 -0.0883 -0.0962 32  THR C CB  
2697 O OG1 . THR C 15  ? 0.9561 1.2225 0.9756 -0.0147 -0.0944 -0.1241 32  THR C OG1 
2698 C CG2 . THR C 15  ? 0.9906 1.2641 0.9079 -0.0099 -0.0965 -0.1005 32  THR C CG2 
2699 N N   . LEU C 16  ? 0.8320 1.0687 0.7745 -0.0245 -0.0652 -0.0373 33  LEU C N   
2700 C CA  . LEU C 16  ? 0.7705 1.0036 0.6797 -0.0268 -0.0611 -0.0159 33  LEU C CA  
2701 C C   . LEU C 16  ? 0.7095 0.9420 0.6128 -0.0285 -0.0518 -0.0035 33  LEU C C   
2702 O O   . LEU C 16  ? 0.6507 0.8829 0.5269 -0.0297 -0.0493 0.0070  33  LEU C O   
2703 C CB  . LEU C 16  ? 0.7542 0.9847 0.6743 -0.0298 -0.0602 -0.0027 33  LEU C CB  
2704 C CG  . LEU C 16  ? 0.7569 0.9868 0.6695 -0.0288 -0.0689 -0.0084 33  LEU C CG  
2705 C CD1 . LEU C 16  ? 0.7650 1.0005 0.6697 -0.0239 -0.0793 -0.0285 33  LEU C CD1 
2706 C CD2 . LEU C 16  ? 0.7238 0.9524 0.6704 -0.0306 -0.0677 -0.0043 33  LEU C CD2 
2707 N N   . ASP C 17  ? 0.6954 0.9287 0.6298 -0.0286 -0.0466 -0.0055 34  ASP C N   
2708 C CA  . ASP C 17  ? 0.7065 0.9409 0.6391 -0.0298 -0.0386 0.0067  34  ASP C CA  
2709 C C   . ASP C 17  ? 0.7172 0.9515 0.6106 -0.0287 -0.0385 0.0039  34  ASP C C   
2710 O O   . ASP C 17  ? 0.7012 0.9358 0.5752 -0.0306 -0.0358 0.0170  34  ASP C O   
2711 C CB  . ASP C 17  ? 0.7071 0.9422 0.6822 -0.0290 -0.0333 0.0010  34  ASP C CB  
2712 C CG  . ASP C 17  ? 0.7189 0.9564 0.6963 -0.0298 -0.0255 0.0158  34  ASP C CG  
2713 O OD1 . ASP C 17  ? 0.7076 0.9497 0.6666 -0.0313 -0.0241 0.0344  34  ASP C OD1 
2714 O OD2 . ASP C 17  ? 0.7697 1.0068 0.7693 -0.0288 -0.0212 0.0066  34  ASP C OD2 
2715 N N   . SER C 18  ? 0.7255 0.9624 0.6101 -0.0250 -0.0410 -0.0141 35  SER C N   
2716 C CA  . SER C 18  ? 0.7466 0.9868 0.5975 -0.0222 -0.0384 -0.0143 35  SER C CA  
2717 C C   . SER C 18  ? 0.7291 0.9670 0.5526 -0.0229 -0.0395 0.0002  35  SER C C   
2718 O O   . SER C 18  ? 0.7030 0.9390 0.5154 -0.0242 -0.0334 0.0117  35  SER C O   
2719 C CB  . SER C 18  ? 0.7907 1.0424 0.6312 -0.0161 -0.0428 -0.0361 35  SER C CB  
2720 O OG  . SER C 18  ? 0.8061 1.0648 0.6171 -0.0121 -0.0373 -0.0335 35  SER C OG  
2721 N N   . ILE C 19  ? 0.7292 0.9672 0.5488 -0.0223 -0.0470 -0.0011 36  ILE C N   
2722 C CA  . ILE C 19  ? 0.7418 0.9775 0.5447 -0.0229 -0.0479 0.0111  36  ILE C CA  
2723 C C   . ILE C 19  ? 0.7111 0.9426 0.5225 -0.0287 -0.0430 0.0231  36  ILE C C   
2724 O O   . ILE C 19  ? 0.7099 0.9407 0.5128 -0.0295 -0.0391 0.0310  36  ILE C O   
2725 C CB  . ILE C 19  ? 0.7735 1.0101 0.5781 -0.0217 -0.0569 0.0072  36  ILE C CB  
2726 C CG1 . ILE C 19  ? 0.7681 1.0164 0.5603 -0.0145 -0.0641 -0.0056 36  ILE C CG1 
2727 C CG2 . ILE C 19  ? 0.7872 1.0206 0.5846 -0.0231 -0.0564 0.0200  36  ILE C CG2 
2728 C CD1 . ILE C 19  ? 0.7772 1.0283 0.5781 -0.0132 -0.0748 -0.0129 36  ILE C CD1 
2729 N N   . ILE C 20  ? 0.6882 0.9206 0.5196 -0.0318 -0.0429 0.0242  37  ILE C N   
2730 C CA  . ILE C 20  ? 0.6532 0.8907 0.4901 -0.0357 -0.0395 0.0339  37  ILE C CA  
2731 C C   . ILE C 20  ? 0.6487 0.8891 0.4810 -0.0365 -0.0339 0.0381  37  ILE C C   
2732 O O   . ILE C 20  ? 0.6594 0.9042 0.4882 -0.0387 -0.0320 0.0408  37  ILE C O   
2733 C CB  . ILE C 20  ? 0.6512 0.8955 0.5106 -0.0366 -0.0384 0.0394  37  ILE C CB  
2734 C CG1 . ILE C 20  ? 0.6537 0.8959 0.5232 -0.0363 -0.0427 0.0364  37  ILE C CG1 
2735 C CG2 . ILE C 20  ? 0.6535 0.9128 0.5135 -0.0385 -0.0350 0.0495  37  ILE C CG2 
2736 C CD1 . ILE C 20  ? 0.6481 0.8942 0.5491 -0.0355 -0.0401 0.0420  37  ILE C CD1 
2737 N N   . ARG C 21  ? 0.6479 0.8866 0.4853 -0.0347 -0.0310 0.0362  38  ARG C N   
2738 C CA  . ARG C 21  ? 0.6455 0.8865 0.4824 -0.0353 -0.0253 0.0400  38  ARG C CA  
2739 C C   . ARG C 21  ? 0.6469 0.8840 0.4675 -0.0345 -0.0223 0.0402  38  ARG C C   
2740 O O   . ARG C 21  ? 0.6710 0.9118 0.4955 -0.0368 -0.0192 0.0442  38  ARG C O   
2741 C CB  . ARG C 21  ? 0.6586 0.8982 0.5091 -0.0333 -0.0219 0.0363  38  ARG C CB  
2742 C CG  . ARG C 21  ? 0.6644 0.9083 0.5434 -0.0337 -0.0225 0.0406  38  ARG C CG  
2743 C CD  . ARG C 21  ? 0.6721 0.9140 0.5762 -0.0320 -0.0182 0.0349  38  ARG C CD  
2744 N NE  . ARG C 21  ? 0.7013 0.9492 0.6184 -0.0326 -0.0128 0.0463  38  ARG C NE  
2745 C CZ  . ARG C 21  ? 0.7183 0.9752 0.6661 -0.0323 -0.0104 0.0610  38  ARG C CZ  
2746 N NH1 . ARG C 21  ? 0.6909 0.9511 0.6635 -0.0314 -0.0110 0.0677  38  ARG C NH1 
2747 N NH2 . ARG C 21  ? 0.7616 1.0263 0.7186 -0.0322 -0.0066 0.0713  38  ARG C NH2 
2748 N N   . THR C 22  ? 0.6453 0.8783 0.4514 -0.0305 -0.0231 0.0369  39  THR C N   
2749 C CA  . THR C 22  ? 0.6543 0.8865 0.4503 -0.0281 -0.0172 0.0434  39  THR C CA  
2750 C C   . THR C 22  ? 0.6219 0.8526 0.4239 -0.0305 -0.0179 0.0491  39  THR C C   
2751 O O   . THR C 22  ? 0.6372 0.8676 0.4491 -0.0316 -0.0115 0.0547  39  THR C O   
2752 C CB  . THR C 22  ? 0.7069 0.9433 0.4833 -0.0206 -0.0153 0.0424  39  THR C CB  
2753 O OG1 . THR C 22  ? 0.7257 0.9644 0.4923 -0.0170 -0.0189 0.0486  39  THR C OG1 
2754 C CG2 . THR C 22  ? 0.7083 0.9494 0.4825 -0.0179 -0.0193 0.0274  39  THR C CG2 
2755 N N   . HIS C 23  ? 0.5901 0.8203 0.3928 -0.0314 -0.0249 0.0464  40  HIS C N   
2756 C CA  . HIS C 23  ? 0.5847 0.8138 0.3975 -0.0331 -0.0248 0.0500  40  HIS C CA  
2757 C C   . HIS C 23  ? 0.6085 0.8432 0.4376 -0.0392 -0.0264 0.0431  40  HIS C C   
2758 O O   . HIS C 23  ? 0.6327 0.8700 0.4792 -0.0418 -0.0228 0.0415  40  HIS C O   
2759 C CB  . HIS C 23  ? 0.5677 0.7952 0.3730 -0.0294 -0.0309 0.0517  40  HIS C CB  
2760 N N   . HIS C 24  ? 0.6020 0.8418 0.4290 -0.0406 -0.0310 0.0388  41  HIS C N   
2761 C CA  . HIS C 24  ? 0.6230 0.8744 0.4601 -0.0443 -0.0329 0.0334  41  HIS C CA  
2762 C C   . HIS C 24  ? 0.6536 0.9222 0.4967 -0.0464 -0.0312 0.0310  41  HIS C C   
2763 O O   . HIS C 24  ? 0.6736 0.9592 0.5235 -0.0484 -0.0323 0.0243  41  HIS C O   
2764 C CB  . HIS C 24  ? 0.6096 0.8619 0.4447 -0.0434 -0.0373 0.0340  41  HIS C CB  
2765 C CG  . HIS C 24  ? 0.6035 0.8470 0.4391 -0.0425 -0.0410 0.0323  41  HIS C CG  
2766 N ND1 . HIS C 24  ? 0.5956 0.8429 0.4416 -0.0448 -0.0411 0.0278  41  HIS C ND1 
2767 C CD2 . HIS C 24  ? 0.6159 0.8501 0.4453 -0.0390 -0.0454 0.0331  41  HIS C CD2 
2768 C CE1 . HIS C 24  ? 0.6127 0.8510 0.4596 -0.0429 -0.0452 0.0288  41  HIS C CE1 
2769 N NE2 . HIS C 24  ? 0.6324 0.8641 0.4678 -0.0390 -0.0486 0.0319  41  HIS C NE2 
2770 N N   . THR C 25  ? 0.6903 0.9579 0.5311 -0.0453 -0.0287 0.0355  42  THR C N   
2771 C CA  . THR C 25  ? 0.6680 0.9538 0.5140 -0.0459 -0.0285 0.0366  42  THR C CA  
2772 C C   . THR C 25  ? 0.6688 0.9645 0.5268 -0.0483 -0.0269 0.0277  42  THR C C   
2773 O O   . THR C 25  ? 0.6525 0.9345 0.5167 -0.0486 -0.0225 0.0274  42  THR C O   
2774 C CB  . THR C 25  ? 0.7092 0.9873 0.5537 -0.0435 -0.0260 0.0448  42  THR C CB  
2775 O OG1 . THR C 25  ? 0.7203 1.0037 0.5686 -0.0417 -0.0275 0.0522  42  THR C OG1 
2776 C CG2 . THR C 25  ? 0.7454 1.0333 0.5982 -0.0440 -0.0235 0.0458  42  THR C CG2 
2777 N N   . PHE C 26  ? 0.6819 1.0049 0.5463 -0.0493 -0.0300 0.0199  43  PHE C N   
2778 C CA  . PHE C 26  ? 0.6723 1.0090 0.5553 -0.0518 -0.0298 0.0059  43  PHE C CA  
2779 C C   . PHE C 26  ? 0.6842 1.0406 0.5699 -0.0504 -0.0317 0.0084  43  PHE C C   
2780 O O   . PHE C 26  ? 0.7109 1.0798 0.5855 -0.0472 -0.0339 0.0208  43  PHE C O   
2781 C CB  . PHE C 26  ? 0.6621 1.0202 0.5564 -0.0538 -0.0326 -0.0125 43  PHE C CB  
2782 C CG  . PHE C 26  ? 0.6551 0.9925 0.5560 -0.0555 -0.0299 -0.0154 43  PHE C CG  
2783 C CD1 . PHE C 26  ? 0.6491 0.9693 0.5746 -0.0576 -0.0248 -0.0195 43  PHE C CD1 
2784 C CD2 . PHE C 26  ? 0.6442 0.9797 0.5312 -0.0545 -0.0317 -0.0110 43  PHE C CD2 
2785 C CE1 . PHE C 26  ? 0.6418 0.9453 0.5773 -0.0581 -0.0222 -0.0181 43  PHE C CE1 
2786 C CE2 . PHE C 26  ? 0.6454 0.9630 0.5409 -0.0556 -0.0300 -0.0127 43  PHE C CE2 
2787 C CZ  . PHE C 26  ? 0.6450 0.9473 0.5642 -0.0572 -0.0256 -0.0155 43  PHE C CZ  
2788 N N   . PRO C 27  ? 0.7128 1.0717 0.6185 -0.0523 -0.0301 -0.0011 44  PRO C N   
2789 C CA  . PRO C 27  ? 0.7469 1.1270 0.6571 -0.0507 -0.0331 0.0010  44  PRO C CA  
2790 C C   . PRO C 27  ? 0.7767 1.2023 0.6925 -0.0499 -0.0414 -0.0151 44  PRO C C   
2791 O O   . PRO C 27  ? 0.7585 1.1961 0.6891 -0.0525 -0.0430 -0.0372 44  PRO C O   
2792 C CB  . PRO C 27  ? 0.7326 1.0951 0.6649 -0.0528 -0.0270 -0.0022 44  PRO C CB  
2793 C CG  . PRO C 27  ? 0.7177 1.0505 0.6543 -0.0544 -0.0197 -0.0011 44  PRO C CG  
2794 C CD  . PRO C 27  ? 0.7135 1.0536 0.6424 -0.0551 -0.0239 -0.0087 44  PRO C CD  
2795 N N   . ARG C 28  ? 0.8274 1.2814 0.7337 -0.0454 -0.0463 -0.0041 45  ARG C N   
2796 C CA  . ARG C 28  ? 0.8640 1.3708 0.7700 -0.0423 -0.0549 -0.0166 45  ARG C CA  
2797 C C   . ARG C 28  ? 0.8435 1.3670 0.7782 -0.0453 -0.0589 -0.0445 45  ARG C C   
2798 O O   . ARG C 28  ? 0.7981 1.3117 0.7484 -0.0462 -0.0578 -0.0413 45  ARG C O   
2799 C CB  . ARG C 28  ? 0.9216 1.4561 0.8162 -0.0354 -0.0583 0.0078  45  ARG C CB  
2800 C CG  . ARG C 28  ? 0.9648 1.5643 0.8554 -0.0294 -0.0680 -0.0004 45  ARG C CG  
2801 C CD  . ARG C 28  ? 0.9831 1.6096 0.8617 -0.0208 -0.0688 0.0337  45  ARG C CD  
2802 N NE  . ARG C 28  ? 1.0227 1.6512 0.8843 -0.0175 -0.0639 0.0511  45  ARG C NE  
2803 C CZ  . ARG C 28  ? 1.0901 1.7623 0.9366 -0.0131 -0.0666 0.0435  45  ARG C CZ  
2804 N NH1 . ARG C 28  ? 1.0995 1.8205 0.9449 -0.0115 -0.0755 0.0149  45  ARG C NH1 
2805 N NH2 . ARG C 28  ? 1.0684 1.7379 0.9036 -0.0101 -0.0601 0.0623  45  ARG C NH2 
2806 N N   . SER C 29  ? 0.9198 1.1899 0.8356 -0.0072 -0.0660 -0.0277 46  SER C N   
2807 C CA  . SER C 29  ? 0.9065 1.1755 0.8361 -0.0129 -0.0766 -0.0235 46  SER C CA  
2808 C C   . SER C 29  ? 0.9174 1.1433 0.8265 -0.0050 -0.0883 -0.0286 46  SER C C   
2809 O O   . SER C 29  ? 0.9085 1.1090 0.7929 0.0017  -0.0851 -0.0306 46  SER C O   
2810 C CB  . SER C 29  ? 0.9083 1.1816 0.8450 -0.0259 -0.0745 -0.0090 46  SER C CB  
2811 O OG  . SER C 29  ? 0.9688 1.2794 0.9177 -0.0327 -0.0617 -0.0021 46  SER C OG  
2812 N N   . PRO C 30  ? 0.9230 1.1414 0.8423 -0.0056 -0.1024 -0.0298 47  PRO C N   
2813 C CA  . PRO C 30  ? 0.9433 1.1209 0.8395 0.0040  -0.1144 -0.0355 47  PRO C CA  
2814 C C   . PRO C 30  ? 0.9351 1.0846 0.8101 0.0036  -0.1151 -0.0292 47  PRO C C   
2815 O O   . PRO C 30  ? 0.9071 1.0667 0.7921 -0.0061 -0.1116 -0.0203 47  PRO C O   
2816 C CB  . PRO C 30  ? 0.9559 1.1370 0.8732 0.0038  -0.1311 -0.0399 47  PRO C CB  
2817 C CG  . PRO C 30  ? 0.9274 1.1548 0.8815 -0.0075 -0.1262 -0.0339 47  PRO C CG  
2818 C CD  . PRO C 30  ? 0.9236 1.1689 0.8754 -0.0151 -0.1092 -0.0246 47  PRO C CD  
2819 N N   . ASN C 31  ? 0.9342 1.0501 0.7802 0.0152  -0.1206 -0.0337 48  ASN C N   
2820 C CA  . ASN C 31  ? 0.9535 1.0445 0.7727 0.0200  -0.1186 -0.0300 48  ASN C CA  
2821 C C   . ASN C 31  ? 0.8749 0.9784 0.6945 0.0122  -0.1031 -0.0214 48  ASN C C   
2822 O O   . ASN C 31  ? 0.8462 0.9411 0.6619 0.0102  -0.1054 -0.0173 48  ASN C O   
2823 C CB  . ASN C 31  ? 1.0068 1.0755 0.8224 0.0240  -0.1372 -0.0329 48  ASN C CB  
2824 C CG  . ASN C 31  ? 1.0813 1.1173 0.8581 0.0404  -0.1412 -0.0371 48  ASN C CG  
2825 O OD1 . ASN C 31  ? 1.0543 1.0754 0.8169 0.0452  -0.1450 -0.0367 48  ASN C OD1 
2826 N ND2 . ASN C 31  ? 1.0855 1.1121 0.8447 0.0499  -0.1405 -0.0409 48  ASN C ND2 
2827 N N   . THR C 32  ? 0.8356 0.9572 0.6592 0.0094  -0.0894 -0.0198 49  THR C N   
2828 C CA  . THR C 32  ? 0.8225 0.9540 0.6443 0.0038  -0.0749 -0.0126 49  THR C CA  
2829 C C   . THR C 32  ? 0.8139 0.9377 0.6186 0.0099  -0.0652 -0.0120 49  THR C C   
2830 O O   . THR C 32  ? 0.8203 0.9368 0.6194 0.0165  -0.0690 -0.0165 49  THR C O   
2831 C CB  . THR C 32  ? 0.7958 0.9625 0.6434 -0.0069 -0.0675 -0.0097 49  THR C CB  
2832 O OG1 . THR C 32  ? 0.7856 0.9675 0.6413 -0.0031 -0.0659 -0.0168 49  THR C OG1 
2833 C CG2 . THR C 32  ? 0.7811 0.9627 0.6515 -0.0165 -0.0755 -0.0053 49  THR C CG2 
2834 N N   . CYS C 33  ? 0.7945 0.9205 0.5940 0.0068  -0.0542 -0.0054 50  CYS C N   
2835 C CA  . CYS C 33  ? 0.7641 0.8868 0.5540 0.0094  -0.0446 -0.0017 50  CYS C CA  
2836 C C   . CYS C 33  ? 0.7507 0.8947 0.5553 0.0013  -0.0348 0.0011  50  CYS C C   
2837 O O   . CYS C 33  ? 0.6773 0.8338 0.4913 -0.0058 -0.0325 0.0037  50  CYS C O   
2838 C CB  . CYS C 33  ? 0.7666 0.8699 0.5330 0.0159  -0.0411 0.0041  50  CYS C CB  
2839 S SG  . CYS C 33  ? 0.7568 0.8570 0.5140 0.0181  -0.0299 0.0131  50  CYS C SG  
2840 N N   . THR C 34  ? 0.7419 0.8881 0.5481 0.0029  -0.0310 0.0010  51  THR C N   
2841 C CA  . THR C 34  ? 0.7252 0.8896 0.5439 -0.0018 -0.0245 0.0012  51  THR C CA  
2842 C C   . THR C 34  ? 0.7265 0.8814 0.5421 0.0007  -0.0224 0.0044  51  THR C C   
2843 O O   . THR C 34  ? 0.7346 0.8752 0.5446 0.0057  -0.0280 0.0046  51  THR C O   
2844 C CB  . THR C 34  ? 0.7367 0.9257 0.5728 -0.0023 -0.0283 -0.0078 51  THR C CB  
2845 O OG1 . THR C 34  ? 0.7736 0.9815 0.6186 -0.0047 -0.0225 -0.0087 51  THR C OG1 
2846 C CG2 . THR C 34  ? 0.7404 0.9234 0.5782 0.0053  -0.0377 -0.0164 51  THR C CG2 
2847 N N   . SER C 35  ? 0.7385 0.9005 0.5591 -0.0031 -0.0155 0.0084  52  SER C N   
2848 C CA  . SER C 35  ? 0.7193 0.8757 0.5447 -0.0019 -0.0163 0.0110  52  SER C CA  
2849 C C   . SER C 35  ? 0.6710 0.8399 0.5051 -0.0062 -0.0107 0.0119  52  SER C C   
2850 O O   . SER C 35  ? 0.6501 0.8321 0.4850 -0.0101 -0.0057 0.0114  52  SER C O   
2851 C CB  . SER C 35  ? 0.7301 0.8667 0.5442 -0.0004 -0.0143 0.0229  52  SER C CB  
2852 O OG  . SER C 35  ? 0.7069 0.8409 0.5095 -0.0014 -0.0052 0.0308  52  SER C OG  
2853 N N   . LEU C 36  ? 0.6354 0.7990 0.4772 -0.0056 -0.0136 0.0140  53  LEU C N   
2854 C CA  . LEU C 36  ? 0.6107 0.7823 0.4611 -0.0083 -0.0108 0.0145  53  LEU C CA  
2855 C C   . LEU C 36  ? 0.6023 0.7602 0.4551 -0.0110 -0.0082 0.0274  53  LEU C C   
2856 O O   . LEU C 36  ? 0.5990 0.7440 0.4540 -0.0099 -0.0137 0.0333  53  LEU C O   
2857 C CB  . LEU C 36  ? 0.6260 0.8074 0.4885 -0.0030 -0.0212 0.0015  53  LEU C CB  
2858 C CG  . LEU C 36  ? 0.6187 0.8163 0.4874 -0.0029 -0.0198 -0.0037 53  LEU C CG  
2859 C CD1 . LEU C 36  ? 0.6487 0.8594 0.5251 0.0065  -0.0310 -0.0201 53  LEU C CD1 
2860 C CD2 . LEU C 36  ? 0.6195 0.8053 0.4943 -0.0066 -0.0191 0.0051  53  LEU C CD2 
2861 N N   . ILE C 37  ? 0.5941 0.7563 0.4478 -0.0150 -0.0002 0.0332  54  ILE C N   
2862 C CA  . ILE C 37  ? 0.6112 0.7666 0.4728 -0.0179 0.0020  0.0448  54  ILE C CA  
2863 C C   . ILE C 37  ? 0.6416 0.8030 0.5184 -0.0192 -0.0028 0.0400  54  ILE C C   
2864 O O   . ILE C 37  ? 0.6377 0.8113 0.5124 -0.0189 -0.0016 0.0311  54  ILE C O   
2865 C CB  . ILE C 37  ? 0.6278 0.7835 0.4791 -0.0193 0.0142  0.0547  54  ILE C CB  
2866 C CG1 . ILE C 37  ? 0.6656 0.8140 0.5003 -0.0152 0.0171  0.0591  54  ILE C CG1 
2867 C CG2 . ILE C 37  ? 0.6346 0.7899 0.4978 -0.0224 0.0180  0.0671  54  ILE C CG2 
2868 C CD1 . ILE C 37  ? 0.6830 0.8323 0.5057 -0.0127 0.0148  0.0487  54  ILE C CD1 
2869 N N   . ALA C 38  ? 0.6493 0.8023 0.5417 -0.0209 -0.0095 0.0469  55  ALA C N   
2870 C CA  . ALA C 38  ? 0.6512 0.8063 0.5596 -0.0214 -0.0168 0.0430  55  ALA C CA  
2871 C C   . ALA C 38  ? 0.6564 0.8081 0.5771 -0.0273 -0.0120 0.0588  55  ALA C C   
2872 O O   . ALA C 38  ? 0.7095 0.8547 0.6359 -0.0303 -0.0110 0.0731  55  ALA C O   
2873 C CB  . ALA C 38  ? 0.6573 0.8045 0.5792 -0.0168 -0.0354 0.0341  55  ALA C CB  
2874 N N   . HIS C 39  ? 0.6878 0.8457 0.6137 -0.0288 -0.0095 0.0572  56  HIS C N   
2875 C CA  . HIS C 39  ? 0.7019 0.8595 0.6426 -0.0340 -0.0052 0.0716  56  HIS C CA  
2876 C C   . HIS C 39  ? 0.7093 0.8666 0.6673 -0.0344 -0.0153 0.0659  56  HIS C C   
2877 O O   . HIS C 39  ? 0.7081 0.8712 0.6572 -0.0310 -0.0164 0.0530  56  HIS C O   
2878 C CB  . HIS C 39  ? 0.6943 0.8602 0.6208 -0.0347 0.0116  0.0780  56  HIS C CB  
2879 C CG  . HIS C 39  ? 0.7236 0.8937 0.6642 -0.0383 0.0185  0.0947  56  HIS C CG  
2880 N ND1 . HIS C 39  ? 0.7510 0.9278 0.6986 -0.0396 0.0232  0.0960  56  HIS C ND1 
2881 C CD2 . HIS C 39  ? 0.7221 0.8934 0.6729 -0.0409 0.0215  0.1119  56  HIS C CD2 
2882 C CE1 . HIS C 39  ? 0.7522 0.9361 0.7149 -0.0421 0.0294  0.1125  56  HIS C CE1 
2883 N NE2 . HIS C 39  ? 0.7391 0.9210 0.7038 -0.0433 0.0291  0.1235  56  HIS C NE2 
2884 N N   . ARG C 40  ? 0.7493 0.9001 0.7328 -0.0387 -0.0239 0.0769  57  ARG C N   
2885 C CA  . ARG C 40  ? 0.7398 0.8874 0.7439 -0.0390 -0.0367 0.0726  57  ARG C CA  
2886 C C   . ARG C 40  ? 0.7368 0.8933 0.7457 -0.0430 -0.0249 0.0814  57  ARG C C   
2887 O O   . ARG C 40  ? 0.7805 0.9428 0.7973 -0.0480 -0.0142 0.0987  57  ARG C O   
2888 C CB  . ARG C 40  ? 0.7416 0.8767 0.7764 -0.0431 -0.0542 0.0825  57  ARG C CB  
2889 C CG  . ARG C 40  ? 0.7477 0.8695 0.7892 -0.0362 -0.0783 0.0661  57  ARG C CG  
2890 C CD  . ARG C 40  ? 0.7762 0.8825 0.8519 -0.0421 -0.0982 0.0794  57  ARG C CD  
2891 N NE  . ARG C 40  ? 0.7871 0.8796 0.8623 -0.0369 -0.1156 0.0707  57  ARG C NE  
2892 C CZ  . ARG C 40  ? 0.7839 0.8763 0.8443 -0.0376 -0.1078 0.0761  57  ARG C CZ  
2893 N NH1 . ARG C 40  ? 0.7905 0.8955 0.8341 -0.0426 -0.0832 0.0899  57  ARG C NH1 
2894 N NH2 . ARG C 40  ? 0.8149 0.8938 0.8766 -0.0317 -0.1264 0.0659  57  ARG C NH2 
2895 N N   . VAL C 41  ? 0.7205 0.8800 0.7243 -0.0399 -0.0271 0.0695  58  VAL C N   
2896 C CA  . VAL C 41  ? 0.7094 0.8752 0.7198 -0.0428 -0.0196 0.0755  58  VAL C CA  
2897 C C   . VAL C 41  ? 0.7769 0.9361 0.8092 -0.0421 -0.0370 0.0699  58  VAL C C   
2898 O O   . VAL C 41  ? 0.7541 0.9081 0.7806 -0.0356 -0.0507 0.0538  58  VAL C O   
2899 C CB  . VAL C 41  ? 0.7081 0.8814 0.6918 -0.0401 -0.0084 0.0673  58  VAL C CB  
2900 C CG1 . VAL C 41  ? 0.7148 0.8926 0.7057 -0.0421 -0.0032 0.0720  58  VAL C CG1 
2901 C CG2 . VAL C 41  ? 0.7214 0.8984 0.6845 -0.0397 0.0049  0.0710  58  VAL C CG2 
2902 N N   . ASP C 42  ? 0.8290 0.9901 0.8872 -0.0477 -0.0370 0.0830  59  ASP C N   
2903 C CA  . ASP C 42  ? 0.8352 0.9886 0.9190 -0.0477 -0.0554 0.0793  59  ASP C CA  
2904 C C   . ASP C 42  ? 0.8313 0.9891 0.9043 -0.0445 -0.0520 0.0705  59  ASP C C   
2905 O O   . ASP C 42  ? 0.8409 1.0039 0.9308 -0.0484 -0.0480 0.0796  59  ASP C O   
2906 C CB  . ASP C 42  ? 0.8353 0.9899 0.9582 -0.0566 -0.0590 0.1001  59  ASP C CB  
2907 C CG  . ASP C 42  ? 0.8297 0.9738 0.9833 -0.0569 -0.0818 0.0963  59  ASP C CG  
2908 O OD1 . ASP C 42  ? 0.8211 0.9495 0.9789 -0.0518 -0.1039 0.0834  59  ASP C OD1 
2909 O OD2 . ASP C 42  ? 0.8045 0.9560 0.9785 -0.0611 -0.0789 0.1052  59  ASP C OD2 
2910 N N   . ALA C 43  ? 0.8191 0.9766 0.8639 -0.0374 -0.0536 0.0537  60  ALA C N   
2911 C CA  . ALA C 43  ? 0.7839 0.9445 0.8157 -0.0341 -0.0534 0.0452  60  ALA C CA  
2912 C C   . ALA C 43  ? 0.7602 0.9225 0.7661 -0.0253 -0.0599 0.0279  60  ALA C C   
2913 O O   . ALA C 43  ? 0.7281 0.8935 0.7206 -0.0228 -0.0572 0.0238  60  ALA C O   
2914 C CB  . ALA C 43  ? 0.7872 0.9568 0.8048 -0.0379 -0.0342 0.0530  60  ALA C CB  
2915 N N   . PRO C 44  ? 0.7636 0.9263 0.7620 -0.0200 -0.0683 0.0180  61  PRO C N   
2916 C CA  . PRO C 44  ? 0.7585 0.9289 0.7312 -0.0102 -0.0733 0.0028  61  PRO C CA  
2917 C C   . PRO C 44  ? 0.7303 0.9148 0.6759 -0.0129 -0.0556 0.0058  61  PRO C C   
2918 O O   . PRO C 44  ? 0.7571 0.9435 0.6980 -0.0205 -0.0426 0.0163  61  PRO C O   
2919 C CB  . PRO C 44  ? 0.7624 0.9319 0.7314 -0.0059 -0.0819 -0.0030 61  PRO C CB  
2920 C CG  . PRO C 44  ? 0.7423 0.9074 0.7260 -0.0158 -0.0736 0.0106  61  PRO C CG  
2921 C CD  . PRO C 44  ? 0.7373 0.8960 0.7488 -0.0220 -0.0725 0.0211  61  PRO C CD  
2922 N N   . ALA C 45  ? 0.7058 0.9005 0.6357 -0.0058 -0.0569 -0.0038 62  ALA C N   
2923 C CA  . ALA C 45  ? 0.6823 0.8918 0.5909 -0.0089 -0.0419 -0.0003 62  ALA C CA  
2924 C C   . ALA C 45  ? 0.6925 0.9094 0.5864 -0.0149 -0.0325 0.0074  62  ALA C C   
2925 O O   . ALA C 45  ? 0.7481 0.9680 0.6347 -0.0226 -0.0204 0.0167  62  ALA C O   
2926 C CB  . ALA C 45  ? 0.6678 0.8931 0.5620 0.0017  -0.0465 -0.0136 62  ALA C CB  
2927 N N   . HIS C 46  ? 0.6596 0.8776 0.5496 -0.0111 -0.0401 0.0035  63  HIS C N   
2928 C CA  . HIS C 46  ? 0.6372 0.8621 0.5121 -0.0165 -0.0338 0.0111  63  HIS C CA  
2929 C C   . HIS C 46  ? 0.6259 0.8373 0.5116 -0.0267 -0.0269 0.0231  63  HIS C C   
2930 O O   . HIS C 46  ? 0.6354 0.8499 0.5103 -0.0334 -0.0196 0.0315  63  HIS C O   
2931 C CB  . HIS C 46  ? 0.6366 0.8657 0.5028 -0.0090 -0.0447 0.0042  63  HIS C CB  
2932 C CG  . HIS C 46  ? 0.6238 0.8340 0.5088 -0.0087 -0.0550 0.0029  63  HIS C CG  
2933 N ND1 . HIS C 46  ? 0.6362 0.8352 0.5407 -0.0019 -0.0683 -0.0062 63  HIS C ND1 
2934 C CD2 . HIS C 46  ? 0.6163 0.8170 0.5065 -0.0146 -0.0552 0.0103  63  HIS C CD2 
2935 C CE1 . HIS C 46  ? 0.6278 0.8128 0.5503 -0.0045 -0.0755 -0.0034 63  HIS C CE1 
2936 N NE2 . HIS C 46  ? 0.6332 0.8196 0.5466 -0.0114 -0.0672 0.0056  63  HIS C NE2 
2937 N N   . ALA C 47  ? 0.6072 0.8048 0.5152 -0.0273 -0.0301 0.0241  64  ALA C N   
2938 C CA  . ALA C 47  ? 0.6057 0.7950 0.5247 -0.0339 -0.0231 0.0342  64  ALA C CA  
2939 C C   . ALA C 47  ? 0.6081 0.7992 0.5214 -0.0380 -0.0109 0.0407  64  ALA C C   
2940 O O   . ALA C 47  ? 0.5721 0.7601 0.4828 -0.0416 -0.0048 0.0470  64  ALA C O   
2941 C CB  . ALA C 47  ? 0.6058 0.7862 0.5524 -0.0333 -0.0286 0.0356  64  ALA C CB  
2942 N N   . ILE C 48  ? 0.6270 0.8219 0.5383 -0.0360 -0.0093 0.0377  65  ILE C N   
2943 C CA  . ILE C 48  ? 0.6204 0.8163 0.5252 -0.0386 0.0003  0.0424  65  ILE C CA  
2944 C C   . ILE C 48  ? 0.6406 0.8446 0.5256 -0.0415 0.0037  0.0432  65  ILE C C   
2945 O O   . ILE C 48  ? 0.6947 0.8956 0.5740 -0.0450 0.0093  0.0488  65  ILE C O   
2946 C CB  . ILE C 48  ? 0.6039 0.8004 0.5133 -0.0355 -0.0012 0.0387  65  ILE C CB  
2947 C CG1 . ILE C 48  ? 0.5861 0.7740 0.5191 -0.0349 -0.0061 0.0418  65  ILE C CG1 
2948 C CG2 . ILE C 48  ? 0.6043 0.8019 0.5040 -0.0374 0.0077  0.0427  65  ILE C CG2 
2949 C CD1 . ILE C 48  ? 0.5898 0.7751 0.5301 -0.0315 -0.0136 0.0372  65  ILE C CD1 
2950 N N   . TRP C 49  ? 0.6748 0.8905 0.5500 -0.0393 -0.0006 0.0380  66  TRP C N   
2951 C CA  . TRP C 49  ? 0.6563 0.8854 0.5156 -0.0431 0.0024  0.0417  66  TRP C CA  
2952 C C   . TRP C 49  ? 0.6392 0.8617 0.4947 -0.0503 0.0025  0.0509  66  TRP C C   
2953 O O   . TRP C 49  ? 0.6232 0.8464 0.4729 -0.0561 0.0051  0.0576  66  TRP C O   
2954 C CB  . TRP C 49  ? 0.6573 0.9052 0.5072 -0.0375 -0.0018 0.0352  66  TRP C CB  
2955 C CG  . TRP C 49  ? 0.6594 0.9282 0.4955 -0.0417 0.0024  0.0414  66  TRP C CG  
2956 C CD1 . TRP C 49  ? 0.6585 0.9424 0.4834 -0.0433 0.0009  0.0466  66  TRP C CD1 
2957 C CD2 . TRP C 49  ? 0.6701 0.9490 0.5043 -0.0455 0.0084  0.0451  66  TRP C CD2 
2958 N NE1 . TRP C 49  ? 0.6802 0.9853 0.4980 -0.0489 0.0062  0.0552  66  TRP C NE1 
2959 C CE2 . TRP C 49  ? 0.6571 0.9590 0.4814 -0.0502 0.0104  0.0537  66  TRP C CE2 
2960 C CE3 . TRP C 49  ? 0.6423 0.9133 0.4825 -0.0454 0.0116  0.0429  66  TRP C CE3 
2961 C CZ2 . TRP C 49  ? 0.6658 0.9840 0.4897 -0.0555 0.0151  0.0603  66  TRP C CZ2 
2962 C CZ3 . TRP C 49  ? 0.6251 0.9095 0.4623 -0.0494 0.0155  0.0472  66  TRP C CZ3 
2963 C CH2 . TRP C 49  ? 0.6498 0.9579 0.4805 -0.0547 0.0171  0.0558  66  TRP C CH2 
2964 N N   . ARG C 50  ? 0.6161 0.8305 0.4767 -0.0494 -0.0025 0.0507  67  ARG C N   
2965 C CA  . ARG C 50  ? 0.6045 0.8100 0.4631 -0.0548 -0.0052 0.0580  67  ARG C CA  
2966 C C   . ARG C 50  ? 0.5814 0.7777 0.4408 -0.0580 -0.0015 0.0625  67  ARG C C   
2967 O O   . ARG C 50  ? 0.5617 0.7550 0.4147 -0.0639 -0.0050 0.0692  67  ARG C O   
2968 C CB  . ARG C 50  ? 0.6184 0.8127 0.4884 -0.0518 -0.0105 0.0555  67  ARG C CB  
2969 C CG  . ARG C 50  ? 0.6337 0.8326 0.4982 -0.0498 -0.0187 0.0530  67  ARG C CG  
2970 N N   . PHE C 51  ? 0.5678 0.7598 0.4351 -0.0538 0.0040  0.0591  68  PHE C N   
2971 C CA  . PHE C 51  ? 0.5395 0.7235 0.4053 -0.0534 0.0075  0.0613  68  PHE C CA  
2972 C C   . PHE C 51  ? 0.5381 0.7280 0.3952 -0.0559 0.0097  0.0622  68  PHE C C   
2973 O O   . PHE C 51  ? 0.5508 0.7349 0.4026 -0.0585 0.0071  0.0655  68  PHE C O   
2974 C CB  . PHE C 51  ? 0.5253 0.7055 0.4019 -0.0472 0.0134  0.0595  68  PHE C CB  
2975 C CG  . PHE C 51  ? 0.5028 0.6794 0.3924 -0.0445 0.0119  0.0598  68  PHE C CG  
2976 C CD1 . PHE C 51  ? 0.5015 0.6711 0.3908 -0.0424 0.0096  0.0605  68  PHE C CD1 
2977 C CD2 . PHE C 51  ? 0.4853 0.6653 0.3899 -0.0432 0.0115  0.0588  68  PHE C CD2 
2978 C CE1 . PHE C 51  ? 0.4983 0.6675 0.4017 -0.0389 0.0085  0.0603  68  PHE C CE1 
2979 C CE2 . PHE C 51  ? 0.4825 0.6610 0.4029 -0.0412 0.0099  0.0600  68  PHE C CE2 
2980 C CZ  . PHE C 51  ? 0.4889 0.6634 0.4086 -0.0389 0.0093  0.0607  68  PHE C CZ  
2981 N N   . VAL C 52  ? 0.5356 0.7362 0.3928 -0.0543 0.0127  0.0585  69  VAL C N   
2982 C CA  . VAL C 52  ? 0.5418 0.7490 0.3930 -0.0556 0.0149  0.0585  69  VAL C CA  
2983 C C   . VAL C 52  ? 0.5941 0.8089 0.4391 -0.0633 0.0111  0.0654  69  VAL C C   
2984 O O   . VAL C 52  ? 0.6308 0.8408 0.4738 -0.0664 0.0093  0.0688  69  VAL C O   
2985 C CB  . VAL C 52  ? 0.5259 0.7454 0.3787 -0.0514 0.0165  0.0519  69  VAL C CB  
2986 C CG1 . VAL C 52  ? 0.5155 0.7447 0.3635 -0.0526 0.0182  0.0516  69  VAL C CG1 
2987 C CG2 . VAL C 52  ? 0.5221 0.7323 0.3845 -0.0458 0.0178  0.0481  69  VAL C CG2 
2988 N N   . ARG C 53  ? 0.6330 0.8597 0.4754 -0.0665 0.0086  0.0685  70  ARG C N   
2989 C CA  . ARG C 53  ? 0.6470 0.8857 0.4850 -0.0755 0.0051  0.0791  70  ARG C CA  
2990 C C   . ARG C 53  ? 0.6534 0.8745 0.4929 -0.0823 -0.0029 0.0875  70  ARG C C   
2991 O O   . ARG C 53  ? 0.6913 0.9186 0.5312 -0.0914 -0.0079 0.0983  70  ARG C O   
2992 C CB  . ARG C 53  ? 0.6714 0.9280 0.5037 -0.0757 0.0044  0.0815  70  ARG C CB  
2993 C CG  . ARG C 53  ? 0.6933 0.9364 0.5250 -0.0772 -0.0018 0.0845  70  ARG C CG  
2994 C CD  . ARG C 53  ? 0.7254 0.9827 0.5504 -0.0722 -0.0026 0.0811  70  ARG C CD  
2995 N NE  . ARG C 53  ? 0.7524 1.0349 0.5675 -0.0777 -0.0025 0.0922  70  ARG C NE  
2996 C CZ  . ARG C 53  ? 0.7479 1.0300 0.5588 -0.0867 -0.0084 0.1062  70  ARG C CZ  
2997 N NH1 . ARG C 53  ? 0.7142 0.9700 0.5299 -0.0903 -0.0165 0.1087  70  ARG C NH1 
2998 N NH2 . ARG C 53  ? 0.8067 1.1171 0.6093 -0.0918 -0.0068 0.1187  70  ARG C NH2 
2999 N N   . ASP C 54  ? 0.6577 0.8585 0.5000 -0.0776 -0.0053 0.0828  71  ASP C N   
3000 C CA  . ASP C 54  ? 0.6757 0.8583 0.5194 -0.0810 -0.0157 0.0877  71  ASP C CA  
3001 C C   . ASP C 54  ? 0.6991 0.8716 0.5434 -0.0820 -0.0206 0.0886  71  ASP C C   
3002 O O   . ASP C 54  ? 0.7169 0.8749 0.5609 -0.0735 -0.0208 0.0809  71  ASP C O   
3003 C CB  . ASP C 54  ? 0.6702 0.8384 0.5176 -0.0728 -0.0159 0.0804  71  ASP C CB  
3004 C CG  . ASP C 54  ? 0.7017 0.8519 0.5506 -0.0742 -0.0286 0.0832  71  ASP C CG  
3005 O OD1 . ASP C 54  ? 0.7531 0.8977 0.6009 -0.0817 -0.0390 0.0908  71  ASP C OD1 
3006 O OD2 . ASP C 54  ? 0.7358 0.8775 0.5890 -0.0675 -0.0297 0.0777  71  ASP C OD2 
3007 N N   . PHE C 55  ? 0.6903 0.8725 0.5359 -0.0920 -0.0253 0.0987  72  PHE C N   
3008 C CA  . PHE C 55  ? 0.6654 0.8409 0.5138 -0.0940 -0.0312 0.0999  72  PHE C CA  
3009 C C   . PHE C 55  ? 0.6895 0.8377 0.5395 -0.0915 -0.0462 0.0981  72  PHE C C   
3010 O O   . PHE C 55  ? 0.7303 0.8663 0.5797 -0.0861 -0.0511 0.0923  72  PHE C O   
3011 C CB  . PHE C 55  ? 0.6733 0.8687 0.5274 -0.1071 -0.0341 0.1142  72  PHE C CB  
3012 C CG  . PHE C 55  ? 0.6803 0.8747 0.5402 -0.1092 -0.0383 0.1149  72  PHE C CG  
3013 C CD1 . PHE C 55  ? 0.6733 0.8742 0.5299 -0.1009 -0.0281 0.1044  72  PHE C CD1 
3014 C CD2 . PHE C 55  ? 0.6860 0.8714 0.5560 -0.1195 -0.0546 0.1264  72  PHE C CD2 
3015 C CE1 . PHE C 55  ? 0.6500 0.8489 0.5118 -0.1021 -0.0331 0.1043  72  PHE C CE1 
3016 C CE2 . PHE C 55  ? 0.6770 0.8605 0.5544 -0.1212 -0.0605 0.1267  72  PHE C CE2 
3017 C CZ  . PHE C 55  ? 0.6695 0.8602 0.5420 -0.1121 -0.0492 0.1151  72  PHE C CZ  
3018 N N   . ALA C 56  ? 0.6960 0.8336 0.5474 -0.0937 -0.0553 0.1018  73  ALA C N   
3019 C CA  . ALA C 56  ? 0.7380 0.8488 0.5914 -0.0893 -0.0725 0.0980  73  ALA C CA  
3020 C C   . ALA C 56  ? 0.7701 0.8704 0.6182 -0.0724 -0.0674 0.0825  73  ALA C C   
3021 O O   . ALA C 56  ? 0.8234 0.9037 0.6712 -0.0642 -0.0808 0.0757  73  ALA C O   
3022 C CB  . ALA C 56  ? 0.7480 0.8505 0.6067 -0.0996 -0.0880 0.1096  73  ALA C CB  
3023 N N   . ASN C 57  ? 0.7260 0.8250 0.6224 -0.0626 0.0136  0.0523  74  ASN C N   
3024 C CA  . ASN C 57  ? 0.7441 0.8565 0.6538 -0.0584 0.0161  0.0463  74  ASN C CA  
3025 C C   . ASN C 57  ? 0.7327 0.8557 0.6511 -0.0672 0.0215  0.0431  74  ASN C C   
3026 O O   . ASN C 57  ? 0.7730 0.9132 0.7043 -0.0687 0.0219  0.0395  74  ASN C O   
3027 C CB  . ASN C 57  ? 0.7438 0.8718 0.6628 -0.0491 0.0106  0.0438  74  ASN C CB  
3028 C CG  . ASN C 57  ? 0.7509 0.8643 0.6576 -0.0372 0.0051  0.0468  74  ASN C CG  
3029 O OD1 . ASN C 57  ? 0.7219 0.8274 0.6258 -0.0290 0.0059  0.0451  74  ASN C OD1 
3030 N ND2 . ASN C 57  ? 0.7793 0.8867 0.6758 -0.0352 -0.0004 0.0514  74  ASN C ND2 
3031 N N   . PRO C 58  ? 0.7468 0.8582 0.6571 -0.0733 0.0252  0.0442  75  PRO C N   
3032 C CA  . PRO C 58  ? 0.7623 0.8780 0.6755 -0.0797 0.0303  0.0417  75  PRO C CA  
3033 C C   . PRO C 58  ? 0.7746 0.8997 0.6970 -0.0777 0.0362  0.0381  75  PRO C C   
3034 O O   . PRO C 58  ? 0.7343 0.8683 0.6635 -0.0835 0.0399  0.0364  75  PRO C O   
3035 C CB  . PRO C 58  ? 0.7696 0.8702 0.6706 -0.0829 0.0316  0.0429  75  PRO C CB  
3036 C CG  . PRO C 58  ? 0.7823 0.8706 0.6763 -0.0797 0.0283  0.0454  75  PRO C CG  
3037 C CD  . PRO C 58  ? 0.7703 0.8636 0.6675 -0.0750 0.0241  0.0477  75  PRO C CD  
3038 N N   . ASN C 59  ? 0.8308 0.9532 0.7524 -0.0695 0.0373  0.0369  76  ASN C N   
3039 C CA  . ASN C 59  ? 0.8237 0.9585 0.7542 -0.0655 0.0439  0.0333  76  ASN C CA  
3040 C C   . ASN C 59  ? 0.7934 0.9538 0.7436 -0.0678 0.0449  0.0308  76  ASN C C   
3041 O O   . ASN C 59  ? 0.8380 1.0123 0.7978 -0.0700 0.0529  0.0284  76  ASN C O   
3042 C CB  . ASN C 59  ? 0.8367 0.9654 0.7626 -0.0527 0.0430  0.0315  76  ASN C CB  
3043 C CG  . ASN C 59  ? 0.8482 0.9794 0.7769 -0.0442 0.0348  0.0320  76  ASN C CG  
3044 O OD1 . ASN C 59  ? 0.8249 0.9741 0.7656 -0.0352 0.0343  0.0285  76  ASN C OD1 
3045 N ND2 . ASN C 59  ? 0.8271 0.9413 0.7444 -0.0466 0.0284  0.0365  76  ASN C ND2 
3046 N N   . LYS C 60  ? 0.7304 0.8975 0.6863 -0.0677 0.0370  0.0311  77  LYS C N   
3047 C CA  . LYS C 60  ? 0.7182 0.9097 0.6934 -0.0715 0.0356  0.0275  77  LYS C CA  
3048 C C   . LYS C 60  ? 0.6818 0.8767 0.6617 -0.0852 0.0424  0.0270  77  LYS C C   
3049 O O   . LYS C 60  ? 0.6817 0.8979 0.6795 -0.0903 0.0462  0.0236  77  LYS C O   
3050 C CB  . LYS C 60  ? 0.7606 0.9536 0.7354 -0.0699 0.0249  0.0279  77  LYS C CB  
3051 C CG  . LYS C 60  ? 0.7880 0.9944 0.7704 -0.0569 0.0176  0.0253  77  LYS C CG  
3052 C CD  . LYS C 60  ? 0.7973 0.9903 0.7686 -0.0442 0.0180  0.0272  77  LYS C CD  
3053 N N   . TYR C 61  ? 0.6700 0.8442 0.6337 -0.0913 0.0437  0.0302  78  TYR C N   
3054 C CA  . TYR C 61  ? 0.6655 0.8354 0.6274 -0.1028 0.0501  0.0305  78  TYR C CA  
3055 C C   . TYR C 61  ? 0.6461 0.7953 0.5892 -0.1034 0.0564  0.0335  78  TYR C C   
3056 O O   . TYR C 61  ? 0.6508 0.7914 0.5873 -0.1115 0.0613  0.0346  78  TYR C O   
3057 C CB  . TYR C 61  ? 0.6541 0.8198 0.6143 -0.1099 0.0432  0.0298  78  TYR C CB  
3058 C CG  . TYR C 61  ? 0.6737 0.8204 0.6153 -0.1071 0.0381  0.0324  78  TYR C CG  
3059 C CD1 . TYR C 61  ? 0.6775 0.8246 0.6160 -0.0996 0.0310  0.0336  78  TYR C CD1 
3060 C CD2 . TYR C 61  ? 0.7193 0.8483 0.6456 -0.1115 0.0406  0.0339  78  TYR C CD2 
3061 C CE1 . TYR C 61  ? 0.6785 0.8130 0.6025 -0.0982 0.0278  0.0360  78  TYR C CE1 
3062 C CE2 . TYR C 61  ? 0.7190 0.8361 0.6310 -0.1078 0.0359  0.0352  78  TYR C CE2 
3063 C CZ  . TYR C 61  ? 0.7063 0.8282 0.6187 -0.1020 0.0301  0.0362  78  TYR C CZ  
3064 O OH  . TYR C 61  ? 0.7275 0.8424 0.6283 -0.0995 0.0270  0.0376  78  TYR C OH  
3065 N N   . LYS C 62  ? 0.6559 0.7951 0.5887 -0.0951 0.0555  0.0345  79  LYS C N   
3066 C CA  . LYS C 62  ? 0.6876 0.8086 0.6026 -0.0944 0.0600  0.0359  79  LYS C CA  
3067 C C   . LYS C 62  ? 0.6791 0.8028 0.5935 -0.0881 0.0672  0.0346  79  LYS C C   
3068 O O   . LYS C 62  ? 0.6761 0.7986 0.5898 -0.0793 0.0641  0.0332  79  LYS C O   
3069 C CB  . LYS C 62  ? 0.6860 0.7928 0.5886 -0.0913 0.0528  0.0370  79  LYS C CB  
3070 C CG  . LYS C 62  ? 0.7043 0.8089 0.6044 -0.0959 0.0470  0.0380  79  LYS C CG  
3071 C CD  . LYS C 62  ? 0.7176 0.8154 0.6102 -0.0933 0.0409  0.0391  79  LYS C CD  
3072 C CE  . LYS C 62  ? 0.7224 0.8189 0.6097 -0.0959 0.0368  0.0395  79  LYS C CE  
3073 N NZ  . LYS C 62  ? 0.7433 0.8381 0.6258 -0.0946 0.0326  0.0406  79  LYS C NZ  
3074 N N   . HIS C 63  ? 0.6967 0.8220 0.6090 -0.0923 0.0770  0.0352  80  HIS C N   
3075 C CA  . HIS C 63  ? 0.7221 0.8574 0.6376 -0.0865 0.0861  0.0336  80  HIS C CA  
3076 C C   . HIS C 63  ? 0.7261 0.8448 0.6232 -0.0763 0.0863  0.0323  80  HIS C C   
3077 O O   . HIS C 63  ? 0.7505 0.8768 0.6493 -0.0673 0.0910  0.0296  80  HIS C O   
3078 C CB  . HIS C 63  ? 0.7691 0.9108 0.6864 -0.0958 0.0984  0.0356  80  HIS C CB  
3079 C CG  . HIS C 63  ? 0.8045 0.9567 0.7215 -0.0896 0.1102  0.0346  80  HIS C CG  
3080 N ND1 . HIS C 63  ? 0.8302 0.9652 0.7244 -0.0869 0.1181  0.0365  80  HIS C ND1 
3081 C CD2 . HIS C 63  ? 0.8111 0.9899 0.7465 -0.0836 0.1152  0.0313  80  HIS C CD2 
3082 C CE1 . HIS C 63  ? 0.8584 1.0088 0.7565 -0.0802 0.1285  0.0347  80  HIS C CE1 
3083 N NE2 . HIS C 63  ? 0.8577 1.0361 0.7817 -0.0779 0.1272  0.0314  80  HIS C NE2 
3084 N N   . PHE C 64  ? 0.7359 0.8333 0.6155 -0.0768 0.0807  0.0332  81  PHE C N   
3085 C CA  . PHE C 64  ? 0.7348 0.8156 0.5966 -0.0682 0.0792  0.0307  81  PHE C CA  
3086 C C   . PHE C 64  ? 0.7226 0.7962 0.5849 -0.0636 0.0686  0.0287  81  PHE C C   
3087 O O   . PHE C 64  ? 0.7098 0.7678 0.5580 -0.0579 0.0652  0.0259  81  PHE C O   
3088 C CB  . PHE C 64  ? 0.7663 0.8293 0.6082 -0.0708 0.0791  0.0318  81  PHE C CB  
3089 C CG  . PHE C 64  ? 0.8051 0.8686 0.6409 -0.0754 0.0903  0.0349  81  PHE C CG  
3090 C CD1 . PHE C 64  ? 0.8523 0.9157 0.6785 -0.0699 0.1009  0.0345  81  PHE C CD1 
3091 C CD2 . PHE C 64  ? 0.7989 0.8622 0.6376 -0.0853 0.0908  0.0384  81  PHE C CD2 
3092 C CE1 . PHE C 64  ? 0.8595 0.9226 0.6790 -0.0758 0.1130  0.0388  81  PHE C CE1 
3093 C CE2 . PHE C 64  ? 0.8314 0.8910 0.6626 -0.0914 0.1016  0.0422  81  PHE C CE2 
3094 C CZ  . PHE C 64  ? 0.8617 0.9215 0.6836 -0.0876 0.1133  0.0430  81  PHE C CZ  
3095 N N   . ILE C 65  ? 0.7106 0.7940 0.5874 -0.0662 0.0633  0.0302  82  ILE C N   
3096 C CA  . ILE C 65  ? 0.7528 0.8284 0.6291 -0.0619 0.0547  0.0297  82  ILE C CA  
3097 C C   . ILE C 65  ? 0.7806 0.8657 0.6653 -0.0519 0.0560  0.0276  82  ILE C C   
3098 O O   . ILE C 65  ? 0.7589 0.8635 0.6597 -0.0521 0.0569  0.0282  82  ILE C O   
3099 C CB  . ILE C 65  ? 0.7717 0.8491 0.6537 -0.0692 0.0478  0.0332  82  ILE C CB  
3100 C CG1 . ILE C 65  ? 0.7684 0.8340 0.6398 -0.0750 0.0441  0.0337  82  ILE C CG1 
3101 C CG2 . ILE C 65  ? 0.8026 0.8753 0.6862 -0.0650 0.0412  0.0344  82  ILE C CG2 
3102 C CD1 . ILE C 65  ? 0.7874 0.8532 0.6529 -0.0782 0.0486  0.0332  82  ILE C CD1 
3103 N N   . LYS C 66  ? 0.8196 0.8907 0.6926 -0.0422 0.0550  0.0242  83  LYS C N   
3104 C CA  . LYS C 66  ? 0.8930 0.9699 0.7699 -0.0290 0.0551  0.0212  83  LYS C CA  
3105 C C   . LYS C 66  ? 0.9230 0.9949 0.8031 -0.0266 0.0458  0.0234  83  LYS C C   
3106 O O   . LYS C 66  ? 0.9214 1.0116 0.8148 -0.0204 0.0453  0.0229  83  LYS C O   
3107 C CB  . LYS C 66  ? 0.9296 0.9871 0.7882 -0.0177 0.0553  0.0162  83  LYS C CB  
