data_4JDL
# 
_entry.id   4JDL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4JDL         
RCSB  RCSB077912   
WWPDB D_1000077912 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2013-03-13 
_pdbx_database_PDB_obs_spr.pdb_id           4JDL 
_pdbx_database_PDB_obs_spr.replace_pdb_id   3QRZ 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3KLX . unspecified 
PDB 3OQU . unspecified 
PDB 3KL1 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4JDL 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, X.' 1 
'Zhang, Q.' 2 
'Chen, Z.'  3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Insights into the Abscisic Acid Stereospecificity by the ABA Receptors PYR/PYL/RCAR' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            8 
_citation.page_first                e67477 
_citation.page_last                 e67477 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23844015 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0067477 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, X.' 1 
primary 'Jiang, L.' 2 
primary 'Wang, G.'  3 
primary 'Yu, L.'    4 
primary 'Zhang, Q.' 5 
primary 'Xin, Q.'   6 
primary 'Wu, W.'    7 
primary 'Gong, Z.'  8 
primary 'Chen, Z.'  9 
# 
_cell.entry_id           4JDL 
_cell.length_a           95.850 
_cell.length_b           95.850 
_cell.length_c           143.968 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4JDL 
_symmetry.space_group_name_H-M             'P 64' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                172 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Abscisic acid receptor PYL5' 24967.951 3   ? ? ? ? 
2 non-polymer syn GLYCEROL                      92.094    12  ? ? ? ? 
3 water       nat water                         18.015    565 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ABI1-binding protein 3, PYR1-like protein 5, Regulatory components of ABA receptor 8' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHSSGENLYFQGHMRSPVQLQHGSDATNGFHTLQPHDQTDGPIKRVCLTRGMHVPEHVAMHHTHDVGPDQCCS
SVVQMIHAPPESVWALVRRFDNPKVYKNFIRQCRIVQGDGLHVGDLREVMVVSGLPAVSSTERLEILDEERHVISFSVVG
GDHRLKNYRSVTTLHASDDEGTVVVESYIVDVPPGNTEEETLSFVDTIVRCNLQSLARSTNRQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHSSGENLYFQGHMRSPVQLQHGSDATNGFHTLQPHDQTDGPIKRVCLTRGMHVPEHVAMHHTHDVGPDQCCS
SVVQMIHAPPESVWALVRRFDNPKVYKNFIRQCRIVQGDGLHVGDLREVMVVSGLPAVSSTERLEILDEERHVISFSVVG
GDHRLKNYRSVTTLHASDDEGTVVVESYIVDVPPGNTEEETLSFVDTIVRCNLQSLARSTNRQ
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  GLU n 
1 14  ASN n 
1 15  LEU n 
1 16  TYR n 
1 17  PHE n 
1 18  GLN n 
1 19  GLY n 
1 20  HIS n 
1 21  MET n 
1 22  ARG n 
1 23  SER n 
1 24  PRO n 
1 25  VAL n 
1 26  GLN n 
1 27  LEU n 
1 28  GLN n 
1 29  HIS n 
1 30  GLY n 
1 31  SER n 
1 32  ASP n 
1 33  ALA n 
1 34  THR n 
1 35  ASN n 
1 36  GLY n 
1 37  PHE n 
1 38  HIS n 
1 39  THR n 
1 40  LEU n 
1 41  GLN n 
1 42  PRO n 
1 43  HIS n 
1 44  ASP n 
1 45  GLN n 
1 46  THR n 
1 47  ASP n 
1 48  GLY n 
1 49  PRO n 
1 50  ILE n 
1 51  LYS n 
1 52  ARG n 
1 53  VAL n 
1 54  CYS n 
1 55  LEU n 
1 56  THR n 
1 57  ARG n 
1 58  GLY n 
1 59  MET n 
1 60  HIS n 
1 61  VAL n 
1 62  PRO n 
1 63  GLU n 
1 64  HIS n 
1 65  VAL n 
1 66  ALA n 
1 67  MET n 
1 68  HIS n 
1 69  HIS n 
1 70  THR n 
1 71  HIS n 
1 72  ASP n 
1 73  VAL n 
1 74  GLY n 
1 75  PRO n 
1 76  ASP n 
1 77  GLN n 
1 78  CYS n 
1 79  CYS n 
1 80  SER n 
1 81  SER n 
1 82  VAL n 
1 83  VAL n 
1 84  GLN n 
1 85  MET n 
1 86  ILE n 
1 87  HIS n 
1 88  ALA n 
1 89  PRO n 
1 90  PRO n 
1 91  GLU n 
1 92  SER n 
1 93  VAL n 
1 94  TRP n 
1 95  ALA n 
1 96  LEU n 
1 97  VAL n 
1 98  ARG n 
1 99  ARG n 
1 100 PHE n 
1 101 ASP n 
1 102 ASN n 
1 103 PRO n 
1 104 LYS n 
1 105 VAL n 
1 106 TYR n 
1 107 LYS n 
1 108 ASN n 
1 109 PHE n 
1 110 ILE n 
1 111 ARG n 
1 112 GLN n 
1 113 CYS n 
1 114 ARG n 
1 115 ILE n 
1 116 VAL n 
1 117 GLN n 
1 118 GLY n 
1 119 ASP n 
1 120 GLY n 
1 121 LEU n 
1 122 HIS n 
1 123 VAL n 
1 124 GLY n 
1 125 ASP n 
1 126 LEU n 
1 127 ARG n 
1 128 GLU n 
1 129 VAL n 
1 130 MET n 
1 131 VAL n 
1 132 VAL n 
1 133 SER n 
1 134 GLY n 
1 135 LEU n 
1 136 PRO n 
1 137 ALA n 
1 138 VAL n 
1 139 SER n 
1 140 SER n 
1 141 THR n 
1 142 GLU n 
1 143 ARG n 
1 144 LEU n 
1 145 GLU n 
1 146 ILE n 
1 147 LEU n 
1 148 ASP n 
1 149 GLU n 
1 150 GLU n 
1 151 ARG n 
1 152 HIS n 
1 153 VAL n 
1 154 ILE n 
1 155 SER n 
1 156 PHE n 
1 157 SER n 
1 158 VAL n 
1 159 VAL n 
1 160 GLY n 
1 161 GLY n 
1 162 ASP n 
1 163 HIS n 
1 164 ARG n 
1 165 LEU n 
1 166 LYS n 
1 167 ASN n 
1 168 TYR n 
1 169 ARG n 
1 170 SER n 
1 171 VAL n 
1 172 THR n 
1 173 THR n 
1 174 LEU n 
1 175 HIS n 
1 176 ALA n 
1 177 SER n 
1 178 ASP n 
1 179 ASP n 
1 180 GLU n 
1 181 GLY n 
1 182 THR n 
1 183 VAL n 
1 184 VAL n 
1 185 VAL n 
1 186 GLU n 
1 187 SER n 
1 188 TYR n 
1 189 ILE n 
1 190 VAL n 
1 191 ASP n 
1 192 VAL n 
1 193 PRO n 
1 194 PRO n 
1 195 GLY n 
1 196 ASN n 
1 197 THR n 
1 198 GLU n 
1 199 GLU n 
1 200 GLU n 
1 201 THR n 
1 202 LEU n 
1 203 SER n 
1 204 PHE n 
1 205 VAL n 
1 206 ASP n 
1 207 THR n 
1 208 ILE n 
1 209 VAL n 
1 210 ARG n 
1 211 CYS n 
1 212 ASN n 
1 213 LEU n 
1 214 GLN n 
1 215 SER n 
1 216 LEU n 
1 217 ALA n 
1 218 ARG n 
1 219 SER n 
1 220 THR n 
1 221 ASN n 
1 222 ARG n 
1 223 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'mouse-ear cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PYL5 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta 2 (DE3) cells' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pet-28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYL5_ARATH 
_struct_ref.pdbx_db_accession          Q9FLB1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRSPVQLQHGSDATNGFHTLQPHDQTDGPIKRVCLTRGMHVPEHVAMHHTHDVGPDQCCSSVVQMIHAPPESVWALVRRF
DNPKVYKNFIRQCRIVQGDGLHVGDLREVMVVSGLPAVSSTERLEILDEERHVISFSVVGGDHRLKNYRSVTTLHASDDE
GTVVVESYIVDVPPGNTEEETLSFVDTIVRCNLQSLARSTNRQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4JDL A 21 ? 223 ? Q9FLB1 1 ? 203 ? 1 203 
2 1 4JDL B 21 ? 223 ? Q9FLB1 1 ? 203 ? 1 203 
3 1 4JDL C 21 ? 223 ? Q9FLB1 1 ? 203 ? 1 203 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4JDL MET A 1  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -19 1  
1 4JDL GLY A 2  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -18 2  
1 4JDL SER A 3  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -17 3  
1 4JDL SER A 4  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -16 4  
1 4JDL HIS A 5  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -15 5  
1 4JDL HIS A 6  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -14 6  
1 4JDL HIS A 7  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -13 7  
1 4JDL HIS A 8  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -12 8  
1 4JDL HIS A 9  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -11 9  
1 4JDL SER A 10 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -10 10 
1 4JDL SER A 11 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -9  11 
1 4JDL GLY A 12 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -8  12 
1 4JDL GLU A 13 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -7  13 
1 4JDL ASN A 14 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -6  14 
1 4JDL LEU A 15 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -5  15 
1 4JDL TYR A 16 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -4  16 
1 4JDL PHE A 17 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -3  17 
1 4JDL GLN A 18 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -2  18 
1 4JDL GLY A 19 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -1  19 
1 4JDL HIS A 20 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' 0   20 
2 4JDL MET B 1  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -19 21 
2 4JDL GLY B 2  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -18 22 
2 4JDL SER B 3  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -17 23 
2 4JDL SER B 4  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -16 24 
2 4JDL HIS B 5  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -15 25 
2 4JDL HIS B 6  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -14 26 
2 4JDL HIS B 7  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -13 27 
2 4JDL HIS B 8  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -12 28 
2 4JDL HIS B 9  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -11 29 
2 4JDL SER B 10 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -10 30 
2 4JDL SER B 11 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -9  31 
2 4JDL GLY B 12 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -8  32 
2 4JDL GLU B 13 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -7  33 
2 4JDL ASN B 14 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -6  34 
2 4JDL LEU B 15 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -5  35 
2 4JDL TYR B 16 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -4  36 
2 4JDL PHE B 17 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -3  37 
2 4JDL GLN B 18 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -2  38 
2 4JDL GLY B 19 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -1  39 
2 4JDL HIS B 20 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' 0   40 
3 4JDL MET C 1  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -19 41 
3 4JDL GLY C 2  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -18 42 
3 4JDL SER C 3  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -17 43 
3 4JDL SER C 4  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -16 44 
3 4JDL HIS C 5  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -15 45 
3 4JDL HIS C 6  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -14 46 
3 4JDL HIS C 7  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -13 47 
3 4JDL HIS C 8  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -12 48 
3 4JDL HIS C 9  ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -11 49 
3 4JDL SER C 10 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -10 50 
3 4JDL SER C 11 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -9  51 
3 4JDL GLY C 12 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -8  52 
3 4JDL GLU C 13 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -7  53 
3 4JDL ASN C 14 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -6  54 
3 4JDL LEU C 15 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -5  55 
3 4JDL TYR C 16 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -4  56 
3 4JDL PHE C 17 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -3  57 
3 4JDL GLN C 18 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -2  58 
3 4JDL GLY C 19 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' -1  59 
3 4JDL HIS C 20 ? UNP Q9FLB1 ? ? 'EXPRESSION TAG' 0   60 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4JDL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '13% peg3k, 0.1M tris, 5% glycerol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           130 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-10-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97877 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97877 
# 
_reflns.entry_id                     4JDL 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   3 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   23999 
_reflns.number_all                   24503 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.55 
_reflns_shell.d_res_low                   2.59 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4JDL 
_refine.ls_number_reflns_obs                     20210 
_refine.ls_number_reflns_all                     20500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.92 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    97.71 
_refine.ls_R_factor_obs                          0.25462 
_refine.ls_R_factor_all                          0.25462 
_refine.ls_R_factor_R_work                       0.25349 
_refine.ls_R_factor_R_free                       0.27444 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1082 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.909 
_refine.correlation_coeff_Fo_to_Fc_free          0.888 
_refine.B_iso_mean                               45.353 
_refine.aniso_B[1][1]                            -20.53 
_refine.aniso_B[2][2]                            -20.53 
_refine.aniso_B[3][3]                            41.06 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ID 3KLX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.130 
_refine.pdbx_overall_ESU_R_Free                  0.069 
_refine.overall_SU_ML                            0.174 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.479 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3200 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             565 
_refine_hist.number_atoms_total               3837 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        47.92 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.009  0.019  ? 3316 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.002  0.020  ? 2995 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.444  1.955  ? 4482 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            0.867  3.000  ? 6852 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       8.252  5.000  ? 420  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       38.974 22.256 ? 133  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       23.073 15.000 ? 474  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       17.334 15.000 ? 31   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.073  0.200  ? 535  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.008  0.021  ? 3691 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           0.002  0.020  ? 749  ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scbond_it                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.650 
_refine_ls_shell.d_res_low                        2.719 
_refine_ls_shell.number_reflns_R_work             1510 
_refine_ls_shell.R_factor_R_work                  0.326 
_refine_ls_shell.percent_reflns_obs               99.87 
_refine_ls_shell.R_factor_R_free                  0.480 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             78 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4JDL 
_struct.title                     'Crystal structure of native abscisic acid receptor PYL5 at 2.65 Angstrom' 
_struct.pdbx_descriptor           'Abscisic acid receptor PYL5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4JDL 
_struct_keywords.pdbx_keywords   'HORMONE RECEPTOR' 
_struct_keywords.text            'abscisic acid receptor, PP2C, HORMONE RECEPTOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 61  ? ALA A 66  ? VAL A 41  ALA A 46  1 ? 6  
HELX_P HELX_P2  2  PRO A 89  ? ARG A 99  ? PRO A 69  ARG A 79  1 ? 11 
HELX_P HELX_P3  3  GLU A 200 ? THR A 220 ? GLU A 180 THR A 200 1 ? 21 
HELX_P HELX_P4  4  VAL B 65  ? THR B 70  ? VAL B 45  THR B 50  1 ? 6  
HELX_P HELX_P5  5  PRO B 89  ? ARG B 98  ? PRO B 69  ARG B 78  1 ? 10 
HELX_P HELX_P6  6  ASN B 102 ? TYR B 106 ? ASN B 82  TYR B 86  5 ? 5  
HELX_P HELX_P7  7  GLU B 200 ? VAL B 205 ? GLU B 180 VAL B 185 1 ? 6  
HELX_P HELX_P8  8  ASP B 206 ? ALA B 217 ? ASP B 186 ALA B 197 1 ? 12 
HELX_P HELX_P9  9  HIS C 64  ? THR C 70  ? HIS C 44  THR C 50  1 ? 7  
HELX_P HELX_P10 10 PRO C 89  ? VAL C 97  ? PRO C 69  VAL C 77  1 ? 9  
HELX_P HELX_P11 11 THR C 197 ? LEU C 202 ? THR C 177 LEU C 182 1 ? 6  
HELX_P HELX_P12 12 VAL C 205 ? SER C 219 ? VAL C 185 SER C 199 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 77  ? SER A 80  ? GLN A 57  SER A 60  
A 2 VAL A 185 ? ASP A 191 ? VAL A 165 ASP A 171 
A 3 VAL A 171 ? THR A 173 ? VAL A 151 THR A 153 
A 4 VAL A 153 ? SER A 155 ? VAL A 133 SER A 135 
A 5 ILE A 146 ? ASP A 148 ? ILE A 126 ASP A 128 
B 1 GLN B 112 ? CYS B 113 ? GLN B 92  CYS B 93  
B 2 VAL B 129 ? MET B 130 ? VAL B 109 MET B 110 
C 1 GLU B 142 ? ILE B 146 ? GLU B 122 ILE B 126 
C 2 SER B 155 ? VAL B 158 ? SER B 135 VAL B 138 
C 3 ARG B 169 ? VAL B 171 ? ARG B 149 VAL B 151 
D 1 GLN C 77  ? CYS C 78  ? GLN C 57  CYS C 58  
D 2 VAL C 190 ? ASP C 191 ? VAL C 170 ASP C 171 
E 1 ILE C 146 ? ASP C 148 ? ILE C 126 ASP C 128 
E 2 VAL C 153 ? SER C 155 ? VAL C 133 SER C 135 
F 1 VAL C 171 ? THR C 172 ? VAL C 151 THR C 152 
F 2 GLU C 186 ? SER C 187 ? GLU C 166 SER C 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 78  ? N CYS A 58  O VAL A 190 ? O VAL A 170 
A 2 3 O SER A 187 ? O SER A 167 N VAL A 171 ? N VAL A 151 
A 3 4 O THR A 172 ? O THR A 152 N ILE A 154 ? N ILE A 134 
A 4 5 O VAL A 153 ? O VAL A 133 N ASP A 148 ? N ASP A 128 
B 1 2 N GLN B 112 ? N GLN B 92  O MET B 130 ? O MET B 110 
C 1 2 N GLU B 145 ? N GLU B 125 O SER B 155 ? O SER B 135 
C 2 3 N PHE B 156 ? N PHE B 136 O SER B 170 ? O SER B 150 
D 1 2 N CYS C 78  ? N CYS C 58  O VAL C 190 ? O VAL C 170 
E 1 2 N ASP C 148 ? N ASP C 128 O VAL C 153 ? O VAL C 133 
F 1 2 N VAL C 171 ? N VAL C 151 O SER C 187 ? O SER C 167 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GOL A 301' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL A 303' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GOL A 305' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GOL A 306' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL A 307' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GOL B 301' 
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GOL B 302' 
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE GOL C 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 HOH P .   ? HOH A 581 . ? 1_555 ? 
2  AC2 2 ARG A 210 ? ARG A 190 . ? 1_555 ? 
3  AC2 2 HOH P .   ? HOH A 429 . ? 1_555 ? 
4  AC3 1 HOH P .   ? HOH A 535 . ? 1_555 ? 
5  AC4 1 GOL J .   ? GOL A 307 . ? 1_555 ? 
6  AC5 2 GOL I .   ? GOL A 306 . ? 1_555 ? 
7  AC5 2 HOH P .   ? HOH A 520 . ? 1_555 ? 
8  AC6 1 HOH Q .   ? HOH B 404 . ? 1_555 ? 
9  AC7 1 HOH Q .   ? HOH B 418 . ? 1_555 ? 
10 AC8 1 HOH R .   ? HOH C 449 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4JDL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4JDL 
_atom_sites.fract_transf_matrix[1][1]   0.010433 
_atom_sites.fract_transf_matrix[1][2]   0.006023 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012047 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006946 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 57  ? 19.659  -27.669 28.865  1.00 62.12 ? 37  ARG A N   1 
ATOM   2    C CA  . ARG A 1 57  ? 20.656  -28.782 28.957  1.00 62.50 ? 37  ARG A CA  1 
ATOM   3    C C   . ARG A 1 57  ? 20.977  -29.092 30.411  1.00 64.02 ? 37  ARG A C   1 
ATOM   4    O O   . ARG A 1 57  ? 21.002  -28.199 31.258  1.00 67.68 ? 37  ARG A O   1 
ATOM   5    C CB  . ARG A 1 57  ? 21.941  -28.464 28.162  1.00 62.67 ? 37  ARG A CB  1 
ATOM   6    C CG  . ARG A 1 57  ? 22.701  -27.204 28.572  1.00 61.99 ? 37  ARG A CG  1 
ATOM   7    C CD  . ARG A 1 57  ? 23.909  -26.952 27.670  1.00 64.62 ? 37  ARG A CD  1 
ATOM   8    N NE  . ARG A 1 57  ? 25.102  -27.718 28.064  1.00 67.11 ? 37  ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 57  ? 26.271  -27.711 27.418  1.00 66.97 ? 37  ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 57  ? 26.444  -26.985 26.316  1.00 68.74 ? 37  ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 57  ? 27.282  -28.436 27.882  1.00 70.02 ? 37  ARG A NH2 1 
ATOM   12   N N   . GLY A 1 58  ? 21.198  -30.366 30.704  1.00 70.75 ? 38  GLY A N   1 
ATOM   13   C CA  . GLY A 1 58  ? 21.526  -30.795 32.059  1.00 71.75 ? 38  GLY A CA  1 
ATOM   14   C C   . GLY A 1 58  ? 20.303  -31.233 32.837  1.00 70.45 ? 38  GLY A C   1 
ATOM   15   O O   . GLY A 1 58  ? 19.374  -31.818 32.265  1.00 70.61 ? 38  GLY A O   1 
ATOM   16   N N   . MET A 1 59  ? 20.307  -30.930 34.139  1.00 69.44 ? 39  MET A N   1 
ATOM   17   C CA  . MET A 1 59  ? 19.376  -31.533 35.101  1.00 67.25 ? 39  MET A CA  1 
ATOM   18   C C   . MET A 1 59  ? 18.682  -30.563 36.066  1.00 63.54 ? 39  MET A C   1 
ATOM   19   O O   . MET A 1 59  ? 17.888  -30.999 36.904  1.00 56.50 ? 39  MET A O   1 
ATOM   20   C CB  . MET A 1 59  ? 20.118  -32.606 35.911  1.00 64.93 ? 39  MET A CB  1 
ATOM   21   N N   . HIS A 1 60  ? 18.978  -29.266 35.954  1.00 65.35 ? 40  HIS A N   1 
ATOM   22   C CA  . HIS A 1 60  ? 18.231  -28.218 36.671  1.00 69.29 ? 40  HIS A CA  1 
ATOM   23   C C   . HIS A 1 60  ? 17.202  -27.605 35.717  1.00 67.24 ? 40  HIS A C   1 
ATOM   24   O O   . HIS A 1 60  ? 16.773  -26.467 35.880  1.00 76.71 ? 40  HIS A O   1 
ATOM   25   C CB  . HIS A 1 60  ? 19.200  -27.147 37.204  1.00 73.58 ? 40  HIS A CB  1 
ATOM   26   C CG  . HIS A 1 60  ? 18.523  -25.922 37.743  1.00 77.62 ? 40  HIS A CG  1 
ATOM   27   N ND1 . HIS A 1 60  ? 18.184  -24.850 36.944  1.00 77.93 ? 40  HIS A ND1 1 
ATOM   28   C CD2 . HIS A 1 60  ? 18.118  -25.600 38.995  1.00 78.53 ? 40  HIS A CD2 1 
ATOM   29   C CE1 . HIS A 1 60  ? 17.597  -23.923 37.680  1.00 77.81 ? 40  HIS A CE1 1 
ATOM   30   N NE2 . HIS A 1 60  ? 17.548  -24.351 38.929  1.00 78.08 ? 40  HIS A NE2 1 
ATOM   31   N N   . VAL A 1 61  ? 16.781  -28.397 34.739  1.00 64.88 ? 41  VAL A N   1 
ATOM   32   C CA  . VAL A 1 61  ? 16.071  -27.908 33.562  1.00 62.24 ? 41  VAL A CA  1 
ATOM   33   C C   . VAL A 1 61  ? 14.523  -28.011 33.533  1.00 61.33 ? 41  VAL A C   1 
ATOM   34   O O   . VAL A 1 61  ? 13.901  -27.486 32.617  1.00 65.35 ? 41  VAL A O   1 
ATOM   35   C CB  . VAL A 1 61  ? 16.668  -28.571 32.296  1.00 61.83 ? 41  VAL A CB  1 
ATOM   36   C CG1 . VAL A 1 61  ? 18.160  -28.296 32.222  1.00 60.87 ? 41  VAL A CG1 1 
ATOM   37   C CG2 . VAL A 1 61  ? 16.412  -30.073 32.261  1.00 61.90 ? 41  VAL A CG2 1 
ATOM   38   N N   . PRO A 1 62  ? 13.897  -28.693 34.508  1.00 59.02 ? 42  PRO A N   1 
ATOM   39   C CA  . PRO A 1 62  ? 12.422  -28.722 34.569  1.00 57.96 ? 42  PRO A CA  1 
ATOM   40   C C   . PRO A 1 62  ? 11.644  -27.406 34.840  1.00 53.83 ? 42  PRO A C   1 
ATOM   41   O O   . PRO A 1 62  ? 10.421  -27.389 34.715  1.00 47.56 ? 42  PRO A O   1 
ATOM   42   C CB  . PRO A 1 62  ? 12.152  -29.704 35.712  1.00 58.97 ? 42  PRO A CB  1 
ATOM   43   C CG  . PRO A 1 62  ? 13.295  -30.644 35.670  1.00 61.95 ? 42  PRO A CG  1 
ATOM   44   C CD  . PRO A 1 62  ? 14.483  -29.811 35.275  1.00 61.62 ? 42  PRO A CD  1 
ATOM   45   N N   . GLU A 1 63  ? 12.322  -26.326 35.197  1.00 56.74 ? 43  GLU A N   1 
ATOM   46   C CA  . GLU A 1 63  ? 11.635  -25.083 35.577  1.00 58.39 ? 43  GLU A CA  1 
ATOM   47   C C   . GLU A 1 63  ? 10.271  -24.904 34.875  1.00 60.88 ? 43  GLU A C   1 
ATOM   48   O O   . GLU A 1 63  ? 9.250   -24.693 35.525  1.00 64.48 ? 43  GLU A O   1 
ATOM   49   C CB  . GLU A 1 63  ? 12.557  -23.864 35.386  1.00 58.99 ? 43  GLU A CB  1 
ATOM   50   C CG  . GLU A 1 63  ? 12.916  -23.474 33.950  1.00 60.35 ? 43  GLU A CG  1 
ATOM   51   C CD  . GLU A 1 63  ? 13.750  -24.498 33.183  1.00 59.75 ? 43  GLU A CD  1 
ATOM   52   O OE1 . GLU A 1 63  ? 14.814  -24.924 33.700  1.00 61.20 ? 43  GLU A OE1 1 
ATOM   53   O OE2 . GLU A 1 63  ? 13.348  -24.853 32.049  1.00 52.38 ? 43  GLU A OE2 1 
ATOM   54   N N   . HIS A 1 64  ? 10.248  -25.020 33.558  1.00 61.17 ? 44  HIS A N   1 
ATOM   55   C CA  . HIS A 1 64  ? 8.985   -25.121 32.818  1.00 62.43 ? 44  HIS A CA  1 
ATOM   56   C C   . HIS A 1 64  ? 8.976   -26.381 31.935  1.00 56.19 ? 44  HIS A C   1 
ATOM   57   O O   . HIS A 1 64  ? 8.020   -26.618 31.204  1.00 53.32 ? 44  HIS A O   1 
ATOM   58   C CB  . HIS A 1 64  ? 8.691   -23.836 32.003  1.00 62.98 ? 44  HIS A CB  1 
ATOM   59   C CG  . HIS A 1 64  ? 9.911   -23.046 31.654  1.00 62.44 ? 44  HIS A CG  1 
ATOM   60   N ND1 . HIS A 1 64  ? 10.580  -23.187 30.457  1.00 62.97 ? 44  HIS A ND1 1 
ATOM   61   C CD2 . HIS A 1 64  ? 10.600  -22.123 32.361  1.00 65.94 ? 44  HIS A CD2 1 
ATOM   62   C CE1 . HIS A 1 64  ? 11.629  -22.382 30.443  1.00 62.10 ? 44  HIS A CE1 1 
ATOM   63   N NE2 . HIS A 1 64  ? 11.662  -21.722 31.586  1.00 65.24 ? 44  HIS A NE2 1 
ATOM   64   N N   . VAL A 1 65  ? 10.034  -27.189 32.035  1.00 56.43 ? 45  VAL A N   1 
ATOM   65   C CA  . VAL A 1 65  ? 10.124  -28.483 31.341  1.00 58.10 ? 45  VAL A CA  1 
ATOM   66   C C   . VAL A 1 65  ? 9.666   -29.640 32.232  1.00 60.04 ? 45  VAL A C   1 
ATOM   67   O O   . VAL A 1 65  ? 10.091  -30.776 32.049  1.00 57.29 ? 45  VAL A O   1 
ATOM   68   C CB  . VAL A 1 65  ? 11.555  -28.775 30.855  1.00 55.32 ? 45  VAL A CB  1 
ATOM   69   N N   . ALA A 1 66  ? 8.793   -29.344 33.194  1.00 61.45 ? 46  ALA A N   1 
ATOM   70   C CA  . ALA A 1 66  ? 8.108   -30.374 33.942  1.00 60.95 ? 46  ALA A CA  1 
ATOM   71   C C   . ALA A 1 66  ? 6.627   -30.363 33.558  1.00 62.99 ? 46  ALA A C   1 
ATOM   72   O O   . ALA A 1 66  ? 6.149   -31.291 32.910  1.00 61.00 ? 46  ALA A O   1 
ATOM   73   C CB  . ALA A 1 66  ? 8.289   -30.149 35.429  1.00 61.96 ? 46  ALA A CB  1 
ATOM   74   N N   . MET A 1 67  ? 5.927   -29.287 33.923  1.00 66.51 ? 47  MET A N   1 
ATOM   75   C CA  . MET A 1 67  ? 4.467   -29.168 33.742  1.00 63.93 ? 47  MET A CA  1 
ATOM   76   C C   . MET A 1 67  ? 4.006   -29.253 32.285  1.00 64.28 ? 47  MET A C   1 
ATOM   77   O O   . MET A 1 67  ? 2.804   -29.330 32.012  1.00 64.69 ? 47  MET A O   1 
ATOM   78   C CB  . MET A 1 67  ? 3.953   -27.850 34.348  1.00 61.51 ? 47  MET A CB  1 
ATOM   79   C CG  . MET A 1 67  ? 4.407   -26.589 33.624  1.00 61.96 ? 47  MET A CG  1 
ATOM   80   S SD  . MET A 1 67  ? 3.333   -25.165 33.923  1.00 63.45 ? 47  MET A SD  1 
ATOM   81   C CE  . MET A 1 67  ? 4.401   -23.842 33.354  1.00 60.58 ? 47  MET A CE  1 
ATOM   82   N N   . HIS A 1 68  ? 4.960   -29.197 31.359  1.00 63.01 ? 48  HIS A N   1 
ATOM   83   C CA  . HIS A 1 68  ? 4.682   -29.392 29.944  1.00 60.38 ? 48  HIS A CA  1 
ATOM   84   C C   . HIS A 1 68  ? 5.119   -30.783 29.496  1.00 61.45 ? 48  HIS A C   1 
ATOM   85   O O   . HIS A 1 68  ? 4.281   -31.685 29.381  1.00 65.24 ? 48  HIS A O   1 
ATOM   86   C CB  . HIS A 1 68  ? 5.394   -28.320 29.128  1.00 57.58 ? 48  HIS A CB  1 
ATOM   87   C CG  . HIS A 1 68  ? 4.669   -27.016 29.092  1.00 55.30 ? 48  HIS A CG  1 
ATOM   88   N ND1 . HIS A 1 68  ? 3.427   -26.879 28.516  1.00 56.33 ? 48  HIS A ND1 1 
ATOM   89   C CD2 . HIS A 1 68  ? 5.017   -25.785 29.531  1.00 57.45 ? 48  HIS A CD2 1 
ATOM   90   C CE1 . HIS A 1 68  ? 3.038   -25.619 28.603  1.00 57.74 ? 48  HIS A CE1 1 
ATOM   91   N NE2 . HIS A 1 68  ? 3.984   -24.935 29.217  1.00 55.65 ? 48  HIS A NE2 1 
ATOM   92   N N   . HIS A 1 69  ? 6.429   -30.956 29.289  1.00 57.19 ? 49  HIS A N   1 
ATOM   93   C CA  . HIS A 1 69  ? 6.991   -32.171 28.684  1.00 57.06 ? 49  HIS A CA  1 
ATOM   94   C C   . HIS A 1 69  ? 6.515   -33.449 29.338  1.00 58.67 ? 49  HIS A C   1 
ATOM   95   O O   . HIS A 1 69  ? 6.213   -34.413 28.632  1.00 60.45 ? 49  HIS A O   1 
ATOM   96   C CB  . HIS A 1 69  ? 8.529   -32.150 28.677  1.00 55.32 ? 49  HIS A CB  1 
ATOM   97   C CG  . HIS A 1 69  ? 9.110   -31.101 27.785  1.00 51.67 ? 49  HIS A CG  1 
ATOM   98   N ND1 . HIS A 1 69  ? 10.385  -30.610 27.947  1.00 51.36 ? 49  HIS A ND1 1 
ATOM   99   C CD2 . HIS A 1 69  ? 8.574   -30.424 26.740  1.00 50.26 ? 49  HIS A CD2 1 
ATOM   100  C CE1 . HIS A 1 69  ? 10.617  -29.686 27.029  1.00 53.07 ? 49  HIS A CE1 1 
ATOM   101  N NE2 . HIS A 1 69  ? 9.530   -29.548 26.290  1.00 49.49 ? 49  HIS A NE2 1 
ATOM   102  N N   . THR A 1 70  ? 6.456   -33.466 30.670  1.00 57.81 ? 50  THR A N   1 
ATOM   103  C CA  . THR A 1 70  ? 5.906   -34.618 31.376  1.00 58.17 ? 50  THR A CA  1 
ATOM   104  C C   . THR A 1 70  ? 4.481   -34.736 30.890  1.00 57.56 ? 50  THR A C   1 
ATOM   105  O O   . THR A 1 70  ? 3.598   -34.053 31.394  1.00 60.39 ? 50  THR A O   1 
ATOM   106  C CB  . THR A 1 70  ? 5.945   -34.455 32.902  1.00 55.91 ? 50  THR A CB  1 
ATOM   107  N N   . HIS A 1 71  ? 4.281   -35.591 29.885  1.00 57.92 ? 51  HIS A N   1 
ATOM   108  C CA  . HIS A 1 71  ? 3.069   -35.558 29.063  1.00 57.84 ? 51  HIS A CA  1 
ATOM   109  C C   . HIS A 1 71  ? 2.647   -36.947 28.566  1.00 59.12 ? 51  HIS A C   1 
ATOM   110  O O   . HIS A 1 71  ? 3.433   -37.901 28.577  1.00 55.74 ? 51  HIS A O   1 
ATOM   111  C CB  . HIS A 1 71  ? 3.292   -34.606 27.888  1.00 55.46 ? 51  HIS A CB  1 
ATOM   112  C CG  . HIS A 1 71  ? 4.046   -35.208 26.745  1.00 48.95 ? 51  HIS A CG  1 
ATOM   113  N ND1 . HIS A 1 71  ? 4.058   -34.636 25.494  1.00 48.68 ? 51  HIS A ND1 1 
ATOM   114  C CD2 . HIS A 1 71  ? 4.781   -36.342 26.648  1.00 48.85 ? 51  HIS A CD2 1 
ATOM   115  C CE1 . HIS A 1 71  ? 4.780   -35.383 24.679  1.00 50.69 ? 51  HIS A CE1 1 
ATOM   116  N NE2 . HIS A 1 71  ? 5.223   -36.431 25.353  1.00 47.68 ? 51  HIS A NE2 1 
ATOM   117  N N   . ASP A 1 72  ? 1.406   -37.058 28.118  1.00 59.48 ? 52  ASP A N   1 
ATOM   118  C CA  . ASP A 1 72  ? 0.819   -38.378 27.944  1.00 59.71 ? 52  ASP A CA  1 
ATOM   119  C C   . ASP A 1 72  ? 1.196   -39.023 26.645  1.00 64.17 ? 52  ASP A C   1 
ATOM   120  O O   . ASP A 1 72  ? 0.509   -38.878 25.626  1.00 65.69 ? 52  ASP A O   1 
ATOM   121  C CB  . ASP A 1 72  ? -0.695  -38.351 28.102  1.00 58.60 ? 52  ASP A CB  1 
ATOM   122  C CG  . ASP A 1 72  ? -1.111  -38.628 29.509  1.00 56.86 ? 52  ASP A CG  1 
ATOM   123  O OD1 . ASP A 1 72  ? -1.907  -39.579 29.702  1.00 55.87 ? 52  ASP A OD1 1 
ATOM   124  O OD2 . ASP A 1 72  ? -0.612  -37.908 30.412  1.00 52.94 ? 52  ASP A OD2 1 
ATOM   125  N N   . VAL A 1 73  ? 2.314   -39.735 26.703  1.00 66.56 ? 53  VAL A N   1 
ATOM   126  C CA  . VAL A 1 73  ? 2.648   -40.707 25.686  1.00 67.21 ? 53  VAL A CA  1 
ATOM   127  C C   . VAL A 1 73  ? 1.693   -41.883 25.884  1.00 67.71 ? 53  VAL A C   1 
ATOM   128  O O   . VAL A 1 73  ? 1.982   -42.804 26.648  1.00 67.91 ? 53  VAL A O   1 
ATOM   129  C CB  . VAL A 1 73  ? 4.102   -41.186 25.828  1.00 68.83 ? 53  VAL A CB  1 
ATOM   130  N N   . GLY A 1 74  ? 0.534   -41.810 25.237  1.00 64.00 ? 54  GLY A N   1 
ATOM   131  C CA  . GLY A 1 74  ? -0.445  -42.892 25.275  1.00 65.84 ? 54  GLY A CA  1 
ATOM   132  C C   . GLY A 1 74  ? -0.074  -43.984 24.286  1.00 64.38 ? 54  GLY A C   1 
ATOM   133  O O   . GLY A 1 74  ? 1.044   -43.991 23.791  1.00 60.73 ? 54  GLY A O   1 
ATOM   134  N N   . PRO A 1 75  ? -1.024  -44.888 23.956  1.00 67.03 ? 55  PRO A N   1 
ATOM   135  C CA  . PRO A 1 75  ? -0.703  -46.056 23.131  1.00 70.20 ? 55  PRO A CA  1 
ATOM   136  C C   . PRO A 1 75  ? -0.200  -45.719 21.719  1.00 75.62 ? 55  PRO A C   1 
ATOM   137  O O   . PRO A 1 75  ? 0.923   -46.087 21.365  1.00 80.61 ? 55  PRO A O   1 
ATOM   138  C CB  . PRO A 1 75  ? -2.022  -46.830 23.079  1.00 68.25 ? 55  PRO A CB  1 
ATOM   139  C CG  . PRO A 1 75  ? -3.078  -45.820 23.322  1.00 67.07 ? 55  PRO A CG  1 
ATOM   140  C CD  . PRO A 1 75  ? -2.472  -44.776 24.212  1.00 66.74 ? 55  PRO A CD  1 
ATOM   141  N N   . ASP A 1 76  ? -1.022  -45.028 20.932  1.00 80.00 ? 56  ASP A N   1 
ATOM   142  C CA  . ASP A 1 76  ? -0.650  -44.598 19.583  1.00 79.16 ? 56  ASP A CA  1 
ATOM   143  C C   . ASP A 1 76  ? -0.489  -43.082 19.563  1.00 78.21 ? 56  ASP A C   1 
ATOM   144  O O   . ASP A 1 76  ? -1.093  -42.395 18.735  1.00 83.61 ? 56  ASP A O   1 
ATOM   145  C CB  . ASP A 1 76  ? -1.719  -45.029 18.570  1.00 76.06 ? 56  ASP A CB  1 
ATOM   146  N N   . GLN A 1 77  ? 0.314   -42.564 20.490  1.00 75.82 ? 57  GLN A N   1 
ATOM   147  C CA  . GLN A 1 77  ? 0.581   -41.122 20.593  1.00 71.32 ? 57  GLN A CA  1 
ATOM   148  C C   . GLN A 1 77  ? 2.053   -40.910 20.945  1.00 63.68 ? 57  GLN A C   1 
ATOM   149  O O   . GLN A 1 77  ? 2.429   -41.005 22.115  1.00 61.26 ? 57  GLN A O   1 
ATOM   150  C CB  . GLN A 1 77  ? -0.299  -40.487 21.671  1.00 71.82 ? 57  GLN A CB  1 
ATOM   151  C CG  . GLN A 1 77  ? -1.785  -40.819 21.593  1.00 71.01 ? 57  GLN A CG  1 