3108 C CG  . LYS C 66  ? 0.9507 1.0086 0.8089 -0.0010 0.0534  0.0122  83  LYS C CG  
3109 N N   . SER C 67  ? 0.9252 0.9729 0.7925 -0.0314 0.0384  0.0258  84  SER C N   
3110 C CA  . SER C 67  ? 0.9130 0.9500 0.7777 -0.0298 0.0304  0.0294  84  SER C CA  
3111 C C   . SER C 67  ? 0.8868 0.9110 0.7460 -0.0435 0.0262  0.0344  84  SER C C   
3112 O O   . SER C 67  ? 0.8218 0.8383 0.6753 -0.0513 0.0269  0.0333  84  SER C O   
3113 C CB  . SER C 67  ? 0.9330 0.9468 0.7828 -0.0163 0.0257  0.0266  84  SER C CB  
3114 O OG  . SER C 67  ? 0.9593 0.9416 0.7919 -0.0228 0.0199  0.0281  84  SER C OG  
3115 N N   . CYS C 68  ? 0.8738 0.8976 0.7346 -0.0454 0.0218  0.0395  85  CYS C N   
3116 C CA  . CYS C 68  ? 0.8498 0.8655 0.7064 -0.0578 0.0190  0.0451  85  CYS C CA  
3117 C C   . CYS C 68  ? 0.8800 0.8701 0.7222 -0.0557 0.0133  0.0495  85  CYS C C   
3118 O O   . CYS C 68  ? 0.9090 0.8901 0.7453 -0.0427 0.0105  0.0485  85  CYS C O   
3119 C CB  . CYS C 68  ? 0.8325 0.8708 0.7011 -0.0622 0.0201  0.0481  85  CYS C CB  
3120 S SG  . CYS C 68  ? 0.8447 0.8812 0.7101 -0.0760 0.0189  0.0541  85  CYS C SG  
3121 N N   . THR C 69  ? 0.8948 0.8729 0.7306 -0.0682 0.0118  0.0545  86  THR C N   
3122 C CA  . THR C 69  ? 0.9295 0.8813 0.7499 -0.0696 0.0077  0.0610  86  THR C CA  
3123 C C   . THR C 69  ? 0.9305 0.8848 0.7514 -0.0858 0.0092  0.0678  86  THR C C   
3124 O O   . THR C 69  ? 0.9365 0.8962 0.7628 -0.0974 0.0108  0.0656  86  THR C O   
3125 C CB  . THR C 69  ? 0.9940 0.9119 0.7980 -0.0681 0.0037  0.0583  86  THR C CB  
3126 O OG1 . THR C 69  ? 0.9868 0.9039 0.7894 -0.0514 0.0030  0.0510  86  THR C OG1 
3127 C CG2 . THR C 69  ? 1.0299 0.9151 0.8144 -0.0698 -0.0004 0.0661  86  THR C CG2 
3128 N N   . ILE C 70  ? 0.9207 0.8728 0.7356 -0.0855 0.0088  0.0755  87  ILE C N   
3129 C CA  . ILE C 70  ? 0.9448 0.9014 0.7589 -0.0997 0.0119  0.0829  87  ILE C CA  
3130 C C   . ILE C 70  ? 1.0009 0.9272 0.8012 -0.1121 0.0111  0.0877  87  ILE C C   
3131 O O   . ILE C 70  ? 1.0422 0.9373 0.8239 -0.1075 0.0078  0.0922  87  ILE C O   
3132 C CB  . ILE C 70  ? 0.9145 0.8778 0.7235 -0.0941 0.0122  0.0898  87  ILE C CB  
3133 N N   . ARG C 71  ? 0.9846 0.9198 0.7936 -0.1278 0.0134  0.0863  88  ARG C N   
3134 C CA  . ARG C 71  ? 1.0028 0.9121 0.8027 -0.1428 0.0121  0.0889  88  ARG C CA  
3135 C C   . ARG C 71  ? 1.0083 0.9192 0.8051 -0.1581 0.0174  0.0996  88  ARG C C   
3136 O O   . ARG C 71  ? 1.0577 0.9376 0.8389 -0.1680 0.0170  0.1064  88  ARG C O   
3137 C CB  . ARG C 71  ? 0.9888 0.9080 0.8010 -0.1513 0.0103  0.0796  88  ARG C CB  
3138 C CG  . ARG C 71  ? 0.9916 0.9051 0.8028 -0.1371 0.0061  0.0695  88  ARG C CG  
3139 C CD  . ARG C 71  ? 1.0467 0.9208 0.8377 -0.1284 0.0010  0.0693  88  ARG C CD  
3140 N NE  . ARG C 71  ? 1.0750 0.9467 0.8650 -0.1143 -0.0017 0.0591  88  ARG C NE  
3141 C CZ  . ARG C 71  ? 1.1155 0.9548 0.8886 -0.1057 -0.0071 0.0548  88  ARG C CZ  
3142 N NH1 . ARG C 71  ? 1.1627 0.9641 0.9168 -0.1100 -0.0113 0.0597  88  ARG C NH1 
3143 N NH2 . ARG C 71  ? 1.1065 0.9495 0.8796 -0.0922 -0.0079 0.0455  88  ARG C NH2 
3144 N N   . VAL C 72  ? 0.9841 0.9298 0.7941 -0.1601 0.0228  0.1012  89  VAL C N   
3145 C CA  . VAL C 72  ? 1.0160 0.9681 0.8223 -0.1718 0.0295  0.1118  89  VAL C CA  
3146 C C   . VAL C 72  ? 1.0330 1.0018 0.8367 -0.1580 0.0316  0.1152  89  VAL C C   
3147 O O   . VAL C 72  ? 1.0566 1.0547 0.8746 -0.1505 0.0316  0.1085  89  VAL C O   
3148 C CB  . VAL C 72  ? 1.0053 0.9876 0.8306 -0.1885 0.0341  0.1096  89  VAL C CB  
3149 C CG1 . VAL C 72  ? 1.0043 0.9976 0.8264 -0.2001 0.0431  0.1209  89  VAL C CG1 
3150 C CG2 . VAL C 72  ? 0.9955 0.9630 0.8250 -0.2024 0.0300  0.1043  89  VAL C CG2 
3151 N N   . ASN C 73  ? 1.0952 1.0424 0.8783 -0.1541 0.0325  0.1252  90  ASN C N   
3152 C CA  . ASN C 73  ? 1.1056 1.0652 0.8826 -0.1401 0.0330  0.1283  90  ASN C CA  
3153 C C   . ASN C 73  ? 1.0854 1.0791 0.8719 -0.1464 0.0403  0.1304  90  ASN C C   
3154 O O   . ASN C 73  ? 1.0790 1.0825 0.8718 -0.1631 0.0469  0.1337  90  ASN C O   
3155 C CB  . ASN C 73  ? 1.1445 1.0702 0.8931 -0.1342 0.0318  0.1392  90  ASN C CB  
3156 C CG  . ASN C 73  ? 1.1639 1.0575 0.9005 -0.1211 0.0231  0.1360  90  ASN C CG  
3157 O OD1 . ASN C 73  ? 1.2419 1.0990 0.9530 -0.1186 0.0213  0.1444  90  ASN C OD1 
3158 N ND2 . ASN C 73  ? 1.1202 1.0264 0.8731 -0.1118 0.0181  0.1242  90  ASN C ND2 
3159 N N   . GLU C 79  ? 1.2071 1.2216 0.9439 -0.0747 0.0229  0.1338  96  GLU C N   
3160 C CA  . GLU C 79  ? 1.1789 1.1855 0.9301 -0.0747 0.0182  0.1269  96  GLU C CA  
3161 C C   . GLU C 79  ? 1.1014 1.1310 0.8786 -0.0841 0.0212  0.1180  96  GLU C C   
3162 O O   . GLU C 79  ? 1.0938 1.1166 0.8767 -0.0965 0.0255  0.1190  96  GLU C O   
3163 C CB  . GLU C 79  ? 1.2241 1.2291 0.9758 -0.0566 0.0074  0.1203  96  GLU C CB  
3164 C CG  . GLU C 79  ? 1.2533 1.2852 1.0143 -0.0470 0.0020  0.1122  96  GLU C CG  
3165 C CD  . GLU C 79  ? 1.2784 1.3151 1.0219 -0.0449 0.0043  0.1183  96  GLU C CD  
3166 O OE1 . GLU C 79  ? 1.2456 1.2997 0.9952 -0.0534 0.0109  0.1177  96  GLU C OE1 
3167 O OE2 . GLU C 79  ? 1.3091 1.3318 1.0306 -0.0332 -0.0004 0.1235  96  GLU C OE2 
3168 N N   . ILE C 80  ? 1.0153 1.0698 0.8060 -0.0785 0.0184  0.1093  97  ILE C N   
3169 C CA  . ILE C 80  ? 1.0044 1.0771 0.8158 -0.0853 0.0205  0.1011  97  ILE C CA  
3170 C C   . ILE C 80  ? 0.9551 1.0495 0.7681 -0.0879 0.0247  0.1004  97  ILE C C   
3171 O O   . ILE C 80  ? 0.9610 1.0674 0.7736 -0.0793 0.0208  0.0957  97  ILE C O   
3172 C CB  . ILE C 80  ? 0.9860 1.0666 0.8123 -0.0778 0.0143  0.0906  97  ILE C CB  
3173 C CG1 . ILE C 80  ? 0.9911 1.0541 0.8174 -0.0736 0.0110  0.0900  97  ILE C CG1 
3174 C CG2 . ILE C 80  ? 0.9098 1.0053 0.7519 -0.0843 0.0169  0.0836  97  ILE C CG2 
3175 C CD1 . ILE C 80  ? 0.9830 1.0303 0.8087 -0.0833 0.0150  0.0924  97  ILE C CD1 
3176 N N   . LYS C 81  ? 0.9222 1.0218 0.7374 -0.0996 0.0321  0.1043  98  LYS C N   
3177 C CA  . LYS C 81  ? 0.8911 1.0141 0.7087 -0.1016 0.0372  0.1034  98  LYS C CA  
3178 C C   . LYS C 81  ? 0.8320 0.9673 0.6653 -0.1122 0.0410  0.0997  98  LYS C C   
3179 O O   . LYS C 81  ? 0.7768 0.9004 0.6171 -0.1189 0.0397  0.0984  98  LYS C O   
3180 C CB  . LYS C 81  ? 0.9200 1.0428 0.7205 -0.1040 0.0441  0.1142  98  LYS C CB  
3181 C CG  . LYS C 81  ? 0.9129 1.0246 0.7107 -0.1195 0.0516  0.1238  98  LYS C CG  
3182 N N   . VAL C 82  ? 0.7841 0.9435 0.6217 -0.1122 0.0448  0.0972  99  VAL C N   
3183 C CA  . VAL C 82  ? 0.7392 0.9149 0.5916 -0.1203 0.0477  0.0931  99  VAL C CA  
3184 C C   . VAL C 82  ? 0.7613 0.9290 0.6160 -0.1360 0.0525  0.1002  99  VAL C C   
3185 O O   . VAL C 82  ? 0.8515 1.0150 0.6960 -0.1421 0.0587  0.1100  99  VAL C O   
3186 C CB  . VAL C 82  ? 0.7060 0.9109 0.5603 -0.1165 0.0520  0.0906  99  VAL C CB  
3187 C CG1 . VAL C 82  ? 0.6986 0.9242 0.5693 -0.1254 0.0550  0.0869  99  VAL C CG1 
3188 C CG2 . VAL C 82  ? 0.6828 0.8907 0.5335 -0.1015 0.0456  0.0820  99  VAL C CG2 
3189 N N   . GLY C 83  ? 0.7802 0.9431 0.6463 -0.1426 0.0495  0.0952  100 GLY C N   
3190 C CA  . GLY C 83  ? 0.7760 0.9288 0.6452 -0.1588 0.0522  0.0999  100 GLY C CA  
3191 C C   . GLY C 83  ? 0.7639 0.8837 0.6273 -0.1586 0.0462  0.0993  100 GLY C C   
3192 O O   . GLY C 83  ? 0.7834 0.8935 0.6518 -0.1691 0.0447  0.0977  100 GLY C O   
3193 N N   . THR C 84  ? 0.7269 0.8311 0.5800 -0.1459 0.0423  0.0997  101 THR C N   
3194 C CA  . THR C 84  ? 0.7500 0.8268 0.5977 -0.1418 0.0368  0.0981  101 THR C CA  
3195 C C   . THR C 84  ? 0.7619 0.8398 0.6213 -0.1436 0.0331  0.0887  101 THR C C   
3196 O O   . THR C 84  ? 0.7142 0.8134 0.5844 -0.1417 0.0329  0.0820  101 THR C O   
3197 C CB  . THR C 84  ? 0.7594 0.8321 0.6009 -0.1261 0.0327  0.0968  101 THR C CB  
3198 O OG1 . THR C 84  ? 0.7849 0.8549 0.6127 -0.1233 0.0349  0.1051  101 THR C OG1 
3199 C CG2 . THR C 84  ? 0.8016 0.8505 0.6386 -0.1198 0.0275  0.0947  101 THR C CG2 
3200 N N   . ILE C 85  ? 0.7904 0.8432 0.6448 -0.1460 0.0298  0.0881  102 ILE C N   
3201 C CA  . ILE C 85  ? 0.8106 0.8617 0.6724 -0.1473 0.0262  0.0793  102 ILE C CA  
3202 C C   . ILE C 85  ? 0.8220 0.8523 0.6771 -0.1362 0.0221  0.0756  102 ILE C C   
3203 O O   . ILE C 85  ? 0.8295 0.8354 0.6725 -0.1337 0.0205  0.0799  102 ILE C O   
3204 C CB  . ILE C 85  ? 0.8230 0.8672 0.6870 -0.1634 0.0259  0.0796  102 ILE C CB  
3205 C CG1 . ILE C 85  ? 0.8173 0.8931 0.6942 -0.1731 0.0302  0.0801  102 ILE C CG1 
3206 C CG2 . ILE C 85  ? 0.8236 0.8579 0.6896 -0.1621 0.0202  0.0701  102 ILE C CG2 
3207 C CD1 . ILE C 85  ? 0.8397 0.9154 0.7228 -0.1920 0.0305  0.0808  102 ILE C CD1 
3208 N N   . ARG C 86  ? 0.8302 0.8707 0.6922 -0.1290 0.0209  0.0677  103 ARG C N   
3209 C CA  . ARG C 86  ? 0.8338 0.8628 0.6925 -0.1178 0.0188  0.0631  103 ARG C CA  
3210 C C   . ARG C 86  ? 0.8497 0.8637 0.7048 -0.1201 0.0160  0.0574  103 ARG C C   
3211 O O   . ARG C 86  ? 0.8649 0.8863 0.7247 -0.1282 0.0150  0.0541  103 ARG C O   
3212 C CB  . ARG C 86  ? 0.8004 0.8484 0.6671 -0.1105 0.0205  0.0582  103 ARG C CB  
3213 C CG  . ARG C 86  ? 0.8094 0.8655 0.6784 -0.1023 0.0212  0.0601  103 ARG C CG  
3214 C CD  . ARG C 86  ? 0.8004 0.8653 0.6754 -0.0960 0.0227  0.0543  103 ARG C CD  
3215 N NE  . ARG C 86  ? 0.7806 0.8572 0.6588 -0.0992 0.0241  0.0512  103 ARG C NE  
3216 C CZ  . ARG C 86  ? 0.7927 0.8817 0.6748 -0.0975 0.0250  0.0502  103 ARG C CZ  
3217 N NH1 . ARG C 86  ? 0.8154 0.9100 0.7011 -0.0938 0.0243  0.0515  103 ARG C NH1 
3218 N NH2 . ARG C 86  ? 0.7994 0.8940 0.6806 -0.0988 0.0255  0.0472  103 ARG C NH2 
3219 N N   . GLU C 87  ? 0.8689 0.8636 0.7157 -0.1113 0.0140  0.0551  104 GLU C N   
3220 C CA  . GLU C 87  ? 0.8914 0.8761 0.7341 -0.1081 0.0119  0.0473  104 GLU C CA  
3221 C C   . GLU C 87  ? 0.8623 0.8509 0.7050 -0.0936 0.0145  0.0438  104 GLU C C   
3222 O O   . GLU C 87  ? 0.8604 0.8356 0.6965 -0.0842 0.0135  0.0439  104 GLU C O   
3223 C CB  . GLU C 87  ? 0.9506 0.9051 0.7808 -0.1126 0.0068  0.0464  104 GLU C CB  
3224 C CG  . GLU C 87  ? 0.9813 0.9286 0.8077 -0.1137 0.0031  0.0375  104 GLU C CG  
3225 C CD  . GLU C 87  ? 1.0537 0.9673 0.8659 -0.1180 -0.0034 0.0351  104 GLU C CD  
3226 O OE1 . GLU C 87  ? 1.0380 0.9330 0.8437 -0.1246 -0.0047 0.0416  104 GLU C OE1 
3227 O OE2 . GLU C 87  ? 1.1573 1.0605 0.9624 -0.1147 -0.0075 0.0265  104 GLU C OE2 
3228 N N   . VAL C 88  ? 0.8475 0.8553 0.6977 -0.0918 0.0181  0.0408  105 VAL C N   
3229 C CA  . VAL C 88  ? 0.8503 0.8641 0.7017 -0.0811 0.0222  0.0372  105 VAL C CA  
3230 C C   . VAL C 88  ? 0.8781 0.8753 0.7180 -0.0756 0.0212  0.0310  105 VAL C C   
3231 O O   . VAL C 88  ? 0.8789 0.8658 0.7123 -0.0814 0.0170  0.0280  105 VAL C O   
3232 C CB  . VAL C 88  ? 0.8154 0.8486 0.6740 -0.0828 0.0266  0.0364  105 VAL C CB  
3233 C CG2 . VAL C 88  ? 0.8073 0.8560 0.6758 -0.0855 0.0273  0.0410  105 VAL C CG2 
3234 N N   . SER C 89  ? 0.8734 0.8695 0.7109 -0.0639 0.0244  0.0284  106 SER C N   
3235 C CA  . SER C 89  ? 0.9182 0.9012 0.7433 -0.0559 0.0249  0.0219  106 SER C CA  
3236 C C   . SER C 89  ? 0.8713 0.8721 0.7001 -0.0504 0.0338  0.0201  106 SER C C   
3237 O O   . SER C 89  ? 0.8506 0.8677 0.6899 -0.0454 0.0393  0.0216  106 SER C O   
3238 C CB  . SER C 89  ? 0.9695 0.9333 0.7850 -0.0453 0.0215  0.0199  106 SER C CB  
3239 O OG  . SER C 89  ? 1.0178 0.9971 0.8411 -0.0338 0.0267  0.0200  106 SER C OG  
3240 N N   . VAL C 90  ? 0.8443 0.8420 0.6642 -0.0518 0.0351  0.0169  107 VAL C N   
3241 C CA  . VAL C 90  ? 0.7800 0.7904 0.5995 -0.0489 0.0443  0.0168  107 VAL C CA  
3242 C C   . VAL C 90  ? 0.8027 0.8144 0.6175 -0.0363 0.0512  0.0135  107 VAL C C   
3243 O O   . VAL C 90  ? 0.8063 0.8030 0.6114 -0.0275 0.0474  0.0091  107 VAL C O   
3244 C CB  . VAL C 90  ? 0.7685 0.7710 0.5741 -0.0509 0.0431  0.0141  107 VAL C CB  
3245 C CG1 . VAL C 90  ? 0.7640 0.7767 0.5675 -0.0502 0.0531  0.0165  107 VAL C CG1 
3246 C CG2 . VAL C 90  ? 0.7818 0.7846 0.5916 -0.0611 0.0351  0.0154  107 VAL C CG2 
3247 N N   . VAL C 91  ? 0.8120 0.8419 0.6338 -0.0357 0.0618  0.0156  108 VAL C N   
3248 C CA  . VAL C 91  ? 0.8611 0.8990 0.6807 -0.0244 0.0710  0.0127  108 VAL C CA  
3249 C C   . VAL C 91  ? 0.9114 0.9325 0.7068 -0.0171 0.0734  0.0083  108 VAL C C   
3250 O O   . VAL C 91  ? 0.9328 0.9413 0.7157 -0.0223 0.0695  0.0083  108 VAL C O   
3251 C CB  . VAL C 91  ? 0.8493 0.9138 0.6857 -0.0297 0.0824  0.0169  108 VAL C CB  
3252 C CG1 . VAL C 91  ? 0.8430 0.9043 0.6676 -0.0356 0.0905  0.0195  108 VAL C CG1 
3253 C CG2 . VAL C 91  ? 0.8921 0.9761 0.7385 -0.0189 0.0902  0.0141  108 VAL C CG2 
3254 N N   . SER C 92  ? 0.9721 0.9936 0.7595 -0.0033 0.0789  0.0038  109 SER C N   
3255 C CA  . SER C 92  ? 1.0325 1.0395 0.7946 0.0054  0.0824  -0.0006 109 SER C CA  
3256 C C   . SER C 92  ? 1.0736 1.0942 0.8337 0.0009  0.0965  0.0043  109 SER C C   
3257 O O   . SER C 92  ? 1.1223 1.1668 0.9019 -0.0053 0.1059  0.0093  109 SER C O   
3258 C CB  . SER C 92  ? 1.0159 1.0180 0.7674 0.0235  0.0842  -0.0077 109 SER C CB  
3259 O OG  . SER C 92  ? 1.0118 1.0406 0.7722 0.0301  0.0996  -0.0064 109 SER C OG  
3260 N N   . GLY C 93  ? 1.1213 1.1253 0.8566 0.0036  0.0975  0.0030  110 GLY C N   
3261 C CA  . GLY C 93  ? 1.1482 1.1575 0.8755 -0.0014 0.1100  0.0090  110 GLY C CA  
3262 C C   . GLY C 93  ? 1.1520 1.1466 0.8710 -0.0105 0.1014  0.0115  110 GLY C C   
3263 O O   . GLY C 93  ? 1.2197 1.2007 0.9149 -0.0080 0.1041  0.0125  110 GLY C O   
3264 N N   . LEU C 94  ? 1.1378 1.1356 0.8751 -0.0199 0.0908  0.0125  111 LEU C N   
3265 C CA  . LEU C 94  ? 1.1142 1.0999 0.8445 -0.0256 0.0800  0.0124  111 LEU C CA  
3266 C C   . LEU C 94  ? 1.1079 1.0771 0.8264 -0.0193 0.0666  0.0041  111 LEU C C   
3267 O O   . LEU C 94  ? 1.0905 1.0584 0.8161 -0.0160 0.0623  0.0003  111 LEU C O   
3268 C CB  . LEU C 94  ? 1.0878 1.0856 0.8417 -0.0378 0.0753  0.0167  111 LEU C CB  
3269 C CG  . LEU C 94  ? 1.0816 1.0885 0.8412 -0.0459 0.0851  0.0239  111 LEU C CG  
3270 C CD1 . LEU C 94  ? 1.0722 1.0926 0.8558 -0.0559 0.0806  0.0268  111 LEU C CD1 
3271 C CD2 . LEU C 94  ? 1.1124 1.1032 0.8488 -0.0455 0.0847  0.0256  111 LEU C CD2 
3272 N N   . PRO C 95  ? 1.1056 1.0612 0.8052 -0.0172 0.0592  0.0009  112 PRO C N   
3273 C CA  . PRO C 95  ? 1.1118 1.0526 0.8009 -0.0131 0.0450  -0.0081 112 PRO C CA  
3274 C C   . PRO C 95  ? 1.0882 1.0334 0.7988 -0.0234 0.0336  -0.0094 112 PRO C C   
3275 O O   . PRO C 95  ? 1.1538 1.0878 0.8629 -0.0219 0.0254  -0.0155 112 PRO C O   
3276 C CB  . PRO C 95  ? 1.1284 1.0603 0.7971 -0.0100 0.0397  -0.0102 112 PRO C CB  
3277 C CG  . PRO C 95  ? 1.1188 1.0600 0.7929 -0.0159 0.0477  -0.0013 112 PRO C CG  
3278 C CD  . PRO C 95  ? 1.1053 1.0580 0.7926 -0.0190 0.0625  0.0054  112 PRO C CD  
3279 N N   . ALA C 96  ? 1.0033 0.9625 0.7316 -0.0337 0.0332  -0.0037 113 ALA C N   
3280 C CA  . ALA C 96  ? 0.9647 0.9310 0.7137 -0.0441 0.0255  -0.0028 113 ALA C CA  
3281 C C   . ALA C 96  ? 0.9506 0.9144 0.7084 -0.0433 0.0276  -0.0020 113 ALA C C   
3282 O O   . ALA C 96  ? 0.9811 0.9495 0.7395 -0.0372 0.0375  0.0005  113 ALA C O   
3283 C CB  . ALA C 96  ? 0.9621 0.9450 0.7264 -0.0522 0.0284  0.0039  113 ALA C CB  
3284 N N   . SER C 97  ? 0.9451 0.9019 0.7093 -0.0495 0.0183  -0.0042 114 SER C N   
3285 C CA  . SER C 97  ? 1.0143 0.9628 0.7821 -0.0471 0.0184  -0.0036 114 SER C CA  
3286 C C   . SER C 97  ? 0.9892 0.9462 0.7757 -0.0573 0.0169  0.0029  114 SER C C   
3287 O O   . SER C 97  ? 0.9872 0.9473 0.7803 -0.0535 0.0210  0.0066  114 SER C O   
3288 C CB  . SER C 97  ? 1.0591 0.9821 0.8113 -0.0437 0.0088  -0.0118 114 SER C CB  
3289 O OG  . SER C 97  ? 1.0965 1.0148 0.8536 -0.0567 -0.0018 -0.0137 114 SER C OG  
3290 N N   . THR C 98  ? 0.9754 0.9377 0.7698 -0.0692 0.0108  0.0041  115 THR C N   
3291 C CA  . THR C 98  ? 0.9714 0.9406 0.7803 -0.0787 0.0099  0.0107  115 THR C CA  
3292 C C   . THR C 98  ? 0.9093 0.8970 0.7294 -0.0887 0.0084  0.0131  115 THR C C   
3293 O O   . THR C 98  ? 0.8900 0.8819 0.7066 -0.0896 0.0048  0.0084  115 THR C O   
3294 C CB  . THR C 98  ? 1.0400 0.9873 0.8443 -0.0839 0.0027  0.0098  115 THR C CB  
3295 O OG1 . THR C 98  ? 1.0412 0.9950 0.8571 -0.0943 0.0026  0.0173  115 THR C OG1 
3296 C CG2 . THR C 98  ? 1.0919 1.0269 0.8886 -0.0902 -0.0063 0.0023  115 THR C CG2 
3297 N N   . SER C 99  ? 0.8804 0.8798 0.7126 -0.0942 0.0110  0.0200  116 SER C N   
3298 C CA  . SER C 99  ? 0.8799 0.8985 0.7228 -0.1021 0.0103  0.0225  116 SER C CA  
3299 C C   . SER C 99  ? 0.8913 0.9130 0.7427 -0.1102 0.0106  0.0293  116 SER C C   
3300 O O   . SER C 99  ? 0.9161 0.9310 0.7667 -0.1065 0.0132  0.0336  116 SER C O   
3301 C CB  . SER C 99  ? 0.8705 0.9034 0.7153 -0.0964 0.0157  0.0239  116 SER C CB  
3302 O OG  . SER C 99  ? 0.8984 0.9481 0.7501 -0.1011 0.0140  0.0246  116 SER C OG  
3303 N N   . VAL C 100 ? 0.8663 0.8993 0.7253 -0.1206 0.0080  0.0302  117 VAL C N   
3304 C CA  . VAL C 100 ? 0.8323 0.8673 0.6969 -0.1297 0.0092  0.0373  117 VAL C CA  
3305 C C   . VAL C 100 ? 0.7864 0.8486 0.6616 -0.1329 0.0115  0.0393  117 VAL C C   
3306 O O   . VAL C 100 ? 0.7231 0.7999 0.6031 -0.1345 0.0088  0.0341  117 VAL C O   
3307 C CB  . VAL C 100 ? 0.8658 0.8838 0.7277 -0.1415 0.0046  0.0371  117 VAL C CB  
3308 C CG1 . VAL C 100 ? 0.8946 0.9036 0.7517 -0.1415 -0.0018 0.0276  117 VAL C CG1 
3309 C CG2 . VAL C 100 ? 0.8688 0.9024 0.7411 -0.1562 0.0059  0.0421  117 VAL C CG2 
3310 N N   . GLU C 101 ? 0.7434 0.8122 0.6207 -0.1318 0.0157  0.0461  118 GLU C N   
3311 C CA  . GLU C 101 ? 0.7402 0.8322 0.6236 -0.1293 0.0182  0.0469  118 GLU C CA  
3312 C C   . GLU C 101 ? 0.7577 0.8573 0.6429 -0.1331 0.0217  0.0547  118 GLU C C   
3313 O O   . GLU C 101 ? 0.7418 0.8287 0.6214 -0.1307 0.0229  0.0599  118 GLU C O   
3314 C CB  . GLU C 101 ? 0.7149 0.8062 0.5948 -0.1179 0.0194  0.0444  118 GLU C CB  
3315 N N   . ILE C 102 ? 0.7267 0.8486 0.6188 -0.1374 0.0234  0.0552  119 ILE C N   
3316 C CA  . ILE C 102 ? 0.6919 0.8232 0.5841 -0.1413 0.0278  0.0627  119 ILE C CA  
3317 C C   . ILE C 102 ? 0.6558 0.8003 0.5463 -0.1306 0.0290  0.0620  119 ILE C C   
3318 O O   . ILE C 102 ? 0.6552 0.8116 0.5484 -0.1246 0.0272  0.0557  119 ILE C O   
3319 C CB  . ILE C 102 ? 0.6922 0.8428 0.5936 -0.1537 0.0303  0.0639  119 ILE C CB  
3320 C CG1 . ILE C 102 ? 0.7381 0.8951 0.6361 -0.1583 0.0368  0.0735  119 ILE C CG1 
3321 C CG2 . ILE C 102 ? 0.6722 0.8500 0.5831 -0.1491 0.0285  0.0561  119 ILE C CG2 
3322 C CD1 . ILE C 102 ? 0.7329 0.9123 0.6410 -0.1723 0.0419  0.0764  119 ILE C CD1 
3323 N N   . LEU C 103 ? 0.6505 0.7904 0.5345 -0.1276 0.0310  0.0679  120 LEU C N   
3324 C CA  . LEU C 103 ? 0.6606 0.8110 0.5414 -0.1178 0.0309  0.0667  120 LEU C CA  
3325 C C   . LEU C 103 ? 0.6768 0.8514 0.5596 -0.1186 0.0344  0.0675  120 LEU C C   
3326 O O   . LEU C 103 ? 0.6582 0.8386 0.5400 -0.1259 0.0392  0.0742  120 LEU C O   
3327 C CB  . LEU C 103 ? 0.6811 0.8193 0.5537 -0.1134 0.0303  0.0718  120 LEU C CB  
3328 C CG  . LEU C 103 ? 0.7097 0.8553 0.5773 -0.1039 0.0286  0.0704  120 LEU C CG  
3329 C CD1 . LEU C 103 ? 0.7191 0.8647 0.5904 -0.0980 0.0249  0.0624  120 LEU C CD1 
3330 C CD2 . LEU C 103 ? 0.7285 0.8621 0.5882 -0.0999 0.0268  0.0753  120 LEU C CD2 
3331 N N   . GLU C 104 ? 0.6592 0.8472 0.5434 -0.1107 0.0325  0.0607  121 GLU C N   
3332 C CA  . GLU C 104 ? 0.6634 0.8776 0.5504 -0.1087 0.0353  0.0592  121 GLU C CA  
3333 C C   . GLU C 104 ? 0.6681 0.8888 0.5453 -0.0983 0.0358  0.0594  121 GLU C C   
3334 O O   . GLU C 104 ? 0.6781 0.9184 0.5542 -0.0977 0.0408  0.0621  121 GLU C O   
3335 C CB  . GLU C 104 ? 0.6647 0.8895 0.5571 -0.1039 0.0316  0.0505  121 GLU C CB  
3336 C CG  . GLU C 104 ? 0.6787 0.9000 0.5800 -0.1129 0.0298  0.0486  121 GLU C CG  
3337 C CD  . GLU C 104 ? 0.6889 0.9366 0.6004 -0.1127 0.0284  0.0424  121 GLU C CD  
3338 O OE1 . GLU C 104 ? 0.6700 0.9272 0.5776 -0.0998 0.0252  0.0358  121 GLU C OE1 
3339 O OE2 . GLU C 104 ? 0.6655 0.9238 0.5886 -0.1253 0.0300  0.0437  121 GLU C OE2 
3340 N N   . VAL C 105 ? 0.6645 0.8695 0.5344 -0.0903 0.0307  0.0558  122 VAL C N   
3341 C CA  . VAL C 105 ? 0.6538 0.8604 0.5131 -0.0802 0.0288  0.0541  122 VAL C CA  
3342 C C   . VAL C 105 ? 0.6623 0.8492 0.5172 -0.0795 0.0249  0.0554  122 VAL C C   
3343 O O   . VAL C 105 ? 0.6464 0.8197 0.5056 -0.0815 0.0219  0.0527  122 VAL C O   
3344 C CB  . VAL C 105 ? 0.6403 0.8504 0.4951 -0.0699 0.0246  0.0452  122 VAL C CB  
3345 C CG1 . VAL C 105 ? 0.6548 0.8606 0.4962 -0.0594 0.0208  0.0420  122 VAL C CG1 
3346 C CG2 . VAL C 105 ? 0.6163 0.8513 0.4767 -0.0682 0.0279  0.0430  122 VAL C CG2 
3347 N N   . LEU C 106 ? 0.6711 0.8585 0.5175 -0.0764 0.0252  0.0595  123 LEU C N   
3348 C CA  . LEU C 106 ? 0.6698 0.8439 0.5116 -0.0728 0.0197  0.0591  123 LEU C CA  
3349 C C   . LEU C 106 ? 0.6927 0.8728 0.5212 -0.0630 0.0171  0.0569  123 LEU C C   
3350 O O   . LEU C 106 ? 0.7437 0.9292 0.5628 -0.0609 0.0204  0.0629  123 LEU C O   
3351 C CB  . LEU C 106 ? 0.6752 0.8400 0.5171 -0.0779 0.0215  0.0670  123 LEU C CB  
3352 C CG  . LEU C 106 ? 0.6823 0.8372 0.5198 -0.0723 0.0152  0.0668  123 LEU C CG  
3353 C CD1 . LEU C 106 ? 0.6776 0.8274 0.5256 -0.0721 0.0098  0.0592  123 LEU C CD1 
3354 C CD2 . LEU C 106 ? 0.6875 0.8312 0.5211 -0.0748 0.0168  0.0751  123 LEU C CD2 
3355 N N   . ASP C 107 ? 0.6989 0.8759 0.5245 -0.0569 0.0112  0.0483  124 ASP C N   
3356 C CA  . ASP C 107 ? 0.6955 0.8751 0.5066 -0.0463 0.0068  0.0438  124 ASP C CA  
3357 C C   . ASP C 107 ? 0.6986 0.8650 0.5084 -0.0447 -0.0024 0.0387  124 ASP C C   
3358 O O   . ASP C 107 ? 0.6634 0.8200 0.4780 -0.0469 -0.0072 0.0322  124 ASP C O   
3359 C CB  . ASP C 107 ? 0.7120 0.8958 0.5183 -0.0398 0.0061  0.0367  124 ASP C CB  
3360 C CG  . ASP C 107 ? 0.7807 0.9675 0.5692 -0.0268 0.0021  0.0314  124 ASP C CG  
3361 O OD1 . ASP C 107 ? 0.8176 0.9978 0.5976 -0.0233 -0.0033 0.0305  124 ASP C OD1 
3362 O OD2 . ASP C 107 ? 0.8071 1.0034 0.5894 -0.0187 0.0038  0.0274  124 ASP C OD2 
3363 N N   . GLU C 108 ? 0.7293 0.8961 0.5319 -0.0408 -0.0052 0.0417  125 GLU C N   
3364 C CA  . GLU C 108 ? 0.7003 0.8593 0.5045 -0.0393 -0.0150 0.0369  125 GLU C CA  
3365 C C   . GLU C 108 ? 0.6952 0.8490 0.4911 -0.0336 -0.0242 0.0263  125 GLU C C   
3366 O O   . GLU C 108 ? 0.7030 0.8505 0.5063 -0.0367 -0.0324 0.0200  125 GLU C O   
3367 C CB  . GLU C 108 ? 0.7224 0.8831 0.5162 -0.0334 -0.0168 0.0425  125 GLU C CB  
3368 C CG  . GLU C 108 ? 0.7363 0.8960 0.5335 -0.0384 -0.0094 0.0534  125 GLU C CG  
3369 C CD  . GLU C 108 ? 0.7461 0.9002 0.5604 -0.0443 -0.0121 0.0526  125 GLU C CD  
3370 O OE1 . GLU C 108 ? 0.7806 0.9309 0.6001 -0.0503 -0.0055 0.0596  125 GLU C OE1 
3371 O OE2 . GLU C 108 ? 0.7315 0.8857 0.5539 -0.0431 -0.0207 0.0447  125 GLU C OE2 
3372 N N   . GLU C 109 ? 0.7026 0.8594 0.4827 -0.0249 -0.0231 0.0238  126 GLU C N   
3373 C CA  . GLU C 109 ? 0.7510 0.8995 0.5170 -0.0166 -0.0333 0.0133  126 GLU C CA  
3374 C C   . GLU C 109 ? 0.7673 0.9031 0.5363 -0.0203 -0.0356 0.0062  126 GLU C C   
3375 O O   . GLU C 109 ? 0.7389 0.8604 0.5082 -0.0234 -0.0450 -0.0018 126 GLU C O   
3376 C CB  . GLU C 109 ? 0.7710 0.9277 0.5147 -0.0026 -0.0314 0.0133  126 GLU C CB  
3377 N N   . LYS C 110 ? 0.7802 0.9207 0.5510 -0.0205 -0.0273 0.0094  127 LYS C N   
3378 C CA  . LYS C 110 ? 0.7898 0.9165 0.5625 -0.0239 -0.0282 0.0049  127 LYS C CA  
3379 C C   . LYS C 110 ? 0.7659 0.8855 0.5576 -0.0385 -0.0265 0.0077  127 LYS C C   
3380 O O   . LYS C 110 ? 0.7788 0.8820 0.5706 -0.0433 -0.0286 0.0038  127 LYS C O   
3381 C CB  . LYS C 110 ? 0.8000 0.9380 0.5696 -0.0179 -0.0205 0.0071  127 LYS C CB  
3382 C CG  . LYS C 110 ? 0.8077 0.9498 0.5572 -0.0016 -0.0227 0.0011  127 LYS C CG  
3383 C CD  . LYS C 110 ? 0.8019 0.9713 0.5541 0.0037  -0.0126 0.0063  127 LYS C CD  
3384 C CE  . LYS C 110 ? 0.8346 1.0085 0.5713 0.0201  -0.0140 -0.0012 127 LYS C CE  
3385 N NZ  . LYS C 110 ? 0.8849 1.0478 0.5988 0.0337  -0.0221 -0.0093 127 LYS C NZ  
3386 N N   . ARG C 111 ? 0.7334 0.8641 0.5390 -0.0445 -0.0222 0.0148  128 ARG C N   
3387 C CA  . ARG C 111 ? 0.7177 0.8454 0.5410 -0.0561 -0.0193 0.0177  128 ARG C CA  
3388 C C   . ARG C 111 ? 0.6923 0.8162 0.5184 -0.0595 -0.0126 0.0199  128 ARG C C   
3389 O O   . ARG C 111 ? 0.6927 0.8048 0.5233 -0.0661 -0.0123 0.0180  128 ARG C O   
3390 C CB  . ARG C 111 ? 0.7244 0.8418 0.5538 -0.0625 -0.0265 0.0114  128 ARG C CB  
3391 C CG  . ARG C 111 ? 0.7357 0.8576 0.5618 -0.0580 -0.0356 0.0072  128 ARG C CG  
3392 C CD  . ARG C 111 ? 0.7290 0.8452 0.5663 -0.0670 -0.0428 0.0004  128 ARG C CD  
3393 N NE  . ARG C 111 ? 0.7311 0.8578 0.5724 -0.0638 -0.0515 -0.0028 128 ARG C NE  
3394 C CZ  . ARG C 111 ? 0.7295 0.8514 0.5643 -0.0620 -0.0633 -0.0121 128 ARG C CZ  
3395 N NH1 . ARG C 111 ? 0.7257 0.8292 0.5482 -0.0635 -0.0677 -0.0190 128 ARG C NH1 
3396 N NH2 . ARG C 111 ? 0.7277 0.8616 0.5669 -0.0579 -0.0717 -0.0149 128 ARG C NH2 
3397 N N   . ILE C 112 ? 0.6708 0.8059 0.4935 -0.0549 -0.0072 0.0236  129 ILE C N   
3398 C CA  . ILE C 112 ? 0.6635 0.7994 0.4902 -0.0573 -0.0019 0.0255  129 ILE C CA  
3399 C C   . ILE C 112 ? 0.6484 0.7936 0.4878 -0.0643 0.0040  0.0329  129 ILE C C   
3400 O O   . ILE C 112 ? 0.5938 0.7481 0.4335 -0.0638 0.0055  0.0376  129 ILE C O   
3401 C CB  . ILE C 112 ? 0.6699 0.8153 0.4864 -0.0476 -0.0008 0.0232  129 ILE C CB  
3402 C CG1 . ILE C 112 ? 0.6711 0.8041 0.4706 -0.0378 -0.0079 0.0151  129 ILE C CG1 
3403 C CG2 . ILE C 112 ? 0.6930 0.8399 0.5143 -0.0495 0.0027  0.0237  129 ILE C CG2 
3404 N N   . LEU C 113 ? 0.6026 0.7422 0.4495 -0.0703 0.0071  0.0340  130 LEU C N   
3405 C CA  . LEU C 113 ? 0.5729 0.7177 0.4292 -0.0763 0.0120  0.0397  130 LEU C CA  
3406 C C   . LEU C 113 ? 0.6172 0.7618 0.4748 -0.0775 0.0144  0.0384  130 LEU C C   
3407 O O   . LEU C 113 ? 0.6511 0.7852 0.5036 -0.0756 0.0127  0.0342  130 LEU C O   
3408 C CB  . LEU C 113 ? 0.5568 0.6941 0.4215 -0.0814 0.0120  0.0415  130 LEU C CB  
3409 C CG  . LEU C 113 ? 0.5448 0.6837 0.4153 -0.0854 0.0155  0.0475  130 LEU C CG  
3410 C CD2 . LEU C 113 ? 0.5488 0.6821 0.4235 -0.0897 0.0186  0.0473  130 LEU C CD2 
3411 N N   . SER C 114 ? 0.6388 0.7936 0.5019 -0.0812 0.0178  0.0420  131 SER C N   
3412 C CA  . SER C 114 ? 0.6420 0.8010 0.5071 -0.0818 0.0185  0.0397  131 SER C CA  
3413 C C   . SER C 114 ? 0.6618 0.8239 0.5355 -0.0903 0.0215  0.0439  131 SER C C   
3414 O O   . SER C 114 ? 0.6555 0.8241 0.5317 -0.0945 0.0241  0.0492  131 SER C O   
3415 C CB  . SER C 114 ? 0.6310 0.8074 0.4928 -0.0750 0.0180  0.0366  131 SER C CB  
3416 O OG  . SER C 114 ? 0.6648 0.8468 0.5294 -0.0744 0.0170  0.0330  131 SER C OG  
3417 N N   . PHE C 115 ? 0.6525 0.8076 0.5282 -0.0927 0.0208  0.0415  132 PHE C N   
3418 C CA  . PHE C 115 ? 0.6919 0.8459 0.5741 -0.1010 0.0221  0.0440  132 PHE C CA  
3419 C C   . PHE C 115 ? 0.7190 0.8764 0.6029 -0.1015 0.0197  0.0388  132 PHE C C   
3420 O O   . PHE C 115 ? 0.7419 0.8935 0.6191 -0.0947 0.0172  0.0340  132 PHE C O   
3421 C CB  . PHE C 115 ? 0.7024 0.8383 0.5840 -0.1033 0.0229  0.0469  132 PHE C CB  
3422 C CG  . PHE C 115 ? 0.7090 0.8317 0.5873 -0.1005 0.0222  0.0429  132 PHE C CG  
3423 C CD1 . PHE C 115 ? 0.7147 0.8311 0.5925 -0.1029 0.0213  0.0405  132 PHE C CD1 
3424 C CD2 . PHE C 115 ? 0.6991 0.8152 0.5740 -0.0963 0.0228  0.0417  132 PHE C CD2 
3425 C CE1 . PHE C 115 ? 0.7334 0.8372 0.6051 -0.0993 0.0216  0.0373  132 PHE C CE1 
3426 C CE2 . PHE C 115 ? 0.7018 0.8063 0.5726 -0.0948 0.0242  0.0392  132 PHE C CE2 
3427 C CZ  . PHE C 115 ? 0.7178 0.8161 0.5859 -0.0954 0.0240  0.0373  132 PHE C CZ  
3428 N N   . ARG C 116 ? 0.7077 0.8731 0.5994 -0.1100 0.0199  0.0399  133 ARG C N   
3429 C CA  . ARG C 116 ? 0.7483 0.9192 0.6435 -0.1117 0.0162  0.0342  133 ARG C CA  
3430 C C   . ARG C 116 ? 0.7535 0.9051 0.6477 -0.1183 0.0149  0.0345  133 ARG C C   
3431 O O   . ARG C 116 ? 0.7628 0.9051 0.6583 -0.1256 0.0174  0.0401  133 ARG C O   
3432 C CB  . ARG C 116 ? 0.7774 0.9762 0.6847 -0.1178 0.0166  0.0335  133 ARG C CB  
3433 C CG  . ARG C 116 ? 0.8301 1.0408 0.7432 -0.1178 0.0107  0.0254  133 ARG C CG  
3434 C CD  . ARG C 116 ? 0.8457 1.0920 0.7699 -0.1158 0.0103  0.0216  133 ARG C CD  
3435 N NE  . ARG C 116 ? 0.8352 1.1003 0.7728 -0.1294 0.0161  0.0272  133 ARG C NE  
3436 C CZ  . ARG C 116 ? 0.9039 1.1724 0.8528 -0.1455 0.0160  0.0280  133 ARG C CZ  
3437 N NH1 . ARG C 116 ? 0.8803 1.1353 0.8292 -0.1491 0.0092  0.0225  133 ARG C NH1 
3438 N N   . VAL C 117 ? 0.6890 0.8323 0.5779 -0.1141 0.0108  0.0284  134 VAL C N   
3439 C CA  . VAL C 117 ? 0.7195 0.8461 0.6062 -0.1191 0.0084  0.0266  134 VAL C CA  
3440 C C   . VAL C 117 ? 0.7306 0.8706 0.6281 -0.1300 0.0044  0.0237  134 VAL C C   
3441 O O   . VAL C 117 ? 0.7223 0.8854 0.6272 -0.1291 0.0014  0.0191  134 VAL C O   
3442 C CB  . VAL C 117 ? 0.7288 0.8409 0.6031 -0.1098 0.0059  0.0212  134 VAL C CB  
3443 C CG1 . VAL C 117 ? 0.7477 0.8444 0.6181 -0.1134 0.0018  0.0172  134 VAL C CG1 
3444 C CG2 . VAL C 117 ? 0.7262 0.8251 0.5925 -0.1031 0.0112  0.0249  134 VAL C CG2 
3445 N N   . LEU C 118 ? 0.7563 0.8812 0.6544 -0.1402 0.0038  0.0259  135 LEU C N   
3446 C CA  . LEU C 118 ? 0.7890 0.9221 0.6978 -0.1548 0.0005  0.0240  135 LEU C CA  
3447 C C   . LEU C 118 ? 0.8005 0.9146 0.7035 -0.1575 -0.0070 0.0167  135 LEU C C   
3448 O O   . LEU C 118 ? 0.7907 0.9096 0.7025 -0.1708 -0.0116 0.0135  135 LEU C O   
3449 C CB  . LEU C 118 ? 0.8198 0.9447 0.7304 -0.1667 0.0059  0.0336  135 LEU C CB  
3450 C CG  . LEU C 118 ? 0.8282 0.9790 0.7504 -0.1752 0.0118  0.0397  135 LEU C CG  
3451 C CD1 . LEU C 118 ? 0.8111 0.9907 0.7383 -0.1640 0.0136  0.0373  135 LEU C CD1 
3452 C CD2 . LEU C 118 ? 0.8563 0.9883 0.7696 -0.1781 0.0178  0.0506  135 LEU C CD2 
3453 N N   . GLY C 119 ? 0.8353 0.9278 0.7234 -0.1456 -0.0081 0.0141  136 GLY C N   
3454 C CA  . GLY C 119 ? 0.8790 0.9489 0.7569 -0.1454 -0.0148 0.0073  136 GLY C CA  
3455 C C   . GLY C 119 ? 0.8999 0.9441 0.7613 -0.1334 -0.0114 0.0087  136 GLY C C   
3456 O O   . GLY C 119 ? 0.8202 0.8675 0.6798 -0.1251 -0.0046 0.0138  136 GLY C O   
3457 N N   . GLY C 120 ? 0.9522 0.9721 0.8024 -0.1329 -0.0164 0.0037  137 GLY C N   
3458 C CA  . GLY C 120 ? 0.9741 0.9726 0.8080 -0.1195 -0.0136 0.0026  137 GLY C CA  
3459 C C   . GLY C 120 ? 0.9944 0.9866 0.8149 -0.1101 -0.0188 -0.0068 137 GLY C C   
3460 O O   . GLY C 120 ? 0.9633 0.9687 0.7871 -0.1125 -0.0254 -0.0128 137 GLY C O   
3461 N N   . GLU C 121 ? 1.0151 0.9885 0.8197 -0.0983 -0.0158 -0.0084 138 GLU C N   
3462 C CA  . GLU C 121 ? 1.0453 1.0094 0.8323 -0.0873 -0.0191 -0.0166 138 GLU C CA  
3463 C C   . GLU C 121 ? 1.0115 0.9856 0.7930 -0.0766 -0.0101 -0.0128 138 GLU C C   
3464 O O   . GLU C 121 ? 1.0077 0.9756 0.7832 -0.0688 -0.0012 -0.0092 138 GLU C O   
3465 C CB  . GLU C 121 ? 1.0847 1.0211 0.8550 -0.0802 -0.0207 -0.0211 138 GLU C CB  
3466 N N   . HIS C 122 ? 0.9692 0.9592 0.7534 -0.0766 -0.0123 -0.0137 139 HIS C N   
3467 C CA  . HIS C 122 ? 0.9474 0.9420 0.7226 -0.0674 -0.0050 -0.0102 139 HIS C CA  
3468 C C   . HIS C 122 ? 0.9158 0.9229 0.6897 -0.0657 -0.0118 -0.0139 139 HIS C C   
3469 O O   . HIS C 122 ? 0.9212 0.9395 0.7060 -0.0724 -0.0212 -0.0189 139 HIS C O   
3470 C CB  . HIS C 122 ? 0.9503 0.9543 0.7378 -0.0707 0.0047  -0.0009 139 HIS C CB  
3471 C CG  . HIS C 122 ? 0.9940 1.0160 0.8007 -0.0805 0.0021  0.0021  139 HIS C CG  
3472 N ND1 . HIS C 122 ? 1.0146 1.0385 0.8345 -0.0904 -0.0003 0.0038  139 HIS C ND1 
3473 C CD2 . HIS C 122 ? 1.0106 1.0485 0.8233 -0.0811 0.0020  0.0041  139 HIS C CD2 
3474 C CE1 . HIS C 122 ? 1.0412 1.0837 0.8751 -0.0972 -0.0008 0.0070  139 HIS C CE1 
3475 N NE2 . HIS C 122 ? 1.0449 1.0970 0.8753 -0.0910 0.0002  0.0066  139 HIS C NE2 
3476 N N   . ARG C 123 ? 0.9420 0.9475 0.7025 -0.0567 -0.0071 -0.0114 140 ARG C N   
3477 C CA  . ARG C 123 ? 1.0264 1.0386 0.7786 -0.0500 -0.0147 -0.0159 140 ARG C CA  
3478 C C   . ARG C 123 ? 1.0476 1.0740 0.8081 -0.0506 -0.0120 -0.0108 140 ARG C C   
3479 O O   . ARG C 123 ? 1.1076 1.1320 0.8536 -0.0410 -0.0146 -0.0121 140 ARG C O   
3480 C CB  . ARG C 123 ? 1.1015 1.0936 0.8230 -0.0363 -0.0137 -0.0183 140 ARG C CB  
3481 C CG  . ARG C 123 ? 1.1330 1.1136 0.8420 -0.0319 -0.0221 -0.0276 140 ARG C CG  
3482 C CD  . ARG C 123 ? 1.1455 1.1346 0.8502 -0.0268 -0.0374 -0.0376 140 ARG C CD  
3483 N N   . LEU C 124 ? 1.0047 1.0433 0.7860 -0.0606 -0.0076 -0.0054 141 LEU C N   
3484 C CA  . LEU C 124 ? 0.9644 1.0176 0.7547 -0.0614 -0.0062 -0.0017 141 LEU C CA  
3485 C C   . LEU C 124 ? 0.9618 1.0382 0.7756 -0.0714 -0.0111 -0.0034 141 LEU C C   
3486 O O   . LEU C 124 ? 0.9543 1.0378 0.7824 -0.0797 -0.0061 0.0021  141 LEU C O   
3487 C CB  . LEU C 124 ? 0.9534 1.0001 0.7453 -0.0641 0.0044  0.0065  141 LEU C CB  
3488 C CG  . LEU C 124 ? 0.9656 0.9916 0.7375 -0.0579 0.0121  0.0097  141 LEU C CG  
3489 C CD1 . LEU C 124 ? 0.9417 0.9675 0.7222 -0.0637 0.0217  0.0168  141 LEU C CD1 
3490 C CD2 . LEU C 124 ? 0.9526 0.9691 0.7031 -0.0477 0.0092  0.0081  141 LEU C CD2 
3491 N N   . ASN C 125 ? 0.9475 1.0365 0.7649 -0.0707 -0.0209 -0.0113 142 ASN C N   
3492 C CA  . ASN C 125 ? 0.9249 1.0380 0.7656 -0.0824 -0.0250 -0.0132 142 ASN C CA  
3493 C C   . ASN C 125 ? 0.8428 0.9801 0.6945 -0.0809 -0.0234 -0.0111 142 ASN C C   
3494 O O   . ASN C 125 ? 0.7963 0.9358 0.6370 -0.0682 -0.0257 -0.0133 142 ASN C O   
3495 C CB  . ASN C 125 ? 0.9681 1.0897 0.8118 -0.0839 -0.0366 -0.0236 142 ASN C CB  
3496 C CG  . ASN C 125 ? 1.0203 1.1165 0.8527 -0.0861 -0.0389 -0.0265 142 ASN C CG  
3497 O OD1 . ASN C 125 ? 1.0942 1.1808 0.9109 -0.0772 -0.0463 -0.0342 142 ASN C OD1 
3498 N ND2 . ASN C 125 ? 1.0194 1.1032 0.8571 -0.0960 -0.0329 -0.0207 142 ASN C ND2 
3499 N N   . ASN C 126 ? 0.7998 0.9523 0.6703 -0.0929 -0.0194 -0.0064 143 ASN C N   
3500 C CA  . ASN C 126 ? 0.7801 0.9562 0.6611 -0.0920 -0.0162 -0.0036 143 ASN C CA  
3501 C C   . ASN C 126 ? 0.7673 0.9309 0.6351 -0.0822 -0.0107 0.0013  143 ASN C C   
3502 O O   . ASN C 126 ? 0.7750 0.9530 0.6427 -0.0745 -0.0111 0.0003  143 ASN C O   
3503 C CB  . ASN C 126 ? 0.7743 0.9804 0.6639 -0.0866 -0.0240 -0.0120 143 ASN C CB  
3504 C CG  . ASN C 126 ? 0.7708 0.9938 0.6774 -0.0992 -0.0301 -0.0178 143 ASN C CG  
3505 O OD1 . ASN C 126 ? 0.7713 0.9946 0.6903 -0.1155 -0.0263 -0.0134 143 ASN C OD1 
3506 N ND2 . ASN C 126 ? 0.7963 1.0321 0.7024 -0.0916 -0.0404 -0.0281 143 ASN C ND2 
3507 N N   . TYR C 127 ? 0.7384 0.8761 0.5956 -0.0825 -0.0056 0.0061  144 TYR C N   
3508 C CA  . TYR C 127 ? 0.7353 0.8613 0.5832 -0.0772 -0.0001 0.0110  144 TYR C CA  
3509 C C   . TYR C 127 ? 0.7409 0.8818 0.6012 -0.0824 0.0037  0.0158  144 TYR C C   
3510 O O   . TYR C 127 ? 0.7567 0.9032 0.6289 -0.0925 0.0062  0.0195  144 TYR C O   
3511 C CB  . TYR C 127 ? 0.7182 0.8201 0.5577 -0.0789 0.0051  0.0148  144 TYR C CB  
3512 C CG  . TYR C 127 ? 0.7182 0.8092 0.5507 -0.0763 0.0107  0.0193  144 TYR C CG  
3513 C CD1 . TYR C 127 ? 0.7488 0.8249 0.5635 -0.0682 0.0111  0.0184  144 TYR C CD1 
3514 C CD2 . TYR C 127 ? 0.7289 0.8228 0.5717 -0.0823 0.0152  0.0244  144 TYR C CD2 
3515 C CE1 . TYR C 127 ? 0.7476 0.8123 0.5568 -0.0686 0.0161  0.0224  144 TYR C CE1 
3516 C CE2 . TYR C 127 ? 0.7069 0.7927 0.5455 -0.0812 0.0191  0.0273  144 TYR C CE2 
3517 C CZ  . TYR C 127 ? 0.7269 0.7983 0.5498 -0.0756 0.0197  0.0262  144 TYR C CZ  
3518 O OH  . TYR C 127 ? 0.7550 0.8176 0.5750 -0.0774 0.0234  0.0289  144 TYR C OH  
3519 N N   . ARG C 128 ? 0.7135 0.8864 0.5944 -0.0564 -0.0031 0.0278  145 ARG C N   
3520 C CA  . ARG C 128 ? 0.7170 0.8976 0.6008 -0.0596 0.0004  0.0316  145 ARG C CA  
3521 C C   . ARG C 128 ? 0.6936 0.8737 0.5736 -0.0530 0.0015  0.0325  145 ARG C C   
3522 O O   . ARG C 128 ? 0.7093 0.8911 0.5887 -0.0479 -0.0009 0.0294  145 ARG C O   
3523 C CB  . ARG C 128 ? 0.7562 0.9547 0.6486 -0.0634 0.0006  0.0285  145 ARG C CB  
3524 C CG  . ARG C 128 ? 0.7746 0.9856 0.6695 -0.0679 0.0050  0.0318  145 ARG C CG  
3525 C CD  . ARG C 128 ? 0.7905 1.0205 0.6948 -0.0754 0.0061  0.0301  145 ARG C CD  
3526 N NE  . ARG C 128 ? 0.7920 1.0424 0.7031 -0.0701 0.0060  0.0228  145 ARG C NE  
3527 C CZ  . ARG C 128 ? 0.8374 1.0937 0.7543 -0.0659 0.0016  0.0156  145 ARG C CZ  
3528 N NH1 . ARG C 128 ? 0.8322 1.0764 0.7481 -0.0665 -0.0027 0.0147  145 ARG C NH1 
3529 N NH2 . ARG C 128 ? 0.8383 1.1131 0.7618 -0.0598 0.0007  0.0085  145 ARG C NH2 
3530 N N   . SER C 129 ? 0.6569 0.8331 0.5341 -0.0533 0.0041  0.0370  146 SER C N   
3531 C CA  . SER C 129 ? 0.6385 0.8139 0.5132 -0.0480 0.0043  0.0378  146 SER C CA  
3532 C C   . SER C 129 ? 0.6425 0.8243 0.5177 -0.0491 0.0064  0.0399  146 SER C C   
3533 O O   . SER C 129 ? 0.6492 0.8334 0.5243 -0.0542 0.0085  0.0431  146 SER C O   
3534 C CB  . SER C 129 ? 0.6453 0.8096 0.5153 -0.0454 0.0044  0.0404  146 SER C CB  
3535 O OG  . SER C 129 ? 0.6516 0.8104 0.5204 -0.0474 0.0059  0.0440  146 SER C OG  
3536 N N   . VAL C 130 ? 0.6381 0.8219 0.5132 -0.0444 0.0050  0.0383  147 VAL C N   
3537 C CA  . VAL C 130 ? 0.6421 0.8323 0.5168 -0.0438 0.0060  0.0386  147 VAL C CA  
3538 C C   . VAL C 130 ? 0.6399 0.8216 0.5125 -0.0403 0.0041  0.0404  147 VAL C C   
3539 O O   . VAL C 130 ? 0.6658 0.8425 0.5391 -0.0375 0.0011  0.0391  147 VAL C O   
3540 C CB  . VAL C 130 ? 0.6588 0.8625 0.5373 -0.0405 0.0044  0.0318  147 VAL C CB  
3541 C CG1 . VAL C 130 ? 0.6708 0.8817 0.5475 -0.0385 0.0049  0.0305  147 VAL C CG1 
3542 C CG2 . VAL C 130 ? 0.6439 0.8605 0.5268 -0.0445 0.0066  0.0295  147 VAL C CG2 
3543 N N   . THR C 131 ? 0.6030 0.7831 0.4732 -0.0412 0.0053  0.0440  148 THR C N   
3544 C CA  . THR C 131 ? 0.6105 0.7851 0.4806 -0.0386 0.0033  0.0454  148 THR C CA  
3545 C C   . THR C 131 ? 0.6198 0.8005 0.4889 -0.0371 0.0019  0.0438  148 THR C C   
3546 O O   . THR C 131 ? 0.6305 0.8181 0.4965 -0.0391 0.0042  0.0446  148 THR C O   
3547 C CB  . THR C 131 ? 0.6107 0.7779 0.4798 -0.0395 0.0047  0.0500  148 THR C CB  
3548 O OG1 . THR C 131 ? 0.6137 0.7767 0.4827 -0.0400 0.0057  0.0498  148 THR C OG1 
3549 C CG2 . THR C 131 ? 0.6215 0.7867 0.4927 -0.0376 0.0029  0.0513  148 THR C CG2 
3550 N N   . SER C 132 ? 0.5984 0.7766 0.4695 -0.0342 -0.0020 0.0417  149 SER C N   
3551 C CA  . SER C 132 ? 0.5958 0.7793 0.4658 -0.0318 -0.0047 0.0385  149 SER C CA  
3552 C C   . SER C 132 ? 0.5829 0.7601 0.4558 -0.0308 -0.0092 0.0392  149 SER C C   
3553 O O   . SER C 132 ? 0.5842 0.7546 0.4609 -0.0310 -0.0124 0.0393  149 SER C O   
3554 C CB  . SER C 132 ? 0.6206 0.8113 0.4918 -0.0280 -0.0073 0.0304  149 SER C CB  
3555 O OG  . SER C 132 ? 0.6115 0.7935 0.4869 -0.0255 -0.0131 0.0279  149 SER C OG  
3556 N N   . VAL C 133 ? 0.5820 0.7619 0.4529 -0.0303 -0.0102 0.0399  150 VAL C N   
3557 C CA  . VAL C 133 ? 0.5841 0.7599 0.4591 -0.0300 -0.0150 0.0403  150 VAL C CA  
3558 C C   . VAL C 133 ? 0.6074 0.7856 0.4823 -0.0264 -0.0215 0.0327  150 VAL C C   
3559 O O   . VAL C 133 ? 0.6213 0.8081 0.4904 -0.0237 -0.0208 0.0288  150 VAL C O   
3560 C CB  . VAL C 133 ? 0.5713 0.7484 0.4452 -0.0309 -0.0134 0.0452  150 VAL C CB  
3561 C CG1 . VAL C 133 ? 0.5819 0.7571 0.4630 -0.0316 -0.0177 0.0462  150 VAL C CG1 
3562 C CG2 . VAL C 133 ? 0.5696 0.7441 0.4423 -0.0328 -0.0079 0.0505  150 VAL C CG2 
3563 N N   . ASN C 134 ? 0.6270 0.7978 0.5079 -0.0265 -0.0281 0.0306  151 ASN C N   
3564 C CA  . ASN C 134 ? 0.6571 0.8270 0.5387 -0.0221 -0.0363 0.0218  151 ASN C CA  
3565 C C   . ASN C 134 ? 0.7028 0.8657 0.5907 -0.0242 -0.0441 0.0218  151 ASN C C   
3566 O O   . ASN C 134 ? 0.7512 0.9053 0.6454 -0.0290 -0.0466 0.0267  151 ASN C O   
3567 C CB  . ASN C 134 ? 0.6580 0.8226 0.5412 -0.0193 -0.0399 0.0168  151 ASN C CB  
3568 C CG  . ASN C 134 ? 0.6773 0.8520 0.5559 -0.0168 -0.0334 0.0145  151 ASN C CG  
3569 O OD1 . ASN C 134 ? 0.7054 0.8923 0.5799 -0.0124 -0.0325 0.0078  151 ASN C OD1 
3570 N ND2 . ASN C 134 ? 0.6492 0.8211 0.5287 -0.0199 -0.0289 0.0199  151 ASN C ND2 
3571 N N   . GLU C 135 ? 0.7443 0.9121 0.6301 -0.0210 -0.0485 0.0163  152 GLU C N   
3572 C CA  . GLU C 135 ? 0.7673 0.9305 0.6598 -0.0234 -0.0564 0.0161  152 GLU C CA  
3573 C C   . GLU C 135 ? 0.7772 0.9296 0.6745 -0.0216 -0.0682 0.0080  152 GLU C C   
3574 O O   . GLU C 135 ? 0.7604 0.9129 0.6532 -0.0146 -0.0715 -0.0014 152 GLU C O   
3575 C CB  . GLU C 135 ? 0.7954 0.9685 0.6829 -0.0205 -0.0568 0.0137  152 GLU C CB  
3576 C CG  . GLU C 135 ? 0.8266 0.9997 0.7221 -0.0247 -0.0607 0.0178  152 GLU C CG  
3577 C CD  . GLU C 135 ? 0.8242 1.0068 0.7130 -0.0209 -0.0618 0.0158  152 GLU C CD  
3578 O OE1 . GLU C 135 ? 0.8382 1.0242 0.7199 -0.0154 -0.0669 0.0069  152 GLU C OE1 
3579 O OE2 . GLU C 135 ? 0.8025 0.9896 0.6926 -0.0226 -0.0581 0.0228  152 GLU C OE2 
3580 N N   . PHE C 136 ? 0.7887 0.9322 0.6955 -0.0278 -0.0750 0.0115  153 PHE C N   
3581 C CA  . PHE C 136 ? 0.8093 0.9380 0.7219 -0.0280 -0.0885 0.0056  153 PHE C CA  
3582 C C   . PHE C 136 ? 0.8324 0.9591 0.7536 -0.0331 -0.0967 0.0057  153 PHE C C   
3583 O O   . PHE C 136 ? 0.7955 0.9308 0.7214 -0.0391 -0.0913 0.0138  153 PHE C O   
3584 C CB  . PHE C 136 ? 0.8133 0.9284 0.7302 -0.0340 -0.0898 0.0130  153 PHE C CB  
3585 C CG  . PHE C 136 ? 0.8017 0.9156 0.7118 -0.0279 -0.0862 0.0102  153 PHE C CG  
3586 C CD1 . PHE C 136 ? 0.7744 0.8986 0.6796 -0.0285 -0.0733 0.0164  153 PHE C CD1 
3587 C CD2 . PHE C 136 ? 0.7997 0.9028 0.7091 -0.0208 -0.0965 0.0001  153 PHE C CD2 
3588 C CE1 . PHE C 136 ? 0.7579 0.8827 0.6581 -0.0233 -0.0704 0.0133  153 PHE C CE1 
3589 C CE2 . PHE C 136 ? 0.8071 0.9119 0.7119 -0.0145 -0.0935 -0.0034 153 PHE C CE2 
3590 C CZ  . PHE C 136 ? 0.7756 0.8919 0.6760 -0.0163 -0.0803 0.0035  153 PHE C CZ  
3591 N N   . VAL C 137 ? 0.9112 1.0266 0.8352 -0.0303 -0.1106 -0.0040 154 VAL C N   
3592 C CA  . VAL C 137 ? 0.9724 1.0841 0.9057 -0.0352 -0.1213 -0.0059 154 VAL C CA  
3593 C C   . VAL C 137 ? 1.0378 1.1273 0.9801 -0.0412 -0.1353 -0.0059 154 VAL C C   
3594 O O   . VAL C 137 ? 1.1252 1.2014 1.0638 -0.0343 -0.1433 -0.0145 154 VAL C O   
3595 C CB  . VAL C 137 ? 0.9869 1.1054 0.9140 -0.0254 -0.1278 -0.0202 154 VAL C CB  
3596 C CG1 . VAL C 137 ? 1.0087 1.1260 0.9459 -0.0309 -0.1382 -0.0216 154 VAL C CG1 
3597 C CG2 . VAL C 137 ? 0.9791 1.1172 0.8941 -0.0191 -0.1149 -0.0198 154 VAL C CG2 
3598 N N   . VAL C 138 ? 1.0987 1.1845 1.0533 -0.0540 -0.1391 0.0034  155 VAL C N   
3599 C CA  . VAL C 138 ? 1.1553 1.2185 1.1191 -0.0624 -0.1537 0.0058  155 VAL C CA  
3600 C C   . VAL C 138 ? 1.1786 1.2322 1.1476 -0.0596 -0.1710 -0.0072 155 VAL C C   
3601 O O   . VAL C 138 ? 1.1707 1.2319 1.1491 -0.0663 -0.1744 -0.0060 155 VAL C O   
3602 C CB  . VAL C 138 ? 1.1839 1.2492 1.1590 -0.0796 -0.1498 0.0232  155 VAL C CB  
3603 C CG1 . VAL C 138 ? 1.2167 1.2563 1.1992 -0.0899 -0.1649 0.0282  155 VAL C CG1 
3604 C CG2 . VAL C 138 ? 1.1674 1.2449 1.1363 -0.0810 -0.1325 0.0344  155 VAL C CG2 
3605 N N   . ARG C 146 ? 1.1762 1.3006 1.1646 -0.0917 -0.1192 0.0426  163 ARG C N   
3606 C CA  . ARG C 146 ? 1.1832 1.3176 1.1702 -0.0826 -0.1217 0.0318  163 ARG C CA  
3607 C C   . ARG C 146 ? 1.1324 1.2711 1.1026 -0.0684 -0.1132 0.0254  163 ARG C C   
3608 O O   . ARG C 146 ? 1.1684 1.2977 1.1294 -0.0594 -0.1195 0.0146  163 ARG C O   
3609 C CB  . ARG C 146 ? 1.2145 1.3706 1.2141 -0.0887 -0.1174 0.0371  163 ARG C CB  
3610 C CG  . ARG C 146 ? 1.2465 1.4139 1.2451 -0.0802 -0.1208 0.0278  163 ARG C CG  
3611 C CD  . ARG C 146 ? 1.2801 1.4351 1.2809 -0.0787 -0.1377 0.0165  163 ARG C CD  
3612 N NE  . ARG C 146 ? 1.2538 1.4031 1.2374 -0.0643 -0.1397 0.0045  163 ARG C NE  
3613 C CZ  . ARG C 146 ? 1.2277 1.3706 1.2086 -0.0585 -0.1529 -0.0083 163 ARG C CZ  
3614 N NH1 . ARG C 146 ? 1.2390 1.3774 1.2341 -0.0660 -0.1667 -0.0113 163 ARG C NH1 
3615 N NH2 . ARG C 146 ? 1.1922 1.3346 1.1564 -0.0454 -0.1525 -0.0187 163 ARG C NH2 
3616 N N   . VAL C 147 ? 1.0282 1.1817 0.9947 -0.0667 -0.0993 0.0317  164 VAL C N   
3617 C CA  . VAL C 147 ? 0.9429 1.1002 0.8944 -0.0559 -0.0906 0.0282  164 VAL C CA  
3618 C C   . VAL C 147 ? 0.8470 1.0093 0.7959 -0.0580 -0.0776 0.0375  164 VAL C C   
3619 O O   . VAL C 147 ? 0.7815 0.9552 0.7385 -0.0635 -0.0718 0.0449  164 VAL C O   
3620 C CB  . VAL C 147 ? 0.9635 1.1338 0.9106 -0.0488 -0.0895 0.0237  164 VAL C CB  
3621 C CG1 . VAL C 147 ? 0.9508 1.1262 0.8838 -0.0412 -0.0788 0.0246  164 VAL C CG1 
3622 C CG2 . VAL C 147 ? 1.0200 1.1857 0.9645 -0.0439 -0.1020 0.0121  164 VAL C CG2 
3623 N N   . TYR C 148 ? 0.7900 0.9454 0.7280 -0.0531 -0.0733 0.0361  165 TYR C N   
3624 C CA  . TYR C 148 ? 0.7592 0.9168 0.6943 -0.0552 -0.0628 0.0439  165 TYR C CA  
3625 C C   . TYR C 148 ? 0.7401 0.8937 0.6629 -0.0478 -0.0583 0.0401  165 TYR C C   
3626 O O   . TYR C 148 ? 0.8124 0.9594 0.7304 -0.0425 -0.0644 0.0320  165 TYR C O   
3627 C CB  . TYR C 148 ? 0.7216 0.8715 0.6636 -0.0649 -0.0653 0.0513  165 TYR C CB  
3628 C CG  . TYR C 148 ? 0.7097 0.8407 0.6483 -0.0642 -0.0746 0.0478  165 TYR C CG  
3629 C CD1 . TYR C 148 ? 0.7126 0.8322 0.6567 -0.0656 -0.0882 0.0422  165 TYR C CD1 
3630 C CD2 . TYR C 148 ? 0.7085 0.8324 0.6393 -0.0619 -0.0712 0.0495  165 TYR C CD2 
3631 C CE1 . TYR C 148 ? 0.7209 0.8215 0.6625 -0.0636 -0.0984 0.0380  165 TYR C CE1 
3632 C CE2 . TYR C 148 ? 0.7310 0.8374 0.6596 -0.0602 -0.0810 0.0459  165 TYR C CE2 
3633 C CZ  . TYR C 148 ? 0.7369 0.8311 0.6710 -0.0606 -0.0948 0.0399  165 TYR C CZ  
3634 O OH  . TYR C 148 ? 0.7685 0.8435 0.7008 -0.0573 -0.1064 0.0349  165 TYR C OH  
3635 N N   . SER C 149 ? 0.7141 0.8731 0.6326 -0.0474 -0.0482 0.0451  166 SER C N   
3636 C CA  . SER C 149 ? 0.7302 0.8869 0.6388 -0.0420 -0.0438 0.0423  166 SER C CA  
3637 C C   . SER C 149 ? 0.7044 0.8545 0.6122 -0.0452 -0.0413 0.0470  166 SER C C   
3638 O O   . SER C 149 ? 0.6806 0.8307 0.5935 -0.0519 -0.0400 0.0543  166 SER C O   
3639 C CB  . SER C 149 ? 0.7109 0.8768 0.6134 -0.0384 -0.0354 0.0434  166 SER C CB  
3640 O OG  . SER C 149 ? 0.7048 0.8770 0.6084 -0.0366 -0.0376 0.0420  166 SER C OG  
3641 N N   . VAL C 150 ? 0.6654 0.8119 0.5665 -0.0404 -0.0409 0.0426  167 VAL C N   
3642 C CA  . VAL C 150 ? 0.6573 0.7993 0.5556 -0.0416 -0.0380 0.0461  167 VAL C CA  
3643 C C   . VAL C 150 ? 0.6463 0.7960 0.5384 -0.0380 -0.0295 0.0451  167 VAL C C   
3644 O O   . VAL C 150 ? 0.6490 0.8023 0.5373 -0.0330 -0.0294 0.0388  167 VAL C O   
3645 C CB  . VAL C 150 ? 0.6486 0.7791 0.5460 -0.0387 -0.0467 0.0412  167 VAL C CB  
3646 C CG1 . VAL C 150 ? 0.6567 0.7839 0.5500 -0.0388 -0.0438 0.0445  167 VAL C CG1 
3647 C CG2 . VAL C 150 ? 0.6671 0.7857 0.5708 -0.0435 -0.0569 0.0433  167 VAL C CG2 
3648 N N   . VAL C 151 ? 0.6382 0.7914 0.5296 -0.0409 -0.0225 0.0511  168 VAL C N   
3649 C CA  . VAL C 151 ? 0.6464 0.8040 0.5327 -0.0387 -0.0158 0.0507  168 VAL C CA  
3650 C C   . VAL C 151 ? 0.6686 0.8215 0.5519 -0.0381 -0.0166 0.0498  168 VAL C C   
3651 O O   . VAL C 151 ? 0.7218 0.8700 0.6054 -0.0412 -0.0179 0.0542  168 VAL C O   
3652 C CB  . VAL C 151 ? 0.6397 0.8019 0.5266 -0.0406 -0.0096 0.0556  168 VAL C CB  
3653 C CG1 . VAL C 151 ? 0.6196 0.7828 0.5014 -0.0387 -0.0044 0.0548  168 VAL C CG1 
3654 C CG2 . VAL C 151 ? 0.6431 0.8105 0.5339 -0.0402 -0.0098 0.0562  168 VAL C CG2 
3655 N N   . LEU C 152 ? 0.6173 0.7730 0.4978 -0.0344 -0.0162 0.0444  169 LEU C N   
3656 C CA  . LEU C 152 ? 0.6189 0.7728 0.4976 -0.0330 -0.0169 0.0427  169 LEU C CA  
3657 C C   . LEU C 152 ? 0.6297 0.7889 0.5056 -0.0339 -0.0101 0.0437  169 LEU C C   
3658 O O   . LEU C 152 ? 0.5924 0.7573 0.4674 -0.0341 -0.0062 0.0431  169 LEU C O   
3659 C CB  . LEU C 152 ? 0.6198 0.7759 0.4995 -0.0278 -0.0218 0.0345  169 LEU C CB  
3660 C CG  . LEU C 152 ? 0.6448 0.7922 0.5274 -0.0255 -0.0312 0.0315  169 LEU C CG  
3661 C CD1 . LEU C 152 ? 0.6456 0.7994 0.5295 -0.0184 -0.0354 0.0208  169 LEU C CD1 
3662 C CD2 . LEU C 152 ? 0.6732 0.8079 0.5557 -0.0272 -0.0372 0.0357  169 LEU C CD2 
3663 N N   . GLU C 153 ? 0.6479 0.8040 0.5217 -0.0348 -0.0096 0.0456  170 GLU C N   
3664 C CA  . GLU C 153 ? 0.6333 0.7929 0.5049 -0.0354 -0.0050 0.0450  170 GLU C CA  
3665 C C   . GLU C 153 ? 0.6273 0.7857 0.4978 -0.0339 -0.0080 0.0426  170 GLU C C   
3666 O O   . GLU C 153 ? 0.6846 0.8371 0.5526 -0.0340 -0.0112 0.0455  170 GLU C O   
3667 C CB  . GLU C 153 ? 0.6293 0.7877 0.4990 -0.0374 -0.0007 0.0493  170 GLU C CB  
3668 C CG  . GLU C 153 ? 0.6390 0.7984 0.5067 -0.0378 0.0024  0.0478  170 GLU C CG  
3669 C CD  . GLU C 153 ? 0.6597 0.8179 0.5268 -0.0378 0.0057  0.0497  170 GLU C CD  
3670 O OE1 . GLU C 153 ? 0.6676 0.8267 0.5368 -0.0375 0.0061  0.0517  170 GLU C OE1 
3671 O OE2 . GLU C 153 ? 0.6845 0.8408 0.5492 -0.0375 0.0068  0.0481  170 GLU C OE2 
3672 N N   . SER C 154 ? 0.6058 0.7709 0.4781 -0.0329 -0.0075 0.0379  171 SER C N   
3673 C CA  . SER C 154 ? 0.6093 0.7754 0.4817 -0.0310 -0.0107 0.0347  171 SER C CA  
3674 C C   . SER C 154 ? 0.5981 0.7684 0.4702 -0.0339 -0.0067 0.0340  171 SER C C   
3675 O O   . SER C 154 ? 0.5666 0.7385 0.4390 -0.0371 -0.0022 0.0357  171 SER C O   
3676 C CB  . SER C 154 ? 0.6014 0.7749 0.4789 -0.0268 -0.0147 0.0277  171 SER C CB  
3677 O OG  . SER C 154 ? 0.6029 0.7885 0.4835 -0.0286 -0.0098 0.0252  171 SER C OG  
3678 N N   . TYR C 155 ? 0.6034 0.7744 0.4751 -0.0328 -0.0096 0.0314  172 TYR C N   
3679 C CA  . TYR C 155 ? 0.6388 0.8132 0.5113 -0.0358 -0.0074 0.0296  172 TYR C CA  
3680 C C   . TYR C 155 ? 0.6275 0.8069 0.5024 -0.0339 -0.0120 0.0247  172 TYR C C   
3681 O O   . TYR C 155 ? 0.5957 0.7731 0.4695 -0.0294 -0.0175 0.0234  172 TYR C O   
3682 C CB  . TYR C 155 ? 0.6654 0.8317 0.5317 -0.0372 -0.0052 0.0329  172 TYR C CB  
3683 C CG  . TYR C 155 ? 0.7023 0.8635 0.5618 -0.0345 -0.0081 0.0346  172 TYR C CG  
3684 C CD1 . TYR C 155 ? 0.7240 0.8809 0.5804 -0.0338 -0.0084 0.0396  172 TYR C CD1 
3685 C CD2 . TYR C 155 ? 0.7263 0.8875 0.5821 -0.0334 -0.0112 0.0319  172 TYR C CD2 
3686 C CE1 . TYR C 155 ? 0.7593 0.9122 0.6084 -0.0331 -0.0110 0.0432  172 TYR C CE1 
3687 C CE2 . TYR C 155 ? 0.7360 0.8932 0.5833 -0.0314 -0.0140 0.0347  172 TYR C CE2 
3688 C CZ  . TYR C 155 ? 0.7486 0.9018 0.5922 -0.0317 -0.0136 0.0410  172 TYR C CZ  
3689 O OH  . TYR C 155 ? 0.7696 0.9195 0.6039 -0.0315 -0.0162 0.0458  172 TYR C OH  
3690 N N   . ILE C 156 ? 0.6398 0.8249 0.5185 -0.0378 -0.0106 0.0221  173 ILE C N   
3691 C CA  . ILE C 156 ? 0.6613 0.8511 0.5425 -0.0369 -0.0151 0.0172  173 ILE C CA  
3692 C C   . ILE C 156 ? 0.6454 0.8292 0.5233 -0.0407 -0.0144 0.0172  173 ILE C C   
3693 O O   . ILE C 156 ? 0.6231 0.8030 0.5011 -0.0452 -0.0106 0.0197  173 ILE C O   
3694 C CB  . ILE C 156 ? 0.6791 0.8861 0.5715 -0.0378 -0.0158 0.0117  173 ILE C CB  
3695 C CG1 . ILE C 156 ? 0.7245 0.9377 0.6209 -0.0364 -0.0215 0.0059  173 ILE C CG1 
3696 C CG2 . ILE C 156 ? 0.6966 0.9108 0.5941 -0.0458 -0.0099 0.0136  173 ILE C CG2 
3697 C CD1 . ILE C 156 ? 0.7332 0.9657 0.6414 -0.0337 -0.0241 -0.0009 173 ILE C CD1 
3698 N N   . VAL C 157 ? 0.6822 0.8639 0.5561 -0.0381 -0.0192 0.0142  174 VAL C N   
3699 C CA  . VAL C 157 ? 0.7166 0.8929 0.5872 -0.0406 -0.0200 0.0121  174 VAL C CA  
3700 C C   . VAL C 157 ? 0.7304 0.9100 0.6003 -0.0384 -0.0267 0.0064  174 VAL C C   
3701 O O   . VAL C 157 ? 0.7365 0.9197 0.6052 -0.0337 -0.0310 0.0056  174 VAL C O   
3702 C CB  . VAL C 157 ? 0.7233 0.8888 0.5831 -0.0383 -0.0171 0.0154  174 VAL C CB  
3703 C CG1 . VAL C 157 ? 0.7455 0.9092 0.5952 -0.0330 -0.0196 0.0172  174 VAL C CG1 
3704 C CG2 . VAL C 157 ? 0.7304 0.8897 0.5885 -0.0401 -0.0177 0.0117  174 VAL C CG2 
3705 N N   . ASP C 158 ? 0.7490 0.9266 0.6199 -0.0416 -0.0288 0.0021  175 ASP C N   
3706 C CA  . ASP C 158 ? 0.7778 0.9586 0.6477 -0.0396 -0.0359 -0.0040 175 ASP C CA  
3707 C C   . ASP C 158 ? 0.7683 0.9415 0.6223 -0.0332 -0.0379 -0.0034 175 ASP C C   
3708 O O   . ASP C 158 ? 0.7069 0.8725 0.5525 -0.0322 -0.0339 -0.0012 175 ASP C O   
3709 C CB  . ASP C 158 ? 0.8152 0.9955 0.6920 -0.0459 -0.0387 -0.0093 175 ASP C CB  
3710 C CG  . ASP C 158 ? 0.8207 1.0123 0.7135 -0.0541 -0.0372 -0.0090 175 ASP C CG  
3711 O OD1 . ASP C 158 ? 0.8303 1.0356 0.7303 -0.0527 -0.0367 -0.0091 175 ASP C OD1 
3712 O OD2 . ASP C 158 ? 0.8224 1.0096 0.7206 -0.0620 -0.0368 -0.0089 175 ASP C OD2 
3713 N N   . ILE C 159 ? 0.7978 0.9749 0.6478 -0.0288 -0.0444 -0.0055 176 ILE C N   
3714 C CA  . ILE C 159 ? 0.8226 0.9947 0.6559 -0.0237 -0.0472 -0.0045 176 ILE C CA  
3715 C C   . ILE C 159 ? 0.8497 1.0211 0.6797 -0.0237 -0.0514 -0.0128 176 ILE C C   
3716 O O   . ILE C 159 ? 0.9099 1.0869 0.7474 -0.0246 -0.0582 -0.0191 176 ILE C O   
3717 C CB  . ILE C 159 ? 0.8312 1.0058 0.6605 -0.0188 -0.0544 -0.0027 176 ILE C CB  
3718 C CG1 . ILE C 159 ? 0.8142 0.9877 0.6479 -0.0181 -0.0524 0.0038  176 ILE C CG1 
3719 C CG2 . ILE C 159 ? 0.8402 1.0104 0.6499 -0.0147 -0.0575 -0.0003 176 ILE C CG2 
3720 C CD1 . ILE C 159 ? 0.8298 1.0059 0.6663 -0.0130 -0.0616 0.0028  176 ILE C CD1 
3721 N N   . PRO C 160 ? 0.8661 1.0318 0.6856 -0.0222 -0.0482 -0.0140 177 PRO C N   
3722 C CA  . PRO C 160 ? 0.9227 1.0870 0.7382 -0.0208 -0.0539 -0.0238 177 PRO C CA  
3723 C C   . PRO C 160 ? 0.9266 1.0955 0.7316 -0.0161 -0.0620 -0.0270 177 PRO C C   
3724 O O   . PRO C 160 ? 0.9128 1.0833 0.7061 -0.0125 -0.0618 -0.0202 177 PRO C O   
3725 C CB  . PRO C 160 ? 0.9271 1.0863 0.7319 -0.0176 -0.0487 -0.0250 177 PRO C CB  
3726 C CG  . PRO C 160 ? 0.9079 1.0665 0.7142 -0.0188 -0.0399 -0.0153 177 PRO C CG  
3727 C CD  . PRO C 160 ? 0.8772 1.0396 0.6879 -0.0205 -0.0405 -0.0079 177 PRO C CD  
3728 N N   . GLN C 161 ? 0.9480 1.1184 0.7572 -0.0166 -0.0701 -0.0368 178 GLN C N   
3729 C CA  . GLN C 161 ? 1.0153 1.1899 0.8128 -0.0113 -0.0789 -0.0413 178 GLN C CA  
3730 C C   . GLN C 161 ? 1.0224 1.1955 0.7971 -0.0053 -0.0760 -0.0400 178 GLN C C   
3731 O O   . GLN C 161 ? 0.9893 1.1590 0.7600 -0.0042 -0.0723 -0.0452 178 GLN C O   
3732 C CB  . GLN C 161 ? 1.0294 1.2053 0.8353 -0.0133 -0.0881 -0.0536 178 GLN C CB  
3733 N N   . GLY C 162 ? 1.0215 1.1976 0.7814 -0.0016 -0.0776 -0.0327 179 GLY C N   
3734 C CA  . GLY C 162 ? 1.0616 1.2401 0.7988 0.0026  -0.0738 -0.0291 179 GLY C CA  
3735 C C   . GLY C 162 ? 1.0722 1.2503 0.8040 0.0007  -0.0651 -0.0151 179 GLY C C   
3736 O O   . GLY C 162 ? 1.0941 1.2770 0.8082 0.0025  -0.0604 -0.0104 179 GLY C O   
3737 N N   . ASN C 163 ? 1.0483 1.2222 0.7956 -0.0033 -0.0629 -0.0088 180 ASN C N   
3738 C CA  . ASN C 163 ? 1.0092 1.1809 0.7535 -0.0057 -0.0567 0.0042  180 ASN C CA  
3739 C C   . ASN C 163 ? 0.9878 1.1550 0.7419 -0.0067 -0.0624 0.0097  180 ASN C C   
3740 O O   . ASN C 163 ? 0.9992 1.1676 0.7659 -0.0058 -0.0688 0.0027  180 ASN C O   
3741 C CB  . ASN C 163 ? 0.9923 1.1634 0.7465 -0.0088 -0.0464 0.0049  180 ASN C CB  
3742 C CG  . ASN C 163 ? 0.9792 1.1538 0.7293 -0.0063 -0.0426 -0.0042 180 ASN C CG  
3743 O OD1 . ASN C 163 ? 1.0214 1.2022 0.7588 -0.0043 -0.0369 -0.0022 180 ASN C OD1 
3744 N ND2 . ASN C 163 ? 0.9621 1.1332 0.7235 -0.0065 -0.0462 -0.0148 180 ASN C ND2 
3745 N N   . THR C 164 ? 0.9635 1.1262 0.7127 -0.0084 -0.0604 0.0216  181 THR C N   
3746 C CA  . THR C 164 ? 0.9604 1.1170 0.7190 -0.0081 -0.0663 0.0261  181 THR C CA  
3747 C C   . THR C 164 ? 0.9679 1.1227 0.7427 -0.0114 -0.0596 0.0276  181 THR C C   
3748 O O   . THR C 164 ? 0.9481 1.1052 0.7260 -0.0146 -0.0502 0.0274  181 THR C O   
3749 C CB  . THR C 164 ? 0.9690 1.1179 0.7120 -0.0079 -0.0719 0.0386  181 THR C CB  
3750 O OG1 . THR C 164 ? 1.0164 1.1660 0.7487 -0.0126 -0.0629 0.0480  181 THR C OG1 
3751 C CG2 . THR C 164 ? 1.0068 1.1566 0.7344 -0.0038 -0.0812 0.0376  181 THR C CG2 
3752 N N   . GLU C 165 ? 0.9447 1.0961 0.7299 -0.0097 -0.0656 0.0281  182 GLU C N   
3753 C CA  . GLU C 165 ? 0.9002 1.0486 0.6967 -0.0117 -0.0616 0.0312  182 GLU C CA  
3754 C C   . GLU C 165 ? 0.9196 1.0619 0.7050 -0.0158 -0.0562 0.0425  182 GLU C C   
3755 O O   . GLU C 165 ? 0.9505 1.0959 0.7396 -0.0193 -0.0468 0.0431  182 GLU C O   
3756 C CB  . GLU C 165 ? 0.9018 1.0464 0.7061 -0.0069 -0.0717 0.0301  182 GLU C CB  
3757 C CG  . GLU C 165 ? 0.8814 1.0297 0.7033 -0.0066 -0.0690 0.0257  182 GLU C CG  
3758 N N   . GLU C 166 ? 0.9242 1.0587 0.6959 -0.0157 -0.0624 0.0518  183 GLU C N   
3759 C CA  . GLU C 166 ? 0.9043 1.0337 0.6678 -0.0214 -0.0582 0.0642  183 GLU C CA  
3760 C C   . GLU C 166 ? 0.8991 1.0390 0.6578 -0.0252 -0.0461 0.0645  183 GLU C C   
3761 O O   . GLU C 166 ? 0.9283 1.0691 0.6901 -0.0297 -0.0394 0.0700  183 GLU C O   
3762 C CB  . GLU C 166 ? 0.8938 1.0136 0.6405 -0.0223 -0.0671 0.0756  183 GLU C CB  
3763 N N   . ASP C 167 ? 0.9092 1.0576 0.6614 -0.0225 -0.0441 0.0574  184 ASP C N   
3764 C CA  . ASP C 167 ? 0.9291 1.0882 0.6767 -0.0239 -0.0338 0.0555  184 ASP C CA  
3765 C C   . ASP C 167 ? 0.9007 1.0626 0.6640 -0.0235 -0.0274 0.0469  184 ASP C C   
3766 O O   . ASP C 167 ? 0.8958 1.0636 0.6599 -0.0252 -0.0191 0.0480  184 ASP C O   
3767 C CB  . ASP C 167 ? 0.9769 1.1434 0.7096 -0.0203 -0.0353 0.0502  184 ASP C CB  
3768 C CG  . ASP C 167 ? 1.0279 1.1955 0.7403 -0.0223 -0.0381 0.0614  184 ASP C CG  
3769 O OD1 . ASP C 167 ? 1.0185 1.1795 0.7292 -0.0275 -0.0394 0.0742  184 ASP C OD1 
3770 O OD2 . ASP C 167 ? 1.0939 1.2689 0.7914 -0.0192 -0.0395 0.0577  184 ASP C OD2 
3771 N N   . THR C 168 ? 0.9021 1.0609 0.6778 -0.0214 -0.0313 0.0387  185 THR C N   
3772 C CA  . THR C 168 ? 0.8677 1.0273 0.6583 -0.0225 -0.0261 0.0330  185 THR C CA  
3773 C C   . THR C 168 ? 0.8445 1.0013 0.6418 -0.0257 -0.0223 0.0403  185 THR C C   
3774 O O   . THR C 168 ? 0.8358 0.9952 0.6367 -0.0272 -0.0153 0.0407  185 THR C O   
3775 C CB  . THR C 168 ? 0.7976 0.9567 0.6007 -0.0218 -0.0308 0.0250  185 THR C CB  
3776 N N   . ARG C 169 ? 0.8604 1.0113 0.6591 -0.0260 -0.0280 0.0454  186 ARG C N   
3777 C CA  . ARG C 169 ? 0.8928 1.0395 0.6977 -0.0288 -0.0266 0.0517  186 ARG C CA  
3778 C C   . ARG C 169 ? 0.8625 1.0115 0.6607 -0.0329 -0.0206 0.0600  186 ARG C C   
3779 O O   . ARG C 169 ? 0.8477 0.9979 0.6535 -0.0353 -0.0157 0.0616  186 ARG C O   
3780 C CB  . ARG C 169 ? 0.9392 1.0770 0.7449 -0.0272 -0.0362 0.0549  186 ARG C CB  
3781 C CG  . ARG C 169 ? 0.9727 1.1039 0.7844 -0.0297 -0.0368 0.0603  186 ARG C CG  
3782 C CD  . ARG C 169 ? 0.9995 1.1242 0.8194 -0.0252 -0.0460 0.0564  186 ARG C CD  
3783 N NE  . ARG C 169 ? 1.0055 1.1244 0.8193 -0.0209 -0.0563 0.0563  186 ARG C NE  
3784 C CZ  . ARG C 169 ? 1.0135 1.1384 0.8319 -0.0156 -0.0603 0.0474  186 ARG C CZ  
3785 N NH1 . ARG C 169 ? 1.0013 1.1382 0.8304 -0.0150 -0.0546 0.0384  186 ARG C NH1 
3786 N NH2 . ARG C 169 ? 1.0701 1.1893 0.8824 -0.0113 -0.0708 0.0480  186 ARG C NH2 
3787 N N   . MET C 170 ? 0.9024 1.0539 0.6866 -0.0342 -0.0208 0.0656  187 MET C N   
3788 C CA  . MET C 170 ? 0.9442 1.1028 0.7226 -0.0391 -0.0142 0.0738  187 MET C CA  
3789 C C   . MET C 170 ? 0.8668 1.0370 0.6498 -0.0375 -0.0049 0.0673  187 MET C C   
3790 O O   . MET C 170 ? 0.7998 0.9751 0.5887 -0.0405 0.0006  0.0707  187 MET C O   
3791 C CB  . MET C 170 ? 1.0187 1.1805 0.7792 -0.0412 -0.0159 0.0816  187 MET C CB  
3792 C CG  . MET C 170 ? 1.1057 1.2540 0.8611 -0.0448 -0.0255 0.0924  187 MET C CG  
3793 S SD  . MET C 170 ? 1.3282 1.4818 1.0653 -0.0536 -0.0238 0.1090  187 MET C SD  
3794 C CE  . MET C 170 ? 1.3272 1.4886 1.0449 -0.0484 -0.0255 0.1052  187 MET C CE  
3795 N N   . PHE C 171 ? 0.8303 1.0038 0.6115 -0.0324 -0.0043 0.0573  188 PHE C N   
3796 C CA  . PHE C 171 ? 0.8286 1.0100 0.6140 -0.0295 0.0023  0.0501  188 PHE C CA  
3797 C C   . PHE C 171 ? 0.7739 0.9505 0.5743 -0.0305 0.0040  0.0489  188 PHE C C   
3798 O O   . PHE C 171 ? 0.7835 0.9663 0.5883 -0.0315 0.0094  0.0511  188 PHE C O   
3799 C CB  . PHE C 171 ? 0.8458 1.0274 0.6279 -0.0240 0.0002  0.0387  188 PHE C CB  
3800 C CG  . PHE C 171 ? 0.8534 1.0378 0.6420 -0.0203 0.0043  0.0303  188 PHE C CG  
3801 C CD1 . PHE C 171 ? 0.8493 1.0461 0.6347 -0.0181 0.0108  0.0297  188 PHE C CD1 
3802 C CD2 . PHE C 171 ? 0.8840 1.0590 0.6826 -0.0192 0.0013  0.0233  188 PHE C CD2 
3803 C CE1 . PHE C 171 ? 0.8790 1.0771 0.6710 -0.0131 0.0131  0.0212  188 PHE C CE1 
3804 C CE2 . PHE C 171 ? 0.9202 1.0943 0.7242 -0.0158 0.0032  0.0165  188 PHE C CE2 
3805 C CZ  . PHE C 171 ? 0.9165 1.1011 0.7173 -0.0119 0.0086  0.0149  188 PHE C CZ  
3806 N N   . VAL C 172 ? 0.7212 0.8888 0.5292 -0.0301 -0.0006 0.0455  189 VAL C N   
3807 C CA  . VAL C 172 ? 0.6827 0.8467 0.5031 -0.0310 0.0007  0.0440  189 VAL C CA  
3808 C C   . VAL C 172 ? 0.6592 0.8234 0.4838 -0.0344 0.0024  0.0516  189 VAL C C   
3809 O O   . VAL C 172 ? 0.6265 0.7934 0.4571 -0.0346 0.0063  0.0516  189 VAL C O   
3810 C CB  . VAL C 172 ? 0.6727 0.8311 0.5000 -0.0310 -0.0039 0.0398  189 VAL C CB  
3811 C CG1 . VAL C 172 ? 0.7043 0.8611 0.5418 -0.0328 -0.0021 0.0407  189 VAL C CG1 
3812 C CG2 . VAL C 172 ? 0.6612 0.8192 0.4887 -0.0293 -0.0052 0.0318  189 VAL C CG2 
3813 N N   . ASP C 173 ? 0.6703 0.8306 0.4917 -0.0368 -0.0018 0.0578  190 ASP C N   
3814 C CA  . ASP C 173 ? 0.7017 0.8603 0.5275 -0.0408 -0.0018 0.0649  190 ASP C CA  
3815 C C   . ASP C 173 ? 0.7027 0.8718 0.5288 -0.0431 0.0051  0.0684  190 ASP C C   
3816 O O   . ASP C 173 ? 0.6551 0.8259 0.4895 -0.0446 0.0071  0.0693  190 ASP C O   
3817 C CB  . ASP C 173 ? 0.7260 0.8768 0.5463 -0.0436 -0.0087 0.0722  190 ASP C CB  
3818 C CG  . ASP C 173 ? 0.7372 0.8784 0.5619 -0.0403 -0.0167 0.0681  190 ASP C CG  
3819 O OD1 . ASP C 173 ? 0.7238 0.8674 0.5545 -0.0366 -0.0159 0.0598  190 ASP C OD1 
3820 O OD2 . ASP C 173 ? 0.7902 0.9222 0.6128 -0.0414 -0.0242 0.0731  190 ASP C OD2 
3821 N N   . THR C 174 ? 0.7455 0.9238 0.5625 -0.0430 0.0087  0.0694  191 THR C N   
3822 C CA  . THR C 174 ? 0.7520 0.9449 0.5702 -0.0445 0.0158  0.0715  191 THR C CA  
3823 C C   . THR C 174 ? 0.7210 0.9172 0.5487 -0.0396 0.0194  0.0636  191 THR C C   
3824 O O   . THR C 174 ? 0.7007 0.9051 0.5359 -0.0410 0.0229  0.0656  191 THR C O   
3825 C CB  . THR C 174 ? 0.7659 0.9715 0.5718 -0.0434 0.0198  0.0714  191 THR C CB  
3826 O OG1 . THR C 174 ? 0.7779 0.9770 0.5726 -0.0463 0.0146  0.0775  191 THR C OG1 
3827 C CG2 . THR C 174 ? 0.8178 1.0416 0.6251 -0.0475 0.0267  0.0770  191 THR C CG2 
3828 N N   . VAL C 175 ? 0.6871 0.8767 0.5148 -0.0344 0.0175  0.0553  192 VAL C N   
3829 C CA  . VAL C 175 ? 0.6802 0.8693 0.5152 -0.0300 0.0191  0.0486  192 VAL C CA  
3830 C C   . VAL C 175 ? 0.6923 0.8757 0.5371 -0.0324 0.0177  0.0516  192 VAL C C   
3831 O O   . VAL C 175 ? 0.7048 0.8932 0.5562 -0.0309 0.0201  0.0511  192 VAL C O   
3832 C CB  . VAL C 175 ? 0.6681 0.8480 0.5014 -0.0262 0.0157  0.0407  192 VAL C CB  
3833 C CG1 . VAL C 175 ? 0.6602 0.8346 0.5013 -0.0233 0.0153  0.0362  192 VAL C CG1 
3834 C CG2 . VAL C 175 ? 0.6768 0.8627 0.5005 -0.0222 0.0164  0.0352  192 VAL C CG2 
3835 N N   . VAL C 176 ? 0.6728 0.8470 0.5183 -0.0352 0.0135  0.0538  193 VAL C N   
3836 C CA  . VAL C 176 ? 0.6369 0.8062 0.4899 -0.0367 0.0116  0.0551  193 VAL C CA  
3837 C C   . VAL C 176 ? 0.6236 0.7984 0.4807 -0.0400 0.0126  0.0610  193 VAL C C   
3838 O O   . VAL C 176 ? 0.6543 0.8315 0.5181 -0.0395 0.0135  0.0608  193 VAL C O   
3839 C CB  . VAL C 176 ? 0.6539 0.8157 0.5068 -0.0376 0.0067  0.0544  193 VAL C CB  
3840 C CG1 . VAL C 176 ? 0.6593 0.8186 0.5187 -0.0385 0.0049  0.0548  193 VAL C CG1 
3841 C CG2 . VAL C 176 ? 0.6565 0.8156 0.5077 -0.0356 0.0059  0.0487  193 VAL C CG2 
3842 N N   . LYS C 177 ? 0.6255 0.8021 0.4786 -0.0440 0.0118  0.0667  194 LYS C N   
3843 C CA  . LYS C 177 ? 0.6593 0.8415 0.5168 -0.0492 0.0123  0.0734  194 LYS C CA  
3844 C C   . LYS C 177 ? 0.6309 0.8279 0.4936 -0.0479 0.0184  0.0722  194 LYS C C   
3845 O O   . LYS C 177 ? 0.6533 0.8550 0.5246 -0.0501 0.0184  0.0741  194 LYS C O   
3846 C CB  . LYS C 177 ? 0.6883 0.8701 0.5387 -0.0550 0.0105  0.0814  194 LYS C CB  
3847 C CG  . LYS C 177 ? 0.7208 0.9059 0.5768 -0.0629 0.0093  0.0898  194 LYS C CG  
3848 C CD  . LYS C 177 ? 0.7610 0.9343 0.6114 -0.0691 0.0023  0.0982  194 LYS C CD  
3849 N N   . SER C 178 ? 0.6284 0.8333 0.4864 -0.0434 0.0227  0.0676  195 SER C N   
3850 C CA  . SER C 178 ? 0.6150 0.8346 0.4783 -0.0394 0.0276  0.0637  195 SER C CA  
3851 C C   . SER C 178 ? 0.6037 0.8177 0.4757 -0.0353 0.0255  0.0595  195 SER C C   
3852 O O   . SER C 178 ? 0.6190 0.8432 0.4996 -0.0348 0.0269  0.0597  195 SER C O   
3853 C CB  . SER C 178 ? 0.6132 0.8392 0.4688 -0.0332 0.0308  0.0570  195 SER C CB  
3854 O OG  . SER C 178 ? 0.6528 0.8809 0.5136 -0.0252 0.0314  0.0486  195 SER C OG  
3855 N N   . ASN C 179 ? 0.6007 0.7997 0.4704 -0.0329 0.0218  0.0563  196 ASN C N   
3856 C CA  . ASN C 179 ? 0.5924 0.7850 0.4676 -0.0300 0.0194  0.0539  196 ASN C CA  
3857 C C   . ASN C 179 ? 0.5979 0.7904 0.4793 -0.0339 0.0170  0.0583  196 ASN C C   
3858 O O   . ASN C 179 ? 0.5841 0.7800 0.4719 -0.0316 0.0163  0.0574  196 ASN C O   
3859 C CB  . ASN C 179 ? 0.5979 0.7765 0.4687 -0.0289 0.0164  0.0511  196 ASN C CB  
3860 C CG  . ASN C 179 ? 0.6007 0.7770 0.4664 -0.0248 0.0169  0.0454  196 ASN C CG  
3861 O OD1 . ASN C 179 ? 0.6306 0.8160 0.4959 -0.0207 0.0195  0.0421  196 ASN C OD1 
3862 N ND2 . ASN C 179 ? 0.5791 0.7450 0.4416 -0.0258 0.0142  0.0436  196 ASN C ND2 
3863 N N   . LEU C 180 ? 0.6141 0.8019 0.4938 -0.0391 0.0146  0.0622  197 LEU C N   
3864 C CA  . LEU C 180 ? 0.6230 0.8091 0.5084 -0.0423 0.0109  0.0649  197 LEU C CA  
3865 C C   . LEU C 180 ? 0.6363 0.8347 0.5294 -0.0458 0.0123  0.0686  197 LEU C C   
3866 O O   . LEU C 180 ? 0.6469 0.8469 0.5470 -0.0467 0.0094  0.0689  197 LEU C O   
3867 C CB  . LEU C 180 ? 0.6387 0.8151 0.5210 -0.0457 0.0063  0.0667  197 LEU C CB  
3868 C CG  . LEU C 180 ? 0.6412 0.8093 0.5174 -0.0429 0.0050  0.0629  197 LEU C CG  
3869 C CD1 . LEU C 180 ? 0.6194 0.7799 0.4952 -0.0443 -0.0008 0.0630  197 LEU C CD1 
3870 C CD2 . LEU C 180 ? 0.6483 0.8152 0.5249 -0.0393 0.0059  0.0590  197 LEU C CD2 
3871 N N   . GLN C 181 ? 0.6426 0.8518 0.5345 -0.0482 0.0166  0.0714  198 GLN C N   
3872 C CA  . GLN C 181 ? 0.6202 0.8463 0.5207 -0.0527 0.0192  0.0752  198 GLN C CA  
3873 C C   . GLN C 181 ? 0.5852 0.8230 0.4940 -0.0462 0.0213  0.0698  198 GLN C C   
3874 O O   . GLN C 181 ? 0.5414 0.7886 0.4605 -0.0486 0.0201  0.0712  198 GLN C O   
3875 C CB  . GLN C 181 ? 0.6180 0.8567 0.5138 -0.0568 0.0245  0.0796  198 GLN C CB  
3876 N N   . ASN C 182 ? 0.5684 0.8046 0.4729 -0.0379 0.0232  0.0634  199 ASN C N   
3877 C CA  . ASN C 182 ? 0.5860 0.8303 0.4973 -0.0300 0.0236  0.0576  199 ASN C CA  
3878 C C   . ASN C 182 ? 0.6150 0.8480 0.5296 -0.0285 0.0177  0.0574  199 ASN C C   
3879 O O   . ASN C 182 ? 0.6187 0.8605 0.5426 -0.0264 0.0158  0.0564  199 ASN C O   
3880 C CB  . ASN C 182 ? 0.5981 0.8381 0.5026 -0.0216 0.0250  0.0506  199 ASN C CB  
3881 C CG  . ASN C 182 ? 0.6194 0.8744 0.5198 -0.0212 0.0311  0.0490  199 ASN C CG  
3882 O OD1 . ASN C 182 ? 0.6115 0.8866 0.5167 -0.0254 0.0355  0.0522  199 ASN C OD1 
3883 N ND2 . ASN C 182 ? 0.6124 0.8588 0.5036 -0.0165 0.0310  0.0440  199 ASN C ND2 
3884 N N   . LEU C 183 ? 0.6401 0.8554 0.5469 -0.0298 0.0146  0.0583  200 LEU C N   
3885 C CA  . LEU C 183 ? 0.6149 0.8209 0.5221 -0.0295 0.0094  0.0588  200 LEU C CA  
3886 C C   . LEU C 183 ? 0.5983 0.8124 0.5141 -0.0342 0.0070  0.0615  200 LEU C C   
3887 O O   . LEU C 183 ? 0.6190 0.8362 0.5404 -0.0316 0.0036  0.0604  200 LEU C O   
3888 C CB  . LEU C 183 ? 0.6103 0.8019 0.5087 -0.0319 0.0078  0.0595  200 LEU C CB  
3889 C CG  . LEU C 183 ? 0.6004 0.7843 0.4965 -0.0317 0.0034  0.0595  200 LEU C CG  
3890 C CD1 . LEU C 183 ? 0.6061 0.7854 0.4999 -0.0267 0.0019  0.0585  200 LEU C CD1 
3891 C CD2 . LEU C 183 ? 0.5981 0.7739 0.4876 -0.0342 0.0029  0.0593  200 LEU C CD2 
3892 N N   . ALA C 184 ? 0.6108 0.8280 0.5279 -0.0413 0.0079  0.0655  201 ALA C N   
3893 C CA  . ALA C 184 ? 0.6289 0.8521 0.5551 -0.0476 0.0043  0.0687  201 ALA C CA  
3894 C C   . ALA C 184 ? 0.6364 0.8778 0.5747 -0.0462 0.0054  0.0676  201 ALA C C   
3895 O O   . ALA C 184 ? 0.7103 0.9539 0.6560 -0.0471 0.0003  0.0671  201 ALA C O   
3896 C CB  . ALA C 184 ? 0.6300 0.8533 0.5556 -0.0565 0.0049  0.0746  201 ALA C CB  
3897 N N   . VAL C 185 ? 0.6096 0.8650 0.5500 -0.0429 0.0114  0.0661  202 VAL C N   
3898 C CA  . VAL C 185 ? 0.5985 0.8754 0.5522 -0.0405 0.0127  0.0639  202 VAL C CA  
3899 C C   . VAL C 185 ? 0.5708 0.8429 0.5262 -0.0307 0.0080  0.0584  202 VAL C C   
3900 O O   . VAL C 185 ? 0.5956 0.8763 0.5612 -0.0305 0.0039  0.0577  202 VAL C O   
3901 C CB  . VAL C 185 ? 0.6029 0.9005 0.5591 -0.0383 0.0206  0.0621  202 VAL C CB  
3902 C CG1 . VAL C 185 ? 0.6139 0.9388 0.5867 -0.0380 0.0221  0.0603  202 VAL C CG1 
3903 C CG2 . VAL C 185 ? 0.6106 0.9101 0.5601 -0.0473 0.0254  0.0684  202 VAL C CG2 
3904 N N   . ILE C 186 ? 0.5719 0.8300 0.5173 -0.0229 0.0076  0.0549  203 ILE C N   
3905 C CA  . ILE C 186 ? 0.5926 0.8442 0.5386 -0.0144 0.0019  0.0515  203 ILE C CA  
3906 C C   . ILE C 186 ? 0.6184 0.8601 0.5624 -0.0178 -0.0043 0.0543  203 ILE C C   
3907 O O   . ILE C 186 ? 0.6065 0.8508 0.5553 -0.0135 -0.0097 0.0529  203 ILE C O   
3908 C CB  . ILE C 186 ? 0.5985 0.8328 0.5336 -0.0073 0.0008  0.0489  203 ILE C CB  
3909 C CG1 . ILE C 186 ? 0.5774 0.7958 0.5001 -0.0129 0.0027  0.0519  203 ILE C CG1 
3910 C CG2 . ILE C 186 ? 0.6038 0.8472 0.5425 0.0011  0.0033  0.0426  203 ILE C CG2 
3911 N N   . SER C 187 ? 0.6629 0.8937 0.5995 -0.0246 -0.0041 0.0574  204 SER C N   
3912 C CA  . SER C 187 ? 0.6895 0.9115 0.6226 -0.0270 -0.0100 0.0584  204 SER C CA  
3913 C C   . SER C 187 ? 0.7046 0.9375 0.6494 -0.0301 -0.0149 0.0583  204 SER C C   
3914 O O   . SER C 187 ? 0.6519 0.8819 0.5956 -0.0275 -0.0211 0.0569  204 SER C O   
3915 C CB  . SER C 187 ? 0.7100 0.9210 0.6351 -0.0325 -0.0091 0.0600  204 SER C CB  
3916 O OG  . SER C 187 ? 0.7364 0.9370 0.6508 -0.0299 -0.0061 0.0597  204 SER C OG  
3917 N N   . THR C 188 ? 0.7613 1.0077 0.7170 -0.0362 -0.0125 0.0600  205 THR C N   
3918 C CA  . THR C 188 ? 0.8021 1.0591 0.7706 -0.0412 -0.0178 0.0603  205 THR C CA  
3919 C C   . THR C 188 ? 0.8313 1.1072 0.8125 -0.0359 -0.0185 0.0575  205 THR C C   
3920 O O   . THR C 188 ? 0.8126 1.0945 0.8023 -0.0360 -0.0254 0.0558  205 THR C O   
3921 C CB  . THR C 188 ? 0.7786 1.0412 0.7541 -0.0527 -0.0162 0.0650  205 THR C CB  
3922 O OG1 . THR C 188 ? 0.8295 1.1136 0.8150 -0.0546 -0.0095 0.0668  205 THR C OG1 
3923 C CG2 . THR C 188 ? 0.7439 0.9894 0.7070 -0.0560 -0.0145 0.0677  205 THR C CG2 
3924 N N   . ALA C 189 ? 0.8734 1.1593 0.8565 -0.0305 -0.0123 0.0559  206 ALA C N   
3925 C CA  . ALA C 189 ? 0.9654 1.2705 0.9609 -0.0228 -0.0129 0.0515  206 ALA C CA  
3926 C C   . ALA C 189 ? 1.1043 1.4347 1.1194 -0.0294 -0.0139 0.0519  206 ALA C C   
3927 O O   . ALA C 189 ? 1.1699 1.5091 1.1950 -0.0253 -0.0205 0.0486  206 ALA C O   
3928 C CB  . ALA C 189 ? 0.9528 1.2461 0.9428 -0.0125 -0.0204 0.0483  206 ALA C CB  
3929 N N   . SER C 190 ? 1.1125 1.4547 1.1329 -0.0402 -0.0078 0.0565  207 SER C N   
3930 C CA  . SER C 190 ? 1.1452 1.5147 1.1852 -0.0490 -0.0071 0.0584  207 SER C CA  
3931 C C   . SER C 190 ? 1.1548 1.5208 1.2031 -0.0548 -0.0173 0.0590  207 SER C C   