ATOM   152  C CD  . GLN A 1 77  ? -2.458  -40.686 22.944  1.00 71.22 ? 57  GLN A CD  1 
ATOM   153  O OE1 . GLN A 1 77  ? -2.021  -39.899 23.787  1.00 76.32 ? 57  GLN A OE1 1 
ATOM   154  N NE2 . GLN A 1 77  ? -3.513  -41.466 23.170  1.00 69.36 ? 57  GLN A NE2 1 
ATOM   155  N N   . CYS A 1 78  ? 2.882   -40.649 19.932  1.00 59.32 ? 58  CYS A N   1 
ATOM   156  C CA  . CYS A 1 78  ? 4.341   -40.547 20.121  1.00 52.34 ? 58  CYS A CA  1 
ATOM   157  C C   . CYS A 1 78  ? 4.822   -39.096 20.142  1.00 47.47 ? 58  CYS A C   1 
ATOM   158  O O   . CYS A 1 78  ? 4.152   -38.198 19.655  1.00 44.86 ? 58  CYS A O   1 
ATOM   159  C CB  . CYS A 1 78  ? 5.082   -41.305 19.025  1.00 50.38 ? 58  CYS A CB  1 
ATOM   160  S SG  . CYS A 1 78  ? 5.510   -40.274 17.598  1.00 51.87 ? 58  CYS A SG  1 
ATOM   161  N N   . CYS A 1 79  ? 6.009   -38.906 20.700  1.00 46.02 ? 59  CYS A N   1 
ATOM   162  C CA  . CYS A 1 79  ? 6.590   -37.596 20.920  1.00 44.59 ? 59  CYS A CA  1 
ATOM   163  C C   . CYS A 1 79  ? 8.097   -37.700 20.995  1.00 46.52 ? 59  CYS A C   1 
ATOM   164  O O   . CYS A 1 79  ? 8.640   -38.797 21.161  1.00 43.82 ? 59  CYS A O   1 
ATOM   165  C CB  . CYS A 1 79  ? 6.088   -37.030 22.237  1.00 44.76 ? 59  CYS A CB  1 
ATOM   166  N N   . SER A 1 80  ? 8.780   -36.562 20.875  1.00 48.48 ? 60  SER A N   1 
ATOM   167  C CA  . SER A 1 80  ? 10.251  -36.529 21.052  1.00 47.49 ? 60  SER A CA  1 
ATOM   168  C C   . SER A 1 80  ? 10.813  -35.105 21.056  1.00 44.37 ? 60  SER A C   1 
ATOM   169  O O   . SER A 1 80  ? 10.237  -34.205 20.463  1.00 44.59 ? 60  SER A O   1 
ATOM   170  C CB  . SER A 1 80  ? 10.975  -37.377 19.980  1.00 47.59 ? 60  SER A CB  1 
ATOM   171  O OG  . SER A 1 80  ? 12.092  -38.069 20.523  1.00 43.74 ? 60  SER A OG  1 
ATOM   172  N N   . SER A 1 81  ? 11.973  -34.966 21.694  1.00 45.12 ? 61  SER A N   1 
ATOM   173  C CA  . SER A 1 81  ? 12.645  -33.704 22.008  1.00 44.51 ? 61  SER A CA  1 
ATOM   174  C C   . SER A 1 81  ? 13.471  -33.097 20.842  1.00 45.76 ? 61  SER A C   1 
ATOM   175  O O   . SER A 1 81  ? 13.133  -33.305 19.679  1.00 44.40 ? 61  SER A O   1 
ATOM   176  C CB  . SER A 1 81  ? 13.564  -33.967 23.211  1.00 47.42 ? 61  SER A CB  1 
ATOM   177  O OG  . SER A 1 81  ? 14.688  -34.738 22.802  1.00 49.95 ? 61  SER A OG  1 
ATOM   178  N N   . VAL A 1 82  ? 14.542  -32.339 21.157  1.00 51.30 ? 62  VAL A N   1 
ATOM   179  C CA  . VAL A 1 82  ? 15.318  -31.583 20.136  1.00 51.25 ? 62  VAL A CA  1 
ATOM   180  C C   . VAL A 1 82  ? 16.536  -30.768 20.645  1.00 50.99 ? 62  VAL A C   1 
ATOM   181  O O   . VAL A 1 82  ? 16.407  -29.605 21.016  1.00 49.23 ? 62  VAL A O   1 
ATOM   182  C CB  . VAL A 1 82  ? 14.396  -30.593 19.390  1.00 51.46 ? 62  VAL A CB  1 
ATOM   183  N N   . VAL A 1 83  ? 17.724  -31.365 20.593  1.00 52.12 ? 63  VAL A N   1 
ATOM   184  C CA  . VAL A 1 83  ? 18.979  -30.701 21.010  1.00 50.53 ? 63  VAL A CA  1 
ATOM   185  C C   . VAL A 1 83  ? 19.350  -29.499 20.119  1.00 48.55 ? 63  VAL A C   1 
ATOM   186  O O   . VAL A 1 83  ? 19.685  -29.674 18.944  1.00 47.74 ? 63  VAL A O   1 
ATOM   187  C CB  . VAL A 1 83  ? 20.157  -31.709 21.013  1.00 52.02 ? 63  VAL A CB  1 
ATOM   188  C CG1 . VAL A 1 83  ? 21.457  -31.062 21.481  1.00 50.97 ? 63  VAL A CG1 1 
ATOM   189  C CG2 . VAL A 1 83  ? 19.824  -32.902 21.908  1.00 54.29 ? 63  VAL A CG2 1 
ATOM   190  N N   . GLN A 1 84  ? 19.314  -28.294 20.702  1.00 46.61 ? 64  GLN A N   1 
ATOM   191  C CA  . GLN A 1 84  ? 19.615  -27.026 20.004  1.00 42.83 ? 64  GLN A CA  1 
ATOM   192  C C   . GLN A 1 84  ? 20.149  -25.978 20.986  1.00 43.04 ? 64  GLN A C   1 
ATOM   193  O O   . GLN A 1 84  ? 19.567  -25.809 22.047  1.00 45.99 ? 64  GLN A O   1 
ATOM   194  C CB  . GLN A 1 84  ? 18.328  -26.489 19.364  1.00 41.27 ? 64  GLN A CB  1 
ATOM   195  C CG  . GLN A 1 84  ? 18.363  -25.027 18.943  1.00 39.35 ? 64  GLN A CG  1 
ATOM   196  C CD  . GLN A 1 84  ? 19.194  -24.803 17.707  1.00 38.49 ? 64  GLN A CD  1 
ATOM   197  O OE1 . GLN A 1 84  ? 20.337  -24.324 17.780  1.00 35.76 ? 64  GLN A OE1 1 
ATOM   198  N NE2 . GLN A 1 84  ? 18.630  -25.163 16.550  1.00 38.16 ? 64  GLN A NE2 1 
ATOM   199  N N   . MET A 1 85  ? 21.201  -25.236 20.630  1.00 41.69 ? 65  MET A N   1 
ATOM   200  C CA  . MET A 1 85  ? 21.746  -24.215 21.535  1.00 43.25 ? 65  MET A CA  1 
ATOM   201  C C   . MET A 1 85  ? 22.158  -22.931 20.827  1.00 44.30 ? 65  MET A C   1 
ATOM   202  O O   . MET A 1 85  ? 22.973  -22.982 19.918  1.00 38.51 ? 65  MET A O   1 
ATOM   203  C CB  . MET A 1 85  ? 22.948  -24.770 22.300  1.00 47.35 ? 65  MET A CB  1 
ATOM   204  C CG  . MET A 1 85  ? 22.600  -25.849 23.315  1.00 49.00 ? 65  MET A CG  1 
ATOM   205  S SD  . MET A 1 85  ? 21.801  -25.132 24.759  1.00 49.49 ? 65  MET A SD  1 
ATOM   206  C CE  . MET A 1 85  ? 23.223  -24.412 25.574  1.00 51.28 ? 65  MET A CE  1 
ATOM   207  N N   . ILE A 1 86  ? 21.624  -21.789 21.311  1.00 49.59 ? 66  ILE A N   1 
ATOM   208  C CA  . ILE A 1 86  ? 21.755  -20.452 20.686  1.00 49.71 ? 66  ILE A CA  1 
ATOM   209  C C   . ILE A 1 86  ? 22.414  -19.390 21.599  1.00 49.95 ? 66  ILE A C   1 
ATOM   210  O O   . ILE A 1 86  ? 21.974  -19.175 22.736  1.00 47.54 ? 66  ILE A O   1 
ATOM   211  C CB  . ILE A 1 86  ? 20.358  -19.935 20.263  1.00 50.63 ? 66  ILE A CB  1 
ATOM   212  C CG1 . ILE A 1 86  ? 19.846  -20.685 19.028  1.00 50.85 ? 66  ILE A CG1 1 
ATOM   213  C CG2 . ILE A 1 86  ? 20.358  -18.427 20.011  1.00 49.68 ? 66  ILE A CG2 1 
ATOM   214  C CD1 . ILE A 1 86  ? 18.399  -20.360 18.691  1.00 52.02 ? 66  ILE A CD1 1 
ATOM   215  N N   . HIS A 1 87  ? 23.434  -18.707 21.071  1.00 52.01 ? 67  HIS A N   1 
ATOM   216  C CA  . HIS A 1 87  ? 24.264  -17.735 21.830  1.00 53.66 ? 67  HIS A CA  1 
ATOM   217  C C   . HIS A 1 87  ? 23.669  -16.315 22.033  1.00 51.53 ? 67  HIS A C   1 
ATOM   218  O O   . HIS A 1 87  ? 24.314  -15.433 22.620  1.00 49.34 ? 67  HIS A O   1 
ATOM   219  C CB  . HIS A 1 87  ? 25.660  -17.650 21.184  1.00 56.56 ? 67  HIS A CB  1 
ATOM   220  C CG  . HIS A 1 87  ? 26.310  -16.304 21.289  1.00 61.23 ? 67  HIS A CG  1 
ATOM   221  N ND1 . HIS A 1 87  ? 25.924  -15.227 20.515  1.00 62.05 ? 67  HIS A ND1 1 
ATOM   222  C CD2 . HIS A 1 87  ? 27.332  -15.864 22.061  1.00 61.32 ? 67  HIS A CD2 1 
ATOM   223  C CE1 . HIS A 1 87  ? 26.671  -14.181 20.815  1.00 60.66 ? 67  HIS A CE1 1 
ATOM   224  N NE2 . HIS A 1 87  ? 27.533  -14.541 21.750  1.00 62.78 ? 67  HIS A NE2 1 
ATOM   225  N N   . ALA A 1 88  ? 22.456  -16.089 21.554  1.00 47.76 ? 68  ALA A N   1 
ATOM   226  C CA  . ALA A 1 88  ? 21.738  -14.858 21.867  1.00 49.15 ? 68  ALA A CA  1 
ATOM   227  C C   . ALA A 1 88  ? 20.985  -14.979 23.205  1.00 48.35 ? 68  ALA A C   1 
ATOM   228  O O   . ALA A 1 88  ? 20.766  -16.084 23.714  1.00 54.41 ? 68  ALA A O   1 
ATOM   229  C CB  . ALA A 1 88  ? 20.773  -14.511 20.741  1.00 50.58 ? 68  ALA A CB  1 
ATOM   230  N N   . PRO A 1 89  ? 20.583  -13.843 23.787  1.00 42.31 ? 69  PRO A N   1 
ATOM   231  C CA  . PRO A 1 89  ? 19.781  -13.951 24.995  1.00 42.66 ? 69  PRO A CA  1 
ATOM   232  C C   . PRO A 1 89  ? 18.453  -14.673 24.732  1.00 43.01 ? 69  PRO A C   1 
ATOM   233  O O   . PRO A 1 89  ? 17.908  -14.566 23.637  1.00 46.98 ? 69  PRO A O   1 
ATOM   234  C CB  . PRO A 1 89  ? 19.544  -12.495 25.384  1.00 42.23 ? 69  PRO A CB  1 
ATOM   235  C CG  . PRO A 1 89  ? 20.686  -11.749 24.785  1.00 40.43 ? 69  PRO A CG  1 
ATOM   236  C CD  . PRO A 1 89  ? 20.986  -12.458 23.507  1.00 40.75 ? 69  PRO A CD  1 
ATOM   237  N N   . PRO A 1 90  ? 17.930  -15.408 25.727  1.00 40.93 ? 70  PRO A N   1 
ATOM   238  C CA  . PRO A 1 90  ? 16.675  -16.134 25.522  1.00 38.92 ? 70  PRO A CA  1 
ATOM   239  C C   . PRO A 1 90  ? 15.522  -15.179 25.205  1.00 39.91 ? 70  PRO A C   1 
ATOM   240  O O   . PRO A 1 90  ? 14.531  -15.576 24.562  1.00 38.88 ? 70  PRO A O   1 
ATOM   241  C CB  . PRO A 1 90  ? 16.455  -16.813 26.866  1.00 38.19 ? 70  PRO A CB  1 
ATOM   242  C CG  . PRO A 1 90  ? 17.072  -15.878 27.837  1.00 39.35 ? 70  PRO A CG  1 
ATOM   243  C CD  . PRO A 1 90  ? 18.330  -15.423 27.146  1.00 39.74 ? 70  PRO A CD  1 
ATOM   244  N N   . GLU A 1 91  ? 15.662  -13.932 25.660  1.00 38.75 ? 71  GLU A N   1 
ATOM   245  C CA  . GLU A 1 91  ? 14.741  -12.856 25.297  1.00 37.55 ? 71  GLU A CA  1 
ATOM   246  C C   . GLU A 1 91  ? 14.816  -12.599 23.795  1.00 39.25 ? 71  GLU A C   1 
ATOM   247  O O   . GLU A 1 91  ? 13.785  -12.659 23.110  1.00 38.50 ? 71  GLU A O   1 
ATOM   248  C CB  . GLU A 1 91  ? 15.067  -11.587 26.082  1.00 37.12 ? 71  GLU A CB  1 
ATOM   249  N N   . SER A 1 92  ? 16.037  -12.349 23.292  1.00 41.74 ? 72  SER A N   1 
ATOM   250  C CA  . SER A 1 92  ? 16.292  -12.187 21.837  1.00 42.73 ? 72  SER A CA  1 
ATOM   251  C C   . SER A 1 92  ? 15.838  -13.416 21.070  1.00 46.98 ? 72  SER A C   1 
ATOM   252  O O   . SER A 1 92  ? 15.302  -13.314 19.956  1.00 47.20 ? 72  SER A O   1 
ATOM   253  C CB  . SER A 1 92  ? 17.772  -11.959 21.549  1.00 40.62 ? 72  SER A CB  1 
ATOM   254  O OG  . SER A 1 92  ? 18.276  -10.898 22.333  1.00 42.65 ? 72  SER A OG  1 
ATOM   255  N N   . VAL A 1 93  ? 16.051  -14.582 21.674  1.00 49.47 ? 73  VAL A N   1 
ATOM   256  C CA  . VAL A 1 93  ? 15.585  -15.818 21.077  1.00 52.96 ? 73  VAL A CA  1 
ATOM   257  C C   . VAL A 1 93  ? 14.057  -15.797 21.028  1.00 52.38 ? 73  VAL A C   1 
ATOM   258  O O   . VAL A 1 93  ? 13.473  -16.055 19.985  1.00 49.01 ? 73  VAL A O   1 
ATOM   259  C CB  . VAL A 1 93  ? 16.081  -17.065 21.839  1.00 53.21 ? 73  VAL A CB  1 
ATOM   260  C CG1 . VAL A 1 93  ? 15.579  -18.328 21.160  1.00 54.11 ? 73  VAL A CG1 1 
ATOM   261  C CG2 . VAL A 1 93  ? 17.598  -17.097 21.892  1.00 55.07 ? 73  VAL A CG2 1 
ATOM   262  N N   . TRP A 1 94  ? 13.428  -15.456 22.153  1.00 53.52 ? 74  TRP A N   1 
ATOM   263  C CA  . TRP A 1 94  ? 11.967  -15.525 22.285  1.00 55.00 ? 74  TRP A CA  1 
ATOM   264  C C   . TRP A 1 94  ? 11.209  -14.691 21.252  1.00 55.25 ? 74  TRP A C   1 
ATOM   265  O O   . TRP A 1 94  ? 10.234  -15.160 20.683  1.00 56.81 ? 74  TRP A O   1 
ATOM   266  C CB  . TRP A 1 94  ? 11.556  -15.097 23.685  1.00 56.09 ? 74  TRP A CB  1 
ATOM   267  C CG  . TRP A 1 94  ? 10.079  -15.022 23.936  1.00 57.66 ? 74  TRP A CG  1 
ATOM   268  C CD1 . TRP A 1 94  ? 9.380   -13.928 24.361  1.00 56.84 ? 74  TRP A CD1 1 
ATOM   269  C CD2 . TRP A 1 94  ? 9.123   -16.084 23.816  1.00 60.10 ? 74  TRP A CD2 1 
ATOM   270  N NE1 . TRP A 1 94  ? 8.048   -14.240 24.511  1.00 55.13 ? 74  TRP A NE1 1 
ATOM   271  C CE2 . TRP A 1 94  ? 7.863   -15.556 24.179  1.00 59.20 ? 74  TRP A CE2 1 
ATOM   272  C CE3 . TRP A 1 94  ? 9.200   -17.425 23.423  1.00 60.35 ? 74  TRP A CE3 1 
ATOM   273  C CZ2 . TRP A 1 94  ? 6.699   -16.326 24.162  1.00 58.28 ? 74  TRP A CZ2 1 
ATOM   274  C CZ3 . TRP A 1 94  ? 8.036   -18.191 23.417  1.00 55.20 ? 74  TRP A CZ3 1 
ATOM   275  C CH2 . TRP A 1 94  ? 6.814   -17.640 23.784  1.00 54.94 ? 74  TRP A CH2 1 
ATOM   276  N N   . ALA A 1 95  ? 11.650  -13.460 21.013  1.00 54.19 ? 75  ALA A N   1 
ATOM   277  C CA  . ALA A 1 95  ? 10.963  -12.569 20.067  1.00 50.64 ? 75  ALA A CA  1 
ATOM   278  C C   . ALA A 1 95  ? 10.771  -13.218 18.693  1.00 47.68 ? 75  ALA A C   1 
ATOM   279  O O   . ALA A 1 95  ? 9.659   -13.335 18.205  1.00 46.63 ? 75  ALA A O   1 
ATOM   280  C CB  . ALA A 1 95  ? 11.728  -11.263 19.931  1.00 51.26 ? 75  ALA A CB  1 
ATOM   281  N N   . LEU A 1 96  ? 11.872  -13.647 18.091  1.00 48.57 ? 76  LEU A N   1 
ATOM   282  C CA  . LEU A 1 96  ? 11.868  -14.354 16.803  1.00 47.82 ? 76  LEU A CA  1 
ATOM   283  C C   . LEU A 1 96  ? 10.906  -15.533 16.765  1.00 49.09 ? 76  LEU A C   1 
ATOM   284  O O   . LEU A 1 96  ? 10.278  -15.813 15.738  1.00 45.24 ? 76  LEU A O   1 
ATOM   285  C CB  . LEU A 1 96  ? 13.275  -14.879 16.515  1.00 45.82 ? 76  LEU A CB  1 
ATOM   286  C CG  . LEU A 1 96  ? 13.444  -15.748 15.264  1.00 46.83 ? 76  LEU A CG  1 
ATOM   287  N N   . VAL A 1 97  ? 10.830  -16.235 17.889  1.00 53.72 ? 77  VAL A N   1 
ATOM   288  C CA  . VAL A 1 97  ? 10.075  -17.469 17.982  1.00 56.18 ? 77  VAL A CA  1 
ATOM   289  C C   . VAL A 1 97  ? 8.637   -17.165 18.373  1.00 55.62 ? 77  VAL A C   1 
ATOM   290  O O   . VAL A 1 97  ? 7.703   -17.761 17.840  1.00 60.78 ? 77  VAL A O   1 
ATOM   291  C CB  . VAL A 1 97  ? 10.752  -18.461 18.959  1.00 55.56 ? 77  VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 97  ? 10.186  -18.351 20.370  1.00 55.65 ? 77  VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 97  ? 10.626  -19.884 18.442  1.00 56.73 ? 77  VAL A CG2 1 
ATOM   294  N N   . ARG A 1 98  ? 8.472   -16.214 19.288  1.00 55.99 ? 78  ARG A N   1 
ATOM   295  C CA  . ARG A 1 98  ? 7.160   -15.813 19.780  1.00 54.26 ? 78  ARG A CA  1 
ATOM   296  C C   . ARG A 1 98  ? 6.182   -15.616 18.632  1.00 57.05 ? 78  ARG A C   1 
ATOM   297  O O   . ARG A 1 98  ? 5.045   -16.079 18.702  1.00 55.31 ? 78  ARG A O   1 
ATOM   298  C CB  . ARG A 1 98  ? 7.276   -14.526 20.579  1.00 52.63 ? 78  ARG A CB  1 
ATOM   299  C CG  . ARG A 1 98  ? 5.949   -13.817 20.776  1.00 54.19 ? 78  ARG A CG  1 
ATOM   300  C CD  . ARG A 1 98  ? 6.068   -12.589 21.667  1.00 53.34 ? 78  ARG A CD  1 
ATOM   301  N NE  . ARG A 1 98  ? 6.029   -11.339 20.921  1.00 53.90 ? 78  ARG A NE  1 
ATOM   302  C CZ  . ARG A 1 98  ? 4.969   -10.875 20.258  1.00 55.53 ? 78  ARG A CZ  1 
ATOM   303  N NH1 . ARG A 1 98  ? 3.829   -11.562 20.197  1.00 54.86 ? 78  ARG A NH1 1 
ATOM   304  N NH2 . ARG A 1 98  ? 5.055   -9.710  19.629  1.00 56.70 ? 78  ARG A NH2 1 
ATOM   305  N N   . ARG A 1 99  ? 6.651   -14.932 17.585  1.00 57.52 ? 79  ARG A N   1 
ATOM   306  C CA  . ARG A 1 99  ? 5.854   -14.630 16.402  1.00 56.91 ? 79  ARG A CA  1 
ATOM   307  C C   . ARG A 1 99  ? 5.144   -15.864 15.869  1.00 54.57 ? 79  ARG A C   1 
ATOM   308  O O   . ARG A 1 99  ? 5.730   -16.681 15.156  1.00 58.20 ? 79  ARG A O   1 
ATOM   309  C CB  . ARG A 1 99  ? 6.719   -14.014 15.288  1.00 60.52 ? 79  ARG A CB  1 
ATOM   310  C CG  . ARG A 1 99  ? 7.641   -12.871 15.701  1.00 61.16 ? 79  ARG A CG  1 
ATOM   311  C CD  . ARG A 1 99  ? 6.955   -11.800 16.538  1.00 62.03 ? 79  ARG A CD  1 
ATOM   312  N NE  . ARG A 1 99  ? 5.890   -11.124 15.793  1.00 61.46 ? 79  ARG A NE  1 
ATOM   313  C CZ  . ARG A 1 99  ? 4.596   -11.119 16.115  1.00 61.40 ? 79  ARG A CZ  1 
ATOM   314  N NH1 . ARG A 1 99  ? 4.144   -11.746 17.201  1.00 61.48 ? 79  ARG A NH1 1 
ATOM   315  N NH2 . ARG A 1 99  ? 3.741   -10.458 15.340  1.00 63.60 ? 79  ARG A NH2 1 
ATOM   316  N N   . PHE A 1 100 ? 3.882   -15.994 16.256  1.00 53.17 ? 80  PHE A N   1 
ATOM   317  C CA  . PHE A 1 100 ? 3.002   -17.080 15.818  1.00 52.48 ? 80  PHE A CA  1 
ATOM   318  C C   . PHE A 1 100 ? 2.123   -16.557 14.682  1.00 50.26 ? 80  PHE A C   1 
ATOM   319  O O   . PHE A 1 100 ? 1.666   -17.335 13.854  1.00 49.96 ? 80  PHE A O   1 
ATOM   320  C CB  . PHE A 1 100 ? 2.166   -17.578 17.016  1.00 53.37 ? 80  PHE A CB  1 
ATOM   321  C CG  . PHE A 1 100 ? 1.051   -18.541 16.663  1.00 53.94 ? 80  PHE A CG  1 
ATOM   322  C CD1 . PHE A 1 100 ? 1.297   -19.902 16.516  1.00 56.42 ? 80  PHE A CD1 1 
ATOM   323  C CD2 . PHE A 1 100 ? -0.258  -18.088 16.534  1.00 55.50 ? 80  PHE A CD2 1 
ATOM   324  C CE1 . PHE A 1 100 ? 0.259   -20.783 16.220  1.00 59.29 ? 80  PHE A CE1 1 
ATOM   325  C CE2 . PHE A 1 100 ? -1.299  -18.957 16.247  1.00 54.92 ? 80  PHE A CE2 1 
ATOM   326  C CZ  . PHE A 1 100 ? -1.042  -20.309 16.088  1.00 57.54 ? 80  PHE A CZ  1 
ATOM   327  N N   . ASP A 1 101 ? 1.890   -15.243 14.659  1.00 47.40 ? 81  ASP A N   1 
ATOM   328  C CA  . ASP A 1 101 ? 1.304   -14.555 13.501  1.00 49.10 ? 81  ASP A CA  1 
ATOM   329  C C   . ASP A 1 101 ? 1.914   -15.076 12.204  1.00 53.14 ? 81  ASP A C   1 
ATOM   330  O O   . ASP A 1 101 ? 1.334   -15.926 11.513  1.00 61.03 ? 81  ASP A O   1 
ATOM   331  C CB  . ASP A 1 101 ? 1.560   -13.051 13.589  1.00 47.50 ? 81  ASP A CB  1 
ATOM   332  N N   . ASN A 1 102 ? 3.080   -14.549 11.866  1.00 48.97 ? 82  ASN A N   1 
ATOM   333  C CA  . ASN A 1 102 ? 3.882   -15.118 10.812  1.00 45.66 ? 82  ASN A CA  1 
ATOM   334  C C   . ASN A 1 102 ? 4.659   -16.187 11.498  1.00 45.81 ? 82  ASN A C   1 
ATOM   335  O O   . ASN A 1 102 ? 5.378   -15.878 12.440  1.00 50.44 ? 82  ASN A O   1 
ATOM   336  C CB  . ASN A 1 102 ? 4.874   -14.098 10.242  1.00 45.04 ? 82  ASN A CB  1 
ATOM   337  C CG  . ASN A 1 102 ? 4.325   -13.313 9.068   1.00 44.28 ? 82  ASN A CG  1 
ATOM   338  O OD1 . ASN A 1 102 ? 4.770   -12.190 8.814   1.00 40.87 ? 82  ASN A OD1 1 
ATOM   339  N ND2 . ASN A 1 102 ? 3.387   -13.906 8.319   1.00 43.48 ? 82  ASN A ND2 1 
ATOM   340  N N   . PRO A 1 103 ? 4.483   -17.451 11.087  1.00 46.43 ? 83  PRO A N   1 
ATOM   341  C CA  . PRO A 1 103 ? 5.421   -18.503 11.430  1.00 43.41 ? 83  PRO A CA  1 
ATOM   342  C C   . PRO A 1 103 ? 6.606   -18.455 10.504  1.00 44.71 ? 83  PRO A C   1 
ATOM   343  O O   . PRO A 1 103 ? 7.691   -18.975 10.826  1.00 47.47 ? 83  PRO A O   1 
ATOM   344  C CB  . PRO A 1 103 ? 4.620   -19.761 11.175  1.00 45.73 ? 83  PRO A CB  1 
ATOM   345  C CG  . PRO A 1 103 ? 3.668   -19.380 10.104  1.00 45.09 ? 83  PRO A CG  1 
ATOM   346  C CD  . PRO A 1 103 ? 3.267   -18.001 10.465  1.00 46.42 ? 83  PRO A CD  1 
ATOM   347  N N   . LYS A 1 104 ? 6.392   -17.823 9.354   1.00 43.36 ? 84  LYS A N   1 
ATOM   348  C CA  . LYS A 1 104 ? 7.437   -17.618 8.369   1.00 42.03 ? 84  LYS A CA  1 
ATOM   349  C C   . LYS A 1 104 ? 8.665   -16.941 8.963   1.00 42.26 ? 84  LYS A C   1 
ATOM   350  O O   . LYS A 1 104 ? 9.782   -17.183 8.529   1.00 43.11 ? 84  LYS A O   1 
ATOM   351  C CB  . LYS A 1 104 ? 6.885   -16.818 7.195   1.00 41.65 ? 84  LYS A CB  1 
ATOM   352  C CG  . LYS A 1 104 ? 6.386   -17.706 6.057   1.00 43.49 ? 84  LYS A CG  1 
ATOM   353  C CD  . LYS A 1 104 ? 7.359   -17.837 4.883   1.00 42.90 ? 84  LYS A CD  1 
ATOM   354  C CE  . LYS A 1 104 ? 8.816   -17.586 5.257   1.00 40.18 ? 84  LYS A CE  1 
ATOM   355  N NZ  . LYS A 1 104 ? 9.690   -18.278 4.282   1.00 40.77 ? 84  LYS A NZ  1 
ATOM   356  N N   . VAL A 1 105 ? 8.463   -16.095 9.962   1.00 44.85 ? 85  VAL A N   1 
ATOM   357  C CA  . VAL A 1 105 ? 9.584   -15.412 10.606  1.00 46.82 ? 85  VAL A CA  1 
ATOM   358  C C   . VAL A 1 105 ? 10.880  -16.228 10.565  1.00 45.33 ? 85  VAL A C   1 
ATOM   359  O O   . VAL A 1 105 ? 11.932  -15.663 10.303  1.00 45.92 ? 85  VAL A O   1 
ATOM   360  C CB  . VAL A 1 105 ? 9.266   -15.030 12.070  1.00 48.27 ? 85  VAL A CB  1 
ATOM   361  C CG1 . VAL A 1 105 ? 8.470   -13.741 12.106  1.00 48.94 ? 85  VAL A CG1 1 
ATOM   362  C CG2 . VAL A 1 105 ? 8.538   -16.151 12.805  1.00 46.25 ? 85  VAL A CG2 1 
ATOM   363  N N   . TYR A 1 106 ? 10.777  -17.538 10.828  1.00 44.11 ? 86  TYR A N   1 
ATOM   364  C CA  . TYR A 1 106 ? 11.910  -18.488 10.795  1.00 42.00 ? 86  TYR A CA  1 
ATOM   365  C C   . TYR A 1 106 ? 11.517  -19.939 10.373  1.00 43.95 ? 86  TYR A C   1 
ATOM   366  O O   . TYR A 1 106 ? 12.377  -20.722 10.000  1.00 42.62 ? 86  TYR A O   1 
ATOM   367  C CB  . TYR A 1 106 ? 12.560  -18.542 12.167  1.00 38.75 ? 86  TYR A CB  1 
ATOM   368  C CG  . TYR A 1 106 ? 11.696  -19.262 13.153  1.00 39.47 ? 86  TYR A CG  1 
ATOM   369  C CD1 . TYR A 1 106 ? 11.698  -20.662 13.219  1.00 40.19 ? 86  TYR A CD1 1 
ATOM   370  C CD2 . TYR A 1 106 ? 10.832  -18.569 13.990  1.00 38.90 ? 86  TYR A CD2 1 
ATOM   371  C CE1 . TYR A 1 106 ? 10.880  -21.337 14.107  1.00 37.92 ? 86  TYR A CE1 1 
ATOM   372  C CE2 . TYR A 1 106 ? 10.002  -19.247 14.882  1.00 37.13 ? 86  TYR A CE2 1 
ATOM   373  C CZ  . TYR A 1 106 ? 10.040  -20.625 14.935  1.00 35.57 ? 86  TYR A CZ  1 
ATOM   374  O OH  . TYR A 1 106 ? 9.244   -21.318 15.804  1.00 34.36 ? 86  TYR A OH  1 
ATOM   375  N N   . LYS A 1 107 ? 10.227  -20.289 10.430  1.00 48.26 ? 87  LYS A N   1 
ATOM   376  C CA  . LYS A 1 107 ? 9.752   -21.665 10.165  1.00 47.54 ? 87  LYS A CA  1 
ATOM   377  C C   . LYS A 1 107 ? 9.631   -21.988 8.674   1.00 45.38 ? 87  LYS A C   1 
ATOM   378  O O   . LYS A 1 107 ? 8.950   -21.264 7.953   1.00 44.68 ? 87  LYS A O   1 
ATOM   379  C CB  . LYS A 1 107 ? 8.382   -21.867 10.815  1.00 47.97 ? 87  LYS A CB  1 
ATOM   380  N N   . ASN A 1 108 ? 10.232  -23.109 8.252   1.00 42.88 ? 88  ASN A N   1 
ATOM   381  C CA  . ASN A 1 108 ? 10.432  -23.475 6.826   1.00 40.07 ? 88  ASN A CA  1 
ATOM   382  C C   . ASN A 1 108 ? 9.256   -24.150 6.096   1.00 44.36 ? 88  ASN A C   1 
ATOM   383  O O   . ASN A 1 108 ? 8.355   -24.732 6.711   1.00 42.15 ? 88  ASN A O   1 
ATOM   384  C CB  . ASN A 1 108 ? 11.612  -24.445 6.691   1.00 37.49 ? 88  ASN A CB  1 
ATOM   385  C CG  . ASN A 1 108 ? 12.864  -23.962 7.372   1.00 35.13 ? 88  ASN A CG  1 
ATOM   386  O OD1 . ASN A 1 108 ? 13.621  -23.144 6.834   1.00 33.39 ? 88  ASN A OD1 1 
ATOM   387  N ND2 . ASN A 1 108 ? 13.120  -24.501 8.549   1.00 34.73 ? 88  ASN A ND2 1 
ATOM   388  N N   . PHE A 1 109 ? 9.318   -24.091 4.761   1.00 48.83 ? 89  PHE A N   1 
ATOM   389  C CA  . PHE A 1 109 ? 8.364   -24.753 3.862   1.00 50.95 ? 89  PHE A CA  1 
ATOM   390  C C   . PHE A 1 109 ? 6.909   -24.320 4.062   1.00 53.77 ? 89  PHE A C   1 
ATOM   391  O O   . PHE A 1 109 ? 5.984   -25.036 3.666   1.00 59.56 ? 89  PHE A O   1 
ATOM   392  C CB  . PHE A 1 109 ? 8.481   -26.277 3.984   1.00 52.31 ? 89  PHE A CB  1 
ATOM   393  C CG  . PHE A 1 109 ? 9.891   -26.783 3.900   1.00 52.33 ? 89  PHE A CG  1 
ATOM   394  C CD1 . PHE A 1 109 ? 10.469  -27.043 2.677   1.00 53.49 ? 89  PHE A CD1 1 
ATOM   395  C CD2 . PHE A 1 109 ? 10.641  -26.989 5.048   1.00 54.08 ? 89  PHE A CD2 1 
ATOM   396  C CE1 . PHE A 1 109 ? 11.767  -27.496 2.595   1.00 54.11 ? 89  PHE A CE1 1 
ATOM   397  C CE2 . PHE A 1 109 ? 11.943  -27.450 4.978   1.00 53.78 ? 89  PHE A CE2 1 
ATOM   398  C CZ  . PHE A 1 109 ? 12.505  -27.711 3.745   1.00 54.51 ? 89  PHE A CZ  1 
ATOM   399  N N   . ILE A 1 110 ? 6.714   -23.136 4.639   1.00 51.84 ? 90  ILE A N   1 
ATOM   400  C CA  . ILE A 1 110 ? 5.387   -22.652 4.988   1.00 49.95 ? 90  ILE A CA  1 
ATOM   401  C C   . ILE A 1 110 ? 4.843   -21.981 3.739   1.00 48.26 ? 90  ILE A C   1 
ATOM   402  O O   . ILE A 1 110 ? 5.546   -21.868 2.747   1.00 52.43 ? 90  ILE A O   1 
ATOM   403  C CB  . ILE A 1 110 ? 5.433   -21.628 6.159   1.00 50.67 ? 90  ILE A CB  1 
ATOM   404  C CG1 . ILE A 1 110 ? 6.276   -22.133 7.340   1.00 50.80 ? 90  ILE A CG1 1 
ATOM   405  C CG2 . ILE A 1 110 ? 4.040   -21.279 6.665   1.00 50.49 ? 90  ILE A CG2 1 
ATOM   406  C CD1 . ILE A 1 110 ? 5.528   -22.939 8.382   1.00 52.74 ? 90  ILE A CD1 1 
ATOM   407  N N   . ARG A 1 111 ? 3.580   -21.578 3.770   1.00 49.23 ? 91  ARG A N   1 
ATOM   408  C CA  . ARG A 1 111 ? 3.027   -20.638 2.798   1.00 49.41 ? 91  ARG A CA  1 
ATOM   409  C C   . ARG A 1 111 ? 2.145   -19.629 3.563   1.00 46.49 ? 91  ARG A C   1 
ATOM   410  O O   . ARG A 1 111 ? 2.171   -19.585 4.794   1.00 45.64 ? 91  ARG A O   1 
ATOM   411  C CB  . ARG A 1 111 ? 2.279   -21.401 1.688   1.00 54.47 ? 91  ARG A CB  1 
ATOM   412  C CG  . ARG A 1 111 ? 3.184   -22.335 0.871   1.00 57.05 ? 91  ARG A CG  1 
ATOM   413  C CD  . ARG A 1 111 ? 2.608   -22.688 -0.499  1.00 60.48 ? 91  ARG A CD  1 
ATOM   414  N NE  . ARG A 1 111 ? 3.468   -23.597 -1.271  1.00 59.31 ? 91  ARG A NE  1 
ATOM   415  C CZ  . ARG A 1 111 ? 3.219   -23.979 -2.523  1.00 54.03 ? 91  ARG A CZ  1 
ATOM   416  N N   . GLN A 1 112 ? 1.374   -18.812 2.864   1.00 46.63 ? 92  GLN A N   1 
ATOM   417  C CA  . GLN A 1 112 ? 0.644   -17.710 3.522   1.00 47.11 ? 92  GLN A CA  1 
ATOM   418  C C   . GLN A 1 112 ? -0.244  -18.204 4.681   1.00 46.75 ? 92  GLN A C   1 
ATOM   419  O O   . GLN A 1 112 ? -0.777  -19.308 4.595   1.00 39.61 ? 92  GLN A O   1 
ATOM   420  C CB  . GLN A 1 112 ? -0.191  -16.952 2.480   1.00 45.50 ? 92  GLN A CB  1 
ATOM   421  C CG  . GLN A 1 112 ? -0.353  -15.467 2.727   1.00 43.80 ? 92  GLN A CG  1 
ATOM   422  C CD  . GLN A 1 112 ? 0.978   -14.735 2.705   1.00 43.01 ? 92  GLN A CD  1 
ATOM   423  O OE1 . GLN A 1 112 ? 1.379   -14.166 1.684   1.00 38.70 ? 92  GLN A OE1 1 
ATOM   424  N NE2 . GLN A 1 112 ? 1.682   -14.765 3.834   1.00 43.35 ? 92  GLN A NE2 1 
ATOM   425  N N   . CYS A 1 113 ? -0.387  -17.390 5.750   1.00 48.45 ? 93  CYS A N   1 
ATOM   426  C CA  . CYS A 1 113 ? -1.184  -17.776 6.940   1.00 48.08 ? 93  CYS A CA  1 
ATOM   427  C C   . CYS A 1 113 ? -1.970  -16.651 7.671   1.00 49.51 ? 93  CYS A C   1 
ATOM   428  O O   . CYS A 1 113 ? -1.399  -15.647 8.097   1.00 46.76 ? 93  CYS A O   1 
ATOM   429  C CB  . CYS A 1 113 ? -0.316  -18.586 7.930   1.00 48.83 ? 93  CYS A CB  1 
ATOM   430  S SG  . CYS A 1 113 ? 0.427   -17.749 9.362   1.00 50.59 ? 93  CYS A SG  1 
ATOM   431  N N   . ARG A 1 114 ? -3.280  -16.871 7.851   1.00 51.26 ? 94  ARG A N   1 
ATOM   432  C CA  . ARG A 1 114 ? -4.195  -15.899 8.484   1.00 54.02 ? 94  ARG A CA  1 
ATOM   433  C C   . ARG A 1 114 ? -4.498  -16.246 9.959   1.00 56.00 ? 94  ARG A C   1 
ATOM   434  O O   . ARG A 1 114 ? -3.650  -16.843 10.624  1.00 56.48 ? 94  ARG A O   1 
ATOM   435  C CB  . ARG A 1 114 ? -5.503  -15.796 7.682   1.00 53.89 ? 94  ARG A CB  1 
ATOM   436  C CG  . ARG A 1 114 ? -5.331  -15.431 6.217   1.00 51.49 ? 94  ARG A CG  1 
ATOM   437  C CD  . ARG A 1 114 ? -5.212  -16.653 5.335   1.00 48.36 ? 94  ARG A CD  1 
ATOM   438  N NE  . ARG A 1 114 ? -4.534  -16.351 4.082   1.00 44.61 ? 94  ARG A NE  1 
ATOM   439  C CZ  . ARG A 1 114 ? -4.001  -17.277 3.298   1.00 41.86 ? 94  ARG A CZ  1 
ATOM   440  N NH2 . ARG A 1 114 ? -3.401  -16.918 2.179   1.00 43.42 ? 94  ARG A NH2 1 
ATOM   441  N N   . ILE A 1 115 ? -5.675  -15.834 10.464  1.00 58.02 ? 95  ILE A N   1 
ATOM   442  C CA  . ILE A 1 115 ? -6.152  -16.141 11.839  1.00 57.47 ? 95  ILE A CA  1 
ATOM   443  C C   . ILE A 1 115 ? -7.693  -16.295 11.893  1.00 54.70 ? 95  ILE A C   1 
ATOM   444  O O   . ILE A 1 115 ? -8.325  -16.411 10.853  1.00 53.78 ? 95  ILE A O   1 
ATOM   445  C CB  . ILE A 1 115 ? -5.683  -15.066 12.853  1.00 58.84 ? 95  ILE A CB  1 
ATOM   446  C CG1 . ILE A 1 115 ? -6.375  -13.721 12.597  1.00 61.86 ? 95  ILE A CG1 1 
ATOM   447  C CG2 . ILE A 1 115 ? -4.166  -14.898 12.792  1.00 58.44 ? 95  ILE A CG2 1 
ATOM   448  C CD1 . ILE A 1 115 ? -5.886  -12.594 13.491  1.00 63.51 ? 95  ILE A CD1 1 
ATOM   449  N N   . VAL A 1 116 ? -8.298  -16.325 13.084  1.00 54.97 ? 96  VAL A N   1 
ATOM   450  C CA  . VAL A 1 116 ? -9.776  -16.239 13.202  1.00 55.00 ? 96  VAL A CA  1 
ATOM   451  C C   . VAL A 1 116 ? -10.232 -15.296 14.314  1.00 57.54 ? 96  VAL A C   1 
ATOM   452  O O   . VAL A 1 116 ? -9.640  -15.272 15.392  1.00 59.03 ? 96  VAL A O   1 
ATOM   453  C CB  . VAL A 1 116 ? -10.446 -17.613 13.455  1.00 53.46 ? 96  VAL A CB  1 
ATOM   454  C CG1 . VAL A 1 116 ? -10.058 -18.612 12.376  1.00 52.64 ? 96  VAL A CG1 1 
ATOM   455  C CG2 . VAL A 1 116 ? -10.117 -18.140 14.839  1.00 53.37 ? 96  VAL A CG2 1 
ATOM   456  N N   . GLN A 1 117 ? -11.304 -14.544 14.062  1.00 60.64 ? 97  GLN A N   1 
ATOM   457  C CA  . GLN A 1 117 ? -11.856 -13.618 15.065  1.00 61.64 ? 97  GLN A CA  1 
ATOM   458  C C   . GLN A 1 117 ? -12.523 -14.356 16.223  1.00 63.07 ? 97  GLN A C   1 
ATOM   459  O O   . GLN A 1 117 ? -12.534 -13.874 17.355  1.00 63.69 ? 97  GLN A O   1 
ATOM   460  C CB  . GLN A 1 117 ? -12.862 -12.665 14.419  1.00 62.64 ? 97  GLN A CB  1 
ATOM   461  N N   . LEU A 1 121 ? -0.003  -13.991 18.861  1.00 48.17 ? 101 LEU A N   1 
ATOM   462  C CA  . LEU A 1 121 ? -1.223  -13.389 18.350  1.00 46.90 ? 101 LEU A CA  1 
ATOM   463  C C   . LEU A 1 121 ? -2.272  -13.331 19.465  1.00 45.61 ? 101 LEU A C   1 
ATOM   464  O O   . LEU A 1 121 ? -2.775  -12.263 19.778  1.00 45.13 ? 101 LEU A O   1 
ATOM   465  C CB  . LEU A 1 121 ? -1.735  -14.185 17.145  1.00 46.78 ? 101 LEU A CB  1 
ATOM   466  C CG  . LEU A 1 121 ? -2.456  -13.438 16.016  1.00 47.59 ? 101 LEU A CG  1 
ATOM   467  C CD1 . LEU A 1 121 ? -3.614  -12.586 16.484  1.00 46.09 ? 101 LEU A CD1 1 
ATOM   468  C CD2 . LEU A 1 121 ? -1.471  -12.591 15.243  1.00 49.16 ? 101 LEU A CD2 1 
ATOM   469  N N   . HIS A 1 122 ? -2.593  -14.484 20.050  1.00 43.66 ? 102 HIS A N   1 
ATOM   470  C CA  . HIS A 1 122 ? -3.511  -14.584 21.197  1.00 40.87 ? 102 HIS A CA  1 
ATOM   471  C C   . HIS A 1 122 ? -3.508  -16.031 21.698  1.00 40.03 ? 102 HIS A C   1 
ATOM   472  O O   . HIS A 1 122 ? -2.783  -16.874 21.170  1.00 35.99 ? 102 HIS A O   1 
ATOM   473  C CB  . HIS A 1 122 ? -4.947  -14.203 20.818  1.00 41.38 ? 102 HIS A CB  1 
ATOM   474  C CG  . HIS A 1 122 ? -5.182  -12.735 20.696  1.00 39.01 ? 102 HIS A CG  1 
ATOM   475  N ND1 . HIS A 1 122 ? -4.972  -12.052 19.521  1.00 37.45 ? 102 HIS A ND1 1 
ATOM   476  C CD2 . HIS A 1 122 ? -5.613  -11.819 21.594  1.00 38.50 ? 102 HIS A CD2 1 
ATOM   477  C CE1 . HIS A 1 122 ? -5.266  -10.777 19.695  1.00 38.13 ? 102 HIS A CE1 1 
ATOM   478  N NE2 . HIS A 1 122 ? -5.657  -10.609 20.947  1.00 37.65 ? 102 HIS A NE2 1 
ATOM   479  N N   . VAL A 1 123 ? -4.302  -16.300 22.732  1.00 39.38 ? 103 VAL A N   1 
ATOM   480  C CA  . VAL A 1 123 ? -4.520  -17.659 23.183  1.00 40.21 ? 103 VAL A CA  1 
ATOM   481  C C   . VAL A 1 123 ? -5.960  -18.021 22.842  1.00 41.77 ? 103 VAL A C   1 
ATOM   482  O O   . VAL A 1 123 ? -6.893  -17.446 23.399  1.00 39.45 ? 103 VAL A O   1 
ATOM   483  C CB  . VAL A 1 123 ? -4.271  -17.801 24.695  1.00 39.84 ? 103 VAL A CB  1 
ATOM   484  N N   . GLY A 1 124 ? -6.128  -18.966 21.912  1.00 44.65 ? 104 GLY A N   1 
ATOM   485  C CA  . GLY A 1 124 ? -7.460  -19.386 21.419  1.00 44.49 ? 104 GLY A CA  1 
ATOM   486  C C   . GLY A 1 124 ? -7.833  -18.875 20.024  1.00 45.00 ? 104 GLY A C   1 
ATOM   487  O O   . GLY A 1 124 ? -8.957  -19.094 19.584  1.00 43.04 ? 104 GLY A O   1 
ATOM   488  N N   . ASP A 1 125 ? -6.892  -18.209 19.336  1.00 45.03 ? 105 ASP A N   1 
ATOM   489  C CA  . ASP A 1 125 ? -7.092  -17.677 17.975  1.00 44.74 ? 105 ASP A CA  1 
ATOM   490  C C   . ASP A 1 125 ? -6.416  -18.574 16.945  1.00 46.81 ? 105 ASP A C   1 
ATOM   491  O O   . ASP A 1 125 ? -5.198  -18.592 16.855  1.00 47.51 ? 105 ASP A O   1 
ATOM   492  C CB  . ASP A 1 125 ? -6.512  -16.247 17.828  1.00 44.06 ? 105 ASP A CB  1 
ATOM   493  C CG  . ASP A 1 125 ? -7.506  -15.137 18.223  1.00 42.38 ? 105 ASP A CG  1 
ATOM   494  O OD1 . ASP A 1 125 ? -7.845  -14.986 19.411  1.00 42.65 ? 105 ASP A OD1 1 
ATOM   495  O OD2 . ASP A 1 125 ? -7.927  -14.375 17.341  1.00 42.91 ? 105 ASP A OD2 1 
ATOM   496  N N   . LEU A 1 126 ? -7.228  -19.296 16.169  1.00 49.64 ? 106 LEU A N   1 
ATOM   497  C CA  . LEU A 1 126 ? -6.786  -20.187 15.073  1.00 49.03 ? 106 LEU A CA  1 
ATOM   498  C C   . LEU A 1 126 ? -5.995  -19.501 13.946  1.00 49.84 ? 106 LEU A C   1 
ATOM   499  O O   . LEU A 1 126 ? -6.059  -18.285 13.814  1.00 51.32 ? 106 LEU A O   1 
ATOM   500  C CB  . LEU A 1 126 ? -8.014  -20.857 14.448  1.00 48.74 ? 106 LEU A CB  1 
ATOM   501  C CG  . LEU A 1 126 ? -7.859  -22.251 13.832  1.00 47.93 ? 106 LEU A CG  1 
ATOM   502  C CD1 . LEU A 1 126 ? -7.809  -23.300 14.931  1.00 47.23 ? 106 LEU A CD1 1 
ATOM   503  C CD2 . LEU A 1 126 ? -9.006  -22.549 12.883  1.00 48.84 ? 106 LEU A CD2 1 
ATOM   504  N N   . ARG A 1 127 ? -5.261  -20.297 13.149  1.00 50.32 ? 107 ARG A N   1 
ATOM   505  C CA  . ARG A 1 127 ? -4.481  -19.816 11.980  1.00 49.42 ? 107 ARG A CA  1 
ATOM   506  C C   . ARG A 1 127 ? -4.614  -20.772 10.775  1.00 51.77 ? 107 ARG A C   1 
ATOM   507  O O   . ARG A 1 127 ? -5.200  -21.855 10.890  1.00 56.12 ? 107 ARG A O   1 
ATOM   508  C CB  . ARG A 1 127 ? -3.008  -19.606 12.351  1.00 48.55 ? 107 ARG A CB  1 
ATOM   509  C CG  . ARG A 1 127 ? -2.019  -20.576 11.707  1.00 52.88 ? 107 ARG A CG  1 
ATOM   510  C CD  . ARG A 1 127 ? -0.590  -20.405 12.222  1.00 51.82 ? 107 ARG A CD  1 
ATOM   511  N NE  . ARG A 1 127 ? -0.161  -21.553 13.011  1.00 49.71 ? 107 ARG A NE  1 