3932 O O   . SER C 190 ? 1.1528 1.5387 1.2175 -0.0531 -0.0212 0.0556  207 SER C O   
3933 C CB  . SER C 190 ? 1.1795 1.5790 1.2334 -0.0401 -0.0031 0.0522  207 SER C CB  
3934 O OG  . SER C 190 ? 1.1650 1.5614 1.2217 -0.0274 -0.0109 0.0454  207 SER C OG  
3935 N N   . TYR D 6   ? 1.6139 1.4911 1.6480 0.0812  -0.3835 0.1478  23  TYR D N   
3936 C CA  . TYR D 6   ? 1.5453 1.4829 1.5977 0.0439  -0.3147 0.1809  23  TYR D CA  
3937 C C   . TYR D 6   ? 1.5931 1.4532 1.4753 0.0539  -0.2552 0.2180  23  TYR D C   
3938 O O   . TYR D 6   ? 1.6895 1.5137 1.5194 0.0621  -0.2414 0.2254  23  TYR D O   
3939 C CB  . TYR D 6   ? 1.5606 1.5069 1.7023 0.0540  -0.3645 0.1482  23  TYR D CB  
3940 C CG  . TYR D 6   ? 1.4615 1.4839 1.6616 0.0122  -0.2966 0.1762  23  TYR D CG  
3941 C CD1 . TYR D 6   ? 1.3817 1.4815 1.7138 -0.0261 -0.2399 0.1853  23  TYR D CD1 
3942 C CD2 . TYR D 6   ? 1.5049 1.4900 1.6038 0.0203  -0.2834 0.1933  23  TYR D CD2 
3943 C CE1 . TYR D 6   ? 1.3649 1.4902 1.7007 -0.0478 -0.1854 0.2086  23  TYR D CE1 
3944 C CE2 . TYR D 6   ? 1.4621 1.5081 1.6104 -0.0116 -0.2346 0.2133  23  TYR D CE2 
3945 C CZ  . TYR D 6   ? 1.3896 1.4994 1.6438 -0.0419 -0.1928 0.2198  23  TYR D CZ  
3946 O OH  . TYR D 6   ? 1.3199 1.4473 1.5749 -0.0577 -0.1517 0.2375  23  TYR D OH  
3947 N N   . GLY D 7   ? 1.5530 1.3824 1.3740 0.0521  -0.2072 0.2391  24  GLY D N   
3948 C CA  . GLY D 7   ? 1.6200 1.3865 1.3645 0.0505  -0.1154 0.2705  24  GLY D CA  
3949 C C   . GLY D 7   ? 1.5416 1.4312 1.4372 -0.0004 -0.0711 0.2817  24  GLY D C   
3950 O O   . GLY D 7   ? 1.5372 1.3976 1.4519 -0.0071 -0.0006 0.2939  24  GLY D O   
3951 N N   . LEU D 8   ? 1.4655 1.4652 1.4673 -0.0271 -0.1105 0.2722  25  LEU D N   
3952 C CA  . LEU D 8   ? 1.3431 1.4159 1.4371 -0.0538 -0.0972 0.2740  25  LEU D CA  
3953 C C   . LEU D 8   ? 1.3861 1.4734 1.5000 -0.0583 -0.0980 0.2732  25  LEU D C   
3954 O O   . LEU D 8   ? 1.4079 1.4652 1.4769 -0.0470 -0.1060 0.2734  25  LEU D O   
3955 C CB  . LEU D 8   ? 1.2607 1.3762 1.3864 -0.0619 -0.1208 0.2696  25  LEU D CB  
3956 N N   . THR D 9   ? 1.4262 1.5451 1.6007 -0.0662 -0.1047 0.2653  26  THR D N   
3957 C CA  . THR D 9   ? 1.4605 1.5870 1.6531 -0.0660 -0.1148 0.2602  26  THR D CA  
3958 C C   . THR D 9   ? 1.5116 1.6315 1.6582 -0.0583 -0.1378 0.2613  26  THR D C   
3959 O O   . THR D 9   ? 1.5634 1.6723 1.6817 -0.0567 -0.1297 0.2675  26  THR D O   
3960 C CB  . THR D 9   ? 1.4402 1.5731 1.7403 -0.0651 -0.1199 0.2367  26  THR D CB  
3961 O OG1 . THR D 9   ? 1.3966 1.5311 1.7329 -0.0546 -0.1605 0.2156  26  THR D OG1 
3962 C CG2 . THR D 9   ? 1.4541 1.5599 1.8157 -0.0730 -0.0475 0.2410  26  THR D CG2 
3963 N N   . LYS D 10  ? 1.5566 1.6616 1.6925 -0.0496 -0.1517 0.2557  27  LYS D N   
3964 C CA  . LYS D 10  ? 1.5573 1.6078 1.6127 -0.0330 -0.1448 0.2628  27  LYS D CA  
3965 C C   . LYS D 10  ? 1.6434 1.6114 1.6049 -0.0040 -0.1488 0.2620  27  LYS D C   
3966 O O   . LYS D 10  ? 1.6846 1.6134 1.6103 -0.0040 -0.0946 0.2787  27  LYS D O   
3967 C CB  . LYS D 10  ? 1.5471 1.5711 1.5816 -0.0180 -0.1688 0.2532  27  LYS D CB  
3968 C CG  . LYS D 10  ? 1.6142 1.5483 1.5384 0.0044  -0.1379 0.2665  27  LYS D CG  
3969 N N   . ASP D 11  ? 1.7024 1.6291 1.6387 0.0264  -0.2139 0.2357  28  ASP D N   
3970 C CA  . ASP D 11  ? 1.8012 1.5973 1.5901 0.0771  -0.2406 0.2276  28  ASP D CA  
3971 C C   . ASP D 11  ? 1.7429 1.5565 1.5407 0.0638  -0.2106 0.2394  28  ASP D C   
3972 O O   . ASP D 11  ? 1.8670 1.5561 1.5175 0.0983  -0.1813 0.2515  28  ASP D O   
3973 C CB  . ASP D 11  ? 1.8501 1.5899 1.6390 0.1259  -0.3578 0.1751  28  ASP D CB  
3974 N N   . GLU D 12  ? 1.5538 1.4933 1.5014 0.0208  -0.2078 0.2377  29  GLU D N   
3975 C CA  . GLU D 12  ? 1.4729 1.4355 1.4376 0.0078  -0.1868 0.2462  29  GLU D CA  
3976 C C   . GLU D 12  ? 1.4489 1.4064 1.3991 -0.0089 -0.1131 0.2730  29  GLU D C   
3977 O O   . GLU D 12  ? 1.4541 1.3573 1.3541 0.0020  -0.0822 0.2812  29  GLU D O   
3978 C CB  . GLU D 12  ? 1.3433 1.4031 1.4427 -0.0239 -0.1894 0.2390  29  GLU D CB  
3979 C CG  . GLU D 12  ? 1.2752 1.3421 1.4714 -0.0121 -0.2410 0.2024  29  GLU D CG  
3980 C CD  . GLU D 12  ? 1.1421 1.2663 1.4644 -0.0419 -0.1955 0.2037  29  GLU D CD  
3981 O OE1 . GLU D 12  ? 1.0700 1.2057 1.3695 -0.0602 -0.1409 0.2295  29  GLU D OE1 
3982 O OE2 . GLU D 12  ? 1.0815 1.2130 1.5152 -0.0386 -0.2118 0.1759  29  GLU D OE2 
3983 N N   . PHE D 13  ? 1.3777 1.3861 1.3969 -0.0323 -0.0880 0.2789  30  PHE D N   
3984 C CA  . PHE D 13  ? 1.3848 1.3957 1.4699 -0.0459 -0.0331 0.2843  30  PHE D CA  
3985 C C   . PHE D 13  ? 1.4650 1.3539 1.4719 -0.0233 0.0457  0.2989  30  PHE D C   
3986 O O   . PHE D 13  ? 1.4678 1.3202 1.5219 -0.0263 0.1129  0.3029  30  PHE D O   
3987 C CB  . PHE D 13  ? 1.3916 1.4575 1.5681 -0.0617 -0.0447 0.2744  30  PHE D CB  
3988 C CG  . PHE D 13  ? 1.4178 1.4788 1.7233 -0.0697 0.0015  0.2619  30  PHE D CG  
3989 C CD1 . PHE D 13  ? 1.3747 1.4607 1.7984 -0.0759 -0.0030 0.2412  30  PHE D CD1 
3990 C CD2 . PHE D 13  ? 1.4748 1.5010 1.8151 -0.0693 0.0517  0.2635  30  PHE D CD2 
3991 C CE1 . PHE D 13  ? 1.4080 1.4933 2.0277 -0.0827 0.0365  0.2132  30  PHE D CE1 
3992 C CE2 . PHE D 13  ? 1.5123 1.5335 2.0394 -0.0788 0.1077  0.2420  30  PHE D CE2 
3993 C CZ  . PHE D 13  ? 1.4733 1.5282 2.1631 -0.0861 0.0977  0.2121  30  PHE D CZ  
3994 N N   . SER D 14  ? 1.5323 1.7036 1.1490 -0.1557 -0.1191 0.1871  31  SER D N   
3995 C CA  . SER D 14  ? 1.5463 1.7349 1.1563 -0.1368 -0.1129 0.1983  31  SER D CA  
3996 C C   . SER D 14  ? 1.5465 1.7578 1.1624 -0.1343 -0.1184 0.1904  31  SER D C   
3997 O O   . SER D 14  ? 1.6387 1.8457 1.2538 -0.1305 -0.1142 0.2013  31  SER D O   
3998 C CB  . SER D 14  ? 1.5075 1.7215 1.1071 -0.1161 -0.1092 0.2000  31  SER D CB  
3999 N N   . THR D 15  ? 1.5012 1.7360 1.1252 -0.1371 -0.1268 0.1704  32  THR D N   
4000 C CA  . THR D 15  ? 1.4687 1.7302 1.1005 -0.1336 -0.1317 0.1595  32  THR D CA  
4001 C C   . THR D 15  ? 1.4063 1.6498 1.0518 -0.1539 -0.1362 0.1515  32  THR D C   
4002 O O   . THR D 15  ? 1.3947 1.6585 1.0531 -0.1570 -0.1408 0.1340  32  THR D O   
4003 C CB  . THR D 15  ? 1.4689 1.7742 1.1056 -0.1224 -0.1365 0.1388  32  THR D CB  
4004 O OG1 . THR D 15  ? 1.4385 1.7379 1.0885 -0.1380 -0.1404 0.1211  32  THR D OG1 
4005 C CG2 . THR D 15  ? 1.4746 1.8014 1.0963 -0.0999 -0.1321 0.1465  32  THR D CG2 
4006 N N   . LEU D 16  ? 1.3309 1.5383 0.9748 -0.1667 -0.1339 0.1637  33  LEU D N   
4007 C CA  . LEU D 16  ? 1.2680 1.4577 0.9226 -0.1842 -0.1373 0.1585  33  LEU D CA  
4008 C C   . LEU D 16  ? 1.2556 1.4166 0.9076 -0.1927 -0.1350 0.1727  33  LEU D C   
4009 O O   . LEU D 16  ? 1.2151 1.3672 0.8745 -0.2033 -0.1378 0.1700  33  LEU D O   
4010 C CB  . LEU D 16  ? 1.2298 1.4092 0.8906 -0.1954 -0.1390 0.1480  33  LEU D CB  
4011 N N   . ASP D 17  ? 1.2569 1.4045 0.9004 -0.1880 -0.1290 0.1869  34  ASP D N   
4012 C CA  . ASP D 17  ? 1.2826 1.4051 0.9275 -0.1971 -0.1259 0.1968  34  ASP D CA  
4013 C C   . ASP D 17  ? 1.2420 1.3694 0.8921 -0.1983 -0.1277 0.1979  34  ASP D C   
4014 O O   . ASP D 17  ? 1.1336 1.2473 0.7891 -0.2103 -0.1304 0.1970  34  ASP D O   
4015 C CB  . ASP D 17  ? 1.3121 1.4229 0.9516 -0.1899 -0.1158 0.2107  34  ASP D CB  
4016 C CG  . ASP D 17  ? 1.3680 1.4539 1.0137 -0.2015 -0.1118 0.2163  34  ASP D CG  
4017 O OD1 . ASP D 17  ? 1.4327 1.5104 1.0834 -0.2148 -0.1184 0.2094  34  ASP D OD1 
4018 O OD2 . ASP D 17  ? 1.3716 1.4473 1.0183 -0.1964 -0.1009 0.2270  34  ASP D OD2 
4019 N N   . SER D 18  ? 1.2197 1.3691 0.8676 -0.1845 -0.1261 0.1999  35  SER D N   
4020 C CA  . SER D 18  ? 1.2009 1.3596 0.8533 -0.1833 -0.1279 0.2000  35  SER D CA  
4021 C C   . SER D 18  ? 1.1818 1.3397 0.8438 -0.1964 -0.1354 0.1879  35  SER D C   
4022 O O   . SER D 18  ? 1.1770 1.3242 0.8434 -0.2043 -0.1365 0.1909  35  SER D O   
4023 C CB  . SER D 18  ? 1.1968 1.3878 0.8454 -0.1652 -0.1273 0.1984  35  SER D CB  
4024 O OG  . SER D 18  ? 1.2010 1.4131 0.8518 -0.1629 -0.1326 0.1829  35  SER D OG  
4025 N N   . ILE D 19  ? 1.1646 1.3341 0.8311 -0.1983 -0.1392 0.1744  36  ILE D N   
4026 C CA  . ILE D 19  ? 1.1290 1.2973 0.8072 -0.2092 -0.1429 0.1633  36  ILE D CA  
4027 C C   . ILE D 19  ? 1.0843 1.2245 0.7622 -0.2221 -0.1429 0.1685  36  ILE D C   
4028 O O   . ILE D 19  ? 1.0902 1.2235 0.7738 -0.2291 -0.1440 0.1686  36  ILE D O   
4029 C CB  . ILE D 19  ? 1.1168 1.3034 0.8039 -0.2083 -0.1440 0.1461  36  ILE D CB  
4030 C CG1 . ILE D 19  ? 1.0946 1.3167 0.7829 -0.1939 -0.1451 0.1378  36  ILE D CG1 
4031 C CG2 . ILE D 19  ? 1.0821 1.2633 0.7845 -0.2196 -0.1438 0.1360  36  ILE D CG2 
4032 C CD1 . ILE D 19  ? 1.1047 1.3492 0.7992 -0.1894 -0.1457 0.1211  36  ILE D CD1 
4033 N N   . ILE D 20  ? 1.0522 1.1787 0.7233 -0.2239 -0.1414 0.1728  37  ILE D N   
4034 C CA  . ILE D 20  ? 1.0548 1.1590 0.7243 -0.2340 -0.1416 0.1774  37  ILE D CA  
4035 C C   . ILE D 20  ? 1.0642 1.1603 0.7332 -0.2363 -0.1411 0.1859  37  ILE D C   
4036 O O   . ILE D 20  ? 1.0982 1.1871 0.7703 -0.2433 -0.1432 0.1860  37  ILE D O   
4037 C CB  . ILE D 20  ? 1.0705 1.1634 0.7332 -0.2348 -0.1398 0.1798  37  ILE D CB  
4038 C CG1 . ILE D 20  ? 1.0534 1.1542 0.7174 -0.2330 -0.1401 0.1706  37  ILE D CG1 
4039 C CG2 . ILE D 20  ? 1.0547 1.1297 0.7162 -0.2439 -0.1406 0.1827  37  ILE D CG2 
4040 N N   . ARG D 21  ? 1.0427 1.1410 0.7085 -0.2293 -0.1372 0.1932  38  ARG D N   
4041 C CA  . ARG D 21  ? 1.0105 1.1018 0.6789 -0.2309 -0.1345 0.2005  38  ARG D CA  
4042 C C   . ARG D 21  ? 0.9829 1.0836 0.6562 -0.2314 -0.1379 0.1989  38  ARG D C   
4043 O O   . ARG D 21  ? 0.9812 1.0746 0.6583 -0.2385 -0.1397 0.1996  38  ARG D O   
4044 C CB  . ARG D 21  ? 1.0092 1.1007 0.6748 -0.2210 -0.1261 0.2099  38  ARG D CB  
4045 N N   . THR D 22  ? 0.9813 1.1003 0.6551 -0.2233 -0.1389 0.1954  39  THR D N   
4046 C CA  . THR D 22  ? 0.9911 1.1206 0.6705 -0.2229 -0.1414 0.1936  39  THR D CA  
4047 C C   . THR D 22  ? 0.9828 1.1087 0.6691 -0.2323 -0.1454 0.1864  39  THR D C   
4048 O O   . THR D 22  ? 0.9889 1.1137 0.6793 -0.2356 -0.1467 0.1880  39  THR D O   
4049 C CB  . THR D 22  ? 1.0285 1.1838 0.7083 -0.2109 -0.1416 0.1888  39  THR D CB  
4050 O OG1 . THR D 22  ? 1.0562 1.2179 0.7278 -0.1983 -0.1365 0.1964  39  THR D OG1 
4051 C CG2 . THR D 22  ? 1.0139 1.1791 0.6987 -0.2091 -0.1429 0.1894  39  THR D CG2 
4052 N N   . HIS D 23  ? 0.9738 1.0974 0.6617 -0.2358 -0.1459 0.1794  40  HIS D N   
4053 C CA  . HIS D 23  ? 0.9393 1.0611 0.6359 -0.2418 -0.1462 0.1733  40  HIS D CA  
4054 C C   . HIS D 23  ? 0.9257 1.0311 0.6205 -0.2483 -0.1453 0.1751  40  HIS D C   
4055 O O   . HIS D 23  ? 0.9013 1.0026 0.6017 -0.2516 -0.1438 0.1748  40  HIS D O   
4056 C CB  . HIS D 23  ? 0.9390 1.0776 0.6456 -0.2389 -0.1448 0.1603  40  HIS D CB  
4057 C CG  . HIS D 23  ? 0.9664 1.1270 0.6769 -0.2317 -0.1461 0.1560  40  HIS D CG  
4058 N ND1 . HIS D 23  ? 0.9624 1.1272 0.6795 -0.2330 -0.1466 0.1561  40  HIS D ND1 
4059 C CD2 . HIS D 23  ? 0.9614 1.1432 0.6693 -0.2214 -0.1469 0.1516  40  HIS D CD2 
4060 C CE1 . HIS D 23  ? 0.9753 1.1629 0.6940 -0.2243 -0.1479 0.1514  40  HIS D CE1 
4061 N NE2 . HIS D 23  ? 0.9688 1.1684 0.6816 -0.2163 -0.1481 0.1487  40  HIS D NE2 
4062 N N   . HIS D 24  ? 0.9277 1.0248 0.6149 -0.2488 -0.1453 0.1773  41  HIS D N   
4063 C CA  . HIS D 24  ? 0.9369 1.0219 0.6221 -0.2530 -0.1441 0.1777  41  HIS D CA  
4064 C C   . HIS D 24  ? 0.9415 1.0170 0.6195 -0.2558 -0.1463 0.1840  41  HIS D C   
4065 O O   . HIS D 24  ? 0.9065 0.9760 0.5821 -0.2574 -0.1458 0.1851  41  HIS D O   
4066 C CB  . HIS D 24  ? 0.9087 0.9929 0.5925 -0.2519 -0.1423 0.1728  41  HIS D CB  
4067 C CG  . HIS D 24  ? 0.8478 0.9423 0.5428 -0.2506 -0.1391 0.1624  41  HIS D CG  
4068 N ND1 . HIS D 24  ? 0.8306 0.9199 0.5351 -0.2536 -0.1336 0.1584  41  HIS D ND1 
4069 C CD2 . HIS D 24  ? 0.8236 0.9356 0.5239 -0.2459 -0.1394 0.1539  41  HIS D CD2 
4070 C CE1 . HIS D 24  ? 0.8274 0.9293 0.5454 -0.2527 -0.1301 0.1460  41  HIS D CE1 
4071 N NE2 . HIS D 24  ? 0.8143 0.9324 0.5294 -0.2478 -0.1347 0.1422  41  HIS D NE2 
4072 N N   . THR D 25  ? 0.9919 1.0677 0.6678 -0.2557 -0.1475 0.1874  42  THR D N   
4073 C CA  . THR D 25  ? 1.0050 1.0746 0.6783 -0.2593 -0.1487 0.1895  42  THR D CA  
4074 C C   . THR D 25  ? 1.0207 1.0932 0.6957 -0.2611 -0.1512 0.1903  42  THR D C   
4075 O O   . THR D 25  ? 0.9755 1.0527 0.6543 -0.2598 -0.1513 0.1915  42  THR D O   
4076 C CB  . THR D 25  ? 1.0194 1.0877 0.6948 -0.2590 -0.1462 0.1921  42  THR D CB  
4077 O OG1 . THR D 25  ? 1.0306 1.1017 0.7044 -0.2530 -0.1430 0.1938  42  THR D OG1 
4078 C CG2 . THR D 25  ? 1.0221 1.0833 0.6978 -0.2631 -0.1448 0.1901  42  THR D CG2 
4079 N N   . PHE D 26  ? 1.0442 1.1162 0.7168 -0.2632 -0.1531 0.1890  43  PHE D N   
4080 C CA  . PHE D 26  ? 1.0272 1.1060 0.7002 -0.2628 -0.1557 0.1895  43  PHE D CA  
4081 C C   . PHE D 26  ? 1.0369 1.1207 0.7136 -0.2663 -0.1578 0.1848  43  PHE D C   
4082 O O   . PHE D 26  ? 1.0443 1.1251 0.7220 -0.2691 -0.1568 0.1804  43  PHE D O   
4083 C CB  . PHE D 26  ? 1.0195 1.0992 0.6865 -0.2587 -0.1552 0.1913  43  PHE D CB  
4084 C CG  . PHE D 26  ? 1.0035 1.0796 0.6728 -0.2557 -0.1507 0.1949  43  PHE D CG  
4085 C CD1 . PHE D 26  ? 0.9852 1.0651 0.6585 -0.2536 -0.1493 0.1982  43  PHE D CD1 
4086 C CD2 . PHE D 26  ? 1.0071 1.0764 0.6770 -0.2555 -0.1467 0.1935  43  PHE D CD2 
4087 C CE1 . PHE D 26  ? 0.9826 1.0590 0.6623 -0.2517 -0.1431 0.1996  43  PHE D CE1 
4088 C CE2 . PHE D 26  ? 0.9861 1.0532 0.6631 -0.2538 -0.1408 0.1937  43  PHE D CE2 
4089 C CZ  . PHE D 26  ? 0.9849 1.0551 0.6677 -0.2522 -0.1384 0.1964  43  PHE D CZ  
4090 N N   . PRO D 27  ? 1.0647 1.1569 0.7454 -0.2665 -0.1599 0.1843  44  PRO D N   
4091 C CA  . PRO D 27  ? 1.0938 1.1931 0.7822 -0.2707 -0.1610 0.1767  44  PRO D CA  
4092 C C   . PRO D 27  ? 1.1056 1.2166 0.7901 -0.2689 -0.1647 0.1700  44  PRO D C   
4093 O O   . PRO D 27  ? 1.1394 1.2582 0.8156 -0.2624 -0.1672 0.1737  44  PRO D O   
4094 C CB  . PRO D 27  ? 1.0997 1.2064 0.7932 -0.2705 -0.1625 0.1781  44  PRO D CB  
4095 C CG  . PRO D 27  ? 1.0926 1.1962 0.7799 -0.2657 -0.1624 0.1867  44  PRO D CG  
4096 C CD  . PRO D 27  ? 1.0806 1.1778 0.7602 -0.2628 -0.1610 0.1891  44  PRO D CD  
4097 N N   . ARG D 28  ? 1.1185 1.2315 0.8094 -0.2735 -0.1639 0.1604  45  ARG D N   
4098 C CA  . ARG D 28  ? 1.1290 1.2585 0.8182 -0.2715 -0.1679 0.1508  45  ARG D CA  
4099 C C   . ARG D 28  ? 1.1568 1.3072 0.8453 -0.2664 -0.1730 0.1482  45  ARG D C   
4100 O O   . ARG D 28  ? 1.1589 1.3143 0.8581 -0.2703 -0.1729 0.1440  45  ARG D O   
4101 C CB  . ARG D 28  ? 1.0836 1.2151 0.7872 -0.2793 -0.1651 0.1369  45  ARG D CB  
4102 N N   . SER D 29  ? 1.1823 1.3444 0.8577 -0.2565 -0.1762 0.1522  46  SER D N   
4103 C CA  . SER D 29  ? 1.2519 1.4385 0.9243 -0.2483 -0.1807 0.1498  46  SER D CA  
4104 C C   . SER D 29  ? 1.2827 1.4950 0.9508 -0.2414 -0.1851 0.1389  46  SER D C   
4105 O O   . SER D 29  ? 1.2766 1.4839 0.9414 -0.2421 -0.1841 0.1366  46  SER D O   
4106 C CB  . SER D 29  ? 1.2616 1.4429 0.9222 -0.2386 -0.1783 0.1664  46  SER D CB  
4107 O OG  . SER D 29  ? 1.2257 1.3973 0.8926 -0.2430 -0.1767 0.1716  46  SER D OG  
4108 N N   . PRO D 30  ? 1.3391 1.5819 1.0075 -0.2340 -0.1901 0.1310  47  PRO D N   
4109 C CA  . PRO D 30  ? 1.3316 1.6057 0.9948 -0.2244 -0.1949 0.1196  47  PRO D CA  
4110 C C   . PRO D 30  ? 1.3075 1.5836 0.9489 -0.2074 -0.1929 0.1362  47  PRO D C   
4111 O O   . PRO D 30  ? 1.3056 1.5735 0.9380 -0.1993 -0.1890 0.1531  47  PRO D O   
4112 C CB  . PRO D 30  ? 1.3271 1.6363 0.9983 -0.2205 -0.2008 0.1056  47  PRO D CB  
4113 C CG  . PRO D 30  ? 1.3574 1.6493 1.0401 -0.2308 -0.1984 0.1090  47  PRO D CG  
4114 C CD  . PRO D 30  ? 1.3494 1.6030 1.0239 -0.2337 -0.1921 0.1300  47  PRO D CD  
4115 N N   . ASN D 31  ? 1.2587 1.5450 0.8932 -0.2019 -0.1939 0.1315  48  ASN D N   
4116 C CA  . ASN D 31  ? 1.2242 1.5121 0.8389 -0.1846 -0.1899 0.1476  48  ASN D CA  
4117 C C   . ASN D 31  ? 1.1761 1.4258 0.7860 -0.1866 -0.1806 0.1687  48  ASN D C   
4118 O O   . ASN D 31  ? 1.2125 1.4599 0.8116 -0.1730 -0.1740 0.1856  48  ASN D O   
4119 C CB  . ASN D 31  ? 1.2330 1.5565 0.8362 -0.1641 -0.1920 0.1510  48  ASN D CB  
4120 C CG  . ASN D 31  ? 1.2378 1.6071 0.8448 -0.1587 -0.2015 0.1277  48  ASN D CG  
4121 O OD1 . ASN D 31  ? 1.2459 1.6412 0.8397 -0.1421 -0.2027 0.1272  48  ASN D OD1 
4122 N ND2 . ASN D 31  ? 1.2125 1.5937 0.8389 -0.1722 -0.2073 0.1073  48  ASN D ND2 
4123 N N   . THR D 32  ? 0.9093 1.0510 0.6570 -0.1016 0.0412  -0.0066 49  THR D N   
4124 C CA  . THR D 32  ? 0.9121 1.0486 0.6634 -0.0960 0.0404  -0.0017 49  THR D CA  
4125 C C   . THR D 32  ? 0.9150 1.0356 0.6662 -0.0923 0.0390  -0.0013 49  THR D C   
4126 O O   . THR D 32  ? 0.9200 1.0325 0.6691 -0.0944 0.0384  -0.0051 49  THR D O   
4127 C CB  . THR D 32  ? 0.8930 1.0274 0.6419 -0.1008 0.0397  0.0010  49  THR D CB  
4128 O OG1 . THR D 32  ? 0.8922 1.0140 0.6346 -0.1082 0.0381  0.0013  49  THR D OG1 
4129 C CG2 . THR D 32  ? 0.8717 1.0231 0.6226 -0.1036 0.0412  -0.0003 49  THR D CG2 
4130 N N   . CYS D 33  ? 0.9164 1.0331 0.6712 -0.0868 0.0383  0.0027  50  CYS D N   
4131 C CA  . CYS D 33  ? 0.9240 1.0275 0.6803 -0.0820 0.0369  0.0037  50  CYS D CA  
4132 C C   . CYS D 33  ? 0.9063 1.0030 0.6634 -0.0807 0.0352  0.0087  50  CYS D C   
4133 O O   . CYS D 33  ? 0.8782 0.9844 0.6386 -0.0790 0.0360  0.0105  50  CYS D O   
4134 C CB  . CYS D 33  ? 0.9111 1.0232 0.6731 -0.0743 0.0384  0.0028  50  CYS D CB  
4135 S SG  . CYS D 33  ? 0.9380 1.0386 0.7042 -0.0667 0.0371  0.0049  50  CYS D SG  
4136 N N   . THR D 34  ? 0.8970 0.9780 0.6521 -0.0815 0.0327  0.0106  51  THR D N   
4137 C CA  . THR D 34  ? 0.9057 0.9812 0.6608 -0.0810 0.0307  0.0156  51  THR D CA  
4138 C C   . THR D 34  ? 0.9287 0.9895 0.6863 -0.0764 0.0283  0.0174  51  THR D C   
4139 O O   . THR D 34  ? 0.9648 1.0158 0.7230 -0.0766 0.0274  0.0148  51  THR D O   
4140 C CB  . THR D 34  ? 0.9329 1.0077 0.6817 -0.0902 0.0293  0.0186  51  THR D CB  
4141 O OG1 . THR D 34  ? 0.9288 1.0079 0.6777 -0.0899 0.0284  0.0221  51  THR D OG1 
4142 C CG2 . THR D 34  ? 0.9309 0.9898 0.6767 -0.0954 0.0262  0.0210  51  THR D CG2 
4143 N N   . SER D 35  ? 0.9252 0.9851 0.6856 -0.0720 0.0273  0.0210  52  SER D N   
4144 C CA  . SER D 35  ? 0.9104 0.9564 0.6729 -0.0684 0.0243  0.0239  52  SER D CA  
4145 C C   . SER D 35  ? 0.8946 0.9424 0.6584 -0.0664 0.0228  0.0284  52  SER D C   
4146 O O   . SER D 35  ? 0.8430 0.9033 0.6073 -0.0669 0.0243  0.0280  52  SER D O   
4147 C CB  . SER D 35  ? 0.8752 0.9184 0.6435 -0.0610 0.0253  0.0200  52  SER D CB  
4148 O OG  . SER D 35  ? 0.8804 0.9368 0.6529 -0.0557 0.0282  0.0188  52  SER D OG  
4149 N N   . LEU D 36  ? 0.8881 0.9241 0.6534 -0.0641 0.0196  0.0320  53  LEU D N   
4150 C CA  . LEU D 36  ? 0.8820 0.9192 0.6481 -0.0625 0.0175  0.0363  53  LEU D CA  
4151 C C   . LEU D 36  ? 0.8591 0.8896 0.6322 -0.0539 0.0167  0.0360  53  LEU D C   
4152 O O   . LEU D 36  ? 0.8593 0.8784 0.6348 -0.0517 0.0154  0.0352  53  LEU D O   
4153 C CB  . LEU D 36  ? 0.8971 0.9273 0.6578 -0.0696 0.0134  0.0430  53  LEU D CB  
4154 C CG  . LEU D 36  ? 0.8890 0.9251 0.6475 -0.0716 0.0109  0.0483  53  LEU D CG  
4155 C CD1 . LEU D 36  ? 0.9111 0.9370 0.6657 -0.0780 0.0061  0.0568  53  LEU D CD1 
4156 C CD2 . LEU D 36  ? 0.8705 0.9072 0.6352 -0.0635 0.0104  0.0479  53  LEU D CD2 
4157 N N   . ILE D 37  ? 0.8168 0.8552 0.5945 -0.0490 0.0176  0.0358  54  ILE D N   
4158 C CA  . ILE D 37  ? 0.8021 0.8361 0.5867 -0.0412 0.0169  0.0360  54  ILE D CA  
4159 C C   . ILE D 37  ? 0.8028 0.8368 0.5877 -0.0411 0.0139  0.0402  54  ILE D C   
4160 O O   . ILE D 37  ? 0.7627 0.8074 0.5462 -0.0442 0.0143  0.0402  54  ILE D O   
4161 C CB  . ILE D 37  ? 0.8012 0.8455 0.5929 -0.0353 0.0207  0.0324  54  ILE D CB  
4162 C CG1 . ILE D 37  ? 0.8088 0.8520 0.6017 -0.0331 0.0228  0.0289  54  ILE D CG1 
4163 C CG2 . ILE D 37  ? 0.8130 0.8571 0.6124 -0.0284 0.0199  0.0335  54  ILE D CG2 
4164 C CD1 . ILE D 37  ? 0.8438 0.8860 0.6300 -0.0394 0.0235  0.0268  54  ILE D CD1 
4165 N N   . ALA D 38  ? 0.8145 0.8378 0.6021 -0.0376 0.0107  0.0431  55  ALA D N   
4166 C CA  . ALA D 38  ? 0.8026 0.8258 0.5907 -0.0372 0.0072  0.0477  55  ALA D CA  
4167 C C   . ALA D 38  ? 0.7803 0.8014 0.5769 -0.0286 0.0071  0.0465  55  ALA D C   
4168 O O   . ALA D 38  ? 0.8063 0.8182 0.6068 -0.0243 0.0068  0.0454  55  ALA D O   
4169 C CB  . ALA D 38  ? 0.8158 0.8279 0.5995 -0.0420 0.0023  0.0545  55  ALA D CB  
4170 N N   . HIS D 39  ? 0.7988 0.8293 0.5992 -0.0264 0.0073  0.0461  56  HIS D N   
4171 C CA  . HIS D 39  ? 0.8160 0.8462 0.6253 -0.0186 0.0075  0.0448  56  HIS D CA  
4172 C C   . HIS D 39  ? 0.8306 0.8642 0.6417 -0.0180 0.0041  0.0476  56  HIS D C   
4173 O O   . HIS D 39  ? 0.8666 0.9119 0.6776 -0.0207 0.0046  0.0460  56  HIS D O   
4174 C CB  . HIS D 39  ? 0.8256 0.8664 0.6416 -0.0155 0.0120  0.0402  56  HIS D CB  
4175 C CG  . HIS D 39  ? 0.8541 0.8950 0.6798 -0.0080 0.0129  0.0393  56  HIS D CG  
4176 N ND1 . HIS D 39  ? 0.8628 0.9102 0.6963 -0.0050 0.0123  0.0389  56  HIS D ND1 
4177 C CD2 . HIS D 39  ? 0.8523 0.8889 0.6817 -0.0031 0.0142  0.0384  56  HIS D CD2 
4178 C CE1 . HIS D 39  ? 0.8777 0.9241 0.7191 0.0012  0.0133  0.0387  56  HIS D CE1 
4179 N NE2 . HIS D 39  ? 0.8690 0.9095 0.7078 0.0024  0.0144  0.0384  56  HIS D NE2 
4180 N N   . ARG D 40  ? 0.8637 0.8883 0.6775 -0.0142 0.0006  0.0510  57  ARG D N   
4181 C CA  . ARG D 40  ? 0.8687 0.8971 0.6842 -0.0136 -0.0030 0.0543  57  ARG D CA  
4182 C C   . ARG D 40  ? 0.8586 0.8973 0.6827 -0.0089 -0.0009 0.0497  57  ARG D C   
4183 O O   . ARG D 40  ? 0.9161 0.9534 0.7479 -0.0031 0.0018  0.0468  57  ARG D O   
4184 C CB  . ARG D 40  ? 0.9048 0.9209 0.7231 -0.0099 -0.0075 0.0591  57  ARG D CB  
4185 C CG  . ARG D 40  ? 0.9834 0.9930 0.7949 -0.0160 -0.0126 0.0671  57  ARG D CG  
4186 C CD  . ARG D 40  ? 1.0365 1.0314 0.8537 -0.0120 -0.0172 0.0717  57  ARG D CD  
4187 N NE  . ARG D 40  ? 1.0915 1.0746 0.9058 -0.0166 -0.0192 0.0754  57  ARG D NE  
4188 C CZ  . ARG D 40  ? 1.1389 1.1107 0.9578 -0.0137 -0.0177 0.0711  57  ARG D CZ  
4189 N NH1 . ARG D 40  ? 1.1685 1.1401 0.9944 -0.0063 -0.0142 0.0634  57  ARG D NH1 
4190 N NH2 . ARG D 40  ? 1.1746 1.1362 0.9918 -0.0188 -0.0199 0.0743  57  ARG D NH2 
4191 N N   . VAL D 41  ? 0.8658 0.9162 0.6896 -0.0118 -0.0021 0.0491  58  VAL D N   
4192 C CA  . VAL D 41  ? 0.8613 0.9222 0.6953 -0.0081 -0.0005 0.0439  58  VAL D CA  
4193 C C   . VAL D 41  ? 0.9182 0.9837 0.7535 -0.0075 -0.0048 0.0460  58  VAL D C   
4194 O O   . VAL D 41  ? 0.9540 1.0267 0.7820 -0.0133 -0.0077 0.0483  58  VAL D O   
4195 C CB  . VAL D 41  ? 0.8292 0.9038 0.6649 -0.0120 0.0023  0.0379  58  VAL D CB  
4196 C CG1 . VAL D 41  ? 0.8142 0.8978 0.6642 -0.0076 0.0040  0.0320  58  VAL D CG1 
4197 C CG2 . VAL D 41  ? 0.8212 0.8927 0.6541 -0.0137 0.0059  0.0368  58  VAL D CG2 
4198 N N   . ASP D 42  ? 0.9543 1.0175 0.7990 -0.0009 -0.0052 0.0453  59  ASP D N   
4199 C CA  . ASP D 42  ? 0.9667 1.0345 0.8138 0.0002  -0.0094 0.0472  59  ASP D CA  
4200 C C   . ASP D 42  ? 0.9500 1.0349 0.8032 -0.0014 -0.0085 0.0403  59  ASP D C   
4201 O O   . ASP D 42  ? 0.9649 1.0540 0.8297 0.0031  -0.0077 0.0362  59  ASP D O   
4202 C CB  . ASP D 42  ? 0.9654 1.0242 0.8205 0.0078  -0.0104 0.0489  59  ASP D CB  
4203 C CG  . ASP D 42  ? 0.9755 1.0190 0.8255 0.0090  -0.0129 0.0551  59  ASP D CG  
4204 O OD1 . ASP D 42  ? 0.9572 0.9981 0.8016 0.0061  -0.0180 0.0615  59  ASP D OD1 
4205 O OD2 . ASP D 42  ? 0.9653 1.0005 0.8179 0.0125  -0.0100 0.0536  59  ASP D OD2 
4206 N N   . ALA D 43  ? 0.9146 1.0098 0.7603 -0.0084 -0.0087 0.0387  60  ALA D N   
4207 C CA  . ALA D 43  ? 0.8628 0.9765 0.7137 -0.0113 -0.0079 0.0306  60  ALA D CA  
4208 C C   . ALA D 43  ? 0.8667 0.9904 0.7048 -0.0200 -0.0091 0.0318  60  ALA D C   
4209 O O   . ALA D 43  ? 0.8724 0.9870 0.6998 -0.0233 -0.0097 0.0385  60  ALA D O   
4210 C CB  . ALA D 43  ? 0.8446 0.9612 0.7082 -0.0086 -0.0030 0.0223  60  ALA D CB  
4211 N N   . PRO D 44  ? 0.8671 1.0109 0.7068 -0.0241 -0.0095 0.0248  61  PRO D N   
4212 C CA  . PRO D 44  ? 0.8425 0.9990 0.6694 -0.0330 -0.0108 0.0264  61  PRO D CA  
4213 C C   . PRO D 44  ? 0.8126 0.9757 0.6404 -0.0365 -0.0062 0.0188  61  PRO D C   
4214 O O   . PRO D 44  ? 0.8110 0.9774 0.6523 -0.0329 -0.0027 0.0091  61  PRO D O   
4215 C CB  . PRO D 44  ? 0.8744 1.0523 0.7033 -0.0356 -0.0134 0.0214  61  PRO D CB  
4216 C CG  . PRO D 44  ? 0.8685 1.0481 0.7154 -0.0288 -0.0112 0.0111  61  PRO D CG  
4217 C CD  . PRO D 44  ? 0.8563 1.0133 0.7096 -0.0213 -0.0092 0.0151  61  PRO D CD  
4218 N N   . ALA D 45  ? 0.8010 0.9665 0.6156 -0.0436 -0.0066 0.0237  62  ALA D N   
4219 C CA  . ALA D 45  ? 0.7834 0.9553 0.5973 -0.0475 -0.0026 0.0175  62  ALA D CA  
4220 C C   . ALA D 45  ? 0.7721 0.9598 0.6009 -0.0458 0.0008  0.0025  62  ALA D C   
4221 O O   . ALA D 45  ? 0.8242 1.0068 0.6621 -0.0428 0.0045  -0.0024 62  ALA D O   
4222 C CB  . ALA D 45  ? 0.7753 0.9585 0.5740 -0.0574 -0.0042 0.0225  62  ALA D CB  
4223 N N   . HIS D 46  ? 0.7431 0.9502 0.5761 -0.0478 -0.0005 -0.0047 63  HIS D N   
4224 C CA  . HIS D 46  ? 0.7377 0.9624 0.5856 -0.0476 0.0025  -0.0205 63  HIS D CA  
4225 C C   . HIS D 46  ? 0.7087 0.9230 0.5772 -0.0390 0.0049  -0.0265 63  HIS D C   
4226 O O   . HIS D 46  ? 0.7187 0.9409 0.6011 -0.0382 0.0079  -0.0373 63  HIS D O   
4227 C CB  . HIS D 46  ? 0.7632 1.0134 0.6121 -0.0517 0.0004  -0.0287 63  HIS D CB  
4228 C CG  . HIS D 46  ? 0.7344 0.9826 0.5926 -0.0462 -0.0020 -0.0296 63  HIS D CG  
4229 N ND1 . HIS D 46  ? 0.7474 0.9944 0.5947 -0.0472 -0.0065 -0.0193 63  HIS D ND1 
4230 C CD2 . HIS D 46  ? 0.7273 0.9748 0.6059 -0.0397 -0.0007 -0.0392 63  HIS D CD2 
4231 C CE1 . HIS D 46  ? 0.7495 0.9956 0.6091 -0.0415 -0.0078 -0.0232 63  HIS D CE1 
4232 N NE2 . HIS D 46  ? 0.7466 0.9929 0.6253 -0.0371 -0.0042 -0.0352 63  HIS D NE2 
4233 N N   . ALA D 47  ? 0.6963 0.8941 0.5679 -0.0327 0.0034  -0.0194 64  ALA D N   
4234 C CA  . ALA D 47  ? 0.7069 0.8953 0.5978 -0.0250 0.0054  -0.0228 64  ALA D CA  
4235 C C   . ALA D 47  ? 0.7233 0.8965 0.6143 -0.0227 0.0083  -0.0175 64  ALA D C   
4236 O O   . ALA D 47  ? 0.7353 0.9062 0.6431 -0.0184 0.0106  -0.0216 64  ALA D O   
4237 C CB  . ALA D 47  ? 0.6983 0.8773 0.5930 -0.0195 0.0030  -0.0176 64  ALA D CB  
4238 N N   . ILE D 48  ? 0.7306 0.8941 0.6035 -0.0257 0.0077  -0.0080 65  ILE D N   
4239 C CA  . ILE D 48  ? 0.7267 0.8783 0.5969 -0.0248 0.0102  -0.0034 65  ILE D CA  
4240 C C   . ILE D 48  ? 0.7423 0.9057 0.6150 -0.0291 0.0129  -0.0108 65  ILE D C   
4241 O O   . ILE D 48  ? 0.7439 0.9044 0.6269 -0.0264 0.0155  -0.0128 65  ILE D O   
4242 C CB  . ILE D 48  ? 0.7358 0.8743 0.5872 -0.0273 0.0085  0.0075  65  ILE D CB  
4243 C CG1 . ILE D 48  ? 0.7423 0.8691 0.5928 -0.0225 0.0057  0.0144  65  ILE D CG1 
4244 C CG2 . ILE D 48  ? 0.7487 0.8770 0.5972 -0.0269 0.0112  0.0108  65  ILE D CG2 
4245 C CD1 . ILE D 48  ? 0.7751 0.8925 0.6095 -0.0258 0.0025  0.0241  65  ILE D CD1 
4246 N N   . TRP D 49  ? 0.7460 0.9240 0.6093 -0.0361 0.0120  -0.0145 66  TRP D N   
4247 C CA  . TRP D 49  ? 0.7328 0.9248 0.5975 -0.0410 0.0145  -0.0224 66  TRP D CA  
4248 C C   . TRP D 49  ? 0.7114 0.9124 0.5996 -0.0369 0.0166  -0.0345 66  TRP D C   
4249 O O   . TRP D 49  ? 0.6710 0.8759 0.5661 -0.0375 0.0191  -0.0392 66  TRP D O   
4250 C CB  . TRP D 49  ? 0.7881 0.9989 0.6409 -0.0492 0.0129  -0.0254 66  TRP D CB  
4251 C CG  . TRP D 49  ? 0.7880 1.0162 0.6408 -0.0551 0.0154  -0.0342 66  TRP D CG  
4252 C CD1 . TRP D 49  ? 0.7684 1.0210 0.6289 -0.0585 0.0162  -0.0476 66  TRP D CD1 
4253 C CD2 . TRP D 49  ? 0.7913 1.0151 0.6367 -0.0583 0.0176  -0.0309 66  TRP D CD2 
4254 N NE1 . TRP D 49  ? 0.8022 1.0661 0.6606 -0.0636 0.0188  -0.0529 66  TRP D NE1 
4255 C CE2 . TRP D 49  ? 0.8033 1.0495 0.6522 -0.0636 0.0196  -0.0424 66  TRP D CE2 
4256 C CE3 . TRP D 49  ? 0.7674 0.9718 0.6039 -0.0575 0.0180  -0.0203 66  TRP D CE3 
4257 C CZ2 . TRP D 49  ? 0.8095 1.0586 0.6535 -0.0678 0.0219  -0.0428 66  TRP D CZ2 
4258 C CZ3 . TRP D 49  ? 0.7665 0.9737 0.5978 -0.0618 0.0202  -0.0207 66  TRP D CZ3 
4259 C CH2 . TRP D 49  ? 0.7913 1.0202 0.6261 -0.0669 0.0221  -0.0314 66  TRP D CH2 
4260 N N   . ARG D 50  ? 0.7230 0.9275 0.6248 -0.0329 0.0154  -0.0396 67  ARG D N   
4261 C CA  . ARG D 50  ? 0.7084 0.9210 0.6359 -0.0290 0.0168  -0.0514 67  ARG D CA  
4262 C C   . ARG D 50  ? 0.6932 0.8942 0.6307 -0.0249 0.0189  -0.0473 67  ARG D C   
4263 O O   . ARG D 50  ? 0.6980 0.9071 0.6525 -0.0242 0.0205  -0.0559 67  ARG D O   
4264 C CB  . ARG D 50  ? 0.7272 0.9381 0.6687 -0.0238 0.0150  -0.0535 67  ARG D CB  
4265 C CG  . ARG D 50  ? 0.7557 0.9827 0.6929 -0.0274 0.0128  -0.0605 67  ARG D CG  
4266 N N   . PHE D 51  ? 0.6836 0.8665 0.6111 -0.0222 0.0187  -0.0344 68  PHE D N   
4267 C CA  . PHE D 51  ? 0.6460 0.8186 0.5818 -0.0182 0.0205  -0.0288 68  PHE D CA  
4268 C C   . PHE D 51  ? 0.6561 0.8292 0.5800 -0.0225 0.0222  -0.0267 68  PHE D C   
4269 O O   . PHE D 51  ? 0.6629 0.8408 0.5998 -0.0217 0.0238  -0.0305 68  PHE D O   
4270 C CB  . PHE D 51  ? 0.6233 0.7797 0.5551 -0.0135 0.0197  -0.0175 68  PHE D CB  
4271 C CG  . PHE D 51  ? 0.6058 0.7621 0.5523 -0.0089 0.0183  -0.0195 68  PHE D CG  
4272 C CD1 . PHE D 51  ? 0.5894 0.7490 0.5617 -0.0048 0.0189  -0.0235 68  PHE D CD1 
4273 C CD2 . PHE D 51  ? 0.5989 0.7523 0.5353 -0.0089 0.0161  -0.0170 68  PHE D CD2 
4274 C CE1 . PHE D 51  ? 0.5921 0.7520 0.5795 -0.0011 0.0175  -0.0256 68  PHE D CE1 
4275 C CE2 . PHE D 51  ? 0.6108 0.7650 0.5612 -0.0049 0.0148  -0.0193 68  PHE D CE2 
4276 C CZ  . PHE D 51  ? 0.5979 0.7554 0.5737 -0.0011 0.0156  -0.0238 68  PHE D CZ  
4277 N N   . VAL D 52  ? 0.6604 0.8291 0.5613 -0.0272 0.0216  -0.0208 69  VAL D N   
4278 C CA  . VAL D 52  ? 0.6642 0.8335 0.5529 -0.0320 0.0231  -0.0189 69  VAL D CA  
4279 C C   . VAL D 52  ? 0.6881 0.8745 0.5865 -0.0352 0.0247  -0.0298 69  VAL D C   
4280 O O   . VAL D 52  ? 0.7342 0.9210 0.6370 -0.0352 0.0265  -0.0299 69  VAL D O   
4281 C CB  . VAL D 52  ? 0.6836 0.8494 0.5487 -0.0381 0.0216  -0.0129 69  VAL D CB  
4282 C CG1 . VAL D 52  ? 0.7074 0.8726 0.5612 -0.0431 0.0231  -0.0104 69  VAL D CG1 
4283 C CG2 . VAL D 52  ? 0.6928 0.8422 0.5504 -0.0346 0.0196  -0.0032 69  VAL D CG2 
4284 N N   . ARG D 53  ? 0.7124 0.9142 0.6150 -0.0379 0.0241  -0.0396 70  ARG D N   
4285 C CA  . ARG D 53  ? 0.7215 0.9424 0.6346 -0.0411 0.0257  -0.0524 70  ARG D CA  
4286 C C   . ARG D 53  ? 0.7052 0.9287 0.6469 -0.0350 0.0267  -0.0599 70  ARG D C   
4287 O O   . ARG D 53  ? 0.7224 0.9587 0.6748 -0.0366 0.0282  -0.0691 70  ARG D O   
4288 C CB  . ARG D 53  ? 0.7359 0.9756 0.6463 -0.0457 0.0248  -0.0621 70  ARG D CB  
4289 C CG  . ARG D 53  ? 0.7578 1.0015 0.6865 -0.0409 0.0234  -0.0696 70  ARG D CG  
4290 C CD  . ARG D 53  ? 0.7948 1.0558 0.7151 -0.0460 0.0219  -0.0759 70  ARG D CD  
4291 N NE  . ARG D 53  ? 0.8123 1.0981 0.7347 -0.0521 0.0236  -0.0894 70  ARG D NE  
4292 C CZ  . ARG D 53  ? 0.7985 1.1009 0.7442 -0.0505 0.0247  -0.1064 70  ARG D CZ  
4293 N NH1 . ARG D 53  ? 0.7887 1.0855 0.7592 -0.0432 0.0242  -0.1119 70  ARG D NH1 
4294 N NH2 . ARG D 53  ? 0.8246 1.1506 0.7704 -0.0563 0.0265  -0.1187 70  ARG D NH2 
4295 N N   . ASP D 54  ? 0.7047 0.9169 0.6600 -0.0283 0.0257  -0.0555 71  ASP D N   
4296 C CA  . ASP D 54  ? 0.6971 0.9119 0.6825 -0.0228 0.0259  -0.0614 71  ASP D CA  
4297 C C   . ASP D 54  ? 0.7056 0.9153 0.6958 -0.0213 0.0271  -0.0555 71  ASP D C   
4298 O O   . ASP D 54  ? 0.7080 0.9074 0.7089 -0.0163 0.0267  -0.0469 71  ASP D O   
4299 C CB  . ASP D 54  ? 0.7053 0.9099 0.7029 -0.0169 0.0243  -0.0568 71  ASP D CB  
4300 C CG  . ASP D 54  ? 0.7047 0.9155 0.7360 -0.0124 0.0237  -0.0660 71  ASP D CG  
4301 O OD1 . ASP D 54  ? 0.6971 0.9139 0.7447 -0.0117 0.0245  -0.0708 71  ASP D OD1 
4302 O OD2 . ASP D 54  ? 0.7073 0.9168 0.7501 -0.0094 0.0223  -0.0683 71  ASP D OD2 
4303 N N   . PHE D 55  ? 0.7286 0.9481 0.7116 -0.0261 0.0286  -0.0604 72  PHE D N   
4304 C CA  . PHE D 55  ? 0.7550 0.9713 0.7363 -0.0263 0.0298  -0.0544 72  PHE D CA  
4305 C C   . PHE D 55  ? 0.7798 0.9953 0.7900 -0.0202 0.0292  -0.0537 72  PHE D C   
4306 O O   . PHE D 55  ? 0.7810 0.9911 0.7906 -0.0190 0.0296  -0.0448 72  PHE D O   
4307 C CB  . PHE D 55  ? 0.7737 1.0049 0.7470 -0.0327 0.0313  -0.0632 72  PHE D CB  
4308 C CG  . PHE D 55  ? 0.7577 0.9871 0.7258 -0.0341 0.0326  -0.0577 72  PHE D CG  
4309 C CD1 . PHE D 55  ? 0.7450 0.9635 0.6883 -0.0372 0.0330  -0.0464 72  PHE D CD1 
4310 C CD2 . PHE D 55  ? 0.7379 0.9776 0.7271 -0.0325 0.0331  -0.0647 72  PHE D CD2 
4311 C CE1 . PHE D 55  ? 0.7740 0.9923 0.7126 -0.0389 0.0341  -0.0423 72  PHE D CE1 
4312 C CE2 . PHE D 55  ? 0.7659 1.0055 0.7502 -0.0340 0.0341  -0.0598 72  PHE D CE2 
4313 C CZ  . PHE D 55  ? 0.7928 1.0220 0.7513 -0.0374 0.0347  -0.0486 72  PHE D CZ  
4314 N N   . ALA D 56  ? 0.8049 1.0267 0.8415 -0.0167 0.0282  -0.0631 73  ALA D N   
4315 C CA  . ALA D 56  ? 0.8038 1.0252 0.8717 -0.0111 0.0270  -0.0621 73  ALA D CA  
4316 C C   . ALA D 56  ? 0.7778 0.9853 0.8525 -0.0060 0.0255  -0.0491 73  ALA D C   
4317 O O   . ALA D 56  ? 0.8009 1.0069 0.9017 -0.0015 0.0240  -0.0450 73  ALA D O   
4318 C CB  . ALA D 56  ? 0.8110 1.0459 0.9079 -0.0097 0.0263  -0.0793 73  ALA D CB  
4319 N N   . ASN D 57  ? 0.7481 0.9465 0.8009 -0.0069 0.0256  -0.0424 74  ASN D N   
4320 C CA  . ASN D 57  ? 0.7451 0.9320 0.8023 -0.0025 0.0245  -0.0309 74  ASN D CA  
4321 C C   . ASN D 57  ? 0.7402 0.9163 0.7670 -0.0041 0.0253  -0.0199 74  ASN D C   
4322 O O   . ASN D 57  ? 0.7255 0.8961 0.7432 -0.0036 0.0248  -0.0187 74  ASN D O   
4323 C CB  . ASN D 57  ? 0.7775 0.9655 0.8507 -0.0002 0.0231  -0.0382 74  ASN D CB  
4324 C CG  . ASN D 57  ? 0.8219 1.0213 0.9266 0.0011  0.0222  -0.0522 74  ASN D CG  
4325 O OD1 . ASN D 57  ? 0.8548 1.0558 0.9832 0.0038  0.0214  -0.0506 74  ASN D OD1 
4326 N ND2 . ASN D 57  ? 0.8519 1.0601 0.9583 -0.0006 0.0220  -0.0662 74  ASN D ND2 
4327 N N   . PRO D 58  ? 0.7577 0.9312 0.7701 -0.0059 0.0265  -0.0122 75  PRO D N   
4328 C CA  . PRO D 58  ? 0.7590 0.9222 0.7468 -0.0067 0.0272  -0.0023 75  PRO D CA  
4329 C C   . PRO D 58  ? 0.7578 0.9141 0.7533 -0.0019 0.0266  0.0081  75  PRO D C   
4330 O O   . PRO D 58  ? 0.7097 0.8580 0.6890 -0.0016 0.0268  0.0134  75  PRO D O   
4331 C CB  . PRO D 58  ? 0.7748 0.9398 0.7503 -0.0099 0.0285  0.0010  75  PRO D CB  
4332 C CG  . PRO D 58  ? 0.7785 0.9531 0.7774 -0.0085 0.0282  -0.0021 75  PRO D CG  
4333 C CD  . PRO D 58  ? 0.7692 0.9501 0.7873 -0.0074 0.0272  -0.0137 75  PRO D CD  
4334 N N   . ASN D 59  ? 0.8021 0.9622 0.8234 0.0016  0.0257  0.0113  76  ASN D N   
4335 C CA  . ASN D 59  ? 0.8222 0.9781 0.8537 0.0057  0.0249  0.0214  76  ASN D CA  
4336 C C   . ASN D 59  ? 0.7854 0.9358 0.8154 0.0074  0.0243  0.0189  76  ASN D C   
4337 O O   . ASN D 59  ? 0.7690 0.9158 0.8034 0.0103  0.0240  0.0270  76  ASN D O   
4338 C CB  . ASN D 59  ? 0.8438 1.0055 0.9073 0.0088  0.0234  0.0255  76  ASN D CB  
4339 C CG  . ASN D 59  ? 0.8700 1.0362 0.9576 0.0097  0.0219  0.0132  76  ASN D CG  
4340 O OD1 . ASN D 59  ? 0.8046 0.9693 0.9094 0.0122  0.0206  0.0113  76  ASN D OD1 
4341 N ND2 . ASN D 59  ? 0.8590 1.0320 0.9488 0.0074  0.0223  0.0039  76  ASN D ND2 
4342 N N   . LYS D 60  ? 0.7918 0.9433 0.8160 0.0053  0.0240  0.0077  77  LYS D N   
4343 C CA  . LYS D 60  ? 0.7772 0.9248 0.7975 0.0062  0.0230  0.0048  77  LYS D CA  