ATOM   512  C CZ  . ARG A 1 127 ? 1.106   -21.939 13.166  1.00 53.68 ? 107 ARG A CZ  1 
ATOM   513  N NH1 . ARG A 1 127 ? 2.111   -21.269 12.592  1.00 53.65 ? 107 ARG A NH1 1 
ATOM   514  N NH2 . ARG A 1 127 ? 1.377   -23.012 13.907  1.00 49.95 ? 107 ARG A NH2 1 
ATOM   515  N N   . GLU A 1 128 ? -4.086  -20.370 9.619   1.00 50.49 ? 108 GLU A N   1 
ATOM   516  C CA  . GLU A 1 128 ? -4.285  -21.130 8.389   1.00 51.47 ? 108 GLU A CA  1 
ATOM   517  C C   . GLU A 1 128 ? -3.017  -21.304 7.569   1.00 55.63 ? 108 GLU A C   1 
ATOM   518  O O   . GLU A 1 128 ? -2.979  -20.968 6.383   1.00 55.26 ? 108 GLU A O   1 
ATOM   519  C CB  . GLU A 1 128 ? -5.350  -20.460 7.532   1.00 54.72 ? 108 GLU A CB  1 
ATOM   520  N N   . VAL A 1 129 ? -1.984  -21.858 8.198   1.00 59.66 ? 109 VAL A N   1 
ATOM   521  C CA  . VAL A 1 129 ? -0.728  -22.130 7.509   1.00 56.18 ? 109 VAL A CA  1 
ATOM   522  C C   . VAL A 1 129 ? -0.901  -23.257 6.499   1.00 57.21 ? 109 VAL A C   1 
ATOM   523  O O   . VAL A 1 129 ? -1.832  -24.057 6.588   1.00 54.51 ? 109 VAL A O   1 
ATOM   524  C CB  . VAL A 1 129 ? 0.398   -22.495 8.498   1.00 58.61 ? 109 VAL A CB  1 
ATOM   525  N N   . MET A 1 130 ? 0.024   -23.315 5.545   1.00 61.44 ? 110 MET A N   1 
ATOM   526  C CA  . MET A 1 130 ? -0.049  -24.224 4.393   1.00 56.25 ? 110 MET A CA  1 
ATOM   527  C C   . MET A 1 130 ? 1.367   -24.426 3.868   1.00 59.05 ? 110 MET A C   1 
ATOM   528  O O   . MET A 1 130 ? 2.220   -23.547 4.014   1.00 58.94 ? 110 MET A O   1 
ATOM   529  C CB  . MET A 1 130 ? -0.952  -23.607 3.324   1.00 54.11 ? 110 MET A CB  1 
ATOM   530  C CG  . MET A 1 130 ? -0.660  -23.993 1.877   1.00 54.34 ? 110 MET A CG  1 
ATOM   531  S SD  . MET A 1 130 ? -1.411  -22.815 0.731   1.00 49.42 ? 110 MET A SD  1 
ATOM   532  C CE  . MET A 1 130 ? -3.013  -23.551 0.445   1.00 45.69 ? 110 MET A CE  1 
ATOM   533  N N   . VAL A 1 131 ? 1.614   -25.576 3.247   1.00 57.76 ? 111 VAL A N   1 
ATOM   534  C CA  . VAL A 1 131 ? 2.968   -25.956 2.868   1.00 52.77 ? 111 VAL A CA  1 
ATOM   535  C C   . VAL A 1 131 ? 3.119   -26.034 1.358   1.00 55.55 ? 111 VAL A C   1 
ATOM   536  O O   . VAL A 1 131 ? 2.241   -25.605 0.606   1.00 58.93 ? 111 VAL A O   1 
ATOM   537  C CB  . VAL A 1 131 ? 3.358   -27.298 3.513   1.00 52.66 ? 111 VAL A CB  1 
ATOM   538  C CG1 . VAL A 1 131 ? 2.658   -27.465 4.863   1.00 52.77 ? 111 VAL A CG1 1 
ATOM   539  C CG2 . VAL A 1 131 ? 3.043   -28.474 2.607   1.00 52.05 ? 111 VAL A CG2 1 
ATOM   540  N N   . LEU A 1 135 ? 5.657   -29.186 -5.247  1.00 45.62 ? 115 LEU A N   1 
ATOM   541  C CA  . LEU A 1 135 ? 4.974   -30.183 -4.435  1.00 44.46 ? 115 LEU A CA  1 
ATOM   542  C C   . LEU A 1 135 ? 3.550   -30.382 -4.977  1.00 45.60 ? 115 LEU A C   1 
ATOM   543  O O   . LEU A 1 135 ? 3.166   -29.710 -5.940  1.00 45.17 ? 115 LEU A O   1 
ATOM   544  C CB  . LEU A 1 135 ? 4.963   -29.748 -2.951  1.00 40.88 ? 115 LEU A CB  1 
ATOM   545  C CG  . LEU A 1 135 ? 5.088   -30.835 -1.869  1.00 37.88 ? 115 LEU A CG  1 
ATOM   546  C CD1 . LEU A 1 135 ? 6.478   -31.424 -1.893  1.00 38.95 ? 115 LEU A CD1 1 
ATOM   547  C CD2 . LEU A 1 135 ? 4.781   -30.335 -0.476  1.00 37.47 ? 115 LEU A CD2 1 
ATOM   548  N N   . PRO A 1 136 ? 2.785   -31.329 -4.397  1.00 47.42 ? 116 PRO A N   1 
ATOM   549  C CA  . PRO A 1 136 ? 1.349   -31.443 -4.673  1.00 49.87 ? 116 PRO A CA  1 
ATOM   550  C C   . PRO A 1 136 ? 0.429   -30.649 -3.699  1.00 51.14 ? 116 PRO A C   1 
ATOM   551  O O   . PRO A 1 136 ? 0.342   -29.421 -3.824  1.00 50.14 ? 116 PRO A O   1 
ATOM   552  C CB  . PRO A 1 136 ? 1.099   -32.973 -4.612  1.00 49.79 ? 116 PRO A CB  1 
ATOM   553  C CG  . PRO A 1 136 ? 2.446   -33.597 -4.645  1.00 51.25 ? 116 PRO A CG  1 
ATOM   554  C CD  . PRO A 1 136 ? 3.310   -32.614 -3.916  1.00 50.18 ? 116 PRO A CD  1 
ATOM   555  N N   . ALA A 1 137 ? -0.239  -31.336 -2.759  1.00 47.07 ? 117 ALA A N   1 
ATOM   556  C CA  . ALA A 1 137 ? -1.228  -30.725 -1.887  1.00 44.66 ? 117 ALA A CA  1 
ATOM   557  C C   . ALA A 1 137 ? -1.066  -31.151 -0.422  1.00 45.00 ? 117 ALA A C   1 
ATOM   558  O O   . ALA A 1 137 ? -0.562  -32.240 -0.126  1.00 42.13 ? 117 ALA A O   1 
ATOM   559  C CB  . ALA A 1 137 ? -2.618  -31.078 -2.379  1.00 46.58 ? 117 ALA A CB  1 
ATOM   560  N N   . VAL A 1 138 ? -1.464  -30.239 0.469   1.00 46.09 ? 118 VAL A N   1 
ATOM   561  C CA  . VAL A 1 138 ? -1.630  -30.448 1.931   1.00 46.08 ? 118 VAL A CA  1 
ATOM   562  C C   . VAL A 1 138 ? -1.569  -29.066 2.609   1.00 46.32 ? 118 VAL A C   1 
ATOM   563  O O   . VAL A 1 138 ? -0.742  -28.227 2.228   1.00 44.39 ? 118 VAL A O   1 
ATOM   564  C CB  . VAL A 1 138 ? -0.629  -31.466 2.557   1.00 46.45 ? 118 VAL A CB  1 
ATOM   565  C CG1 . VAL A 1 138 ? -0.079  -31.002 3.905   1.00 46.99 ? 118 VAL A CG1 1 
ATOM   566  C CG2 . VAL A 1 138 ? -1.298  -32.827 2.730   1.00 45.25 ? 118 VAL A CG2 1 
ATOM   567  N N   . SER A 1 139 ? -2.454  -28.847 3.591   1.00 46.13 ? 119 SER A N   1 
ATOM   568  C CA  . SER A 1 139 ? -2.622  -27.541 4.268   1.00 45.77 ? 119 SER A CA  1 
ATOM   569  C C   . SER A 1 139 ? -2.985  -27.611 5.778   1.00 46.30 ? 119 SER A C   1 
ATOM   570  O O   . SER A 1 139 ? -3.916  -28.334 6.176   1.00 45.98 ? 119 SER A O   1 
ATOM   571  C CB  . SER A 1 139 ? -3.702  -26.746 3.569   1.00 45.82 ? 119 SER A CB  1 
ATOM   572  O OG  . SER A 1 139 ? -4.466  -26.058 4.543   1.00 50.16 ? 119 SER A OG  1 
ATOM   573  N N   . SER A 1 140 ? -2.300  -26.794 6.590   1.00 44.21 ? 120 SER A N   1 
ATOM   574  C CA  . SER A 1 140 ? -2.271  -26.946 8.055   1.00 42.09 ? 120 SER A CA  1 
ATOM   575  C C   . SER A 1 140 ? -3.004  -25.853 8.849   1.00 48.71 ? 120 SER A C   1 
ATOM   576  O O   . SER A 1 140 ? -2.729  -24.647 8.671   1.00 48.88 ? 120 SER A O   1 
ATOM   577  C CB  . SER A 1 140 ? -0.829  -26.943 8.507   1.00 39.91 ? 120 SER A CB  1 
ATOM   578  O OG  . SER A 1 140 ? -0.738  -26.435 9.819   1.00 38.41 ? 120 SER A OG  1 
ATOM   579  N N   . THR A 1 141 ? -3.887  -26.258 9.767   1.00 46.52 ? 121 THR A N   1 
ATOM   580  C CA  . THR A 1 141 ? -4.665  -25.278 10.545  1.00 46.56 ? 121 THR A CA  1 
ATOM   581  C C   . THR A 1 141 ? -4.536  -25.510 12.055  1.00 45.22 ? 121 THR A C   1 
ATOM   582  O O   . THR A 1 141 ? -4.956  -26.541 12.574  1.00 47.17 ? 121 THR A O   1 
ATOM   583  C CB  . THR A 1 141 ? -6.150  -25.265 10.129  1.00 46.48 ? 121 THR A CB  1 
ATOM   584  N N   . GLU A 1 142 ? -3.989  -24.518 12.757  1.00 45.43 ? 122 GLU A N   1 
ATOM   585  C CA  . GLU A 1 142 ? -3.480  -24.695 14.134  1.00 41.63 ? 122 GLU A CA  1 
ATOM   586  C C   . GLU A 1 142 ? -4.189  -23.820 15.168  1.00 38.87 ? 122 GLU A C   1 
ATOM   587  O O   . GLU A 1 142 ? -4.998  -22.970 14.808  1.00 38.02 ? 122 GLU A O   1 
ATOM   588  C CB  . GLU A 1 142 ? -1.985  -24.376 14.140  1.00 40.59 ? 122 GLU A CB  1 
ATOM   589  C CG  . GLU A 1 142 ? -1.076  -25.505 13.667  1.00 42.88 ? 122 GLU A CG  1 
ATOM   590  C CD  . GLU A 1 142 ? -0.754  -25.503 12.190  1.00 44.33 ? 122 GLU A CD  1 
ATOM   591  O OE1 . GLU A 1 142 ? -1.396  -24.753 11.429  1.00 47.30 ? 122 GLU A OE1 1 
ATOM   592  O OE2 . GLU A 1 142 ? 0.146   -26.279 11.783  1.00 45.37 ? 122 GLU A OE2 1 
ATOM   593  N N   . ARG A 1 143 ? -3.870  -24.023 16.446  1.00 37.35 ? 123 ARG A N   1 
ATOM   594  C CA  . ARG A 1 143 ? -4.330  -23.129 17.543  1.00 37.45 ? 123 ARG A CA  1 
ATOM   595  C C   . ARG A 1 143 ? -3.142  -22.596 18.357  1.00 35.02 ? 123 ARG A C   1 
ATOM   596  O O   . ARG A 1 143 ? -2.017  -22.810 17.975  1.00 37.20 ? 123 ARG A O   1 
ATOM   597  C CB  . ARG A 1 143 ? -5.335  -23.838 18.445  1.00 38.11 ? 123 ARG A CB  1 
ATOM   598  C CG  . ARG A 1 143 ? -6.406  -22.919 19.019  1.00 39.28 ? 123 ARG A CG  1 
ATOM   599  C CD  . ARG A 1 143 ? -7.184  -23.588 20.137  1.00 43.35 ? 123 ARG A CD  1 
ATOM   600  N NE  . ARG A 1 143 ? -8.546  -23.947 19.741  1.00 47.51 ? 123 ARG A NE  1 
ATOM   601  C CZ  . ARG A 1 143 ? -9.438  -24.509 20.555  1.00 49.36 ? 123 ARG A CZ  1 
ATOM   602  N NH1 . ARG A 1 143 ? -9.115  -24.793 21.819  1.00 47.51 ? 123 ARG A NH1 1 
ATOM   603  N NH2 . ARG A 1 143 ? -10.661 -24.787 20.101  1.00 49.47 ? 123 ARG A NH2 1 
ATOM   604  N N   . LEU A 1 144 ? -3.382  -21.830 19.414  1.00 35.22 ? 124 LEU A N   1 
ATOM   605  C CA  . LEU A 1 144 ? -2.298  -21.319 20.271  1.00 35.45 ? 124 LEU A CA  1 
ATOM   606  C C   . LEU A 1 144 ? -2.743  -21.408 21.738  1.00 36.96 ? 124 LEU A C   1 
ATOM   607  O O   . LEU A 1 144 ? -2.966  -20.398 22.398  1.00 35.29 ? 124 LEU A O   1 
ATOM   608  C CB  . LEU A 1 144 ? -1.904  -19.886 19.892  1.00 34.78 ? 124 LEU A CB  1 
ATOM   609  C CG  . LEU A 1 144 ? -0.415  -19.531 20.053  1.00 36.12 ? 124 LEU A CG  1 
ATOM   610  C CD1 . LEU A 1 144 ? -0.156  -18.059 19.807  1.00 36.21 ? 124 LEU A CD1 1 
ATOM   611  C CD2 . LEU A 1 144 ? 0.124   -19.907 21.422  1.00 37.70 ? 124 LEU A CD2 1 
ATOM   612  N N   . GLU A 1 145 ? -2.863  -22.644 22.225  1.00 37.50 ? 125 GLU A N   1 
ATOM   613  C CA  . GLU A 1 145 ? -3.381  -22.903 23.559  1.00 38.69 ? 125 GLU A CA  1 
ATOM   614  C C   . GLU A 1 145 ? -2.619  -22.091 24.570  1.00 39.84 ? 125 GLU A C   1 
ATOM   615  O O   . GLU A 1 145 ? -3.223  -21.412 25.403  1.00 43.63 ? 125 GLU A O   1 
ATOM   616  C CB  . GLU A 1 145 ? -3.329  -24.405 23.923  1.00 38.11 ? 125 GLU A CB  1 
ATOM   617  C CG  . GLU A 1 145 ? -1.996  -25.103 23.661  1.00 36.45 ? 125 GLU A CG  1 
ATOM   618  C CD  . GLU A 1 145 ? -1.888  -26.442 24.352  1.00 36.17 ? 125 GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 145 ? -1.744  -26.481 25.598  1.00 34.49 ? 125 GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 145 ? -1.926  -27.460 23.641  1.00 36.78 ? 125 GLU A OE2 1 
ATOM   621  N N   . ILE A 1 146 ? -1.294  -22.147 24.475  1.00 40.88 ? 126 ILE A N   1 
ATOM   622  C CA  . ILE A 1 146 ? -0.416  -21.501 25.425  1.00 40.46 ? 126 ILE A CA  1 
ATOM   623  C C   . ILE A 1 146 ? 0.528   -20.546 24.701  1.00 43.19 ? 126 ILE A C   1 
ATOM   624  O O   . ILE A 1 146 ? 1.341   -20.964 23.859  1.00 41.28 ? 126 ILE A O   1 
ATOM   625  C CB  . ILE A 1 146 ? 0.380   -22.537 26.220  1.00 40.32 ? 126 ILE A CB  1 
ATOM   626  C CG1 . ILE A 1 146 ? -0.371  -22.905 27.497  1.00 43.64 ? 126 ILE A CG1 1 
ATOM   627  C CG2 . ILE A 1 146 ? 1.760   -22.001 26.611  1.00 41.91 ? 126 ILE A CG2 1 
ATOM   628  C CD1 . ILE A 1 146 ? -1.783  -23.445 27.309  1.00 44.08 ? 126 ILE A CD1 1 
ATOM   629  N N   . LEU A 1 147 ? 0.406   -19.260 25.025  1.00 42.78 ? 127 LEU A N   1 
ATOM   630  C CA  . LEU A 1 147 ? 1.420   -18.289 24.642  1.00 44.65 ? 127 LEU A CA  1 
ATOM   631  C C   . LEU A 1 147 ? 1.933   -17.651 25.920  1.00 45.69 ? 127 LEU A C   1 
ATOM   632  O O   . LEU A 1 147 ? 1.517   -16.550 26.274  1.00 47.84 ? 127 LEU A O   1 
ATOM   633  C CB  . LEU A 1 147 ? 0.867   -17.230 23.665  1.00 44.20 ? 127 LEU A CB  1 
ATOM   634  C CG  . LEU A 1 147 ? 1.833   -16.703 22.594  1.00 44.28 ? 127 LEU A CG  1 
ATOM   635  C CD1 . LEU A 1 147 ? 1.305   -15.444 21.935  1.00 45.60 ? 127 LEU A CD1 1 
ATOM   636  C CD2 . LEU A 1 147 ? 3.219   -16.427 23.156  1.00 45.55 ? 127 LEU A CD2 1 
ATOM   637  N N   . ASP A 1 148 ? 2.814   -18.364 26.628  1.00 45.84 ? 128 ASP A N   1 
ATOM   638  C CA  . ASP A 1 148 ? 3.447   -17.829 27.836  1.00 42.36 ? 128 ASP A CA  1 
ATOM   639  C C   . ASP A 1 148 ? 4.635   -16.973 27.412  1.00 45.90 ? 128 ASP A C   1 
ATOM   640  O O   . ASP A 1 148 ? 5.576   -17.487 26.784  1.00 42.55 ? 128 ASP A O   1 
ATOM   641  C CB  . ASP A 1 148 ? 3.875   -18.958 28.770  1.00 39.32 ? 128 ASP A CB  1 
ATOM   642  C CG  . ASP A 1 148 ? 4.346   -18.458 30.121  1.00 39.07 ? 128 ASP A CG  1 
ATOM   643  O OD1 . ASP A 1 148 ? 5.136   -19.158 30.773  1.00 42.63 ? 128 ASP A OD1 1 
ATOM   644  O OD2 . ASP A 1 148 ? 3.951   -17.365 30.543  1.00 40.61 ? 128 ASP A OD2 1 
ATOM   645  N N   . GLU A 1 149 ? 4.570   -15.677 27.754  1.00 49.09 ? 129 GLU A N   1 
ATOM   646  C CA  . GLU A 1 149 ? 5.520   -14.635 27.276  1.00 50.83 ? 129 GLU A CA  1 
ATOM   647  C C   . GLU A 1 149 ? 6.674   -14.335 28.237  1.00 51.65 ? 129 GLU A C   1 
ATOM   648  O O   . GLU A 1 149 ? 7.631   -13.649 27.852  1.00 52.42 ? 129 GLU A O   1 
ATOM   649  C CB  . GLU A 1 149 ? 4.791   -13.303 27.008  1.00 48.51 ? 129 GLU A CB  1 
ATOM   650  C CG  . GLU A 1 149 ? 3.623   -13.377 26.029  1.00 49.06 ? 129 GLU A CG  1 
ATOM   651  C CD  . GLU A 1 149 ? 3.953   -12.896 24.617  1.00 48.45 ? 129 GLU A CD  1 
ATOM   652  O OE1 . GLU A 1 149 ? 4.617   -11.850 24.470  1.00 48.96 ? 129 GLU A OE1 1 
ATOM   653  O OE2 . GLU A 1 149 ? 3.518   -13.550 23.640  1.00 47.02 ? 129 GLU A OE2 1 
ATOM   654  N N   . GLU A 1 150 ? 6.572   -14.818 29.477  1.00 52.02 ? 130 GLU A N   1 
ATOM   655  C CA  . GLU A 1 150 ? 7.587   -14.577 30.507  1.00 48.03 ? 130 GLU A CA  1 
ATOM   656  C C   . GLU A 1 150 ? 8.500   -15.800 30.526  1.00 53.28 ? 130 GLU A C   1 
ATOM   657  O O   . GLU A 1 150 ? 9.711   -15.702 30.286  1.00 50.24 ? 130 GLU A O   1 
ATOM   658  C CB  . GLU A 1 150 ? 6.914   -14.342 31.867  1.00 44.79 ? 130 GLU A CB  1 
ATOM   659  C CG  . GLU A 1 150 ? 7.704   -13.475 32.842  1.00 44.82 ? 130 GLU A CG  1 
ATOM   660  C CD  . GLU A 1 150 ? 8.341   -14.244 33.995  1.00 44.26 ? 130 GLU A CD  1 
ATOM   661  O OE1 . GLU A 1 150 ? 8.582   -13.608 35.044  1.00 42.54 ? 130 GLU A OE1 1 
ATOM   662  O OE2 . GLU A 1 150 ? 8.600   -15.468 33.873  1.00 43.06 ? 130 GLU A OE2 1 
ATOM   663  N N   . ARG A 1 151 ? 7.905   -16.960 30.796  1.00 58.83 ? 131 ARG A N   1 
ATOM   664  C CA  . ARG A 1 151 ? 8.611   -18.219 30.628  1.00 61.96 ? 131 ARG A CA  1 
ATOM   665  C C   . ARG A 1 151 ? 8.355   -18.573 29.176  1.00 60.30 ? 131 ARG A C   1 
ATOM   666  O O   . ARG A 1 151 ? 7.257   -19.003 28.816  1.00 61.48 ? 131 ARG A O   1 
ATOM   667  C CB  . ARG A 1 151 ? 8.099   -19.304 31.586  1.00 64.72 ? 131 ARG A CB  1 
ATOM   668  C CG  . ARG A 1 151 ? 8.179   -18.924 33.066  1.00 66.04 ? 131 ARG A CG  1 
ATOM   669  C CD  . ARG A 1 151 ? 9.376   -19.557 33.765  1.00 66.16 ? 131 ARG A CD  1 
ATOM   670  N NE  . ARG A 1 151 ? 9.826   -18.837 34.966  1.00 66.82 ? 131 ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 151 ? 10.399  -19.399 36.036  1.00 68.00 ? 131 ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 151 ? 10.595  -20.721 36.116  1.00 67.45 ? 131 ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 151 ? 10.770  -18.628 37.051  1.00 66.79 ? 131 ARG A NH2 1 
ATOM   674  N N   . HIS A 1 152 ? 9.370   -18.338 28.347  1.00 54.64 ? 132 HIS A N   1 
ATOM   675  C CA  . HIS A 1 152 ? 9.284   -18.545 26.910  1.00 50.29 ? 132 HIS A CA  1 
ATOM   676  C C   . HIS A 1 152 ? 8.670   -19.909 26.618  1.00 47.02 ? 132 HIS A C   1 
ATOM   677  O O   . HIS A 1 152 ? 9.355   -20.917 26.691  1.00 43.79 ? 132 HIS A O   1 
ATOM   678  C CB  . HIS A 1 152 ? 10.679  -18.466 26.268  1.00 49.61 ? 132 HIS A CB  1 
ATOM   679  C CG  . HIS A 1 152 ? 11.561  -17.407 26.849  1.00 51.38 ? 132 HIS A CG  1 
ATOM   680  N ND1 . HIS A 1 152 ? 11.165  -16.089 26.979  1.00 52.72 ? 132 HIS A ND1 1 
ATOM   681  C CD2 . HIS A 1 152 ? 12.824  -17.470 27.334  1.00 49.55 ? 132 HIS A CD2 1 
ATOM   682  C CE1 . HIS A 1 152 ? 12.146  -15.387 27.518  1.00 49.79 ? 132 HIS A CE1 1 
ATOM   683  N NE2 . HIS A 1 152 ? 13.161  -16.201 27.747  1.00 51.93 ? 132 HIS A NE2 1 
ATOM   684  N N   . VAL A 1 153 ? 7.372   -19.941 26.331  1.00 47.64 ? 133 VAL A N   1 
ATOM   685  C CA  . VAL A 1 153 ? 6.710   -21.183 25.944  1.00 45.97 ? 133 VAL A CA  1 
ATOM   686  C C   . VAL A 1 153 ? 5.572   -20.925 24.978  1.00 45.98 ? 133 VAL A C   1 
ATOM   687  O O   . VAL A 1 153 ? 4.637   -20.205 25.311  1.00 47.55 ? 133 VAL A O   1 
ATOM   688  C CB  . VAL A 1 153 ? 6.114   -21.924 27.149  1.00 47.07 ? 133 VAL A CB  1 
ATOM   689  C CG1 . VAL A 1 153 ? 5.387   -23.174 26.689  1.00 50.73 ? 133 VAL A CG1 1 
ATOM   690  C CG2 . VAL A 1 153 ? 7.195   -22.315 28.142  1.00 50.14 ? 133 VAL A CG2 1 
ATOM   691  N N   . ILE A 1 154 ? 5.641   -21.534 23.795  1.00 45.57 ? 134 ILE A N   1 
ATOM   692  C CA  . ILE A 1 154 ? 4.471   -21.637 22.924  1.00 46.88 ? 134 ILE A CA  1 
ATOM   693  C C   . ILE A 1 154 ? 4.088   -23.100 22.640  1.00 48.07 ? 134 ILE A C   1 
ATOM   694  O O   . ILE A 1 154 ? 4.938   -23.936 22.346  1.00 52.01 ? 134 ILE A O   1 
ATOM   695  C CB  . ILE A 1 154 ? 4.611   -20.854 21.583  1.00 46.36 ? 134 ILE A CB  1 
ATOM   696  C CG1 . ILE A 1 154 ? 6.024   -20.896 21.024  1.00 43.84 ? 134 ILE A CG1 1 
ATOM   697  C CG2 . ILE A 1 154 ? 4.177   -19.406 21.754  1.00 46.17 ? 134 ILE A CG2 1 
ATOM   698  C CD1 . ILE A 1 154 ? 6.162   -20.087 19.760  1.00 43.62 ? 134 ILE A CD1 1 
ATOM   699  N N   . SER A 1 155 ? 2.793   -23.394 22.765  1.00 48.13 ? 135 SER A N   1 
ATOM   700  C CA  . SER A 1 155 ? 2.220   -24.651 22.291  1.00 44.94 ? 135 SER A CA  1 
ATOM   701  C C   . SER A 1 155 ? 1.043   -24.335 21.398  1.00 45.11 ? 135 SER A C   1 
ATOM   702  O O   . SER A 1 155 ? 0.418   -23.272 21.513  1.00 49.96 ? 135 SER A O   1 
ATOM   703  C CB  . SER A 1 155 ? 1.790   -25.550 23.446  1.00 45.53 ? 135 SER A CB  1 
ATOM   704  O OG  . SER A 1 155 ? 2.768   -26.558 23.681  1.00 45.30 ? 135 SER A OG  1 
ATOM   705  N N   . PHE A 1 156 ? 0.754   -25.244 20.482  1.00 39.67 ? 136 PHE A N   1 
ATOM   706  C CA  . PHE A 1 156 ? -0.291  -25.003 19.529  1.00 38.48 ? 136 PHE A CA  1 
ATOM   707  C C   . PHE A 1 156 ? -0.702  -26.302 18.841  1.00 41.55 ? 136 PHE A C   1 
ATOM   708  O O   . PHE A 1 156 ? 0.150   -27.074 18.394  1.00 42.70 ? 136 PHE A O   1 
ATOM   709  C CB  . PHE A 1 156 ? 0.157   -23.939 18.520  1.00 37.14 ? 136 PHE A CB  1 
ATOM   710  C CG  . PHE A 1 156 ? 1.356   -24.322 17.731  1.00 35.14 ? 136 PHE A CG  1 
ATOM   711  C CD1 . PHE A 1 156 ? 1.211   -24.861 16.468  1.00 34.29 ? 136 PHE A CD1 1 
ATOM   712  C CD2 . PHE A 1 156 ? 2.611   -24.177 18.254  1.00 31.80 ? 136 PHE A CD2 1 
ATOM   713  C CE1 . PHE A 1 156 ? 2.304   -25.237 15.744  1.00 31.49 ? 136 PHE A CE1 1 
ATOM   714  C CE2 . PHE A 1 156 ? 3.696   -24.533 17.533  1.00 31.63 ? 136 PHE A CE2 1 
ATOM   715  C CZ  . PHE A 1 156 ? 3.545   -25.071 16.276  1.00 31.51 ? 136 PHE A CZ  1 
ATOM   716  N N   . SER A 1 157 ? -2.013  -26.545 18.795  1.00 45.15 ? 137 SER A N   1 
ATOM   717  C CA  . SER A 1 157 ? -2.568  -27.751 18.199  1.00 49.69 ? 137 SER A CA  1 
ATOM   718  C C   . SER A 1 157 ? -3.029  -27.468 16.785  1.00 50.07 ? 137 SER A C   1 
ATOM   719  O O   . SER A 1 157 ? -3.363  -26.344 16.457  1.00 54.94 ? 137 SER A O   1 
ATOM   720  C CB  . SER A 1 157 ? -3.745  -28.272 19.031  1.00 50.73 ? 137 SER A CB  1 
ATOM   721  O OG  . SER A 1 157 ? -4.925  -27.530 18.772  1.00 55.73 ? 137 SER A OG  1 
ATOM   722  N N   . VAL A 1 158 ? -3.084  -28.500 15.958  1.00 51.62 ? 138 VAL A N   1 
ATOM   723  C CA  . VAL A 1 158 ? -3.444  -28.323 14.567  1.00 52.21 ? 138 VAL A CA  1 
ATOM   724  C C   . VAL A 1 158 ? -4.912  -28.673 14.326  1.00 55.30 ? 138 VAL A C   1 
ATOM   725  O O   . VAL A 1 158 ? -5.257  -29.316 13.331  1.00 56.10 ? 138 VAL A O   1 
ATOM   726  C CB  . VAL A 1 158 ? -2.531  -29.130 13.624  1.00 54.55 ? 138 VAL A CB  1 
ATOM   727  C CG1 . VAL A 1 158 ? -2.623  -28.556 12.235  1.00 57.68 ? 138 VAL A CG1 1 
ATOM   728  C CG2 . VAL A 1 158 ? -1.075  -29.082 14.069  1.00 56.97 ? 138 VAL A CG2 1 
ATOM   729  N N   . VAL A 1 159 ? -5.776  -28.239 15.239  1.00 59.65 ? 139 VAL A N   1 
ATOM   730  C CA  . VAL A 1 159 ? -7.219  -28.421 15.086  1.00 61.11 ? 139 VAL A CA  1 
ATOM   731  C C   . VAL A 1 159 ? -7.710  -27.708 13.837  1.00 64.03 ? 139 VAL A C   1 
ATOM   732  O O   . VAL A 1 159 ? -7.277  -26.590 13.544  1.00 62.00 ? 139 VAL A O   1 
ATOM   733  C CB  . VAL A 1 159 ? -7.998  -27.873 16.293  1.00 60.45 ? 139 VAL A CB  1 
ATOM   734  C CG1 . VAL A 1 159 ? -7.853  -26.361 16.386  1.00 58.96 ? 139 VAL A CG1 1 
ATOM   735  C CG2 . VAL A 1 159 ? -9.467  -28.269 16.210  1.00 60.57 ? 139 VAL A CG2 1 
ATOM   736  N N   . GLY A 1 160 ? -8.614  -28.363 13.111  1.00 64.49 ? 140 GLY A N   1 
ATOM   737  C CA  . GLY A 1 160 ? -9.165  -27.808 11.883  1.00 64.92 ? 140 GLY A CA  1 
ATOM   738  C C   . GLY A 1 160 ? -8.216  -27.908 10.710  1.00 66.40 ? 140 GLY A C   1 
ATOM   739  O O   . GLY A 1 160 ? -8.370  -27.205 9.719   1.00 76.91 ? 140 GLY A O   1 
ATOM   740  N N   . GLY A 1 161 ? -7.236  -28.792 10.807  1.00 67.90 ? 141 GLY A N   1 
ATOM   741  C CA  . GLY A 1 161 ? -6.313  -29.024 9.709   1.00 69.18 ? 141 GLY A CA  1 
ATOM   742  C C   . GLY A 1 161 ? -6.940  -29.801 8.566   1.00 69.85 ? 141 GLY A C   1 
ATOM   743  O O   . GLY A 1 161 ? -8.004  -30.408 8.718   1.00 74.70 ? 141 GLY A O   1 
ATOM   744  N N   . ASP A 1 162 ? -6.264  -29.767 7.419   1.00 69.87 ? 142 ASP A N   1 
ATOM   745  C CA  . ASP A 1 162 ? -6.691  -30.456 6.190   1.00 64.38 ? 142 ASP A CA  1 
ATOM   746  C C   . ASP A 1 162 ? -5.920  -31.757 5.956   1.00 62.36 ? 142 ASP A C   1 
ATOM   747  O O   . ASP A 1 162 ? -6.237  -32.532 5.049   1.00 60.13 ? 142 ASP A O   1 
ATOM   748  C CB  . ASP A 1 162 ? -6.438  -29.525 4.994   1.00 59.69 ? 142 ASP A CB  1 
ATOM   749  C CG  . ASP A 1 162 ? -7.369  -29.783 3.837   1.00 58.85 ? 142 ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 162 ? -8.590  -29.936 4.069   1.00 53.39 ? 142 ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 162 ? -6.872  -29.809 2.688   1.00 60.11 ? 142 ASP A OD2 1 
ATOM   752  N N   . HIS A 1 163 ? -4.924  -32.004 6.799   1.00 59.93 ? 143 HIS A N   1 
ATOM   753  C CA  . HIS A 1 163 ? -3.801  -32.865 6.431   1.00 55.52 ? 143 HIS A CA  1 
ATOM   754  C C   . HIS A 1 163 ? -3.893  -34.188 7.153   1.00 56.77 ? 143 HIS A C   1 
ATOM   755  O O   . HIS A 1 163 ? -4.819  -34.406 7.952   1.00 55.24 ? 143 HIS A O   1 
ATOM   756  C CB  . HIS A 1 163 ? -2.457  -32.165 6.708   1.00 54.06 ? 143 HIS A CB  1 
ATOM   757  C CG  . HIS A 1 163 ? -2.369  -31.518 8.052   1.00 49.67 ? 143 HIS A CG  1 
ATOM   758  N ND1 . HIS A 1 163 ? -3.154  -30.445 8.402   1.00 48.01 ? 143 HIS A ND1 1 
ATOM   759  C CD2 . HIS A 1 163 ? -1.584  -31.777 9.123   1.00 49.01 ? 143 HIS A CD2 1 
ATOM   760  C CE1 . HIS A 1 163 ? -2.873  -30.079 9.635   1.00 47.46 ? 143 HIS A CE1 1 
ATOM   761  N NE2 . HIS A 1 163 ? -1.911  -30.861 10.093  1.00 48.53 ? 143 HIS A NE2 1 
ATOM   762  N N   . ARG A 1 164 ? -2.940  -35.072 6.858   1.00 54.01 ? 144 ARG A N   1 
ATOM   763  C CA  . ARG A 1 164 ? -2.931  -36.404 7.446   1.00 53.53 ? 144 ARG A CA  1 
ATOM   764  C C   . ARG A 1 164 ? -2.579  -36.377 8.930   1.00 53.67 ? 144 ARG A C   1 
ATOM   765  O O   . ARG A 1 164 ? -3.357  -36.828 9.773   1.00 53.04 ? 144 ARG A O   1 
ATOM   766  C CB  . ARG A 1 164 ? -1.927  -37.304 6.706   1.00 54.72 ? 144 ARG A CB  1 
ATOM   767  C CG  . ARG A 1 164 ? -1.683  -38.651 7.370   1.00 51.86 ? 144 ARG A CG  1 
ATOM   768  C CD  . ARG A 1 164 ? -2.923  -39.525 7.335   1.00 52.76 ? 144 ARG A CD  1 
ATOM   769  N NE  . ARG A 1 164 ? -3.026  -40.242 6.065   1.00 51.51 ? 144 ARG A NE  1 
ATOM   770  C CZ  . ARG A 1 164 ? -4.145  -40.422 5.364   1.00 55.55 ? 144 ARG A CZ  1 
ATOM   771  N NH1 . ARG A 1 164 ? -5.321  -39.918 5.764   1.00 51.95 ? 144 ARG A NH1 1 
ATOM   772  N NH2 . ARG A 1 164 ? -4.080  -41.107 4.224   1.00 57.74 ? 144 ARG A NH2 1 
ATOM   773  N N   . LEU A 1 165 ? -1.395  -35.849 9.234   1.00 52.50 ? 145 LEU A N   1 
ATOM   774  C CA  . LEU A 1 165 ? -0.761  -36.060 10.531  1.00 48.81 ? 145 LEU A CA  1 
ATOM   775  C C   . LEU A 1 165 ? -1.615  -35.460 11.648  1.00 52.49 ? 145 LEU A C   1 
ATOM   776  O O   . LEU A 1 165 ? -1.818  -34.245 11.702  1.00 59.86 ? 145 LEU A O   1 
ATOM   777  C CB  . LEU A 1 165 ? 0.667   -35.519 10.521  1.00 45.86 ? 145 LEU A CB  1 
ATOM   778  C CG  . LEU A 1 165 ? 1.565   -36.148 9.427   1.00 44.64 ? 145 LEU A CG  1 
ATOM   779  C CD1 . LEU A 1 165 ? 2.906   -35.426 9.249   1.00 42.00 ? 145 LEU A CD1 1 
ATOM   780  C CD2 . LEU A 1 165 ? 1.779   -37.630 9.703   1.00 42.44 ? 145 LEU A CD2 1 
ATOM   781  N N   . LYS A 1 166 ? -2.095  -36.337 12.532  1.00 50.74 ? 146 LYS A N   1 
ATOM   782  C CA  . LYS A 1 166 ? -3.243  -36.069 13.398  1.00 53.89 ? 146 LYS A CA  1 
ATOM   783  C C   . LYS A 1 166 ? -2.956  -35.128 14.577  1.00 53.21 ? 146 LYS A C   1 
ATOM   784  O O   . LYS A 1 166 ? -2.571  -33.986 14.360  1.00 54.26 ? 146 LYS A O   1 
ATOM   785  C CB  . LYS A 1 166 ? -3.843  -37.397 13.891  1.00 54.22 ? 146 LYS A CB  1 
ATOM   786  N N   . ASN A 1 167 ? -3.165  -35.599 15.810  1.00 53.96 ? 147 ASN A N   1 
ATOM   787  C CA  . ASN A 1 167 ? -3.136  -34.734 17.001  1.00 51.42 ? 147 ASN A CA  1 
ATOM   788  C C   . ASN A 1 167 ? -1.769  -34.089 17.206  1.00 50.34 ? 147 ASN A C   1 
ATOM   789  O O   . ASN A 1 167 ? -0.756  -34.712 16.940  1.00 53.56 ? 147 ASN A O   1 
ATOM   790  C CB  . ASN A 1 167 ? -3.523  -35.535 18.239  1.00 49.75 ? 147 ASN A CB  1 
ATOM   791  N N   . TYR A 1 168 ? -1.743  -32.845 17.670  1.00 49.30 ? 148 TYR A N   1 
ATOM   792  C CA  . TYR A 1 168 ? -0.490  -32.103 17.777  1.00 50.48 ? 148 TYR A CA  1 
ATOM   793  C C   . TYR A 1 168 ? -0.588  -31.021 18.855  1.00 51.17 ? 148 TYR A C   1 
ATOM   794  O O   . TYR A 1 168 ? -1.668  -30.474 19.120  1.00 48.29 ? 148 TYR A O   1 
ATOM   795  C CB  . TYR A 1 168 ? -0.150  -31.459 16.427  1.00 51.53 ? 148 TYR A CB  1 
ATOM   796  C CG  . TYR A 1 168 ? 1.316   -31.492 16.030  1.00 50.67 ? 148 TYR A CG  1 
ATOM   797  C CD1 . TYR A 1 168 ? 1.730   -32.030 14.803  1.00 52.00 ? 148 TYR A CD1 1 
ATOM   798  C CD2 . TYR A 1 168 ? 2.282   -30.966 16.853  1.00 52.61 ? 148 TYR A CD2 1 
ATOM   799  C CE1 . TYR A 1 168 ? 3.071   -32.047 14.440  1.00 47.32 ? 148 TYR A CE1 1 
ATOM   800  C CE2 . TYR A 1 168 ? 3.614   -30.979 16.496  1.00 53.17 ? 148 TYR A CE2 1 
ATOM   801  C CZ  . TYR A 1 168 ? 4.004   -31.513 15.301  1.00 48.99 ? 148 TYR A CZ  1 
ATOM   802  O OH  . TYR A 1 168 ? 5.351   -31.477 15.022  1.00 51.62 ? 148 TYR A OH  1 
ATOM   803  N N   . ARG A 1 169 ? 0.556   -30.743 19.474  1.00 48.32 ? 149 ARG A N   1 
ATOM   804  C CA  . ARG A 1 169 ? 0.683   -29.783 20.546  1.00 45.65 ? 149 ARG A CA  1 
ATOM   805  C C   . ARG A 1 169 ? 2.183   -29.482 20.645  1.00 49.26 ? 149 ARG A C   1 
ATOM   806  O O   . ARG A 1 169 ? 2.851   -29.833 21.631  1.00 50.60 ? 149 ARG A O   1 
ATOM   807  C CB  . ARG A 1 169 ? 0.102   -30.395 21.826  1.00 43.49 ? 149 ARG A CB  1 
ATOM   808  C CG  . ARG A 1 169 ? 0.431   -29.699 23.138  1.00 43.60 ? 149 ARG A CG  1 
ATOM   809  C CD  . ARG A 1 169 ? 0.284   -30.652 24.318  1.00 40.04 ? 149 ARG A CD  1 
ATOM   810  N NE  . ARG A 1 169 ? 0.859   -30.082 25.530  1.00 37.87 ? 149 ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 169 ? 0.956   -30.717 26.690  1.00 37.66 ? 149 ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 169 ? 0.526   -31.967 26.823  1.00 40.87 ? 149 ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 169 ? 1.494   -30.102 27.725  1.00 37.84 ? 149 ARG A NH2 1 
ATOM   814  N N   . SER A 1 170 ? 2.707   -28.845 19.595  1.00 50.04 ? 150 SER A N   1 
ATOM   815  C CA  . SER A 1 170 ? 4.142   -28.574 19.464  1.00 49.50 ? 150 SER A CA  1 
ATOM   816  C C   . SER A 1 170 ? 4.697   -27.613 20.516  1.00 48.27 ? 150 SER A C   1 
ATOM   817  O O   . SER A 1 170 ? 4.778   -26.411 20.286  1.00 51.81 ? 150 SER A O   1 
ATOM   818  C CB  . SER A 1 170 ? 4.428   -28.006 18.078  1.00 51.50 ? 150 SER A CB  1 
ATOM   819  O OG  . SER A 1 170 ? 5.812   -27.776 17.894  1.00 51.41 ? 150 SER A OG  1 
ATOM   820  N N   . VAL A 1 171 ? 5.118   -28.143 21.655  1.00 50.84 ? 151 VAL A N   1 
ATOM   821  C CA  . VAL A 1 171 ? 5.610   -27.297 22.750  1.00 51.21 ? 151 VAL A CA  1 
ATOM   822  C C   . VAL A 1 171 ? 7.002   -26.808 22.454  1.00 52.04 ? 151 VAL A C   1 
ATOM   823  O O   . VAL A 1 171 ? 7.934   -27.616 22.477  1.00 56.21 ? 151 VAL A O   1 
ATOM   824  C CB  . VAL A 1 171 ? 5.687   -28.050 24.094  1.00 48.87 ? 151 VAL A CB  1 
ATOM   825  N N   . THR A 1 172 ? 7.133   -25.505 22.174  1.00 48.66 ? 152 THR A N   1 
ATOM   826  C CA  . THR A 1 172 ? 8.436   -24.852 22.064  1.00 46.64 ? 152 THR A CA  1 
ATOM   827  C C   . THR A 1 172 ? 8.705   -24.003 23.297  1.00 48.66 ? 152 THR A C   1 
ATOM   828  O O   . THR A 1 172 ? 8.161   -22.911 23.422  1.00 51.50 ? 152 THR A O   1 
ATOM   829  C CB  . THR A 1 172 ? 8.530   -23.950 20.828  1.00 45.60 ? 152 THR A CB  1 
ATOM   830  O OG1 . THR A 1 172 ? 7.999   -24.636 19.691  1.00 45.22 ? 152 THR A OG1 1 
ATOM   831  C CG2 . THR A 1 172 ? 9.989   -23.559 20.556  1.00 44.20 ? 152 THR A CG2 1 
ATOM   832  N N   . THR A 1 173 ? 9.559   -24.506 24.192  1.00 48.50 ? 153 THR A N   1 
ATOM   833  C CA  . THR A 1 173 ? 9.937   -23.805 25.417  1.00 45.03 ? 153 THR A CA  1 
ATOM   834  C C   . THR A 1 173 ? 11.387  -23.379 25.375  1.00 43.97 ? 153 THR A C   1 
ATOM   835  O O   . THR A 1 173 ? 12.199  -24.015 24.701  1.00 44.49 ? 153 THR A O   1 
ATOM   836  C CB  . THR A 1 173 ? 9.746   -24.692 26.662  1.00 47.22 ? 153 THR A CB  1 
ATOM   837  O OG1 . THR A 1 173 ? 10.848  -25.606 26.808  1.00 49.76 ? 153 THR A OG1 1 
ATOM   838  C CG2 . THR A 1 173 ? 8.444   -25.465 26.555  1.00 49.23 ? 153 THR A CG2 1 
ATOM   839  N N   . LEU A 1 174 ? 11.710  -22.314 26.112  1.00 41.39 ? 154 LEU A N   1 
ATOM   840  C CA  . LEU A 1 174 ? 13.068  -21.785 26.175  1.00 40.39 ? 154 LEU A CA  1 
ATOM   841  C C   . LEU A 1 174 ? 13.326  -21.292 27.597  1.00 42.43 ? 154 LEU A C   1 
ATOM   842  O O   . LEU A 1 174 ? 14.465  -21.192 28.047  1.00 42.12 ? 154 LEU A O   1 
ATOM   843  C CB  . LEU A 1 174 ? 13.280  -20.650 25.165  1.00 38.68 ? 154 LEU A CB  1 
ATOM   844  C CG  . LEU A 1 174 ? 12.482  -20.665 23.857  1.00 39.67 ? 154 LEU A CG  1 
ATOM   845  C CD1 . LEU A 1 174 ? 12.490  -19.293 23.209  1.00 39.57 ? 154 LEU A CD1 1 
ATOM   846  C CD2 . LEU A 1 174 ? 13.030  -21.697 22.877  1.00 41.34 ? 154 LEU A CD2 1 
ATOM   847  N N   . VAL A 1 183 ? 15.975  -23.200 28.899  1.00 67.73 ? 163 VAL A N   1 
ATOM   848  C CA  . VAL A 1 183 ? 16.239  -24.401 28.115  1.00 68.75 ? 163 VAL A CA  1 
ATOM   849  C C   . VAL A 1 183 ? 15.406  -24.471 26.830  1.00 71.08 ? 163 VAL A C   1 
ATOM   850  O O   . VAL A 1 183 ? 14.187  -24.672 26.885  1.00 68.81 ? 163 VAL A O   1 
ATOM   851  C CB  . VAL A 1 183 ? 15.983  -25.652 28.959  1.00 64.83 ? 163 VAL A CB  1 
ATOM   852  C CG1 . VAL A 1 183 ? 16.113  -26.916 28.121  1.00 63.06 ? 163 VAL A CG1 1 
ATOM   853  C CG2 . VAL A 1 183 ? 16.965  -25.673 30.114  1.00 66.24 ? 163 VAL A CG2 1 
ATOM   854  N N   . VAL A 1 184 ? 16.101  -24.354 25.692  1.00 70.20 ? 164 VAL A N   1 
ATOM   855  C CA  . VAL A 1 184 ? 15.509  -24.295 24.343  1.00 67.98 ? 164 VAL A CA  1 
ATOM   856  C C   . VAL A 1 184 ? 15.172  -25.688 23.777  1.00 66.49 ? 164 VAL A C   1 
ATOM   857  O O   . VAL A 1 184 ? 16.060  -26.384 23.280  1.00 70.35 ? 164 VAL A O   1 
ATOM   858  C CB  . VAL A 1 184 ? 16.480  -23.580 23.359  1.00 66.80 ? 164 VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 184 ? 15.916  -23.532 21.941  1.00 69.81 ? 164 VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 184 ? 16.806  -22.173 23.840  1.00 64.64 ? 164 VAL A CG2 1 
ATOM   861  N N   . VAL A 1 185 ? 13.896  -26.088 23.838  1.00 62.02 ? 165 VAL A N   1 
ATOM   862  C CA  . VAL A 1 185 ? 13.463  -27.409 23.338  1.00 54.24 ? 165 VAL A CA  1 
ATOM   863  C C   . VAL A 1 185 ? 12.073  -27.362 22.701  1.00 51.17 ? 165 VAL A C   1 
ATOM   864  O O   . VAL A 1 185 ? 11.184  -26.655 23.177  1.00 42.70 ? 165 VAL A O   1 
ATOM   865  C CB  . VAL A 1 185 ? 13.467  -28.469 24.464  1.00 53.74 ? 165 VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 185 ? 12.930  -29.811 23.973  1.00 54.35 ? 165 VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 185 ? 14.872  -28.646 25.020  1.00 54.56 ? 165 VAL A CG2 1 
ATOM   868  N N   . GLU A 1 186 ? 11.901  -28.136 21.627  1.00 49.48 ? 166 GLU A N   1 