4344 C C   . LYS D 60  ? 0.7662 0.9049 0.7617 0.0059  0.0237  0.0124  77  LYS D C   
4345 O O   . LYS D 60  ? 0.8054 0.9395 0.8014 0.0086  0.0230  0.0158  77  LYS D O   
4346 C CB  . LYS D 60  ? 0.7818 0.9356 0.7981 0.0030  0.0225  -0.0083 77  LYS D CB  
4347 C CG  . LYS D 60  ? 0.8025 0.9603 0.8365 0.0050  0.0209  -0.0162 77  LYS D CG  
4348 C CD  . LYS D 60  ? 0.7918 0.9597 0.8542 0.0056  0.0204  -0.0267 77  LYS D CD  
4349 N N   . TYR D 61  ? 0.7450 0.8817 0.7203 0.0027  0.0248  0.0143  78  TYR D N   
4350 C CA  . TYR D 61  ? 0.7453 0.8734 0.6986 0.0022  0.0253  0.0202  78  TYR D CA  
4351 C C   . TYR D 61  ? 0.7068 0.8335 0.6494 0.0011  0.0269  0.0267  78  TYR D C   
4352 O O   . TYR D 61  ? 0.6533 0.7735 0.5804 0.0011  0.0274  0.0306  78  TYR D O   
4353 C CB  . TYR D 61  ? 0.7307 0.8557 0.6658 -0.0013 0.0243  0.0150  78  TYR D CB  
4354 C CG  . TYR D 61  ? 0.7481 0.8753 0.6683 -0.0070 0.0249  0.0119  78  TYR D CG  
4355 C CD1 . TYR D 61  ? 0.7716 0.8919 0.6733 -0.0092 0.0255  0.0167  78  TYR D CD1 
4356 C CD2 . TYR D 61  ? 0.7700 0.9072 0.6953 -0.0103 0.0248  0.0033  78  TYR D CD2 
4357 C CE1 . TYR D 61  ? 0.7703 0.8925 0.6590 -0.0149 0.0260  0.0143  78  TYR D CE1 
4358 C CE2 . TYR D 61  ? 0.7618 0.9023 0.6733 -0.0160 0.0255  0.0008  78  TYR D CE2 
4359 C CZ  . TYR D 61  ? 0.7552 0.8877 0.6483 -0.0184 0.0260  0.0069  78  TYR D CZ  
4360 O OH  . TYR D 61  ? 0.7462 0.8818 0.6262 -0.0245 0.0266  0.0050  78  TYR D OH  
4361 N N   . LYS D 62  ? 0.7265 0.8603 0.6786 0.0003  0.0277  0.0273  79  LYS D N   
4362 C CA  . LYS D 62  ? 0.7377 0.8729 0.6821 -0.0006 0.0291  0.0336  79  LYS D CA  
4363 C C   . LYS D 62  ? 0.7207 0.8615 0.6828 0.0031  0.0291  0.0422  79  LYS D C   
4364 O O   . LYS D 62  ? 0.6812 0.8284 0.6645 0.0044  0.0282  0.0427  79  LYS D O   
4365 C CB  . LYS D 62  ? 0.7622 0.9031 0.7038 -0.0045 0.0296  0.0293  79  LYS D CB  
4366 C CG  . LYS D 62  ? 0.7874 0.9249 0.7116 -0.0092 0.0296  0.0221  79  LYS D CG  
4367 C CD  . LYS D 62  ? 0.7858 0.9293 0.7044 -0.0137 0.0305  0.0191  79  LYS D CD  
4368 C CE  . LYS D 62  ? 0.7844 0.9283 0.6906 -0.0189 0.0303  0.0115  79  LYS D CE  
4369 N NZ  . LYS D 62  ? 0.8212 0.9723 0.7227 -0.0236 0.0314  0.0083  79  LYS D NZ  
4370 N N   . HIS D 63  ? 0.7270 0.8661 0.6812 0.0046  0.0300  0.0490  80  HIS D N   
4371 C CA  . HIS D 63  ? 0.7145 0.8600 0.6839 0.0077  0.0300  0.0584  80  HIS D CA  
4372 C C   . HIS D 63  ? 0.7101 0.8660 0.6863 0.0068  0.0303  0.0654  80  HIS D C   
4373 O O   . HIS D 63  ? 0.7426 0.9058 0.7384 0.0088  0.0294  0.0735  80  HIS D O   
4374 C CB  . HIS D 63  ? 0.7245 0.8674 0.6829 0.0094  0.0311  0.0623  80  HIS D CB  
4375 C CG  . HIS D 63  ? 0.7453 0.8974 0.7174 0.0119  0.0313  0.0728  80  HIS D CG  
4376 N ND1 . HIS D 63  ? 0.7770 0.9380 0.7416 0.0111  0.0329  0.0794  80  HIS D ND1 
4377 C CD2 . HIS D 63  ? 0.7331 0.8886 0.7269 0.0144  0.0301  0.0782  80  HIS D CD2 
4378 C CE1 . HIS D 63  ? 0.7706 0.9411 0.7506 0.0129  0.0327  0.0892  80  HIS D CE1 
4379 N NE2 . HIS D 63  ? 0.7864 0.9528 0.7848 0.0150  0.0309  0.0891  80  HIS D NE2 
4380 N N   . PHE D 64  ? 0.7305 0.8877 0.6915 0.0034  0.0313  0.0629  81  PHE D N   
4381 C CA  . PHE D 64  ? 0.7490 0.9175 0.7148 0.0023  0.0315  0.0696  81  PHE D CA  
4382 C C   . PHE D 64  ? 0.7564 0.9291 0.7388 0.0017  0.0300  0.0671  81  PHE D C   
4383 O O   . PHE D 64  ? 0.7703 0.9524 0.7578 0.0006  0.0297  0.0719  81  PHE D O   
4384 C CB  . PHE D 64  ? 0.7554 0.9250 0.6981 -0.0008 0.0333  0.0682  81  PHE D CB  
4385 C CG  . PHE D 64  ? 0.7661 0.9330 0.6962 0.0002  0.0347  0.0695  81  PHE D CG  
4386 C CD1 . PHE D 64  ? 0.7906 0.9677 0.7277 0.0022  0.0351  0.0787  81  PHE D CD1 
4387 C CD2 . PHE D 64  ? 0.7669 0.9217 0.6800 -0.0007 0.0352  0.0618  81  PHE D CD2 
4388 C CE1 . PHE D 64  ? 0.7940 0.9702 0.7208 0.0034  0.0366  0.0785  81  PHE D CE1 
4389 C CE2 . PHE D 64  ? 0.7559 0.9081 0.6600 0.0008  0.0362  0.0620  81  PHE D CE2 
4390 C CZ  . PHE D 64  ? 0.7816 0.9448 0.6925 0.0030  0.0371  0.0695  81  PHE D CZ  
4391 N N   . ILE D 65  ? 0.7751 0.9423 0.7675 0.0025  0.0290  0.0591  82  ILE D N   
4392 C CA  . ILE D 65  ? 0.7744 0.9465 0.7868 0.0026  0.0275  0.0550  82  ILE D CA  
4393 C C   . ILE D 65  ? 0.7766 0.9510 0.8187 0.0067  0.0254  0.0601  82  ILE D C   
4394 O O   . ILE D 65  ? 0.7656 0.9344 0.8142 0.0085  0.0248  0.0559  82  ILE D O   
4395 C CB  . ILE D 65  ? 0.7253 0.8932 0.7303 0.0002  0.0279  0.0410  82  ILE D CB  
4396 C CG1 . ILE D 65  ? 0.6665 0.8330 0.6449 -0.0044 0.0296  0.0376  82  ILE D CG1 
4397 C CG2 . ILE D 65  ? 0.7380 0.9130 0.7663 0.0007  0.0265  0.0349  82  ILE D CG2 
4398 N N   . LYS D 66  ? 0.7979 0.9810 0.8588 0.0078  0.0238  0.0697  83  LYS D N   
4399 C CA  . LYS D 66  ? 0.8106 0.9960 0.9028 0.0112  0.0213  0.0765  83  LYS D CA  
4400 C C   . LYS D 66  ? 0.7971 0.9792 0.9093 0.0125  0.0198  0.0637  83  LYS D C   
4401 O O   . LYS D 66  ? 0.7971 0.9744 0.9208 0.0145  0.0191  0.0603  83  LYS D O   
4402 C CB  . LYS D 66  ? 0.8270 1.0234 0.9364 0.0117  0.0192  0.0904  83  LYS D CB  
4403 C CG  . LYS D 66  ? 0.8055 1.0048 0.9476 0.0147  0.0162  0.1015  83  LYS D CG  
4404 N N   . SER D 67  ? 0.7895 0.9757 0.9058 0.0112  0.0196  0.0557  84  SER D N   
4405 C CA  . SER D 67  ? 0.7723 0.9588 0.9072 0.0120  0.0186  0.0411  84  SER D CA  
4406 C C   . SER D 67  ? 0.7804 0.9712 0.9021 0.0087  0.0201  0.0295  84  SER D C   
4407 O O   . SER D 67  ? 0.7434 0.9368 0.8458 0.0061  0.0214  0.0340  84  SER D O   
4408 C CB  . SER D 67  ? 0.7414 0.9323 0.9164 0.0155  0.0152  0.0454  84  SER D CB  
4409 O OG  . SER D 67  ? 0.7546 0.9532 0.9373 0.0150  0.0141  0.0486  84  SER D OG  
4410 N N   . CYS D 68  ? 0.8018 0.9949 0.9351 0.0086  0.0199  0.0141  85  CYS D N   
4411 C CA  . CYS D 68  ? 0.7890 0.9881 0.9104 0.0049  0.0215  0.0015  85  CYS D CA  
4412 C C   . CYS D 68  ? 0.7637 0.9715 0.9163 0.0066  0.0200  -0.0112 85  CYS D C   
4413 O O   . CYS D 68  ? 0.7356 0.9430 0.9128 0.0095  0.0183  -0.0168 85  CYS D O   
4414 C CB  . CYS D 68  ? 0.7848 0.9802 0.8790 0.0014  0.0236  -0.0071 85  CYS D CB  
4415 S SG  . CYS D 68  ? 0.8164 1.0198 0.8893 -0.0046 0.0259  -0.0190 85  CYS D SG  
4416 N N   . THR D 69  ? 0.7833 0.9997 0.9361 0.0046  0.0205  -0.0167 86  THR D N   
4417 C CA  . THR D 69  ? 0.7974 1.0239 0.9791 0.0060  0.0194  -0.0313 86  THR D CA  
4418 C C   . THR D 69  ? 0.8063 1.0426 0.9704 0.0011  0.0221  -0.0451 86  THR D C   
4419 O O   . THR D 69  ? 0.7940 1.0317 0.9367 -0.0021 0.0235  -0.0396 86  THR D O   
4420 C CB  . THR D 69  ? 0.8052 1.0351 1.0196 0.0101  0.0162  -0.0234 86  THR D CB  
4421 O OG1 . THR D 69  ? 0.8746 1.0976 1.1129 0.0145  0.0134  -0.0134 86  THR D OG1 
4422 C CG2 . THR D 69  ? 0.8105 1.0518 1.0532 0.0113  0.0153  -0.0399 86  THR D CG2 
4423 N N   . ILE D 70  ? 0.8011 1.0455 0.9745 0.0001  0.0227  -0.0631 87  ILE D N   
4424 C CA  . ILE D 70  ? 0.8130 1.0707 0.9749 -0.0046 0.0251  -0.0776 87  ILE D CA  
4425 C C   . ILE D 70  ? 0.8441 1.1117 1.0315 -0.0026 0.0240  -0.0818 87  ILE D C   
4426 O O   . ILE D 70  ? 0.8844 1.1541 1.1090 0.0025  0.0213  -0.0857 87  ILE D O   
4427 C CB  . ILE D 70  ? 0.7860 1.0532 0.9523 -0.0063 0.0260  -0.0964 87  ILE D CB  
4428 C CG1 . ILE D 70  ? 0.7792 1.0379 0.9169 -0.0091 0.0270  -0.0916 87  ILE D CG1 
4429 C CG2 . ILE D 70  ? 0.7678 1.0530 0.9282 -0.0113 0.0283  -0.1123 87  ILE D CG2 
4430 C CD1 . ILE D 70  ? 0.7834 1.0367 0.8815 -0.0145 0.0290  -0.0815 87  ILE D CD1 
4431 N N   . ARG D 71  ? 0.8863 1.1598 1.0544 -0.0068 0.0258  -0.0810 88  ARG D N   
4432 C CA  . ARG D 71  ? 0.8993 1.1821 1.0872 -0.0052 0.0248  -0.0826 88  ARG D CA  
4433 C C   . ARG D 71  ? 0.9486 1.2497 1.1436 -0.0081 0.0266  -0.1033 88  ARG D C   
4434 O O   . ARG D 71  ? 1.0197 1.3303 1.2436 -0.0051 0.0251  -0.1101 88  ARG D O   
4435 C CB  . ARG D 71  ? 0.8932 1.1723 1.0556 -0.0081 0.0256  -0.0680 88  ARG D CB  
4436 C CG  . ARG D 71  ? 0.9115 1.1760 1.0643 -0.0060 0.0242  -0.0479 88  ARG D CG  
4437 C CD  . ARG D 71  ? 0.9163 1.1814 1.0950 -0.0011 0.0208  -0.0354 88  ARG D CD  
4438 N NE  . ARG D 71  ? 0.9085 1.1697 1.1222 0.0048  0.0174  -0.0333 88  ARG D NE  
4439 C CZ  . ARG D 71  ? 0.8976 1.1542 1.1287 0.0088  0.0141  -0.0163 88  ARG D CZ  
4440 N NH1 . ARG D 71  ? 0.9032 1.1599 1.1187 0.0076  0.0138  -0.0005 88  ARG D NH1 
4441 N NH2 . ARG D 71  ? 0.8691 1.1221 1.1335 0.0138  0.0109  -0.0150 88  ARG D NH2 
4442 N N   . VAL D 72  ? 1.0087 1.3160 1.1779 -0.0142 0.0297  -0.1130 89  VAL D N   
4443 C CA  . VAL D 72  ? 1.0898 1.4172 1.2591 -0.0186 0.0321  -0.1312 89  VAL D CA  
4444 C C   . VAL D 72  ? 1.1268 1.4678 1.3170 -0.0179 0.0324  -0.1524 89  VAL D C   
4445 O O   . VAL D 72  ? 1.1145 1.4720 1.3312 -0.0165 0.0325  -0.1687 89  VAL D O   
4446 C CB  . VAL D 72  ? 1.0885 1.4187 1.2156 -0.0273 0.0354  -0.1283 89  VAL D CB  
4447 C CG1 . VAL D 72  ? 1.1102 1.4366 1.2152 -0.0309 0.0364  -0.1293 89  VAL D CG1 
4448 C CG2 . VAL D 72  ? 1.0402 1.3922 1.1676 -0.0322 0.0378  -0.1433 89  VAL D CG2 
4449 N N   . ASN D 73  ? 1.1069 1.4425 1.2868 -0.0187 0.0325  -0.1529 90  ASN D N   
4450 C CA  . ASN D 73  ? 1.1192 1.4707 1.3111 -0.0199 0.0334  -0.1737 90  ASN D CA  
4451 C C   . ASN D 73  ? 1.1305 1.4752 1.3554 -0.0130 0.0305  -0.1778 90  ASN D C   
4452 O O   . ASN D 73  ? 1.1214 1.4490 1.3386 -0.0110 0.0291  -0.1645 90  ASN D O   
4453 C CB  . ASN D 73  ? 1.0928 1.4486 1.2468 -0.0276 0.0358  -0.1739 90  ASN D CB  
4454 C CG  . ASN D 73  ? 1.0910 1.4603 1.2184 -0.0356 0.0388  -0.1758 90  ASN D CG  
4455 O OD1 . ASN D 73  ? 1.0503 1.4140 1.1426 -0.0415 0.0400  -0.1651 90  ASN D OD1 
4456 N ND2 . ASN D 73  ? 1.1055 1.4926 1.2508 -0.0359 0.0399  -0.1894 90  ASN D ND2 
4457 N N   . GLY D 74  ? 1.1417 1.5004 1.4045 -0.0096 0.0296  -0.1968 91  GLY D N   
4458 C CA  . GLY D 74  ? 1.1527 1.5064 1.4518 -0.0033 0.0267  -0.2030 91  GLY D CA  
4459 C C   . GLY D 74  ? 1.1702 1.5440 1.5090 -0.0009 0.0263  -0.2290 91  GLY D C   
4460 O O   . GLY D 74  ? 1.1830 1.5536 1.5616 0.0054  0.0233  -0.2308 91  GLY D O   
4461 N N   . GLU D 79  ? 1.2035 1.3797 1.1996 -0.0617 0.2156  -0.2154 96  GLU D N   
4462 C CA  . GLU D 79  ? 1.2267 1.3930 1.2242 -0.0568 0.2035  -0.1952 96  GLU D CA  
4463 C C   . GLU D 79  ? 1.1249 1.3117 1.1193 -0.0445 0.1845  -0.1707 96  GLU D C   
4464 O O   . GLU D 79  ? 1.0866 1.2641 1.0948 -0.0271 0.1828  -0.1563 96  GLU D O   
4465 C CB  . GLU D 79  ? 1.2806 1.4522 1.2630 -0.0785 0.2016  -0.2032 96  GLU D CB  
4466 C CG  . GLU D 79  ? 1.3296 1.5417 1.2915 -0.0977 0.1961  -0.2131 96  GLU D CG  
4467 C CD  . GLU D 79  ? 1.3179 1.5472 1.2773 -0.1004 0.2025  -0.2273 96  GLU D CD  
4468 O OE1 . GLU D 79  ? 1.2885 1.5387 1.2457 -0.0908 0.1916  -0.2140 96  GLU D OE1 
4469 O OE2 . GLU D 79  ? 1.3676 1.5887 1.3250 -0.1133 0.2188  -0.2520 96  GLU D OE2 
4470 N N   . ILE D 80  ? 1.0548 1.2685 1.0299 -0.0533 0.1709  -0.1655 97  ILE D N   
4471 C CA  . ILE D 80  ? 1.0146 1.2387 0.9804 -0.0426 0.1535  -0.1435 97  ILE D CA  
4472 C C   . ILE D 80  ? 0.9778 1.2264 0.9303 -0.0471 0.1477  -0.1440 97  ILE D C   
4473 O O   . ILE D 80  ? 1.0052 1.2769 0.9420 -0.0600 0.1448  -0.1509 97  ILE D O   
4474 C CB  . ILE D 80  ? 1.0197 1.2512 0.9715 -0.0438 0.1415  -0.1325 97  ILE D CB  
4475 C CG1 . ILE D 80  ? 1.0316 1.2413 0.9965 -0.0385 0.1445  -0.1267 97  ILE D CG1 
4476 C CG2 . ILE D 80  ? 0.9850 1.2230 0.9204 -0.0333 0.1250  -0.1132 97  ILE D CG2 
4477 C CD1 . ILE D 80  ? 1.0193 1.2080 0.9987 -0.0210 0.1423  -0.1110 97  ILE D CD1 
4478 N N   . LYS D 81  ? 0.9402 1.1866 0.8991 -0.0376 0.1457  -0.1350 98  LYS D N   
4479 C CA  . LYS D 81  ? 0.9316 1.1995 0.8772 -0.0425 0.1384  -0.1311 98  LYS D CA  
4480 C C   . LYS D 81  ? 0.8718 1.1306 0.8114 -0.0325 0.1253  -0.1089 98  LYS D C   
4481 O O   . LYS D 81  ? 0.9046 1.1445 0.8549 -0.0211 0.1243  -0.0988 98  LYS D O   
4482 C CB  . LYS D 81  ? 0.9186 1.2004 0.8773 -0.0456 0.1522  -0.1461 98  LYS D CB  
4483 N N   . VAL D 82  ? 0.8112 1.0829 0.7318 -0.0390 0.1151  -0.1011 99  VAL D N   
4484 C CA  . VAL D 82  ? 0.7729 1.0356 0.6842 -0.0347 0.1037  -0.0822 99  VAL D CA  
4485 C C   . VAL D 82  ? 0.7842 1.0509 0.7219 -0.0271 0.1127  -0.0809 99  VAL D C   
4486 O O   . VAL D 82  ? 0.8059 1.0890 0.7612 -0.0277 0.1259  -0.0939 99  VAL D O   
4487 C CB  . VAL D 82  ? 0.7528 1.0279 0.6378 -0.0472 0.0929  -0.0754 99  VAL D CB  
4488 C CG1 . VAL D 82  ? 0.7491 1.0225 0.6289 -0.0489 0.0854  -0.0603 99  VAL D CG1 
4489 C CG2 . VAL D 82  ? 0.7556 1.0170 0.6114 -0.0478 0.0810  -0.0680 99  VAL D CG2 
4490 N N   . GLY D 83  ? 0.7857 1.0386 0.7259 -0.0187 0.1064  -0.0650 100 GLY D N   
4491 C CA  . GLY D 83  ? 0.7721 1.0329 0.7383 -0.0092 0.1141  -0.0592 100 GLY D CA  
4492 C C   . GLY D 83  ? 0.7482 0.9919 0.7396 0.0045  0.1249  -0.0622 100 GLY D C   
4493 O O   . GLY D 83  ? 0.7316 0.9796 0.7462 0.0157  0.1320  -0.0551 100 GLY D O   
4494 N N   . THR D 84  ? 0.7556 0.9823 0.7421 0.0033  0.1263  -0.0712 101 THR D N   
4495 C CA  . THR D 84  ? 0.7808 0.9880 0.7860 0.0127  0.1343  -0.0720 101 THR D CA  
4496 C C   . THR D 84  ? 0.7845 0.9821 0.7876 0.0204  0.1232  -0.0515 101 THR D C   
4497 O O   . THR D 84  ? 0.7957 0.9898 0.7747 0.0164  0.1098  -0.0443 101 THR D O   
4498 C CB  . THR D 84  ? 0.8065 1.0050 0.8029 0.0046  0.1369  -0.0861 101 THR D CB  
4499 O OG1 . THR D 84  ? 0.8066 1.0158 0.8036 -0.0047 0.1477  -0.1062 101 THR D OG1 
4500 C CG2 . THR D 84  ? 0.8613 1.0388 0.8739 0.0105  0.1441  -0.0856 101 THR D CG2 
4501 N N   . ILE D 85  ? 0.7886 0.9821 0.8157 0.0320  0.1294  -0.0418 102 ILE D N   
4502 C CA  . ILE D 85  ? 0.7768 0.9645 0.8050 0.0385  0.1205  -0.0226 102 ILE D CA  
4503 C C   . ILE D 85  ? 0.7646 0.9328 0.8036 0.0434  0.1252  -0.0230 102 ILE D C   
4504 O O   . ILE D 85  ? 0.7608 0.9182 0.8201 0.0476  0.1391  -0.0305 102 ILE D O   
4505 C CB  . ILE D 85  ? 0.7420 0.9455 0.7902 0.0475  0.1230  -0.0070 102 ILE D CB  
4506 N N   . ARG D 86  ? 0.7617 0.9244 0.7853 0.0423  0.1142  -0.0150 103 ARG D N   
4507 C CA  . ARG D 86  ? 0.7771 0.9275 0.8108 0.0456  0.1170  -0.0116 103 ARG D CA  
4508 C C   . ARG D 86  ? 0.7837 0.9361 0.8234 0.0534  0.1100  0.0092  103 ARG D C   
4509 O O   . ARG D 86  ? 0.7655 0.9267 0.7907 0.0535  0.0994  0.0191  103 ARG D O   
4510 C CB  . ARG D 86  ? 0.7518 0.9017 0.7645 0.0384  0.1115  -0.0199 103 ARG D CB  
4511 C CG  . ARG D 86  ? 0.7392 0.8939 0.7259 0.0407  0.0967  -0.0104 103 ARG D CG  
4512 C CD  . ARG D 86  ? 0.7520 0.9114 0.7194 0.0378  0.0925  -0.0170 103 ARG D CD  
4513 N NE  . ARG D 86  ? 0.7629 0.9215 0.7011 0.0429  0.0800  -0.0100 103 ARG D NE  
4514 C CZ  . ARG D 86  ? 0.7801 0.9437 0.6948 0.0440  0.0749  -0.0139 103 ARG D CZ  
4515 N NH1 . ARG D 86  ? 0.7888 0.9662 0.7065 0.0379  0.0800  -0.0244 103 ARG D NH1 
4516 N NH2 . ARG D 86  ? 0.8178 0.9723 0.7042 0.0512  0.0649  -0.0069 103 ARG D NH2 
4517 N N   . GLU D 87  ? 0.8022 0.9456 0.8610 0.0579  0.1158  0.0157  104 GLU D N   
4518 C CA  . GLU D 87  ? 0.8069 0.9555 0.8728 0.0643  0.1097  0.0363  104 GLU D CA  
4519 C C   . GLU D 87  ? 0.7798 0.9256 0.8364 0.0610  0.1048  0.0376  104 GLU D C   
4520 O O   . GLU D 87  ? 0.7761 0.9112 0.8420 0.0571  0.1124  0.0318  104 GLU D O   
4521 C CB  . GLU D 87  ? 0.8195 0.9646 0.9175 0.0740  0.1200  0.0485  104 GLU D CB  
4522 N N   . VAL D 88  ? 0.7801 0.9356 0.8161 0.0618  0.0925  0.0451  105 VAL D N   
4523 C CA  . VAL D 88  ? 0.8048 0.9644 0.8264 0.0606  0.0869  0.0452  105 VAL D CA  
4524 C C   . VAL D 88  ? 0.8094 0.9775 0.8398 0.0650  0.0827  0.0639  105 VAL D C   
4525 O O   . VAL D 88  ? 0.7912 0.9659 0.8215 0.0682  0.0778  0.0758  105 VAL D O   
4526 C CB  . VAL D 88  ? 0.7999 0.9619 0.7872 0.0609  0.0774  0.0376  105 VAL D CB  
4527 C CG1 . VAL D 88  ? 0.8043 0.9747 0.7740 0.0660  0.0696  0.0438  105 VAL D CG1 
4528 C CG2 . VAL D 88  ? 0.7939 0.9543 0.7739 0.0553  0.0817  0.0205  105 VAL D CG2 
4529 N N   . SER D 89  ? 0.8103 0.9820 0.8478 0.0628  0.0846  0.0669  106 SER D N   
4530 C CA  . SER D 89  ? 0.7848 0.9677 0.8322 0.0652  0.0812  0.0853  106 SER D CA  
4531 C C   . SER D 89  ? 0.7594 0.9588 0.7846 0.0659  0.0731  0.0851  106 SER D C   
4532 O O   . SER D 89  ? 0.7357 0.9399 0.7536 0.0618  0.0747  0.0754  106 SER D O   
4533 C CB  . SER D 89  ? 0.7948 0.9681 0.8706 0.0616  0.0908  0.0926  106 SER D CB  
4534 O OG  . SER D 89  ? 0.7707 0.9366 0.8434 0.0519  0.0962  0.0789  106 SER D OG  
4535 N N   . VAL D 90  ? 0.7621 0.9735 0.7767 0.0709  0.0652  0.0963  107 VAL D N   
4536 C CA  . VAL D 90  ? 0.7641 0.9903 0.7526 0.0756  0.0577  0.0951  107 VAL D CA  
4537 C C   . VAL D 90  ? 0.7809 1.0293 0.7808 0.0736  0.0575  0.1068  107 VAL D C   
4538 O O   . VAL D 90  ? 0.7432 0.9938 0.7692 0.0687  0.0608  0.1207  107 VAL D O   
4539 C CB  . VAL D 90  ? 0.7614 0.9856 0.7266 0.0802  0.0498  0.0986  107 VAL D CB  
4540 C CG1 . VAL D 90  ? 0.7653 0.9976 0.6985 0.0883  0.0439  0.0943  107 VAL D CG1 
4541 C CG2 . VAL D 90  ? 0.7793 0.9829 0.7331 0.0785  0.0496  0.0890  107 VAL D CG2 
4542 N N   . VAL D 91  ? 0.8178 1.0838 0.7974 0.0782  0.0539  0.1019  108 VAL D N   
4543 C CA  . VAL D 91  ? 0.8310 1.1261 0.8162 0.0763  0.0525  0.1125  108 VAL D CA  
4544 C C   . VAL D 91  ? 0.8330 1.1406 0.8166 0.0795  0.0471  0.1272  108 VAL D C   
4545 O O   . VAL D 91  ? 0.8531 1.1512 0.8175 0.0856  0.0428  0.1247  108 VAL D O   
4546 C CB  . VAL D 91  ? 0.8397 1.1568 0.8017 0.0835  0.0505  0.1032  108 VAL D CB  
4547 C CG1 . VAL D 91  ? 0.9173 1.2721 0.8819 0.0825  0.0483  0.1147  108 VAL D CG1 
4548 C CG2 . VAL D 91  ? 0.8447 1.1589 0.8113 0.0762  0.0557  0.0916  108 VAL D CG2 
4549 N N   . SER D 92  ? 0.8392 1.1687 0.8413 0.0731  0.0472  0.1429  109 SER D N   
4550 C CA  . SER D 92  ? 0.8381 1.1849 0.8424 0.0736  0.0424  0.1591  109 SER D CA  
4551 C C   . SER D 92  ? 0.8627 1.2244 0.8328 0.0838  0.0362  0.1531  109 SER D C   
4552 O O   . SER D 92  ? 0.9406 1.3091 0.9042 0.0836  0.0320  0.1612  109 SER D O   
4553 C CB  . SER D 92  ? 0.8170 1.1873 0.8453 0.0641  0.0434  0.1779  109 SER D CB  
4554 O OG  . SER D 92  ? 0.8281 1.2292 0.8435 0.0646  0.0413  0.1756  109 SER D OG  
4555 N N   . GLY D 93  ? 0.8943 1.2615 0.8414 0.0930  0.0362  0.1392  110 GLY D N   
4556 C CA  . GLY D 93  ? 0.9423 1.3188 0.8537 0.1066  0.0323  0.1319  110 GLY D CA  
4557 C C   . GLY D 93  ? 0.9719 1.3160 0.8544 0.1118  0.0294  0.1225  110 GLY D C   
4558 O O   . GLY D 93  ? 1.0093 1.3539 0.8589 0.1219  0.0269  0.1164  110 GLY D O   
4559 N N   . LEU D 94  ? 0.9609 1.2764 0.8532 0.1043  0.0301  0.1209  111 LEU D N   
4560 C CA  . LEU D 94  ? 0.9446 1.2300 0.8097 0.1042  0.0269  0.1133  111 LEU D CA  
4561 C C   . LEU D 94  ? 0.9358 1.2230 0.8214 0.0905  0.0251  0.1268  111 LEU D C   
4562 O O   . LEU D 94  ? 0.9176 1.2132 0.8407 0.0843  0.0287  0.1378  111 LEU D O   
4563 C CB  . LEU D 94  ? 0.9245 1.1788 0.7793 0.1076  0.0289  0.0992  111 LEU D CB  
4564 C CG  . LEU D 94  ? 0.9203 1.1708 0.7516 0.1229  0.0304  0.0864  111 LEU D CG  
4565 C CD1 . LEU D 94  ? 0.9293 1.1595 0.7656 0.1210  0.0331  0.0776  111 LEU D CD1 
4566 C CD2 . LEU D 94  ? 0.9452 1.1761 0.7295 0.1355  0.0274  0.0776  111 LEU D CD2 
4567 N N   . PRO D 95  ? 0.9251 1.2038 0.7846 0.0855  0.0202  0.1262  112 PRO D N   
4568 C CA  . PRO D 95  ? 0.9274 1.2144 0.8042 0.0720  0.0180  0.1402  112 PRO D CA  
4569 C C   . PRO D 95  ? 0.9747 1.2474 0.8755 0.0682  0.0216  0.1407  112 PRO D C   
4570 O O   . PRO D 95  ? 1.0789 1.3688 1.0122 0.0625  0.0232  0.1568  112 PRO D O   
4571 C CB  . PRO D 95  ? 0.9373 1.2097 0.7700 0.0652  0.0122  0.1330  112 PRO D CB  
4572 C CG  . PRO D 95  ? 0.9473 1.1887 0.7392 0.0778  0.0128  0.1127  112 PRO D CG  
4573 C CD  . PRO D 95  ? 0.9407 1.2005 0.7507 0.0920  0.0171  0.1125  112 PRO D CD  
4574 N N   . ALA D 96  ? 0.9950 1.2386 0.8797 0.0725  0.0233  0.1241  113 ALA D N   
4575 C CA  . ALA D 96  ? 0.9984 1.2303 0.9043 0.0694  0.0276  0.1220  113 ALA D CA  
4576 C C   . ALA D 96  ? 0.9666 1.2104 0.9149 0.0725  0.0351  0.1290  113 ALA D C   
4577 O O   . ALA D 96  ? 1.0287 1.2825 0.9828 0.0771  0.0368  0.1296  113 ALA D O   
4578 C CB  . ALA D 96  ? 1.0039 1.2054 0.8818 0.0731  0.0275  0.1033  113 ALA D CB  
4579 N N   . SER D 97  ? 0.9218 1.1639 0.8975 0.0695  0.0400  0.1343  114 SER D N   
4580 C CA  . SER D 97  ? 0.9251 1.1696 0.9380 0.0720  0.0487  0.1402  114 SER D CA  
4581 C C   . SER D 97  ? 0.8846 1.1110 0.9118 0.0725  0.0566  0.1301  114 SER D C   
4582 O O   . SER D 97  ? 0.9243 1.1425 0.9710 0.0734  0.0645  0.1270  114 SER D O   
4583 C CB  . SER D 97  ? 0.9545 1.2207 0.9966 0.0715  0.0496  0.1643  114 SER D CB  
4584 O OG  . SER D 97  ? 0.9555 1.2321 1.0035 0.0693  0.0480  0.1743  114 SER D OG  
4585 N N   . THR D 98  ? 0.8419 1.0623 0.8579 0.0700  0.0549  0.1244  115 THR D N   
4586 C CA  . THR D 98  ? 0.8085 1.0160 0.8370 0.0704  0.0627  0.1140  115 THR D CA  
4587 C C   . THR D 98  ? 0.7779 0.9758 0.7776 0.0653  0.0579  0.1012  115 THR D C   
4588 O O   . THR D 98  ? 0.7677 0.9680 0.7420 0.0602  0.0492  0.1043  115 THR D O   
4589 C CB  . THR D 98  ? 0.7988 1.0160 0.8641 0.0747  0.0707  0.1288  115 THR D CB  
4590 O OG1 . THR D 98  ? 0.7992 1.0048 0.8890 0.0790  0.0805  0.1292  115 THR D OG1 
4591 C CG2 . THR D 98  ? 0.7987 1.0152 0.8687 0.0746  0.0752  0.1226  115 THR D CG2 
4592 N N   . SER D 99  ? 0.7719 0.9572 0.7727 0.0650  0.0636  0.0862  116 SER D N   
4593 C CA  . SER D 99  ? 0.7597 0.9367 0.7362 0.0592  0.0598  0.0756  116 SER D CA  
4594 C C   . SER D 99  ? 0.7293 0.9036 0.7228 0.0586  0.0692  0.0648  116 SER D C   
4595 O O   . SER D 99  ? 0.6955 0.8634 0.7033 0.0612  0.0773  0.0562  116 SER D O   
4596 C CB  . SER D 99  ? 0.7331 0.8948 0.6727 0.0594  0.0529  0.0648  116 SER D CB  
4597 O OG  . SER D 99  ? 0.7425 0.8934 0.6523 0.0524  0.0462  0.0613  116 SER D OG  
4598 N N   . VAL D 100 ? 0.7425 0.9233 0.7322 0.0532  0.0682  0.0650  117 VAL D N   
4599 C CA  . VAL D 100 ? 0.7594 0.9433 0.7655 0.0530  0.0777  0.0555  117 VAL D CA  
4600 C C   . VAL D 100 ? 0.7402 0.9179 0.7165 0.0435  0.0722  0.0435  117 VAL D C   
4601 O O   . VAL D 100 ? 0.7340 0.9178 0.6926 0.0351  0.0647  0.0490  117 VAL D O   
4602 C CB  . VAL D 100 ? 0.7666 0.9724 0.8011 0.0572  0.0836  0.0687  117 VAL D CB  
4603 C CG1 . VAL D 100 ? 0.7666 0.9903 0.7905 0.0517  0.0732  0.0862  117 VAL D CG1 
4604 C CG2 . VAL D 100 ? 0.7800 0.9950 0.8213 0.0554  0.0908  0.0589  117 VAL D CG2 
4605 N N   . GLU D 101 ? 0.7435 0.9103 0.7127 0.0431  0.0754  0.0283  118 GLU D N   
4606 C CA  . GLU D 101 ? 0.7486 0.9082 0.6874 0.0355  0.0693  0.0191  118 GLU D CA  
4607 C C   . GLU D 101 ? 0.7548 0.9242 0.7039 0.0302  0.0772  0.0073  118 GLU D C   
4608 O O   . GLU D 101 ? 0.7552 0.9266 0.7258 0.0332  0.0883  -0.0026 118 GLU D O   
4609 C CB  . GLU D 101 ? 0.7208 0.8681 0.6408 0.0393  0.0660  0.0125  118 GLU D CB  
4610 N N   . ILE D 102 ? 0.7542 0.9291 0.6858 0.0207  0.0718  0.0080  119 ILE D N   
4611 C CA  . ILE D 102 ? 0.7396 0.9263 0.6735 0.0137  0.0774  -0.0038 119 ILE D CA  
4612 C C   . ILE D 102 ? 0.7180 0.8936 0.6227 0.0083  0.0716  -0.0123 119 ILE D C   
4613 O O   . ILE D 102 ? 0.6875 0.8467 0.5611 0.0063  0.0604  -0.0058 119 ILE D O   
4614 C CB  . ILE D 102 ? 0.7647 0.9711 0.6967 0.0045  0.0749  0.0030  119 ILE D CB  
4615 C CG1 . ILE D 102 ? 0.7969 1.0229 0.7395 -0.0003 0.0839  -0.0095 119 ILE D CG1 
4616 C CG2 . ILE D 102 ? 0.7900 0.9840 0.6824 -0.0079 0.0600  0.0112  119 ILE D CG2 
4617 C CD1 . ILE D 102 ? 0.8082 1.0472 0.7890 0.0111  0.1003  -0.0158 119 ILE D CD1 
4618 N N   . LEU D 103 ? 0.7370 0.9214 0.6513 0.0065  0.0800  -0.0266 120 LEU D N   
4619 C CA  . LEU D 103 ? 0.7467 0.9303 0.6374 0.0008  0.0758  -0.0337 120 LEU D CA  
4620 C C   . LEU D 103 ? 0.7475 0.9404 0.6224 -0.0113 0.0714  -0.0329 120 LEU D C   
4621 O O   . LEU D 103 ? 0.7712 0.9845 0.6643 -0.0165 0.0792  -0.0387 120 LEU D O   
4622 C CB  . LEU D 103 ? 0.7585 0.9536 0.6660 -0.0002 0.0870  -0.0495 120 LEU D CB  
4623 C CG  . LEU D 103 ? 0.7649 0.9703 0.6544 -0.0070 0.0851  -0.0578 120 LEU D CG  
4624 C CD1 . LEU D 103 ? 0.7886 0.9814 0.6457 -0.0020 0.0717  -0.0462 120 LEU D CD1 
4625 C CD2 . LEU D 103 ? 0.7623 0.9760 0.6670 -0.0083 0.0948  -0.0702 120 LEU D CD2 
4626 N N   . GLU D 104 ? 0.7410 0.9185 0.5811 -0.0153 0.0593  -0.0251 121 GLU D N   
4627 C CA  . GLU D 104 ? 0.7721 0.9545 0.5921 -0.0298 0.0531  -0.0213 121 GLU D CA  
4628 C C   . GLU D 104 ? 0.7919 0.9827 0.5966 -0.0363 0.0520  -0.0276 121 GLU D C   
4629 O O   . GLU D 104 ? 0.7788 0.9921 0.5857 -0.0489 0.0543  -0.0319 121 GLU D O   
4630 C CB  . GLU D 104 ? 0.7911 0.9448 0.5774 -0.0337 0.0401  -0.0070 121 GLU D CB  
4631 C CG  . GLU D 104 ? 0.7949 0.9449 0.5935 -0.0296 0.0400  0.0006  121 GLU D CG  
4632 C CD  . GLU D 104 ? 0.8034 0.9510 0.5821 -0.0456 0.0315  0.0120  121 GLU D CD  
4633 O OE1 . GLU D 104 ? 0.8283 0.9482 0.5660 -0.0555 0.0210  0.0172  121 GLU D OE1 
4634 O OE2 . GLU D 104 ? 0.7710 0.9448 0.5742 -0.0487 0.0355  0.0164  121 GLU D OE2 
4635 N N   . VAL D 105 ? 0.7937 0.9712 0.5832 -0.0272 0.0488  -0.0272 122 VAL D N   
4636 C CA  . VAL D 105 ? 0.7878 0.9739 0.5590 -0.0314 0.0459  -0.0287 122 VAL D CA  
4637 C C   . VAL D 105 ? 0.7868 0.9882 0.5709 -0.0225 0.0522  -0.0371 122 VAL D C   
4638 O O   . VAL D 105 ? 0.8321 1.0201 0.6149 -0.0087 0.0508  -0.0332 122 VAL D O   
4639 C CB  . VAL D 105 ? 0.7860 0.9382 0.5145 -0.0287 0.0329  -0.0141 122 VAL D CB  
4640 C CG1 . VAL D 105 ? 0.7908 0.9510 0.5008 -0.0271 0.0299  -0.0120 122 VAL D CG1 
4641 C CG2 . VAL D 105 ? 0.7882 0.9267 0.4992 -0.0443 0.0260  -0.0060 122 VAL D CG2 
4642 N N   . LEU D 106 ? 0.8014 1.0342 0.5969 -0.0322 0.0591  -0.0487 123 LEU D N   
4643 C CA  . LEU D 106 ? 0.8015 1.0555 0.6063 -0.0297 0.0648  -0.0571 123 LEU D CA  
4644 C C   . LEU D 106 ? 0.8447 1.1265 0.6358 -0.0401 0.0630  -0.0588 123 LEU D C   
4645 O O   . LEU D 106 ? 0.9062 1.2157 0.7105 -0.0547 0.0712  -0.0727 123 LEU D O   
4646 C CB  . LEU D 106 ? 0.7871 1.0534 0.6250 -0.0345 0.0787  -0.0738 123 LEU D CB  
4647 C CG  . LEU D 106 ? 0.7794 1.0668 0.6265 -0.0376 0.0856  -0.0843 123 LEU D CG  
4648 C CD1 . LEU D 106 ? 0.7710 1.0473 0.6135 -0.0229 0.0804  -0.0737 123 LEU D CD1 
4649 C CD2 . LEU D 106 ? 0.7653 1.0580 0.6394 -0.0469 0.1007  -0.1033 123 LEU D CD2 
4650 N N   . ASP D 107 ? 0.8570 1.1311 0.6203 -0.0314 0.0528  -0.0440 124 ASP D N   
4651 C CA  . ASP D 107 ? 0.8177 1.1173 0.5646 -0.0387 0.0491  -0.0399 124 ASP D CA  
4652 C C   . ASP D 107 ? 0.7740 1.1057 0.5241 -0.0333 0.0516  -0.0411 124 ASP D C   
4653 O O   . ASP D 107 ? 0.7257 1.0495 0.4590 -0.0154 0.0452  -0.0270 124 ASP D O   
4654 C CB  . ASP D 107 ? 0.8654 1.1328 0.5767 -0.0312 0.0365  -0.0201 124 ASP D CB  
4655 C CG  . ASP D 107 ? 0.9129 1.2027 0.6072 -0.0429 0.0320  -0.0137 124 ASP D CG  
4656 O OD1 . ASP D 107 ? 0.9340 1.2649 0.6335 -0.0456 0.0350  -0.0165 124 ASP D OD1 
4657 O OD2 . ASP D 107 ? 0.9294 1.1972 0.6038 -0.0511 0.0251  -0.0048 124 ASP D OD2 
4658 N N   . GLU D 108 ? 0.7889 1.1585 0.5590 -0.0495 0.0613  -0.0581 125 GLU D N   
4659 C CA  . GLU D 108 ? 0.7938 1.2049 0.5666 -0.0522 0.0641  -0.0607 125 GLU D CA  
4660 C C   . GLU D 108 ? 0.7934 1.2300 0.5426 -0.0470 0.0553  -0.0436 125 GLU D C   
4661 O O   . GLU D 108 ? 0.7679 1.2351 0.5150 -0.0403 0.0544  -0.0375 125 GLU D O   
4662 C CB  . GLU D 108 ? 0.8034 1.2476 0.5954 -0.0766 0.0764  -0.0841 125 GLU D CB  
4663 C CG  . GLU D 108 ? 0.8405 1.2637 0.6568 -0.0806 0.0877  -0.1016 125 GLU D CG  
4664 C CD  . GLU D 108 ? 0.8732 1.2960 0.6975 -0.0737 0.0897  -0.1010 125 GLU D CD  
4665 O OE1 . GLU D 108 ? 0.8672 1.2581 0.7059 -0.0667 0.0937  -0.1040 125 GLU D OE1 
4666 O OE2 . GLU D 108 ? 0.9265 1.3850 0.7434 -0.0759 0.0872  -0.0962 125 GLU D OE2 
4667 N N   . GLU D 109 ? 0.8572 1.2856 0.5891 -0.0509 0.0489  -0.0346 126 GLU D N   
4668 C CA  . GLU D 109 ? 0.8950 1.3479 0.6044 -0.0467 0.0410  -0.0167 126 GLU D CA  
4669 C C   . GLU D 109 ? 0.9100 1.3245 0.5944 -0.0173 0.0314  0.0064  126 GLU D C   
4670 O O   . GLU D 109 ? 0.9068 1.3450 0.5827 -0.0014 0.0287  0.0196  126 GLU D O   
4671 C CB  . GLU D 109 ? 0.8736 1.3371 0.5735 -0.0656 0.0383  -0.0159 126 GLU D CB  
4672 N N   . LYS D 110 ? 0.9174 1.2743 0.5891 -0.0100 0.0270  0.0110  127 LYS D N   
4673 C CA  . LYS D 110 ? 0.9493 1.2598 0.5930 0.0171  0.0193  0.0299  127 LYS D CA  
4674 C C   . LYS D 110 ? 0.9010 1.2035 0.5557 0.0361  0.0229  0.0266  127 LYS D C   
4675 O O   . LYS D 110 ? 0.9161 1.1892 0.5490 0.0618  0.0185  0.0405  127 LYS D O   
4676 C CB  . LYS D 110 ? 0.9912 1.2418 0.6127 0.0134  0.0130  0.0352  127 LYS D CB  
4677 C CG  . LYS D 110 ? 1.0406 1.2933 0.6447 -0.0046 0.0075  0.0428  127 LYS D CG  
4678 C CD  . LYS D 110 ? 1.0828 1.2850 0.6696 -0.0163 0.0023  0.0447  127 LYS D CD  
4679 C CE  . LYS D 110 ? 1.1185 1.3346 0.6945 -0.0408 -0.0020 0.0494  127 LYS D CE  
4680 N NZ  . LYS D 110 ? 1.0728 1.3509 0.6822 -0.0626 0.0061  0.0319  127 LYS D NZ  
4681 N N   . ARG D 111 ? 0.8596 1.1859 0.5463 0.0236  0.0313  0.0083  128 ARG D N   
4682 C CA  . ARG D 111 ? 0.8730 1.1936 0.5735 0.0367  0.0352  0.0041  128 ARG D CA  
4683 C C   . ARG D 111 ? 0.8377 1.1002 0.5272 0.0499  0.0317  0.0080  128 ARG D C   
4684 O O   . ARG D 111 ? 0.7909 1.0372 0.4686 0.0725  0.0294  0.0167  128 ARG D O   
4685 C CB  . ARG D 111 ? 0.8787 1.2350 0.5748 0.0554  0.0345  0.0147  128 ARG D CB  
4686 C CG  . ARG D 111 ? 0.8709 1.2897 0.5910 0.0370  0.0415  0.0034  128 ARG D CG  
4687 C CD  . ARG D 111 ? 0.8969 1.3575 0.6122 0.0550  0.0402  0.0163  128 ARG D CD  
4688 N NE  . ARG D 111 ? 0.9411 1.4339 0.6394 0.0598  0.0355  0.0313  128 ARG D NE  
4689 C CZ  . ARG D 111 ? 0.8942 1.4472 0.6016 0.0391  0.0381  0.0273  128 ARG D CZ  
4690 N NH1 . ARG D 111 ? 0.8620 1.4448 0.5931 0.0109  0.0460  0.0065  128 ARG D NH1 
4691 N NH2 . ARG D 111 ? 0.9200 1.5023 0.6108 0.0465  0.0329  0.0447  128 ARG D NH2 
4692 N N   . ILE D 112 ? 0.8336 1.0703 0.5274 0.0344  0.0319  0.0010  129 ILE D N   
4693 C CA  . ILE D 112 ? 0.8253 1.0124 0.5081 0.0405  0.0283  0.0043  129 ILE D CA  
4694 C C   . ILE D 112 ? 0.7963 0.9867 0.5101 0.0266  0.0350  -0.0091 129 ILE D C   
4695 O O   . ILE D 112 ? 0.7391 0.9507 0.4710 0.0080  0.0400  -0.0194 129 ILE D O   
4696 C CB  . ILE D 112 ? 0.8618 1.0127 0.5137 0.0338  0.0203  0.0135  129 ILE D CB  
4697 C CG1 . ILE D 112 ? 0.9037 1.0297 0.5176 0.0543  0.0133  0.0302  129 ILE D CG1 
4698 C CG2 . ILE D 112 ? 0.8675 0.9787 0.5147 0.0281  0.0180  0.0126  129 ILE D CG2 
4699 C CD1 . ILE D 112 ? 0.9564 1.0661 0.5426 0.0434  0.0066  0.0401  129 ILE D CD1 
4700 N N   . LEU D 113 ? 0.8268 0.9964 0.5455 0.0372  0.0354  -0.0081 130 LEU D N   
4701 C CA  . LEU D 113 ? 0.8058 0.9736 0.5520 0.0284  0.0410  -0.0166 130 LEU D CA  
4702 C C   . LEU D 113 ? 0.8098 0.9373 0.5383 0.0317  0.0347  -0.0084 130 LEU D C   
4703 O O   . LEU D 113 ? 0.8185 0.9168 0.5156 0.0448  0.0278  0.0010  130 LEU D O   
4704 C CB  . LEU D 113 ? 0.7887 0.9759 0.5598 0.0349  0.0478  -0.0221 130 LEU D CB  
4705 C CG  . LEU D 113 ? 0.7799 0.9668 0.5824 0.0272  0.0552  -0.0297 130 LEU D CG  
4706 C CD1 . LEU D 113 ? 0.7464 0.9622 0.5753 0.0212  0.0649  -0.0408 130 LEU D CD1 
4707 C CD2 . LEU D 113 ? 0.7830 0.9445 0.5821 0.0386  0.0514  -0.0210 130 LEU D CD2 
4708 N N   . SER D 114 ? 0.7898 0.9166 0.5367 0.0198  0.0375  -0.0121 131 SER D N   
4709 C CA  . SER D 114 ? 0.8341 0.9308 0.5658 0.0178  0.0316  -0.0044 131 SER D CA  
4710 C C   . SER D 114 ? 0.8289 0.9386 0.5936 0.0118  0.0376  -0.0074 131 SER D C   
4711 O O   . SER D 114 ? 0.8167 0.9492 0.6043 0.0011  0.0438  -0.0139 131 SER D O   
4712 C CB  . SER D 114 ? 0.8532 0.9336 0.5565 0.0039  0.0243  0.0009  131 SER D CB  
4713 O OG  . SER D 114 ? 0.9338 0.9844 0.6166 -0.0017 0.0178  0.0085  131 SER D OG  
4714 N N   . PHE D 115 ? 0.8225 0.9190 0.5891 0.0198  0.0361  -0.0020 132 PHE D N   
4715 C CA  . PHE D 115 ? 0.8205 0.9301 0.6178 0.0161  0.0413  -0.0011 132 PHE D CA  
4716 C C   . PHE D 115 ? 0.8301 0.9213 0.6102 0.0122  0.0339  0.0094  132 PHE D C   
4717 O O   . PHE D 115 ? 0.8327 0.8950 0.5776 0.0154  0.0260  0.0141  132 PHE D O   
4718 C CB  . PHE D 115 ? 0.7907 0.9147 0.6193 0.0262  0.0496  -0.0050 132 PHE D CB  
4719 C CG  . PHE D 115 ? 0.7896 0.9007 0.6082 0.0384  0.0455  0.0017  132 PHE D CG  
4720 C CD1 . PHE D 115 ? 0.8175 0.9252 0.6443 0.0392  0.0441  0.0102  132 PHE D CD1 
4721 C CD2 . PHE D 115 ? 0.7730 0.8806 0.5748 0.0496  0.0434  0.0005  132 PHE D CD2 
4722 C CE1 . PHE D 115 ? 0.7573 0.8563 0.5742 0.0496  0.0406  0.0158  132 PHE D CE1 
4723 C CE2 . PHE D 115 ? 0.7799 0.8796 0.5722 0.0622  0.0404  0.0063  132 PHE D CE2 
4724 C CZ  . PHE D 115 ? 0.7615 0.8561 0.5610 0.0614  0.0391  0.0131  132 PHE D CZ  
4725 N N   . ARG D 116 ? 0.8285 0.9380 0.6329 0.0050  0.0372  0.0130  133 ARG D N   
4726 C CA  . ARG D 116 ? 0.8797 0.9831 0.6714 -0.0033 0.0306  0.0238  133 ARG D CA  
4727 C C   . ARG D 116 ? 0.8378 0.9599 0.6642 0.0046  0.0363  0.0293  133 ARG D C   
4728 O O   . ARG D 116 ? 0.7875 0.9306 0.6509 0.0107  0.0465  0.0253  133 ARG D O   
4729 C CB  . ARG D 116 ? 0.9246 1.0428 0.7126 -0.0215 0.0285  0.0266  133 ARG D CB  
4730 C CG  . ARG D 116 ? 0.9869 1.1160 0.7723 -0.0339 0.0237  0.0388  133 ARG D CG  
4731 C CD  . ARG D 116 ? 1.0456 1.2074 0.8423 -0.0489 0.0251  0.0419  133 ARG D CD  
4732 N NE  . ARG D 116 ? 1.1314 1.2761 0.8857 -0.0697 0.0149  0.0443  133 ARG D NE  
4733 C CZ  . ARG D 116 ? 1.2711 1.3992 0.9910 -0.0870 0.0046  0.0536  133 ARG D CZ  
4734 N NH1 . ARG D 116 ? 1.3014 1.4322 1.0250 -0.0855 0.0029  0.0611  133 ARG D NH1 
4735 N NH2 . ARG D 116 ? 1.2853 1.3930 0.9644 -0.1080 -0.0041 0.0555  133 ARG D NH2 
4736 N N   . VAL D 117 ? 0.8223 0.9346 0.6351 0.0044  0.0303  0.0383  134 VAL D N   
4737 C CA  . VAL D 117 ? 0.8221 0.9552 0.6661 0.0101  0.0344  0.0473  134 VAL D CA  
4738 C C   . VAL D 117 ? 0.8110 0.9715 0.6693 -0.0013 0.0344  0.0574  134 VAL D C   
4739 O O   . VAL D 117 ? 0.8600 1.0168 0.6898 -0.0177 0.0261  0.0619  134 VAL D O   
4740 C CB  . VAL D 117 ? 0.8772 0.9954 0.7023 0.0148  0.0285  0.0529  134 VAL D CB  
4741 C CG1 . VAL D 117 ? 0.8739 1.0178 0.7250 0.0144  0.0298  0.0667  134 VAL D CG1 
4742 C CG2 . VAL D 117 ? 0.8896 0.9977 0.7171 0.0307  0.0319  0.0455  134 VAL D CG2 
4743 N N   . LEU D 118 ? 0.8046 0.9923 0.7059 0.0072  0.0442  0.0615  135 LEU D N   
4744 C CA  . LEU D 118 ? 0.7979 1.0210 0.7219 0.0023  0.0473  0.0722  135 LEU D CA  
4745 C C   . LEU D 118 ? 0.8177 1.0624 0.7590 0.0054  0.0462  0.0902  135 LEU D C   
4746 O O   . LEU D 118 ? 0.8731 1.1508 0.8230 -0.0020 0.0448  0.1034  135 LEU D O   
4747 C CB  . LEU D 118 ? 0.7556 0.9938 0.7164 0.0136  0.0613  0.0647  135 LEU D CB  
4748 C CG  . LEU D 118 ? 0.7753 1.0279 0.7338 0.0054  0.0643  0.0564  135 LEU D CG  
4749 C CD1 . LEU D 118 ? 0.7819 1.0204 0.6967 -0.0136 0.0523  0.0528  135 LEU D CD1 
4750 C CD2 . LEU D 118 ? 0.7755 1.0202 0.7534 0.0161  0.0769  0.0396  135 LEU D CD2 
4751 N N   . GLY D 119 ? 0.7905 1.1310 0.8572 0.0224  0.0267  0.0020  136 GLY D N   
4752 C CA  . GLY D 119 ? 0.8403 1.1808 0.9116 0.0326  0.0190  0.0105  136 GLY D CA  
4753 C C   . GLY D 119 ? 0.8662 1.1826 0.9285 0.0355  0.0167  0.0241  136 GLY D C   
4754 O O   . GLY D 119 ? 0.8975 1.1991 0.9481 0.0283  0.0210  0.0265  136 GLY D O   
4755 N N   . GLY D 120 ? 0.8759 1.1900 0.9438 0.0460  0.0099  0.0336  137 GLY D N   