ATOM   869  C CA  . GLU A 1 186 ? 10.609  -28.278 20.960  1.00 48.76 ? 166 GLU A CA  1 
ATOM   870  C C   . GLU A 1 186 ? 10.083  -29.709 21.097  1.00 48.15 ? 166 GLU A C   1 
ATOM   871  O O   . GLU A 1 186 ? 10.668  -30.643 20.548  1.00 45.07 ? 166 GLU A O   1 
ATOM   872  C CB  . GLU A 1 186 ? 10.750  -27.887 19.491  1.00 49.63 ? 166 GLU A CB  1 
ATOM   873  C CG  . GLU A 1 186 ? 9.663   -28.406 18.552  1.00 52.36 ? 166 GLU A CG  1 
ATOM   874  C CD  . GLU A 1 186 ? 8.374   -27.598 18.588  1.00 52.42 ? 166 GLU A CD  1 
ATOM   875  O OE1 . GLU A 1 186 ? 7.988   -27.074 17.522  1.00 49.48 ? 166 GLU A OE1 1 
ATOM   876  O OE2 . GLU A 1 186 ? 7.739   -27.497 19.663  1.00 52.23 ? 166 GLU A OE2 1 
ATOM   877  N N   . SER A 1 187 ? 8.985   -29.884 21.838  1.00 49.80 ? 167 SER A N   1 
ATOM   878  C CA  . SER A 1 187 ? 8.322   -31.198 21.926  1.00 47.27 ? 167 SER A CA  1 
ATOM   879  C C   . SER A 1 187 ? 7.179   -31.273 20.927  1.00 48.44 ? 167 SER A C   1 
ATOM   880  O O   . SER A 1 187 ? 6.378   -30.340 20.792  1.00 45.05 ? 167 SER A O   1 
ATOM   881  C CB  . SER A 1 187 ? 7.792   -31.492 23.326  1.00 47.10 ? 167 SER A CB  1 
ATOM   882  O OG  . SER A 1 187 ? 7.610   -32.896 23.505  1.00 46.64 ? 167 SER A OG  1 
ATOM   883  N N   . TYR A 1 188 ? 7.133   -32.391 20.214  1.00 48.52 ? 168 TYR A N   1 
ATOM   884  C CA  . TYR A 1 188 ? 6.114   -32.630 19.219  1.00 47.03 ? 168 TYR A CA  1 
ATOM   885  C C   . TYR A 1 188 ? 5.302   -33.857 19.664  1.00 47.05 ? 168 TYR A C   1 
ATOM   886  O O   . TYR A 1 188 ? 5.815   -34.717 20.395  1.00 44.19 ? 168 TYR A O   1 
ATOM   887  C CB  . TYR A 1 188 ? 6.776   -32.854 17.861  1.00 46.06 ? 168 TYR A CB  1 
ATOM   888  C CG  . TYR A 1 188 ? 6.749   -34.287 17.406  1.00 46.55 ? 168 TYR A CG  1 
ATOM   889  C CD1 . TYR A 1 188 ? 5.972   -34.673 16.330  1.00 47.62 ? 168 TYR A CD1 1 
ATOM   890  C CD2 . TYR A 1 188 ? 7.477   -35.262 18.074  1.00 47.76 ? 168 TYR A CD2 1 
ATOM   891  C CE1 . TYR A 1 188 ? 5.920   -35.987 15.921  1.00 48.88 ? 168 TYR A CE1 1 
ATOM   892  C CE2 . TYR A 1 188 ? 7.442   -36.577 17.668  1.00 48.37 ? 168 TYR A CE2 1 
ATOM   893  C CZ  . TYR A 1 188 ? 6.660   -36.931 16.584  1.00 48.46 ? 168 TYR A CZ  1 
ATOM   894  O OH  . TYR A 1 188 ? 6.610   -38.234 16.157  1.00 48.20 ? 168 TYR A OH  1 
ATOM   895  N N   . ILE A 1 189 ? 4.037   -33.910 19.256  1.00 45.06 ? 169 ILE A N   1 
ATOM   896  C CA  . ILE A 1 189 ? 3.208   -35.095 19.465  1.00 46.02 ? 169 ILE A CA  1 
ATOM   897  C C   . ILE A 1 189 ? 2.398   -35.373 18.212  1.00 50.34 ? 169 ILE A C   1 
ATOM   898  O O   . ILE A 1 189 ? 1.870   -34.468 17.578  1.00 50.29 ? 169 ILE A O   1 
ATOM   899  C CB  . ILE A 1 189 ? 2.276   -34.974 20.695  1.00 46.62 ? 169 ILE A CB  1 
ATOM   900  C CG1 . ILE A 1 189 ? 1.607   -36.320 21.001  1.00 44.51 ? 169 ILE A CG1 1 
ATOM   901  C CG2 . ILE A 1 189 ? 1.222   -33.870 20.523  1.00 46.27 ? 169 ILE A CG2 1 
ATOM   902  C CD1 . ILE A 1 189 ? 1.101   -36.426 22.429  1.00 44.55 ? 169 ILE A CD1 1 
ATOM   903  N N   . VAL A 1 190 ? 2.327   -36.639 17.849  1.00 56.70 ? 170 VAL A N   1 
ATOM   904  C CA  . VAL A 1 190 ? 1.639   -37.043 16.648  1.00 60.28 ? 170 VAL A CA  1 
ATOM   905  C C   . VAL A 1 190 ? 0.880   -38.309 16.972  1.00 59.74 ? 170 VAL A C   1 
ATOM   906  O O   . VAL A 1 190 ? 1.500   -39.309 17.358  1.00 58.36 ? 170 VAL A O   1 
ATOM   907  C CB  . VAL A 1 190 ? 2.630   -37.339 15.506  1.00 65.20 ? 170 VAL A CB  1 
ATOM   908  N N   . ASP A 1 191 ? -0.450  -38.246 16.855  1.00 56.61 ? 171 ASP A N   1 
ATOM   909  C CA  . ASP A 1 191 ? -1.275  -39.438 16.917  1.00 53.12 ? 171 ASP A CA  1 
ATOM   910  C C   . ASP A 1 191 ? -0.538  -40.441 16.070  1.00 53.74 ? 171 ASP A C   1 
ATOM   911  O O   . ASP A 1 191 ? -0.506  -40.327 14.834  1.00 54.50 ? 171 ASP A O   1 
ATOM   912  C CB  . ASP A 1 191 ? -2.676  -39.197 16.359  1.00 52.62 ? 171 ASP A CB  1 
ATOM   913  N N   . VAL A 1 192 ? 0.065   -41.410 16.759  1.00 50.80 ? 172 VAL A N   1 
ATOM   914  C CA  . VAL A 1 192 ? 1.102   -42.271 16.207  1.00 49.62 ? 172 VAL A CA  1 
ATOM   915  C C   . VAL A 1 192 ? 0.869   -42.727 14.784  1.00 45.80 ? 172 VAL A C   1 
ATOM   916  O O   . VAL A 1 192 ? 1.829   -42.897 14.052  1.00 42.32 ? 172 VAL A O   1 
ATOM   917  C CB  . VAL A 1 192 ? 1.298   -43.525 17.078  1.00 55.08 ? 172 VAL A CB  1 
ATOM   918  N N   . PRO A 1 193 ? -0.398  -42.975 14.405  1.00 48.95 ? 173 PRO A N   1 
ATOM   919  C CA  . PRO A 1 193 ? -0.670  -43.460 13.054  1.00 47.82 ? 173 PRO A CA  1 
ATOM   920  C C   . PRO A 1 193 ? -1.254  -42.426 12.081  1.00 48.18 ? 173 PRO A C   1 
ATOM   921  O O   . PRO A 1 193 ? -2.314  -41.840 12.333  1.00 44.66 ? 173 PRO A O   1 
ATOM   922  C CB  . PRO A 1 193 ? -1.689  -44.598 13.293  1.00 47.09 ? 173 PRO A CB  1 
ATOM   923  C CG  . PRO A 1 193 ? -1.835  -44.720 14.784  1.00 47.80 ? 173 PRO A CG  1 
ATOM   924  C CD  . PRO A 1 193 ? -1.503  -43.356 15.301  1.00 49.05 ? 173 PRO A CD  1 
ATOM   925  N N   . PRO A 1 194 ? -0.535  -42.191 10.979  1.00 49.38 ? 174 PRO A N   1 
ATOM   926  C CA  . PRO A 1 194 ? -1.047  -41.692 9.725   1.00 50.56 ? 174 PRO A CA  1 
ATOM   927  C C   . PRO A 1 194 ? -1.517  -42.818 8.814   1.00 51.86 ? 174 PRO A C   1 
ATOM   928  O O   . PRO A 1 194 ? -1.513  -42.651 7.598   1.00 53.33 ? 174 PRO A O   1 
ATOM   929  C CB  . PRO A 1 194 ? 0.185   -41.031 9.096   1.00 49.88 ? 174 PRO A CB  1 
ATOM   930  C CG  . PRO A 1 194 ? 1.078   -40.742 10.236  1.00 51.13 ? 174 PRO A CG  1 
ATOM   931  C CD  . PRO A 1 194 ? 0.911   -41.961 11.067  1.00 52.16 ? 174 PRO A CD  1 
ATOM   932  N N   . GLY A 1 195 ? -1.920  -43.949 9.388   1.00 57.66 ? 175 GLY A N   1 
ATOM   933  C CA  . GLY A 1 195 ? -2.183  -45.160 8.601   1.00 63.04 ? 175 GLY A CA  1 
ATOM   934  C C   . GLY A 1 195 ? -0.936  -45.523 7.823   1.00 61.74 ? 175 GLY A C   1 
ATOM   935  O O   . GLY A 1 195 ? -0.953  -45.591 6.595   1.00 61.71 ? 175 GLY A O   1 
ATOM   936  N N   . ASN A 1 196 ? 0.155   -45.711 8.556   1.00 61.20 ? 176 ASN A N   1 
ATOM   937  C CA  . ASN A 1 196 ? 1.470   -45.912 7.966   1.00 60.62 ? 176 ASN A CA  1 
ATOM   938  C C   . ASN A 1 196 ? 2.412   -46.482 9.029   1.00 54.95 ? 176 ASN A C   1 
ATOM   939  O O   . ASN A 1 196 ? 1.951   -47.145 9.966   1.00 50.63 ? 176 ASN A O   1 
ATOM   940  C CB  . ASN A 1 196 ? 1.998   -44.592 7.390   1.00 63.57 ? 176 ASN A CB  1 
ATOM   941  C CG  . ASN A 1 196 ? 2.944   -44.799 6.221   1.00 67.68 ? 176 ASN A CG  1 
ATOM   942  O OD1 . ASN A 1 196 ? 2.713   -44.279 5.129   0.50 72.16 ? 176 ASN A OD1 1 
ATOM   943  N N   . THR A 1 197 ? 3.714   -46.245 8.885   1.00 52.37 ? 177 THR A N   1 
ATOM   944  C CA  . THR A 1 197 ? 4.709   -46.812 9.804   1.00 52.52 ? 177 THR A CA  1 
ATOM   945  C C   . THR A 1 197 ? 4.759   -45.986 11.095  1.00 50.30 ? 177 THR A C   1 
ATOM   946  O O   . THR A 1 197 ? 3.830   -45.235 11.380  1.00 48.40 ? 177 THR A O   1 
ATOM   947  C CB  . THR A 1 197 ? 6.092   -46.888 9.124   1.00 50.51 ? 177 THR A CB  1 
ATOM   948  O OG1 . THR A 1 197 ? 6.187   -45.862 8.131   1.00 55.07 ? 177 THR A OG1 1 
ATOM   949  C CG2 . THR A 1 197 ? 6.272   -48.214 8.442   1.00 52.30 ? 177 THR A CG2 1 
ATOM   950  N N   . GLU A 1 198 ? 5.805   -46.183 11.893  1.00 49.45 ? 178 GLU A N   1 
ATOM   951  C CA  . GLU A 1 198 ? 6.111   -45.314 13.032  1.00 48.32 ? 178 GLU A CA  1 
ATOM   952  C C   . GLU A 1 198 ? 7.555   -44.831 13.029  1.00 48.41 ? 178 GLU A C   1 
ATOM   953  O O   . GLU A 1 198 ? 7.847   -43.816 13.649  1.00 48.11 ? 178 GLU A O   1 
ATOM   954  C CB  . GLU A 1 198 ? 5.833   -46.034 14.354  1.00 48.10 ? 178 GLU A CB  1 
ATOM   955  N N   . GLU A 1 199 ? 8.447   -45.529 12.317  1.00 46.84 ? 179 GLU A N   1 
ATOM   956  C CA  . GLU A 1 199 ? 9.872   -45.168 12.274  1.00 46.74 ? 179 GLU A CA  1 
ATOM   957  C C   . GLU A 1 199 ? 10.082  -44.084 11.213  1.00 48.85 ? 179 GLU A C   1 
ATOM   958  O O   . GLU A 1 199 ? 11.208  -43.794 10.823  1.00 50.64 ? 179 GLU A O   1 
ATOM   959  C CB  . GLU A 1 199 ? 10.754  -46.386 11.958  1.00 46.41 ? 179 GLU A CB  1 
ATOM   960  C CG  . GLU A 1 199 ? 10.109  -47.759 12.191  1.00 48.12 ? 179 GLU A CG  1 
ATOM   961  C CD  . GLU A 1 199 ? 9.660   -47.999 13.633  1.00 45.78 ? 179 GLU A CD  1 
ATOM   962  O OE1 . GLU A 1 199 ? 10.531  -48.267 14.486  1.00 44.87 ? 179 GLU A OE1 1 
ATOM   963  O OE2 . GLU A 1 199 ? 8.440   -47.924 13.917  1.00 44.05 ? 179 GLU A OE2 1 
ATOM   964  N N   . GLU A 1 200 ? 8.962   -43.527 10.750  1.00 50.59 ? 180 GLU A N   1 
ATOM   965  C CA  . GLU A 1 200 ? 8.854   -42.625 9.601   1.00 49.49 ? 180 GLU A CA  1 
ATOM   966  C C   . GLU A 1 200 ? 8.043   -41.400 9.993   1.00 50.18 ? 180 GLU A C   1 
ATOM   967  O O   . GLU A 1 200 ? 8.385   -40.273 9.649   1.00 52.73 ? 180 GLU A O   1 
ATOM   968  C CB  . GLU A 1 200 ? 8.100   -43.328 8.461   1.00 46.45 ? 180 GLU A CB  1 
ATOM   969  C CG  . GLU A 1 200 ? 8.951   -44.256 7.598   1.00 47.52 ? 180 GLU A CG  1 
ATOM   970  C CD  . GLU A 1 200 ? 9.245   -45.589 8.247   1.00 42.82 ? 180 GLU A CD  1 
ATOM   971  O OE1 . GLU A 1 200 ? 9.114   -45.684 9.474   1.00 45.09 ? 180 GLU A OE1 1 
ATOM   972  O OE2 . GLU A 1 200 ? 9.585   -46.548 7.533   1.00 38.64 ? 180 GLU A OE2 1 
ATOM   973  N N   . THR A 1 201 ? 6.926   -41.648 10.668  1.00 49.43 ? 181 THR A N   1 
ATOM   974  C CA  . THR A 1 201 ? 6.102   -40.600 11.256  1.00 48.41 ? 181 THR A CA  1 
ATOM   975  C C   . THR A 1 201 ? 6.941   -39.703 12.174  1.00 51.52 ? 181 THR A C   1 
ATOM   976  O O   . THR A 1 201 ? 6.840   -38.469 12.127  1.00 56.71 ? 181 THR A O   1 
ATOM   977  C CB  . THR A 1 201 ? 4.917   -41.228 12.019  1.00 46.08 ? 181 THR A CB  1 
ATOM   978  O OG1 . THR A 1 201 ? 3.892   -41.596 11.082  1.00 43.28 ? 181 THR A OG1 1 
ATOM   979  C CG2 . THR A 1 201 ? 4.346   -40.265 13.044  1.00 48.01 ? 181 THR A CG2 1 
ATOM   980  N N   . LEU A 1 202 ? 7.759   -40.326 13.015  1.00 48.70 ? 182 LEU A N   1 
ATOM   981  C CA  . LEU A 1 202 ? 8.700   -39.585 13.829  1.00 47.88 ? 182 LEU A CA  1 
ATOM   982  C C   . LEU A 1 202 ? 9.726   -38.887 12.937  1.00 47.38 ? 182 LEU A C   1 
ATOM   983  O O   . LEU A 1 202 ? 9.937   -37.691 13.073  1.00 50.52 ? 182 LEU A O   1 
ATOM   984  C CB  . LEU A 1 202 ? 9.421   -40.500 14.824  1.00 50.72 ? 182 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 202 ? 8.697   -40.984 16.088  1.00 51.07 ? 182 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 202 ? 7.545   -41.924 15.776  1.00 51.91 ? 182 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 202 ? 9.705   -41.691 16.977  1.00 49.67 ? 182 LEU A CD2 1 
ATOM   988  N N   . SER A 1 203 ? 10.336  -39.626 12.010  1.00 46.07 ? 183 SER A N   1 
ATOM   989  C CA  . SER A 1 203 ? 11.473  -39.126 11.231  1.00 44.95 ? 183 SER A CA  1 
ATOM   990  C C   . SER A 1 203 ? 11.067  -38.098 10.177  1.00 46.15 ? 183 SER A C   1 
ATOM   991  O O   . SER A 1 203 ? 11.839  -37.199 9.860   1.00 42.33 ? 183 SER A O   1 
ATOM   992  C CB  . SER A 1 203 ? 12.253  -40.283 10.583  1.00 44.82 ? 183 SER A CB  1 
ATOM   993  O OG  . SER A 1 203 ? 11.861  -40.496 9.243   1.00 42.55 ? 183 SER A OG  1 
ATOM   994  N N   . PHE A 1 204 ? 9.861   -38.248 9.633   1.00 51.17 ? 184 PHE A N   1 
ATOM   995  C CA  . PHE A 1 204 ? 9.296   -37.267 8.711   1.00 53.86 ? 184 PHE A CA  1 
ATOM   996  C C   . PHE A 1 204 ? 9.214   -35.903 9.389   1.00 51.11 ? 184 PHE A C   1 
ATOM   997  O O   . PHE A 1 204 ? 9.761   -34.910 8.883   1.00 49.05 ? 184 PHE A O   1 
ATOM   998  C CB  . PHE A 1 204 ? 7.896   -37.697 8.235   1.00 58.28 ? 184 PHE A CB  1 
ATOM   999  C CG  . PHE A 1 204 ? 7.217   -36.683 7.344   1.00 61.85 ? 184 PHE A CG  1 
ATOM   1000 C CD1 . PHE A 1 204 ? 7.677   -36.464 6.048   1.00 61.15 ? 184 PHE A CD1 1 
ATOM   1001 C CD2 . PHE A 1 204 ? 6.134   -35.938 7.800   1.00 63.84 ? 184 PHE A CD2 1 
ATOM   1002 C CE1 . PHE A 1 204 ? 7.074   -35.524 5.227   1.00 62.02 ? 184 PHE A CE1 1 
ATOM   1003 C CE2 . PHE A 1 204 ? 5.520   -34.997 6.977   1.00 64.98 ? 184 PHE A CE2 1 
ATOM   1004 C CZ  . PHE A 1 204 ? 5.992   -34.791 5.690   1.00 63.20 ? 184 PHE A CZ  1 
ATOM   1005 N N   . VAL A 1 205 ? 8.537   -35.861 10.535  1.00 48.89 ? 185 VAL A N   1 
ATOM   1006 C CA  . VAL A 1 205 ? 8.360   -34.600 11.260  1.00 48.05 ? 185 VAL A CA  1 
ATOM   1007 C C   . VAL A 1 205 ? 9.616   -34.186 12.028  1.00 44.21 ? 185 VAL A C   1 
ATOM   1008 O O   . VAL A 1 205 ? 10.152  -33.113 11.774  1.00 47.89 ? 185 VAL A O   1 
ATOM   1009 C CB  . VAL A 1 205 ? 7.096   -34.595 12.149  1.00 47.85 ? 185 VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 205 ? 7.216   -33.604 13.303  1.00 48.88 ? 185 VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 205 ? 5.878   -34.243 11.309  1.00 47.45 ? 185 VAL A CG2 1 
ATOM   1012 N N   . ASP A 1 206 ? 10.102  -35.021 12.939  1.00 40.53 ? 186 ASP A N   1 
ATOM   1013 C CA  . ASP A 1 206 ? 11.293  -34.669 13.734  1.00 38.37 ? 186 ASP A CA  1 
ATOM   1014 C C   . ASP A 1 206 ? 12.386  -33.982 12.903  1.00 37.66 ? 186 ASP A C   1 
ATOM   1015 O O   . ASP A 1 206 ? 13.126  -33.151 13.419  1.00 41.60 ? 186 ASP A O   1 
ATOM   1016 C CB  . ASP A 1 206 ? 11.867  -35.899 14.455  1.00 37.57 ? 186 ASP A CB  1 
ATOM   1017 C CG  . ASP A 1 206 ? 11.070  -36.279 15.707  1.00 36.55 ? 186 ASP A CG  1 
ATOM   1018 O OD1 . ASP A 1 206 ? 9.869   -36.598 15.602  1.00 31.10 ? 186 ASP A OD1 1 
ATOM   1019 O OD2 . ASP A 1 206 ? 11.666  -36.268 16.806  1.00 40.24 ? 186 ASP A OD2 1 
ATOM   1020 N N   . THR A 1 207 ? 12.485  -34.334 11.625  1.00 37.50 ? 187 THR A N   1 
ATOM   1021 C CA  . THR A 1 207 ? 13.343  -33.642 10.677  1.00 36.47 ? 187 THR A CA  1 
ATOM   1022 C C   . THR A 1 207 ? 12.787  -32.273 10.323  1.00 39.08 ? 187 THR A C   1 
ATOM   1023 O O   . THR A 1 207 ? 13.527  -31.281 10.277  1.00 42.21 ? 187 THR A O   1 
ATOM   1024 C CB  . THR A 1 207 ? 13.461  -34.439 9.374   1.00 37.00 ? 187 THR A CB  1 
ATOM   1025 O OG1 . THR A 1 207 ? 13.839  -35.787 9.677   1.00 36.70 ? 187 THR A OG1 1 
ATOM   1026 C CG2 . THR A 1 207 ? 14.507  -33.807 8.423   1.00 38.23 ? 187 THR A CG2 1 
ATOM   1027 N N   . ILE A 1 208 ? 11.492  -32.224 10.031  1.00 38.38 ? 188 ILE A N   1 
ATOM   1028 C CA  . ILE A 1 208 ? 10.810  -30.955 9.778   1.00 38.86 ? 188 ILE A CA  1 
ATOM   1029 C C   . ILE A 1 208 ? 11.073  -30.052 10.971  1.00 40.47 ? 188 ILE A C   1 
ATOM   1030 O O   . ILE A 1 208 ? 11.614  -28.954 10.814  1.00 41.09 ? 188 ILE A O   1 
ATOM   1031 C CB  . ILE A 1 208 ? 9.304   -31.178 9.501   1.00 39.89 ? 188 ILE A CB  1 
ATOM   1032 C CG1 . ILE A 1 208 ? 9.090   -31.343 7.993   1.00 39.94 ? 188 ILE A CG1 1 
ATOM   1033 C CG2 . ILE A 1 208 ? 8.441   -30.039 10.022  1.00 40.65 ? 188 ILE A CG2 1 
ATOM   1034 C CD1 . ILE A 1 208 ? 7.754   -31.941 7.615   1.00 42.25 ? 188 ILE A CD1 1 
ATOM   1035 N N   . VAL A 1 209 ? 10.732  -30.543 12.162  1.00 38.76 ? 189 VAL A N   1 
ATOM   1036 C CA  . VAL A 1 209 ? 11.098  -29.886 13.412  1.00 37.45 ? 189 VAL A CA  1 
ATOM   1037 C C   . VAL A 1 209 ? 12.544  -29.450 13.324  1.00 38.75 ? 189 VAL A C   1 
ATOM   1038 O O   . VAL A 1 209 ? 12.869  -28.298 13.578  1.00 38.40 ? 189 VAL A O   1 
ATOM   1039 C CB  . VAL A 1 209 ? 10.999  -30.848 14.623  1.00 36.61 ? 189 VAL A CB  1 
ATOM   1040 C CG1 . VAL A 1 209 ? 11.525  -30.193 15.899  1.00 35.98 ? 189 VAL A CG1 1 
ATOM   1041 C CG2 . VAL A 1 209 ? 9.575   -31.342 14.821  1.00 37.12 ? 189 VAL A CG2 1 
ATOM   1042 N N   . ARG A 1 210 ? 13.411  -30.399 12.995  1.00 40.16 ? 190 ARG A N   1 
ATOM   1043 C CA  . ARG A 1 210 ? 14.841  -30.160 13.035  1.00 44.63 ? 190 ARG A CA  1 
ATOM   1044 C C   . ARG A 1 210 ? 15.154  -28.902 12.246  1.00 44.84 ? 190 ARG A C   1 
ATOM   1045 O O   . ARG A 1 210 ? 15.856  -28.016 12.735  1.00 44.56 ? 190 ARG A O   1 
ATOM   1046 C CB  . ARG A 1 210 ? 15.624  -31.371 12.485  1.00 45.71 ? 190 ARG A CB  1 
ATOM   1047 C CG  . ARG A 1 210 ? 17.139  -31.224 12.540  1.00 47.12 ? 190 ARG A CG  1 
ATOM   1048 C CD  . ARG A 1 210 ? 17.842  -32.210 11.606  1.00 48.70 ? 190 ARG A CD  1 
ATOM   1049 N NE  . ARG A 1 210 ? 18.243  -33.450 12.276  1.00 50.56 ? 190 ARG A NE  1 
ATOM   1050 C CZ  . ARG A 1 210 ? 18.715  -34.527 11.649  1.00 53.40 ? 190 ARG A CZ  1 
ATOM   1051 N NH1 . ARG A 1 210 ? 18.847  -34.533 10.322  1.00 52.40 ? 190 ARG A NH1 1 
ATOM   1052 N NH2 . ARG A 1 210 ? 19.050  -35.617 12.348  1.00 54.32 ? 190 ARG A NH2 1 
ATOM   1053 N N   . CYS A 1 211 ? 14.609  -28.819 11.035  1.00 47.13 ? 191 CYS A N   1 
ATOM   1054 C CA  . CYS A 1 211 ? 14.990  -27.749 10.111  1.00 47.44 ? 191 CYS A CA  1 
ATOM   1055 C C   . CYS A 1 211 ? 14.629  -26.402 10.682  1.00 46.65 ? 191 CYS A C   1 
ATOM   1056 O O   . CYS A 1 211 ? 15.397  -25.453 10.552  1.00 54.51 ? 191 CYS A O   1 
ATOM   1057 C CB  . CYS A 1 211 ? 14.308  -27.902 8.756   1.00 46.53 ? 191 CYS A CB  1 
ATOM   1058 S SG  . CYS A 1 211 ? 14.888  -29.288 7.773   1.00 48.95 ? 191 CYS A SG  1 
ATOM   1059 N N   . ASN A 1 212 ? 13.452  -26.324 11.299  1.00 45.10 ? 192 ASN A N   1 
ATOM   1060 C CA  . ASN A 1 212 ? 12.910  -25.059 11.786  1.00 42.40 ? 192 ASN A CA  1 
ATOM   1061 C C   . ASN A 1 212 ? 13.722  -24.469 12.916  1.00 40.08 ? 192 ASN A C   1 
ATOM   1062 O O   . ASN A 1 212 ? 14.184  -23.350 12.818  1.00 42.75 ? 192 ASN A O   1 
ATOM   1063 C CB  . ASN A 1 212 ? 11.474  -25.241 12.247  1.00 44.93 ? 192 ASN A CB  1 
ATOM   1064 N N   . LEU A 1 213 ? 13.921  -25.229 13.980  1.00 36.40 ? 193 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 213 ? 14.654  -24.732 15.130  1.00 32.90 ? 193 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 213 ? 16.037  -24.397 14.641  1.00 35.04 ? 193 LEU A C   1 
ATOM   1067 O O   . LEU A 1 213 ? 16.641  -23.448 15.088  1.00 38.44 ? 193 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 213 ? 14.695  -25.763 16.260  1.00 31.04 ? 193 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 213 ? 13.415  -26.031 17.065  1.00 30.03 ? 193 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 213 ? 12.996  -24.870 17.947  1.00 29.95 ? 193 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 213 ? 12.252  -26.400 16.170  1.00 30.99 ? 193 LEU A CD2 1 
ATOM   1072 N N   . GLN A 1 214 ? 16.552  -25.180 13.703  1.00 41.83 ? 194 GLN A N   1 
ATOM   1073 C CA  . GLN A 1 214 ? 17.821  -24.818 13.044  1.00 43.79 ? 194 GLN A CA  1 
ATOM   1074 C C   . GLN A 1 214 ? 17.685  -23.486 12.284  1.00 42.38 ? 194 GLN A C   1 
ATOM   1075 O O   . GLN A 1 214 ? 18.609  -22.652 12.284  1.00 41.62 ? 194 GLN A O   1 
ATOM   1076 C CB  . GLN A 1 214 ? 18.306  -25.919 12.102  1.00 40.69 ? 194 GLN A CB  1 
ATOM   1077 C CG  . GLN A 1 214 ? 19.747  -25.684 11.662  1.00 41.95 ? 194 GLN A CG  1 
ATOM   1078 C CD  . GLN A 1 214 ? 20.338  -26.847 10.897  1.00 40.01 ? 194 GLN A CD  1 
ATOM   1079 O OE1 . GLN A 1 214 ? 21.357  -27.414 11.299  1.00 37.01 ? 194 GLN A OE1 1 
ATOM   1080 N NE2 . GLN A 1 214 ? 19.699  -27.210 9.786   1.00 39.94 ? 194 GLN A NE2 1 
ATOM   1081 N N   . SER A 1 215 ? 16.524  -23.308 11.658  1.00 40.54 ? 195 SER A N   1 
ATOM   1082 C CA  . SER A 1 215 ? 16.126  -22.013 11.086  1.00 43.03 ? 195 SER A CA  1 
ATOM   1083 C C   . SER A 1 215 ? 15.841  -20.907 12.135  1.00 41.60 ? 195 SER A C   1 
ATOM   1084 O O   . SER A 1 215 ? 16.086  -19.729 11.876  1.00 42.06 ? 195 SER A O   1 
ATOM   1085 C CB  . SER A 1 215 ? 14.938  -22.194 10.142  1.00 41.18 ? 195 SER A CB  1 
ATOM   1086 O OG  . SER A 1 215 ? 15.335  -22.876 8.950   1.00 39.13 ? 195 SER A OG  1 
ATOM   1087 N N   . LEU A 1 216 ? 15.327  -21.285 13.303  1.00 40.06 ? 196 LEU A N   1 
ATOM   1088 C CA  . LEU A 1 216 ? 15.260  -20.372 14.447  1.00 40.69 ? 196 LEU A CA  1 
ATOM   1089 C C   . LEU A 1 216 ? 16.656  -19.841 14.714  1.00 41.74 ? 196 LEU A C   1 
ATOM   1090 O O   . LEU A 1 216 ? 16.897  -18.640 14.638  1.00 38.63 ? 196 LEU A O   1 
ATOM   1091 C CB  . LEU A 1 216 ? 14.703  -21.069 15.708  1.00 38.62 ? 196 LEU A CB  1 
ATOM   1092 C CG  . LEU A 1 216 ? 14.826  -20.386 17.080  1.00 37.93 ? 196 LEU A CG  1 
ATOM   1093 C CD1 . LEU A 1 216 ? 14.337  -18.945 17.093  1.00 38.67 ? 196 LEU A CD1 1 
ATOM   1094 C CD2 . LEU A 1 216 ? 14.057  -21.184 18.117  1.00 38.83 ? 196 LEU A CD2 1 
ATOM   1095 N N   . ALA A 1 217 ? 17.581  -20.758 14.982  1.00 46.97 ? 197 ALA A N   1 
ATOM   1096 C CA  . ALA A 1 217 ? 18.947  -20.399 15.346  1.00 45.94 ? 197 ALA A CA  1 
ATOM   1097 C C   . ALA A 1 217 ? 19.539  -19.401 14.371  1.00 46.38 ? 197 ALA A C   1 
ATOM   1098 O O   . ALA A 1 217 ? 19.969  -18.339 14.783  1.00 47.40 ? 197 ALA A O   1 
ATOM   1099 C CB  . ALA A 1 217 ? 19.812  -21.641 15.436  1.00 45.69 ? 197 ALA A CB  1 
ATOM   1100 N N   . ARG A 1 218 ? 19.530  -19.716 13.079  1.00 48.62 ? 198 ARG A N   1 
ATOM   1101 C CA  . ARG A 1 218 ? 20.186  -18.839 12.102  1.00 49.55 ? 198 ARG A CA  1 
ATOM   1102 C C   . ARG A 1 218 ? 19.806  -17.375 12.282  1.00 50.22 ? 198 ARG A C   1 
ATOM   1103 O O   . ARG A 1 218 ? 20.682  -16.520 12.429  1.00 53.02 ? 198 ARG A O   1 
ATOM   1104 C CB  . ARG A 1 218 ? 19.909  -19.261 10.645  1.00 48.70 ? 198 ARG A CB  1 
ATOM   1105 C CG  . ARG A 1 218 ? 18.435  -19.372 10.235  1.00 48.34 ? 198 ARG A CG  1 
ATOM   1106 C CD  . ARG A 1 218 ? 18.275  -19.578 8.732   1.00 47.50 ? 198 ARG A CD  1 
ATOM   1107 N NE  . ARG A 1 218 ? 17.088  -20.345 8.338   1.00 46.72 ? 198 ARG A NE  1 
ATOM   1108 C CZ  . ARG A 1 218 ? 15.915  -19.837 7.948   1.00 45.55 ? 198 ARG A CZ  1 
ATOM   1109 N NH1 . ARG A 1 218 ? 15.691  -18.526 7.903   1.00 44.87 ? 198 ARG A NH1 1 
ATOM   1110 N NH2 . ARG A 1 218 ? 14.936  -20.661 7.607   1.00 46.88 ? 198 ARG A NH2 1 
ATOM   1111 N N   . SER A 1 219 ? 18.499  -17.111 12.302  1.00 52.70 ? 199 SER A N   1 
ATOM   1112 C CA  . SER A 1 219 ? 17.945  -15.759 12.151  1.00 52.81 ? 199 SER A CA  1 
ATOM   1113 C C   . SER A 1 219 ? 18.235  -14.850 13.341  1.00 55.93 ? 199 SER A C   1 
ATOM   1114 O O   . SER A 1 219 ? 18.082  -13.613 13.248  1.00 60.55 ? 199 SER A O   1 
ATOM   1115 C CB  . SER A 1 219 ? 16.442  -15.832 11.936  1.00 52.41 ? 199 SER A CB  1 
ATOM   1116 O OG  . SER A 1 219 ? 16.155  -16.377 10.664  1.00 57.56 ? 199 SER A OG  1 
ATOM   1117 N N   . THR A 1 220 ? 18.623  -15.461 14.457  1.00 50.49 ? 200 THR A N   1 
ATOM   1118 C CA  . THR A 1 220 ? 19.172  -14.722 15.574  1.00 49.46 ? 200 THR A CA  1 
ATOM   1119 C C   . THR A 1 220 ? 20.670  -15.018 15.644  1.00 52.46 ? 200 THR A C   1 
ATOM   1120 O O   . THR A 1 220 ? 21.125  -16.092 15.216  1.00 53.90 ? 200 THR A O   1 
ATOM   1121 C CB  . THR A 1 220 ? 18.436  -15.025 16.888  1.00 49.41 ? 200 THR A CB  1 
ATOM   1122 O OG1 . THR A 1 220 ? 19.147  -14.432 17.981  1.00 48.97 ? 200 THR A OG1 1 
ATOM   1123 C CG2 . THR A 1 220 ? 18.276  -16.522 17.115  1.00 50.04 ? 200 THR A CG2 1 
ATOM   1124 N N   . ASN A 1 221 ? 21.448  -14.065 16.157  1.00 51.45 ? 201 ASN A N   1 
ATOM   1125 C CA  . ASN A 1 221 ? 22.912  -14.180 16.108  1.00 51.51 ? 201 ASN A CA  1 
ATOM   1126 C C   . ASN A 1 221 ? 23.454  -15.138 17.167  1.00 54.94 ? 201 ASN A C   1 
ATOM   1127 O O   . ASN A 1 221 ? 24.338  -14.793 17.946  1.00 60.16 ? 201 ASN A O   1 
ATOM   1128 C CB  . ASN A 1 221 ? 23.577  -12.804 16.208  1.00 49.97 ? 201 ASN A CB  1 
ATOM   1129 C CG  . ASN A 1 221 ? 24.931  -12.745 15.514  1.00 49.19 ? 201 ASN A CG  1 
ATOM   1130 O OD1 . ASN A 1 221 ? 25.913  -12.262 16.083  1.00 50.59 ? 201 ASN A OD1 1 
ATOM   1131 N ND2 . ASN A 1 221 ? 24.984  -13.201 14.274  1.00 47.56 ? 201 ASN A ND2 1 
ATOM   1132 N N   . ARG A 1 222 ? 22.902  -16.350 17.186  1.00 56.44 ? 202 ARG A N   1 
ATOM   1133 C CA  . ARG A 1 222 ? 23.523  -17.473 17.873  1.00 55.11 ? 202 ARG A CA  1 
ATOM   1134 C C   . ARG A 1 222 ? 24.803  -17.846 17.146  1.00 52.85 ? 202 ARG A C   1 
ATOM   1135 O O   . ARG A 1 222 ? 25.819  -18.124 17.772  1.00 56.61 ? 202 ARG A O   1 
ATOM   1136 C CB  . ARG A 1 222 ? 22.583  -18.672 17.874  1.00 54.37 ? 202 ARG A CB  1 
ATOM   1137 N N   . GLN A 1 223 ? 24.732  -17.856 15.817  1.00 51.97 ? 203 GLN A N   1 
ATOM   1138 C CA  . GLN A 1 223 ? 25.891  -18.107 14.961  1.00 52.15 ? 203 GLN A CA  1 
ATOM   1139 C C   . GLN A 1 223 ? 25.585  -17.784 13.497  1.00 50.62 ? 203 GLN A C   1 
ATOM   1140 O O   . GLN A 1 223 ? 25.065  -18.631 12.757  1.00 48.57 ? 203 GLN A O   1 
ATOM   1141 C CB  . GLN A 1 223 ? 26.340  -19.566 15.082  1.00 53.39 ? 203 GLN A CB  1 
ATOM   1142 N N   . THR B 1 56  ? 10.422  12.835  30.290  1.00 46.97 ? 36  THR B N   1 
ATOM   1143 C CA  . THR B 1 56  ? 11.791  12.521  29.774  1.00 48.25 ? 36  THR B CA  1 
ATOM   1144 C C   . THR B 1 56  ? 12.466  13.794  29.258  1.00 52.99 ? 36  THR B C   1 
ATOM   1145 O O   . THR B 1 56  ? 11.849  14.876  29.261  1.00 49.17 ? 36  THR B O   1 
ATOM   1146 C CB  . THR B 1 56  ? 11.798  11.505  28.597  1.00 47.53 ? 36  THR B CB  1 
ATOM   1147 O OG1 . THR B 1 56  ? 11.526  12.202  27.375  1.00 46.86 ? 36  THR B OG1 1 
ATOM   1148 C CG2 . THR B 1 56  ? 10.789  10.342  28.797  1.00 47.22 ? 36  THR B CG2 1 
ATOM   1149 N N   . ARG B 1 57  ? 13.727  13.627  28.816  1.00 54.63 ? 37  ARG B N   1 
ATOM   1150 C CA  . ARG B 1 57  ? 14.564  14.681  28.231  1.00 54.12 ? 37  ARG B CA  1 
ATOM   1151 C C   . ARG B 1 57  ? 14.048  15.083  26.856  1.00 55.29 ? 37  ARG B C   1 
ATOM   1152 O O   . ARG B 1 57  ? 14.468  14.504  25.842  1.00 53.76 ? 37  ARG B O   1 
ATOM   1153 C CB  . ARG B 1 57  ? 15.996  14.177  28.059  1.00 54.79 ? 37  ARG B CB  1 
ATOM   1154 C CG  . ARG B 1 57  ? 16.699  13.754  29.337  1.00 56.72 ? 37  ARG B CG  1 
ATOM   1155 C CD  . ARG B 1 57  ? 17.523  12.497  29.107  1.00 55.83 ? 37  ARG B CD  1 
ATOM   1156 N NE  . ARG B 1 57  ? 18.770  12.493  29.861  1.00 55.32 ? 37  ARG B NE  1 
ATOM   1157 C CZ  . ARG B 1 57  ? 19.693  11.543  29.765  1.00 54.39 ? 37  ARG B CZ  1 
ATOM   1158 N NH1 . ARG B 1 57  ? 19.503  10.507  28.952  1.00 55.91 ? 37  ARG B NH1 1 
ATOM   1159 N NH2 . ARG B 1 57  ? 20.808  11.625  30.480  1.00 51.26 ? 37  ARG B NH2 1 
ATOM   1160 N N   . GLY B 1 58  ? 13.178  16.098  26.828  1.00 52.67 ? 38  GLY B N   1 
ATOM   1161 C CA  . GLY B 1 58  ? 12.381  16.437  25.642  1.00 54.42 ? 38  GLY B CA  1 
ATOM   1162 C C   . GLY B 1 58  ? 12.963  16.038  24.299  1.00 57.33 ? 38  GLY B C   1 
ATOM   1163 O O   . GLY B 1 58  ? 12.418  15.203  23.582  1.00 52.74 ? 38  GLY B O   1 
ATOM   1164 N N   . MET B 1 59  ? 14.103  16.625  23.977  1.00 68.84 ? 39  MET B N   1 
ATOM   1165 C CA  . MET B 1 59  ? 14.688  16.482  22.654  1.00 72.38 ? 39  MET B CA  1 
ATOM   1166 C C   . MET B 1 59  ? 15.641  15.292  22.672  1.00 73.95 ? 39  MET B C   1 
ATOM   1167 O O   . MET B 1 59  ? 16.847  15.424  22.929  1.00 69.26 ? 39  MET B O   1 
ATOM   1168 C CB  . MET B 1 59  ? 15.375  17.792  22.266  1.00 74.58 ? 39  MET B CB  1 
ATOM   1169 C CG  . MET B 1 59  ? 14.429  18.992  22.357  1.00 77.44 ? 39  MET B CG  1 
ATOM   1170 S SD  . MET B 1 59  ? 15.189  20.567  22.803  1.00 83.51 ? 39  MET B SD  1 
ATOM   1171 C CE  . MET B 1 59  ? 16.210  20.083  24.197  1.00 85.28 ? 39  MET B CE  1 
ATOM   1172 N N   . HIS B 1 60  ? 15.063  14.120  22.412  1.00 73.98 ? 40  HIS B N   1 
ATOM   1173 C CA  . HIS B 1 60  ? 15.781  12.852  22.482  1.00 71.41 ? 40  HIS B CA  1 
ATOM   1174 C C   . HIS B 1 60  ? 16.270  12.413  21.100  1.00 70.15 ? 40  HIS B C   1 
ATOM   1175 O O   . HIS B 1 60  ? 15.545  12.506  20.095  1.00 67.05 ? 40  HIS B O   1 
ATOM   1176 C CB  . HIS B 1 60  ? 14.871  11.772  23.076  1.00 73.90 ? 40  HIS B CB  1 
ATOM   1177 N N   . VAL B 1 61  ? 17.508  11.933  21.065  1.00 65.28 ? 41  VAL B N   1 
ATOM   1178 C CA  . VAL B 1 61  ? 18.115  11.405  19.851  1.00 59.65 ? 41  VAL B CA  1 
ATOM   1179 C C   . VAL B 1 61  ? 19.519  10.961  20.203  1.00 55.84 ? 41  VAL B C   1 
ATOM   1180 O O   . VAL B 1 61  ? 20.249  11.725  20.828  1.00 49.78 ? 41  VAL B O   1 
ATOM   1181 C CB  . VAL B 1 61  ? 18.231  12.469  18.750  1.00 64.09 ? 41  VAL B CB  1 
ATOM   1182 N N   . PRO B 1 62  ? 19.895  9.718   19.834  1.00 55.56 ? 42  PRO B N   1 
ATOM   1183 C CA  . PRO B 1 62  ? 21.263  9.309   20.077  1.00 52.90 ? 42  PRO B CA  1 
ATOM   1184 C C   . PRO B 1 62  ? 22.220  10.298  19.433  1.00 51.77 ? 42  PRO B C   1 
ATOM   1185 O O   . PRO B 1 62  ? 21.893  10.887  18.398  1.00 44.31 ? 42  PRO B O   1 
ATOM   1186 C CB  . PRO B 1 62  ? 21.379  7.940   19.383  1.00 53.64 ? 42  PRO B CB  1 
ATOM   1187 C CG  . PRO B 1 62  ? 20.070  7.642   18.759  1.00 53.75 ? 42  PRO B CG  1 
ATOM   1188 C CD  . PRO B 1 62  ? 19.077  8.648   19.233  1.00 54.84 ? 42  PRO B CD  1 
ATOM   1189 N N   . GLU B 1 63  ? 23.383  10.474  20.057  1.00 52.75 ? 43  GLU B N   1 
ATOM   1190 C CA  . GLU B 1 63  ? 24.496  11.211  19.454  1.00 53.11 ? 43  GLU B CA  1 
ATOM   1191 C C   . GLU B 1 63  ? 24.985  10.577  18.152  1.00 53.07 ? 43  GLU B C   1 
ATOM   1192 O O   . GLU B 1 63  ? 25.766  11.199  17.439  1.00 59.99 ? 43  GLU B O   1 
ATOM   1193 C CB  . GLU B 1 63  ? 25.674  11.307  20.429  1.00 50.44 ? 43  GLU B CB  1 
ATOM   1194 N N   . HIS B 1 64  ? 24.547  9.353   17.850  1.00 51.55 ? 44  HIS B N   1 
ATOM   1195 C CA  . HIS B 1 64  ? 24.918  8.669   16.600  1.00 56.30 ? 44  HIS B CA  1 
ATOM   1196 C C   . HIS B 1 64  ? 24.064  9.130   15.444  1.00 59.05 ? 44  HIS B C   1 
ATOM   1197 O O   . HIS B 1 64  ? 24.577  9.625   14.444  1.00 62.05 ? 44  HIS B O   1 
ATOM   1198 C CB  . HIS B 1 64  ? 24.766  7.144   16.727  1.00 58.46 ? 44  HIS B CB  1 
ATOM   1199 N N   . VAL B 1 65  ? 22.751  8.974   15.609  1.00 60.26 ? 45  VAL B N   1 
ATOM   1200 C CA  . VAL B 1 65  ? 21.754  9.216   14.568  1.00 56.58 ? 45  VAL B CA  1 
ATOM   1201 C C   . VAL B 1 65  ? 21.894  10.537  13.820  1.00 57.23 ? 45  VAL B C   1 
ATOM   1202 O O   . VAL B 1 65  ? 21.199  10.765  12.827  1.00 59.27 ? 45  VAL B O   1 
ATOM   1203 C CB  . VAL B 1 65  ? 20.334  9.180   15.166  1.00 58.65 ? 45  VAL B CB  1 
ATOM   1204 N N   . ALA B 1 66  ? 22.756  11.421  14.305  1.00 54.89 ? 46  ALA B N   1 
ATOM   1205 C CA  . ALA B 1 66  ? 23.139  12.584  13.532  1.00 52.37 ? 46  ALA B CA  1 
ATOM   1206 C C   . ALA B 1 66  ? 23.552  12.147  12.144  1.00 46.74 ? 46  ALA B C   1 
ATOM   1207 O O   . ALA B 1 66  ? 22.897  12.504  11.165  1.00 52.11 ? 46  ALA B O   1 
ATOM   1208 C CB  . ALA B 1 66  ? 24.272  13.338  14.220  1.00 55.43 ? 46  ALA B CB  1 
ATOM   1209 N N   . MET B 1 67  ? 24.610  11.345  12.057  1.00 43.85 ? 47  MET B N   1 
ATOM   1210 C CA  . MET B 1 67  ? 25.216  11.004  10.745  1.00 42.01 ? 47  MET B CA  1 
ATOM   1211 C C   . MET B 1 67  ? 24.586  9.833   9.968   1.00 41.04 ? 47  MET B C   1 
ATOM   1212 O O   . MET B 1 67  ? 25.074  9.446   8.904   1.00 38.57 ? 47  MET B O   1 
ATOM   1213 C CB  . MET B 1 67  ? 26.727  10.791  10.880  1.00 38.76 ? 47  MET B CB  1 
ATOM   1214 C CG  . MET B 1 67  ? 27.145  9.560   11.654  1.00 40.81 ? 47  MET B CG  1 
ATOM   1215 S SD  . MET B 1 67  ? 27.187  9.774   13.445  1.00 41.13 ? 47  MET B SD  1 
ATOM   1216 C CE  . MET B 1 67  ? 27.886  11.409  13.613  1.00 42.12 ? 47  MET B CE  1 
ATOM   1217 N N   . HIS B 1 68  ? 23.523  9.243   10.494  1.00 43.37 ? 48  HIS B N   1 
ATOM   1218 C CA  . HIS B 1 68  ? 22.798  8.224   9.738   1.00 45.47 ? 48  HIS B CA  1 
ATOM   1219 C C   . HIS B 1 68  ? 21.519  8.801   9.097   1.00 46.28 ? 48  HIS B C   1 
ATOM   1220 O O   . HIS B 1 68  ? 20.803  8.102   8.376   1.00 45.90 ? 48  HIS B O   1 
ATOM   1221 C CB  . HIS B 1 68  ? 22.434  7.055   10.640  1.00 47.91 ? 48  HIS B CB  1 
ATOM   1222 C CG  . HIS B 1 68  ? 23.581  6.497   11.431  1.00 48.97 ? 48  HIS B CG  1 
ATOM   1223 N ND1 . HIS B 1 68  ? 24.393  5.491   10.958  1.00 50.08 ? 48  HIS B ND1 1 
ATOM   1224 C CD2 . HIS B 1 68  ? 24.009  6.763   12.687  1.00 49.04 ? 48  HIS B CD2 1 
ATOM   1225 C CE1 . HIS B 1 68  ? 25.283  5.175   11.878  1.00 50.40 ? 48  HIS B CE1 1 
ATOM   1226 N NE2 . HIS B 1 68  ? 25.072  5.933   12.937  1.00 49.45 ? 48  HIS B NE2 1 
ATOM   1227 N N   . HIS B 1 69  ? 21.226  10.067  9.378   1.00 47.12 ? 49  HIS B N   1 
ATOM   1228 C CA  . HIS B 1 69  ? 20.016  10.718  8.881   1.00 49.22 ? 49  HIS B CA  1 
ATOM   1229 C C   . HIS B 1 69  ? 20.372  11.906  7.997   1.00 50.53 ? 49  HIS B C   1 
ATOM   1230 O O   . HIS B 1 69  ? 19.714  12.127  6.971   1.00 51.20 ? 49  HIS B O   1 
ATOM   1231 C CB  . HIS B 1 69  ? 19.120  11.138  10.045  1.00 48.83 ? 49  HIS B CB  1 
ATOM   1232 C CG  . HIS B 1 69  ? 18.489  9.986   10.765  1.00 49.93 ? 49  HIS B CG  1 
ATOM   1233 N ND1 . HIS B 1 69  ? 17.356  10.124  11.536  1.00 51.76 ? 49  HIS B ND1 1 
ATOM   1234 C CD2 . HIS B 1 69  ? 18.821  8.673   10.821  1.00 50.78 ? 49  HIS B CD2 1 
ATOM   1235 C CE1 . HIS B 1 69  ? 17.023  8.951   12.045  1.00 50.12 ? 49  HIS B CE1 1 
ATOM   1236 N NE2 . HIS B 1 69  ? 17.900  8.054   11.631  1.00 51.53 ? 49  HIS B NE2 1 
ATOM   1237 N N   . THR B 1 70  ? 21.402  12.665  8.385   1.00 48.99 ? 50  THR B N   1 
ATOM   1238 C CA  . THR B 1 70  ? 22.067  13.553  7.445   1.00 47.75 ? 50  THR B CA  1 
ATOM   1239 C C   . THR B 1 70  ? 22.168  12.794  6.132   1.00 48.83 ? 50  THR B C   1 
ATOM   1240 O O   . THR B 1 70  ? 22.693  11.685  6.093   1.00 46.05 ? 50  THR B O   1 
ATOM   1241 C CB  . THR B 1 70  ? 23.482  13.937  7.892   1.00 45.99 ? 50  THR B CB  1 
ATOM   1242 N N   . HIS B 1 71  ? 21.591  13.376  5.086   1.00 53.53 ? 51  HIS B N   1 
ATOM   1243 C CA  . HIS B 1 71  ? 21.664  12.853  3.734   1.00 56.84 ? 51  HIS B CA  1 
ATOM   1244 C C   . HIS B 1 71  ? 22.197  13.938  2.815   1.00 62.78 ? 51  HIS B C   1 
ATOM   1245 O O   . HIS B 1 71  ? 22.123  15.143  3.132   1.00 61.67 ? 51  HIS B O   1 
ATOM   1246 C CB  . HIS B 1 71  ? 20.284  12.411  3.247   1.00 60.58 ? 51  HIS B CB  1 
ATOM   1247 N N   . ASP B 1 72  ? 22.732  13.506  1.672   1.00 63.97 ? 52  ASP B N   1 
ATOM   1248 C CA  . ASP B 1 72  ? 23.355  14.432  0.731   1.00 61.86 ? 52  ASP B CA  1 
ATOM   1249 C C   . ASP B 1 72  ? 22.268  15.309  0.167   1.00 60.56 ? 52  ASP B C   1 
ATOM   1250 O O   . ASP B 1 72  ? 21.220  14.806  -0.226  1.00 63.74 ? 52  ASP B O   1 
ATOM   1251 C CB  . ASP B 1 72  ? 24.067  13.689  -0.396  1.00 59.07 ? 52  ASP B CB  1 
ATOM   1252 N N   . VAL B 1 73  ? 22.495  16.619  0.169   1.00 60.10 ? 53  VAL B N   1 
ATOM   1253 C CA  . VAL B 1 73  ? 21.526  17.528  -0.410  1.00 58.51 ? 53  VAL B CA  1 
ATOM   1254 C C   . VAL B 1 73  ? 21.192  16.908  -1.757  1.00 57.74 ? 53  VAL B C   1 
ATOM   1255 O O   . VAL B 1 73  ? 22.101  16.494  -2.496  1.00 58.90 ? 53  VAL B O   1 
ATOM   1256 C CB  . VAL B 1 73  ? 22.003  19.013  -0.500  1.00 62.71 ? 53  VAL B CB  1 
ATOM   1257 C CG1 . VAL B 1 73  ? 21.557  19.803  0.729   1.00 63.66 ? 53  VAL B CG1 1 
ATOM   1258 C CG2 . VAL B 1 73  ? 23.517  19.146  -0.680  1.00 61.55 ? 53  VAL B CG2 1 
ATOM   1259 N N   . GLY B 1 74  ? 19.888  16.795  -2.030  1.00 53.22 ? 54  GLY B N   1 
ATOM   1260 C CA  . GLY B 1 74  ? 19.364  15.999  -3.134  1.00 50.84 ? 54  GLY B CA  1 
ATOM   1261 C C   . GLY B 1 74  ? 18.355  16.746  -4.001  1.00 50.92 ? 54  GLY B C   1 
ATOM   1262 O O   . GLY B 1 74  ? 17.172  16.830  -3.652  1.00 44.63 ? 54  GLY B O   1 
ATOM   1263 N N   . PRO B 1 75  ? 18.817  17.285  -5.151  1.00 52.40 ? 55  PRO B N   1 
ATOM   1264 C CA  . PRO B 1 75  ? 17.989  18.050  -6.101  1.00 50.35 ? 55  PRO B CA  1 
ATOM   1265 C C   . PRO B 1 75  ? 16.776  17.291  -6.654  1.00 50.78 ? 55  PRO B C   1 
ATOM   1266 O O   . PRO B 1 75  ? 15.633  17.732  -6.471  1.00 47.35 ? 55  PRO B O   1 
ATOM   1267 C CB  . PRO B 1 75  ? 18.971  18.385  -7.228  1.00 48.17 ? 55  PRO B CB  1 
ATOM   1268 C CG  . PRO B 1 75  ? 20.291  18.401  -6.562  1.00 49.93 ? 55  PRO B CG  1 
ATOM   1269 C CD  . PRO B 1 75  ? 20.246  17.330  -5.523  1.00 50.36 ? 55  PRO B CD  1 
ATOM   1270 N N   . ASP B 1 76  ? 17.040  16.164  -7.322  1.00 49.47 ? 56  ASP B N   1 
ATOM   1271 C CA  . ASP B 1 76  ? 15.994  15.284  -7.849  1.00 45.66 ? 56  ASP B CA  1 
ATOM   1272 C C   . ASP B 1 76  ? 15.545  14.260  -6.803  1.00 41.13 ? 56  ASP B C   1 
ATOM   1273 O O   . ASP B 1 76  ? 14.796  13.353  -7.136  1.00 39.62 ? 56  ASP B O   1 
ATOM   1274 C CB  . ASP B 1 76  ? 16.513  14.541  -9.090  1.00 44.97 ? 56  ASP B CB  1 
ATOM   1275 N N   . GLN B 1 77  ? 15.995  14.436  -5.557  1.00 37.32 ? 57  GLN B N   1 
ATOM   1276 C CA  . GLN B 1 77  ? 15.819  13.482  -4.464  1.00 38.89 ? 57  GLN B CA  1 
ATOM   1277 C C   . GLN B 1 77  ? 14.893  13.959  -3.321  1.00 39.64 ? 57  GLN B C   1 
ATOM   1278 O O   . GLN B 1 77  ? 14.961  15.114  -2.886  1.00 41.14 ? 57  GLN B O   1 
ATOM   1279 C CB  . GLN B 1 77  ? 17.187  13.146  -3.865  1.00 38.25 ? 57  GLN B CB  1 
ATOM   1280 C CG  . GLN B 1 77  ? 18.249  12.798  -4.903  1.00 38.11 ? 57  GLN B CG  1 
ATOM   1281 C CD  . GLN B 1 77  ? 19.572  12.407  -4.294  1.00 35.25 ? 57  GLN B CD  1 
ATOM   1282 O OE1 . GLN B 1 77  ? 19.952  12.916  -3.245  1.00 34.88 ? 57  GLN B OE1 1 
ATOM   1283 N NE2 . GLN B 1 77  ? 20.294  11.515  -4.961  1.00 36.28 ? 57  GLN B NE2 1 
ATOM   1284 N N   . CYS B 1 78  ? 14.058  13.052  -2.818  1.00 39.33 ? 58  CYS B N   1 
ATOM   1285 C CA  . CYS B 1 78  ? 13.127  13.366  -1.735  1.00 40.51 ? 58  CYS B CA  1 
ATOM   1286 C C   . CYS B 1 78  ? 13.706  12.942  -0.396  1.00 41.32 ? 58  CYS B C   1 
ATOM   1287 O O   . CYS B 1 78  ? 14.878  12.590  -0.332  1.00 43.56 ? 58  CYS B O   1 
ATOM   1288 C CB  . CYS B 1 78  ? 11.802  12.694  -2.004  1.00 38.68 ? 58  CYS B CB  1 
ATOM   1289 S SG  . CYS B 1 78  ? 11.390  12.773  -3.755  1.00 41.18 ? 58  CYS B SG  1 
ATOM   1290 N N   . CYS B 1 79  ? 12.907  13.022  0.670   1.00 44.44 ? 59  CYS B N   1 
ATOM   1291 C CA  . CYS B 1 79  ? 13.334  12.603  2.027   1.00 46.41 ? 59  CYS B CA  1 
ATOM   1292 C C   . CYS B 1 79  ? 12.309  12.982  3.102   1.00 44.07 ? 59  CYS B C   1 
ATOM   1293 O O   . CYS B 1 79  ? 11.633  14.008  2.995   1.00 42.42 ? 59  CYS B O   1 
ATOM   1294 C CB  . CYS B 1 79  ? 14.703  13.210  2.397   1.00 50.24 ? 59  CYS B CB  1 
ATOM   1295 S SG  . CYS B 1 79  ? 15.709  12.205  3.514   1.00 53.58 ? 59  CYS B SG  1 
ATOM   1296 N N   . SER B 1 80  ? 12.196  12.140  4.128   1.00 46.19 ? 60  SER B N   1 
ATOM   1297 C CA  . SER B 1 80  ? 11.333  12.423  5.303   1.00 45.40 ? 60  SER B CA  1 
ATOM   1298 C C   . SER B 1 80  ? 11.435  11.377  6.423   1.00 44.99 ? 60  SER B C   1 
ATOM   1299 O O   . SER B 1 80  ? 11.102  10.206  6.215   1.00 42.96 ? 60  SER B O   1 
ATOM   1300 C CB  . SER B 1 80  ? 9.864   12.546  4.897   1.00 44.60 ? 60  SER B CB  1 
ATOM   1301 O OG  . SER B 1 80  ? 9.432   13.878  4.945   1.00 44.96 ? 60  SER B OG  1 
ATOM   1302 N N   . SER B 1 81  ? 11.825  11.838  7.614   1.00 44.11 ? 61  SER B N   1 
ATOM   1303 C CA  . SER B 1 81  ? 12.045  10.976  8.792   1.00 46.13 ? 61  SER B CA  1 
ATOM   1304 C C   . SER B 1 81  ? 10.724  10.509  9.474   1.00 46.14 ? 61  SER B C   1 
ATOM   1305 O O   . SER B 1 81  ? 9.677   10.561  8.847   1.00 44.76 ? 61  SER B O   1 
ATOM   1306 C CB  . SER B 1 81  ? 12.971  11.707  9.778   1.00 46.25 ? 61  SER B CB  1 
ATOM   1307 O OG  . SER B 1 81  ? 12.542  13.043  10.011  1.00 47.25 ? 61  SER B OG  1 
ATOM   1308 N N   . VAL B 1 82  ? 10.792  10.030  10.729  1.00 48.96 ? 62  VAL B N   1 
ATOM   1309 C CA  . VAL B 1 82  ? 9.619   9.516   11.488  1.00 48.15 ? 62  VAL B CA  1 
ATOM   1310 C C   . VAL B 1 82  ? 9.833   9.500   13.014  1.00 46.60 ? 62  VAL B C   1 
ATOM   1311 O O   . VAL B 1 82  ? 10.949  9.547   13.498  1.00 45.20 ? 62  VAL B O   1 
ATOM   1312 C CB  . VAL B 1 82  ? 9.226   8.107   11.013  1.00 49.56 ? 62  VAL B CB  1 
ATOM   1313 C CG1 . VAL B 1 82  ? 10.396  7.166   11.141  1.00 53.13 ? 62  VAL B CG1 1 
ATOM   1314 C CG2 . VAL B 1 82  ? 8.043   7.550   11.783  1.00 51.63 ? 62  VAL B CG2 1 
ATOM   1315 N N   . VAL B 1 83  ? 8.740   9.459   13.766  1.00 48.86 ? 63  VAL B N   1 
ATOM   1316 C CA  . VAL B 1 83  ? 8.781   9.486   15.222  1.00 48.82 ? 63  VAL B CA  1 
ATOM   1317 C C   . VAL B 1 83  ? 7.927   8.348   15.780  1.00 49.99 ? 63  VAL B C   1 
ATOM   1318 O O   . VAL B 1 83  ? 6.996   8.578   16.561  1.00 54.29 ? 63  VAL B O   1 
ATOM   1319 C CB  . VAL B 1 83  ? 8.263   10.844  15.761  1.00 49.32 ? 63  VAL B CB  1 
ATOM   1320 C CG1 . VAL B 1 83  ? 8.798   11.098  17.162  1.00 50.17 ? 63  VAL B CG1 1 
ATOM   1321 C CG2 . VAL B 1 83  ? 8.676   11.979  14.842  1.00 47.29 ? 63  VAL B CG2 1 
ATOM   1322 N N   . GLN B 1 84  ? 8.253   7.120   15.377  1.00 50.85 ? 64  GLN B N   1 
ATOM   1323 C CA  . GLN B 1 84  ? 7.547   5.916   15.845  1.00 49.75 ? 64  GLN B CA  1 
ATOM   1324 C C   . GLN B 1 84  ? 8.232   5.294   17.054  1.00 50.02 ? 64  GLN B C   1 
ATOM   1325 O O   . GLN B 1 84  ? 9.454   5.354   17.156  1.00 50.27 ? 64  GLN B O   1 
ATOM   1326 C CB  . GLN B 1 84  ? 7.476   4.880   14.732  1.00 48.21 ? 64  GLN B CB  1 
ATOM   1327 N N   . MET B 1 85  ? 7.442   4.679   17.946  1.00 50.26 ? 65  MET B N   1 
ATOM   1328 C CA  . MET B 1 85  ? 7.936   4.109   19.208  1.00 47.57 ? 65  MET B CA  1 
ATOM   1329 C C   . MET B 1 85  ? 7.197   2.843   19.648  1.00 52.91 ? 65  MET B C   1 
ATOM   1330 O O   . MET B 1 85  ? 6.129   2.507   19.124  1.00 56.27 ? 65  MET B O   1 
ATOM   1331 C CB  . MET B 1 85  ? 7.828   5.141   20.332  1.00 47.00 ? 65  MET B CB  1 
ATOM   1332 C CG  . MET B 1 85  ? 9.123   5.835   20.676  1.00 45.65 ? 65  MET B CG  1 
ATOM   1333 S SD  . MET B 1 85  ? 9.138   6.603   22.310  1.00 50.25 ? 65  MET B SD  1 
ATOM   1334 C CE  . MET B 1 85  ? 8.998   5.190   23.406  1.00 50.19 ? 65  MET B CE  1 
ATOM   1335 N N   . ILE B 1 86  ? 7.776   2.164   20.643  1.00 54.79 ? 66  ILE B N   1 
ATOM   1336 C CA  . ILE B 1 86  ? 7.231   0.915   21.170  1.00 52.10 ? 66  ILE B CA  1 
ATOM   1337 C C   . ILE B 1 86  ? 7.736   0.608   22.588  1.00 52.00 ? 66  ILE B C   1 
ATOM   1338 O O   . ILE B 1 86  ? 8.895   0.873   22.930  1.00 47.95 ? 66  ILE B O   1 
ATOM   1339 C CB  . ILE B 1 86  ? 7.603   -0.258  20.257  1.00 54.72 ? 66  ILE B CB  1 
ATOM   1340 N N   . HIS B 1 87  ? 6.868   0.029   23.407  1.00 48.91 ? 67  HIS B N   1 
ATOM   1341 C CA  . HIS B 1 87  ? 7.217   -0.272  24.794  1.00 53.68 ? 67  HIS B CA  1 
ATOM   1342 C C   . HIS B 1 87  ? 7.980   -1.613  24.956  1.00 53.55 ? 67  HIS B C   1 
ATOM   1343 O O   . HIS B 1 87  ? 7.433   -2.556  25.519  1.00 52.38 ? 67  HIS B O   1 
ATOM   1344 C CB  . HIS B 1 87  ? 5.928   -0.275  25.624  1.00 53.34 ? 67  HIS B CB  1 
ATOM   1345 C CG  . HIS B 1 87  ? 6.130   -0.331  27.111  1.00 53.11 ? 67  HIS B CG  1 
ATOM   1346 N ND1 . HIS B 1 87  ? 5.313   0.352   27.985  1.00 50.77 ? 67  HIS B ND1 1 
ATOM   1347 C CD2 . HIS B 1 87  ? 7.027   -0.995  27.880  1.00 52.57 ? 67  HIS B CD2 1 
ATOM   1348 C CE1 . HIS B 1 87  ? 5.698   0.115   29.225  1.00 50.08 ? 67  HIS B CE1 1 
ATOM   1349 N NE2 . HIS B 1 87  ? 6.734   -0.701  29.189  1.00 51.71 ? 67  HIS B NE2 1 
ATOM   1350 N N   . ALA B 1 88  ? 9.228   -1.700  24.483  1.00 49.23 ? 68  ALA B N   1 
ATOM   1351 C CA  . ALA B 1 88  ? 10.068  -2.887  24.749  1.00 49.15 ? 68  ALA B CA  1 
ATOM   1352 C C   . ALA B 1 88  ? 11.567  -2.522  24.821  1.00 51.34 ? 68  ALA B C   1 
ATOM   1353 O O   . ALA B 1 88  ? 11.949  -1.393  24.489  1.00 55.47 ? 68  ALA B O   1 
ATOM   1354 C CB  . ALA B 1 88  ? 9.814   -3.955  23.700  1.00 47.60 ? 68  ALA B CB  1 
ATOM   1355 N N   . PRO B 1 89  ? 12.425  -3.460  25.268  1.00 47.45 ? 69  PRO B N   1 
ATOM   1356 C CA  . PRO B 1 89  ? 13.837  -3.092  25.293  1.00 45.51 ? 69  PRO B CA  1 
ATOM   1357 C C   . PRO B 1 89  ? 14.400  -2.985  23.889  1.00 43.41 ? 69  PRO B C   1 
ATOM   1358 O O   . PRO B 1 89  ? 14.035  -3.787  23.025  1.00 44.10 ? 69  PRO B O   1 
ATOM   1359 C CB  . PRO B 1 89  ? 14.516  -4.239  26.053  1.00 46.02 ? 69  PRO B CB  1 
ATOM   1360 C CG  . PRO B 1 89  ? 13.433  -5.141  26.532  1.00 47.50 ? 69  PRO B CG  1 
ATOM   1361 C CD  . PRO B 1 89  ? 12.200  -4.836  25.738  1.00 49.12 ? 69  PRO B CD  1 
ATOM   1362 N N   . PRO B 1 90  ? 15.295  -2.010  23.665  1.00 42.44 ? 70  PRO B N   1 
ATOM   1363 C CA  . PRO B 1 90  ? 15.818  -1.700  22.328  1.00 41.00 ? 70  PRO B CA  1 
ATOM   1364 C C   . PRO B 1 90  ? 16.369  -2.944  21.644  1.00 44.81 ? 70  PRO B C   1 
ATOM   1365 O O   . PRO B 1 90  ? 16.032  -3.203  20.493  1.00 46.08 ? 70  PRO B O   1 
ATOM   1366 C CB  . PRO B 1 90  ? 16.936  -0.710  22.605  1.00 40.20 ? 70  PRO B CB  1 
ATOM   1367 C CG  . PRO B 1 90  ? 17.305  -0.916  24.039  1.00 39.51 ? 70  PRO B CG  1 
ATOM   1368 C CD  . PRO B 1 90  ? 16.068  -1.346  24.733  1.00 39.69 ? 70  PRO B CD  1 
ATOM   1369 N N   . GLU B 1 91  ? 17.186  -3.725  22.357  1.00 44.50 ? 71  GLU B N   1 
ATOM   1370 C CA  . GLU B 1 91  ? 17.728  -4.970  21.797  1.00 43.49 ? 71  GLU B CA  1 
ATOM   1371 C C   . GLU B 1 91  ? 16.577  -5.849  21.308  1.00 44.86 ? 71  GLU B C   1 
ATOM   1372 O O   . GLU B 1 91  ? 16.596  -6.376  20.193  1.00 47.50 ? 71  GLU B O   1 
ATOM   1373 C CB  . GLU B 1 91  ? 18.536  -5.744  22.857  1.00 42.26 ? 71  GLU B CB  1 
ATOM   1374 C CG  . GLU B 1 91  ? 19.910  -6.246  22.412  1.00 39.70 ? 71  GLU B CG  1 
ATOM   1375 C CD  . GLU B 1 91  ? 21.039  -5.458  23.059  1.00 41.03 ? 71  GLU B CD  1 
ATOM   1376 O OE1 . GLU B 1 91  ? 21.702  -6.042  23.942  1.00 41.61 ? 71  GLU B OE1 1 
ATOM   1377 O OE2 . GLU B 1 91  ? 21.246  -4.256  22.721  1.00 37.40 ? 71  GLU B OE2 1 
ATOM   1378 N N   . SER B 1 92  ? 15.573  -5.991  22.168  1.00 43.99 ? 72  SER B N   1 
ATOM   1379 C CA  . SER B 1 92  ? 14.412  -6.829  21.901  1.00 43.10 ? 72  SER B CA  1 
ATOM   1380 C C   . SER B 1 92  ? 13.530  -6.361  20.725  1.00 44.33 ? 72  SER B C   1 
ATOM   1381 O O   . SER B 1 92  ? 12.805  -7.168  20.147  1.00 40.21 ? 72  SER B O   1 
ATOM   1382 C CB  . SER B 1 92  ? 13.579  -6.943  23.175  1.00 43.19 ? 72  SER B CB  1 
ATOM   1383 O OG  . SER B 1 92  ? 14.420  -7.083  24.326  1.00 41.00 ? 72  SER B OG  1 
ATOM   1384 N N   . VAL B 1 93  ? 13.589  -5.074  20.374  1.00 47.98 ? 73  VAL B N   1 
ATOM   1385 C CA  . VAL B 1 93  ? 12.861  -4.561  19.197  1.00 49.20 ? 73  VAL B CA  1 
ATOM   1386 C C   . VAL B 1 93  ? 13.783  -4.641  18.010  1.00 50.71 ? 73  VAL B C   1 
ATOM   1387 O O   . VAL B 1 93  ? 13.421  -5.169  16.964  1.00 50.93 ? 73  VAL B O   1 
ATOM   1388 C CB  . VAL B 1 93  ? 12.290  -3.117  19.358  1.00 52.27 ? 73  VAL B CB  1 
ATOM   1389 C CG1 . VAL B 1 93  ? 13.013  -2.292  20.409  1.00 51.69 ? 73  VAL B CG1 1 
ATOM   1390 C CG2 . VAL B 1 93  ? 12.259  -2.367  18.025  1.00 51.34 ? 73  VAL B CG2 1 
ATOM   1391 N N   . TRP B 1 94  ? 14.974  -4.092  18.190  1.00 55.06 ? 74  TRP B N   1 
ATOM   1392 C CA  . TRP B 1 94  ? 16.093  -4.292  17.278  1.00 56.22 ? 74  TRP B CA  1 
ATOM   1393 C C   . TRP B 1 94  ? 16.132  -5.723  16.722  1.00 55.14 ? 74  TRP B C   1 
ATOM   1394 O O   . TRP B 1 94  ? 16.468  -5.934  15.567  1.00 57.89 ? 74  TRP B O   1 
ATOM   1395 C CB  . TRP B 1 94  ? 17.388  -3.961  18.032  1.00 58.04 ? 74  TRP B CB  1 
ATOM   1396 C CG  . TRP B 1 94  ? 18.628  -4.454  17.424  1.00 59.84 ? 74  TRP B CG  1 
ATOM   1397 C CD1 . TRP B 1 94  ? 19.621  -5.153  18.045  1.00 62.17 ? 74  TRP B CD1 1 
ATOM   1398 C CD2 . TRP B 1 94  ? 19.041  -4.280  16.072  1.00 60.91 ? 74  TRP B CD2 1 
ATOM   1399 N NE1 . TRP B 1 94  ? 20.636  -5.416  17.160  1.00 64.75 ? 74  TRP B NE1 1 
ATOM   1400 C CE2 . TRP B 1 94  ? 20.296  -4.900  15.934  1.00 64.29 ? 74  TRP B CE2 1 
ATOM   1401 C CE3 . TRP B 1 94  ? 18.470  -3.665  14.962  1.00 59.53 ? 74  TRP B CE3 1 
ATOM   1402 C CZ2 . TRP B 1 94  ? 20.989  -4.917  14.720  1.00 64.04 ? 74  TRP B CZ2 1 
ATOM   1403 C CZ3 . TRP B 1 94  ? 19.149  -3.685  13.762  1.00 60.74 ? 74  TRP B CZ3 1 
ATOM   1404 C CH2 . TRP B 1 94  ? 20.399  -4.304  13.648  1.00 62.69 ? 74  TRP B CH2 1 
ATOM   1405 N N   . ALA B 1 95  ? 15.785  -6.702  17.549  1.00 57.66 ? 75  ALA B N   1 
ATOM   1406 C CA  . ALA B 1 95  ? 15.759  -8.107  17.124  1.00 58.59 ? 75  ALA B CA  1 
ATOM   1407 C C   . ALA B 1 95  ? 15.187  -8.293  15.718  1.00 57.71 ? 75  ALA B C   1 
ATOM   1408 O O   . ALA B 1 95  ? 15.874  -8.800  14.827  1.00 62.41 ? 75  ALA B O   1 
ATOM   1409 C CB  . ALA B 1 95  ? 14.966  -8.950  18.125  1.00 56.33 ? 75  ALA B CB  1 
ATOM   1410 N N   . LEU B 1 96  ? 13.940  -7.858  15.532  1.00 53.01 ? 76  LEU B N   1 
ATOM   1411 C CA  . LEU B 1 96  ? 13.161  -8.196  14.333  1.00 50.09 ? 76  LEU B CA  1 
ATOM   1412 C C   . LEU B 1 96  ? 13.599  -7.447  13.095  1.00 44.00 ? 76  LEU B C   1 
ATOM   1413 O O   . LEU B 1 96  ? 13.572  -7.997  11.998  1.00 44.77 ? 76  LEU B O   1 
ATOM   1414 C CB  . LEU B 1 96  ? 11.669  -7.931  14.560  1.00 50.29 ? 76  LEU B CB  1 
ATOM   1415 N N   . VAL B 1 97  ? 13.975  -6.190  13.275  1.00 40.18 ? 77  VAL B N   1 
ATOM   1416 C CA  . VAL B 1 97  ? 14.400  -5.344  12.160  1.00 42.39 ? 77  VAL B CA  1 
ATOM   1417 C C   . VAL B 1 97  ? 15.634  -5.939  11.444  1.00 40.07 ? 77  VAL B C   1 
ATOM   1418 O O   . VAL B 1 97  ? 15.739  -5.889  10.221  1.00 37.73 ? 77  VAL B O   1 
ATOM   1419 C CB  . VAL B 1 97  ? 14.649  -3.858  12.589  1.00 44.17 ? 77  VAL B CB  1 
ATOM   1420 C CG1 . VAL B 1 97  ? 13.350  -3.110  12.842  1.00 44.87 ? 77  VAL B CG1 1 
ATOM   1421 C CG2 . VAL B 1 97  ? 15.491  -3.775  13.840  1.00 46.37 ? 77  VAL B CG2 1 
ATOM   1422 N N   . ARG B 1 98  ? 16.534  -6.536  12.218  1.00 38.84 ? 78  ARG B N   1 
ATOM   1423 C CA  . ARG B 1 98  ? 17.765  -7.140  11.700  1.00 39.65 ? 78  ARG B CA  1 
ATOM   1424 C C   . ARG B 1 98  ? 17.568  -8.085  10.493  1.00 40.22 ? 78  ARG B C   1 
ATOM   1425 O O   . ARG B 1 98  ? 18.438  -8.162  9.604   1.00 35.71 ? 78  ARG B O   1 
ATOM   1426 C CB  . ARG B 1 98  ? 18.447  -7.909  12.831  1.00 42.42 ? 78  ARG B CB  1 
ATOM   1427 C CG  . ARG B 1 98  ? 19.959  -7.990  12.698  1.00 44.60 ? 78  ARG B CG  1 
ATOM   1428 C CD  . ARG B 1 98  ? 20.471  -9.255  13.345  1.00 45.89 ? 78  ARG B CD  1 
ATOM   1429 N NE  . ARG B 1 98  ? 20.503  -10.399 12.427  1.00 47.59 ? 78  ARG B NE  1 
ATOM   1430 C CZ  . ARG B 1 98  ? 20.562  -11.671 12.824  1.00 50.44 ? 78  ARG B CZ  1 
ATOM   1431 N NH1 . ARG B 1 98  ? 20.549  -11.965 14.118  1.00 49.62 ? 78  ARG B NH1 1 
ATOM   1432 N NH2 . ARG B 1 98  ? 20.610  -12.662 11.932  1.00 50.91 ? 78  ARG B NH2 1 
ATOM   1433 N N   . ARG B 1 99  ? 16.447  -8.809  10.483  1.00 40.09 ? 79  ARG B N   1 
ATOM   1434 C CA  . ARG B 1 99  ? 16.103  -9.734  9.396   1.00 42.00 ? 79  ARG B CA  1 
ATOM   1435 C C   . ARG B 1 99  ? 16.161  -9.088  8.014   1.00 41.95 ? 79  ARG B C   1 
ATOM   1436 O O   . ARG B 1 99  ? 15.267  -8.357  7.596   1.00 41.79 ? 79  ARG B O   1 
ATOM   1437 C CB  . ARG B 1 99  ? 14.712  -10.334 9.618   1.00 46.09 ? 79  ARG B CB  1 
ATOM   1438 C CG  . ARG B 1 99  ? 14.702  -11.460 10.636  1.00 47.74 ? 79  ARG B CG  1 
ATOM   1439 C CD  . ARG B 1 99  ? 15.058  -12.780 9.973   1.00 49.81 ? 79  ARG B CD  1 
ATOM   1440 N NE  . ARG B 1 99  ? 13.907  -13.402 9.317   1.00 50.53 ? 79  ARG B NE  1 
ATOM   1441 C CZ  . ARG B 1 99  ? 13.991  -14.323 8.358   1.00 53.91 ? 79  ARG B CZ  1 
ATOM   1442 N NH1 . ARG B 1 99  ? 15.176  -14.767 7.930   1.00 53.58 ? 79  ARG B NH1 1 
ATOM   1443 N NH2 . ARG B 1 99  ? 12.871  -14.826 7.837   1.00 54.46 ? 79  ARG B NH2 1 
ATOM   1444 N N   . PHE B 1 100 ? 17.244  -9.383  7.313   1.00 44.75 ? 80  PHE B N   1 
ATOM   1445 C CA  . PHE B 1 100 ? 17.486  -8.884  5.962   1.00 40.70 ? 80  PHE B CA  1 
ATOM   1446 C C   . PHE B 1 100 ? 17.088  -9.963  4.967   1.00 40.71 ? 80  PHE B C   1 
ATOM   1447 O O   . PHE B 1 100 ? 16.697  -9.655  3.825   1.00 38.25 ? 80  PHE B O   1 
ATOM   1448 C CB  . PHE B 1 100 ? 18.971  -8.535  5.823   1.00 39.70 ? 80  PHE B CB  1 
ATOM   1449 C CG  . PHE B 1 100 ? 19.307  -7.838  4.553   1.00 38.25 ? 80  PHE B CG  1 
ATOM   1450 C CD1 . PHE B 1 100 ? 19.253  -6.460  4.478   1.00 36.93 ? 80  PHE B CD1 1 
ATOM   1451 C CD2 . PHE B 1 100 ? 19.674  -8.557  3.434   1.00 36.66 ? 80  PHE B CD2 1 
ATOM   1452 C CE1 . PHE B 1 100 ? 19.553  -5.817  3.302   1.00 37.12 ? 80  PHE B CE1 1 
ATOM   1453 C CE2 . PHE B 1 100 ? 19.977  -7.918  2.256   1.00 36.45 ? 80  PHE B CE2 1 
ATOM   1454 C CZ  . PHE B 1 100 ? 19.917  -6.549  2.190   1.00 36.93 ? 80  PHE B CZ  1 
ATOM   1455 N N   . ASP B 1 101 ? 17.207  -11.224 5.415   1.00 40.41 ? 81  ASP B N   1 
ATOM   1456 C CA  . ASP B 1 101 ? 16.726  -12.404 4.681   1.00 41.09 ? 81  ASP B CA  1 
ATOM   1457 C C   . ASP B 1 101 ? 15.224  -12.363 4.322   1.00 42.32 ? 81  ASP B C   1 
ATOM   1458 O O   . ASP B 1 101 ? 14.875  -12.536 3.158   1.00 43.43 ? 81  ASP B O   1 
ATOM   1459 C CB  . ASP B 1 101 ? 17.022  -13.667 5.482   1.00 39.57 ? 81  ASP B CB  1 
ATOM   1460 N N   . ASN B 1 102 ? 14.355  -12.158 5.312   1.00 44.01 ? 82  ASN B N   1 
ATOM   1461 C CA  . ASN B 1 102 ? 12.905  -11.999 5.064   1.00 49.43 ? 82  ASN B CA  1 
ATOM   1462 C C   . ASN B 1 102 ? 12.377  -10.732 5.728   1.00 53.05 ? 82  ASN B C   1 
ATOM   1463 O O   . ASN B 1 102 ? 12.034  -10.741 6.909   1.00 56.57 ? 82  ASN B O   1 
ATOM   1464 C CB  . ASN B 1 102 ? 12.101  -13.216 5.559   1.00 47.54 ? 82  ASN B CB  1 
ATOM   1465 C CG  . ASN B 1 102 ? 10.707  -13.319 4.936   1.00 47.55 ? 82  ASN B CG  1 
ATOM   1466 O OD1 . ASN B 1 102 ? 9.738   -13.663 5.624   1.00 45.27 ? 82  ASN B OD1 1 
ATOM   1467 N ND2 . ASN B 1 102 ? 10.600  -13.055 3.628   1.00 46.95 ? 82  ASN B ND2 1 
ATOM   1468 N N   . PRO B 1 103 ? 12.307  -9.624  4.973   1.00 55.51 ? 83  PRO B N   1 
ATOM   1469 C CA  . PRO B 1 103 ? 11.768  -8.408  5.564   1.00 54.11 ? 83  PRO B CA  1 
ATOM   1470 C C   . PRO B 1 103 ? 10.278  -8.575  5.871   1.00 53.70 ? 83  PRO B C   1 
ATOM   1471 O O   . PRO B 1 103 ? 9.716   -7.798  6.636   1.00 56.59 ? 83  PRO B O   1 
ATOM   1472 C CB  . PRO B 1 103 ? 11.993  -7.371  4.468   1.00 53.94 ? 83  PRO B CB  1 
ATOM   1473 C CG  . PRO B 1 103 ? 11.889  -8.143  3.201   1.00 54.37 ? 83  PRO B CG  1 
ATOM   1474 C CD  . PRO B 1 103 ? 12.424  -9.513  3.509   1.00 54.28 ? 83  PRO B CD  1 
ATOM   1475 N N   . LYS B 1 104 ? 9.659   -9.596  5.281   1.00 48.82 ? 84  LYS B N   1 
ATOM   1476 C CA  . LYS B 1 104 ? 8.278   -9.944  5.555   1.00 44.46 ? 84  LYS B CA  1 
ATOM   1477 C C   . LYS B 1 104 ? 8.059   -10.302 7.036   1.00 43.99 ? 84  LYS B C   1 
ATOM   1478 O O   . LYS B 1 104 ? 6.915   -10.411 7.484   1.00 43.66 ? 84  LYS B O   1 
ATOM   1479 C CB  . LYS B 1 104 ? 7.837   -11.107 4.639   1.00 45.16 ? 84  LYS B CB  1 
ATOM   1480 C CG  . LYS B 1 104 ? 6.497   -10.911 3.927   1.00 43.38 ? 84  LYS B CG  1 
ATOM   1481 C CD  . LYS B 1 104 ? 5.306   -10.889 4.882   1.00 41.15 ? 84  LYS B CD  1 
ATOM   1482 C CE  . LYS B 1 104 ? 4.925   -9.479  5.296   1.00 39.84 ? 84  LYS B CE  1 
ATOM   1483 N NZ  . LYS B 1 104 ? 3.716   -9.481  6.160   1.00 40.93 ? 84  LYS B NZ  1 
ATOM   1484 N N   . VAL B 1 105 ? 9.125   -10.480 7.814   1.00 45.47 ? 85  VAL B N   1 
ATOM   1485 C CA  . VAL B 1 105 ? 8.928   -10.568 9.270   1.00 49.67 ? 85  VAL B CA  1 
ATOM   1486 C C   . VAL B 1 105 ? 8.175   -9.316  9.752   1.00 54.21 ? 85  VAL B C   1 
ATOM   1487 O O   . VAL B 1 105 ? 7.337   -9.407  10.646  1.00 53.10 ? 85  VAL B O   1 
ATOM   1488 C CB  . VAL B 1 105 ? 10.226  -10.750 10.116  1.00 47.97 ? 85  VAL B CB  1 
ATOM   1489 C CG1 . VAL B 1 105 ? 11.296  -11.505 9.362   1.00 47.30 ? 85  VAL B CG1 1 
ATOM   1490 C CG2 . VAL B 1 105 ? 10.776  -9.414  10.624  1.00 47.69 ? 85  VAL B CG2 1 
ATOM   1491 N N   . TYR B 1 106 ? 8.490   -8.154  9.170   1.00 57.84 ? 86  TYR B N   1 
ATOM   1492 C CA  . TYR B 1 106 ? 7.755   -6.920  9.474   1.00 62.04 ? 86  TYR B CA  1 
ATOM   1493 C C   . TYR B 1 106 ? 7.366   -6.059  8.262   1.00 62.04 ? 86  TYR B C   1 
ATOM   1494 O O   . TYR B 1 106 ? 6.377   -5.328  8.336   1.00 65.78 ? 86  TYR B O   1 
ATOM   1495 C CB  . TYR B 1 106 ? 8.507   -6.070  10.513  1.00 64.75 ? 86  TYR B CB  1 
ATOM   1496 C CG  . TYR B 1 106 ? 9.506   -5.056  9.971   1.00 69.05 ? 86  TYR B CG  1 
ATOM   1497 C CD1 . TYR B 1 106 ? 9.077   -3.880  9.348   1.00 70.65 ? 86  TYR B CD1 1 
ATOM   1498 C CD2 . TYR B 1 106 ? 10.882  -5.244  10.138  1.00 70.35 ? 86  TYR B CD2 1 
ATOM   1499 C CE1 . TYR B 1 106 ? 9.987   -2.944  8.877   1.00 74.49 ? 86  TYR B CE1 1 
ATOM   1500 C CE2 . TYR B 1 106 ? 11.798  -4.311  9.672   1.00 71.65 ? 86  TYR B CE2 1 
ATOM   1501 C CZ  . TYR B 1 106 ? 11.348  -3.163  9.045   1.00 74.91 ? 86  TYR B CZ  1 
ATOM   1502 O OH  . TYR B 1 106 ? 12.256  -2.235  8.583   1.00 75.50 ? 86  TYR B OH  1 
ATOM   1503 N N   . LYS B 1 107 ? 8.121   -6.116  7.168   1.00 59.06 ? 87  LYS B N   1 
ATOM   1504 C CA  . LYS B 1 107 ? 7.843   -5.229  6.036   1.00 56.74 ? 87  LYS B CA  1 
ATOM   1505 C C   . LYS B 1 107 ? 6.588   -5.634  5.271   1.00 54.65 ? 87  LYS B C   1 
ATOM   1506 O O   . LYS B 1 107 ? 6.474   -6.750  4.771   1.00 57.23 ? 87  LYS B O   1 
ATOM   1507 C CB  . LYS B 1 107 ? 9.029   -5.109  5.073   1.00 54.61 ? 87  LYS B CB  1 
ATOM   1508 C CG  . LYS B 1 107 ? 9.958   -3.934  5.371   1.00 53.29 ? 87  LYS B CG  1 
ATOM   1509 C CD  . LYS B 1 107 ? 10.684  -3.438  4.115   1.00 51.96 ? 87  LYS B CD  1 
ATOM   1510 C CE  . LYS B 1 107 ? 10.418  -1.952  3.887   1.00 49.81 ? 87  LYS B CE  1 
ATOM   1511 N NZ  . LYS B 1 107 ? 11.102  -1.402  2.686   1.00 48.25 ? 87  LYS B NZ  1 
ATOM   1512 N N   . ASN B 1 108 ? 5.648   -4.698  5.196   1.00 49.69 ? 88  ASN B N   1 
ATOM   1513 C CA  . ASN B 1 108 ? 4.441   -4.873  4.409   1.00 47.06 ? 88  ASN B CA  1 
ATOM   1514 C C   . ASN B 1 108 ? 4.676   -4.975  2.911   1.00 41.86 ? 88  ASN B C   1 
ATOM   1515 O O   . ASN B 1 108 ? 5.647   -4.429  2.391   1.00 39.43 ? 88  ASN B O   1 
ATOM   1516 C CB  . ASN B 1 108 ? 3.468   -3.719  4.662   1.00 45.82 ? 88  ASN B CB  1 
ATOM   1517 C CG  . ASN B 1 108 ? 2.723   -3.884  5.953   1.00 49.72 ? 88  ASN B CG  1 
ATOM   1518 O OD1 . ASN B 1 108 ? 2.092   -4.940  6.179   1.00 44.85 ? 88  ASN B OD1 1 
ATOM   1519 N ND2 . ASN B 1 108 ? 2.786   -2.856  6.828   1.00 48.48 ? 88  ASN B ND2 1 
ATOM   1520 N N   . PHE B 1 109 ? 3.737   -5.655  2.247   1.00 36.08 ? 89  PHE B N   1 
ATOM   1521 C CA  . PHE B 1 109 ? 3.632   -5.706  0.804   1.00 35.19 ? 89  PHE B CA  1 
ATOM   1522 C C   . PHE B 1 109 ? 4.766   -6.495  0.129   1.00 38.24 ? 89  PHE B C   1 
ATOM   1523 O O   . PHE B 1 109 ? 4.923   -6.434  -1.086  1.00 39.14 ? 89  PHE B O   1 
ATOM   1524 C CB  . PHE B 1 109 ? 3.515   -4.275  0.232   1.00 35.81 ? 89  PHE B CB  1 
ATOM   1525 C CG  . PHE B 1 109 ? 2.623   -3.359  1.054   1.00 33.77 ? 89  PHE B CG  1 
ATOM   1526 C CD1 . PHE B 1 109 ? 1.255   -3.597  1.135   1.00 32.38 ? 89  PHE B CD1 1 
ATOM   1527 C CD2 . PHE B 1 109 ? 3.157   -2.290  1.758   1.00 31.92 ? 89  PHE B CD2 1 
ATOM   1528 C CE1 . PHE B 1 109 ? 0.436   -2.797  1.896   1.00 31.16 ? 89  PHE B CE1 1 
ATOM   1529 C CE2 . PHE B 1 109 ? 2.341   -1.482  2.521   1.00 33.94 ? 89  PHE B CE2 1 
ATOM   1530 C CZ  . PHE B 1 109 ? 0.966   -1.739  2.578   1.00 33.18 ? 89  PHE B CZ  1 
ATOM   1531 N N   . ILE B 1 110 ? 5.528   -7.263  0.901   1.00 40.12 ? 90  ILE B N   1 
ATOM   1532 C CA  . ILE B 1 110 ? 6.669   -7.986  0.365   1.00 42.05 ? 90  ILE B CA  1 
ATOM   1533 C C   . ILE B 1 110 ? 6.271   -9.449  0.084   1.00 46.78 ? 90  ILE B C   1 
ATOM   1534 O O   . ILE B 1 110 ? 6.015   -10.230 1.010   1.00 48.83 ? 90  ILE B O   1 
ATOM   1535 C CB  . ILE B 1 110 ? 7.853   -7.951  1.346   1.00 41.40 ? 90  ILE B CB  1 
ATOM   1536 C CG1 . ILE B 1 110 ? 8.189   -6.507  1.772   1.00 41.97 ? 90  ILE B CG1 1 
ATOM   1537 C CG2 . ILE B 1 110 ? 9.067   -8.637  0.739   1.00 41.52 ? 90  ILE B CG2 1 
ATOM   1538 C CD1 . ILE B 1 110 ? 9.126   -5.739  0.853   1.00 39.72 ? 90  ILE B CD1 1 
ATOM   1539 N N   . ARG B 1 111 ? 6.233   -9.819  -1.192  1.00 49.16 ? 91  ARG B N   1 
ATOM   1540 C CA  . ARG B 1 111 ? 5.810   -11.160 -1.580  1.00 52.05 ? 91  ARG B CA  1 
ATOM   1541 C C   . ARG B 1 111 ? 6.920   -12.192 -1.356  1.00 56.88 ? 91  ARG B C   1 
ATOM   1542 O O   . ARG B 1 111 ? 6.633   -13.385 -1.184  1.00 57.15 ? 91  ARG B O   1 
ATOM   1543 C CB  . ARG B 1 111 ? 5.369   -11.188 -3.037  1.00 51.77 ? 91  ARG B CB  1 
ATOM   1544 C CG  . ARG B 1 111 ? 3.996   -10.575 -3.294  1.00 55.16 ? 91  ARG B CG  1 
ATOM   1545 C CD  . ARG B 1 111 ? 3.892   -9.105  -2.922  1.00 52.26 ? 91  ARG B CD  1 
ATOM   1546 N NE  . ARG B 1 111 ? 2.697   -8.500  -3.514  1.00 55.61 ? 91  ARG B NE  1 
ATOM   1547 C CZ  . ARG B 1 111 ? 2.300   -7.236  -3.329  1.00 52.67 ? 91  ARG B CZ  1 
ATOM   1548 N NH1 . ARG B 1 111 ? 2.998   -6.409  -2.560  1.00 48.57 ? 91  ARG B NH1 1 
ATOM   1549 N NH2 . ARG B 1 111 ? 1.191   -6.798  -3.918  1.00 49.55 ? 91  ARG B NH2 1 
ATOM   1550 N N   . GLN B 1 112 ? 8.176   -11.743 -1.359  1.00 55.38 ? 92  GLN B N   1 
ATOM   1551 C CA  . GLN B 1 112 ? 9.315   -12.654 -1.239  1.00 57.29 ? 92  GLN B CA  1 
ATOM   1552 C C   . GLN B 1 112 ? 10.610  -11.915 -0.955  1.00 56.82 ? 92  GLN B C   1 
ATOM   1553 O O   . GLN B 1 112 ? 10.778  -10.776 -1.381  1.00 62.23 ? 92  GLN B O   1 
ATOM   1554 C CB  . GLN B 1 112 ? 9.487   -13.452 -2.535  1.00 58.29 ? 92  GLN B CB  1 
ATOM   1555 C CG  . GLN B 1 112 ? 9.917   -12.605 -3.731  1.00 59.76 ? 92  GLN B CG  1 
ATOM   1556 C CD  . GLN B 1 112 ? 9.686   -13.293 -5.071  1.00 61.07 ? 92  GLN B CD  1 
ATOM   1557 O OE1 . GLN B 1 112 ? 8.718   -14.033 -5.245  1.00 63.00 ? 92  GLN B OE1 1 
ATOM   1558 N NE2 . GLN B 1 112 ? 10.566  -13.035 -6.029  1.00 61.20 ? 92  GLN B NE2 1 
ATOM   1559 N N   . CYS B 1 113 ? 11.535  -12.570 -0.258  1.00 55.49 ? 93  CYS B N   1 
ATOM   1560 C CA  . CYS B 1 113 ? 12.894  -12.049 -0.139  1.00 54.21 ? 93  CYS B CA  1 
ATOM   1561 C C   . CYS B 1 113 ? 13.976  -13.111 0.036   1.00 53.69 ? 93  CYS B C   1 
ATOM   1562 O O   . CYS B 1 113 ? 13.953  -13.924 0.957   1.00 52.16 ? 93  CYS B O   1 
ATOM   1563 C CB  . CYS B 1 113 ? 12.992  -11.049 0.978   1.00 54.55 ? 93  CYS B CB  1 
ATOM   1564 S SG  . CYS B 1 113 ? 14.588  -10.221 1.004   1.00 55.30 ? 93  CYS B SG  1 
ATOM   1565 N N   . ARG B 1 114 ? 14.960  -13.033 -0.845  1.00 53.12 ? 94  ARG B N   1 
ATOM   1566 C CA  . ARG B 1 114 ? 15.837  -14.130 -1.132  1.00 53.33 ? 94  ARG B CA  1 
ATOM   1567 C C   . ARG B 1 114 ? 17.260  -13.672 -0.795  1.00 56.51 ? 94  ARG B C   1 
ATOM   1568 O O   . ARG B 1 114 ? 17.446  -12.800 0.065   1.00 60.16 ? 94  ARG B O   1 
ATOM   1569 C CB  . ARG B 1 114 ? 15.689  -14.511 -2.612  1.00 53.53 ? 94  ARG B CB  1 
ATOM   1570 C CG  . ARG B 1 114 ? 14.381  -14.090 -3.294  1.00 52.32 ? 94  ARG B CG  1 
ATOM   1571 C CD  . ARG B 1 114 ? 13.268  -15.136 -3.241  1.00 53.60 ? 94  ARG B CD  1 
ATOM   1572 N NE  . ARG B 1 114 ? 12.572  -15.214 -4.540  1.00 53.17 ? 94  ARG B NE  1 
ATOM   1573 C CZ  . ARG B 1 114 ? 11.915  -16.281 -5.015  1.00 51.46 ? 94  ARG B CZ  1 
ATOM   1574 N NH1 . ARG B 1 114 ? 11.816  -17.409 -4.312  1.00 46.71 ? 94  ARG B NH1 1 
ATOM   1575 N NH2 . ARG B 1 114 ? 11.349  -16.218 -6.219  1.00 51.14 ? 94  ARG B NH2 1 
ATOM   1576 N N   . ILE B 1 115 ? 18.261  -14.272 -1.437  1.00 55.61 ? 95  ILE B N   1 
ATOM   1577 C CA  . ILE B 1 115 ? 19.650  -13.814 -1.312  1.00 55.07 ? 95  ILE B CA  1 
ATOM   1578 C C   . ILE B 1 115 ? 20.441  -14.140 -2.582  1.00 54.15 ? 95  ILE B C   1 
ATOM   1579 O O   . ILE B 1 115 ? 20.160  -15.141 -3.265  1.00 58.08 ? 95  ILE B O   1 
ATOM   1580 C CB  . ILE B 1 115 ? 20.356  -14.448 -0.101  1.00 51.27 ? 95  ILE B CB  1 
ATOM   1581 N N   . VAL B 1 116 ? 21.405  -13.279 -2.907  1.00 48.22 ? 96  VAL B N   1 
ATOM   1582 C CA  . VAL B 1 116 ? 22.287  -13.496 -4.052  1.00 45.08 ? 96  VAL B CA  1 
ATOM   1583 C C   . VAL B 1 116 ? 23.684  -12.969 -3.758  1.00 42.91 ? 96  VAL B C   1 
ATOM   1584 O O   . VAL B 1 116 ? 23.846  -11.974 -3.054  1.00 40.09 ? 96  VAL B O   1 
ATOM   1585 C CB  . VAL B 1 116 ? 21.782  -12.777 -5.318  1.00 45.04 ? 96  VAL B CB  1 
ATOM   1586 C CG1 . VAL B 1 116 ? 22.378  -13.442 -6.557  1.00 43.73 ? 96  VAL B CG1 1 