4756 C CA  . GLY D 120 ? 0.8938 1.1878 0.9550 0.0487  0.0078  0.0486  137 GLY D CA  
4757 C C   . GLY D 120 ? 0.9024 1.2022 0.9516 0.0509  0.0027  0.0612  137 GLY D C   
4758 O O   . GLY D 120 ? 0.8852 1.2037 0.9303 0.0501  0.0002  0.0574  137 GLY D O   
4759 N N   . GLU D 121 ? 0.9213 1.2064 0.9652 0.0531  0.0013  0.0760  138 GLU D N   
4760 C CA  . GLU D 121 ? 0.9410 1.2330 0.9716 0.0553  -0.0028 0.0892  138 GLU D CA  
4761 C C   . GLU D 121 ? 0.9196 1.2076 0.9314 0.0459  0.0020  0.0913  138 GLU D C   
4762 O O   . GLU D 121 ? 0.9081 1.1819 0.9164 0.0433  0.0048  0.1004  138 GLU D O   
4763 C CB  . GLU D 121 ? 0.9692 1.2507 1.0060 0.0642  -0.0079 0.1065  138 GLU D CB  
4764 N N   . HIS D 122 ? 0.9131 1.2138 0.9146 0.0406  0.0026  0.0820  139 HIS D N   
4765 C CA  . HIS D 122 ? 0.9028 1.2020 0.8866 0.0335  0.0055  0.0815  139 HIS D CA  
4766 C C   . HIS D 122 ? 0.8815 1.1950 0.8590 0.0298  0.0033  0.0701  139 HIS D C   
4767 O O   . HIS D 122 ? 0.8908 1.2179 0.8771 0.0329  -0.0006 0.0653  139 HIS D O   
4768 C CB  . HIS D 122 ? 0.9239 1.2064 0.9068 0.0261  0.0122  0.0772  139 HIS D CB  
4769 C CG  . HIS D 122 ? 0.9508 1.2329 0.9410 0.0211  0.0152  0.0636  139 HIS D CG  
4770 N ND1 . HIS D 122 ? 0.9771 1.2556 0.9833 0.0237  0.0166  0.0595  139 HIS D ND1 
4771 C CD2 . HIS D 122 ? 0.9540 1.2399 0.9377 0.0137  0.0169  0.0535  139 HIS D CD2 
4772 C CE1 . HIS D 122 ? 0.9950 1.2786 1.0033 0.0178  0.0198  0.0474  139 HIS D CE1 
4773 N NE2 . HIS D 122 ? 0.9715 1.2584 0.9661 0.0110  0.0200  0.0449  139 HIS D NE2 
4774 N N   . ARG D 123 ? 0.8901 1.2006 0.8540 0.0233  0.0052  0.0652  140 ARG D N   
4775 C CA  . ARG D 123 ? 0.9318 1.2534 0.8894 0.0195  0.0016  0.0551  140 ARG D CA  
4776 C C   . ARG D 123 ? 0.8835 1.1936 0.8364 0.0093  0.0052  0.0453  140 ARG D C   
4777 O O   . ARG D 123 ? 0.8504 1.1587 0.7917 0.0061  0.0033  0.0406  140 ARG D O   
4778 C CB  . ARG D 123 ? 1.0012 1.3333 0.9450 0.0241  -0.0029 0.0589  140 ARG D CB  
4779 C CG  . ARG D 123 ? 1.0445 1.3934 0.9908 0.0338  -0.0084 0.0680  140 ARG D CG  
4780 C CD  . ARG D 123 ? 1.0425 1.4089 0.9969 0.0351  -0.0144 0.0593  140 ARG D CD  
4781 N N   . LEU D 124 ? 0.8651 1.1684 0.8274 0.0049  0.0099  0.0421  141 LEU D N   
4782 C CA  . LEU D 124 ? 0.8478 1.1405 0.8059 -0.0048 0.0139  0.0353  141 LEU D CA  
4783 C C   . LEU D 124 ? 0.8341 1.1342 0.8058 -0.0089 0.0167  0.0294  141 LEU D C   
4784 O O   . LEU D 124 ? 0.7979 1.0923 0.7747 -0.0105 0.0219  0.0285  141 LEU D O   
4785 C CB  . LEU D 124 ? 0.8036 1.0798 0.7547 -0.0055 0.0184  0.0392  141 LEU D CB  
4786 C CG  . LEU D 124 ? 0.8182 1.0896 0.7551 -0.0029 0.0165  0.0428  141 LEU D CG  
4787 C CD1 . LEU D 124 ? 0.8502 1.1094 0.7837 -0.0029 0.0211  0.0470  141 LEU D CD1 
4788 C CD2 . LEU D 124 ? 0.7909 1.0598 0.7172 -0.0075 0.0130  0.0353  141 LEU D CD2 
4789 N N   . ASN D 125 ? 0.8271 1.1433 0.8051 -0.0104 0.0129  0.0245  142 ASN D N   
4790 C CA  . ASN D 125 ? 0.8126 1.1436 0.8058 -0.0126 0.0149  0.0187  142 ASN D CA  
4791 C C   . ASN D 125 ? 0.7985 1.1263 0.7896 -0.0254 0.0200  0.0133  142 ASN D C   
4792 O O   . ASN D 125 ? 0.7351 1.0549 0.7158 -0.0340 0.0187  0.0122  142 ASN D O   
4793 C CB  . ASN D 125 ? 0.8470 1.1993 0.8482 -0.0106 0.0087  0.0149  142 ASN D CB  
4794 C CG  . ASN D 125 ? 0.8731 1.2299 0.8733 0.0020  0.0027  0.0219  142 ASN D CG  
4795 O OD1 . ASN D 125 ? 0.8781 1.2430 0.8722 0.0031  -0.0032 0.0212  142 ASN D OD1 
4796 N ND2 . ASN D 125 ? 0.8773 1.2284 0.8831 0.0113  0.0040  0.0289  142 ASN D ND2 
4797 N N   . ASN D 126 ? 0.7788 1.1130 0.7799 -0.0260 0.0255  0.0101  143 ASN D N   
4798 C CA  . ASN D 126 ? 0.7909 1.1250 0.7893 -0.0376 0.0313  0.0066  143 ASN D CA  
4799 C C   . ASN D 126 ? 0.7648 1.0756 0.7458 -0.0422 0.0323  0.0112  143 ASN D C   
4800 O O   . ASN D 126 ? 0.8368 1.1418 0.8093 -0.0530 0.0324  0.0112  143 ASN D O   
4801 C CB  . ASN D 126 ? 0.7896 1.1404 0.7930 -0.0485 0.0304  0.0019  143 ASN D CB  
4802 C CG  . ASN D 126 ? 0.8104 1.1873 0.8317 -0.0426 0.0282  -0.0033 143 ASN D CG  
4803 O OD1 . ASN D 126 ? 0.7816 1.1738 0.8156 -0.0391 0.0322  -0.0080 143 ASN D OD1 
4804 N ND2 . ASN D 126 ? 0.8483 1.2316 0.8711 -0.0403 0.0211  -0.0036 143 ASN D ND2 
4805 N N   . TYR D 127 ? 0.7408 1.0381 0.7173 -0.0341 0.0326  0.0154  144 TYR D N   
4806 C CA  . TYR D 127 ? 0.7552 1.0337 0.7174 -0.0372 0.0341  0.0186  144 TYR D CA  
4807 C C   . TYR D 127 ? 0.7367 1.0169 0.6998 -0.0426 0.0404  0.0156  144 TYR D C   
4808 O O   . TYR D 127 ? 0.7100 1.0008 0.6850 -0.0383 0.0436  0.0117  144 TYR D O   
4809 C CB  . TYR D 127 ? 0.7477 1.0153 0.7067 -0.0277 0.0328  0.0238  144 TYR D CB  
4810 C CG  . TYR D 127 ? 0.7250 0.9764 0.6712 -0.0296 0.0343  0.0261  144 TYR D CG  
4811 C CD1 . TYR D 127 ? 0.7140 0.9555 0.6469 -0.0316 0.0308  0.0275  144 TYR D CD1 
4812 C CD2 . TYR D 127 ? 0.7245 0.9715 0.6731 -0.0284 0.0387  0.0255  144 TYR D CD2 
4813 C CE1 . TYR D 127 ? 0.7148 0.9431 0.6370 -0.0318 0.0315  0.0289  144 TYR D CE1 
4814 C CE2 . TYR D 127 ? 0.6949 0.9298 0.6327 -0.0296 0.0396  0.0271  144 TYR D CE2 
4815 C CZ  . TYR D 127 ? 0.6928 0.9188 0.6174 -0.0310 0.0360  0.0291  144 TYR D CZ  
4816 O OH  . TYR D 127 ? 0.7263 0.9418 0.6410 -0.0309 0.0363  0.0300  144 TYR D OH  
4817 N N   . ARG D 128 ? 0.7404 1.0113 0.6911 -0.0514 0.0416  0.0171  145 ARG D N   
4818 C CA  . ARG D 128 ? 0.7387 1.0123 0.6867 -0.0567 0.0474  0.0155  145 ARG D CA  
4819 C C   . ARG D 128 ? 0.7192 0.9732 0.6514 -0.0578 0.0463  0.0200  145 ARG D C   
4820 O O   . ARG D 128 ? 0.7338 0.9747 0.6563 -0.0601 0.0416  0.0235  145 ARG D O   
4821 C CB  . ARG D 128 ? 0.7542 1.0414 0.7033 -0.0688 0.0501  0.0144  145 ARG D CB  
4822 C CG  . ARG D 128 ? 0.7758 1.0819 0.7312 -0.0709 0.0572  0.0094  145 ARG D CG  
4823 C CD  . ARG D 128 ? 0.8099 1.1253 0.7588 -0.0856 0.0610  0.0122  145 ARG D CD  
4824 N NE  . ARG D 128 ? 0.8073 1.1286 0.7603 -0.0949 0.0585  0.0141  145 ARG D NE  
4825 N N   . SER D 129 ? 0.7145 0.9676 0.6449 -0.0556 0.0500  0.0185  146 SER D N   
4826 C CA  . SER D 129 ? 0.6952 0.9325 0.6123 -0.0546 0.0487  0.0217  146 SER D CA  
4827 C C   . SER D 129 ? 0.7028 0.9448 0.6133 -0.0597 0.0530  0.0206  146 SER D C   
4828 O O   . SER D 129 ? 0.7036 0.9629 0.6220 -0.0615 0.0579  0.0154  146 SER D O   
4829 C CB  . SER D 129 ? 0.6956 0.9281 0.6178 -0.0449 0.0479  0.0209  146 SER D CB  
4830 O OG  . SER D 129 ? 0.7785 0.9974 0.6889 -0.0432 0.0456  0.0239  146 SER D OG  
4831 N N   . VAL D 130 ? 0.7121 0.9405 0.6080 -0.0612 0.0507  0.0250  147 VAL D N   
4832 C CA  . VAL D 130 ? 0.7302 0.9626 0.6167 -0.0654 0.0537  0.0256  147 VAL D CA  
4833 C C   . VAL D 130 ? 0.7733 0.9920 0.6492 -0.0602 0.0503  0.0274  147 VAL D C   
4834 O O   . VAL D 130 ? 0.8283 1.0311 0.6927 -0.0609 0.0453  0.0333  147 VAL D O   
4835 C CB  . VAL D 130 ? 0.7439 0.9762 0.6204 -0.0771 0.0538  0.0324  147 VAL D CB  
4836 C CG1 . VAL D 130 ? 0.7782 1.0155 0.6424 -0.0810 0.0565  0.0351  147 VAL D CG1 
4837 C CG2 . VAL D 130 ? 0.7232 0.9737 0.6112 -0.0836 0.0577  0.0301  147 VAL D CG2 
4838 N N   . THR D 131 ? 0.7967 1.0221 0.6775 -0.0548 0.0526  0.0214  148 THR D N   
4839 C CA  . THR D 131 ? 0.7664 0.9836 0.6395 -0.0499 0.0498  0.0216  148 THR D CA  
4840 C C   . THR D 131 ? 0.7677 0.9928 0.6303 -0.0534 0.0516  0.0212  148 THR D C   
4841 O O   . THR D 131 ? 0.7850 1.0263 0.6507 -0.0575 0.0564  0.0174  148 THR D O   
4842 C CB  . THR D 131 ? 0.7347 0.9548 0.6214 -0.0428 0.0507  0.0152  148 THR D CB  
4843 O OG1 . THR D 131 ? 0.7608 0.9739 0.6543 -0.0393 0.0486  0.0180  148 THR D OG1 
4844 C CG2 . THR D 131 ? 0.7240 0.9409 0.6051 -0.0390 0.0485  0.0138  148 THR D CG2 
4845 N N   . SER D 132 ? 0.7723 0.9884 0.6223 -0.0509 0.0474  0.0247  149 SER D N   
4846 C CA  . SER D 132 ? 0.7311 0.9548 0.5686 -0.0531 0.0477  0.0257  149 SER D CA  
4847 C C   . SER D 132 ? 0.7533 0.9700 0.5844 -0.0459 0.0426  0.0251  149 SER D C   
4848 O O   . SER D 132 ? 0.7528 0.9537 0.5803 -0.0420 0.0373  0.0294  149 SER D O   
4849 C CB  . SER D 132 ? 0.7036 0.9210 0.5265 -0.0611 0.0464  0.0367  149 SER D CB  
4850 O OG  . SER D 132 ? 0.6996 0.8947 0.5128 -0.0586 0.0389  0.0443  149 SER D OG  
4851 N N   . VAL D 133 ? 0.7689 0.9992 0.5988 -0.0439 0.0438  0.0187  150 VAL D N   
4852 C CA  . VAL D 133 ? 0.7560 0.9841 0.5804 -0.0373 0.0387  0.0171  150 VAL D CA  
4853 C C   . VAL D 133 ? 0.7728 1.0018 0.5772 -0.0384 0.0352  0.0243  150 VAL D C   
4854 O O   . VAL D 133 ? 0.8193 1.0611 0.6170 -0.0440 0.0389  0.0254  150 VAL D O   
4855 C CB  . VAL D 133 ? 0.7229 0.9662 0.5603 -0.0341 0.0410  0.0043  150 VAL D CB  
4856 C CG1 . VAL D 133 ? 0.7389 0.9795 0.5759 -0.0275 0.0358  0.0024  150 VAL D CG1 
4857 C CG2 . VAL D 133 ? 0.7282 0.9730 0.5857 -0.0348 0.0454  -0.0020 150 VAL D CG2 
4858 N N   . ASN D 134 ? 0.7741 0.9911 0.5689 -0.0325 0.0280  0.0292  151 ASN D N   
4859 C CA  . ASN D 134 ? 0.7841 0.9964 0.5589 -0.0326 0.0228  0.0390  151 ASN D CA  
4860 C C   . ASN D 134 ? 0.7907 1.0049 0.5606 -0.0229 0.0160  0.0361  151 ASN D C   
4861 O O   . ASN D 134 ? 0.8324 1.0330 0.6033 -0.0160 0.0102  0.0372  151 ASN D O   
4862 C CB  . ASN D 134 ? 0.7819 0.9700 0.5484 -0.0355 0.0185  0.0515  151 ASN D CB  
4863 C CG  . ASN D 134 ? 0.7997 0.9880 0.5721 -0.0457 0.0247  0.0541  151 ASN D CG  
4864 O OD1 . ASN D 134 ? 0.7961 0.9789 0.5814 -0.0454 0.0263  0.0501  151 ASN D OD1 
4865 N ND2 . ASN D 134 ? 0.8276 1.0260 0.5909 -0.0546 0.0286  0.0605  151 ASN D ND2 
4866 N N   . GLU D 135 ? 0.8142 1.0476 0.5790 -0.0219 0.0164  0.0314  152 GLU D N   
4867 C CA  . GLU D 135 ? 0.8182 1.0576 0.5792 -0.0127 0.0097  0.0274  152 GLU D CA  
4868 C C   . GLU D 135 ? 0.8341 1.0579 0.5750 -0.0080 0.0004  0.0410  152 GLU D C   
4869 O O   . GLU D 135 ? 0.8431 1.0543 0.5709 -0.0139 -0.0001 0.0542  152 GLU D O   
4870 C CB  . GLU D 135 ? 0.8214 1.0880 0.5837 -0.0131 0.0123  0.0166  152 GLU D CB  
4871 C CG  . GLU D 135 ? 0.8332 1.1119 0.6051 -0.0055 0.0084  0.0048  152 GLU D CG  
4872 C CD  . GLU D 135 ? 0.8438 1.1491 0.6225 -0.0074 0.0118  -0.0095 152 GLU D CD  
4873 O OE1 . GLU D 135 ? 0.8934 1.2140 0.6610 -0.0033 0.0069  -0.0116 152 GLU D OE1 
4874 O OE2 . GLU D 135 ? 0.8134 1.1245 0.6085 -0.0125 0.0187  -0.0192 152 GLU D OE2 
4875 N N   . PHE D 136 ? 0.8606 1.0850 0.6008 0.0025  -0.0070 0.0378  153 PHE D N   
4876 C CA  . PHE D 136 ? 0.9036 1.1123 0.6272 0.0104  -0.0178 0.0488  153 PHE D CA  
4877 C C   . PHE D 136 ? 0.9180 1.1440 0.6405 0.0210  -0.0241 0.0413  153 PHE D C   
4878 O O   . PHE D 136 ? 0.8883 1.1313 0.6275 0.0234  -0.0213 0.0271  153 PHE D O   
4879 C CB  . PHE D 136 ? 0.9201 1.1036 0.6483 0.0156  -0.0226 0.0516  153 PHE D CB  
4880 C CG  . PHE D 136 ? 0.9233 1.0863 0.6499 0.0063  -0.0195 0.0606  153 PHE D CG  
4881 C CD1 . PHE D 136 ? 0.9054 1.0718 0.6471 -0.0006 -0.0108 0.0542  153 PHE D CD1 
4882 C CD2 . PHE D 136 ? 0.9745 1.1144 0.6850 0.0043  -0.0260 0.0758  153 PHE D CD2 
4883 C CE1 . PHE D 136 ? 0.9449 1.0952 0.6864 -0.0091 -0.0083 0.0613  153 PHE D CE1 
4884 C CE2 . PHE D 136 ? 1.0138 1.1357 0.7246 -0.0056 -0.0234 0.0834  153 PHE D CE2 
4885 C CZ  . PHE D 136 ? 1.0063 1.1349 0.7328 -0.0121 -0.0145 0.0754  153 PHE D CZ  
4886 N N   . VAL D 137 ? 0.9656 1.1870 0.6693 0.0273  -0.0333 0.0514  154 VAL D N   
4887 C CA  . VAL D 137 ? 1.0092 1.2501 0.7097 0.0379  -0.0405 0.0451  154 VAL D CA  
4888 C C   . VAL D 137 ? 1.0247 1.2483 0.7179 0.0521  -0.0534 0.0512  154 VAL D C   
4889 O O   . VAL D 137 ? 1.0576 1.2579 0.7555 0.0553  -0.0561 0.0537  154 VAL D O   
4890 C CB  . VAL D 137 ? 1.0440 1.3036 0.7273 0.0342  -0.0404 0.0500  154 VAL D CB  
4891 C CG1 . VAL D 137 ? 1.0702 1.3467 0.7456 0.0466  -0.0506 0.0470  154 VAL D CG1 
4892 C CG2 . VAL D 137 ? 1.0204 1.3040 0.7148 0.0238  -0.0287 0.0376  154 VAL D CG2 
4893 N N   . LYS D 145 ? 1.1783 1.4378 0.9643 0.0905  -0.0543 -0.0084 162 LYS D N   
4894 C CA  . LYS D 145 ? 1.2094 1.4907 1.0035 0.0795  -0.0466 -0.0132 162 LYS D CA  
4895 C C   . LYS D 145 ? 1.2536 1.5301 1.0305 0.0769  -0.0499 -0.0059 162 LYS D C   
4896 O O   . LYS D 145 ? 1.3013 1.5526 1.0614 0.0770  -0.0536 0.0063  162 LYS D O   
4897 C CB  . LYS D 145 ? 1.1933 1.4717 0.9989 0.0651  -0.0344 -0.0135 162 LYS D CB  
4898 N N   . ARG D 146 ? 1.2287 1.5304 1.0100 0.0739  -0.0485 -0.0134 163 ARG D N   
4899 C CA  . ARG D 146 ? 1.2377 1.5416 1.0028 0.0706  -0.0504 -0.0080 163 ARG D CA  
4900 C C   . ARG D 146 ? 1.1914 1.4814 0.9525 0.0568  -0.0411 -0.0013 163 ARG D C   
4901 O O   . ARG D 146 ? 1.2305 1.5007 0.9738 0.0554  -0.0433 0.0120  163 ARG D O   
4902 C CB  . ARG D 146 ? 1.2305 1.5679 1.0037 0.0701  -0.0506 -0.0208 163 ARG D CB  
4903 N N   . VAL D 147 ? 1.0955 1.3960 0.8742 0.0467  -0.0311 -0.0104 164 VAL D N   
4904 C CA  . VAL D 147 ? 1.0747 1.3654 0.8530 0.0347  -0.0222 -0.0065 164 VAL D CA  
4905 C C   . VAL D 147 ? 1.0133 1.2937 0.8080 0.0295  -0.0151 -0.0080 164 VAL D C   
4906 O O   . VAL D 147 ? 0.9962 1.2892 0.8097 0.0283  -0.0119 -0.0175 164 VAL D O   
4907 C CB  . VAL D 147 ? 1.0792 1.3913 0.8610 0.0272  -0.0172 -0.0156 164 VAL D CB  
4908 C CG1 . VAL D 147 ? 1.0729 1.4068 0.8772 0.0261  -0.0151 -0.0318 164 VAL D CG1 
4909 C CG2 . VAL D 147 ? 1.0802 1.3836 0.8626 0.0164  -0.0083 -0.0124 164 VAL D CG2 
4910 N N   . TYR D 148 ? 0.9630 1.2212 0.7502 0.0259  -0.0131 0.0021  165 TYR D N   
4911 C CA  . TYR D 148 ? 0.9086 1.1576 0.7088 0.0203  -0.0064 0.0018  165 TYR D CA  
4912 C C   . TYR D 148 ? 0.9227 1.1570 0.7149 0.0120  -0.0021 0.0102  165 TYR D C   
4913 O O   . TYR D 148 ? 0.9724 1.2016 0.7480 0.0107  -0.0048 0.0181  165 TYR D O   
4914 C CB  . TYR D 148 ? 0.8869 1.1246 0.6885 0.0284  -0.0109 0.0039  165 TYR D CB  
4915 C CG  . TYR D 148 ? 0.8829 1.0969 0.6671 0.0333  -0.0182 0.0145  165 TYR D CG  
4916 C CD1 . TYR D 148 ? 0.9028 1.1139 0.6747 0.0438  -0.0284 0.0172  165 TYR D CD1 
4917 C CD2 . TYR D 148 ? 0.8786 1.0724 0.6598 0.0276  -0.0159 0.0216  165 TYR D CD2 
4918 C CE1 . TYR D 148 ? 0.9249 1.1105 0.6821 0.0483  -0.0362 0.0274  165 TYR D CE1 
4919 C CE2 . TYR D 148 ? 0.8858 1.0556 0.6530 0.0309  -0.0233 0.0310  165 TYR D CE2 
4920 C CZ  . TYR D 148 ? 0.9362 1.1006 0.6915 0.0412  -0.0336 0.0342  165 TYR D CZ  
4921 O OH  . TYR D 148 ? 1.0112 1.1484 0.7535 0.0446  -0.0422 0.0441  165 TYR D OH  
4922 N N   . SER D 149 ? 0.8718 1.1009 0.6760 0.0061  0.0044  0.0094  166 SER D N   
4923 C CA  . SER D 149 ? 0.8403 1.0581 0.6400 -0.0018 0.0087  0.0162  166 SER D CA  
4924 C C   . SER D 149 ? 0.8291 1.0281 0.6301 -0.0012 0.0078  0.0217  166 SER D C   
4925 O O   . SER D 149 ? 0.8025 0.9994 0.6089 0.0055  0.0047  0.0190  166 SER D O   
4926 C CB  . SER D 149 ? 0.8228 1.0540 0.6361 -0.0093 0.0172  0.0088  166 SER D CB  
4927 O OG  . SER D 149 ? 0.8113 1.0616 0.6283 -0.0081 0.0172  -0.0005 166 SER D OG  
4928 N N   . VAL D 150 ? 0.8025 0.9906 0.5988 -0.0084 0.0102  0.0285  167 VAL D N   
4929 C CA  . VAL D 150 ? 0.7947 0.9679 0.5945 -0.0093 0.0100  0.0317  167 VAL D CA  
4930 C C   . VAL D 150 ? 0.8074 0.9854 0.6166 -0.0182 0.0178  0.0310  167 VAL D C   
4931 O O   . VAL D 150 ? 0.8564 1.0374 0.6605 -0.0254 0.0209  0.0344  167 VAL D O   
4932 C CB  . VAL D 150 ? 0.8041 0.9553 0.5893 -0.0092 0.0029  0.0413  167 VAL D CB  
4933 C CG1 . VAL D 150 ? 0.7951 0.9332 0.5857 -0.0111 0.0027  0.0421  167 VAL D CG1 
4934 C CG2 . VAL D 150 ? 0.8161 0.9605 0.5925 0.0017  -0.0063 0.0417  167 VAL D CG2 
4935 N N   . VAL D 151 ? 0.8160 0.9966 0.6390 -0.0172 0.0209  0.0267  168 VAL D N   
4936 C CA  . VAL D 151 ? 0.7909 0.9744 0.6236 -0.0237 0.0269  0.0264  168 VAL D CA  
4937 C C   . VAL D 151 ? 0.7624 0.9309 0.5897 -0.0258 0.0238  0.0323  168 VAL D C   
4938 O O   . VAL D 151 ? 0.7726 0.9309 0.5964 -0.0201 0.0183  0.0330  168 VAL D O   
4939 C CB  . VAL D 151 ? 0.7699 0.9621 0.6195 -0.0217 0.0307  0.0211  168 VAL D CB  
4940 C CG2 . VAL D 151 ? 0.7744 0.9791 0.6306 -0.0196 0.0320  0.0145  168 VAL D CG2 
4941 N N   . LEU D 152 ? 0.7715 0.9399 0.5981 -0.0341 0.0269  0.0357  169 LEU D N   
4942 C CA  . LEU D 152 ? 0.7823 0.9384 0.6068 -0.0383 0.0244  0.0403  169 LEU D CA  
4943 C C   . LEU D 152 ? 0.7415 0.9092 0.5798 -0.0423 0.0305  0.0371  169 LEU D C   
4944 O O   . LEU D 152 ? 0.7510 0.9309 0.5929 -0.0478 0.0359  0.0360  169 LEU D O   
4945 C CB  . LEU D 152 ? 0.8147 0.9620 0.6264 -0.0462 0.0224  0.0486  169 LEU D CB  
4946 C CG  . LEU D 152 ? 0.8276 0.9566 0.6244 -0.0424 0.0139  0.0545  169 LEU D CG  
4947 N N   . GLU D 153 ? 0.7201 0.8862 0.5662 -0.0386 0.0293  0.0349  170 GLU D N   
4948 C CA  . GLU D 153 ? 0.7118 0.8871 0.5699 -0.0418 0.0334  0.0332  170 GLU D CA  
4949 C C   . GLU D 153 ? 0.7171 0.8835 0.5726 -0.0462 0.0296  0.0360  170 GLU D C   
4950 O O   . GLU D 153 ? 0.7444 0.8983 0.5937 -0.0425 0.0234  0.0364  170 GLU D O   
4951 C CB  . GLU D 153 ? 0.6971 0.8799 0.5670 -0.0352 0.0352  0.0299  170 GLU D CB  
4952 C CG  . GLU D 153 ? 0.7100 0.9036 0.5936 -0.0373 0.0393  0.0282  170 GLU D CG  
4953 C CD  . GLU D 153 ? 0.6912 0.8918 0.5877 -0.0323 0.0420  0.0261  170 GLU D CD  
4954 O OE1 . GLU D 153 ? 0.6849 0.8857 0.5820 -0.0296 0.0427  0.0246  170 GLU D OE1 
4955 O OE2 . GLU D 153 ? 0.7795 0.9858 0.6867 -0.0315 0.0432  0.0261  170 GLU D OE2 
4956 N N   . SER D 154 ? 0.6964 0.8705 0.5570 -0.0542 0.0328  0.0367  171 SER D N   
4957 C CA  . SER D 154 ? 0.7199 0.8886 0.5815 -0.0596 0.0294  0.0381  171 SER D CA  
4958 C C   . SER D 154 ? 0.7219 0.9073 0.5979 -0.0604 0.0332  0.0345  171 SER D C   
4959 O O   . SER D 154 ? 0.7259 0.9258 0.6099 -0.0601 0.0391  0.0322  171 SER D O   
4960 C CB  . SER D 154 ? 0.7369 0.8986 0.5902 -0.0708 0.0286  0.0441  171 SER D CB  
4961 O OG  . SER D 154 ? 0.7498 0.9296 0.6080 -0.0780 0.0359  0.0445  171 SER D OG  
4962 N N   . TYR D 155 ? 0.6960 0.8801 0.5760 -0.0605 0.0292  0.0331  172 TYR D N   
4963 C CA  . TYR D 155 ? 0.7148 0.9155 0.6083 -0.0603 0.0315  0.0300  172 TYR D CA  
4964 C C   . TYR D 155 ? 0.7282 0.9298 0.6249 -0.0666 0.0274  0.0289  172 TYR D C   
4965 O O   . TYR D 155 ? 0.7293 0.9155 0.6180 -0.0699 0.0216  0.0296  172 TYR D O   
4966 C CB  . TYR D 155 ? 0.7346 0.9394 0.6335 -0.0491 0.0309  0.0284  172 TYR D CB  
4967 C CG  . TYR D 155 ? 0.7444 0.9407 0.6370 -0.0441 0.0244  0.0278  172 TYR D CG  
4968 C CD1 . TYR D 155 ? 0.7533 0.9376 0.6356 -0.0393 0.0217  0.0283  172 TYR D CD1 
4969 C CD2 . TYR D 155 ? 0.7833 0.9863 0.6806 -0.0435 0.0205  0.0254  172 TYR D CD2 
4970 C CE1 . TYR D 155 ? 0.7848 0.9642 0.6617 -0.0336 0.0157  0.0257  172 TYR D CE1 
4971 C CE2 . TYR D 155 ? 0.7751 0.9731 0.6663 -0.0381 0.0142  0.0228  172 TYR D CE2 
4972 C CZ  . TYR D 155 ? 0.7744 0.9607 0.6554 -0.0330 0.0120  0.0227  172 TYR D CZ  
4973 O OH  . TYR D 155 ? 0.7989 0.9829 0.6739 -0.0265 0.0059  0.0184  172 TYR D OH  
4974 N N   . ILE D 156 ? 0.7095 0.9294 0.6191 -0.0677 0.0297  0.0261  173 ILE D N   
4975 C CA  . ILE D 156 ? 0.7304 0.9560 0.6460 -0.0716 0.0253  0.0232  173 ILE D CA  
4976 C C   . ILE D 156 ? 0.7294 0.9724 0.6570 -0.0627 0.0253  0.0201  173 ILE D C   
4977 O O   . ILE D 156 ? 0.6969 0.9503 0.6321 -0.0577 0.0303  0.0201  173 ILE D O   
4978 C CB  . ILE D 156 ? 0.7407 0.9740 0.6607 -0.0861 0.0274  0.0238  173 ILE D CB  
4979 C CG1 . ILE D 156 ? 0.7412 0.9763 0.6665 -0.0917 0.0210  0.0202  173 ILE D CG1 
4980 C CG2 . ILE D 156 ? 0.7254 0.9829 0.6574 -0.0870 0.0350  0.0220  173 ILE D CG2 
4981 C CD1 . ILE D 156 ? 0.7492 0.9906 0.6794 -0.1084 0.0224  0.0218  173 ILE D CD1 
4982 N N   . VAL D 157 ? 0.7355 0.9812 0.6646 -0.0603 0.0191  0.0173  174 VAL D N   
4983 C CA  . VAL D 157 ? 0.7485 1.0100 0.6867 -0.0508 0.0176  0.0160  174 VAL D CA  
4984 C C   . VAL D 157 ? 0.7486 1.0197 0.6907 -0.0524 0.0109  0.0111  174 VAL D C   
4985 O O   . VAL D 157 ? 0.7261 0.9864 0.6612 -0.0572 0.0056  0.0080  174 VAL D O   
4986 C CB  . VAL D 157 ? 0.7458 1.0003 0.6770 -0.0392 0.0166  0.0195  174 VAL D CB  
4987 C CG1 . VAL D 157 ? 0.7531 0.9955 0.6718 -0.0380 0.0106  0.0175  174 VAL D CG1 
4988 C CG2 . VAL D 157 ? 0.7372 1.0072 0.6774 -0.0297 0.0156  0.0215  174 VAL D CG2 
4989 N N   . ASP D 158 ? 0.7602 1.0517 0.7144 -0.0476 0.0103  0.0096  175 ASP D N   
4990 C CA  . ASP D 158 ? 0.7888 1.0942 0.7482 -0.0481 0.0036  0.0042  175 ASP D CA  
4991 C C   . ASP D 158 ? 0.7707 1.0725 0.7202 -0.0384 -0.0023 0.0042  175 ASP D C   
4992 O O   . ASP D 158 ? 0.7657 1.0685 0.7124 -0.0279 -0.0008 0.0101  175 ASP D O   
4993 C CB  . ASP D 158 ? 0.8453 1.1754 0.8205 -0.0434 0.0041  0.0030  175 ASP D CB  
4994 C CG  . ASP D 158 ? 0.8928 1.2373 0.8807 -0.0549 0.0074  -0.0014 175 ASP D CG  
4995 O OD1 . ASP D 158 ? 0.8923 1.2292 0.8783 -0.0637 0.0136  0.0000  175 ASP D OD1 
4996 O OD2 . ASP D 158 ? 0.9400 1.3066 0.9400 -0.0549 0.0037  -0.0065 175 ASP D OD2 
4997 N N   . ILE D 159 ? 0.8013 1.1002 0.7462 -0.0423 -0.0092 -0.0026 176 ILE D N   
4998 C CA  . ILE D 159 ? 0.7929 1.0942 0.7288 -0.0329 -0.0157 -0.0055 176 ILE D CA  
4999 C C   . ILE D 159 ? 0.8189 1.1462 0.7623 -0.0256 -0.0198 -0.0066 176 ILE D C   
5000 O O   . ILE D 159 ? 0.8400 1.1807 0.7934 -0.0314 -0.0236 -0.0133 176 ILE D O   
5001 C CB  . ILE D 159 ? 0.7778 1.0680 0.7082 -0.0392 -0.0231 -0.0155 176 ILE D CB  
5002 C CG1 . ILE D 159 ? 0.7736 1.0364 0.6969 -0.0468 -0.0208 -0.0139 176 ILE D CG1 
5003 C CG2 . ILE D 159 ? 0.7870 1.0835 0.7076 -0.0279 -0.0297 -0.0206 176 ILE D CG2 
5004 C CD1 . ILE D 159 ? 0.7842 1.0326 0.7065 -0.0561 -0.0285 -0.0230 176 ILE D CD1 
5005 N N   . PRO D 160 ? 0.8627 1.1981 0.8016 -0.0131 -0.0193 0.0005  177 PRO D N   
5006 C CA  . PRO D 160 ? 0.9006 1.2609 0.8446 -0.0052 -0.0247 0.0004  177 PRO D CA  
5007 C C   . PRO D 160 ? 0.9377 1.3084 0.8768 -0.0054 -0.0340 -0.0112 177 PRO D C   
5008 O O   . PRO D 160 ? 0.9543 1.3130 0.8820 -0.0059 -0.0363 -0.0166 177 PRO D O   
5009 C CB  . PRO D 160 ? 0.8967 1.2590 0.8334 0.0067  -0.0225 0.0126  177 PRO D CB  
5010 C CG  . PRO D 160 ? 0.8613 1.2021 0.7960 0.0037  -0.0143 0.0189  177 PRO D CG  
5011 C CD  . PRO D 160 ? 0.8487 1.1730 0.7791 -0.0065 -0.0141 0.0101  177 PRO D CD  
5012 N N   . GLN D 161 ? 0.9716 1.3653 0.9202 -0.0044 -0.0397 -0.0163 178 GLN D N   
5013 C CA  . GLN D 161 ? 1.0345 1.4409 0.9803 -0.0047 -0.0494 -0.0294 178 GLN D CA  
5014 C C   . GLN D 161 ? 1.1182 1.5326 1.0478 0.0078  -0.0531 -0.0280 178 GLN D C   
5015 O O   . GLN D 161 ? 1.1554 1.5795 1.0805 0.0182  -0.0506 -0.0155 178 GLN D O   
5016 C CB  . GLN D 161 ? 1.0246 1.4584 0.9846 -0.0050 -0.0550 -0.0347 178 GLN D CB  
5017 N N   . GLY D 162 ? 1.1430 1.5534 1.0642 0.0067  -0.0591 -0.0409 179 GLY D N   
5018 C CA  . GLY D 162 ? 1.1698 1.5894 1.0747 0.0183  -0.0619 -0.0418 179 GLY D CA  
5019 C C   . GLY D 162 ? 1.1742 1.5706 1.0684 0.0189  -0.0562 -0.0384 179 GLY D C   
5020 O O   . GLY D 162 ? 1.1640 1.5616 1.0468 0.0244  -0.0601 -0.0473 179 GLY D O   
5021 N N   . ASN D 163 ? 1.1339 1.5116 1.0323 0.0142  -0.0473 -0.0266 180 ASN D N   
5022 C CA  . ASN D 163 ? 1.1072 1.4612 0.9978 0.0129  -0.0423 -0.0246 180 ASN D CA  
5023 C C   . ASN D 163 ? 1.0537 1.3848 0.9480 0.0020  -0.0456 -0.0361 180 ASN D C   
5024 O O   . ASN D 163 ? 0.9895 1.3181 0.8955 -0.0080 -0.0465 -0.0384 180 ASN D O   
5025 C CB  . ASN D 163 ? 1.0930 1.4366 0.9871 0.0117  -0.0324 -0.0088 180 ASN D CB  
5026 C CG  . ASN D 163 ? 1.0993 1.4618 0.9938 0.0203  -0.0297 0.0045  180 ASN D CG  
5027 O OD1 . ASN D 163 ? 1.1439 1.5288 1.0336 0.0280  -0.0348 0.0040  180 ASN D OD1 
5028 N ND2 . ASN D 163 ? 1.0981 1.4511 0.9984 0.0192  -0.0224 0.0168  180 ASN D ND2 
5029 N N   . THR D 164 ? 1.0250 1.3680 0.9079 -0.1390 0.0809  -0.0878 181 THR D N   
5030 C CA  . THR D 164 ? 1.0084 1.3398 0.9113 -0.1411 0.0829  -0.0905 181 THR D CA  
5031 C C   . THR D 164 ? 1.0307 1.3413 0.9364 -0.1336 0.0764  -0.0766 181 THR D C   
5032 O O   . THR D 164 ? 1.0321 1.3377 0.9305 -0.1245 0.0741  -0.0698 181 THR D O   
5033 C CB  . THR D 164 ? 0.9971 1.3233 0.9265 -0.1475 0.0876  -0.1101 181 THR D CB  
5034 O OG1 . THR D 164 ? 1.0017 1.3212 0.9445 -0.1417 0.0883  -0.1166 181 THR D OG1 
5035 C CG2 . THR D 164 ? 1.0111 1.3660 0.9371 -0.1588 0.0965  -0.1276 181 THR D CG2 
5036 N N   . GLU D 165 ? 1.0412 1.3389 0.9539 -0.1419 0.0711  -0.0706 182 GLU D N   
5037 C CA  . GLU D 165 ? 1.0236 1.3013 0.9366 -0.1425 0.0624  -0.0554 182 GLU D CA  
5038 C C   . GLU D 165 ? 1.0141 1.2713 0.9428 -0.1301 0.0601  -0.0572 182 GLU D C   
5039 O O   . GLU D 165 ? 0.9582 1.2142 0.8782 -0.1222 0.0595  -0.0478 182 GLU D O   
5040 C CB  . GLU D 165 ? 1.0841 1.3397 1.0017 -0.1619 0.0501  -0.0471 182 GLU D CB  
5041 C CG  . GLU D 165 ? 1.1479 1.3765 1.0628 -0.1705 0.0345  -0.0271 182 GLU D CG  
5042 C CD  . GLU D 165 ? 1.2694 1.4637 1.1853 -0.1958 0.0126  -0.0144 182 GLU D CD  
5043 O OE1 . GLU D 165 ? 1.3260 1.4950 1.2673 -0.1926 0.0035  -0.0269 182 GLU D OE1 
5044 O OE2 . GLU D 165 ? 1.3421 1.5350 1.2329 -0.2222 0.0019  0.0071  182 GLU D OE2 
5045 N N   . GLU D 166 ? 0.9879 1.2353 0.9434 -0.1288 0.0590  -0.0745 183 GLU D N   
5046 C CA  . GLU D 166 ? 0.9188 1.1552 0.9009 -0.1187 0.0553  -0.0861 183 GLU D CA  
5047 C C   . GLU D 166 ? 0.8752 1.1340 0.8427 -0.1136 0.0677  -0.0894 183 GLU D C   
5048 O O   . GLU D 166 ? 0.8700 1.1219 0.8458 -0.1068 0.0651  -0.0887 183 GLU D O   
5049 C CB  . GLU D 166 ? 0.9075 1.1436 0.9300 -0.1179 0.0516  -0.1168 183 GLU D CB  
5050 N N   . ASP D 167 ? 0.8406 1.1233 0.7839 -0.1199 0.0775  -0.0911 184 ASP D N   
5051 C CA  . ASP D 167 ? 0.8419 1.1363 0.7616 -0.1220 0.0813  -0.0865 184 ASP D CA  
5052 C C   . ASP D 167 ? 0.8213 1.0991 0.7218 -0.1123 0.0731  -0.0637 184 ASP D C   
5053 O O   . ASP D 167 ? 0.8176 1.0911 0.7070 -0.1116 0.0713  -0.0583 184 ASP D O   
5054 C CB  . ASP D 167 ? 0.8528 1.1693 0.7483 -0.1352 0.0849  -0.0896 184 ASP D CB  
5055 C CG  . ASP D 167 ? 0.8559 1.2024 0.7657 -0.1508 0.0963  -0.1172 184 ASP D CG  
5056 O OD1 . ASP D 167 ? 0.8901 1.2550 0.7989 -0.1617 0.1019  -0.1287 184 ASP D OD1 
5057 O OD2 . ASP D 167 ? 0.8548 1.2122 0.7776 -0.1546 0.1004  -0.1309 184 ASP D OD2 
5058 N N   . THR D 168 ? 0.8285 1.1026 0.7254 -0.1079 0.0682  -0.0541 185 THR D N   
5059 C CA  . THR D 168 ? 0.8090 1.0797 0.6945 -0.0994 0.0613  -0.0417 185 THR D CA  
5060 C C   . THR D 168 ? 0.8005 1.0542 0.6962 -0.0968 0.0594  -0.0341 185 THR D C   
5061 O O   . THR D 168 ? 0.8124 1.0596 0.7010 -0.0904 0.0567  -0.0283 185 THR D O   
5062 C CB  . THR D 168 ? 0.7586 1.0481 0.6415 -0.1010 0.0593  -0.0425 185 THR D CB  
5063 N N   . ARG D 169 ? 0.8331 1.0754 0.7454 -0.1032 0.0566  -0.0331 186 ARG D N   
5064 C CA  . ARG D 169 ? 0.8716 1.0934 0.7946 -0.1026 0.0481  -0.0234 186 ARG D CA  
5065 C C   . ARG D 169 ? 0.8582 1.0748 0.7944 -0.0934 0.0503  -0.0320 186 ARG D C   
5066 O O   . ARG D 169 ? 0.8518 1.0608 0.7858 -0.0890 0.0469  -0.0232 186 ARG D O   
5067 C CB  . ARG D 169 ? 0.9271 1.1270 0.8671 -0.1133 0.0348  -0.0197 186 ARG D CB  
5068 C CG  . ARG D 169 ? 0.9893 1.1608 0.9392 -0.1163 0.0168  -0.0052 186 ARG D CG  
5069 C CD  . ARG D 169 ? 1.0675 1.2092 1.0227 -0.1349 -0.0059 0.0072  186 ARG D CD  
5070 N NE  . ARG D 169 ? 1.1021 1.2371 1.0786 -0.1335 -0.0080 -0.0107 186 ARG D NE  
5071 C CZ  . ARG D 169 ? 1.1428 1.2846 1.1039 -0.1500 -0.0061 -0.0082 186 ARG D CZ  
5072 N NH1 . ARG D 169 ? 1.1463 1.3083 1.0712 -0.1713 -0.0017 0.0091  186 ARG D NH1 
5073 N NH2 . ARG D 169 ? 1.1679 1.3033 1.1528 -0.1466 -0.0080 -0.0280 186 ARG D NH2 
5074 N N   . MET D 170 ? 0.8651 1.0937 0.8148 -0.0939 0.0572  -0.0521 187 MET D N   
5075 C CA  . MET D 170 ? 0.8331 1.0736 0.7955 -0.0923 0.0624  -0.0681 187 MET D CA  
5076 C C   . MET D 170 ? 0.7864 1.0283 0.7173 -0.0932 0.0652  -0.0537 187 MET D C   
5077 O O   . MET D 170 ? 0.8095 1.0470 0.7456 -0.0896 0.0634  -0.0518 187 MET D O   
5078 C CB  . MET D 170 ? 0.8954 1.1653 0.8659 -0.1018 0.0733  -0.0943 187 MET D CB  
5079 C CG  . MET D 170 ? 0.9657 1.2643 0.9649 -0.1050 0.0795  -0.1257 187 MET D CG  
5080 S SD  . MET D 170 ? 1.0659 1.4095 1.0864 -0.1190 0.0917  -0.1663 187 MET D SD  
5081 C CE  . MET D 170 ? 1.0421 1.3556 1.1151 -0.1009 0.0742  -0.1795 187 MET D CE  
5082 N N   . PHE D 171 ? 0.7042 0.9490 0.6051 -0.0970 0.0654  -0.0440 188 PHE D N   
5083 C CA  . PHE D 171 ? 0.6769 0.9146 0.5492 -0.0979 0.0598  -0.0312 188 PHE D CA  
5084 C C   . PHE D 171 ? 0.6670 0.8898 0.5392 -0.0857 0.0530  -0.0184 188 PHE D C   
5085 O O   . PHE D 171 ? 0.6795 0.8939 0.5429 -0.0851 0.0500  -0.0126 188 PHE D O   
5086 C CB  . PHE D 171 ? 0.6466 0.8847 0.4942 -0.1019 0.0518  -0.0258 188 PHE D CB  
5087 C CG  . PHE D 171 ? 0.6235 0.8426 0.4458 -0.1006 0.0350  -0.0124 188 PHE D CG  
5088 C CD1 . PHE D 171 ? 0.6322 0.8447 0.4321 -0.1177 0.0312  -0.0066 188 PHE D CD1 
5089 C CD2 . PHE D 171 ? 0.6305 0.8410 0.4535 -0.0844 0.0203  -0.0092 188 PHE D CD2 
5090 C CE1 . PHE D 171 ? 0.6603 0.8450 0.4352 -0.1190 0.0088  0.0083  188 PHE D CE1 
5091 C CE2 . PHE D 171 ? 0.6536 0.8408 0.4612 -0.0796 -0.0023 -0.0011 188 PHE D CE2 
5092 C CZ  . PHE D 171 ? 0.6690 0.8367 0.4506 -0.0972 -0.0102 0.0107  188 PHE D CZ  
5093 N N   . VAL D 172 ? 0.6403 0.8651 0.5199 -0.0805 0.0511  -0.0153 189 VAL D N   
5094 C CA  . VAL D 172 ? 0.6435 0.8670 0.5208 -0.0749 0.0462  -0.0075 189 VAL D CA  
5095 C C   . VAL D 172 ? 0.6439 0.8561 0.5329 -0.0763 0.0462  -0.0012 189 VAL D C   
5096 O O   . VAL D 172 ? 0.6570 0.8656 0.5396 -0.0727 0.0435  0.0042  189 VAL D O   
5097 C CB  . VAL D 172 ? 0.6567 0.8993 0.5354 -0.0782 0.0456  -0.0092 189 VAL D CB  
5098 C CG1 . VAL D 172 ? 0.6669 0.9216 0.5431 -0.0783 0.0427  -0.0068 189 VAL D CG1 
5099 C CG2 . VAL D 172 ? 0.6411 0.8994 0.5147 -0.0730 0.0428  -0.0199 189 VAL D CG2 
5100 N N   . ASP D 173 ? 0.6263 0.8315 0.5358 -0.0802 0.0454  -0.0042 190 ASP D N   
5101 C CA  . ASP D 173 ? 0.6332 0.8246 0.5608 -0.0789 0.0378  -0.0001 190 ASP D CA  
5102 C C   . ASP D 173 ? 0.6332 0.8292 0.5601 -0.0741 0.0433  -0.0070 190 ASP D C   
5103 O O   . ASP D 173 ? 0.6506 0.8412 0.5752 -0.0720 0.0398  0.0011  190 ASP D O   
5104 C CB  . ASP D 173 ? 0.6506 0.8292 0.6105 -0.0795 0.0277  -0.0087 190 ASP D CB  
5105 C CG  . ASP D 173 ? 0.7106 0.8741 0.6667 -0.0918 0.0146  0.0059  190 ASP D CG  
5106 O OD1 . ASP D 173 ? 0.7249 0.9024 0.6536 -0.1019 0.0200  0.0165  190 ASP D OD1 
5107 O OD2 . ASP D 173 ? 0.7461 0.8852 0.7288 -0.0936 -0.0041 0.0044  190 ASP D OD2 
5108 N N   . THR D 174 ? 0.6205 0.8303 0.5455 -0.0776 0.0519  -0.0218 191 THR D N   
5109 C CA  . THR D 174 ? 0.5971 0.8173 0.5102 -0.0836 0.0574  -0.0273 191 THR D CA  
5110 C C   . THR D 174 ? 0.5990 0.8046 0.4840 -0.0818 0.0523  -0.0091 191 THR D C   
5111 O O   . THR D 174 ? 0.5908 0.7955 0.4749 -0.0830 0.0521  -0.0075 191 THR D O   
5112 C CB  . THR D 174 ? 0.6007 0.8412 0.5002 -0.0986 0.0653  -0.0403 191 THR D CB  
5113 O OG1 . THR D 174 ? 0.5743 0.8423 0.5083 -0.1021 0.0726  -0.0692 191 THR D OG1 
5114 C CG2 . THR D 174 ? 0.6125 0.8546 0.4764 -0.1148 0.0646  -0.0330 191 THR D CG2 
5115 N N   . VAL D 175 ? 0.6084 0.8056 0.4759 -0.0778 0.0466  0.0000  192 VAL D N   
5116 C CA  . VAL D 175 ? 0.6664 0.8515 0.5161 -0.0731 0.0376  0.0087  192 VAL D CA  
5117 C C   . VAL D 175 ? 0.6901 0.8766 0.5507 -0.0667 0.0374  0.0136  192 VAL D C   
5118 O O   . VAL D 175 ? 0.7184 0.8981 0.5716 -0.0653 0.0338  0.0175  192 VAL D O   
5119 C CB  . VAL D 175 ? 0.6838 0.8661 0.5238 -0.0663 0.0268  0.0076  192 VAL D CB  
5120 C CG1 . VAL D 175 ? 0.6933 0.8646 0.5276 -0.0564 0.0127  0.0080  192 VAL D CG1 
5121 C CG2 . VAL D 175 ? 0.7155 0.8913 0.5379 -0.0765 0.0211  0.0079  192 VAL D CG2 
5122 N N   . VAL D 176 ? 0.6680 0.8631 0.5425 -0.0674 0.0391  0.0149  193 VAL D N   
5123 C CA  . VAL D 176 ? 0.6507 0.8497 0.5292 -0.0703 0.0362  0.0230  193 VAL D CA  
5124 C C   . VAL D 176 ? 0.6593 0.8476 0.5491 -0.0705 0.0346  0.0270  193 VAL D C   
5125 O O   . VAL D 176 ? 0.6484 0.8365 0.5328 -0.0704 0.0329  0.0321  193 VAL D O   
5126 C CB  . VAL D 176 ? 0.6661 0.8736 0.5493 -0.0812 0.0334  0.0282  193 VAL D CB  
5127 C CG1 . VAL D 176 ? 0.7099 0.9167 0.5927 -0.0939 0.0252  0.0426  193 VAL D CG1 
5128 C CG2 . VAL D 176 ? 0.6574 0.8901 0.5313 -0.0822 0.0364  0.0186  193 VAL D CG2 
5129 N N   . LYS D 177 ? 0.6518 0.8361 0.5615 -0.0699 0.0346  0.0194  194 LYS D N   
5130 C CA  . LYS D 177 ? 0.6681 0.8513 0.5993 -0.0672 0.0312  0.0137  194 LYS D CA  
5131 C C   . LYS D 177 ? 0.6589 0.8488 0.5728 -0.0689 0.0387  0.0110  194 LYS D C   
5132 O O   . LYS D 177 ? 0.6595 0.8495 0.5784 -0.0682 0.0357  0.0141  194 LYS D O   
5133 C CB  . LYS D 177 ? 0.7071 0.8969 0.6711 -0.0641 0.0302  -0.0071 194 LYS D CB  
5134 C CG  . LYS D 177 ? 0.7516 0.9232 0.7389 -0.0626 0.0138  -0.0033 194 LYS D CG  
5135 C CD  . LYS D 177 ? 0.7886 0.9688 0.8055 -0.0588 0.0147  -0.0289 194 LYS D CD  
5136 N N   . SER D 178 ? 0.6807 0.8731 0.5714 -0.0743 0.0448  0.0077  195 SER D N   
5137 C CA  . SER D 178 ? 0.6907 0.8808 0.5571 -0.0825 0.0456  0.0100  195 SER D CA  
5138 C C   . SER D 178 ? 0.6907 0.8677 0.5459 -0.0766 0.0390  0.0221  195 SER D C   
5139 O O   . SER D 178 ? 0.6813 0.8573 0.5302 -0.0811 0.0389  0.0238  195 SER D O   
5140 C CB  . SER D 178 ? 0.7269 0.9109 0.5646 -0.0935 0.0432  0.0111  195 SER D CB  
5141 O OG  . SER D 178 ? 0.7727 0.9383 0.5809 -0.1019 0.0335  0.0211  195 SER D OG  
5142 N N   . ASN D 179 ? 0.6921 0.8662 0.5460 -0.0688 0.0345  0.0260  196 ASN D N   
5143 C CA  . ASN D 179 ? 0.7075 0.8820 0.5565 -0.0644 0.0296  0.0288  196 ASN D CA  
5144 C C   . ASN D 179 ? 0.6954 0.8783 0.5556 -0.0678 0.0314  0.0356  196 ASN D C   
5145 O O   . ASN D 179 ? 0.6458 0.8286 0.5001 -0.0686 0.0299  0.0375  196 ASN D O   
5146 C CB  . ASN D 179 ? 0.7408 0.9288 0.5925 -0.0589 0.0267  0.0220  196 ASN D CB  
5147 C CG  . ASN D 179 ? 0.7465 0.9231 0.5902 -0.0509 0.0162  0.0133  196 ASN D CG  
5148 O OD1 . ASN D 179 ? 0.8103 0.9620 0.6388 -0.0532 0.0073  0.0173  196 ASN D OD1 
5149 N ND2 . ASN D 179 ? 0.7511 0.9466 0.6041 -0.0447 0.0139  0.0013  196 ASN D ND2 
5150 N N   . LEU D 180 ? 0.6949 0.8814 0.5715 -0.0709 0.0303  0.0402  197 LEU D N   
5151 C CA  . LEU D 180 ? 0.7081 0.8957 0.5943 -0.0767 0.0230  0.0509  197 LEU D CA  
5152 C C   . LEU D 180 ? 0.7117 0.8960 0.6093 -0.0732 0.0227  0.0473  197 LEU D C   
5153 O O   . LEU D 180 ? 0.7258 0.9127 0.6221 -0.0764 0.0186  0.0544  197 LEU D O   
5154 C CB  . LEU D 180 ? 0.7183 0.8988 0.6196 -0.0830 0.0118  0.0592  197 LEU D CB  
5155 C CG  . LEU D 180 ? 0.7320 0.9240 0.6181 -0.0954 0.0117  0.0647  197 LEU D CG  
5156 C CD1 . LEU D 180 ? 0.7437 0.9190 0.6401 -0.1073 -0.0052 0.0778  197 LEU D CD1 
5157 C CD2 . LEU D 180 ? 0.7333 0.9505 0.6001 -0.1085 0.0140  0.0681  197 LEU D CD2 
5158 N N   . GLN D 181 ? 0.6858 0.8722 0.5945 -0.0696 0.0278  0.0334  198 GLN D N   
5159 C CA  . GLN D 181 ? 0.6813 0.8788 0.6047 -0.0697 0.0295  0.0220  198 GLN D CA  
5160 C C   . GLN D 181 ? 0.6445 0.8421 0.5400 -0.0764 0.0350  0.0266  198 GLN D C   
5161 O O   . GLN D 181 ? 0.6361 0.8418 0.5387 -0.0781 0.0337  0.0252  198 GLN D O   
5162 C CB  . GLN D 181 ? 0.7110 0.9262 0.6493 -0.0717 0.0372  -0.0006 198 GLN D CB  
5163 C CG  . GLN D 181 ? 0.7534 0.9957 0.7261 -0.0704 0.0366  -0.0240 198 GLN D CG  
5164 C CD  . GLN D 181 ? 0.7520 0.9982 0.7786 -0.0560 0.0219  -0.0420 198 GLN D CD  
5165 O OE1 . GLN D 181 ? 0.7303 0.9724 0.7679 -0.0529 0.0207  -0.0491 198 GLN D OE1 
5166 N NE2 . GLN D 181 ? 0.7521 1.0051 0.8162 -0.0464 0.0071  -0.0521 198 GLN D NE2 