ATOM   1587 C CG2 . VAL B 1 116 ? 20.258  -12.753 -5.387  1.00 41.79 ? 96  VAL B CG2 1 
ATOM   1588 N N   . LEU B 1 121 ? 23.896  -13.639 6.229   1.00 42.01 ? 101 LEU B N   1 
ATOM   1589 C CA  . LEU B 1 121 ? 24.067  -12.545 5.282   1.00 42.88 ? 101 LEU B CA  1 
ATOM   1590 C C   . LEU B 1 121 ? 24.799  -11.377 5.945   1.00 46.45 ? 101 LEU B C   1 
ATOM   1591 O O   . LEU B 1 121 ? 24.511  -11.012 7.102   1.00 41.84 ? 101 LEU B O   1 
ATOM   1592 C CB  . LEU B 1 121 ? 22.720  -12.044 4.767   1.00 43.10 ? 101 LEU B CB  1 
ATOM   1593 C CG  . LEU B 1 121 ? 21.735  -13.023 4.120   1.00 42.91 ? 101 LEU B CG  1 
ATOM   1594 C CD1 . LEU B 1 121 ? 20.335  -12.606 4.507   1.00 42.58 ? 101 LEU B CD1 1 
ATOM   1595 C CD2 . LEU B 1 121 ? 21.879  -13.100 2.598   1.00 41.97 ? 101 LEU B CD2 1 
ATOM   1596 N N   . HIS B 1 122 ? 25.727  -10.799 5.184   1.00 47.67 ? 102 HIS B N   1 
ATOM   1597 C CA  . HIS B 1 122 ? 26.665  -9.818  5.670   1.00 47.79 ? 102 HIS B CA  1 
ATOM   1598 C C   . HIS B 1 122 ? 26.354  -8.469  5.045   1.00 46.79 ? 102 HIS B C   1 
ATOM   1599 O O   . HIS B 1 122 ? 25.289  -8.275  4.467   1.00 43.16 ? 102 HIS B O   1 
ATOM   1600 C CB  . HIS B 1 122 ? 28.083  -10.228 5.262   1.00 52.69 ? 102 HIS B CB  1 
ATOM   1601 C CG  . HIS B 1 122 ? 28.584  -11.469 5.930   1.00 55.05 ? 102 HIS B CG  1 
ATOM   1602 N ND1 . HIS B 1 122 ? 28.811  -12.641 5.241   1.00 57.27 ? 102 HIS B ND1 1 
ATOM   1603 C CD2 . HIS B 1 122 ? 28.937  -11.712 7.214   1.00 56.93 ? 102 HIS B CD2 1 
ATOM   1604 C CE1 . HIS B 1 122 ? 29.275  -13.554 6.075   1.00 54.85 ? 102 HIS B CE1 1 
ATOM   1605 N NE2 . HIS B 1 122 ? 29.359  -13.018 7.278   1.00 55.44 ? 102 HIS B NE2 1 
ATOM   1606 N N   . VAL B 1 123 ? 27.296  -7.532  5.170   1.00 46.79 ? 103 VAL B N   1 
ATOM   1607 C CA  . VAL B 1 123 ? 27.222  -6.263  4.437   1.00 44.30 ? 103 VAL B CA  1 
ATOM   1608 C C   . VAL B 1 123 ? 27.472  -6.459  2.951   1.00 40.69 ? 103 VAL B C   1 
ATOM   1609 O O   . VAL B 1 123 ? 28.223  -7.336  2.560   1.00 41.59 ? 103 VAL B O   1 
ATOM   1610 C CB  . VAL B 1 123 ? 28.221  -5.225  4.969   1.00 42.88 ? 103 VAL B CB  1 
ATOM   1611 C CG1 . VAL B 1 123 ? 27.826  -4.801  6.374   1.00 43.77 ? 103 VAL B CG1 1 
ATOM   1612 C CG2 . VAL B 1 123 ? 29.647  -5.758  4.922   1.00 43.65 ? 103 VAL B CG2 1 
ATOM   1613 N N   . GLY B 1 124 ? 26.818  -5.651  2.127   1.00 38.59 ? 104 GLY B N   1 
ATOM   1614 C CA  . GLY B 1 124 ? 27.017  -5.703  0.682   1.00 37.87 ? 104 GLY B CA  1 
ATOM   1615 C C   . GLY B 1 124 ? 26.481  -6.946  0.012   1.00 38.73 ? 104 GLY B C   1 
ATOM   1616 O O   . GLY B 1 124 ? 26.723  -7.143  -1.174  1.00 37.66 ? 104 GLY B O   1 
ATOM   1617 N N   . ASP B 1 125 ? 25.740  -7.769  0.765   1.00 42.13 ? 105 ASP B N   1 
ATOM   1618 C CA  . ASP B 1 125 ? 25.093  -8.986  0.254   1.00 41.80 ? 105 ASP B CA  1 
ATOM   1619 C C   . ASP B 1 125 ? 23.683  -8.683  -0.223  1.00 40.23 ? 105 ASP B C   1 
ATOM   1620 O O   . ASP B 1 125 ? 22.741  -8.742  0.555   1.00 42.53 ? 105 ASP B O   1 
ATOM   1621 C CB  . ASP B 1 125 ? 25.025  -10.044 1.351   1.00 42.42 ? 105 ASP B CB  1 
ATOM   1622 N N   . LEU B 1 126 ? 23.541  -8.389  -1.510  1.00 41.10 ? 106 LEU B N   1 
ATOM   1623 C CA  . LEU B 1 126 ? 22.308  -7.829  -2.050  1.00 42.15 ? 106 LEU B CA  1 
ATOM   1624 C C   . LEU B 1 126 ? 21.062  -8.579  -1.631  1.00 42.46 ? 106 LEU B C   1 
ATOM   1625 O O   . LEU B 1 126 ? 21.124  -9.760  -1.296  1.00 43.58 ? 106 LEU B O   1 
ATOM   1626 C CB  . LEU B 1 126 ? 22.355  -7.763  -3.568  1.00 44.73 ? 106 LEU B CB  1 
ATOM   1627 C CG  . LEU B 1 126 ? 22.372  -9.106  -4.321  1.00 48.32 ? 106 LEU B CG  1 
ATOM   1628 C CD1 . LEU B 1 126 ? 21.637  -9.009  -5.654  1.00 50.18 ? 106 LEU B CD1 1 
ATOM   1629 C CD2 . LEU B 1 126 ? 23.790  -9.569  -4.554  1.00 48.35 ? 106 LEU B CD2 1 
ATOM   1630 N N   . ARG B 1 127 ? 19.930  -7.875  -1.673  1.00 42.11 ? 107 ARG B N   1 
ATOM   1631 C CA  . ARG B 1 127 ? 18.616  -8.460  -1.407  1.00 38.72 ? 107 ARG B CA  1 
ATOM   1632 C C   . ARG B 1 127 ? 17.721  -8.492  -2.648  1.00 40.84 ? 107 ARG B C   1 
ATOM   1633 O O   . ARG B 1 127 ? 17.831  -7.637  -3.546  1.00 36.79 ? 107 ARG B O   1 
ATOM   1634 C CB  . ARG B 1 127 ? 17.915  -7.687  -0.295  1.00 36.10 ? 107 ARG B CB  1 
ATOM   1635 C CG  . ARG B 1 127 ? 16.434  -8.005  -0.151  1.00 33.64 ? 107 ARG B CG  1 
ATOM   1636 C CD  . ARG B 1 127 ? 15.842  -7.448  1.117   1.00 31.62 ? 107 ARG B CD  1 
ATOM   1637 N NE  . ARG B 1 127 ? 16.030  -6.011  1.279   1.00 30.38 ? 107 ARG B NE  1 
ATOM   1638 C CZ  . ARG B 1 127 ? 15.422  -5.294  2.224   1.00 31.73 ? 107 ARG B CZ  1 
ATOM   1639 N NH1 . ARG B 1 127 ? 14.598  -5.880  3.105   1.00 31.52 ? 107 ARG B NH1 1 
ATOM   1640 N NH2 . ARG B 1 127 ? 15.632  -3.986  2.301   1.00 30.06 ? 107 ARG B NH2 1 
ATOM   1641 N N   . GLU B 1 128 ? 16.817  -9.481  -2.668  1.00 42.09 ? 108 GLU B N   1 
ATOM   1642 C CA  . GLU B 1 128 ? 15.849  -9.633  -3.745  1.00 41.03 ? 108 GLU B CA  1 
ATOM   1643 C C   . GLU B 1 128 ? 14.431  -9.568  -3.214  1.00 41.88 ? 108 GLU B C   1 
ATOM   1644 O O   . GLU B 1 128 ? 14.115  -10.219 -2.207  1.00 40.72 ? 108 GLU B O   1 
ATOM   1645 C CB  . GLU B 1 128 ? 16.066  -10.965 -4.469  1.00 40.11 ? 108 GLU B CB  1 
ATOM   1646 C CG  . GLU B 1 128 ? 14.996  -11.302 -5.504  1.00 39.60 ? 108 GLU B CG  1 
ATOM   1647 C CD  . GLU B 1 128 ? 14.887  -10.259 -6.606  1.00 39.26 ? 108 GLU B CD  1 
ATOM   1648 O OE1 . GLU B 1 128 ? 14.064  -10.437 -7.551  1.00 39.80 ? 108 GLU B OE1 1 
ATOM   1649 O OE2 . GLU B 1 128 ? 15.650  -9.278  -6.535  1.00 35.12 ? 108 GLU B OE2 1 
ATOM   1650 N N   . VAL B 1 129 ? 13.573  -8.814  -3.918  1.00 41.95 ? 109 VAL B N   1 
ATOM   1651 C CA  . VAL B 1 129 ? 12.181  -8.571  -3.486  1.00 40.23 ? 109 VAL B CA  1 
ATOM   1652 C C   . VAL B 1 129 ? 11.215  -8.228  -4.627  1.00 37.56 ? 109 VAL B C   1 
ATOM   1653 O O   . VAL B 1 129 ? 11.473  -7.323  -5.410  1.00 36.87 ? 109 VAL B O   1 
ATOM   1654 C CB  . VAL B 1 129 ? 12.116  -7.421  -2.469  1.00 42.12 ? 109 VAL B CB  1 
ATOM   1655 C CG1 . VAL B 1 129 ? 10.672  -7.056  -2.136  1.00 43.44 ? 109 VAL B CG1 1 
ATOM   1656 N N   . MET B 1 130 ? 10.101  -8.955  -4.706  1.00 35.00 ? 110 MET B N   1 
ATOM   1657 C CA  . MET B 1 130 ? 9.068   -8.633  -5.634  1.00 35.37 ? 110 MET B CA  1 
ATOM   1658 C C   . MET B 1 130 ? 7.829   -8.238  -4.868  1.00 39.44 ? 110 MET B C   1 
ATOM   1659 O O   . MET B 1 130 ? 7.574   -8.751  -3.774  1.00 41.42 ? 110 MET B O   1 
ATOM   1660 C CB  . MET B 1 130 ? 8.793   -9.776  -6.592  1.00 37.31 ? 110 MET B CB  1 
ATOM   1661 C CG  . MET B 1 130 ? 8.183   -9.292  -7.906  1.00 38.08 ? 110 MET B CG  1 
ATOM   1662 S SD  . MET B 1 130 ? 8.615   -10.316 -9.328  1.00 36.42 ? 110 MET B SD  1 
ATOM   1663 C CE  . MET B 1 130 ? 7.057   -11.175 -9.537  1.00 34.63 ? 110 MET B CE  1 
ATOM   1664 N N   . VAL B 1 131 ? 7.082   -7.298  -5.441  1.00 41.20 ? 111 VAL B N   1 
ATOM   1665 C CA  . VAL B 1 131 ? 5.983   -6.658  -4.753  1.00 42.74 ? 111 VAL B CA  1 
ATOM   1666 C C   . VAL B 1 131 ? 5.081   -5.942  -5.752  1.00 46.95 ? 111 VAL B C   1 
ATOM   1667 O O   . VAL B 1 131 ? 4.422   -4.956  -5.416  1.00 55.71 ? 111 VAL B O   1 
ATOM   1668 C CB  . VAL B 1 131 ? 6.512   -5.656  -3.700  1.00 43.45 ? 111 VAL B CB  1 
ATOM   1669 N N   . PRO B 1 136 ? 1.422   -5.322  -7.816  1.00 77.67 ? 116 PRO B N   1 
ATOM   1670 C CA  . PRO B 1 136 ? 2.346   -6.440  -7.921  1.00 75.54 ? 116 PRO B CA  1 
ATOM   1671 C C   . PRO B 1 136 ? 3.130   -6.392  -9.218  1.00 73.33 ? 116 PRO B C   1 
ATOM   1672 O O   . PRO B 1 136 ? 2.977   -5.440  -9.988  1.00 70.39 ? 116 PRO B O   1 
ATOM   1673 C CB  . PRO B 1 136 ? 1.430   -7.670  -7.905  1.00 74.55 ? 116 PRO B CB  1 
ATOM   1674 C CG  . PRO B 1 136 ? 0.103   -7.199  -7.398  1.00 78.83 ? 116 PRO B CG  1 
ATOM   1675 C CD  . PRO B 1 136 ? 0.164   -5.715  -7.164  1.00 80.36 ? 116 PRO B CD  1 
ATOM   1676 N N   . ALA B 1 137 ? 3.949   -7.422  -9.446  1.00 69.09 ? 117 ALA B N   1 
ATOM   1677 C CA  . ALA B 1 137 ? 4.764   -7.535  -10.648 1.00 61.56 ? 117 ALA B CA  1 
ATOM   1678 C C   . ALA B 1 137 ? 5.680   -6.324  -10.742 1.00 65.02 ? 117 ALA B C   1 
ATOM   1679 O O   . ALA B 1 137 ? 5.554   -5.488  -11.648 1.00 69.82 ? 117 ALA B O   1 
ATOM   1680 C CB  . ALA B 1 137 ? 3.884   -7.662  -11.887 1.00 60.67 ? 117 ALA B CB  1 
ATOM   1681 N N   . VAL B 1 138 ? 6.576   -6.224  -9.765  1.00 61.78 ? 118 VAL B N   1 
ATOM   1682 C CA  . VAL B 1 138 ? 7.555   -5.140  -9.675  1.00 59.50 ? 118 VAL B CA  1 
ATOM   1683 C C   . VAL B 1 138 ? 8.579   -5.473  -8.586  1.00 62.90 ? 118 VAL B C   1 
ATOM   1684 O O   . VAL B 1 138 ? 8.262   -5.434  -7.386  1.00 60.09 ? 118 VAL B O   1 
ATOM   1685 C CB  . VAL B 1 138 ? 6.909   -3.768  -9.348  1.00 60.26 ? 118 VAL B CB  1 
ATOM   1686 C CG1 . VAL B 1 138 ? 6.980   -2.843  -10.547 1.00 58.61 ? 118 VAL B CG1 1 
ATOM   1687 C CG2 . VAL B 1 138 ? 5.474   -3.919  -8.839  1.00 60.09 ? 118 VAL B CG2 1 
ATOM   1688 N N   . SER B 1 139 ? 9.802   -5.804  -8.999  1.00 60.57 ? 119 SER B N   1 
ATOM   1689 C CA  . SER B 1 139 ? 10.820  -6.217  -8.049  1.00 57.94 ? 119 SER B CA  1 
ATOM   1690 C C   . SER B 1 139 ? 11.865  -5.123  -7.844  1.00 57.85 ? 119 SER B C   1 
ATOM   1691 O O   . SER B 1 139 ? 12.434  -4.587  -8.814  1.00 56.64 ? 119 SER B O   1 
ATOM   1692 C CB  . SER B 1 139 ? 11.483  -7.531  -8.494  1.00 57.37 ? 119 SER B CB  1 
ATOM   1693 O OG  . SER B 1 139 ? 12.061  -7.406  -9.786  1.00 61.44 ? 119 SER B OG  1 
ATOM   1694 N N   . SER B 1 140 ? 12.114  -4.806  -6.574  1.00 52.35 ? 120 SER B N   1 
ATOM   1695 C CA  . SER B 1 140 ? 13.178  -3.888  -6.191  1.00 53.48 ? 120 SER B CA  1 
ATOM   1696 C C   . SER B 1 140 ? 14.534  -4.518  -6.517  1.00 54.35 ? 120 SER B C   1 
ATOM   1697 O O   . SER B 1 140 ? 14.603  -5.528  -7.220  1.00 54.05 ? 120 SER B O   1 
ATOM   1698 C CB  . SER B 1 140 ? 13.078  -3.580  -4.686  1.00 52.23 ? 120 SER B CB  1 
ATOM   1699 O OG  . SER B 1 140 ? 11.839  -2.975  -4.336  1.00 52.57 ? 120 SER B OG  1 
ATOM   1700 N N   . THR B 1 141 ? 15.609  -3.917  -6.018  1.00 55.41 ? 121 THR B N   1 
ATOM   1701 C CA  . THR B 1 141 ? 16.909  -4.585  -5.966  1.00 56.69 ? 121 THR B CA  1 
ATOM   1702 C C   . THR B 1 141 ? 17.733  -4.017  -4.810  1.00 56.25 ? 121 THR B C   1 
ATOM   1703 O O   . THR B 1 141 ? 18.688  -3.281  -5.028  1.00 59.44 ? 121 THR B O   1 
ATOM   1704 C CB  . THR B 1 141 ? 17.678  -4.438  -7.294  1.00 54.30 ? 121 THR B CB  1 
ATOM   1705 N N   . GLU B 1 142 ? 17.356  -4.356  -3.579  1.00 53.30 ? 122 GLU B N   1 
ATOM   1706 C CA  . GLU B 1 142 ? 17.993  -3.768  -2.391  1.00 50.55 ? 122 GLU B CA  1 
ATOM   1707 C C   . GLU B 1 142 ? 19.345  -4.402  -2.095  1.00 49.38 ? 122 GLU B C   1 
ATOM   1708 O O   . GLU B 1 142 ? 19.691  -5.433  -2.674  1.00 53.13 ? 122 GLU B O   1 
ATOM   1709 C CB  . GLU B 1 142 ? 17.085  -3.882  -1.159  1.00 49.16 ? 122 GLU B CB  1 
ATOM   1710 C CG  . GLU B 1 142 ? 15.791  -3.069  -1.215  1.00 48.04 ? 122 GLU B CG  1 
ATOM   1711 C CD  . GLU B 1 142 ? 14.609  -3.880  -1.720  1.00 46.11 ? 122 GLU B CD  1 
ATOM   1712 O OE1 . GLU B 1 142 ? 14.803  -4.663  -2.654  1.00 44.47 ? 122 GLU B OE1 1 
ATOM   1713 O OE2 . GLU B 1 142 ? 13.489  -3.746  -1.185  1.00 47.09 ? 122 GLU B OE2 1 
ATOM   1714 N N   . ARG B 1 143 ? 20.100  -3.780  -1.189  1.00 48.36 ? 123 ARG B N   1 
ATOM   1715 C CA  . ARG B 1 143 ? 21.437  -4.247  -0.803  1.00 46.35 ? 123 ARG B CA  1 
ATOM   1716 C C   . ARG B 1 143 ? 21.721  -3.854  0.626   1.00 48.46 ? 123 ARG B C   1 
ATOM   1717 O O   . ARG B 1 143 ? 21.409  -2.721  1.023   1.00 50.67 ? 123 ARG B O   1 
ATOM   1718 C CB  . ARG B 1 143 ? 22.516  -3.628  -1.698  1.00 44.52 ? 123 ARG B CB  1 
ATOM   1719 C CG  . ARG B 1 143 ? 23.931  -4.130  -1.415  1.00 44.54 ? 123 ARG B CG  1 
ATOM   1720 C CD  . ARG B 1 143 ? 24.908  -3.817  -2.546  1.00 44.81 ? 123 ARG B CD  1 
ATOM   1721 N NE  . ARG B 1 143 ? 25.591  -2.540  -2.350  1.00 46.18 ? 123 ARG B NE  1 
ATOM   1722 C CZ  . ARG B 1 143 ? 26.112  -1.785  -3.317  1.00 46.64 ? 123 ARG B CZ  1 
ATOM   1723 N NH1 . ARG B 1 143 ? 26.038  -2.153  -4.586  1.00 48.53 ? 123 ARG B NH1 1 
ATOM   1724 N NH2 . ARG B 1 143 ? 26.697  -0.634  -3.011  1.00 48.07 ? 123 ARG B NH2 1 
ATOM   1725 N N   . LEU B 1 144 ? 22.338  -4.763  1.391   1.00 45.59 ? 124 LEU B N   1 
ATOM   1726 C CA  . LEU B 1 144 ? 22.683  -4.471  2.796   1.00 45.70 ? 124 LEU B CA  1 
ATOM   1727 C C   . LEU B 1 144 ? 23.929  -3.583  2.862   1.00 46.31 ? 124 LEU B C   1 
ATOM   1728 O O   . LEU B 1 144 ? 25.034  -4.031  2.532   1.00 43.80 ? 124 LEU B O   1 
ATOM   1729 C CB  . LEU B 1 144 ? 22.895  -5.758  3.593   1.00 44.54 ? 124 LEU B CB  1 
ATOM   1730 C CG  . LEU B 1 144 ? 22.529  -5.682  5.079   1.00 45.01 ? 124 LEU B CG  1 
ATOM   1731 C CD1 . LEU B 1 144 ? 22.491  -7.087  5.693   1.00 44.48 ? 124 LEU B CD1 1 
ATOM   1732 C CD2 . LEU B 1 144 ? 23.493  -4.774  5.840   1.00 45.22 ? 124 LEU B CD2 1 
ATOM   1733 N N   . GLU B 1 145 ? 23.744  -2.329  3.282   1.00 47.53 ? 125 GLU B N   1 
ATOM   1734 C CA  . GLU B 1 145 ? 24.828  -1.354  3.282   1.00 46.98 ? 125 GLU B CA  1 
ATOM   1735 C C   . GLU B 1 145 ? 25.329  -0.942  4.666   1.00 48.27 ? 125 GLU B C   1 
ATOM   1736 O O   . GLU B 1 145 ? 26.411  -0.366  4.747   1.00 53.69 ? 125 GLU B O   1 
ATOM   1737 C CB  . GLU B 1 145 ? 24.442  -0.114  2.455   1.00 48.25 ? 125 GLU B CB  1 
ATOM   1738 C CG  . GLU B 1 145 ? 23.469  0.847   3.135   1.00 49.27 ? 125 GLU B CG  1 
ATOM   1739 C CD  . GLU B 1 145 ? 23.051  2.020   2.250   1.00 47.75 ? 125 GLU B CD  1 
ATOM   1740 O OE1 . GLU B 1 145 ? 23.336  3.170   2.645   1.00 46.57 ? 125 GLU B OE1 1 
ATOM   1741 O OE2 . GLU B 1 145 ? 22.436  1.800   1.178   1.00 40.91 ? 125 GLU B OE2 1 
ATOM   1742 N N   . ILE B 1 146 ? 24.564  -1.190  5.736   1.00 47.93 ? 126 ILE B N   1 
ATOM   1743 C CA  . ILE B 1 146 ? 25.050  -0.949  7.122   1.00 47.04 ? 126 ILE B CA  1 
ATOM   1744 C C   . ILE B 1 146 ? 24.510  -1.980  8.110   1.00 47.54 ? 126 ILE B C   1 
ATOM   1745 O O   . ILE B 1 146 ? 23.287  -2.143  8.235   1.00 46.02 ? 126 ILE B O   1 
ATOM   1746 C CB  . ILE B 1 146 ? 24.649  0.426   7.705   1.00 48.25 ? 126 ILE B CB  1 
ATOM   1747 C CG1 . ILE B 1 146 ? 24.992  1.572   6.758   1.00 48.83 ? 126 ILE B CG1 1 
ATOM   1748 C CG2 . ILE B 1 146 ? 25.353  0.646   9.046   1.00 49.79 ? 126 ILE B CG2 1 
ATOM   1749 C CD1 . ILE B 1 146 ? 24.600  2.939   7.289   1.00 50.57 ? 126 ILE B CD1 1 
ATOM   1750 N N   . LEU B 1 147 ? 25.423  -2.629  8.840   1.00 46.01 ? 127 LEU B N   1 
ATOM   1751 C CA  . LEU B 1 147 ? 25.061  -3.623  9.848   1.00 45.00 ? 127 LEU B CA  1 
ATOM   1752 C C   . LEU B 1 147 ? 25.886  -3.489  11.140  1.00 48.42 ? 127 LEU B C   1 
ATOM   1753 O O   . LEU B 1 147 ? 26.710  -4.343  11.460  1.00 53.42 ? 127 LEU B O   1 
ATOM   1754 C CB  . LEU B 1 147 ? 25.183  -5.027  9.258   1.00 42.69 ? 127 LEU B CB  1 
ATOM   1755 C CG  . LEU B 1 147 ? 24.067  -6.038  9.568   1.00 39.57 ? 127 LEU B CG  1 
ATOM   1756 C CD1 . LEU B 1 147 ? 24.155  -7.213  8.602   1.00 37.73 ? 127 LEU B CD1 1 
ATOM   1757 C CD2 . LEU B 1 147 ? 24.142  -6.526  10.993  1.00 37.64 ? 127 LEU B CD2 1 
ATOM   1758 N N   . ASP B 1 148 ? 25.674  -2.394  11.867  1.00 52.17 ? 128 ASP B N   1 
ATOM   1759 C CA  . ASP B 1 148 ? 26.073  -2.320  13.274  1.00 53.32 ? 128 ASP B CA  1 
ATOM   1760 C C   . ASP B 1 148 ? 24.974  -2.999  14.083  1.00 49.70 ? 128 ASP B C   1 
ATOM   1761 O O   . ASP B 1 148 ? 23.832  -3.088  13.631  1.00 47.80 ? 128 ASP B O   1 
ATOM   1762 C CB  . ASP B 1 148 ? 26.290  -0.879  13.748  1.00 54.89 ? 128 ASP B CB  1 
ATOM   1763 C CG  . ASP B 1 148 ? 27.022  -0.813  15.090  1.00 58.24 ? 128 ASP B CG  1 
ATOM   1764 O OD1 . ASP B 1 148 ? 26.527  -1.429  16.060  1.00 57.26 ? 128 ASP B OD1 1 
ATOM   1765 O OD2 . ASP B 1 148 ? 28.096  -0.162  15.174  1.00 62.93 ? 128 ASP B OD2 1 
ATOM   1766 N N   . GLU B 1 149 ? 25.341  -3.508  15.255  1.00 48.02 ? 129 GLU B N   1 
ATOM   1767 C CA  . GLU B 1 149 ? 24.436  -4.323  16.053  1.00 48.28 ? 129 GLU B CA  1 
ATOM   1768 C C   . GLU B 1 149 ? 24.342  -3.957  17.537  1.00 48.80 ? 129 GLU B C   1 
ATOM   1769 O O   . GLU B 1 149 ? 23.497  -4.491  18.240  1.00 48.18 ? 129 GLU B O   1 
ATOM   1770 C CB  . GLU B 1 149 ? 24.778  -5.800  15.881  1.00 47.86 ? 129 GLU B CB  1 
ATOM   1771 C CG  . GLU B 1 149 ? 24.483  -6.329  14.473  1.00 46.50 ? 129 GLU B CG  1 
ATOM   1772 C CD  . GLU B 1 149 ? 23.795  -7.679  14.458  1.00 42.70 ? 129 GLU B CD  1 
ATOM   1773 O OE1 . GLU B 1 149 ? 22.948  -7.938  15.346  1.00 41.81 ? 129 GLU B OE1 1 
ATOM   1774 O OE2 . GLU B 1 149 ? 24.095  -8.468  13.543  1.00 40.40 ? 129 GLU B OE2 1 
ATOM   1775 N N   . GLU B 1 150 ? 25.172  -3.028  17.998  1.00 49.20 ? 130 GLU B N   1 
ATOM   1776 C CA  . GLU B 1 150 ? 24.996  -2.448  19.317  1.00 49.22 ? 130 GLU B CA  1 
ATOM   1777 C C   . GLU B 1 150 ? 24.123  -1.187  19.231  1.00 48.02 ? 130 GLU B C   1 
ATOM   1778 O O   . GLU B 1 150 ? 23.267  -0.967  20.106  1.00 46.93 ? 130 GLU B O   1 
ATOM   1779 C CB  . GLU B 1 150 ? 26.348  -2.150  19.987  1.00 52.28 ? 130 GLU B CB  1 
ATOM   1780 C CG  . GLU B 1 150 ? 27.296  -1.241  19.207  1.00 53.06 ? 130 GLU B CG  1 
ATOM   1781 C CD  . GLU B 1 150 ? 28.522  -0.840  20.016  1.00 56.80 ? 130 GLU B CD  1 
ATOM   1782 O OE1 . GLU B 1 150 ? 28.391  -0.667  21.252  1.00 58.74 ? 130 GLU B OE1 1 
ATOM   1783 O OE2 . GLU B 1 150 ? 29.616  -0.685  19.416  1.00 56.98 ? 130 GLU B OE2 1 
ATOM   1784 N N   . ARG B 1 151 ? 24.338  -0.374  18.186  1.00 43.15 ? 131 ARG B N   1 
ATOM   1785 C CA  . ARG B 1 151 ? 23.547  0.854   17.961  1.00 42.40 ? 131 ARG B CA  1 
ATOM   1786 C C   . ARG B 1 151 ? 22.342  0.584   17.063  1.00 45.53 ? 131 ARG B C   1 
ATOM   1787 O O   . ARG B 1 151 ? 21.645  1.516   16.613  1.00 47.33 ? 131 ARG B O   1 
ATOM   1788 C CB  . ARG B 1 151 ? 24.404  1.981   17.359  1.00 40.75 ? 131 ARG B CB  1 
ATOM   1789 C CG  . ARG B 1 151 ? 25.357  2.639   18.340  1.00 39.12 ? 131 ARG B CG  1 
ATOM   1790 C CD  . ARG B 1 151 ? 26.366  3.524   17.624  1.00 40.19 ? 131 ARG B CD  1 
ATOM   1791 N NE  . ARG B 1 151 ? 27.372  2.774   16.861  1.00 38.38 ? 131 ARG B NE  1 
ATOM   1792 C CZ  . ARG B 1 151 ? 28.140  3.289   15.898  1.00 36.30 ? 131 ARG B CZ  1 
ATOM   1793 N NH1 . ARG B 1 151 ? 28.046  4.559   15.560  1.00 36.50 ? 131 ARG B NH1 1 
ATOM   1794 N NH2 . ARG B 1 151 ? 29.012  2.522   15.257  1.00 38.12 ? 131 ARG B NH2 1 
ATOM   1795 N N   . HIS B 1 152 ? 22.093  -0.692  16.787  1.00 45.63 ? 132 HIS B N   1 
ATOM   1796 C CA  . HIS B 1 152 ? 20.838  -1.099  16.180  1.00 44.59 ? 132 HIS B CA  1 
ATOM   1797 C C   . HIS B 1 152 ? 20.584  -0.401  14.842  1.00 41.18 ? 132 HIS B C   1 
ATOM   1798 O O   . HIS B 1 152 ? 19.476  -0.445  14.313  1.00 41.42 ? 132 HIS B O   1 
ATOM   1799 C CB  . HIS B 1 152 ? 19.681  -0.778  17.130  1.00 45.90 ? 132 HIS B CB  1 
ATOM   1800 C CG  . HIS B 1 152 ? 19.988  -1.003  18.577  1.00 45.37 ? 132 HIS B CG  1 
ATOM   1801 N ND1 . HIS B 1 152 ? 20.246  -2.250  19.099  1.00 47.66 ? 132 HIS B ND1 1 
ATOM   1802 C CD2 . HIS B 1 152 ? 20.045  -0.141  19.618  1.00 45.78 ? 132 HIS B CD2 1 
ATOM   1803 C CE1 . HIS B 1 152 ? 20.457  -2.149  20.397  1.00 48.01 ? 132 HIS B CE1 1 
ATOM   1804 N NE2 . HIS B 1 152 ? 20.342  -0.878  20.738  1.00 48.20 ? 132 HIS B NE2 1 
ATOM   1805 N N   . VAL B 1 153 ? 21.611  0.230   14.293  1.00 39.92 ? 133 VAL B N   1 
ATOM   1806 C CA  . VAL B 1 153 ? 21.483  0.928   13.026  1.00 40.37 ? 133 VAL B CA  1 
ATOM   1807 C C   . VAL B 1 153 ? 21.332  -0.139  11.960  1.00 39.74 ? 133 VAL B C   1 
ATOM   1808 O O   . VAL B 1 153 ? 21.871  -1.235  12.117  1.00 40.66 ? 133 VAL B O   1 
ATOM   1809 C CB  . VAL B 1 153 ? 22.718  1.805   12.723  1.00 40.97 ? 133 VAL B CB  1 
ATOM   1810 C CG1 . VAL B 1 153 ? 22.625  2.413   11.334  1.00 41.17 ? 133 VAL B CG1 1 
ATOM   1811 C CG2 . VAL B 1 153 ? 22.888  2.885   13.783  1.00 40.66 ? 133 VAL B CG2 1 
ATOM   1812 N N   . ILE B 1 154 ? 20.561  0.187   10.921  1.00 38.75 ? 134 ILE B N   1 
ATOM   1813 C CA  . ILE B 1 154 ? 20.413  -0.626  9.722   1.00 39.92 ? 134 ILE B CA  1 
ATOM   1814 C C   . ILE B 1 154 ? 20.099  0.280   8.538   1.00 41.99 ? 134 ILE B C   1 
ATOM   1815 O O   . ILE B 1 154 ? 19.580  1.365   8.726   1.00 40.75 ? 134 ILE B O   1 
ATOM   1816 C CB  . ILE B 1 154 ? 19.280  -1.658  9.814   1.00 40.26 ? 134 ILE B CB  1 
ATOM   1817 C CG1 . ILE B 1 154 ? 18.026  -1.047  10.474  1.00 37.48 ? 134 ILE B CG1 1 
ATOM   1818 C CG2 . ILE B 1 154 ? 19.779  -2.902  10.532  1.00 42.92 ? 134 ILE B CG2 1 
ATOM   1819 C CD1 . ILE B 1 154 ? 16.758  -1.842  10.252  1.00 34.52 ? 134 ILE B CD1 1 
ATOM   1820 N N   . SER B 1 155 ? 20.395  -0.207  7.330   1.00 45.13 ? 135 SER B N   1 
ATOM   1821 C CA  . SER B 1 155 ? 20.285  0.575   6.110   1.00 45.29 ? 135 SER B CA  1 
ATOM   1822 C C   . SER B 1 155 ? 20.384  -0.298  4.856   1.00 45.20 ? 135 SER B C   1 
ATOM   1823 O O   . SER B 1 155 ? 21.109  -1.292  4.848   1.00 47.34 ? 135 SER B O   1 
ATOM   1824 C CB  . SER B 1 155 ? 21.402  1.614   6.085   1.00 45.99 ? 135 SER B CB  1 
ATOM   1825 O OG  . SER B 1 155 ? 21.443  2.287   4.840   1.00 47.66 ? 135 SER B OG  1 
ATOM   1826 N N   . PHE B 1 156 ? 19.663  0.092   3.801   1.00 45.98 ? 136 PHE B N   1 
ATOM   1827 C CA  . PHE B 1 156 ? 19.743  -0.567  2.484   1.00 45.74 ? 136 PHE B CA  1 
ATOM   1828 C C   . PHE B 1 156 ? 19.395  0.356   1.322   1.00 46.88 ? 136 PHE B C   1 
ATOM   1829 O O   . PHE B 1 156 ? 18.464  1.149   1.403   1.00 50.84 ? 136 PHE B O   1 
ATOM   1830 C CB  . PHE B 1 156 ? 18.881  -1.852  2.388   1.00 46.96 ? 136 PHE B CB  1 
ATOM   1831 C CG  . PHE B 1 156 ? 17.745  -1.946  3.387   1.00 45.61 ? 136 PHE B CG  1 
ATOM   1832 C CD1 . PHE B 1 156 ? 16.577  -1.226  3.210   1.00 45.97 ? 136 PHE B CD1 1 
ATOM   1833 C CD2 . PHE B 1 156 ? 17.827  -2.814  4.472   1.00 45.14 ? 136 PHE B CD2 1 
ATOM   1834 C CE1 . PHE B 1 156 ? 15.531  -1.337  4.117   1.00 46.22 ? 136 PHE B CE1 1 
ATOM   1835 C CE2 . PHE B 1 156 ? 16.783  -2.929  5.381   1.00 45.31 ? 136 PHE B CE2 1 
ATOM   1836 C CZ  . PHE B 1 156 ? 15.634  -2.191  5.203   1.00 44.84 ? 136 PHE B CZ  1 
ATOM   1837 N N   . SER B 1 157 ? 20.154  0.238   0.239   1.00 47.27 ? 137 SER B N   1 
ATOM   1838 C CA  . SER B 1 157 ? 19.899  0.972   -0.985  1.00 46.67 ? 137 SER B CA  1 
ATOM   1839 C C   . SER B 1 157 ? 19.289  0.047   -2.028  1.00 50.29 ? 137 SER B C   1 
ATOM   1840 O O   . SER B 1 157 ? 19.796  -1.052  -2.247  1.00 54.71 ? 137 SER B O   1 
ATOM   1841 C CB  . SER B 1 157 ? 21.215  1.486   -1.572  1.00 48.62 ? 137 SER B CB  1 
ATOM   1842 O OG  . SER B 1 157 ? 21.985  0.425   -2.144  1.00 41.93 ? 137 SER B OG  1 
ATOM   1843 N N   . VAL B 1 158 ? 18.241  0.503   -2.704  1.00 50.01 ? 138 VAL B N   1 
ATOM   1844 C CA  . VAL B 1 158 ? 17.815  -0.131  -3.953  1.00 53.97 ? 138 VAL B CA  1 
ATOM   1845 C C   . VAL B 1 158 ? 18.931  0.049   -4.995  1.00 54.61 ? 138 VAL B C   1 
ATOM   1846 O O   . VAL B 1 158 ? 19.359  1.166   -5.250  1.00 53.89 ? 138 VAL B O   1 
ATOM   1847 C CB  . VAL B 1 158 ? 16.519  0.504   -4.521  1.00 55.57 ? 138 VAL B CB  1 
ATOM   1848 C CG1 . VAL B 1 158 ? 16.178  -0.116  -5.874  1.00 53.65 ? 138 VAL B CG1 1 
ATOM   1849 C CG2 . VAL B 1 158 ? 15.346  0.367   -3.541  1.00 54.75 ? 138 VAL B CG2 1 
ATOM   1850 N N   . VAL B 1 159 ? 19.388  -1.052  -5.596  1.00 57.58 ? 139 VAL B N   1 
ATOM   1851 C CA  . VAL B 1 159 ? 20.468  -1.023  -6.592  1.00 54.00 ? 139 VAL B CA  1 
ATOM   1852 C C   . VAL B 1 159 ? 19.933  -1.381  -7.999  1.00 52.34 ? 139 VAL B C   1 
ATOM   1853 O O   . VAL B 1 159 ? 20.414  -2.284  -8.679  1.00 49.62 ? 139 VAL B O   1 
ATOM   1854 C CB  . VAL B 1 159 ? 21.685  -1.872  -6.118  1.00 53.50 ? 139 VAL B CB  1 
ATOM   1855 C CG1 . VAL B 1 159 ? 21.377  -3.363  -6.067  1.00 52.09 ? 139 VAL B CG1 1 
ATOM   1856 C CG2 . VAL B 1 159 ? 22.924  -1.592  -6.964  1.00 56.54 ? 139 VAL B CG2 1 
ATOM   1857 N N   . GLY B 1 160 ? 18.926  -0.627  -8.427  1.00 54.34 ? 140 GLY B N   1 
ATOM   1858 C CA  . GLY B 1 160 ? 18.372  -0.734  -9.772  1.00 55.35 ? 140 GLY B CA  1 
ATOM   1859 C C   . GLY B 1 160 ? 17.398  -1.878  -9.895  1.00 58.51 ? 140 GLY B C   1 
ATOM   1860 O O   . GLY B 1 160 ? 17.653  -2.988  -9.406  1.00 61.24 ? 140 GLY B O   1 
ATOM   1861 N N   . GLY B 1 161 ? 16.279  -1.617  -10.557 1.00 58.57 ? 141 GLY B N   1 
ATOM   1862 C CA  . GLY B 1 161 ? 15.243  -2.626  -10.705 1.00 59.92 ? 141 GLY B CA  1 
ATOM   1863 C C   . GLY B 1 161 ? 14.206  -2.258  -11.736 1.00 60.64 ? 141 GLY B C   1 
ATOM   1864 O O   . GLY B 1 161 ? 14.376  -1.306  -12.493 1.00 61.98 ? 141 GLY B O   1 
ATOM   1865 N N   . ASP B 1 162 ? 13.128  -3.030  -11.771 1.00 59.68 ? 142 ASP B N   1 
ATOM   1866 C CA  . ASP B 1 162 ? 12.019  -2.746  -12.676 1.00 55.68 ? 142 ASP B CA  1 
ATOM   1867 C C   . ASP B 1 162 ? 10.889  -2.150  -11.872 1.00 54.18 ? 142 ASP B C   1 
ATOM   1868 O O   . ASP B 1 162 ? 9.855   -2.787  -11.685 1.00 54.32 ? 142 ASP B O   1 
ATOM   1869 C CB  . ASP B 1 162 ? 11.560  -3.994  -13.457 1.00 56.90 ? 142 ASP B CB  1 
ATOM   1870 C CG  . ASP B 1 162 ? 11.396  -5.245  -12.582 1.00 57.89 ? 142 ASP B CG  1 
ATOM   1871 O OD1 . ASP B 1 162 ? 11.068  -6.299  -13.173 1.00 51.93 ? 142 ASP B OD1 1 
ATOM   1872 O OD2 . ASP B 1 162 ? 11.598  -5.188  -11.334 1.00 57.75 ? 142 ASP B OD2 1 
ATOM   1873 N N   . HIS B 1 163 ? 11.123  -0.936  -11.375 1.00 51.47 ? 143 HIS B N   1 
ATOM   1874 C CA  . HIS B 1 163 ? 10.090  -0.119  -10.734 1.00 50.29 ? 143 HIS B CA  1 
ATOM   1875 C C   . HIS B 1 163 ? 10.514  1.355   -10.690 1.00 51.04 ? 143 HIS B C   1 
ATOM   1876 O O   . HIS B 1 163 ? 11.660  1.688   -11.017 1.00 46.24 ? 143 HIS B O   1 
ATOM   1877 C CB  . HIS B 1 163 ? 9.746   -0.650  -9.332  1.00 50.36 ? 143 HIS B CB  1 
ATOM   1878 C CG  . HIS B 1 163 ? 10.788  -0.390  -8.278  1.00 50.91 ? 143 HIS B CG  1 
ATOM   1879 N ND1 . HIS B 1 163 ? 10.589  -0.727  -6.956  1.00 50.77 ? 143 HIS B ND1 1 
ATOM   1880 C CD2 . HIS B 1 163 ? 12.020  0.172   -8.334  1.00 53.05 ? 143 HIS B CD2 1 
ATOM   1881 C CE1 . HIS B 1 163 ? 11.653  -0.396  -6.248  1.00 50.65 ? 143 HIS B CE1 1 
ATOM   1882 N NE2 . HIS B 1 163 ? 12.538  0.148   -7.059  1.00 51.34 ? 143 HIS B NE2 1 
ATOM   1883 N N   . ARG B 1 164 ? 9.584   2.233   -10.315 1.00 50.36 ? 144 ARG B N   1 
ATOM   1884 C CA  . ARG B 1 164 ? 9.913   3.643   -10.124 1.00 48.77 ? 144 ARG B CA  1 
ATOM   1885 C C   . ARG B 1 164 ? 10.301  3.911   -8.688  1.00 46.83 ? 144 ARG B C   1 
ATOM   1886 O O   . ARG B 1 164 ? 9.537   3.671   -7.770  1.00 49.67 ? 144 ARG B O   1 
ATOM   1887 C CB  . ARG B 1 164 ? 8.753   4.569   -10.500 1.00 49.46 ? 144 ARG B CB  1 
ATOM   1888 C CG  . ARG B 1 164 ? 9.098   6.062   -10.398 1.00 50.21 ? 144 ARG B CG  1 
ATOM   1889 C CD  . ARG B 1 164 ? 10.049  6.528   -11.501 1.00 50.13 ? 144 ARG B CD  1 
ATOM   1890 N NE  . ARG B 1 164 ? 9.370   7.238   -12.591 1.00 48.85 ? 144 ARG B NE  1 
ATOM   1891 C CZ  . ARG B 1 164 ? 9.850   7.378   -13.828 1.00 49.91 ? 144 ARG B CZ  1 
ATOM   1892 N NH1 . ARG B 1 164 ? 11.018  6.839   -14.184 1.00 49.00 ? 144 ARG B NH1 1 
ATOM   1893 N NH2 . ARG B 1 164 ? 9.141   8.044   -14.732 1.00 50.51 ? 144 ARG B NH2 1 
ATOM   1894 N N   . LEU B 1 165 ? 11.487  4.456   -8.518  1.00 46.05 ? 145 LEU B N   1 
ATOM   1895 C CA  . LEU B 1 165 ? 11.954  4.936   -7.218  1.00 47.04 ? 145 LEU B CA  1 
ATOM   1896 C C   . LEU B 1 165 ? 13.297  5.617   -7.409  1.00 47.58 ? 145 LEU B C   1 
ATOM   1897 O O   . LEU B 1 165 ? 13.579  6.615   -6.770  1.00 49.51 ? 145 LEU B O   1 
ATOM   1898 C CB  . LEU B 1 165 ? 12.095  3.805   -6.204  1.00 46.84 ? 145 LEU B CB  1 
ATOM   1899 C CG  . LEU B 1 165 ? 10.867  3.403   -5.381  1.00 47.29 ? 145 LEU B CG  1 
ATOM   1900 C CD1 . LEU B 1 165 ? 11.284  2.563   -4.180  1.00 48.34 ? 145 LEU B CD1 1 
ATOM   1901 N N   . LYS B 1 166 ? 14.106  5.062   -8.308  1.00 49.08 ? 146 LYS B N   1 
ATOM   1902 C CA  . LYS B 1 166 ? 15.432  5.566   -8.629  1.00 48.67 ? 146 LYS B CA  1 
ATOM   1903 C C   . LYS B 1 166 ? 16.342  5.159   -7.487  1.00 46.56 ? 146 LYS B C   1 
ATOM   1904 O O   . LYS B 1 166 ? 16.331  3.981   -7.101  1.00 52.15 ? 146 LYS B O   1 
ATOM   1905 C CB  . LYS B 1 166 ? 15.423  7.073   -8.899  1.00 49.07 ? 146 LYS B CB  1 
ATOM   1906 N N   . ASN B 1 167 ? 17.112  6.091   -6.935  1.00 41.38 ? 147 ASN B N   1 
ATOM   1907 C CA  . ASN B 1 167 ? 18.025  5.765   -5.835  1.00 39.71 ? 147 ASN B CA  1 
ATOM   1908 C C   . ASN B 1 167 ? 17.370  5.832   -4.444  1.00 38.59 ? 147 ASN B C   1 
ATOM   1909 O O   . ASN B 1 167 ? 17.734  6.681   -3.618  1.00 41.31 ? 147 ASN B O   1 
ATOM   1910 C CB  . ASN B 1 167 ? 19.243  6.702   -5.887  1.00 39.90 ? 147 ASN B CB  1 
ATOM   1911 N N   . TYR B 1 168 ? 16.404  4.961   -4.163  1.00 35.69 ? 148 TYR B N   1 
ATOM   1912 C CA  . TYR B 1 168 ? 15.866  4.889   -2.809  1.00 33.44 ? 148 TYR B CA  1 
ATOM   1913 C C   . TYR B 1 168 ? 17.019  4.413   -1.953  1.00 33.67 ? 148 TYR B C   1 
ATOM   1914 O O   . TYR B 1 168 ? 17.799  3.567   -2.390  1.00 35.68 ? 148 TYR B O   1 
ATOM   1915 C CB  . TYR B 1 168 ? 14.675  3.940   -2.732  1.00 33.33 ? 148 TYR B CB  1 
ATOM   1916 C CG  . TYR B 1 168 ? 13.924  3.968   -1.402  1.00 32.41 ? 148 TYR B CG  1 
ATOM   1917 C CD1 . TYR B 1 168 ? 12.613  4.344   -1.336  1.00 32.43 ? 148 TYR B CD1 1 
ATOM   1918 C CD2 . TYR B 1 168 ? 14.541  3.619   -0.227  1.00 33.79 ? 148 TYR B CD2 1 
ATOM   1919 C CE1 . TYR B 1 168 ? 11.939  4.378   -0.140  1.00 34.07 ? 148 TYR B CE1 1 
ATOM   1920 C CE2 . TYR B 1 168 ? 13.877  3.648   0.977   1.00 33.72 ? 148 TYR B CE2 1 
ATOM   1921 C CZ  . TYR B 1 168 ? 12.574  4.026   1.016   1.00 33.65 ? 148 TYR B CZ  1 
ATOM   1922 O OH  . TYR B 1 168 ? 11.912  4.036   2.226   1.00 34.96 ? 148 TYR B OH  1 
ATOM   1923 N N   . ARG B 1 169 ? 17.175  4.990   -0.770  1.00 37.65 ? 149 ARG B N   1 
ATOM   1924 C CA  . ARG B 1 169 ? 18.265  4.596   0.162   1.00 42.29 ? 149 ARG B CA  1 
ATOM   1925 C C   . ARG B 1 169 ? 17.791  4.657   1.607   1.00 44.24 ? 149 ARG B C   1 
ATOM   1926 O O   . ARG B 1 169 ? 17.411  5.726   2.083   1.00 47.50 ? 149 ARG B O   1 
ATOM   1927 C CB  . ARG B 1 169 ? 19.498  5.491   -0.018  1.00 42.53 ? 149 ARG B CB  1 
ATOM   1928 C CG  . ARG B 1 169 ? 20.791  4.868   0.485   1.00 42.65 ? 149 ARG B CG  1 
ATOM   1929 C CD  . ARG B 1 169 ? 21.839  5.911   0.856   1.00 43.67 ? 149 ARG B CD  1 
ATOM   1930 N NE  . ARG B 1 169 ? 22.540  5.521   2.077   1.00 44.19 ? 149 ARG B NE  1 
ATOM   1931 C CZ  . ARG B 1 169 ? 22.138  5.800   3.317   1.00 46.93 ? 149 ARG B CZ  1 
ATOM   1932 N NH1 . ARG B 1 169 ? 21.024  6.496   3.543   1.00 46.90 ? 149 ARG B NH1 1 
ATOM   1933 N NH2 . ARG B 1 169 ? 22.869  5.376   4.349   1.00 49.96 ? 149 ARG B NH2 1 
ATOM   1934 N N   . SER B 1 170 ? 17.816  3.515   2.299   1.00 45.56 ? 150 SER B N   1 
ATOM   1935 C CA  . SER B 1 170 ? 17.149  3.369   3.612   1.00 46.58 ? 150 SER B CA  1 
ATOM   1936 C C   . SER B 1 170 ? 18.121  3.451   4.795   1.00 45.95 ? 150 SER B C   1 
ATOM   1937 O O   . SER B 1 170 ? 19.294  3.118   4.665   1.00 43.92 ? 150 SER B O   1 
ATOM   1938 C CB  . SER B 1 170 ? 16.371  2.038   3.676   1.00 44.23 ? 150 SER B CB  1 
ATOM   1939 O OG  . SER B 1 170 ? 15.770  1.820   4.948   1.00 42.50 ? 150 SER B OG  1 
ATOM   1940 N N   . VAL B 1 171 ? 17.612  3.923   5.934   1.00 45.84 ? 151 VAL B N   1 
ATOM   1941 C CA  . VAL B 1 171 ? 18.314  3.856   7.222   1.00 43.17 ? 151 VAL B CA  1 
ATOM   1942 C C   . VAL B 1 171 ? 17.261  3.892   8.336   1.00 44.49 ? 151 VAL B C   1 
ATOM   1943 O O   . VAL B 1 171 ? 16.680  4.952   8.601   1.00 44.43 ? 151 VAL B O   1 
ATOM   1944 C CB  . VAL B 1 171 ? 19.277  5.049   7.459   1.00 42.48 ? 151 VAL B CB  1 
ATOM   1945 C CG1 . VAL B 1 171 ? 19.909  4.929   8.819   1.00 41.26 ? 151 VAL B CG1 1 