5167 N N   . ASN D 182 ? 0.6478 0.8335 0.5140 -0.0795 0.0370  0.0313  199 ASN D N   
5168 C CA  . ASN D 182 ? 0.6672 0.8425 0.5080 -0.0851 0.0349  0.0355  199 ASN D CA  
5169 C C   . ASN D 182 ? 0.6560 0.8326 0.4987 -0.0802 0.0312  0.0419  199 ASN D C   
5170 O O   . ASN D 182 ? 0.6652 0.8417 0.5006 -0.0847 0.0306  0.0434  199 ASN D O   
5171 C CB  . ASN D 182 ? 0.7004 0.8550 0.5168 -0.0866 0.0277  0.0368  199 ASN D CB  
5172 C CG  . ASN D 182 ? 0.7145 0.8674 0.5139 -0.1031 0.0289  0.0345  199 ASN D CG  
5173 O OD1 . ASN D 182 ? 0.7210 0.8911 0.5181 -0.1184 0.0361  0.0290  199 ASN D OD1 
5174 N ND2 . ASN D 182 ? 0.7131 0.8525 0.5006 -0.1035 0.0217  0.0361  199 ASN D ND2 
5175 N N   . LEU D 183 ? 0.6690 0.8521 0.5189 -0.0756 0.0292  0.0444  200 LEU D N   
5176 C CA  . LEU D 183 ? 0.6542 0.8522 0.5052 -0.0794 0.0269  0.0491  200 LEU D CA  
5177 C C   . LEU D 183 ? 0.6457 0.8472 0.5071 -0.0848 0.0237  0.0585  200 LEU D C   
5178 O O   . LEU D 183 ? 0.6359 0.8454 0.4907 -0.0899 0.0230  0.0609  200 LEU D O   
5179 C CB  . LEU D 183 ? 0.6478 0.8601 0.5027 -0.0840 0.0256  0.0514  200 LEU D CB  
5180 C CG  . LEU D 183 ? 0.6483 0.8894 0.4971 -0.0994 0.0240  0.0544  200 LEU D CG  
5181 C CD1 . LEU D 183 ? 0.6530 0.9132 0.4966 -0.0958 0.0277  0.0355  200 LEU D CD1 
5182 N N   . ALA D 184 ? 0.6405 0.8373 0.5226 -0.0822 0.0193  0.0598  201 ALA D N   
5183 C CA  . ALA D 184 ? 0.6669 0.8659 0.5694 -0.0831 0.0088  0.0646  201 ALA D CA  
5184 C C   . ALA D 184 ? 0.6965 0.9039 0.5940 -0.0840 0.0152  0.0579  201 ALA D C   
5185 O O   . ALA D 184 ? 0.7437 0.9569 0.6436 -0.0884 0.0083  0.0658  201 ALA D O   
5186 C CB  . ALA D 184 ? 0.6526 0.8470 0.5895 -0.0745 -0.0004 0.0556  201 ALA D CB  
5187 N N   . VAL D 185 ? 0.6849 0.8930 0.5708 -0.0847 0.0264  0.0457  202 VAL D N   
5188 C CA  . VAL D 185 ? 0.6691 0.8859 0.5454 -0.0924 0.0318  0.0392  202 VAL D CA  
5189 C C   . VAL D 185 ? 0.6643 0.8731 0.5163 -0.0972 0.0312  0.0480  202 VAL D C   
5190 O O   . VAL D 185 ? 0.6191 0.8387 0.4754 -0.1009 0.0296  0.0499  202 VAL D O   
5191 C CB  . VAL D 185 ? 0.6659 0.8848 0.5257 -0.1030 0.0403  0.0277  202 VAL D CB  
5192 C CG1 . VAL D 185 ? 0.6696 0.8943 0.5069 -0.1202 0.0440  0.0252  202 VAL D CG1 
5193 C CG2 . VAL D 185 ? 0.6651 0.9082 0.5562 -0.1007 0.0437  0.0090  202 VAL D CG2 
5194 N N   . ILE D 186 ? 0.6650 0.8574 0.4966 -0.0958 0.0302  0.0489  203 ILE D N   
5195 C CA  . ILE D 186 ? 0.7043 0.8925 0.5218 -0.0971 0.0268  0.0481  203 ILE D CA  
5196 C C   . ILE D 186 ? 0.7199 0.9310 0.5468 -0.0994 0.0266  0.0527  203 ILE D C   
5197 O O   . ILE D 186 ? 0.8006 1.0179 0.6200 -0.1042 0.0263  0.0498  203 ILE D O   
5198 C CB  . ILE D 186 ? 0.7175 0.8921 0.5274 -0.0893 0.0202  0.0394  203 ILE D CB  
5199 C CG1 . ILE D 186 ? 0.7130 0.8942 0.5336 -0.0827 0.0220  0.0389  203 ILE D CG1 
5200 C CG2 . ILE D 186 ? 0.7553 0.8953 0.5443 -0.0925 0.0089  0.0371  203 ILE D CG2 
5201 C CD1 . ILE D 186 ? 0.7017 0.8991 0.5286 -0.0763 0.0189  0.0253  203 ILE D CD1 
5202 N N   . SER D 187 ? 0.7051 0.9277 0.5444 -0.1004 0.0243  0.0606  204 SER D N   
5203 C CA  . SER D 187 ? 0.7603 1.0051 0.5993 -0.1128 0.0198  0.0697  204 SER D CA  
5204 C C   . SER D 187 ? 0.7813 1.0250 0.6338 -0.1169 0.0098  0.0836  204 SER D C   
5205 O O   . SER D 187 ? 0.8114 1.0539 0.6732 -0.1240 -0.0042 0.0984  204 SER D O   
5206 C CB  . SER D 187 ? 0.7759 1.0341 0.6132 -0.1207 0.0175  0.0730  204 SER D CB  
5207 O OG  . SER D 187 ? 0.7866 1.0268 0.6363 -0.1161 0.0110  0.0821  204 SER D OG  
5208 N N   . THR D 188 ? 0.8236 1.0666 0.6780 -0.1139 0.0131  0.0780  205 THR D N   
5209 C CA  . THR D 188 ? 0.8425 1.0882 0.7200 -0.1116 0.0031  0.0813  205 THR D CA  
5210 C C   . THR D 188 ? 0.8802 1.1350 0.7513 -0.1140 0.0117  0.0715  205 THR D C   
5211 O O   . THR D 188 ? 0.8365 1.0838 0.6854 -0.1164 0.0229  0.0633  205 THR D O   
5212 C CB  . THR D 188 ? 0.8405 1.0783 0.7454 -0.0992 -0.0012 0.0727  205 THR D CB  
5213 O OG1 . THR D 188 ? 0.7964 1.0237 0.7183 -0.0994 -0.0218 0.0869  205 THR D OG1 
5214 C CG2 . THR D 188 ? 0.8608 1.1144 0.7927 -0.0929 -0.0014 0.0548  205 THR D CG2 
5215 N N   . ALA D 189 ? 0.9849 1.2530 0.8751 -0.1149 0.0022  0.0729  206 ALA D N   
5216 C CA  . ALA D 189 ? 1.0688 1.3520 0.9549 -0.1201 0.0102  0.0621  206 ALA D CA  
5217 C C   . ALA D 189 ? 1.1073 1.4055 1.0124 -0.1164 0.0168  0.0399  206 ALA D C   
5218 O O   . ALA D 189 ? 1.0560 1.3579 0.9920 -0.1052 0.0100  0.0306  206 ALA D O   
5219 C CB  . ALA D 189 ? 1.0673 1.3654 0.9657 -0.1246 -0.0034 0.0713  206 ALA D CB  
5220 N N   . SER D 190 ? 1.1606 1.4714 1.0469 -0.1299 0.0291  0.0293  207 SER D N   
5221 C CA  . SER D 190 ? 1.1982 1.5353 1.0913 -0.1388 0.0392  0.0056  207 SER D CA  
5222 C C   . SER D 190 ? 1.1718 1.5509 1.0778 -0.1498 0.0429  -0.0127 207 SER D C   
5223 O O   . SER D 190 ? 1.0771 1.4958 0.9927 -0.1625 0.0527  -0.0392 207 SER D O   
5224 C CB  . SER D 190 ? 1.2298 1.5436 1.0765 -0.1568 0.0491  0.0099  207 SER D CB  
5225 O OG  . SER D 190 ? 1.2732 1.5644 1.0815 -0.1710 0.0488  0.0220  207 SER D OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   18  ?   ?   ?   A . n 
A 1 2   HIS 2   19  ?   ?   ?   A . n 
A 1 3   MET 3   20  ?   ?   ?   A . n 
A 1 4   THR 4   21  ?   ?   ?   A . n 
A 1 5   PRO 5   22  ?   ?   ?   A . n 
A 1 6   TYR 6   23  23  TYR TYR A . n 
A 1 7   GLY 7   24  24  GLY GLY A . n 
A 1 8   LEU 8   25  25  LEU LEU A . n 
A 1 9   THR 9   26  26  THR THR A . n 
A 1 10  LYS 10  27  27  LYS LYS A . n 
A 1 11  ASP 11  28  28  ASP ASP A . n 
A 1 12  GLU 12  29  29  GLU GLU A . n 
A 1 13  PHE 13  30  30  PHE PHE A . n 
A 1 14  SER 14  31  31  SER SER A . n 
A 1 15  THR 15  32  32  THR THR A . n 
A 1 16  LEU 16  33  33  LEU LEU A . n 
A 1 17  ASP 17  34  34  ASP ASP A . n 
A 1 18  SER 18  35  35  SER SER A . n 
A 1 19  ILE 19  36  36  ILE ILE A . n 
A 1 20  ILE 20  37  37  ILE ILE A . n 
A 1 21  ARG 21  38  38  ARG ARG A . n 
A 1 22  THR 22  39  39  THR THR A . n 
A 1 23  HIS 23  40  40  HIS HIS A . n 
A 1 24  HIS 24  41  41  HIS HIS A . n 
A 1 25  THR 25  42  42  THR THR A . n 
A 1 26  PHE 26  43  43  PHE PHE A . n 
A 1 27  PRO 27  44  44  PRO PRO A . n 
A 1 28  ARG 28  45  45  ARG ARG A . n 
A 1 29  SER 29  46  46  SER SER A . n 
A 1 30  PRO 30  47  47  PRO PRO A . n 
A 1 31  ASN 31  48  48  ASN ASN A . n 
A 1 32  THR 32  49  49  THR THR A . n 
A 1 33  CYS 33  50  50  CYS CYS A . n 
A 1 34  THR 34  51  51  THR THR A . n 
A 1 35  SER 35  52  52  SER SER A . n 
A 1 36  LEU 36  53  53  LEU LEU A . n 
A 1 37  ILE 37  54  54  ILE ILE A . n 
A 1 38  ALA 38  55  55  ALA ALA A . n 
A 1 39  HIS 39  56  56  HIS HIS A . n 
A 1 40  ARG 40  57  57  ARG ARG A . n 
A 1 41  VAL 41  58  58  VAL VAL A . n 
A 1 42  ASP 42  59  59  ASP ASP A . n 
A 1 43  ALA 43  60  60  ALA ALA A . n 
A 1 44  PRO 44  61  61  PRO PRO A . n 
A 1 45  ALA 45  62  62  ALA ALA A . n 
A 1 46  HIS 46  63  63  HIS HIS A . n 
A 1 47  ALA 47  64  64  ALA ALA A . n 
A 1 48  ILE 48  65  65  ILE ILE A . n 
A 1 49  TRP 49  66  66  TRP TRP A . n 
A 1 50  ARG 50  67  67  ARG ARG A . n 
A 1 51  PHE 51  68  68  PHE PHE A . n 
A 1 52  VAL 52  69  69  VAL VAL A . n 
A 1 53  ARG 53  70  70  ARG ARG A . n 
A 1 54  ASP 54  71  71  ASP ASP A . n 
A 1 55  PHE 55  72  72  PHE PHE A . n 
A 1 56  ALA 56  73  73  ALA ALA A . n 
A 1 57  ASN 57  74  74  ASN ASN A . n 
A 1 58  PRO 58  75  75  PRO PRO A . n 
A 1 59  ASN 59  76  76  ASN ASN A . n 
A 1 60  LYS 60  77  77  LYS LYS A . n 
A 1 61  TYR 61  78  78  TYR TYR A . n 
A 1 62  LYS 62  79  79  LYS LYS A . n 
A 1 63  HIS 63  80  80  HIS HIS A . n 
A 1 64  PHE 64  81  81  PHE PHE A . n 
A 1 65  ILE 65  82  82  ILE ILE A . n 
A 1 66  LYS 66  83  83  LYS LYS A . n 
A 1 67  SER 67  84  84  SER SER A . n 
A 1 68  CYS 68  85  85  CYS CYS A . n 
A 1 69  THR 69  86  86  THR THR A . n 
A 1 70  ILE 70  87  87  ILE ILE A . n 
A 1 71  ARG 71  88  88  ARG ARG A . n 
A 1 72  VAL 72  89  89  VAL VAL A . n 
A 1 73  ASN 73  90  90  ASN ASN A . n 
A 1 74  GLY 74  91  ?   ?   ?   A . n 
A 1 75  ASN 75  92  ?   ?   ?   A . n 
A 1 76  GLY 76  93  ?   ?   ?   A . n 
A 1 77  ILE 77  94  ?   ?   ?   A . n 
A 1 78  LYS 78  95  95  LYS LYS A . n 
A 1 79  GLU 79  96  96  GLU GLU A . n 
A 1 80  ILE 80  97  97  ILE ILE A . n 
A 1 81  LYS 81  98  98  LYS LYS A . n 
A 1 82  VAL 82  99  99  VAL VAL A . n 
A 1 83  GLY 83  100 100 GLY GLY A . n 
A 1 84  THR 84  101 101 THR THR A . n 
A 1 85  ILE 85  102 102 ILE ILE A . n 
A 1 86  ARG 86  103 103 ARG ARG A . n 
A 1 87  GLU 87  104 104 GLU GLU A . n 
A 1 88  VAL 88  105 105 VAL VAL A . n 
A 1 89  SER 89  106 106 SER SER A . n 
A 1 90  VAL 90  107 107 VAL VAL A . n 
A 1 91  VAL 91  108 108 VAL VAL A . n 
A 1 92  SER 92  109 109 SER SER A . n 
A 1 93  GLY 93  110 110 GLY GLY A . n 
A 1 94  LEU 94  111 111 LEU LEU A . n 
A 1 95  PRO 95  112 112 PRO PRO A . n 
A 1 96  ALA 96  113 113 ALA ALA A . n 
A 1 97  SER 97  114 114 SER SER A . n 
A 1 98  THR 98  115 115 THR THR A . n 
A 1 99  SER 99  116 116 SER SER A . n 
A 1 100 VAL 100 117 117 VAL VAL A . n 
A 1 101 GLU 101 118 118 GLU GLU A . n 
A 1 102 ILE 102 119 119 ILE ILE A . n 
A 1 103 LEU 103 120 120 LEU LEU A . n 
A 1 104 GLU 104 121 121 GLU GLU A . n 
A 1 105 VAL 105 122 122 VAL VAL A . n 
A 1 106 LEU 106 123 123 LEU LEU A . n 
A 1 107 ASP 107 124 124 ASP ASP A . n 
A 1 108 GLU 108 125 125 GLU GLU A . n 
A 1 109 GLU 109 126 126 GLU GLU A . n 
A 1 110 LYS 110 127 127 LYS LYS A . n 
A 1 111 ARG 111 128 128 ARG ARG A . n 
A 1 112 ILE 112 129 129 ILE ILE A . n 
A 1 113 LEU 113 130 130 LEU LEU A . n 
A 1 114 SER 114 131 131 SER SER A . n 
A 1 115 PHE 115 132 132 PHE PHE A . n 
A 1 116 ARG 116 133 133 ARG ARG A . n 
A 1 117 VAL 117 134 134 VAL VAL A . n 
A 1 118 LEU 118 135 135 LEU LEU A . n 
A 1 119 GLY 119 136 136 GLY GLY A . n 
A 1 120 GLY 120 137 137 GLY GLY A . n 
A 1 121 GLU 121 138 138 GLU GLU A . n 
A 1 122 HIS 122 139 139 HIS HIS A . n 
A 1 123 ARG 123 140 140 ARG ARG A . n 
A 1 124 LEU 124 141 141 LEU LEU A . n 
A 1 125 ASN 125 142 142 ASN ASN A . n 
A 1 126 ASN 126 143 143 ASN ASN A . n 
A 1 127 TYR 127 144 144 TYR TYR A . n 
A 1 128 ARG 128 145 145 ARG ARG A . n 
A 1 129 SER 129 146 146 SER SER A . n 
A 1 130 VAL 130 147 147 VAL VAL A . n 
A 1 131 THR 131 148 148 THR THR A . n 
A 1 132 SER 132 149 149 SER SER A . n 
A 1 133 VAL 133 150 150 VAL VAL A . n 
A 1 134 ASN 134 151 151 ASN ASN A . n 
A 1 135 GLU 135 152 152 GLU GLU A . n 
A 1 136 PHE 136 153 153 PHE PHE A . n 
A 1 137 VAL 137 154 154 VAL VAL A . n 
A 1 138 VAL 138 155 155 VAL VAL A . n 
A 1 139 LEU 139 156 156 LEU LEU A . n 
A 1 140 GLU 140 157 ?   ?   ?   A . n 
A 1 141 LYS 141 158 ?   ?   ?   A . n 
A 1 142 ASP 142 159 ?   ?   ?   A . n 
A 1 143 LYS 143 160 ?   ?   ?   A . n 
A 1 144 LYS 144 161 161 LYS LYS A . n 
A 1 145 LYS 145 162 162 LYS LYS A . n 
A 1 146 ARG 146 163 163 ARG ARG A . n 
A 1 147 VAL 147 164 164 VAL VAL A . n 
A 1 148 TYR 148 165 165 TYR TYR A . n 
A 1 149 SER 149 166 166 SER SER A . n 
A 1 150 VAL 150 167 167 VAL VAL A . n 
A 1 151 VAL 151 168 168 VAL VAL A . n 
A 1 152 LEU 152 169 169 LEU LEU A . n 
A 1 153 GLU 153 170 170 GLU GLU A . n 
A 1 154 SER 154 171 171 SER SER A . n 
A 1 155 TYR 155 172 172 TYR TYR A . n 
A 1 156 ILE 156 173 173 ILE ILE A . n 
A 1 157 VAL 157 174 174 VAL VAL A . n 
A 1 158 ASP 158 175 175 ASP ASP A . n 
A 1 159 ILE 159 176 176 ILE ILE A . n 
A 1 160 PRO 160 177 177 PRO PRO A . n 
A 1 161 GLN 161 178 178 GLN GLN A . n 
A 1 162 GLY 162 179 179 GLY GLY A . n 
A 1 163 ASN 163 180 180 ASN ASN A . n 
A 1 164 THR 164 181 181 THR THR A . n 
A 1 165 GLU 165 182 182 GLU GLU A . n 
A 1 166 GLU 166 183 183 GLU GLU A . n 
A 1 167 ASP 167 184 184 ASP ASP A . n 
A 1 168 THR 168 185 185 THR THR A . n 
A 1 169 ARG 169 186 186 ARG ARG A . n 
A 1 170 MET 170 187 187 MET MET A . n 
A 1 171 PHE 171 188 188 PHE PHE A . n 
A 1 172 VAL 172 189 189 VAL VAL A . n 
A 1 173 ASP 173 190 190 ASP ASP A . n 
A 1 174 THR 174 191 191 THR THR A . n 
A 1 175 VAL 175 192 192 VAL VAL A . n 
A 1 176 VAL 176 193 193 VAL VAL A . n 
A 1 177 LYS 177 194 194 LYS LYS A . n 
A 1 178 SER 178 195 195 SER SER A . n 
A 1 179 ASN 179 196 196 ASN ASN A . n 
A 1 180 LEU 180 197 197 LEU LEU A . n 
A 1 181 GLN 181 198 198 GLN GLN A . n 
A 1 182 ASN 182 199 199 ASN ASN A . n 
A 1 183 LEU 183 200 200 LEU LEU A . n 
A 1 184 ALA 184 201 201 ALA ALA A . n 
A 1 185 VAL 185 202 202 VAL VAL A . n 
A 1 186 ILE 186 203 203 ILE ILE A . n 
A 1 187 SER 187 204 204 SER SER A . n 
A 1 188 THR 188 205 205 THR THR A . n 
A 1 189 ALA 189 206 206 ALA ALA A . n 
A 1 190 SER 190 207 207 SER SER A . n 
A 1 191 PRO 191 208 ?   ?   ?   A . n 
A 1 192 THR 192 209 ?   ?   ?   A . n 
B 1 1   GLY 1   18  ?   ?   ?   B . n 
B 1 2   HIS 2   19  ?   ?   ?   B . n 
B 1 3   MET 3   20  ?   ?   ?   B . n 
B 1 4   THR 4   21  ?   ?   ?   B . n 
B 1 5   PRO 5   22  ?   ?   ?   B . n 
B 1 6   TYR 6   23  23  TYR TYR B . n 
B 1 7   GLY 7   24  24  GLY GLY B . n 
B 1 8   LEU 8   25  25  LEU LEU B . n 
B 1 9   THR 9   26  26  THR THR B . n 
B 1 10  LYS 10  27  27  LYS LYS B . n 
B 1 11  ASP 11  28  28  ASP ASP B . n 
B 1 12  GLU 12  29  29  GLU GLU B . n 
B 1 13  PHE 13  30  30  PHE PHE B . n 
B 1 14  SER 14  31  31  SER SER B . n 
B 1 15  THR 15  32  32  THR THR B . n 
B 1 16  LEU 16  33  33  LEU LEU B . n 
B 1 17  ASP 17  34  34  ASP ASP B . n 
B 1 18  SER 18  35  35  SER SER B . n 
B 1 19  ILE 19  36  36  ILE ILE B . n 
B 1 20  ILE 20  37  37  ILE ILE B . n 
B 1 21  ARG 21  38  38  ARG ARG B . n 
B 1 22  THR 22  39  39  THR THR B . n 
B 1 23  HIS 23  40  40  HIS HIS B . n 
B 1 24  HIS 24  41  41  HIS HIS B . n 
B 1 25  THR 25  42  42  THR THR B . n 
B 1 26  PHE 26  43  43  PHE PHE B . n 
B 1 27  PRO 27  44  44  PRO PRO B . n 
B 1 28  ARG 28  45  45  ARG ARG B . n 
B 1 29  SER 29  46  46  SER SER B . n 
B 1 30  PRO 30  47  47  PRO PRO B . n 
B 1 31  ASN 31  48  48  ASN ASN B . n 
B 1 32  THR 32  49  49  THR THR B . n 
B 1 33  CYS 33  50  50  CYS CYS B . n 
B 1 34  THR 34  51  51  THR THR B . n 
B 1 35  SER 35  52  52  SER SER B . n 
B 1 36  LEU 36  53  53  LEU LEU B . n 
B 1 37  ILE 37  54  54  ILE ILE B . n 
B 1 38  ALA 38  55  55  ALA ALA B . n 
B 1 39  HIS 39  56  56  HIS HIS B . n 
B 1 40  ARG 40  57  57  ARG ARG B . n 
B 1 41  VAL 41  58  58  VAL VAL B . n 
B 1 42  ASP 42  59  59  ASP ASP B . n 
B 1 43  ALA 43  60  60  ALA ALA B . n 
B 1 44  PRO 44  61  61  PRO PRO B . n 
B 1 45  ALA 45  62  62  ALA ALA B . n 
B 1 46  HIS 46  63  63  HIS HIS B . n 
B 1 47  ALA 47  64  64  ALA ALA B . n 
B 1 48  ILE 48  65  65  ILE ILE B . n 
B 1 49  TRP 49  66  66  TRP TRP B . n 
B 1 50  ARG 50  67  67  ARG ARG B . n 
B 1 51  PHE 51  68  68  PHE PHE B . n 
B 1 52  VAL 52  69  69  VAL VAL B . n 
B 1 53  ARG 53  70  70  ARG ARG B . n 
B 1 54  ASP 54  71  71  ASP ASP B . n 
B 1 55  PHE 55  72  72  PHE PHE B . n 
B 1 56  ALA 56  73  73  ALA ALA B . n 
B 1 57  ASN 57  74  74  ASN ASN B . n 
B 1 58  PRO 58  75  75  PRO PRO B . n 
B 1 59  ASN 59  76  76  ASN ASN B . n 
B 1 60  LYS 60  77  77  LYS LYS B . n 
B 1 61  TYR 61  78  78  TYR TYR B . n 
B 1 62  LYS 62  79  79  LYS LYS B . n 
B 1 63  HIS 63  80  80  HIS HIS B . n 
B 1 64  PHE 64  81  81  PHE PHE B . n 
B 1 65  ILE 65  82  82  ILE ILE B . n 
B 1 66  LYS 66  83  83  LYS LYS B . n 
B 1 67  SER 67  84  84  SER SER B . n 
B 1 68  CYS 68  85  85  CYS CYS B . n 
B 1 69  THR 69  86  86  THR THR B . n 
B 1 70  ILE 70  87  87  ILE ILE B . n 
B 1 71  ARG 71  88  88  ARG ARG B . n 
B 1 72  VAL 72  89  89  VAL VAL B . n 
B 1 73  ASN 73  90  90  ASN ASN B . n 
B 1 74  GLY 74  91  ?   ?   ?   B . n 
B 1 75  ASN 75  92  ?   ?   ?   B . n 
B 1 76  GLY 76  93  ?   ?   ?   B . n 
B 1 77  ILE 77  94  ?   ?   ?   B . n 
B 1 78  LYS 78  95  ?   ?   ?   B . n 
B 1 79  GLU 79  96  96  GLU GLU B . n 
B 1 80  ILE 80  97  97  ILE ILE B . n 
B 1 81  LYS 81  98  98  LYS LYS B . n 
B 1 82  VAL 82  99  99  VAL VAL B . n 
B 1 83  GLY 83  100 100 GLY GLY B . n 
B 1 84  THR 84  101 101 THR THR B . n 
B 1 85  ILE 85  102 102 ILE ILE B . n 
B 1 86  ARG 86  103 103 ARG ARG B . n 
B 1 87  GLU 87  104 104 GLU GLU B . n 
B 1 88  VAL 88  105 105 VAL VAL B . n 
B 1 89  SER 89  106 106 SER SER B . n 
B 1 90  VAL 90  107 107 VAL VAL B . n 
B 1 91  VAL 91  108 108 VAL VAL B . n 
B 1 92  SER 92  109 109 SER SER B . n 
B 1 93  GLY 93  110 110 GLY GLY B . n 
B 1 94  LEU 94  111 111 LEU LEU B . n 
B 1 95  PRO 95  112 112 PRO PRO B . n 
B 1 96  ALA 96  113 113 ALA ALA B . n 
B 1 97  SER 97  114 114 SER SER B . n 
B 1 98  THR 98  115 115 THR THR B . n 
B 1 99  SER 99  116 116 SER SER B . n 
B 1 100 VAL 100 117 117 VAL VAL B . n 
B 1 101 GLU 101 118 118 GLU GLU B . n 
B 1 102 ILE 102 119 119 ILE ILE B . n 
B 1 103 LEU 103 120 120 LEU LEU B . n 
B 1 104 GLU 104 121 121 GLU GLU B . n 
B 1 105 VAL 105 122 122 VAL VAL B . n 
B 1 106 LEU 106 123 123 LEU LEU B . n 
B 1 107 ASP 107 124 124 ASP ASP B . n 
B 1 108 GLU 108 125 125 GLU GLU B . n 
B 1 109 GLU 109 126 126 GLU GLU B . n 
B 1 110 LYS 110 127 127 LYS LYS B . n 
B 1 111 ARG 111 128 128 ARG ARG B . n 
B 1 112 ILE 112 129 129 ILE ILE B . n 
B 1 113 LEU 113 130 130 LEU LEU B . n 
B 1 114 SER 114 131 131 SER SER B . n 
B 1 115 PHE 115 132 132 PHE PHE B . n 
B 1 116 ARG 116 133 133 ARG ARG B . n 
B 1 117 VAL 117 134 134 VAL VAL B . n 
B 1 118 LEU 118 135 135 LEU LEU B . n 
B 1 119 GLY 119 136 136 GLY GLY B . n 
B 1 120 GLY 120 137 137 GLY GLY B . n 
B 1 121 GLU 121 138 138 GLU GLU B . n 
B 1 122 HIS 122 139 139 HIS HIS B . n 
B 1 123 ARG 123 140 140 ARG ARG B . n 
B 1 124 LEU 124 141 141 LEU LEU B . n 
B 1 125 ASN 125 142 142 ASN ASN B . n 
B 1 126 ASN 126 143 143 ASN ASN B . n 
B 1 127 TYR 127 144 144 TYR TYR B . n 
B 1 128 ARG 128 145 145 ARG ARG B . n 
B 1 129 SER 129 146 146 SER SER B . n 
B 1 130 VAL 130 147 147 VAL VAL B . n 
B 1 131 THR 131 148 148 THR THR B . n 
B 1 132 SER 132 149 149 SER SER B . n 
B 1 133 VAL 133 150 150 VAL VAL B . n 
B 1 134 ASN 134 151 151 ASN ASN B . n 
B 1 135 GLU 135 152 152 GLU GLU B . n 
B 1 136 PHE 136 153 153 PHE PHE B . n 
B 1 137 VAL 137 154 154 VAL VAL B . n 
B 1 138 VAL 138 155 155 VAL VAL B . n 
B 1 139 LEU 139 156 ?   ?   ?   B . n 
B 1 140 GLU 140 157 ?   ?   ?   B . n 
B 1 141 LYS 141 158 ?   ?   ?   B . n 
B 1 142 ASP 142 159 ?   ?   ?   B . n 
B 1 143 LYS 143 160 ?   ?   ?   B . n 
B 1 144 LYS 144 161 ?   ?   ?   B . n 
B 1 145 LYS 145 162 ?   ?   ?   B . n 
B 1 146 ARG 146 163 ?   ?   ?   B . n 
B 1 147 VAL 147 164 164 VAL VAL B . n 
B 1 148 TYR 148 165 165 TYR TYR B . n 
B 1 149 SER 149 166 166 SER SER B . n 
B 1 150 VAL 150 167 167 VAL VAL B . n 
B 1 151 VAL 151 168 168 VAL VAL B . n 
B 1 152 LEU 152 169 169 LEU LEU B . n 
B 1 153 GLU 153 170 170 GLU GLU B . n 
B 1 154 SER 154 171 171 SER SER B . n 
B 1 155 TYR 155 172 172 TYR TYR B . n 
B 1 156 ILE 156 173 173 ILE ILE B . n 
B 1 157 VAL 157 174 174 VAL VAL B . n 
B 1 158 ASP 158 175 175 ASP ASP B . n 
B 1 159 ILE 159 176 176 ILE ILE B . n 
B 1 160 PRO 160 177 177 PRO PRO B . n 
B 1 161 GLN 161 178 178 GLN GLN B . n 
B 1 162 GLY 162 179 179 GLY GLY B . n 
B 1 163 ASN 163 180 180 ASN ASN B . n 
B 1 164 THR 164 181 181 THR THR B . n 
B 1 165 GLU 165 182 182 GLU GLU B . n 
B 1 166 GLU 166 183 183 GLU GLU B . n 
B 1 167 ASP 167 184 184 ASP ASP B . n 
B 1 168 THR 168 185 185 THR THR B . n 
B 1 169 ARG 169 186 186 ARG ARG B . n 
B 1 170 MET 170 187 187 MET MET B . n 
B 1 171 PHE 171 188 188 PHE PHE B . n 
B 1 172 VAL 172 189 189 VAL VAL B . n 
B 1 173 ASP 173 190 190 ASP ASP B . n 
B 1 174 THR 174 191 191 THR THR B . n 
B 1 175 VAL 175 192 192 VAL VAL B . n 
B 1 176 VAL 176 193 193 VAL VAL B . n 
B 1 177 LYS 177 194 194 LYS LYS B . n 
B 1 178 SER 178 195 195 SER SER B . n 
B 1 179 ASN 179 196 196 ASN ASN B . n 
B 1 180 LEU 180 197 197 LEU LEU B . n 
B 1 181 GLN 181 198 198 GLN GLN B . n 
B 1 182 ASN 182 199 199 ASN ASN B . n 
B 1 183 LEU 183 200 200 LEU LEU B . n 
B 1 184 ALA 184 201 201 ALA ALA B . n 
B 1 185 VAL 185 202 202 VAL VAL B . n 
B 1 186 ILE 186 203 203 ILE ILE B . n 
B 1 187 SER 187 204 204 SER SER B . n 
B 1 188 THR 188 205 205 THR THR B . n 
B 1 189 ALA 189 206 206 ALA ALA B . n 
B 1 190 SER 190 207 ?   ?   ?   B . n 
B 1 191 PRO 191 208 ?   ?   ?   B . n 
B 1 192 THR 192 209 ?   ?   ?   B . n 
C 1 1   GLY 1   18  ?   ?   ?   C . n 
C 1 2   HIS 2   19  ?   ?   ?   C . n 
C 1 3   MET 3   20  ?   ?   ?   C . n 
C 1 4   THR 4   21  ?   ?   ?   C . n 
C 1 5   PRO 5   22  ?   ?   ?   C . n 
C 1 6   TYR 6   23  23  TYR TYR C . n 
C 1 7   GLY 7   24  24  GLY GLY C . n 
C 1 8   LEU 8   25  25  LEU LEU C . n 
C 1 9   THR 9   26  26  THR THR C . n 
C 1 10  LYS 10  27  27  LYS LYS C . n 
C 1 11  ASP 11  28  28  ASP ASP C . n 
C 1 12  GLU 12  29  29  GLU GLU C . n 
C 1 13  PHE 13  30  30  PHE PHE C . n 
C 1 14  SER 14  31  31  SER SER C . n 
C 1 15  THR 15  32  32  THR THR C . n 
C 1 16  LEU 16  33  33  LEU LEU C . n 
C 1 17  ASP 17  34  34  ASP ASP C . n 
C 1 18  SER 18  35  35  SER SER C . n 
C 1 19  ILE 19  36  36  ILE ILE C . n 
C 1 20  ILE 20  37  37  ILE ILE C . n 
C 1 21  ARG 21  38  38  ARG ARG C . n 
C 1 22  THR 22  39  39  THR THR C . n 
C 1 23  HIS 23  40  40  HIS HIS C . n 
C 1 24  HIS 24  41  41  HIS HIS C . n 
C 1 25  THR 25  42  42  THR THR C . n 
C 1 26  PHE 26  43  43  PHE PHE C . n 
C 1 27  PRO 27  44  44  PRO PRO C . n 
C 1 28  ARG 28  45  45  ARG ARG C . n 
C 1 29  SER 29  46  46  SER SER C . n 
C 1 30  PRO 30  47  47  PRO PRO C . n 
C 1 31  ASN 31  48  48  ASN ASN C . n 
C 1 32  THR 32  49  49  THR THR C . n 
C 1 33  CYS 33  50  50  CYS CYS C . n 
C 1 34  THR 34  51  51  THR THR C . n 
C 1 35  SER 35  52  52  SER SER C . n 
C 1 36  LEU 36  53  53  LEU LEU C . n 
C 1 37  ILE 37  54  54  ILE ILE C . n 
C 1 38  ALA 38  55  55  ALA ALA C . n 
C 1 39  HIS 39  56  56  HIS HIS C . n 
C 1 40  ARG 40  57  57  ARG ARG C . n 
C 1 41  VAL 41  58  58  VAL VAL C . n 
C 1 42  ASP 42  59  59  ASP ASP C . n 
C 1 43  ALA 43  60  60  ALA ALA C . n 
C 1 44  PRO 44  61  61  PRO PRO C . n 
C 1 45  ALA 45  62  62  ALA ALA C . n 
C 1 46  HIS 46  63  63  HIS HIS C . n 
C 1 47  ALA 47  64  64  ALA ALA C . n 
C 1 48  ILE 48  65  65  ILE ILE C . n 
C 1 49  TRP 49  66  66  TRP TRP C . n 
C 1 50  ARG 50  67  67  ARG ARG C . n 
C 1 51  PHE 51  68  68  PHE PHE C . n 
C 1 52  VAL 52  69  69  VAL VAL C . n 
C 1 53  ARG 53  70  70  ARG ARG C . n 
C 1 54  ASP 54  71  71  ASP ASP C . n 
C 1 55  PHE 55  72  72  PHE PHE C . n 
C 1 56  ALA 56  73  73  ALA ALA C . n 
C 1 57  ASN 57  74  74  ASN ASN C . n 
C 1 58  PRO 58  75  75  PRO PRO C . n 
C 1 59  ASN 59  76  76  ASN ASN C . n 
C 1 60  LYS 60  77  77  LYS LYS C . n 
C 1 61  TYR 61  78  78  TYR TYR C . n 
C 1 62  LYS 62  79  79  LYS LYS C . n 
C 1 63  HIS 63  80  80  HIS HIS C . n 
C 1 64  PHE 64  81  81  PHE PHE C . n 
C 1 65  ILE 65  82  82  ILE ILE C . n 
C 1 66  LYS 66  83  83  LYS LYS C . n 
C 1 67  SER 67  84  84  SER SER C . n 
C 1 68  CYS 68  85  85  CYS CYS C . n 
C 1 69  THR 69  86  86  THR THR C . n 
C 1 70  ILE 70  87  87  ILE ILE C . n 
C 1 71  ARG 71  88  88  ARG ARG C . n 
C 1 72  VAL 72  89  89  VAL VAL C . n 
C 1 73  ASN 73  90  90  ASN ASN C . n 
C 1 74  GLY 74  91  ?   ?   ?   C . n 
C 1 75  ASN 75  92  ?   ?   ?   C . n 
C 1 76  GLY 76  93  ?   ?   ?   C . n 
C 1 77  ILE 77  94  ?   ?   ?   C . n 
C 1 78  LYS 78  95  ?   ?   ?   C . n 
C 1 79  GLU 79  96  96  GLU GLU C . n 
C 1 80  ILE 80  97  97  ILE ILE C . n 
C 1 81  LYS 81  98  98  LYS LYS C . n 
C 1 82  VAL 82  99  99  VAL VAL C . n 
C 1 83  GLY 83  100 100 GLY GLY C . n 
C 1 84  THR 84  101 101 THR THR C . n 
C 1 85  ILE 85  102 102 ILE ILE C . n 
C 1 86  ARG 86  103 103 ARG ARG C . n 
C 1 87  GLU 87  104 104 GLU GLU C . n 
C 1 88  VAL 88  105 105 VAL VAL C . n 
C 1 89  SER 89  106 106 SER SER C . n 
C 1 90  VAL 90  107 107 VAL VAL C . n 
C 1 91  VAL 91  108 108 VAL VAL C . n 
C 1 92  SER 92  109 109 SER SER C . n 
C 1 93  GLY 93  110 110 GLY GLY C . n 
C 1 94  LEU 94  111 111 LEU LEU C . n 
C 1 95  PRO 95  112 112 PRO PRO C . n 
C 1 96  ALA 96  113 113 ALA ALA C . n 
C 1 97  SER 97  114 114 SER SER C . n 
C 1 98  THR 98  115 115 THR THR C . n 
C 1 99  SER 99  116 116 SER SER C . n 
C 1 100 VAL 100 117 117 VAL VAL C . n 
C 1 101 GLU 101 118 118 GLU GLU C . n 
C 1 102 ILE 102 119 119 ILE ILE C . n 
C 1 103 LEU 103 120 120 LEU LEU C . n 
C 1 104 GLU 104 121 121 GLU GLU C . n 
C 1 105 VAL 105 122 122 VAL VAL C . n 
C 1 106 LEU 106 123 123 LEU LEU C . n 
C 1 107 ASP 107 124 124 ASP ASP C . n 
C 1 108 GLU 108 125 125 GLU GLU C . n 
C 1 109 GLU 109 126 126 GLU GLU C . n 
C 1 110 LYS 110 127 127 LYS LYS C . n 
C 1 111 ARG 111 128 128 ARG ARG C . n 
C 1 112 ILE 112 129 129 ILE ILE C . n 
C 1 113 LEU 113 130 130 LEU LEU C . n 
C 1 114 SER 114 131 131 SER SER C . n 
C 1 115 PHE 115 132 132 PHE PHE C . n 
C 1 116 ARG 116 133 133 ARG ARG C . n 
C 1 117 VAL 117 134 134 VAL VAL C . n 
C 1 118 LEU 118 135 135 LEU LEU C . n 
C 1 119 GLY 119 136 136 GLY GLY C . n 
C 1 120 GLY 120 137 137 GLY GLY C . n 
C 1 121 GLU 121 138 138 GLU GLU C . n 
C 1 122 HIS 122 139 139 HIS HIS C . n 
C 1 123 ARG 123 140 140 ARG ARG C . n 
C 1 124 LEU 124 141 141 LEU LEU C . n 
C 1 125 ASN 125 142 142 ASN ASN C . n 
C 1 126 ASN 126 143 143 ASN ASN C . n 
C 1 127 TYR 127 144 144 TYR TYR C . n 
C 1 128 ARG 128 145 145 ARG ARG C . n 
C 1 129 SER 129 146 146 SER SER C . n 
C 1 130 VAL 130 147 147 VAL VAL C . n 
C 1 131 THR 131 148 148 THR THR C . n 
C 1 132 SER 132 149 149 SER SER C . n 
C 1 133 VAL 133 150 150 VAL VAL C . n 
C 1 134 ASN 134 151 151 ASN ASN C . n 
C 1 135 GLU 135 152 152 GLU GLU C . n 
C 1 136 PHE 136 153 153 PHE PHE C . n 
C 1 137 VAL 137 154 154 VAL VAL C . n 
C 1 138 VAL 138 155 155 VAL VAL C . n 
C 1 139 LEU 139 156 ?   ?   ?   C . n 
C 1 140 GLU 140 157 ?   ?   ?   C . n 
C 1 141 LYS 141 158 ?   ?   ?   C . n 
C 1 142 ASP 142 159 ?   ?   ?   C . n 
C 1 143 LYS 143 160 ?   ?   ?   C . n 
C 1 144 LYS 144 161 ?   ?   ?   C . n 
C 1 145 LYS 145 162 ?   ?   ?   C . n 
C 1 146 ARG 146 163 163 ARG ARG C . n 
C 1 147 VAL 147 164 164 VAL VAL C . n 
C 1 148 TYR 148 165 165 TYR TYR C . n 
C 1 149 SER 149 166 166 SER SER C . n 
C 1 150 VAL 150 167 167 VAL VAL C . n 
C 1 151 VAL 151 168 168 VAL VAL C . n 
C 1 152 LEU 152 169 169 LEU LEU C . n 
C 1 153 GLU 153 170 170 GLU GLU C . n 
C 1 154 SER 154 171 171 SER SER C . n 
C 1 155 TYR 155 172 172 TYR TYR C . n 
C 1 156 ILE 156 173 173 ILE ILE C . n 
C 1 157 VAL 157 174 174 VAL VAL C . n 
C 1 158 ASP 158 175 175 ASP ASP C . n 
C 1 159 ILE 159 176 176 ILE ILE C . n 
C 1 160 PRO 160 177 177 PRO PRO C . n 
C 1 161 GLN 161 178 178 GLN GLN C . n 
C 1 162 GLY 162 179 179 GLY GLY C . n 
C 1 163 ASN 163 180 180 ASN ASN C . n 
C 1 164 THR 164 181 181 THR THR C . n 
C 1 165 GLU 165 182 182 GLU GLU C . n 
C 1 166 GLU 166 183 183 GLU GLU C . n 
C 1 167 ASP 167 184 184 ASP ASP C . n 
C 1 168 THR 168 185 185 THR THR C . n 
C 1 169 ARG 169 186 186 ARG ARG C . n 
C 1 170 MET 170 187 187 MET MET C . n 
C 1 171 PHE 171 188 188 PHE PHE C . n 
C 1 172 VAL 172 189 189 VAL VAL C . n 
C 1 173 ASP 173 190 190 ASP ASP C . n 
C 1 174 THR 174 191 191 THR THR C . n 
C 1 175 VAL 175 192 192 VAL VAL C . n 
C 1 176 VAL 176 193 193 VAL VAL C . n 
C 1 177 LYS 177 194 194 LYS LYS C . n 
C 1 178 SER 178 195 195 SER SER C . n 
C 1 179 ASN 179 196 196 ASN ASN C . n 
C 1 180 LEU 180 197 197 LEU LEU C . n 
C 1 181 GLN 181 198 198 GLN GLN C . n 
C 1 182 ASN 182 199 199 ASN ASN C . n 
C 1 183 LEU 183 200 200 LEU LEU C . n 
C 1 184 ALA 184 201 201 ALA ALA C . n 
C 1 185 VAL 185 202 202 VAL VAL C . n 
C 1 186 ILE 186 203 203 ILE ILE C . n 
C 1 187 SER 187 204 204 SER SER C . n 
C 1 188 THR 188 205 205 THR THR C . n 
C 1 189 ALA 189 206 206 ALA ALA C . n 
C 1 190 SER 190 207 207 SER SER C . n 
C 1 191 PRO 191 208 ?   ?   ?   C . n 
C 1 192 THR 192 209 ?   ?   ?   C . n 
D 1 1   GLY 1   18  ?   ?   ?   D . n 
D 1 2   HIS 2   19  ?   ?   ?   D . n 
D 1 3   MET 3   20  ?   ?   ?   D . n 
D 1 4   THR 4   21  ?   ?   ?   D . n 
D 1 5   PRO 5   22  ?   ?   ?   D . n 
D 1 6   TYR 6   23  23  TYR TYR D . n 
D 1 7   GLY 7   24  24  GLY GLY D . n 
D 1 8   LEU 8   25  25  LEU LEU D . n 
D 1 9   THR 9   26  26  THR THR D . n 
D 1 10  LYS 10  27  27  LYS LYS D . n 
D 1 11  ASP 11  28  28  ASP ASP D . n 
D 1 12  GLU 12  29  29  GLU GLU D . n 
D 1 13  PHE 13  30  30  PHE PHE D . n 
D 1 14  SER 14  31  31  SER SER D . n 
D 1 15  THR 15  32  32  THR THR D . n 
D 1 16  LEU 16  33  33  LEU LEU D . n 
D 1 17  ASP 17  34  34  ASP ASP D . n 
D 1 18  SER 18  35  35  SER SER D . n 
D 1 19  ILE 19  36  36  ILE ILE D . n 
D 1 20  ILE 20  37  37  ILE ILE D . n 
D 1 21  ARG 21  38  38  ARG ARG D . n 
D 1 22  THR 22  39  39  THR THR D . n 
D 1 23  HIS 23  40  40  HIS HIS D . n 
D 1 24  HIS 24  41  41  HIS HIS D . n 
D 1 25  THR 25  42  42  THR THR D . n 
D 1 26  PHE 26  43  43  PHE PHE D . n 
D 1 27  PRO 27  44  44  PRO PRO D . n 
D 1 28  ARG 28  45  45  ARG ARG D . n 
D 1 29  SER 29  46  46  SER SER D . n 
D 1 30  PRO 30  47  47  PRO PRO D . n 
D 1 31  ASN 31  48  48  ASN ASN D . n 
D 1 32  THR 32  49  49  THR THR D . n 
D 1 33  CYS 33  50  50  CYS CYS D . n 
D 1 34  THR 34  51  51  THR THR D . n 
D 1 35  SER 35  52  52  SER SER D . n 
D 1 36  LEU 36  53  53  LEU LEU D . n 
D 1 37  ILE 37  54  54  ILE ILE D . n 
D 1 38  ALA 38  55  55  ALA ALA D . n 
D 1 39  HIS 39  56  56  HIS HIS D . n 
D 1 40  ARG 40  57  57  ARG ARG D . n 
D 1 41  VAL 41  58  58  VAL VAL D . n 
D 1 42  ASP 42  59  59  ASP ASP D . n 
D 1 43  ALA 43  60  60  ALA ALA D . n 
D 1 44  PRO 44  61  61  PRO PRO D . n 
D 1 45  ALA 45  62  62  ALA ALA D . n 
D 1 46  HIS 46  63  63  HIS HIS D . n 
D 1 47  ALA 47  64  64  ALA ALA D . n 
D 1 48  ILE 48  65  65  ILE ILE D . n 
D 1 49  TRP 49  66  66  TRP TRP D . n 
D 1 50  ARG 50  67  67  ARG ARG D . n 
D 1 51  PHE 51  68  68  PHE PHE D . n 
D 1 52  VAL 52  69  69  VAL VAL D . n 
D 1 53  ARG 53  70  70  ARG ARG D . n 
D 1 54  ASP 54  71  71  ASP ASP D . n 
D 1 55  PHE 55  72  72  PHE PHE D . n 
D 1 56  ALA 56  73  73  ALA ALA D . n 
D 1 57  ASN 57  74  74  ASN ASN D . n 
D 1 58  PRO 58  75  75  PRO PRO D . n 
D 1 59  ASN 59  76  76  ASN ASN D . n 
D 1 60  LYS 60  77  77  LYS LYS D . n 
D 1 61  TYR 61  78  78  TYR TYR D . n 
D 1 62  LYS 62  79  79  LYS LYS D . n 
D 1 63  HIS 63  80  80  HIS HIS D . n 
D 1 64  PHE 64  81  81  PHE PHE D . n 
D 1 65  ILE 65  82  82  ILE ILE D . n 
D 1 66  LYS 66  83  83  LYS LYS D . n 
D 1 67  SER 67  84  84  SER SER D . n 
D 1 68  CYS 68  85  85  CYS CYS D . n 
D 1 69  THR 69  86  86  THR THR D . n 
D 1 70  ILE 70  87  87  ILE ILE D . n 
D 1 71  ARG 71  88  88  ARG ARG D . n 
D 1 72  VAL 72  89  89  VAL VAL D . n 
D 1 73  ASN 73  90  90  ASN ASN D . n 
D 1 74  GLY 74  91  91  GLY GLY D . n 
D 1 75  ASN 75  92  ?   ?   ?   D . n 
D 1 76  GLY 76  93  ?   ?   ?   D . n 
D 1 77  ILE 77  94  ?   ?   ?   D . n 
D 1 78  LYS 78  95  ?   ?   ?   D . n 
D 1 79  GLU 79  96  96  GLU GLU D . n 
D 1 80  ILE 80  97  97  ILE ILE D . n 
D 1 81  LYS 81  98  98  LYS LYS D . n 
D 1 82  VAL 82  99  99  VAL VAL D . n 
D 1 83  GLY 83  100 100 GLY GLY D . n 
D 1 84  THR 84  101 101 THR THR D . n 
D 1 85  ILE 85  102 102 ILE ILE D . n 
D 1 86  ARG 86  103 103 ARG ARG D . n 
D 1 87  GLU 87  104 104 GLU GLU D . n 
D 1 88  VAL 88  105 105 VAL VAL D . n 
D 1 89  SER 89  106 106 SER SER D . n 
D 1 90  VAL 90  107 107 VAL VAL D . n 
D 1 91  VAL 91  108 108 VAL VAL D . n 
D 1 92  SER 92  109 109 SER SER D . n 
D 1 93  GLY 93  110 110 GLY GLY D . n 
D 1 94  LEU 94  111 111 LEU LEU D . n 
D 1 95  PRO 95  112 112 PRO PRO D . n 
D 1 96  ALA 96  113 113 ALA ALA D . n 
D 1 97  SER 97  114 114 SER SER D . n 
D 1 98  THR 98  115 115 THR THR D . n 
D 1 99  SER 99  116 116 SER SER D . n 
D 1 100 VAL 100 117 117 VAL VAL D . n 
D 1 101 GLU 101 118 118 GLU GLU D . n 
D 1 102 ILE 102 119 119 ILE ILE D . n 
D 1 103 LEU 103 120 120 LEU LEU D . n 
D 1 104 GLU 104 121 121 GLU GLU D . n 
D 1 105 VAL 105 122 122 VAL VAL D . n 
D 1 106 LEU 106 123 123 LEU LEU D . n 
D 1 107 ASP 107 124 124 ASP ASP D . n 
D 1 108 GLU 108 125 125 GLU GLU D . n 
D 1 109 GLU 109 126 126 GLU GLU D . n 
D 1 110 LYS 110 127 127 LYS LYS D . n 
D 1 111 ARG 111 128 128 ARG ARG D . n 
D 1 112 ILE 112 129 129 ILE ILE D . n 
D 1 113 LEU 113 130 130 LEU LEU D . n 
D 1 114 SER 114 131 131 SER SER D . n 
D 1 115 PHE 115 132 132 PHE PHE D . n 
D 1 116 ARG 116 133 133 ARG ARG D . n 
D 1 117 VAL 117 134 134 VAL VAL D . n 
D 1 118 LEU 118 135 135 LEU LEU D . n 
D 1 119 GLY 119 136 136 GLY GLY D . n 
D 1 120 GLY 120 137 137 GLY GLY D . n 
D 1 121 GLU 121 138 138 GLU GLU D . n 
D 1 122 HIS 122 139 139 HIS HIS D . n 
D 1 123 ARG 123 140 140 ARG ARG D . n 
D 1 124 LEU 124 141 141 LEU LEU D . n 
D 1 125 ASN 125 142 142 ASN ASN D . n 
D 1 126 ASN 126 143 143 ASN ASN D . n 
D 1 127 TYR 127 144 144 TYR TYR D . n 
D 1 128 ARG 128 145 145 ARG ARG D . n 
D 1 129 SER 129 146 146 SER SER D . n 
D 1 130 VAL 130 147 147 VAL VAL D . n 
D 1 131 THR 131 148 148 THR THR D . n 
D 1 132 SER 132 149 149 SER SER D . n 
D 1 133 VAL 133 150 150 VAL VAL D . n 
D 1 134 ASN 134 151 151 ASN ASN D . n 
D 1 135 GLU 135 152 152 GLU GLU D . n 
D 1 136 PHE 136 153 153 PHE PHE D . n 
D 1 137 VAL 137 154 154 VAL VAL D . n 
D 1 138 VAL 138 155 ?   ?   ?   D . n 
D 1 139 LEU 139 156 ?   ?   ?   D . n 
D 1 140 GLU 140 157 ?   ?   ?   D . n 
D 1 141 LYS 141 158 ?   ?   ?   D . n 
D 1 142 ASP 142 159 ?   ?   ?   D . n 
D 1 143 LYS 143 160 ?   ?   ?   D . n 
D 1 144 LYS 144 161 ?   ?   ?   D . n 
D 1 145 LYS 145 162 162 LYS LYS D . n 
D 1 146 ARG 146 163 163 ARG ARG D . n 
D 1 147 VAL 147 164 164 VAL VAL D . n 
D 1 148 TYR 148 165 165 TYR TYR D . n 
D 1 149 SER 149 166 166 SER SER D . n 
D 1 150 VAL 150 167 167 VAL VAL D . n 
D 1 151 VAL 151 168 168 VAL VAL D . n 
D 1 152 LEU 152 169 169 LEU LEU D . n 
D 1 153 GLU 153 170 170 GLU GLU D . n 
D 1 154 SER 154 171 171 SER SER D . n 
D 1 155 TYR 155 172 172 TYR TYR D . n 
D 1 156 ILE 156 173 173 ILE ILE D . n 
D 1 157 VAL 157 174 174 VAL VAL D . n 
D 1 158 ASP 158 175 175 ASP ASP D . n 
D 1 159 ILE 159 176 176 ILE ILE D . n 
D 1 160 PRO 160 177 177 PRO PRO D . n 
D 1 161 GLN 161 178 178 GLN GLN D . n 
D 1 162 GLY 162 179 179 GLY GLY D . n 
D 1 163 ASN 163 180 180 ASN ASN D . n 
D 1 164 THR 164 181 181 THR THR D . n 
D 1 165 GLU 165 182 182 GLU GLU D . n 
D 1 166 GLU 166 183 183 GLU GLU D . n 
D 1 167 ASP 167 184 184 ASP ASP D . n 
D 1 168 THR 168 185 185 THR THR D . n 
D 1 169 ARG 169 186 186 ARG ARG D . n 
D 1 170 MET 170 187 187 MET MET D . n 
D 1 171 PHE 171 188 188 PHE PHE D . n 
D 1 172 VAL 172 189 189 VAL VAL D . n 
D 1 173 ASP 173 190 190 ASP ASP D . n 
D 1 174 THR 174 191 191 THR THR D . n 
D 1 175 VAL 175 192 192 VAL VAL D . n 
D 1 176 VAL 176 193 193 VAL VAL D . n 
D 1 177 LYS 177 194 194 LYS LYS D . n 
D 1 178 SER 178 195 195 SER SER D . n 
D 1 179 ASN 179 196 196 ASN ASN D . n 
D 1 180 LEU 180 197 197 LEU LEU D . n 
D 1 181 GLN 181 198 198 GLN GLN D . n 
D 1 182 ASN 182 199 199 ASN ASN D . n 
D 1 183 LEU 183 200 200 LEU LEU D . n 
D 1 184 ALA 184 201 201 ALA ALA D . n 
D 1 185 VAL 185 202 202 VAL VAL D . n 
D 1 186 ILE 186 203 203 ILE ILE D . n 
D 1 187 SER 187 204 204 SER SER D . n 
D 1 188 THR 188 205 205 THR THR D . n 
D 1 189 ALA 189 206 206 ALA ALA D . n 
D 1 190 SER 190 207 207 SER SER D . n 
D 1 191 PRO 191 208 ?   ?   ?   D . n 
D 1 192 THR 192 209 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1780  ? 