ATOM   1946 C CG2 . VAL B 1 171 ? 20.377  5.152   6.409   1.00 42.72 ? 151 VAL B CG2 1 
ATOM   1947 N N   . THR B 1 172 ? 17.013  2.752   8.988   1.00 45.22 ? 152 THR B N   1 
ATOM   1948 C CA  . THR B 1 172 ? 16.013  2.673   10.074  1.00 46.59 ? 152 THR B CA  1 
ATOM   1949 C C   . THR B 1 172 ? 16.634  2.658   11.475  1.00 47.57 ? 152 THR B C   1 
ATOM   1950 O O   . THR B 1 172 ? 16.126  1.977   12.355  1.00 48.39 ? 152 THR B O   1 
ATOM   1951 C CB  . THR B 1 172 ? 15.091  1.434   9.903   1.00 47.41 ? 152 THR B CB  1 
ATOM   1952 O OG1 . THR B 1 172 ? 14.513  1.424   8.587   1.00 48.30 ? 152 THR B OG1 1 
ATOM   1953 C CG2 . THR B 1 172 ? 13.960  1.410   10.932  1.00 48.13 ? 152 THR B CG2 1 
ATOM   1954 N N   . THR B 1 173 ? 17.701  3.438   11.684  1.00 48.46 ? 153 THR B N   1 
ATOM   1955 C CA  . THR B 1 173 ? 18.390  3.525   12.980  1.00 47.08 ? 153 THR B CA  1 
ATOM   1956 C C   . THR B 1 173 ? 17.456  3.460   14.171  1.00 48.82 ? 153 THR B C   1 
ATOM   1957 O O   . THR B 1 173 ? 16.522  4.250   14.279  1.00 54.70 ? 153 THR B O   1 
ATOM   1958 C CB  . THR B 1 173 ? 19.133  4.866   13.191  1.00 47.60 ? 153 THR B CB  1 
ATOM   1959 O OG1 . THR B 1 173 ? 18.190  5.945   13.238  1.00 44.71 ? 153 THR B OG1 1 
ATOM   1960 C CG2 . THR B 1 173 ? 20.171  5.136   12.117  1.00 47.20 ? 153 THR B CG2 1 
ATOM   1961 N N   . LEU B 1 174 ? 17.741  2.557   15.092  1.00 48.07 ? 154 LEU B N   1 
ATOM   1962 C CA  . LEU B 1 174 ? 16.997  2.496   16.332  1.00 46.40 ? 154 LEU B CA  1 
ATOM   1963 C C   . LEU B 1 174 ? 17.661  3.380   17.395  1.00 47.51 ? 154 LEU B C   1 
ATOM   1964 O O   . LEU B 1 174 ? 18.862  3.258   17.674  1.00 49.09 ? 154 LEU B O   1 
ATOM   1965 C CB  . LEU B 1 174 ? 16.892  1.053   16.811  1.00 44.07 ? 154 LEU B CB  1 
ATOM   1966 C CG  . LEU B 1 174 ? 15.747  0.225   16.235  1.00 42.53 ? 154 LEU B CG  1 
ATOM   1967 C CD1 . LEU B 1 174 ? 16.004  -0.152  14.788  1.00 42.45 ? 154 LEU B CD1 1 
ATOM   1968 C CD2 . LEU B 1 174 ? 15.578  -1.017  17.091  1.00 43.22 ? 154 LEU B CD2 1 
ATOM   1969 N N   . HIS B 1 175 ? 16.869  4.299   17.942  1.00 46.79 ? 155 HIS B N   1 
ATOM   1970 C CA  . HIS B 1 175 ? 17.214  5.056   19.141  1.00 45.74 ? 155 HIS B CA  1 
ATOM   1971 C C   . HIS B 1 175 ? 16.981  4.038   20.265  1.00 49.75 ? 155 HIS B C   1 
ATOM   1972 O O   . HIS B 1 175 ? 17.254  2.840   20.045  1.00 49.19 ? 155 HIS B O   1 
ATOM   1973 C CB  . HIS B 1 175 ? 16.348  6.322   19.188  1.00 45.86 ? 155 HIS B CB  1 
ATOM   1974 C CG  . HIS B 1 175 ? 16.485  7.159   20.428  1.00 47.14 ? 155 HIS B CG  1 
ATOM   1975 N ND1 . HIS B 1 175 ? 17.483  6.981   21.365  1.00 47.51 ? 155 HIS B ND1 1 
ATOM   1976 C CD2 . HIS B 1 175 ? 15.748  8.212   20.862  1.00 47.29 ? 155 HIS B CD2 1 
ATOM   1977 C CE1 . HIS B 1 175 ? 17.345  7.873   22.330  1.00 49.00 ? 155 HIS B CE1 1 
ATOM   1978 N NE2 . HIS B 1 175 ? 16.306  8.638   22.046  1.00 50.99 ? 155 HIS B NE2 1 
ATOM   1979 N N   . ALA B 1 176 ? 16.456  4.448   21.426  1.00 49.82 ? 156 ALA B N   1 
ATOM   1980 C CA  . ALA B 1 176 ? 16.548  3.614   22.622  1.00 52.28 ? 156 ALA B CA  1 
ATOM   1981 C C   . ALA B 1 176 ? 15.328  3.669   23.555  1.00 54.44 ? 156 ALA B C   1 
ATOM   1982 O O   . ALA B 1 176 ? 14.723  4.733   23.767  1.00 52.45 ? 156 ALA B O   1 
ATOM   1983 C CB  . ALA B 1 176 ? 17.815  3.968   23.386  1.00 52.60 ? 156 ALA B CB  1 
ATOM   1984 N N   . SER B 1 177 ? 15.002  2.498   24.115  1.00 56.17 ? 157 SER B N   1 
ATOM   1985 C CA  . SER B 1 177 ? 13.915  2.317   25.087  1.00 58.15 ? 157 SER B CA  1 
ATOM   1986 C C   . SER B 1 177 ? 12.595  2.913   24.599  1.00 59.53 ? 157 SER B C   1 
ATOM   1987 O O   . SER B 1 177 ? 12.116  2.581   23.510  1.00 62.44 ? 157 SER B O   1 
ATOM   1988 C CB  . SER B 1 177 ? 14.310  2.916   26.443  1.00 63.83 ? 157 SER B CB  1 
ATOM   1989 O OG  . SER B 1 177 ? 13.678  2.255   27.539  1.00 66.11 ? 157 SER B OG  1 
ATOM   1990 N N   . VAL B 1 183 ? 12.004  3.531   20.227  1.00 40.90 ? 163 VAL B N   1 
ATOM   1991 C CA  . VAL B 1 183 ? 12.047  4.616   19.253  1.00 40.10 ? 163 VAL B CA  1 
ATOM   1992 C C   . VAL B 1 183 ? 12.608  4.143   17.898  1.00 39.97 ? 163 VAL B C   1 
ATOM   1993 O O   . VAL B 1 183 ? 13.796  4.234   17.654  1.00 40.56 ? 163 VAL B O   1 
ATOM   1994 C CB  . VAL B 1 183 ? 12.877  5.803   19.810  1.00 41.02 ? 163 VAL B CB  1 
ATOM   1995 C CG1 . VAL B 1 183 ? 12.853  6.993   18.855  1.00 42.87 ? 163 VAL B CG1 1 
ATOM   1996 C CG2 . VAL B 1 183 ? 12.384  6.246   21.177  1.00 39.83 ? 163 VAL B CG2 1 
ATOM   1997 N N   . VAL B 1 184 ? 11.766  3.618   17.012  1.00 43.79 ? 164 VAL B N   1 
ATOM   1998 C CA  . VAL B 1 184 ? 12.271  3.241   15.684  1.00 45.17 ? 164 VAL B CA  1 
ATOM   1999 C C   . VAL B 1 184 ? 12.000  4.357   14.706  1.00 46.98 ? 164 VAL B C   1 
ATOM   2000 O O   . VAL B 1 184 ? 10.856  4.797   14.534  1.00 47.32 ? 164 VAL B O   1 
ATOM   2001 C CB  . VAL B 1 184 ? 11.714  1.933   15.108  1.00 44.87 ? 164 VAL B CB  1 
ATOM   2002 C CG1 . VAL B 1 184 ? 12.578  1.524   13.921  1.00 44.32 ? 164 VAL B CG1 1 
ATOM   2003 C CG2 . VAL B 1 184 ? 11.728  0.824   16.148  1.00 45.03 ? 164 VAL B CG2 1 
ATOM   2004 N N   . VAL B 1 185 ? 13.083  4.788   14.067  1.00 46.29 ? 165 VAL B N   1 
ATOM   2005 C CA  . VAL B 1 185 ? 13.104  5.991   13.273  1.00 43.79 ? 165 VAL B CA  1 
ATOM   2006 C C   . VAL B 1 185 ? 13.918  5.709   12.007  1.00 42.40 ? 165 VAL B C   1 
ATOM   2007 O O   . VAL B 1 185 ? 15.039  5.203   12.074  1.00 39.58 ? 165 VAL B O   1 
ATOM   2008 C CB  . VAL B 1 185 ? 13.652  7.162   14.120  1.00 41.47 ? 165 VAL B CB  1 
ATOM   2009 C CG1 . VAL B 1 185 ? 13.817  8.432   13.307  1.00 41.85 ? 165 VAL B CG1 1 
ATOM   2010 C CG2 . VAL B 1 185 ? 12.703  7.421   15.274  1.00 41.13 ? 165 VAL B CG2 1 
ATOM   2011 N N   . GLU B 1 186 ? 13.304  5.993   10.861  1.00 41.76 ? 166 GLU B N   1 
ATOM   2012 C CA  . GLU B 1 186 ? 13.925  5.820   9.556   1.00 41.31 ? 166 GLU B CA  1 
ATOM   2013 C C   . GLU B 1 186 ? 13.664  7.043   8.712   1.00 44.66 ? 166 GLU B C   1 
ATOM   2014 O O   . GLU B 1 186 ? 12.587  7.645   8.790   1.00 41.36 ? 166 GLU B O   1 
ATOM   2015 C CB  . GLU B 1 186 ? 13.343  4.595   8.826   1.00 38.57 ? 166 GLU B CB  1 
ATOM   2016 C CG  . GLU B 1 186 ? 13.607  4.564   7.320   1.00 36.03 ? 166 GLU B CG  1 
ATOM   2017 C CD  . GLU B 1 186 ? 12.886  3.453   6.591   1.00 33.35 ? 166 GLU B CD  1 
ATOM   2018 O OE1 . GLU B 1 186 ? 11.738  3.111   6.957   1.00 32.93 ? 166 GLU B OE1 1 
ATOM   2019 O OE2 . GLU B 1 186 ? 13.476  2.925   5.631   1.00 31.37 ? 166 GLU B OE2 1 
ATOM   2020 N N   . SER B 1 187 ? 14.647  7.379   7.877   1.00 49.14 ? 167 SER B N   1 
ATOM   2021 C CA  . SER B 1 187 ? 14.485  8.402   6.847   1.00 49.80 ? 167 SER B CA  1 
ATOM   2022 C C   . SER B 1 187 ? 14.566  7.704   5.504   1.00 54.69 ? 167 SER B C   1 
ATOM   2023 O O   . SER B 1 187 ? 15.399  6.809   5.337   1.00 65.57 ? 167 SER B O   1 
ATOM   2024 C CB  . SER B 1 187 ? 15.572  9.463   6.976   1.00 45.56 ? 167 SER B CB  1 
ATOM   2025 O OG  . SER B 1 187 ? 15.527  10.052  8.267   1.00 43.12 ? 167 SER B OG  1 
ATOM   2026 N N   . TYR B 1 188 ? 13.726  8.118   4.552   1.00 55.52 ? 168 TYR B N   1 
ATOM   2027 C CA  . TYR B 1 188 ? 13.539  7.373   3.300   1.00 58.41 ? 168 TYR B CA  1 
ATOM   2028 C C   . TYR B 1 188 ? 14.355  7.900   2.094   1.00 58.05 ? 168 TYR B C   1 
ATOM   2029 O O   . TYR B 1 188 ? 15.071  7.144   1.438   1.00 58.88 ? 168 TYR B O   1 
ATOM   2030 C CB  . TYR B 1 188 ? 12.032  7.260   2.978   1.00 62.42 ? 168 TYR B CB  1 
ATOM   2031 C CG  . TYR B 1 188 ? 11.478  8.320   2.053   1.00 63.79 ? 168 TYR B CG  1 
ATOM   2032 C CD1 . TYR B 1 188 ? 11.339  8.069   0.689   1.00 63.24 ? 168 TYR B CD1 1 
ATOM   2033 C CD2 . TYR B 1 188 ? 11.095  9.568   2.536   1.00 64.29 ? 168 TYR B CD2 1 
ATOM   2034 C CE1 . TYR B 1 188 ? 10.838  9.031   -0.172  1.00 62.95 ? 168 TYR B CE1 1 
ATOM   2035 C CE2 . TYR B 1 188 ? 10.590  10.539  1.682   1.00 65.76 ? 168 TYR B CE2 1 
ATOM   2036 C CZ  . TYR B 1 188 ? 10.458  10.263  0.331   1.00 66.54 ? 168 TYR B CZ  1 
ATOM   2037 N N   . ILE B 1 189 ? 14.230  9.183   1.795   1.00 57.73 ? 169 ILE B N   1 
ATOM   2038 C CA  . ILE B 1 189 ? 15.064  9.856   0.788   1.00 56.78 ? 169 ILE B CA  1 
ATOM   2039 C C   . ILE B 1 189 ? 15.309  9.158   -0.550  1.00 54.86 ? 169 ILE B C   1 
ATOM   2040 O O   . ILE B 1 189 ? 16.453  8.822   -0.857  1.00 60.60 ? 169 ILE B O   1 
ATOM   2041 C CB  . ILE B 1 189 ? 16.455  10.191  1.371   1.00 49.53 ? 169 ILE B CB  1 
ATOM   2042 N N   . VAL B 1 190 ? 14.267  8.985   -1.361  1.00 51.05 ? 170 VAL B N   1 
ATOM   2043 C CA  . VAL B 1 190 ? 14.428  8.429   -2.727  1.00 49.96 ? 170 VAL B CA  1 
ATOM   2044 C C   . VAL B 1 190 ? 14.648  9.548   -3.768  1.00 49.61 ? 170 VAL B C   1 
ATOM   2045 O O   . VAL B 1 190 ? 15.267  10.550  -3.444  1.00 51.27 ? 170 VAL B O   1 
ATOM   2046 C CB  . VAL B 1 190 ? 13.255  7.503   -3.128  1.00 44.88 ? 170 VAL B CB  1 
ATOM   2047 N N   . ASP B 1 191 ? 14.159  9.375   -5.000  1.00 50.18 ? 171 ASP B N   1 
ATOM   2048 C CA  . ASP B 1 191 ? 14.483  10.268  -6.126  1.00 50.35 ? 171 ASP B CA  1 
ATOM   2049 C C   . ASP B 1 191 ? 13.233  10.611  -6.935  1.00 53.87 ? 171 ASP B C   1 
ATOM   2050 O O   . ASP B 1 191 ? 12.681  9.753   -7.640  1.00 52.43 ? 171 ASP B O   1 
ATOM   2051 C CB  . ASP B 1 191 ? 15.506  9.596   -7.044  1.00 51.44 ? 171 ASP B CB  1 
ATOM   2052 C CG  . ASP B 1 191 ? 16.362  10.590  -7.822  1.00 53.34 ? 171 ASP B CG  1 
ATOM   2053 O OD1 . ASP B 1 191 ? 15.842  11.316  -8.692  1.00 54.26 ? 171 ASP B OD1 1 
ATOM   2054 O OD2 . ASP B 1 191 ? 17.581  10.619  -7.578  1.00 54.84 ? 171 ASP B OD2 1 
ATOM   2055 N N   . VAL B 1 192 ? 12.818  11.877  -6.849  1.00 56.65 ? 172 VAL B N   1 
ATOM   2056 C CA  . VAL B 1 192 ? 11.545  12.349  -7.408  1.00 60.91 ? 172 VAL B CA  1 
ATOM   2057 C C   . VAL B 1 192 ? 11.363  12.015  -8.888  1.00 63.14 ? 172 VAL B C   1 
ATOM   2058 O O   . VAL B 1 192 ? 12.179  12.430  -9.711  1.00 66.31 ? 172 VAL B O   1 
ATOM   2059 C CB  . VAL B 1 192 ? 11.391  13.874  -7.257  1.00 63.00 ? 172 VAL B CB  1 
ATOM   2060 N N   . PRO B 1 193 ? 10.296  11.263  -9.226  1.00 62.08 ? 173 PRO B N   1 
ATOM   2061 C CA  . PRO B 1 193 ? 10.009  10.849  -10.606 1.00 65.83 ? 173 PRO B CA  1 
ATOM   2062 C C   . PRO B 1 193 ? 9.481   11.933  -11.567 1.00 66.37 ? 173 PRO B C   1 
ATOM   2063 O O   . PRO B 1 193 ? 9.035   13.000  -11.134 1.00 67.44 ? 173 PRO B O   1 
ATOM   2064 C CB  . PRO B 1 193 ? 8.927   9.777   -10.424 1.00 69.02 ? 173 PRO B CB  1 
ATOM   2065 C CG  . PRO B 1 193 ? 8.303   10.083  -9.115  1.00 64.66 ? 173 PRO B CG  1 
ATOM   2066 C CD  . PRO B 1 193 ? 9.436   10.554  -8.269  1.00 63.03 ? 173 PRO B CD  1 
ATOM   2067 N N   . PRO B 1 194 ? 9.593   11.671  -12.878 1.00 66.61 ? 174 PRO B N   1 
ATOM   2068 C CA  . PRO B 1 194 ? 8.793   12.286  -13.942 1.00 66.68 ? 174 PRO B CA  1 
ATOM   2069 C C   . PRO B 1 194 ? 7.323   11.871  -13.924 1.00 64.76 ? 174 PRO B C   1 
ATOM   2070 O O   . PRO B 1 194 ? 6.429   12.718  -14.053 1.00 58.40 ? 174 PRO B O   1 
ATOM   2071 C CB  . PRO B 1 194 ? 9.456   11.750  -15.216 1.00 65.84 ? 174 PRO B CB  1 
ATOM   2072 C CG  . PRO B 1 194 ? 10.885  11.581  -14.836 1.00 65.68 ? 174 PRO B CG  1 
ATOM   2073 C CD  . PRO B 1 194 ? 10.882  11.169  -13.393 1.00 66.42 ? 174 PRO B CD  1 
ATOM   2074 N N   . GLY B 1 195 ? 7.099   10.563  -13.765 1.00 66.36 ? 175 GLY B N   1 
ATOM   2075 C CA  . GLY B 1 195 ? 5.765   9.952   -13.842 1.00 61.07 ? 175 GLY B CA  1 
ATOM   2076 C C   . GLY B 1 195 ? 4.903   10.172  -12.609 1.00 57.15 ? 175 GLY B C   1 
ATOM   2077 O O   . GLY B 1 195 ? 3.792   9.662   -12.531 1.00 57.37 ? 175 GLY B O   1 
ATOM   2078 N N   . ASN B 1 196 ? 5.434   10.906  -11.635 1.00 54.34 ? 176 ASN B N   1 
ATOM   2079 C CA  . ASN B 1 196 ? 4.675   11.390  -10.479 1.00 54.95 ? 176 ASN B CA  1 
ATOM   2080 C C   . ASN B 1 196 ? 5.168   12.798  -10.095 1.00 51.87 ? 176 ASN B C   1 
ATOM   2081 O O   . ASN B 1 196 ? 6.103   13.327  -10.704 1.00 50.71 ? 176 ASN B O   1 
ATOM   2082 C CB  . ASN B 1 196 ? 4.824   10.432  -9.282  1.00 52.58 ? 176 ASN B CB  1 
ATOM   2083 C CG  . ASN B 1 196 ? 3.648   9.486   -9.111  1.00 52.04 ? 176 ASN B CG  1 
ATOM   2084 O OD1 . ASN B 1 196 ? 3.840   8.299   -8.846  1.00 53.54 ? 176 ASN B OD1 1 
ATOM   2085 N ND2 . ASN B 1 196 ? 2.428   10.007  -9.222  1.00 53.21 ? 176 ASN B ND2 1 
ATOM   2086 N N   . THR B 1 197 ? 4.534   13.406  -9.097  1.00 48.58 ? 177 THR B N   1 
ATOM   2087 C CA  . THR B 1 197 ? 4.990   14.704  -8.587  1.00 47.44 ? 177 THR B CA  1 
ATOM   2088 C C   . THR B 1 197 ? 6.184   14.450  -7.683  1.00 46.60 ? 177 THR B C   1 
ATOM   2089 O O   . THR B 1 197 ? 6.865   13.449  -7.840  1.00 46.97 ? 177 THR B O   1 
ATOM   2090 C CB  . THR B 1 197 ? 3.878   15.437  -7.804  1.00 42.74 ? 177 THR B CB  1 
ATOM   2091 N N   . GLU B 1 198 ? 6.438   15.375  -6.760  1.00 48.66 ? 178 GLU B N   1 
ATOM   2092 C CA  . GLU B 1 198 ? 7.397   15.195  -5.663  1.00 48.00 ? 178 GLU B CA  1 
ATOM   2093 C C   . GLU B 1 198 ? 6.756   15.363  -4.297  1.00 49.51 ? 178 GLU B C   1 
ATOM   2094 O O   . GLU B 1 198 ? 7.449   15.286  -3.276  1.00 46.62 ? 178 GLU B O   1 
ATOM   2095 C CB  . GLU B 1 198 ? 8.513   16.233  -5.771  1.00 50.89 ? 178 GLU B CB  1 
ATOM   2096 N N   . GLU B 1 199 ? 5.455   15.670  -4.290  1.00 51.66 ? 179 GLU B N   1 
ATOM   2097 C CA  . GLU B 1 199 ? 4.642   15.734  -3.071  1.00 51.01 ? 179 GLU B CA  1 
ATOM   2098 C C   . GLU B 1 199 ? 3.527   14.705  -3.141  1.00 51.21 ? 179 GLU B C   1 
ATOM   2099 O O   . GLU B 1 199 ? 2.853   14.442  -2.151  1.00 59.67 ? 179 GLU B O   1 
ATOM   2100 C CB  . GLU B 1 199 ? 4.060   17.133  -2.872  1.00 53.64 ? 179 GLU B CB  1 
ATOM   2101 C CG  . GLU B 1 199 ? 3.387   17.757  -4.090  1.00 51.71 ? 179 GLU B CG  1 
ATOM   2102 C CD  . GLU B 1 199 ? 2.201   16.970  -4.581  1.00 48.19 ? 179 GLU B CD  1 
ATOM   2103 O OE1 . GLU B 1 199 ? 1.970   16.949  -5.814  1.00 43.24 ? 179 GLU B OE1 1 
ATOM   2104 O OE2 . GLU B 1 199 ? 1.521   16.363  -3.726  1.00 48.93 ? 179 GLU B OE2 1 
ATOM   2105 N N   . GLU B 1 200 ? 3.311   14.169  -4.336  1.00 49.50 ? 180 GLU B N   1 
ATOM   2106 C CA  . GLU B 1 200 ? 2.562   12.951  -4.525  1.00 49.70 ? 180 GLU B CA  1 
ATOM   2107 C C   . GLU B 1 200 ? 3.417   11.778  -4.075  1.00 52.23 ? 180 GLU B C   1 
ATOM   2108 O O   . GLU B 1 200 ? 2.918   10.843  -3.453  1.00 58.74 ? 180 GLU B O   1 
ATOM   2109 C CB  . GLU B 1 200 ? 2.229   12.775  -6.004  1.00 48.98 ? 180 GLU B CB  1 
ATOM   2110 N N   . THR B 1 201 ? 4.704   11.842  -4.424  1.00 50.38 ? 181 THR B N   1 
ATOM   2111 C CA  . THR B 1 201 ? 5.680   10.779  -4.178  1.00 45.84 ? 181 THR B CA  1 
ATOM   2112 C C   . THR B 1 201 ? 6.139   10.847  -2.712  1.00 47.42 ? 181 THR B C   1 
ATOM   2113 O O   . THR B 1 201 ? 6.070   9.852   -1.966  1.00 39.98 ? 181 THR B O   1 
ATOM   2114 C CB  . THR B 1 201 ? 6.896   10.946  -5.136  1.00 43.24 ? 181 THR B CB  1 
ATOM   2115 O OG1 . THR B 1 201 ? 6.434   11.086  -6.485  1.00 37.64 ? 181 THR B OG1 1 
ATOM   2116 C CG2 . THR B 1 201 ? 7.846   9.779   -5.063  1.00 42.76 ? 181 THR B CG2 1 
ATOM   2117 N N   . LEU B 1 202 ? 6.593   12.037  -2.306  1.00 48.11 ? 182 LEU B N   1 
ATOM   2118 C CA  . LEU B 1 202 ? 6.989   12.293  -0.917  1.00 47.73 ? 182 LEU B CA  1 
ATOM   2119 C C   . LEU B 1 202 ? 5.876   11.960  0.116   1.00 49.80 ? 182 LEU B C   1 
ATOM   2120 O O   . LEU B 1 202 ? 6.170   11.816  1.309   1.00 46.79 ? 182 LEU B O   1 
ATOM   2121 C CB  . LEU B 1 202 ? 7.458   13.737  -0.740  1.00 42.68 ? 182 LEU B CB  1 
ATOM   2122 N N   . SER B 1 203 ? 4.618   11.839  -0.327  1.00 48.26 ? 183 SER B N   1 
ATOM   2123 C CA  . SER B 1 203 ? 3.579   11.287  0.542   1.00 47.72 ? 183 SER B CA  1 
ATOM   2124 C C   . SER B 1 203 ? 3.432   9.781   0.341   1.00 51.00 ? 183 SER B C   1 
ATOM   2125 O O   . SER B 1 203 ? 3.207   9.048   1.311   1.00 54.31 ? 183 SER B O   1 
ATOM   2126 C CB  . SER B 1 203 ? 2.228   11.966  0.310   1.00 47.46 ? 183 SER B CB  1 
ATOM   2127 O OG  . SER B 1 203 ? 1.279   11.500  1.258   1.00 45.59 ? 183 SER B OG  1 
ATOM   2128 N N   . PHE B 1 204 ? 3.537   9.318   -0.907  1.00 50.52 ? 184 PHE B N   1 
ATOM   2129 C CA  . PHE B 1 204 ? 3.299   7.907   -1.207  1.00 51.54 ? 184 PHE B CA  1 
ATOM   2130 C C   . PHE B 1 204 ? 4.521   7.037   -0.967  1.00 47.39 ? 184 PHE B C   1 
ATOM   2131 O O   . PHE B 1 204 ? 4.441   5.830   -1.092  1.00 47.85 ? 184 PHE B O   1 
ATOM   2132 C CB  . PHE B 1 204 ? 2.762   7.704   -2.636  1.00 55.68 ? 184 PHE B CB  1 
ATOM   2133 C CG  . PHE B 1 204 ? 2.568   6.245   -3.017  1.00 55.14 ? 184 PHE B CG  1 
ATOM   2134 C CD1 . PHE B 1 204 ? 1.848   5.387   -2.204  1.00 52.49 ? 184 PHE B CD1 1 
ATOM   2135 C CD2 . PHE B 1 204 ? 3.124   5.736   -4.182  0.50 55.77 ? 184 PHE B CD2 1 
ATOM   2136 C CE1 . PHE B 1 204 ? 1.683   4.054   -2.545  0.50 55.39 ? 184 PHE B CE1 1 
ATOM   2137 C CE2 . PHE B 1 204 ? 2.958   4.403   -4.531  0.50 56.88 ? 184 PHE B CE2 1 
ATOM   2138 C CZ  . PHE B 1 204 ? 2.236   3.559   -3.709  0.50 54.60 ? 184 PHE B CZ  1 
ATOM   2139 N N   . VAL B 1 205 ? 5.639   7.651   -0.612  1.00 49.27 ? 185 VAL B N   1 
ATOM   2140 C CA  . VAL B 1 205 ? 6.821   6.927   -0.140  1.00 45.17 ? 185 VAL B CA  1 
ATOM   2141 C C   . VAL B 1 205 ? 6.886   6.951   1.385   1.00 44.73 ? 185 VAL B C   1 
ATOM   2142 O O   . VAL B 1 205 ? 7.804   6.388   1.971   1.00 43.49 ? 185 VAL B O   1 
ATOM   2143 C CB  . VAL B 1 205 ? 8.111   7.547   -0.699  1.00 41.66 ? 185 VAL B CB  1 
ATOM   2144 N N   . ASP B 1 206 ? 5.897   7.573   2.029   1.00 48.28 ? 186 ASP B N   1 
ATOM   2145 C CA  . ASP B 1 206 ? 5.900   7.737   3.503   1.00 51.86 ? 186 ASP B CA  1 
ATOM   2146 C C   . ASP B 1 206 ? 4.844   6.926   4.281   1.00 49.43 ? 186 ASP B C   1 
ATOM   2147 O O   . ASP B 1 206 ? 4.978   6.730   5.491   1.00 49.84 ? 186 ASP B O   1 
ATOM   2148 C CB  . ASP B 1 206 ? 5.768   9.226   3.858   1.00 51.24 ? 186 ASP B CB  1 
ATOM   2149 C CG  . ASP B 1 206 ? 7.102   9.952   3.818   1.00 53.12 ? 186 ASP B CG  1 
ATOM   2150 O OD1 . ASP B 1 206 ? 7.732   10.027  2.736   1.00 51.60 ? 186 ASP B OD1 1 
ATOM   2151 O OD2 . ASP B 1 206 ? 7.531   10.431  4.884   1.00 56.95 ? 186 ASP B OD2 1 
ATOM   2152 N N   . THR B 1 207 ? 3.800   6.468   3.603   1.00 46.52 ? 187 THR B N   1 
ATOM   2153 C CA  . THR B 1 207 ? 2.736   5.734   4.271   1.00 47.14 ? 187 THR B CA  1 
ATOM   2154 C C   . THR B 1 207 ? 3.262   4.330   4.460   1.00 49.03 ? 187 THR B C   1 
ATOM   2155 O O   . THR B 1 207 ? 3.155   3.756   5.532   1.00 50.96 ? 187 THR B O   1 
ATOM   2156 C CB  . THR B 1 207 ? 1.443   5.699   3.439   1.00 46.64 ? 187 THR B CB  1 
ATOM   2157 O OG1 . THR B 1 207 ? 1.039   7.029   3.091   1.00 46.15 ? 187 THR B OG1 1 
ATOM   2158 C CG2 . THR B 1 207 ? 0.344   5.064   4.217   1.00 49.88 ? 187 THR B CG2 1 
ATOM   2159 N N   . ILE B 1 208 ? 3.859   3.791   3.403   1.00 47.64 ? 188 ILE B N   1 
ATOM   2160 C CA  . ILE B 1 208 ? 4.595   2.542   3.491   1.00 45.79 ? 188 ILE B CA  1 
ATOM   2161 C C   . ILE B 1 208 ? 5.417   2.509   4.774   1.00 46.32 ? 188 ILE B C   1 
ATOM   2162 O O   . ILE B 1 208 ? 5.363   1.533   5.514   1.00 52.59 ? 188 ILE B O   1 
ATOM   2163 C CB  . ILE B 1 208 ? 5.557   2.358   2.292   1.00 45.57 ? 188 ILE B CB  1 
ATOM   2164 C CG1 . ILE B 1 208 ? 4.784   2.137   0.996   1.00 44.88 ? 188 ILE B CG1 1 
ATOM   2165 C CG2 . ILE B 1 208 ? 6.473   1.164   2.519   1.00 45.79 ? 188 ILE B CG2 1 
ATOM   2166 C CD1 . ILE B 1 208 ? 5.544   2.599   -0.221  1.00 45.80 ? 188 ILE B CD1 1 
ATOM   2167 N N   . VAL B 1 209 ? 6.182   3.573   5.017   1.00 45.29 ? 189 VAL B N   1 
ATOM   2168 C CA  . VAL B 1 209 ? 6.972   3.707   6.240   1.00 43.85 ? 189 VAL B CA  1 
ATOM   2169 C C   . VAL B 1 209 ? 6.065   3.880   7.430   1.00 42.33 ? 189 VAL B C   1 
ATOM   2170 O O   . VAL B 1 209 ? 6.206   3.170   8.409   1.00 43.73 ? 189 VAL B O   1 
ATOM   2171 C CB  . VAL B 1 209 ? 7.933   4.901   6.202   1.00 40.66 ? 189 VAL B CB  1 
ATOM   2172 N N   . ARG B 1 210 ? 5.111   4.799   7.341   1.00 43.80 ? 190 ARG B N   1 
ATOM   2173 C CA  . ARG B 1 210 ? 4.125   4.967   8.425   1.00 47.12 ? 190 ARG B CA  1 
ATOM   2174 C C   . ARG B 1 210 ? 3.465   3.632   8.772   1.00 46.52 ? 190 ARG B C   1 
ATOM   2175 O O   . ARG B 1 210 ? 3.119   3.392   9.922   1.00 53.30 ? 190 ARG B O   1 
ATOM   2176 C CB  . ARG B 1 210 ? 3.041   5.971   8.042   1.00 47.93 ? 190 ARG B CB  1 
ATOM   2177 C CG  . ARG B 1 210 ? 2.189   6.443   9.211   1.00 50.99 ? 190 ARG B CG  1 
ATOM   2178 C CD  . ARG B 1 210 ? 0.848   7.038   8.781   1.00 52.89 ? 190 ARG B CD  1 
ATOM   2179 N NE  . ARG B 1 210 ? 0.977   8.096   7.779   1.00 55.29 ? 190 ARG B NE  1 
ATOM   2180 C CZ  . ARG B 1 210 ? 0.012   8.954   7.452   1.00 60.99 ? 190 ARG B CZ  1 
ATOM   2181 N NH1 . ARG B 1 210 ? -1.179  8.902   8.049   1.00 61.71 ? 190 ARG B NH1 1 
ATOM   2182 N NH2 . ARG B 1 210 ? 0.242   9.882   6.522   1.00 59.39 ? 190 ARG B NH2 1 
ATOM   2183 N N   . CYS B 1 211 ? 3.301   2.780   7.766   1.00 42.87 ? 191 CYS B N   1 
ATOM   2184 C CA  . CYS B 1 211 ? 2.672   1.486   7.916   1.00 41.70 ? 191 CYS B CA  1 
ATOM   2185 C C   . CYS B 1 211 ? 3.683   0.358   8.145   1.00 44.15 ? 191 CYS B C   1 
ATOM   2186 O O   . CYS B 1 211 ? 3.318   -0.727  8.612   1.00 46.14 ? 191 CYS B O   1 
ATOM   2187 C CB  . CYS B 1 211 ? 1.870   1.219   6.660   1.00 39.00 ? 191 CYS B CB  1 
ATOM   2188 S SG  . CYS B 1 211 ? 0.937   2.694   6.222   1.00 40.79 ? 191 CYS B SG  1 
ATOM   2189 N N   . ASN B 1 212 ? 4.944   0.600   7.801   1.00 43.10 ? 192 ASN B N   1 
ATOM   2190 C CA  . ASN B 1 212 ? 5.981   -0.418  7.959   1.00 44.14 ? 192 ASN B CA  1 
ATOM   2191 C C   . ASN B 1 212 ? 6.322   -0.703  9.405   1.00 42.06 ? 192 ASN B C   1 
ATOM   2192 O O   . ASN B 1 212 ? 6.243   -1.840  9.865   1.00 44.90 ? 192 ASN B O   1 
ATOM   2193 C CB  . ASN B 1 212 ? 7.273   -0.000  7.246   1.00 44.67 ? 192 ASN B CB  1 
ATOM   2194 C CG  . ASN B 1 212 ? 7.336   -0.479  5.817   1.00 46.03 ? 192 ASN B CG  1 
ATOM   2195 O OD1 . ASN B 1 212 ? 8.075   0.069   5.012   1.00 48.20 ? 192 ASN B OD1 1 
ATOM   2196 N ND2 . ASN B 1 212 ? 6.594   -1.526  5.504   1.00 45.50 ? 192 ASN B ND2 1 
ATOM   2197 N N   . LEU B 1 213 ? 6.712   0.349   10.101  1.00 40.48 ? 193 LEU B N   1 
ATOM   2198 C CA  . LEU B 1 213 ? 7.298   0.239   11.408  1.00 42.94 ? 193 LEU B CA  1 
ATOM   2199 C C   . LEU B 1 213 ? 6.228   0.264   12.469  1.00 42.79 ? 193 LEU B C   1 
ATOM   2200 O O   . LEU B 1 213 ? 6.532   0.152   13.663  1.00 43.09 ? 193 LEU B O   1 
ATOM   2201 C CB  . LEU B 1 213 ? 8.270   1.400   11.636  1.00 46.88 ? 193 LEU B CB  1 
ATOM   2202 C CG  . LEU B 1 213 ? 9.329   1.606   10.562  1.00 46.25 ? 193 LEU B CG  1 
ATOM   2203 C CD1 . LEU B 1 213 ? 10.333  2.611   11.103  1.00 52.00 ? 193 LEU B CD1 1 
ATOM   2204 C CD2 . LEU B 1 213 ? 10.033  0.313   10.192  1.00 45.99 ? 193 LEU B CD2 1 
ATOM   2205 N N   . GLN B 1 214 ? 4.989   0.479   12.034  1.00 43.26 ? 194 GLN B N   1 
ATOM   2206 C CA  . GLN B 1 214 ? 3.816   0.267   12.878  1.00 44.78 ? 194 GLN B CA  1 
ATOM   2207 C C   . GLN B 1 214 ? 3.440   -1.196  12.881  1.00 43.26 ? 194 GLN B C   1 
ATOM   2208 O O   . GLN B 1 214 ? 2.948   -1.713  13.884  1.00 38.65 ? 194 GLN B O   1 
ATOM   2209 C CB  . GLN B 1 214 ? 2.621   1.050   12.360  1.00 46.99 ? 194 GLN B CB  1 
ATOM   2210 C CG  . GLN B 1 214 ? 1.510   1.162   13.379  1.00 46.44 ? 194 GLN B CG  1 
ATOM   2211 C CD  . GLN B 1 214 ? 0.263   1.798   12.821  1.00 52.88 ? 194 GLN B CD  1 
ATOM   2212 O OE1 . GLN B 1 214 ? 0.050   1.834   11.605  1.00 54.33 ? 194 GLN B OE1 1 
ATOM   2213 N NE2 . GLN B 1 214 ? -0.584  2.305   13.715  1.00 58.04 ? 194 GLN B NE2 1 
ATOM   2214 N N   . SER B 1 215 ? 3.635   -1.830  11.725  1.00 46.20 ? 195 SER B N   1 
ATOM   2215 C CA  . SER B 1 215 ? 3.507   -3.274  11.581  1.00 48.66 ? 195 SER B CA  1 
ATOM   2216 C C   . SER B 1 215 ? 4.670   -3.977  12.274  1.00 46.39 ? 195 SER B C   1 
ATOM   2217 O O   . SER B 1 215 ? 4.556   -5.154  12.640  1.00 45.11 ? 195 SER B O   1 
ATOM   2218 C CB  . SER B 1 215 ? 3.426   -3.687  10.098  1.00 52.16 ? 195 SER B CB  1 
ATOM   2219 O OG  . SER B 1 215 ? 2.077   -3.731  9.638   1.00 50.53 ? 195 SER B OG  1 
ATOM   2220 N N   . LEU B 1 216 ? 5.786   -3.258  12.416  1.00 44.16 ? 196 LEU B N   1 
ATOM   2221 C CA  . LEU B 1 216 ? 6.897   -3.681  13.279  1.00 44.42 ? 196 LEU B CA  1 
ATOM   2222 C C   . LEU B 1 216 ? 6.408   -3.590  14.708  1.00 46.75 ? 196 LEU B C   1 
ATOM   2223 O O   . LEU B 1 216 ? 6.329   -4.598  15.411  1.00 50.39 ? 196 LEU B O   1 
ATOM   2224 C CB  . LEU B 1 216 ? 8.134   -2.780  13.085  1.00 44.64 ? 196 LEU B CB  1 
ATOM   2225 C CG  . LEU B 1 216 ? 9.374   -2.840  14.013  1.00 42.97 ? 196 LEU B CG  1 
ATOM   2226 C CD1 . LEU B 1 216 ? 10.242  -4.053  13.707  1.00 44.04 ? 196 LEU B CD1 1 
ATOM   2227 C CD2 . LEU B 1 216 ? 10.231  -1.581  13.900  1.00 39.72 ? 196 LEU B CD2 1 
ATOM   2228 N N   . ALA B 1 217 ? 6.017   -2.380  15.109  1.00 48.73 ? 197 ALA B N   1 
ATOM   2229 C CA  . ALA B 1 217 ? 5.709   -2.078  16.506  1.00 48.67 ? 197 ALA B CA  1 
ATOM   2230 C C   . ALA B 1 217 ? 4.319   -2.524  16.988  1.00 46.79 ? 197 ALA B C   1 
ATOM   2231 O O   . ALA B 1 217 ? 3.895   -2.146  18.067  1.00 48.88 ? 197 ALA B O   1 
ATOM   2232 C CB  . ALA B 1 217 ? 5.917   -0.595  16.761  1.00 47.89 ? 197 ALA B CB  1 
ATOM   2233 N N   . ARG B 1 218 ? 3.599   -3.305  16.195  1.00 49.94 ? 198 ARG B N   1 
ATOM   2234 C CA  . ARG B 1 218 ? 2.424   -4.015  16.719  1.00 52.05 ? 198 ARG B CA  1 
ATOM   2235 C C   . ARG B 1 218 ? 2.952   -5.032  17.697  1.00 55.46 ? 198 ARG B C   1 
ATOM   2236 O O   . ARG B 1 218 ? 2.530   -5.073  18.855  1.00 58.05 ? 198 ARG B O   1 
ATOM   2237 C CB  . ARG B 1 218 ? 1.628   -4.750  15.629  1.00 50.78 ? 198 ARG B CB  1 
ATOM   2238 C CG  . ARG B 1 218 ? 2.477   -5.356  14.510  1.00 51.06 ? 198 ARG B CG  1 
ATOM   2239 C CD  . ARG B 1 218 ? 1.968   -6.696  14.001  1.00 48.15 ? 198 ARG B CD  1 
ATOM   2240 N NE  . ARG B 1 218 ? 2.785   -7.188  12.896  1.00 42.70 ? 198 ARG B NE  1 
ATOM   2241 N N   . SER B 1 219 ? 3.927   -5.805  17.213  1.00 55.55 ? 199 SER B N   1 
ATOM   2242 C CA  . SER B 1 219 ? 4.434   -6.978  17.881  1.00 54.28 ? 199 SER B CA  1 
ATOM   2243 C C   . SER B 1 219 ? 4.932   -6.583  19.247  1.00 53.20 ? 199 SER B C   1 
ATOM   2244 O O   . SER B 1 219 ? 4.278   -6.842  20.252  1.00 55.64 ? 199 SER B O   1 
ATOM   2245 C CB  . SER B 1 219 ? 5.566   -7.611  17.052  1.00 53.52 ? 199 SER B CB  1 
ATOM   2246 O OG  . SER B 1 219 ? 5.386   -7.355  15.670  1.00 53.87 ? 199 SER B OG  1 
ATOM   2247 N N   . THR B 1 220 ? 6.080   -5.920  19.266  1.00 54.40 ? 200 THR B N   1 
ATOM   2248 C CA  . THR B 1 220 ? 6.717   -5.515  20.500  1.00 53.95 ? 200 THR B CA  1 
ATOM   2249 C C   . THR B 1 220 ? 6.156   -4.131  20.858  1.00 56.67 ? 200 THR B C   1 
ATOM   2250 O O   . THR B 1 220 ? 6.356   -3.132  20.151  1.00 60.88 ? 200 THR B O   1 
ATOM   2251 C CB  . THR B 1 220 ? 8.251   -5.618  20.394  1.00 52.72 ? 200 THR B CB  1 
ATOM   2252 O OG1 . THR B 1 220 ? 8.659   -5.398  19.044  1.00 50.69 ? 200 THR B OG1 1 
ATOM   2253 C CG2 . THR B 1 220 ? 8.703   -7.014  20.787  1.00 53.11 ? 200 THR B CG2 1 
ATOM   2254 N N   . ASN B 1 221 ? 5.504   -4.116  22.012  1.00 55.46 ? 201 ASN B N   1 
ATOM   2255 C CA  . ASN B 1 221 ? 4.228   -3.428  22.251  1.00 54.13 ? 201 ASN B CA  1 
ATOM   2256 C C   . ASN B 1 221 ? 4.129   -1.891  22.463  1.00 57.58 ? 201 ASN B C   1 
ATOM   2257 O O   . ASN B 1 221 ? 4.962   -1.097  21.984  1.00 56.39 ? 201 ASN B O   1 
ATOM   2258 C CB  . ASN B 1 221 ? 3.569   -4.149  23.446  1.00 54.89 ? 201 ASN B CB  1 
ATOM   2259 C CG  . ASN B 1 221 ? 4.415   -4.115  24.731  1.00 58.69 ? 201 ASN B CG  1 
ATOM   2260 O OD1 . ASN B 1 221 ? 4.125   -4.837  25.701  1.00 59.09 ? 201 ASN B OD1 1 
ATOM   2261 N ND2 . ASN B 1 221 ? 5.458   -3.299  24.749  1.00 57.43 ? 201 ASN B ND2 1 
ATOM   2262 N N   . ARG B 1 222 ? 3.033   -1.497  23.118  1.00 53.14 ? 202 ARG B N   1 
ATOM   2263 C CA  . ARG B 1 222 ? 2.982   -0.310  23.945  1.00 50.68 ? 202 ARG B CA  1 
ATOM   2264 C C   . ARG B 1 222 ? 2.950   -0.791  25.393  1.00 48.42 ? 202 ARG B C   1 
ATOM   2265 O O   . ARG B 1 222 ? 1.938   -0.672  26.083  1.00 51.28 ? 202 ARG B O   1 
ATOM   2266 C CB  . ARG B 1 222 ? 1.737   0.517   23.631  1.00 52.31 ? 202 ARG B CB  1 
ATOM   2267 N N   . ARG C 1 57  ? 26.641  -15.013 -7.846  1.00 52.43 ? 37  ARG C N   1 
ATOM   2268 C CA  . ARG C 1 57  ? 26.427  -13.558 -7.588  1.00 50.52 ? 37  ARG C CA  1 
ATOM   2269 C C   . ARG C 1 57  ? 27.550  -12.671 -8.105  1.00 51.22 ? 37  ARG C C   1 
ATOM   2270 O O   . ARG C 1 57  ? 27.292  -11.595 -8.685  1.00 46.00 ? 37  ARG C O   1 
ATOM   2271 C CB  . ARG C 1 57  ? 26.282  -13.280 -6.098  1.00 49.01 ? 37  ARG C CB  1 
ATOM   2272 C CG  . ARG C 1 57  ? 25.858  -11.834 -5.834  1.00 49.66 ? 37  ARG C CG  1 
ATOM   2273 C CD  . ARG C 1 57  ? 26.605  -11.130 -4.709  1.00 46.32 ? 37  ARG C CD  1 
ATOM   2274 N NE  . ARG C 1 57  ? 26.720  -9.700  -4.996  1.00 47.06 ? 37  ARG C NE  1 
ATOM   2275 C CZ  . ARG C 1 57  ? 27.071  -8.764  -4.117  1.00 48.06 ? 37  ARG C CZ  1 
ATOM   2276 N NH1 . ARG C 1 57  ? 27.157  -7.498  -4.503  1.00 50.11 ? 37  ARG C NH1 1 
ATOM   2277 N NH2 . ARG C 1 57  ? 27.346  -9.076  -2.858  1.00 48.33 ? 37  ARG C NH2 1 
ATOM   2278 N N   . GLY C 1 58  ? 28.782  -13.136 -7.889  1.00 48.80 ? 38  GLY C N   1 
ATOM   2279 C CA  . GLY C 1 58  ? 29.969  -12.285 -7.943  1.00 50.63 ? 38  GLY C CA  1 
ATOM   2280 C C   . GLY C 1 58  ? 30.520  -12.219 -6.527  1.00 51.97 ? 38  GLY C C   1 
ATOM   2281 O O   . GLY C 1 58  ? 30.708  -11.137 -5.943  1.00 48.77 ? 38  GLY C O   1 
ATOM   2282 N N   . MET C 1 59  ? 30.787  -13.407 -5.990  1.00 51.83 ? 39  MET C N   1 
ATOM   2283 C CA  . MET C 1 59  ? 31.041  -13.612 -4.568  1.00 50.58 ? 39  MET C CA  1 
ATOM   2284 C C   . MET C 1 59  ? 32.353  -12.974 -4.113  1.00 51.48 ? 39  MET C C   1 
ATOM   2285 O O   . MET C 1 59  ? 32.876  -12.064 -4.766  1.00 49.44 ? 39  MET C O   1 
ATOM   2286 C CB  . MET C 1 59  ? 31.072  -15.114 -4.291  1.00 48.72 ? 39  MET C CB  1 
ATOM   2287 N N   . HIS C 1 60  ? 32.872  -13.438 -2.980  1.00 49.96 ? 40  HIS C N   1 
ATOM   2288 C CA  . HIS C 1 60  ? 34.220  -13.076 -2.569  1.00 51.25 ? 40  HIS C CA  1 
ATOM   2289 C C   . HIS C 1 60  ? 35.236  -13.711 -3.530  1.00 51.90 ? 40  HIS C C   1 
ATOM   2290 O O   . HIS C 1 60  ? 36.050  -13.007 -4.146  1.00 57.00 ? 40  HIS C O   1 
ATOM   2291 C CB  . HIS C 1 60  ? 34.487  -13.526 -1.130  1.00 52.85 ? 40  HIS C CB  1 
ATOM   2292 N N   . VAL C 1 61  ? 35.182  -15.033 -3.671  1.00 47.61 ? 41  VAL C N   1 
ATOM   2293 C CA  . VAL C 1 61  ? 36.058  -15.742 -4.612  1.00 45.35 ? 41  VAL C CA  1 
ATOM   2294 C C   . VAL C 1 61  ? 35.301  -16.688 -5.513  1.00 43.92 ? 41  VAL C C   1 
ATOM   2295 O O   . VAL C 1 61  ? 35.471  -17.889 -5.417  1.00 48.10 ? 41  VAL C O   1 
ATOM   2296 C CB  . VAL C 1 61  ? 37.108  -16.584 -3.881  1.00 49.67 ? 41  VAL C CB  1 
ATOM   2297 N N   . PRO C 1 62  ? 34.468  -16.151 -6.404  1.00 43.85 ? 42  PRO C N   1 
ATOM   2298 C CA  . PRO C 1 62  ? 33.864  -16.970 -7.436  1.00 43.81 ? 42  PRO C CA  1 
ATOM   2299 C C   . PRO C 1 62  ? 34.891  -17.363 -8.504  1.00 47.48 ? 42  PRO C C   1 
ATOM   2300 O O   . PRO C 1 62  ? 34.950  -16.738 -9.570  1.00 43.13 ? 42  PRO C O   1 
ATOM   2301 C CB  . PRO C 1 62  ? 32.794  -16.045 -8.018  1.00 45.83 ? 42  PRO C CB  1 
ATOM   2302 C CG  . PRO C 1 62  ? 33.370  -14.667 -7.841  1.00 46.39 ? 42  PRO C CG  1 
ATOM   2303 C CD  . PRO C 1 62  ? 34.099  -14.727 -6.532  1.00 45.60 ? 42  PRO C CD  1 
ATOM   2304 N N   . GLU C 1 63  ? 35.678  -18.407 -8.222  1.00 52.38 ? 43  GLU C N   1 
ATOM   2305 C CA  . GLU C 1 63  ? 36.787  -18.813 -9.102  1.00 55.05 ? 43  GLU C CA  1 