1 MORE         -15   ? 
1 'SSA (A^2)'  16180 ? 
2 'ABSA (A^2)' 1760  ? 
2 MORE         -16   ? 
2 'SSA (A^2)'  16210 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 48.3626 -68.3526 5.8849  0.1949 0.3246 0.1210 -0.0287 0.0133  0.0251  1.4149  1.3390  0.4020 
-0.1911  0.4910  0.3078  0.0182  0.0467  -0.0337 -0.0797 0.1451  -0.0766 -0.0283 0.0004  -0.1633 
'X-RAY DIFFRACTION' 2  ? refined 47.9327 -86.5150 11.9757 0.2102 0.2079 0.1119 -0.0709 -0.0573 0.0087  1.2837  2.5461  8.7366 
0.8336   1.6545  3.0297  0.0421  0.0087  -0.2934 0.1709  0.0025  -0.1296 0.4747  -0.0023 -0.0445 
'X-RAY DIFFRACTION' 3  ? refined 45.6242 -71.5666 7.9061  0.1894 0.3233 0.0901 -0.0644 -0.0214 0.0383  1.9489  0.7756  0.5018 
-0.2072  -0.3861 0.0156  0.0994  0.1279  -0.0538 0.0415  0.0822  -0.0325 -0.0255 -0.1358 -0.1816 
'X-RAY DIFFRACTION' 4  ? refined 54.6691 -69.8636 13.5874 0.2366 0.3423 0.0195 -0.0346 -0.0315 0.0189  10.3700 0.1573  3.0088 
-0.3340  -4.2436 0.0681  0.0297  -0.3360 0.2671  -0.0944 -0.0451 -0.0173 -0.3276 0.3040  0.0154  
'X-RAY DIFFRACTION' 5  ? refined 67.0914 -52.3942 27.7079 0.4721 0.2934 0.1004 -0.0215 0.0336  0.0103  17.4979 7.6144  0.7247 
5.6862   2.7678  -0.3753 0.2618  0.0998  1.1091  0.3421  -0.5170 -0.0078 -0.0631 0.1456  0.2552  
'X-RAY DIFFRACTION' 6  ? refined 67.3345 -62.7156 24.8400 0.1756 0.3053 0.0900 -0.0792 -0.0400 0.0156  3.7158  0.9834  2.6870 
1.1201   -1.2048 -0.0021 0.1958  -0.2892 0.4151  0.0313  -0.0463 0.2345  -0.0689 0.2966  -0.1495 
'X-RAY DIFFRACTION' 7  ? refined 72.0754 -77.2275 24.8117 0.2313 0.4114 0.0980 -0.0027 -0.0223 0.0967  1.9406  0.3044  0.1731 
-0.7636  -0.0253 -0.0057 -0.0555 0.0521  -0.1829 0.0334  -0.0503 0.0563  0.0689  0.1115  0.1058  
'X-RAY DIFFRACTION' 8  ? refined 68.9894 -65.6585 20.6263 0.1992 0.3719 0.0260 -0.0657 -0.0521 0.0405  1.5297  0.7353  1.3721 
-0.2903  -0.5096 -0.1643 0.0149  0.1414  0.1119  0.1377  0.0006  -0.0232 0.0032  0.0865  -0.0155 
'X-RAY DIFFRACTION' 9  ? refined 27.7700 -64.6612 3.6934  0.1762 0.4244 0.0663 -0.0358 -0.0373 0.0446  6.2316  1.8836  0.0995 
-0.9241  -0.7578 0.1495  -0.0199 -0.1054 -0.5821 -0.1557 -0.0668 0.1575  -0.0064 0.0631  0.0867  
'X-RAY DIFFRACTION' 10 ? refined 19.7031 -54.2079 4.2176  0.1645 0.3731 0.0243 -0.0365 0.0207  0.0390  2.7088  1.6738  1.6178 
-0.9908  1.9889  -0.2844 0.0392  0.2030  -0.1691 0.0422  0.0685  0.1308  0.0151  0.1869  -0.1078 
'X-RAY DIFFRACTION' 11 ? refined 23.0474 -42.4806 7.3118  0.1785 0.2625 0.0566 -0.1020 0.0246  0.0470  1.1660  1.7210  2.9455 
-0.7153  0.3694  0.4684  -0.0347 0.0881  0.1858  0.0654  0.0219  0.0166  -0.2220 0.0922  0.0129  
'X-RAY DIFFRACTION' 12 ? refined 20.3814 -56.3778 9.3394  0.1548 0.3110 0.0222 -0.0411 -0.0007 0.0586  1.8541  1.0255  1.7943 
-0.0882  1.0274  0.3286  0.0840  -0.1018 -0.1046 0.0982  0.0397  0.0488  0.0878  -0.0727 -0.1237 
'X-RAY DIFFRACTION' 13 ? refined 8.8302  -72.6055 25.8964 0.1565 0.2823 0.2977 -0.0650 -0.1214 0.2695  3.4229  37.4053 1.5275 
-11.3136 -2.2863 7.5580  -0.0664 -0.0087 -0.1352 0.1987  -0.0130 0.4187  0.0470  -0.0030 0.0794  
'X-RAY DIFFRACTION' 14 ? refined -5.0019 -67.1482 26.0148 0.4087 0.4827 0.0818 -0.2542 -0.1462 0.1886  2.6408  0.5932  0.9372 
-1.2315  -1.5647 0.7164  -0.0887 -0.1202 -0.0374 -0.0518 0.1079  0.0520  0.1035  0.0119  -0.0192 
'X-RAY DIFFRACTION' 15 ? refined 3.1503  -50.4264 23.4200 0.1845 0.3316 0.0845 -0.0226 0.0266  -0.0029 2.0192  0.2657  0.4467 
0.2982   0.2377  0.1294  0.0540  -0.2137 0.2963  0.0589  -0.0943 -0.0402 0.1660  -0.1518 0.0404  
'X-RAY DIFFRACTION' 16 ? refined -4.9270 -49.1654 22.9174 0.2057 0.3539 0.0881 0.0350  0.0655  -0.0132 2.4723  0.3585  4.5023 
0.7528   -0.4484 -0.8925 0.2505  -0.2134 0.4451  0.0235  -0.0664 0.1530  0.2514  0.0525  -0.1841 
'X-RAY DIFFRACTION' 17 ? refined -0.6069 -59.0028 20.4934 0.1676 0.3586 0.0511 -0.0415 0.0361  0.0303  2.5608  0.7634  1.8527 
-0.1646  0.6080  0.4118  0.1292  -0.0953 0.0061  0.0701  -0.0726 0.1313  0.2328  -0.1454 -0.0566 
'X-RAY DIFFRACTION' 18 ? refined 5.8718  -57.3834 15.3796 0.1803 0.3668 0.0781 -0.0692 0.0387  0.0174  6.1966  2.5330  4.9361 
3.8530   4.0694  3.0810  0.0319  0.0909  -0.4937 -0.0085 0.0626  -0.2562 0.0093  -0.0175 -0.0945 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 23  ? ? A 81  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 82  ? ? A 120 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 121 ? ? A 185 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 186 ? ? A 207 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  B 23  ? ? B 42  ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  B 43  ? ? B 67  ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  B 68  ? ? B 126 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  B 127 ? ? B 206 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  C 23  ? ? C 45  ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 C 46  ? ? C 73  ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 C 74  ? ? C 144 ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 C 145 ? ? C 207 ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 D 23  ? ? D 30  ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 D 31  ? ? D 48  ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 D 49  ? ? D 91  ? ? ? ? 
'X-RAY DIFFRACTION' 16 16 D 96  ? ? D 135 ? ? ? ? 
'X-RAY DIFFRACTION' 17 17 D 136 ? ? D 180 ? ? ? ? 
'X-RAY DIFFRACTION' 18 18 D 181 ? ? D 207 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.7.0029 ? 3 
HKL-2000  'data reduction'  .        ? 4 
HKL-2000  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 139 ? ? 173.78  177.84  
2  1 ARG A 140 ? ? -118.16 51.38   
3  1 LEU B 25  ? ? -124.66 -124.59 
4  1 THR B 32  ? ? -178.96 -57.40  
5  1 HIS B 40  ? ? -134.54 -33.42  
6  1 GLU B 121 ? ? -130.47 -33.95  
7  1 ARG B 128 ? ? 64.62   61.44   
8  1 HIS B 139 ? ? -170.95 -173.58 
9  1 ASN C 48  ? ? 34.39   48.99   
10 1 ASP C 71  ? ? -69.93  80.57   
11 1 THR D 32  ? ? -99.17  39.45   
12 1 LEU D 33  ? ? -154.39 -16.64  
13 1 HIS D 139 ? ? -174.14 -167.51 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 27  ? CD  ? A LYS 10  CD  
2   1 Y 1 A LYS 27  ? CE  ? A LYS 10  CE  
3   1 Y 1 A LYS 27  ? NZ  ? A LYS 10  NZ  
4   1 Y 1 A ASP 28  ? CG  ? A ASP 11  CG  
5   1 Y 1 A ASP 28  ? OD1 ? A ASP 11  OD1 
6   1 Y 1 A ASP 28  ? OD2 ? A ASP 11  OD2 
7   1 Y 1 A SER 31  ? OG  ? A SER 14  OG  
8   1 Y 1 A ILE 36  ? CD1 ? A ILE 19  CD1 
9   1 Y 1 A ARG 45  ? CZ  ? A ARG 28  CZ  
10  1 Y 1 A ARG 45  ? NH1 ? A ARG 28  NH1 
11  1 Y 1 A ARG 45  ? NH2 ? A ARG 28  NH2 
12  1 Y 1 A ILE 54  ? CD1 ? A ILE 37  CD1 
13  1 Y 1 A ARG 67  ? CD  ? A ARG 50  CD  
14  1 Y 1 A ARG 67  ? NE  ? A ARG 50  NE  
15  1 Y 1 A ARG 67  ? CZ  ? A ARG 50  CZ  
16  1 Y 1 A ARG 67  ? NH1 ? A ARG 50  NH1 
17  1 Y 1 A ARG 67  ? NH2 ? A ARG 50  NH2 
18  1 Y 1 A LYS 77  ? CE  ? A LYS 60  CE  
19  1 Y 1 A LYS 77  ? NZ  ? A LYS 60  NZ  
20  1 Y 1 A ILE 82  ? CD1 ? A ILE 65  CD1 
21  1 Y 1 A LYS 83  ? NZ  ? A LYS 66  NZ  
22  1 Y 1 A ILE 87  ? CD1 ? A ILE 70  CD1 
23  1 Y 1 A LYS 95  ? CG  ? A LYS 78  CG  
24  1 Y 1 A LYS 95  ? CD  ? A LYS 78  CD  
25  1 Y 1 A LYS 95  ? CE  ? A LYS 78  CE  
26  1 Y 1 A LYS 95  ? NZ  ? A LYS 78  NZ  
27  1 Y 1 A ILE 97  ? CD1 ? A ILE 80  CD1 
28  1 Y 1 A LYS 98  ? CG  ? A LYS 81  CG  
29  1 Y 1 A LYS 98  ? CD  ? A LYS 81  CD  
30  1 Y 1 A LYS 98  ? CE  ? A LYS 81  CE  
31  1 Y 1 A LYS 98  ? NZ  ? A LYS 81  NZ  
32  1 Y 1 A GLU 118 ? CG  ? A GLU 101 CG  
33  1 Y 1 A GLU 118 ? CD  ? A GLU 101 CD  
34  1 Y 1 A GLU 118 ? OE1 ? A GLU 101 OE1 
35  1 Y 1 A GLU 118 ? OE2 ? A GLU 101 OE2 
36  1 Y 1 A GLU 126 ? CG  ? A GLU 109 CG  
37  1 Y 1 A GLU 126 ? CD  ? A GLU 109 CD  
38  1 Y 1 A GLU 126 ? OE1 ? A GLU 109 OE1 
39  1 Y 1 A GLU 126 ? OE2 ? A GLU 109 OE2 
40  1 Y 1 A ARG 140 ? CG  ? A ARG 123 CG  
41  1 Y 1 A ARG 140 ? CD  ? A ARG 123 CD  
42  1 Y 1 A ARG 140 ? NE  ? A ARG 123 NE  
43  1 Y 1 A ARG 140 ? CZ  ? A ARG 123 CZ  
44  1 Y 1 A ARG 140 ? NH1 ? A ARG 123 NH1 
45  1 Y 1 A ARG 140 ? NH2 ? A ARG 123 NH2 
46  1 Y 1 A LEU 156 ? CG  ? A LEU 139 CG  
47  1 Y 1 A LEU 156 ? CD1 ? A LEU 139 CD1 
48  1 Y 1 A LEU 156 ? CD2 ? A LEU 139 CD2 
49  1 Y 1 A LYS 161 ? CG  ? A LYS 144 CG  
50  1 Y 1 A LYS 161 ? CD  ? A LYS 144 CD  
51  1 Y 1 A LYS 161 ? CE  ? A LYS 144 CE  
52  1 Y 1 A LYS 161 ? NZ  ? A LYS 144 NZ  
53  1 Y 1 A LYS 162 ? CG  ? A LYS 145 CG  
54  1 Y 1 A LYS 162 ? CD  ? A LYS 145 CD  
55  1 Y 1 A LYS 162 ? CE  ? A LYS 145 CE  
56  1 Y 1 A LYS 162 ? NZ  ? A LYS 145 NZ  
57  1 Y 1 A ARG 163 ? NH1 ? A ARG 146 NH1 
58  1 Y 1 A ARG 163 ? NH2 ? A ARG 146 NH2 
59  1 Y 1 A GLN 178 ? CG  ? A GLN 161 CG  
60  1 Y 1 A GLN 178 ? CD  ? A GLN 161 CD  
61  1 Y 1 A GLN 178 ? OE1 ? A GLN 161 OE1 
62  1 Y 1 A GLN 178 ? NE2 ? A GLN 161 NE2 
63  1 Y 1 A GLU 182 ? OE1 ? A GLU 165 OE1 
64  1 Y 1 A GLU 183 ? CG  ? A GLU 166 CG  
65  1 Y 1 A GLU 183 ? CD  ? A GLU 166 CD  
66  1 Y 1 A GLU 183 ? OE1 ? A GLU 166 OE1 
67  1 Y 1 A GLU 183 ? OE2 ? A GLU 166 OE2 
68  1 Y 1 A THR 185 ? OG1 ? A THR 168 OG1 
69  1 Y 1 A THR 185 ? CG2 ? A THR 168 CG2 
70  1 Y 1 A VAL 189 ? CG2 ? A VAL 172 CG2 
71  1 Y 1 A VAL 193 ? CG1 ? A VAL 176 CG1 
72  1 Y 1 A LYS 194 ? CD  ? A LYS 177 CD  
73  1 Y 1 A LYS 194 ? CE  ? A LYS 177 CE  
74  1 Y 1 A LYS 194 ? NZ  ? A LYS 177 NZ  
75  1 Y 1 A ASN 196 ? ND2 ? A ASN 179 ND2 
76  1 Y 1 B LYS 27  ? CG  ? B LYS 10  CG  
77  1 Y 1 B LYS 27  ? CD  ? B LYS 10  CD  
78  1 Y 1 B LYS 27  ? CE  ? B LYS 10  CE  
79  1 Y 1 B LYS 27  ? NZ  ? B LYS 10  NZ  
80  1 Y 1 B ASP 28  ? CG  ? B ASP 11  CG  
81  1 Y 1 B ASP 28  ? OD1 ? B ASP 11  OD1 
82  1 Y 1 B ASP 28  ? OD2 ? B ASP 11  OD2 
83  1 Y 1 B SER 31  ? OG  ? B SER 14  OG  
84  1 Y 1 B LEU 33  ? CD1 ? B LEU 16  CD1 
85  1 Y 1 B LEU 33  ? CD2 ? B LEU 16  CD2 
86  1 Y 1 B ILE 37  ? CD1 ? B ILE 20  CD1 
87  1 Y 1 B ARG 45  ? NE  ? B ARG 28  NE  
88  1 Y 1 B ARG 45  ? CZ  ? B ARG 28  CZ  
89  1 Y 1 B ARG 45  ? NH1 ? B ARG 28  NH1 
90  1 Y 1 B ARG 45  ? NH2 ? B ARG 28  NH2 
91  1 Y 1 B ILE 54  ? CD1 ? B ILE 37  CD1 
92  1 Y 1 B LYS 77  ? CE  ? B LYS 60  CE  
93  1 Y 1 B LYS 77  ? NZ  ? B LYS 60  NZ  
94  1 Y 1 B LYS 83  ? CD  ? B LYS 66  CD  
95  1 Y 1 B LYS 83  ? CE  ? B LYS 66  CE  
96  1 Y 1 B LYS 83  ? NZ  ? B LYS 66  NZ  
97  1 Y 1 B ILE 87  ? CD1 ? B ILE 70  CD1 
98  1 Y 1 B LYS 98  ? CG  ? B LYS 81  CG  
99  1 Y 1 B LYS 98  ? CD  ? B LYS 81  CD  
100 1 Y 1 B LYS 98  ? CE  ? B LYS 81  CE  
101 1 Y 1 B LYS 98  ? NZ  ? B LYS 81  NZ  
102 1 Y 1 B ILE 102 ? CG1 ? B ILE 85  CG1 
103 1 Y 1 B ILE 102 ? CG2 ? B ILE 85  CG2 
104 1 Y 1 B ILE 102 ? CD1 ? B ILE 85  CD1 
105 1 Y 1 B VAL 105 ? CG1 ? B VAL 88  CG1 
106 1 Y 1 B GLU 118 ? CG  ? B GLU 101 CG  
107 1 Y 1 B GLU 118 ? CD  ? B GLU 101 CD  
108 1 Y 1 B GLU 118 ? OE1 ? B GLU 101 OE1 
109 1 Y 1 B GLU 118 ? OE2 ? B GLU 101 OE2 
110 1 Y 1 B GLU 126 ? CG  ? B GLU 109 CG  
111 1 Y 1 B GLU 126 ? CD  ? B GLU 109 CD  
112 1 Y 1 B GLU 126 ? OE1 ? B GLU 109 OE1 
113 1 Y 1 B GLU 126 ? OE2 ? B GLU 109 OE2 
114 1 Y 1 B LYS 127 ? CD  ? B LYS 110 CD  
115 1 Y 1 B LYS 127 ? CE  ? B LYS 110 CE  
116 1 Y 1 B LYS 127 ? NZ  ? B LYS 110 NZ  
117 1 Y 1 B ARG 133 ? CG  ? B ARG 116 CG  
118 1 Y 1 B ARG 133 ? CD  ? B ARG 116 CD  
119 1 Y 1 B ARG 133 ? NE  ? B ARG 116 NE  
120 1 Y 1 B ARG 133 ? CZ  ? B ARG 116 CZ  
121 1 Y 1 B ARG 133 ? NH1 ? B ARG 116 NH1 
122 1 Y 1 B ARG 133 ? NH2 ? B ARG 116 NH2 
123 1 Y 1 B GLU 138 ? CG  ? B GLU 121 CG  
124 1 Y 1 B GLU 138 ? CD  ? B GLU 121 CD  
125 1 Y 1 B GLU 138 ? OE1 ? B GLU 121 OE1 
126 1 Y 1 B GLU 138 ? OE2 ? B GLU 121 OE2 
127 1 Y 1 B ARG 140 ? NE  ? B ARG 123 NE  
128 1 Y 1 B ARG 140 ? CZ  ? B ARG 123 CZ  
129 1 Y 1 B ARG 140 ? NH1 ? B ARG 123 NH1 
130 1 Y 1 B ARG 140 ? NH2 ? B ARG 123 NH2 
131 1 Y 1 B ARG 145 ? CG  ? B ARG 128 CG  
132 1 Y 1 B ARG 145 ? CD  ? B ARG 128 CD  
133 1 Y 1 B ARG 145 ? NE  ? B ARG 128 NE  
134 1 Y 1 B ARG 145 ? CZ  ? B ARG 128 CZ  
135 1 Y 1 B ARG 145 ? NH1 ? B ARG 128 NH1 
136 1 Y 1 B ARG 145 ? NH2 ? B ARG 128 NH2 
137 1 Y 1 B VAL 154 ? CG1 ? B VAL 137 CG1 
138 1 Y 1 B VAL 154 ? CG2 ? B VAL 137 CG2 
139 1 Y 1 B VAL 164 ? CG1 ? B VAL 147 CG1 
140 1 Y 1 B LEU 169 ? CD1 ? B LEU 152 CD1 
141 1 Y 1 B GLU 170 ? OE1 ? B GLU 153 OE1 
142 1 Y 1 B GLN 178 ? CG  ? B GLN 161 CG  
143 1 Y 1 B GLN 178 ? CD  ? B GLN 161 CD  
144 1 Y 1 B GLN 178 ? OE1 ? B GLN 161 OE1 
145 1 Y 1 B GLN 178 ? NE2 ? B GLN 161 NE2 
146 1 Y 1 B GLU 183 ? CG  ? B GLU 166 CG  
147 1 Y 1 B GLU 183 ? CD  ? B GLU 166 CD  
148 1 Y 1 B GLU 183 ? OE1 ? B GLU 166 OE1 
149 1 Y 1 B GLU 183 ? OE2 ? B GLU 166 OE2 
150 1 Y 1 B LYS 194 ? CD  ? B LYS 177 CD  
151 1 Y 1 B LYS 194 ? CE  ? B LYS 177 CE  
152 1 Y 1 B LYS 194 ? NZ  ? B LYS 177 NZ  
153 1 Y 1 C LYS 27  ? CG  ? C LYS 10  CG  
154 1 Y 1 C LYS 27  ? CD  ? C LYS 10  CD  
155 1 Y 1 C LYS 27  ? CE  ? C LYS 10  CE  
156 1 Y 1 C LYS 27  ? NZ  ? C LYS 10  NZ  
157 1 Y 1 C SER 31  ? OG  ? C SER 14  OG  
158 1 Y 1 C HIS 40  ? CG  ? C HIS 23  CG  
159 1 Y 1 C HIS 40  ? ND1 ? C HIS 23  ND1 
160 1 Y 1 C HIS 40  ? CD2 ? C HIS 23  CD2 
161 1 Y 1 C HIS 40  ? CE1 ? C HIS 23  CE1 
162 1 Y 1 C HIS 40  ? NE2 ? C HIS 23  NE2 
163 1 Y 1 C ARG 67  ? CD  ? C ARG 50  CD  
164 1 Y 1 C ARG 67  ? NE  ? C ARG 50  NE  
165 1 Y 1 C ARG 67  ? CZ  ? C ARG 50  CZ  
166 1 Y 1 C ARG 67  ? NH1 ? C ARG 50  NH1 
167 1 Y 1 C ARG 67  ? NH2 ? C ARG 50  NH2 
168 1 Y 1 C LYS 77  ? CE  ? C LYS 60  CE  
169 1 Y 1 C LYS 77  ? NZ  ? C LYS 60  NZ  
170 1 Y 1 C LYS 83  ? CD  ? C LYS 66  CD  
171 1 Y 1 C LYS 83  ? CE  ? C LYS 66  CE  
172 1 Y 1 C LYS 83  ? NZ  ? C LYS 66  NZ  
173 1 Y 1 C ILE 87  ? CG1 ? C ILE 70  CG1 
174 1 Y 1 C ILE 87  ? CG2 ? C ILE 70  CG2 
175 1 Y 1 C ILE 87  ? CD1 ? C ILE 70  CD1 
176 1 Y 1 C LYS 98  ? CD  ? C LYS 81  CD  
177 1 Y 1 C LYS 98  ? CE  ? C LYS 81  CE  
178 1 Y 1 C LYS 98  ? NZ  ? C LYS 81  NZ  
179 1 Y 1 C VAL 105 ? CG1 ? C VAL 88  CG1 
180 1 Y 1 C GLU 118 ? CG  ? C GLU 101 CG  
181 1 Y 1 C GLU 118 ? CD  ? C GLU 101 CD  
182 1 Y 1 C GLU 118 ? OE1 ? C GLU 101 OE1 
183 1 Y 1 C GLU 118 ? OE2 ? C GLU 101 OE2 
184 1 Y 1 C GLU 126 ? CG  ? C GLU 109 CG  
185 1 Y 1 C GLU 126 ? CD  ? C GLU 109 CD  
186 1 Y 1 C GLU 126 ? OE1 ? C GLU 109 OE1 
187 1 Y 1 C GLU 126 ? OE2 ? C GLU 109 OE2 
188 1 Y 1 C ILE 129 ? CD1 ? C ILE 112 CD1 
189 1 Y 1 C LEU 130 ? CD1 ? C LEU 113 CD1 
190 1 Y 1 C ARG 133 ? NH2 ? C ARG 116 NH2 
191 1 Y 1 C GLU 138 ? CG  ? C GLU 121 CG  
192 1 Y 1 C GLU 138 ? CD  ? C GLU 121 CD  
193 1 Y 1 C GLU 138 ? OE1 ? C GLU 121 OE1 
194 1 Y 1 C GLU 138 ? OE2 ? C GLU 121 OE2 
195 1 Y 1 C ARG 140 ? NE  ? C ARG 123 NE  
196 1 Y 1 C ARG 140 ? CZ  ? C ARG 123 CZ  
197 1 Y 1 C ARG 140 ? NH1 ? C ARG 123 NH1 
198 1 Y 1 C ARG 140 ? NH2 ? C ARG 123 NH2 
199 1 Y 1 C GLN 178 ? CG  ? C GLN 161 CG  
200 1 Y 1 C GLN 178 ? CD  ? C GLN 161 CD  
201 1 Y 1 C GLN 178 ? OE1 ? C GLN 161 OE1 
202 1 Y 1 C GLN 178 ? NE2 ? C GLN 161 NE2 
203 1 Y 1 C GLU 182 ? CD  ? C GLU 165 CD  
204 1 Y 1 C GLU 182 ? OE1 ? C GLU 165 OE1 
205 1 Y 1 C GLU 182 ? OE2 ? C GLU 165 OE2 
206 1 Y 1 C GLU 183 ? CG  ? C GLU 166 CG  
207 1 Y 1 C GLU 183 ? CD  ? C GLU 166 CD  
208 1 Y 1 C GLU 183 ? OE1 ? C GLU 166 OE1 
209 1 Y 1 C GLU 183 ? OE2 ? C GLU 166 OE2 
210 1 Y 1 C THR 185 ? OG1 ? C THR 168 OG1 
211 1 Y 1 C THR 185 ? CG2 ? C THR 168 CG2 
212 1 Y 1 C LYS 194 ? CE  ? C LYS 177 CE  
213 1 Y 1 C LYS 194 ? NZ  ? C LYS 177 NZ  
214 1 Y 1 C GLN 198 ? CG  ? C GLN 181 CG  
215 1 Y 1 C GLN 198 ? CD  ? C GLN 181 CD  
216 1 Y 1 C GLN 198 ? OE1 ? C GLN 181 OE1 
217 1 Y 1 C GLN 198 ? NE2 ? C GLN 181 NE2 
218 1 Y 1 C ILE 203 ? CD1 ? C ILE 186 CD1 
219 1 Y 1 D LEU 25  ? CG  ? D LEU 8   CG  
220 1 Y 1 D LEU 25  ? CD1 ? D LEU 8   CD1 
221 1 Y 1 D LEU 25  ? CD2 ? D LEU 8   CD2 
222 1 Y 1 D LYS 27  ? CD  ? D LYS 10  CD  
223 1 Y 1 D LYS 27  ? CE  ? D LYS 10  CE  
224 1 Y 1 D LYS 27  ? NZ  ? D LYS 10  NZ  
225 1 Y 1 D ASP 28  ? CG  ? D ASP 11  CG  
226 1 Y 1 D ASP 28  ? OD1 ? D ASP 11  OD1 
227 1 Y 1 D ASP 28  ? OD2 ? D ASP 11  OD2 
228 1 Y 1 D SER 31  ? OG  ? D SER 14  OG  
229 1 Y 1 D LEU 33  ? CG  ? D LEU 16  CG  
230 1 Y 1 D LEU 33  ? CD1 ? D LEU 16  CD1 
231 1 Y 1 D LEU 33  ? CD2 ? D LEU 16  CD2 
232 1 Y 1 D ILE 37  ? CD1 ? D ILE 20  CD1 
233 1 Y 1 D ARG 38  ? CG  ? D ARG 21  CG  
234 1 Y 1 D ARG 38  ? CD  ? D ARG 21  CD  
235 1 Y 1 D ARG 38  ? NE  ? D ARG 21  NE  
236 1 Y 1 D ARG 38  ? CZ  ? D ARG 21  CZ  
237 1 Y 1 D ARG 38  ? NH1 ? D ARG 21  NH1 
238 1 Y 1 D ARG 38  ? NH2 ? D ARG 21  NH2 
239 1 Y 1 D ARG 45  ? CG  ? D ARG 28  CG  
240 1 Y 1 D ARG 45  ? CD  ? D ARG 28  CD  
241 1 Y 1 D ARG 45  ? NE  ? D ARG 28  NE  
242 1 Y 1 D ARG 45  ? CZ  ? D ARG 28  CZ  
243 1 Y 1 D ARG 45  ? NH1 ? D ARG 28  NH1 
244 1 Y 1 D ARG 45  ? NH2 ? D ARG 28  NH2 
245 1 Y 1 D ARG 67  ? CD  ? D ARG 50  CD  
246 1 Y 1 D ARG 67  ? NE  ? D ARG 50  NE  
247 1 Y 1 D ARG 67  ? CZ  ? D ARG 50  CZ  
248 1 Y 1 D ARG 67  ? NH1 ? D ARG 50  NH1 
249 1 Y 1 D ARG 67  ? NH2 ? D ARG 50  NH2 
250 1 Y 1 D LYS 77  ? CE  ? D LYS 60  CE  
251 1 Y 1 D LYS 77  ? NZ  ? D LYS 60  NZ  
252 1 Y 1 D ILE 82  ? CD1 ? D ILE 65  CD1 
253 1 Y 1 D LYS 83  ? CD  ? D LYS 66  CD  
254 1 Y 1 D LYS 83  ? CE  ? D LYS 66  CE  
255 1 Y 1 D LYS 83  ? NZ  ? D LYS 66  NZ  
256 1 Y 1 D LYS 98  ? CG  ? D LYS 81  CG  
257 1 Y 1 D LYS 98  ? CD  ? D LYS 81  CD  
258 1 Y 1 D LYS 98  ? CE  ? D LYS 81  CE  
259 1 Y 1 D LYS 98  ? NZ  ? D LYS 81  NZ  
260 1 Y 1 D ILE 102 ? CG1 ? D ILE 85  CG1 
261 1 Y 1 D ILE 102 ? CG2 ? D ILE 85  CG2 
262 1 Y 1 D ILE 102 ? CD1 ? D ILE 85  CD1 
263 1 Y 1 D GLU 104 ? CG  ? D GLU 87  CG  
264 1 Y 1 D GLU 104 ? CD  ? D GLU 87  CD  
265 1 Y 1 D GLU 104 ? OE1 ? D GLU 87  OE1 
266 1 Y 1 D GLU 104 ? OE2 ? D GLU 87  OE2 
267 1 Y 1 D GLU 118 ? CG  ? D GLU 101 CG  
268 1 Y 1 D GLU 118 ? CD  ? D GLU 101 CD  
269 1 Y 1 D GLU 118 ? OE1 ? D GLU 101 OE1 
270 1 Y 1 D GLU 118 ? OE2 ? D GLU 101 OE2 
271 1 Y 1 D GLU 126 ? CG  ? D GLU 109 CG  
272 1 Y 1 D GLU 126 ? CD  ? D GLU 109 CD  
273 1 Y 1 D GLU 126 ? OE1 ? D GLU 109 OE1 
274 1 Y 1 D GLU 126 ? OE2 ? D GLU 109 OE2 
275 1 Y 1 D GLU 138 ? CG  ? D GLU 121 CG  
276 1 Y 1 D GLU 138 ? CD  ? D GLU 121 CD  
277 1 Y 1 D GLU 138 ? OE1 ? D GLU 121 OE1 
278 1 Y 1 D GLU 138 ? OE2 ? D GLU 121 OE2 
279 1 Y 1 D ARG 140 ? NE  ? D ARG 123 NE  
280 1 Y 1 D ARG 140 ? CZ  ? D ARG 123 CZ  
281 1 Y 1 D ARG 140 ? NH1 ? D ARG 123 NH1 
282 1 Y 1 D ARG 140 ? NH2 ? D ARG 123 NH2 
283 1 Y 1 D ARG 145 ? CZ  ? D ARG 128 CZ  
284 1 Y 1 D ARG 145 ? NH1 ? D ARG 128 NH1 
285 1 Y 1 D ARG 145 ? NH2 ? D ARG 128 NH2 
286 1 Y 1 D LYS 162 ? CG  ? D LYS 145 CG  
287 1 Y 1 D LYS 162 ? CD  ? D LYS 145 CD  
288 1 Y 1 D LYS 162 ? CE  ? D LYS 145 CE  
289 1 Y 1 D LYS 162 ? NZ  ? D LYS 145 NZ  
290 1 Y 1 D ARG 163 ? CG  ? D ARG 146 CG  
291 1 Y 1 D ARG 163 ? CD  ? D ARG 146 CD  
292 1 Y 1 D ARG 163 ? NE  ? D ARG 146 NE  
293 1 Y 1 D ARG 163 ? CZ  ? D ARG 146 CZ  
294 1 Y 1 D ARG 163 ? NH1 ? D ARG 146 NH1 
295 1 Y 1 D ARG 163 ? NH2 ? D ARG 146 NH2 
296 1 Y 1 D VAL 168 ? CG1 ? D VAL 151 CG1 
297 1 Y 1 D LEU 169 ? CD1 ? D LEU 152 CD1 
298 1 Y 1 D LEU 169 ? CD2 ? D LEU 152 CD2 
299 1 Y 1 D GLN 178 ? CG  ? D GLN 161 CG  
300 1 Y 1 D GLN 178 ? CD  ? D GLN 161 CD  
301 1 Y 1 D GLN 178 ? OE1 ? D GLN 161 OE1 
302 1 Y 1 D GLN 178 ? NE2 ? D GLN 161 NE2 
303 1 Y 1 D GLU 183 ? CG  ? D GLU 166 CG  
304 1 Y 1 D GLU 183 ? CD  ? D GLU 166 CD  
305 1 Y 1 D GLU 183 ? OE1 ? D GLU 166 OE1 
306 1 Y 1 D GLU 183 ? OE2 ? D GLU 166 OE2 
307 1 Y 1 D THR 185 ? OG1 ? D THR 168 OG1 
308 1 Y 1 D THR 185 ? CG2 ? D THR 168 CG2 
309 1 Y 1 D LYS 194 ? CE  ? D LYS 177 CE  
310 1 Y 1 D LYS 194 ? NZ  ? D LYS 177 NZ  
311 1 Y 1 D LEU 200 ? CD2 ? D LEU 183 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 18  ? A GLY 1   
2  1 Y 1 A HIS 19  ? A HIS 2   
3  1 Y 1 A MET 20  ? A MET 3   
4  1 Y 1 A THR 21  ? A THR 4   
5  1 Y 1 A PRO 22  ? A PRO 5   
6  1 Y 1 A GLY 91  ? A GLY 74  
7  1 Y 1 A ASN 92  ? A ASN 75  
8  1 Y 1 A GLY 93  ? A GLY 76  
9  1 Y 1 A ILE 94  ? A ILE 77  
10 1 Y 1 A GLU 157 ? A GLU 140 
11 1 Y 1 A LYS 158 ? A LYS 141 
12 1 Y 1 A ASP 159 ? A ASP 142 
13 1 Y 1 A LYS 160 ? A LYS 143 
14 1 Y 1 A PRO 208 ? A PRO 191 
15 1 Y 1 A THR 209 ? A THR 192 
16 1 Y 1 B GLY 18  ? B GLY 1   
17 1 Y 1 B HIS 19  ? B HIS 2   
18 1 Y 1 B MET 20  ? B MET 3   
19 1 Y 1 B THR 21  ? B THR 4   
20 1 Y 1 B PRO 22  ? B PRO 5   
21 1 Y 1 B GLY 91  ? B GLY 74  
22 1 Y 1 B ASN 92  ? B ASN 75  
23 1 Y 1 B GLY 93  ? B GLY 76  
24 1 Y 1 B ILE 94  ? B ILE 77  
25 1 Y 1 B LYS 95  ? B LYS 78  
26 1 Y 1 B LEU 156 ? B LEU 139 
27 1 Y 1 B GLU 157 ? B GLU 140 
28 1 Y 1 B LYS 158 ? B LYS 141 
29 1 Y 1 B ASP 159 ? B ASP 142 
30 1 Y 1 B LYS 160 ? B LYS 143 
31 1 Y 1 B LYS 161 ? B LYS 144 
32 1 Y 1 B LYS 162 ? B LYS 145 
33 1 Y 1 B ARG 163 ? B ARG 146 
34 1 Y 1 B SER 207 ? B SER 190 
35 1 Y 1 B PRO 208 ? B PRO 191 
36 1 Y 1 B THR 209 ? B THR 192 
37 1 Y 1 C GLY 18  ? C GLY 1   
38 1 Y 1 C HIS 19  ? C HIS 2   
39 1 Y 1 C MET 20  ? C MET 3   
40 1 Y 1 C THR 21  ? C THR 4   
41 1 Y 1 C PRO 22  ? C PRO 5   
42 1 Y 1 C GLY 91  ? C GLY 74  
43 1 Y 1 C ASN 92  ? C ASN 75  
44 1 Y 1 C GLY 93  ? C GLY 76  
45 1 Y 1 C ILE 94  ? C ILE 77  
46 1 Y 1 C LYS 95  ? C LYS 78  
47 1 Y 1 C LEU 156 ? C LEU 139 
48 1 Y 1 C GLU 157 ? C GLU 140 
49 1 Y 1 C LYS 158 ? C LYS 141 
50 1 Y 1 C ASP 159 ? C ASP 142 
51 1 Y 1 C LYS 160 ? C LYS 143 
52 1 Y 1 C LYS 161 ? C LYS 144 
53 1 Y 1 C LYS 162 ? C LYS 145 
54 1 Y 1 C PRO 208 ? C PRO 191 
55 1 Y 1 C THR 209 ? C THR 192 
56 1 Y 1 D GLY 18  ? D GLY 1   
57 1 Y 1 D HIS 19  ? D HIS 2   
58 1 Y 1 D MET 20  ? D MET 3   
59 1 Y 1 D THR 21  ? D THR 4   
60 1 Y 1 D PRO 22  ? D PRO 5   
61 1 Y 1 D ASN 92  ? D ASN 75  
62 1 Y 1 D GLY 93  ? D GLY 76  
63 1 Y 1 D ILE 94  ? D ILE 77  
64 1 Y 1 D LYS 95  ? D LYS 78  
65 1 Y 1 D VAL 155 ? D VAL 138 
66 1 Y 1 D LEU 156 ? D LEU 139 
67 1 Y 1 D GLU 157 ? D GLU 140 
68 1 Y 1 D LYS 158 ? D LYS 141 
69 1 Y 1 D ASP 159 ? D ASP 142 
70 1 Y 1 D LYS 160 ? D LYS 143 
71 1 Y 1 D LYS 161 ? D LYS 144 
72 1 Y 1 D PRO 208 ? D PRO 191 
73 1 Y 1 D THR 209 ? D THR 192 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2Z,4E)-5-[(1R)-1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl]-3-methylpenta-2,4-dienoic acid' A9S 
3 water                                                                                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 A9S 1  301 220 A9S A9S A . 
F 2 A9S 1  301 220 A9S A9S B . 
G 2 A9S 1  301 220 A9S A9S C . 
H 2 A9S 1  301 220 A9S A9S D . 
I 3 HOH 1  401 2   HOH HOH A . 
I 3 HOH 2  402 10  HOH HOH A . 
I 3 HOH 3  403 13  HOH HOH A . 
I 3 HOH 4  404 16  HOH HOH A . 
I 3 HOH 5  405 17  HOH HOH A . 
I 3 HOH 6  406 26  HOH HOH A . 
I 3 HOH 7  407 34  HOH HOH A . 
I 3 HOH 8  408 36  HOH HOH A . 
I 3 HOH 9  409 51  HOH HOH A . 
I 3 HOH 10 410 52  HOH HOH A . 
I 3 HOH 11 411 54  HOH HOH A . 
I 3 HOH 12 412 56  HOH HOH A . 
I 3 HOH 13 413 57  HOH HOH A . 
I 3 HOH 14 414 70  HOH HOH A . 
I 3 HOH 15 415 74  HOH HOH A . 
I 3 HOH 16 416 81  HOH HOH A . 
I 3 HOH 17 417 88  HOH HOH A . 
I 3 HOH 18 418 92  HOH HOH A . 
I 3 HOH 19 419 95  HOH HOH A . 
I 3 HOH 20 420 97  HOH HOH A . 
J 3 HOH 1  401 5   HOH HOH B . 
J 3 HOH 2  402 7   HOH HOH B . 
J 3 HOH 3  403 8   HOH HOH B . 
J 3 HOH 4  404 11  HOH HOH B . 
J 3 HOH 5  405 18  HOH HOH B . 
J 3 HOH 6  406 28  HOH HOH B . 
J 3 HOH 7  407 30  HOH HOH B . 
J 3 HOH 8  408 31  HOH HOH B . 
J 3 HOH 9  409 40  HOH HOH B . 
J 3 HOH 10 410 42  HOH HOH B . 
J 3 HOH 11 411 49  HOH HOH B . 
J 3 HOH 12 412 59  HOH HOH B . 
J 3 HOH 13 413 60  HOH HOH B . 
J 3 HOH 14 414 61  HOH HOH B . 
J 3 HOH 15 415 63  HOH HOH B . 
J 3 HOH 16 416 68  HOH HOH B . 
J 3 HOH 17 417 75  HOH HOH B . 
J 3 HOH 18 418 77  HOH HOH B . 
J 3 HOH 19 419 85  HOH HOH B . 
J 3 HOH 20 420 86  HOH HOH B . 
J 3 HOH 21 421 94  HOH HOH B . 
J 3 HOH 22 422 96  HOH HOH B . 
K 3 HOH 1  401 35  HOH HOH C . 
K 3 HOH 2  402 1   HOH HOH C . 
K 3 HOH 3  403 9   HOH HOH C . 
K 3 HOH 4  404 12  HOH HOH C . 
K 3 HOH 5  405 15  HOH HOH C . 
K 3 HOH 6  406 19  HOH HOH C . 
K 3 HOH 7  407 20  HOH HOH C . 
K 3 HOH 8  408 21  HOH HOH C . 
K 3 HOH 9  409 22  HOH HOH C . 
K 3 HOH 10 410 23  HOH HOH C . 
K 3 HOH 11 411 25  HOH HOH C . 
K 3 HOH 12 412 27  HOH HOH C . 
K 3 HOH 13 413 29  HOH HOH C . 
K 3 HOH 14 414 32  HOH HOH C . 
K 3 HOH 15 415 39  HOH HOH C . 
K 3 HOH 16 416 43  HOH HOH C . 
K 3 HOH 17 417 45  HOH HOH C . 
K 3 HOH 18 418 47  HOH HOH C . 
K 3 HOH 19 419 48  HOH HOH C . 
K 3 HOH 20 420 55  HOH HOH C . 
K 3 HOH 21 421 62  HOH HOH C . 
K 3 HOH 22 422 66  HOH HOH C . 
K 3 HOH 23 423 67  HOH HOH C . 
K 3 HOH 24 424 69  HOH HOH C . 
K 3 HOH 25 425 73  HOH HOH C . 
K 3 HOH 26 426 76  HOH HOH C . 
K 3 HOH 27 427 79  HOH HOH C . 
K 3 HOH 28 428 80  HOH HOH C . 
K 3 HOH 29 429 83  HOH HOH C . 
K 3 HOH 30 430 84  HOH HOH C . 
K 3 HOH 31 431 87  HOH HOH C . 
K 3 HOH 32 432 89  HOH HOH C . 
K 3 HOH 33 433 93  HOH HOH C . 
L 3 HOH 1  401 44  HOH HOH D . 
L 3 HOH 2  402 64  HOH HOH D . 
L 3 HOH 3  403 65  HOH HOH D . 
L 3 HOH 4  404 4   HOH HOH D . 
L 3 HOH 5  405 6   HOH HOH D . 
L 3 HOH 6  406 14  HOH HOH D . 
L 3 HOH 7  407 24  HOH HOH D . 
L 3 HOH 8  408 33  HOH HOH D . 
L 3 HOH 9  409 37  HOH HOH D . 
L 3 HOH 10 410 38  HOH HOH D . 
L 3 HOH 11 411 41  HOH HOH D . 
L 3 HOH 12 412 46  HOH HOH D . 
L 3 HOH 13 413 50  HOH HOH D . 
L 3 HOH 14 414 58  HOH HOH D . 
L 3 HOH 15 415 71  HOH HOH D . 
L 3 HOH 16 416 72  HOH HOH D . 
L 3 HOH 17 417 78  HOH HOH D . 
L 3 HOH 18 418 82  HOH HOH D . 
L 3 HOH 19 419 90  HOH HOH D . 
L 3 HOH 20 420 91  HOH HOH D . 
#