ATOM   2306 C C   . GLU C 1 63  ? 36.686  -20.270 -9.600  1.00 59.35 ? 43  GLU C C   1 
ATOM   2307 O O   . GLU C 1 63  ? 36.843  -20.535 -10.800 1.00 53.92 ? 43  GLU C O   1 
ATOM   2308 C CB  . GLU C 1 63  ? 38.148  -18.529 -8.436  1.00 57.45 ? 43  GLU C CB  1 
ATOM   2309 C CG  . GLU C 1 63  ? 38.179  -18.517 -6.905  1.00 55.50 ? 43  GLU C CG  1 
ATOM   2310 C CD  . GLU C 1 63  ? 38.110  -19.903 -6.295  1.00 57.06 ? 43  GLU C CD  1 
ATOM   2311 O OE1 . GLU C 1 63  ? 37.691  -20.027 -5.117  1.00 57.94 ? 43  GLU C OE1 1 
ATOM   2312 O OE2 . GLU C 1 63  ? 38.480  -20.872 -7.001  1.00 57.64 ? 43  GLU C OE2 1 
ATOM   2313 N N   . HIS C 1 64  ? 36.453  -21.201 -8.674  1.00 62.37 ? 44  HIS C N   1 
ATOM   2314 C CA  . HIS C 1 64  ? 36.046  -22.570 -9.004  1.00 62.94 ? 44  HIS C CA  1 
ATOM   2315 C C   . HIS C 1 64  ? 34.514  -22.632 -9.059  1.00 64.58 ? 44  HIS C C   1 
ATOM   2316 O O   . HIS C 1 64  ? 33.931  -23.577 -9.601  1.00 65.60 ? 44  HIS C O   1 
ATOM   2317 C CB  . HIS C 1 64  ? 36.577  -23.560 -7.962  1.00 61.17 ? 44  HIS C CB  1 
ATOM   2318 N N   . VAL C 1 65  ? 33.875  -21.606 -8.495  1.00 62.73 ? 45  VAL C N   1 
ATOM   2319 C CA  . VAL C 1 65  ? 32.429  -21.449 -8.537  1.00 61.97 ? 45  VAL C CA  1 
ATOM   2320 C C   . VAL C 1 65  ? 31.976  -20.940 -9.893  1.00 63.20 ? 45  VAL C C   1 
ATOM   2321 O O   . VAL C 1 65  ? 30.781  -20.954 -10.210 1.00 62.23 ? 45  VAL C O   1 
ATOM   2322 C CB  . VAL C 1 65  ? 31.977  -20.424 -7.488  1.00 62.87 ? 45  VAL C CB  1 
ATOM   2323 N N   . ALA C 1 66  ? 32.942  -20.471 -10.679 1.00 61.22 ? 46  ALA C N   1 
ATOM   2324 C CA  . ALA C 1 66  ? 32.683  -19.835 -11.962 1.00 57.09 ? 46  ALA C CA  1 
ATOM   2325 C C   . ALA C 1 66  ? 31.988  -20.786 -12.932 1.00 55.22 ? 46  ALA C C   1 
ATOM   2326 O O   . ALA C 1 66  ? 30.758  -20.804 -13.011 1.00 55.73 ? 46  ALA C O   1 
ATOM   2327 C CB  . ALA C 1 66  ? 33.993  -19.301 -12.552 1.00 55.30 ? 46  ALA C CB  1 
ATOM   2328 N N   . MET C 1 67  ? 32.780  -21.579 -13.650 1.00 54.02 ? 47  MET C N   1 
ATOM   2329 C CA  . MET C 1 67  ? 32.271  -22.509 -14.659 1.00 55.87 ? 47  MET C CA  1 
ATOM   2330 C C   . MET C 1 67  ? 31.135  -23.374 -14.113 1.00 51.78 ? 47  MET C C   1 
ATOM   2331 O O   . MET C 1 67  ? 30.178  -23.676 -14.819 1.00 57.89 ? 47  MET C O   1 
ATOM   2332 C CB  . MET C 1 67  ? 33.408  -23.399 -15.217 1.00 55.98 ? 47  MET C CB  1 
ATOM   2333 C CG  . MET C 1 67  ? 34.093  -24.318 -14.201 1.00 53.64 ? 47  MET C CG  1 
ATOM   2334 S SD  . MET C 1 67  ? 34.755  -23.431 -12.770 1.00 49.05 ? 47  MET C SD  1 
ATOM   2335 C CE  . MET C 1 67  ? 36.282  -22.779 -13.426 1.00 48.73 ? 47  MET C CE  1 
ATOM   2336 N N   . HIS C 1 68  ? 31.228  -23.758 -12.854 1.00 48.65 ? 48  HIS C N   1 
ATOM   2337 C CA  . HIS C 1 68  ? 30.156  -24.537 -12.257 1.00 47.03 ? 48  HIS C CA  1 
ATOM   2338 C C   . HIS C 1 68  ? 28.882  -23.708 -12.085 1.00 46.37 ? 48  HIS C C   1 
ATOM   2339 O O   . HIS C 1 68  ? 28.021  -23.740 -12.959 1.00 46.50 ? 48  HIS C O   1 
ATOM   2340 C CB  . HIS C 1 68  ? 30.606  -25.148 -10.944 1.00 46.51 ? 48  HIS C CB  1 
ATOM   2341 C CG  . HIS C 1 68  ? 31.557  -26.289 -11.113 1.00 48.04 ? 48  HIS C CG  1 
ATOM   2342 N ND1 . HIS C 1 68  ? 31.143  -27.604 -11.146 1.00 47.42 ? 48  HIS C ND1 1 
ATOM   2343 C CD2 . HIS C 1 68  ? 32.905  -26.316 -11.237 1.00 49.05 ? 48  HIS C CD2 1 
ATOM   2344 C CE1 . HIS C 1 68  ? 32.192  -28.392 -11.282 1.00 46.84 ? 48  HIS C CE1 1 
ATOM   2345 N NE2 . HIS C 1 68  ? 33.274  -27.636 -11.338 1.00 49.92 ? 48  HIS C NE2 1 
ATOM   2346 N N   . HIS C 1 69  ? 28.792  -22.939 -10.997 1.00 45.28 ? 49  HIS C N   1 
ATOM   2347 C CA  . HIS C 1 69  ? 27.549  -22.252 -10.612 1.00 47.45 ? 49  HIS C CA  1 
ATOM   2348 C C   . HIS C 1 69  ? 26.939  -21.383 -11.703 1.00 51.60 ? 49  HIS C C   1 
ATOM   2349 O O   . HIS C 1 69  ? 25.787  -20.956 -11.591 1.00 52.46 ? 49  HIS C O   1 
ATOM   2350 C CB  . HIS C 1 69  ? 27.731  -21.433 -9.330  1.00 46.11 ? 49  HIS C CB  1 
ATOM   2351 C CG  . HIS C 1 69  ? 28.140  -22.266 -8.155  1.00 44.91 ? 49  HIS C CG  1 
ATOM   2352 N ND1 . HIS C 1 69  ? 27.511  -23.449 -7.827  1.00 42.14 ? 49  HIS C ND1 1 
ATOM   2353 C CD2 . HIS C 1 69  ? 29.128  -22.101 -7.246  1.00 43.01 ? 49  HIS C CD2 1 
ATOM   2354 C CE1 . HIS C 1 69  ? 28.091  -23.972 -6.764  1.00 42.50 ? 49  HIS C CE1 1 
ATOM   2355 N NE2 . HIS C 1 69  ? 29.075  -23.171 -6.392  1.00 42.57 ? 49  HIS C NE2 1 
ATOM   2356 N N   . THR C 1 70  ? 27.719  -21.128 -12.744 1.00 53.75 ? 50  THR C N   1 
ATOM   2357 C CA  . THR C 1 70  ? 27.199  -20.647 -14.001 1.00 53.27 ? 50  THR C CA  1 
ATOM   2358 C C   . THR C 1 70  ? 26.395  -21.757 -14.672 1.00 55.33 ? 50  THR C C   1 
ATOM   2359 O O   . THR C 1 70  ? 26.957  -22.715 -15.187 1.00 61.67 ? 50  THR C O   1 
ATOM   2360 C CB  . THR C 1 70  ? 28.359  -20.214 -14.913 1.00 52.32 ? 50  THR C CB  1 
ATOM   2361 O OG1 . THR C 1 70  ? 29.185  -19.271 -14.205 1.00 49.84 ? 50  THR C OG1 1 
ATOM   2362 C CG2 . THR C 1 70  ? 27.823  -19.587 -16.193 1.00 50.25 ? 50  THR C CG2 1 
ATOM   2363 N N   . HIS C 1 71  ? 25.073  -21.630 -14.638 1.00 59.23 ? 51  HIS C N   1 
ATOM   2364 C CA  . HIS C 1 71  ? 24.171  -22.558 -15.310 1.00 59.22 ? 51  HIS C CA  1 
ATOM   2365 C C   . HIS C 1 71  ? 23.392  -21.803 -16.373 1.00 59.15 ? 51  HIS C C   1 
ATOM   2366 O O   . HIS C 1 71  ? 23.138  -20.603 -16.238 1.00 60.17 ? 51  HIS C O   1 
ATOM   2367 C CB  . HIS C 1 71  ? 23.185  -23.169 -14.319 1.00 61.64 ? 51  HIS C CB  1 
ATOM   2368 C CG  . HIS C 1 71  ? 23.807  -24.118 -13.338 1.00 63.42 ? 51  HIS C CG  1 
ATOM   2369 N ND1 . HIS C 1 71  ? 24.792  -23.736 -12.451 1.00 60.53 ? 51  HIS C ND1 1 
ATOM   2370 C CD2 . HIS C 1 71  ? 23.556  -25.425 -13.081 1.00 61.06 ? 51  HIS C CD2 1 
ATOM   2371 C CE1 . HIS C 1 71  ? 25.135  -24.770 -11.705 1.00 64.03 ? 51  HIS C CE1 1 
ATOM   2372 N NE2 . HIS C 1 71  ? 24.402  -25.807 -12.069 1.00 65.12 ? 51  HIS C NE2 1 
ATOM   2373 N N   . ASP C 1 72  ? 23.007  -22.521 -17.427 1.00 57.89 ? 52  ASP C N   1 
ATOM   2374 C CA  . ASP C 1 72  ? 22.215  -21.950 -18.508 1.00 51.35 ? 52  ASP C CA  1 
ATOM   2375 C C   . ASP C 1 72  ? 20.747  -21.969 -18.066 1.00 50.17 ? 52  ASP C C   1 
ATOM   2376 O O   . ASP C 1 72  ? 20.239  -23.007 -17.631 1.00 49.30 ? 52  ASP C O   1 
ATOM   2377 C CB  . ASP C 1 72  ? 22.406  -22.745 -19.819 1.00 48.56 ? 52  ASP C CB  1 
ATOM   2378 C CG  . ASP C 1 72  ? 23.897  -22.951 -20.200 1.00 48.92 ? 52  ASP C CG  1 
ATOM   2379 O OD1 . ASP C 1 72  ? 24.719  -22.011 -20.069 1.00 49.46 ? 52  ASP C OD1 1 
ATOM   2380 O OD2 . ASP C 1 72  ? 24.248  -24.057 -20.661 1.00 43.21 ? 52  ASP C OD2 1 
ATOM   2381 N N   . VAL C 1 73  ? 20.073  -20.820 -18.160 1.00 47.55 ? 53  VAL C N   1 
ATOM   2382 C CA  . VAL C 1 73  ? 18.629  -20.758 -17.910 1.00 46.52 ? 53  VAL C CA  1 
ATOM   2383 C C   . VAL C 1 73  ? 17.937  -21.432 -19.096 1.00 44.02 ? 53  VAL C C   1 
ATOM   2384 O O   . VAL C 1 73  ? 18.599  -21.950 -19.984 1.00 38.61 ? 53  VAL C O   1 
ATOM   2385 C CB  . VAL C 1 73  ? 18.166  -19.298 -17.681 1.00 46.23 ? 53  VAL C CB  1 
ATOM   2386 C CG1 . VAL C 1 73  ? 16.651  -19.169 -17.573 1.00 45.77 ? 53  VAL C CG1 1 
ATOM   2387 C CG2 . VAL C 1 73  ? 18.817  -18.730 -16.425 1.00 46.60 ? 53  VAL C CG2 1 
ATOM   2388 N N   . GLY C 1 74  ? 16.614  -21.503 -19.069 1.00 47.00 ? 54  GLY C N   1 
ATOM   2389 C CA  . GLY C 1 74  ? 15.845  -21.863 -20.255 1.00 50.04 ? 54  GLY C CA  1 
ATOM   2390 C C   . GLY C 1 74  ? 14.388  -21.446 -20.168 1.00 49.87 ? 54  GLY C C   1 
ATOM   2391 O O   . GLY C 1 74  ? 14.007  -20.709 -19.263 1.00 48.27 ? 54  GLY C O   1 
ATOM   2392 N N   . PRO C 1 75  ? 13.567  -21.912 -21.123 1.00 54.03 ? 55  PRO C N   1 
ATOM   2393 C CA  . PRO C 1 75  ? 12.114  -21.735 -21.097 1.00 57.10 ? 55  PRO C CA  1 
ATOM   2394 C C   . PRO C 1 75  ? 11.402  -22.511 -19.985 1.00 57.84 ? 55  PRO C C   1 
ATOM   2395 O O   . PRO C 1 75  ? 10.374  -22.039 -19.479 1.00 61.55 ? 55  PRO C O   1 
ATOM   2396 C CB  . PRO C 1 75  ? 11.676  -22.257 -22.468 1.00 57.39 ? 55  PRO C CB  1 
ATOM   2397 C CG  . PRO C 1 75  ? 12.874  -22.074 -23.330 1.00 56.75 ? 55  PRO C CG  1 
ATOM   2398 C CD  . PRO C 1 75  ? 14.017  -22.418 -22.431 1.00 55.21 ? 55  PRO C CD  1 
ATOM   2399 N N   . ASP C 1 76  ? 11.911  -23.696 -19.636 1.00 53.81 ? 56  ASP C N   1 
ATOM   2400 C CA  . ASP C 1 76  ? 11.433  -24.417 -18.451 1.00 51.83 ? 56  ASP C CA  1 
ATOM   2401 C C   . ASP C 1 76  ? 12.525  -24.652 -17.384 1.00 53.10 ? 56  ASP C C   1 
ATOM   2402 O O   . ASP C 1 76  ? 12.222  -25.091 -16.265 1.00 56.01 ? 56  ASP C O   1 
ATOM   2403 C CB  . ASP C 1 76  ? 10.795  -25.743 -18.868 1.00 50.25 ? 56  ASP C CB  1 
ATOM   2404 N N   . GLN C 1 77  ? 13.779  -24.340 -17.724 1.00 53.85 ? 57  GLN C N   1 
ATOM   2405 C CA  . GLN C 1 77  ? 14.944  -24.616 -16.861 1.00 52.95 ? 57  GLN C CA  1 
ATOM   2406 C C   . GLN C 1 77  ? 15.289  -23.422 -15.936 1.00 52.41 ? 57  GLN C C   1 
ATOM   2407 O O   . GLN C 1 77  ? 15.229  -22.268 -16.362 1.00 53.18 ? 57  GLN C O   1 
ATOM   2408 C CB  . GLN C 1 77  ? 16.150  -25.004 -17.734 1.00 53.14 ? 57  GLN C CB  1 
ATOM   2409 C CG  . GLN C 1 77  ? 15.910  -26.225 -18.634 1.00 52.89 ? 57  GLN C CG  1 
ATOM   2410 C CD  . GLN C 1 77  ? 15.629  -25.888 -20.103 1.00 50.43 ? 57  GLN C CD  1 
ATOM   2411 O OE1 . GLN C 1 77  ? 16.546  -25.586 -20.856 1.00 48.89 ? 57  GLN C OE1 1 
ATOM   2412 N NE2 . GLN C 1 77  ? 14.367  -25.982 -20.518 1.00 48.50 ? 57  GLN C NE2 1 
ATOM   2413 N N   . CYS C 1 78  ? 15.640  -23.705 -14.679 1.00 51.83 ? 58  CYS C N   1 
ATOM   2414 C CA  . CYS C 1 78  ? 15.864  -22.661 -13.655 1.00 51.56 ? 58  CYS C CA  1 
ATOM   2415 C C   . CYS C 1 78  ? 17.073  -22.951 -12.748 1.00 49.01 ? 58  CYS C C   1 
ATOM   2416 O O   . CYS C 1 78  ? 17.733  -23.951 -12.916 1.00 45.73 ? 58  CYS C O   1 
ATOM   2417 C CB  . CYS C 1 78  ? 14.608  -22.521 -12.795 1.00 54.51 ? 58  CYS C CB  1 
ATOM   2418 S SG  . CYS C 1 78  ? 13.115  -23.153 -13.591 1.00 62.77 ? 58  CYS C SG  1 
ATOM   2419 N N   . CYS C 1 79  ? 17.356  -22.070 -11.788 1.00 51.92 ? 59  CYS C N   1 
ATOM   2420 C CA  . CYS C 1 79  ? 18.536  -22.199 -10.901 1.00 51.73 ? 59  CYS C CA  1 
ATOM   2421 C C   . CYS C 1 79  ? 18.685  -20.994 -9.938  1.00 51.59 ? 59  CYS C C   1 
ATOM   2422 O O   . CYS C 1 79  ? 18.060  -19.948 -10.157 1.00 47.49 ? 59  CYS C O   1 
ATOM   2423 C CB  . CYS C 1 79  ? 19.826  -22.385 -11.731 1.00 52.57 ? 59  CYS C CB  1 
ATOM   2424 S SG  . CYS C 1 79  ? 19.823  -21.626 -13.377 1.00 51.29 ? 59  CYS C SG  1 
ATOM   2425 N N   . SER C 1 80  ? 19.504  -21.147 -8.883  1.00 53.35 ? 60  SER C N   1 
ATOM   2426 C CA  . SER C 1 80  ? 19.688  -20.082 -7.859  1.00 56.39 ? 60  SER C CA  1 
ATOM   2427 C C   . SER C 1 80  ? 20.919  -20.257 -6.934  1.00 58.22 ? 60  SER C C   1 
ATOM   2428 O O   . SER C 1 80  ? 21.577  -21.292 -6.959  1.00 62.09 ? 60  SER C O   1 
ATOM   2429 C CB  . SER C 1 80  ? 18.408  -19.944 -7.033  1.00 56.09 ? 60  SER C CB  1 
ATOM   2430 O OG  . SER C 1 80  ? 17.413  -19.224 -7.757  1.00 55.11 ? 60  SER C OG  1 
ATOM   2431 N N   . SER C 1 81  ? 21.219  -19.238 -6.122  1.00 60.33 ? 61  SER C N   1 
ATOM   2432 C CA  . SER C 1 81  ? 22.428  -19.213 -5.268  1.00 59.49 ? 61  SER C CA  1 
ATOM   2433 C C   . SER C 1 81  ? 22.116  -19.463 -3.768  1.00 63.65 ? 61  SER C C   1 
ATOM   2434 O O   . SER C 1 81  ? 20.982  -19.820 -3.431  1.00 62.25 ? 61  SER C O   1 
ATOM   2435 C CB  . SER C 1 81  ? 23.152  -17.880 -5.462  1.00 57.00 ? 61  SER C CB  1 
ATOM   2436 O OG  . SER C 1 81  ? 22.373  -16.812 -4.973  1.00 57.74 ? 61  SER C OG  1 
ATOM   2437 N N   . VAL C 1 82  ? 23.120  -19.291 -2.887  1.00 65.96 ? 62  VAL C N   1 
ATOM   2438 C CA  . VAL C 1 82  ? 22.973  -19.499 -1.409  1.00 60.73 ? 62  VAL C CA  1 
ATOM   2439 C C   . VAL C 1 82  ? 24.068  -18.822 -0.554  1.00 55.81 ? 62  VAL C C   1 
ATOM   2440 O O   . VAL C 1 82  ? 25.147  -18.483 -1.059  1.00 50.94 ? 62  VAL C O   1 
ATOM   2441 C CB  . VAL C 1 82  ? 22.968  -21.002 -1.047  1.00 59.74 ? 62  VAL C CB  1 
ATOM   2442 N N   . VAL C 1 83  ? 23.773  -18.622 0.735   1.00 52.75 ? 63  VAL C N   1 
ATOM   2443 C CA  . VAL C 1 83  ? 24.751  -18.094 1.722   1.00 54.32 ? 63  VAL C CA  1 
ATOM   2444 C C   . VAL C 1 83  ? 24.846  -19.011 2.959   1.00 52.82 ? 63  VAL C C   1 
ATOM   2445 O O   . VAL C 1 83  ? 23.997  -18.939 3.862   1.00 51.96 ? 63  VAL C O   1 
ATOM   2446 C CB  . VAL C 1 83  ? 24.429  -16.625 2.178   1.00 53.10 ? 63  VAL C CB  1 
ATOM   2447 C CG1 . VAL C 1 83  ? 25.205  -16.234 3.430   1.00 48.67 ? 63  VAL C CG1 1 
ATOM   2448 C CG2 . VAL C 1 83  ? 24.753  -15.614 1.078   1.00 53.90 ? 63  VAL C CG2 1 
ATOM   2449 N N   . GLN C 1 84  ? 25.873  -19.865 2.991   1.00 47.47 ? 64  GLN C N   1 
ATOM   2450 C CA  . GLN C 1 84  ? 26.180  -20.681 4.180   1.00 45.85 ? 64  GLN C CA  1 
ATOM   2451 C C   . GLN C 1 84  ? 27.652  -21.081 4.305   1.00 43.35 ? 64  GLN C C   1 
ATOM   2452 O O   . GLN C 1 84  ? 28.128  -21.956 3.575   1.00 36.88 ? 64  GLN C O   1 
ATOM   2453 C CB  . GLN C 1 84  ? 25.347  -21.955 4.227   1.00 45.39 ? 64  GLN C CB  1 
ATOM   2454 C CG  . GLN C 1 84  ? 25.696  -22.851 5.416   1.00 46.86 ? 64  GLN C CG  1 
ATOM   2455 C CD  . GLN C 1 84  ? 25.572  -22.141 6.758   1.00 47.97 ? 64  GLN C CD  1 
ATOM   2456 O OE1 . GLN C 1 84  ? 24.567  -21.489 7.026   1.00 52.61 ? 64  GLN C OE1 1 
ATOM   2457 N NE2 . GLN C 1 84  ? 26.595  -22.258 7.604   1.00 47.73 ? 64  GLN C NE2 1 
ATOM   2458 N N   . MET C 1 85  ? 28.316  -20.482 5.294   1.00 41.89 ? 65  MET C N   1 
ATOM   2459 C CA  . MET C 1 85  ? 29.755  -20.595 5.481   1.00 45.24 ? 65  MET C CA  1 
ATOM   2460 C C   . MET C 1 85  ? 30.063  -21.226 6.824   1.00 46.17 ? 65  MET C C   1 
ATOM   2461 O O   . MET C 1 85  ? 29.272  -21.112 7.781   1.00 43.11 ? 65  MET C O   1 
ATOM   2462 C CB  . MET C 1 85  ? 30.418  -19.213 5.464   1.00 46.21 ? 65  MET C CB  1 
ATOM   2463 C CG  . MET C 1 85  ? 29.594  -18.102 4.833   1.00 46.34 ? 65  MET C CG  1 
ATOM   2464 S SD  . MET C 1 85  ? 30.436  -16.522 4.877   1.00 42.08 ? 65  MET C SD  1 
ATOM   2465 C CE  . MET C 1 85  ? 30.959  -16.459 6.605   1.00 44.50 ? 65  MET C CE  1 
ATOM   2466 N N   . ILE C 1 86  ? 31.245  -21.837 6.902   1.00 44.55 ? 66  ILE C N   1 
ATOM   2467 C CA  . ILE C 1 86  ? 31.691  -22.527 8.114   1.00 44.48 ? 66  ILE C CA  1 
ATOM   2468 C C   . ILE C 1 86  ? 33.144  -22.159 8.452   1.00 47.50 ? 66  ILE C C   1 
ATOM   2469 O O   . ILE C 1 86  ? 33.963  -21.933 7.561   1.00 46.56 ? 66  ILE C O   1 
ATOM   2470 C CB  . ILE C 1 86  ? 31.480  -24.044 7.934   1.00 42.15 ? 66  ILE C CB  1 
ATOM   2471 C CG1 . ILE C 1 86  ? 29.972  -24.343 7.904   1.00 39.81 ? 66  ILE C CG1 1 
ATOM   2472 C CG2 . ILE C 1 86  ? 32.148  -24.828 9.050   1.00 43.38 ? 66  ILE C CG2 1 
ATOM   2473 C CD1 . ILE C 1 86  ? 29.482  -25.023 6.645   1.00 38.94 ? 66  ILE C CD1 1 
ATOM   2474 N N   . HIS C 1 87  ? 33.446  -22.083 9.744   1.00 52.39 ? 67  HIS C N   1 
ATOM   2475 C CA  . HIS C 1 87  ? 34.753  -21.608 10.229  1.00 55.91 ? 67  HIS C CA  1 
ATOM   2476 C C   . HIS C 1 87  ? 35.735  -22.744 10.516  1.00 57.05 ? 67  HIS C C   1 
ATOM   2477 O O   . HIS C 1 87  ? 36.944  -22.510 10.659  1.00 63.20 ? 67  HIS C O   1 
ATOM   2478 C CB  . HIS C 1 87  ? 34.585  -20.749 11.489  1.00 57.76 ? 67  HIS C CB  1 
ATOM   2479 C CG  . HIS C 1 87  ? 35.877  -20.273 12.077  1.00 61.02 ? 67  HIS C CG  1 
ATOM   2480 N ND1 . HIS C 1 87  ? 36.577  -20.999 13.017  1.00 60.14 ? 67  HIS C ND1 1 
ATOM   2481 C CD2 . HIS C 1 87  ? 36.596  -19.147 11.857  1.00 62.95 ? 67  HIS C CD2 1 
ATOM   2482 C CE1 . HIS C 1 87  ? 37.677  -20.346 13.344  1.00 63.48 ? 67  HIS C CE1 1 
ATOM   2483 N NE2 . HIS C 1 87  ? 37.711  -19.217 12.658  1.00 64.70 ? 67  HIS C NE2 1 
ATOM   2484 N N   . ALA C 1 88  ? 35.237  -23.967 10.632  1.00 54.35 ? 68  ALA C N   1 
ATOM   2485 C CA  . ALA C 1 88  ? 36.142  -25.109 10.667  1.00 54.10 ? 68  ALA C CA  1 
ATOM   2486 C C   . ALA C 1 88  ? 36.858  -25.160 9.305   1.00 51.98 ? 68  ALA C C   1 
ATOM   2487 O O   . ALA C 1 88  ? 36.331  -24.660 8.301   1.00 53.87 ? 68  ALA C O   1 
ATOM   2488 C CB  . ALA C 1 88  ? 35.381  -26.399 10.941  1.00 53.07 ? 68  ALA C CB  1 
ATOM   2489 N N   . PRO C 1 89  ? 38.064  -25.734 9.263   1.00 47.09 ? 69  PRO C N   1 
ATOM   2490 C CA  . PRO C 1 89  ? 38.773  -25.770 7.990   1.00 46.46 ? 69  PRO C CA  1 
ATOM   2491 C C   . PRO C 1 89  ? 37.931  -26.353 6.852   1.00 44.49 ? 69  PRO C C   1 
ATOM   2492 O O   . PRO C 1 89  ? 36.982  -27.078 7.110   1.00 43.35 ? 69  PRO C O   1 
ATOM   2493 C CB  . PRO C 1 89  ? 40.003  -26.645 8.295   1.00 47.28 ? 69  PRO C CB  1 
ATOM   2494 C CG  . PRO C 1 89  ? 40.252  -26.458 9.755   1.00 46.37 ? 69  PRO C CG  1 
ATOM   2495 C CD  . PRO C 1 89  ? 38.906  -26.193 10.387  1.00 48.71 ? 69  PRO C CD  1 
ATOM   2496 N N   . PRO C 1 90  ? 38.284  -26.038 5.594   1.00 45.15 ? 70  PRO C N   1 
ATOM   2497 C CA  . PRO C 1 90  ? 37.486  -26.413 4.423   1.00 45.24 ? 70  PRO C CA  1 
ATOM   2498 C C   . PRO C 1 90  ? 37.538  -27.892 4.117   1.00 45.21 ? 70  PRO C C   1 
ATOM   2499 O O   . PRO C 1 90  ? 36.525  -28.494 3.786   1.00 45.68 ? 70  PRO C O   1 
ATOM   2500 C CB  . PRO C 1 90  ? 38.131  -25.613 3.284   1.00 44.79 ? 70  PRO C CB  1 
ATOM   2501 C CG  . PRO C 1 90  ? 39.520  -25.364 3.727   1.00 46.26 ? 70  PRO C CG  1 
ATOM   2502 C CD  . PRO C 1 90  ? 39.488  -25.278 5.222   1.00 46.65 ? 70  PRO C CD  1 
ATOM   2503 N N   . GLU C 1 91  ? 38.724  -28.463 4.251   1.00 45.77 ? 71  GLU C N   1 
ATOM   2504 C CA  . GLU C 1 91  ? 38.952  -29.879 4.011   1.00 45.64 ? 71  GLU C CA  1 
ATOM   2505 C C   . GLU C 1 91  ? 38.242  -30.729 5.063   1.00 39.66 ? 71  GLU C C   1 
ATOM   2506 O O   . GLU C 1 91  ? 37.902  -31.876 4.829   1.00 40.69 ? 71  GLU C O   1 
ATOM   2507 C CB  . GLU C 1 91  ? 40.471  -30.135 4.010   1.00 51.03 ? 71  GLU C CB  1 
ATOM   2508 C CG  . GLU C 1 91  ? 41.208  -29.299 2.955   1.00 54.06 ? 71  GLU C CG  1 
ATOM   2509 C CD  . GLU C 1 91  ? 42.713  -29.398 3.045   1.00 55.94 ? 71  GLU C CD  1 
ATOM   2510 O OE1 . GLU C 1 91  ? 43.221  -29.506 4.188   1.00 55.22 ? 71  GLU C OE1 1 
ATOM   2511 O OE2 . GLU C 1 91  ? 43.376  -29.356 1.969   1.00 51.16 ? 71  GLU C OE2 1 
ATOM   2512 N N   . SER C 1 92  ? 38.031  -30.148 6.234   1.00 39.29 ? 72  SER C N   1 
ATOM   2513 C CA  . SER C 1 92  ? 37.228  -30.765 7.284   1.00 37.89 ? 72  SER C CA  1 
ATOM   2514 C C   . SER C 1 92  ? 35.746  -30.729 6.905   1.00 37.73 ? 72  SER C C   1 
ATOM   2515 O O   . SER C 1 92  ? 34.979  -31.591 7.337   1.00 37.65 ? 72  SER C O   1 
ATOM   2516 C CB  . SER C 1 92  ? 37.467  -30.052 8.627   1.00 36.28 ? 72  SER C CB  1 
ATOM   2517 O OG  . SER C 1 92  ? 38.849  -30.054 8.962   1.00 32.63 ? 72  SER C OG  1 
ATOM   2518 N N   . VAL C 1 93  ? 35.352  -29.733 6.108   1.00 36.99 ? 73  VAL C N   1 
ATOM   2519 C CA  . VAL C 1 93  ? 33.977  -29.640 5.597   1.00 38.44 ? 73  VAL C CA  1 
ATOM   2520 C C   . VAL C 1 93  ? 33.787  -30.550 4.396   1.00 39.22 ? 73  VAL C C   1 
ATOM   2521 O O   . VAL C 1 93  ? 32.768  -31.232 4.281   1.00 36.83 ? 73  VAL C O   1 
ATOM   2522 C CB  . VAL C 1 93  ? 33.588  -28.199 5.168   1.00 36.91 ? 73  VAL C CB  1 
ATOM   2523 C CG1 . VAL C 1 93  ? 32.173  -28.168 4.607   1.00 36.12 ? 73  VAL C CG1 1 
ATOM   2524 C CG2 . VAL C 1 93  ? 33.680  -27.257 6.346   1.00 38.52 ? 73  VAL C CG2 1 
ATOM   2525 N N   . TRP C 1 94  ? 34.749  -30.502 3.477   1.00 42.60 ? 74  TRP C N   1 
ATOM   2526 C CA  . TRP C 1 94  ? 34.737  -31.348 2.289   1.00 45.91 ? 74  TRP C CA  1 
ATOM   2527 C C   . TRP C 1 94  ? 34.557  -32.797 2.711   1.00 50.09 ? 74  TRP C C   1 
ATOM   2528 O O   . TRP C 1 94  ? 33.764  -33.536 2.120   1.00 48.90 ? 74  TRP C O   1 
ATOM   2529 C CB  . TRP C 1 94  ? 36.035  -31.168 1.514   1.00 45.36 ? 74  TRP C CB  1 
ATOM   2530 C CG  . TRP C 1 94  ? 36.226  -32.135 0.410   1.00 46.25 ? 74  TRP C CG  1 
ATOM   2531 C CD1 . TRP C 1 94  ? 37.135  -33.138 0.373   1.00 48.09 ? 74  TRP C CD1 1 
ATOM   2532 C CD2 . TRP C 1 94  ? 35.502  -32.197 -0.833  1.00 46.06 ? 74  TRP C CD2 1 
ATOM   2533 N NE1 . TRP C 1 94  ? 37.033  -33.824 -0.813  1.00 50.22 ? 74  TRP C NE1 1 
ATOM   2534 C CE2 . TRP C 1 94  ? 36.033  -33.275 -1.568  1.00 47.19 ? 74  TRP C CE2 1 
ATOM   2535 C CE3 . TRP C 1 94  ? 34.464  -31.441 -1.401  1.00 45.71 ? 74  TRP C CE3 1 
ATOM   2536 C CZ2 . TRP C 1 94  ? 35.557  -33.629 -2.843  1.00 46.86 ? 74  TRP C CZ2 1 
ATOM   2537 C CZ3 . TRP C 1 94  ? 33.996  -31.787 -2.681  1.00 42.63 ? 74  TRP C CZ3 1 
ATOM   2538 C CH2 . TRP C 1 94  ? 34.542  -32.866 -3.378  1.00 43.44 ? 74  TRP C CH2 1 
ATOM   2539 N N   . ALA C 1 95  ? 35.287  -33.173 3.760   1.00 53.77 ? 75  ALA C N   1 
ATOM   2540 C CA  . ALA C 1 95  ? 35.136  -34.460 4.414   1.00 56.71 ? 75  ALA C CA  1 
ATOM   2541 C C   . ALA C 1 95  ? 33.701  -34.946 4.373   1.00 54.87 ? 75  ALA C C   1 
ATOM   2542 O O   . ALA C 1 95  ? 33.432  -36.021 3.861   1.00 61.76 ? 75  ALA C O   1 
ATOM   2543 C CB  . ALA C 1 95  ? 35.611  -34.370 5.855   1.00 60.10 ? 75  ALA C CB  1 
ATOM   2544 N N   . LEU C 1 96  ? 32.785  -34.144 4.898   1.00 53.73 ? 76  LEU C N   1 
ATOM   2545 C CA  . LEU C 1 96  ? 31.362  -34.505 4.928   1.00 52.85 ? 76  LEU C CA  1 
ATOM   2546 C C   . LEU C 1 96  ? 30.653  -34.324 3.589   1.00 53.84 ? 76  LEU C C   1 
ATOM   2547 O O   . LEU C 1 96  ? 29.674  -35.023 3.310   1.00 60.16 ? 76  LEU C O   1 
ATOM   2548 C CB  . LEU C 1 96  ? 30.623  -33.690 5.991   1.00 49.91 ? 76  LEU C CB  1 
ATOM   2549 C CG  . LEU C 1 96  ? 30.975  -34.045 7.438   1.00 47.73 ? 76  LEU C CG  1 
ATOM   2550 C CD1 . LEU C 1 96  ? 31.207  -32.775 8.232   1.00 48.28 ? 76  LEU C CD1 1 
ATOM   2551 C CD2 . LEU C 1 96  ? 29.907  -34.920 8.093   1.00 46.92 ? 76  LEU C CD2 1 
ATOM   2552 N N   . VAL C 1 97  ? 31.125  -33.390 2.765   1.00 51.72 ? 77  VAL C N   1 
ATOM   2553 C CA  . VAL C 1 97  ? 30.463  -33.119 1.474   1.00 49.48 ? 77  VAL C CA  1 
ATOM   2554 C C   . VAL C 1 97  ? 31.013  -34.038 0.400   1.00 48.58 ? 77  VAL C C   1 
ATOM   2555 O O   . VAL C 1 97  ? 30.916  -33.715 -0.777  1.00 45.71 ? 77  VAL C O   1 
ATOM   2556 C CB  . VAL C 1 97  ? 30.619  -31.649 0.971   1.00 47.44 ? 77  VAL C CB  1 
ATOM   2557 C CG1 . VAL C 1 97  ? 29.358  -31.201 0.251   1.00 47.71 ? 77  VAL C CG1 1 
ATOM   2558 C CG2 . VAL C 1 97  ? 30.913  -30.675 2.086   1.00 46.56 ? 77  VAL C CG2 1 
ATOM   2559 N N   . ARG C 1 98  ? 31.611  -35.162 0.817   1.00 53.33 ? 78  ARG C N   1 
ATOM   2560 C CA  . ARG C 1 98  ? 32.240  -36.150 -0.089  1.00 53.29 ? 78  ARG C CA  1 
ATOM   2561 C C   . ARG C 1 98  ? 31.587  -37.538 0.001   1.00 53.15 ? 78  ARG C C   1 
ATOM   2562 O O   . ARG C 1 98  ? 31.742  -38.348 -0.913  1.00 57.45 ? 78  ARG C O   1 
ATOM   2563 C CB  . ARG C 1 98  ? 33.735  -36.287 0.236   1.00 52.47 ? 78  ARG C CB  1 
ATOM   2564 C CG  . ARG C 1 98  ? 34.593  -36.894 -0.877  1.00 54.17 ? 78  ARG C CG  1 
ATOM   2565 C CD  . ARG C 1 98  ? 35.850  -37.577 -0.331  1.00 55.88 ? 78  ARG C CD  1 
ATOM   2566 N NE  . ARG C 1 98  ? 37.091  -36.856 -0.622  1.00 55.76 ? 78  ARG C NE  1 
ATOM   2567 C CZ  . ARG C 1 98  ? 38.255  -37.046 0.010   1.00 56.63 ? 78  ARG C CZ  1 
ATOM   2568 N NH1 . ARG C 1 98  ? 38.376  -37.931 0.994   1.00 54.74 ? 78  ARG C NH1 1 
ATOM   2569 N NH2 . ARG C 1 98  ? 39.322  -36.340 -0.353  1.00 56.87 ? 78  ARG C NH2 1 
ATOM   2570 N N   . ARG C 1 99  ? 30.861  -37.807 1.087   1.00 52.26 ? 79  ARG C N   1 
ATOM   2571 C CA  . ARG C 1 99  ? 30.333  -39.147 1.353   1.00 54.26 ? 79  ARG C CA  1 
ATOM   2572 C C   . ARG C 1 99  ? 28.836  -39.190 1.038   1.00 51.27 ? 79  ARG C C   1 
ATOM   2573 O O   . ARG C 1 99  ? 28.008  -39.278 1.934   1.00 48.50 ? 79  ARG C O   1 
ATOM   2574 C CB  . ARG C 1 99  ? 30.605  -39.560 2.817   1.00 56.06 ? 79  ARG C CB  1 
ATOM   2575 C CG  . ARG C 1 99  ? 32.047  -39.373 3.283   1.00 56.56 ? 79  ARG C CG  1 
ATOM   2576 C CD  . ARG C 1 99  ? 32.926  -40.568 2.955   1.00 62.87 ? 79  ARG C CD  1 
ATOM   2577 N NE  . ARG C 1 99  ? 33.013  -41.521 4.067   1.00 68.73 ? 79  ARG C NE  1 
ATOM   2578 C CZ  . ARG C 1 99  ? 32.278  -42.628 4.213   1.00 73.91 ? 79  ARG C CZ  1 
ATOM   2579 N NH1 . ARG C 1 99  ? 31.365  -42.989 3.308   1.00 76.07 ? 79  ARG C NH1 1 
ATOM   2580 N NH2 . ARG C 1 99  ? 32.471  -43.401 5.281   1.00 73.37 ? 79  ARG C NH2 1 
ATOM   2581 N N   . PHE C 1 100 ? 28.514  -39.088 -0.246  1.00 50.53 ? 80  PHE C N   1 
ATOM   2582 C CA  . PHE C 1 100 ? 27.153  -39.289 -0.772  1.00 52.75 ? 80  PHE C CA  1 
ATOM   2583 C C   . PHE C 1 100 ? 26.190  -39.878 0.247   1.00 54.04 ? 80  PHE C C   1 
ATOM   2584 O O   . PHE C 1 100 ? 25.042  -40.188 -0.082  1.00 60.97 ? 80  PHE C O   1 
ATOM   2585 C CB  . PHE C 1 100 ? 27.174  -40.220 -1.999  1.00 53.65 ? 80  PHE C CB  1 
ATOM   2586 C CG  . PHE C 1 100 ? 27.900  -39.658 -3.188  1.00 49.43 ? 80  PHE C CG  1 
ATOM   2587 C CD1 . PHE C 1 100 ? 29.268  -39.514 -3.170  1.00 47.69 ? 80  PHE C CD1 1 
ATOM   2588 C CD2 . PHE C 1 100 ? 27.208  -39.293 -4.330  1.00 47.88 ? 80  PHE C CD2 1 
ATOM   2589 C CE1 . PHE C 1 100 ? 29.934  -39.012 -4.255  1.00 47.16 ? 80  PHE C CE1 1 
ATOM   2590 C CE2 . PHE C 1 100 ? 27.872  -38.796 -5.424  1.00 45.53 ? 80  PHE C CE2 1 
ATOM   2591 C CZ  . PHE C 1 100 ? 29.231  -38.656 -5.380  1.00 45.19 ? 80  PHE C CZ  1 
ATOM   2592 N N   . LYS C 1 104 ? 24.392  -39.549 2.890   1.00 46.14 ? 84  LYS C N   1 
ATOM   2593 C CA  . LYS C 1 104 ? 23.168  -38.746 3.053   1.00 45.48 ? 84  LYS C CA  1 
ATOM   2594 C C   . LYS C 1 104 ? 23.446  -37.258 3.258   1.00 43.93 ? 84  LYS C C   1 
ATOM   2595 O O   . LYS C 1 104 ? 24.576  -36.847 3.546   1.00 43.72 ? 84  LYS C O   1 
ATOM   2596 C CB  . LYS C 1 104 ? 22.318  -39.257 4.225   1.00 42.00 ? 84  LYS C CB  1 
ATOM   2597 N N   . VAL C 1 105 ? 22.392  -36.468 3.056   1.00 42.57 ? 85  VAL C N   1 
ATOM   2598 C CA  . VAL C 1 105 ? 22.304  -35.061 3.468   1.00 38.82 ? 85  VAL C CA  1 
ATOM   2599 C C   . VAL C 1 105 ? 23.245  -34.727 4.626   1.00 39.55 ? 85  VAL C C   1 
ATOM   2600 O O   . VAL C 1 105 ? 23.010  -33.812 5.422   1.00 36.93 ? 85  VAL C O   1 
ATOM   2601 C CB  . VAL C 1 105 ? 20.856  -34.767 3.898   1.00 37.94 ? 85  VAL C CB  1 
ATOM   2602 C CG1 . VAL C 1 105 ? 20.505  -35.573 5.152   1.00 36.31 ? 85  VAL C CG1 1 
ATOM   2603 C CG2 . VAL C 1 105 ? 20.607  -33.268 4.065   1.00 37.76 ? 85  VAL C CG2 1 
ATOM   2604 N N   . VAL C 1 131 ? 13.493  -40.931 0.533   1.00 50.62 ? 111 VAL C N   1 
ATOM   2605 C CA  . VAL C 1 131 ? 13.385  -39.507 0.195   1.00 46.98 ? 111 VAL C CA  1 
ATOM   2606 C C   . VAL C 1 131 ? 13.407  -38.644 1.457   1.00 44.28 ? 111 VAL C C   1 
ATOM   2607 O O   . VAL C 1 131 ? 14.356  -38.708 2.242   1.00 46.44 ? 111 VAL C O   1 
ATOM   2608 C CB  . VAL C 1 131 ? 12.099  -39.235 -0.600  1.00 43.93 ? 111 VAL C CB  1 
ATOM   2609 N N   . VAL C 1 132 ? 12.381  -37.811 1.614   1.00 42.01 ? 112 VAL C N   1 
ATOM   2610 C CA  . VAL C 1 132 ? 11.982  -37.269 2.907   1.00 38.54 ? 112 VAL C CA  1 
ATOM   2611 C C   . VAL C 1 132 ? 10.536  -37.686 3.174   1.00 38.55 ? 112 VAL C C   1 
ATOM   2612 O O   . VAL C 1 132 ? 9.875   -37.121 4.034   1.00 40.87 ? 112 VAL C O   1 
ATOM   2613 C CB  . VAL C 1 132 ? 12.109  -35.741 2.920   1.00 38.12 ? 112 VAL C CB  1 
ATOM   2614 N N   . SER C 1 133 ? 10.060  -38.682 2.425   1.00 40.50 ? 113 SER C N   1 
ATOM   2615 C CA  . SER C 1 133 ? 8.686   -39.207 2.491   1.00 42.28 ? 113 SER C CA  1 
ATOM   2616 C C   . SER C 1 133 ? 7.612   -38.120 2.239   1.00 48.09 ? 113 SER C C   1 
ATOM   2617 O O   . SER C 1 133 ? 7.818   -37.252 1.396   1.00 48.23 ? 113 SER C O   1 
ATOM   2618 C CB  . SER C 1 133 ? 8.469   -39.984 3.802   1.00 41.94 ? 113 SER C CB  1 
ATOM   2619 O OG  . SER C 1 133 ? 9.334   -41.097 3.891   1.00 39.37 ? 113 SER C OG  1 
ATOM   2620 N N   . GLY C 1 134 ? 6.468   -38.190 2.928   1.00 55.86 ? 114 GLY C N   1 
ATOM   2621 C CA  . GLY C 1 134 ? 5.440   -37.139 2.895   1.00 61.73 ? 114 GLY C CA  1 
ATOM   2622 C C   . GLY C 1 134 ? 4.331   -37.423 1.899   1.00 70.00 ? 114 GLY C C   1 
ATOM   2623 O O   . GLY C 1 134 ? 3.217   -37.820 2.273   1.00 73.89 ? 114 GLY C O   1 
ATOM   2624 N N   . LEU C 1 135 ? 4.642   -37.213 0.623   1.00 74.40 ? 115 LEU C N   1 
ATOM   2625 C CA  . LEU C 1 135 ? 3.736   -37.564 -0.473  1.00 76.89 ? 115 LEU C CA  1 
ATOM   2626 C C   . LEU C 1 135 ? 3.656   -39.096 -0.550  1.00 79.50 ? 115 LEU C C   1 
ATOM   2627 O O   . LEU C 1 135 ? 4.569   -39.775 -0.075  1.00 87.11 ? 115 LEU C O   1 
ATOM   2628 C CB  . LEU C 1 135 ? 4.260   -36.977 -1.792  1.00 75.51 ? 115 LEU C CB  1 
ATOM   2629 C CG  . LEU C 1 135 ? 3.220   -36.548 -2.825  1.00 74.05 ? 115 LEU C CG  1 
ATOM   2630 N N   . PRO C 1 136 ? 2.582   -39.652 -1.149  1.00 79.10 ? 116 PRO C N   1 
ATOM   2631 C CA  . PRO C 1 136 ? 2.435   -41.122 -1.178  1.00 79.53 ? 116 PRO C CA  1 
ATOM   2632 C C   . PRO C 1 136 ? 3.640   -41.901 -1.752  1.00 75.89 ? 116 PRO C C   1 
ATOM   2633 O O   . PRO C 1 136 ? 4.018   -42.947 -1.209  1.00 75.21 ? 116 PRO C O   1 
ATOM   2634 C CB  . PRO C 1 136 ? 1.192   -41.335 -2.056  1.00 80.70 ? 116 PRO C CB  1 
ATOM   2635 C CG  . PRO C 1 136 ? 0.426   -40.062 -1.960  1.00 80.61 ? 116 PRO C CG  1 
ATOM   2636 C CD  . PRO C 1 136 ? 1.461   -38.981 -1.833  1.00 81.06 ? 116 PRO C CD  1 
ATOM   2637 N N   . ALA C 1 137 ? 4.220   -41.391 -2.838  1.00 73.91 ? 117 ALA C N   1 
ATOM   2638 C CA  . ALA C 1 137 ? 5.389   -42.006 -3.475  1.00 72.69 ? 117 ALA C CA  1 
ATOM   2639 C C   . ALA C 1 137 ? 6.603   -41.099 -3.340  1.00 68.66 ? 117 ALA C C   1 
ATOM   2640 O O   . ALA C 1 137 ? 6.475   -39.957 -2.911  1.00 62.94 ? 117 ALA C O   1 
ATOM   2641 C CB  . ALA C 1 137 ? 5.108   -42.294 -4.945  1.00 73.96 ? 117 ALA C CB  1 
ATOM   2642 N N   . VAL C 1 138 ? 7.769   -41.632 -3.712  1.00 67.62 ? 118 VAL C N   1 
ATOM   2643 C CA  . VAL C 1 138 ? 9.055   -40.942 -3.601  1.00 61.14 ? 118 VAL C CA  1 
ATOM   2644 C C   . VAL C 1 138 ? 10.114  -41.590 -4.503  1.00 58.85 ? 118 VAL C C   1 
ATOM   2645 O O   . VAL C 1 138 ? 10.624  -42.654 -4.177  1.00 64.40 ? 118 VAL C O   1 
ATOM   2646 C CB  . VAL C 1 138 ? 9.602   -40.984 -2.157  1.00 59.96 ? 118 VAL C CB  1 
ATOM   2647 C CG1 . VAL C 1 138 ? 8.834   -40.040 -1.244  1.00 59.73 ? 118 VAL C CG1 1 
ATOM   2648 C CG2 . VAL C 1 138 ? 9.580   -42.397 -1.595  1.00 61.56 ? 118 VAL C CG2 1 
ATOM   2649 N N   . SER C 1 139 ? 10.459  -40.943 -5.619  1.00 55.56 ? 119 SER C N   1 
ATOM   2650 C CA  . SER C 1 139 ? 11.452  -41.474 -6.569  1.00 48.89 ? 119 SER C CA  1 
ATOM   2651 C C   . SER C 1 139 ? 12.585  -40.480 -6.811  1.00 49.31 ? 119 SER C C   1 
ATOM   2652 O O   . SER C 1 139 ? 12.371  -39.270 -6.687  1.00 50.89 ? 119 SER C O   1 
ATOM   2653 C CB  . SER C 1 139 ? 10.783  -41.800 -7.912  1.00 47.35 ? 119 SER C CB  1 
ATOM   2654 O OG  . SER C 1 139 ? 10.308  -40.638 -8.583  1.00 42.62 ? 119 SER C OG  1 
ATOM   2655 N N   . SER C 1 140 ? 13.776  -40.998 -7.144  1.00 47.25 ? 120 SER C N   1 
ATOM   2656 C CA  . SER C 1 140 ? 14.883  -40.198 -7.689  1.00 47.66 ? 120 SER C CA  1 
ATOM   2657 C C   . SER C 1 140 ? 15.789  -41.032 -8.599  1.00 48.55 ? 120 SER C C   1 
ATOM   2658 O O   . SER C 1 140 ? 15.728  -42.263 -8.588  1.00 53.08 ? 120 SER C O   1 
ATOM   2659 C CB  . SER C 1 140 ? 15.725  -39.592 -6.567  1.00 48.09 ? 120 SER C CB  1 
ATOM   2660 O OG  . SER C 1 140 ? 16.673  -38.680 -7.099  1.00 47.38 ? 120 SER C OG  1 
ATOM   2661 N N   . THR C 1 141 ? 16.647  -40.354 -9.362  1.00 45.10 ? 121 THR C N   1 
ATOM   2662 C CA  . THR C 1 141 ? 17.532  -41.008 -10.336 1.00 41.54 ? 121 THR C CA  1 
ATOM   2663 C C   . THR C 1 141 ? 18.846  -40.222 -10.472 1.00 38.61 ? 121 THR C C   1 
ATOM   2664 O O   . THR C 1 141 ? 19.177  -39.744 -11.539 1.00 36.73 ? 121 THR C O   1 
ATOM   2665 C CB  . THR C 1 141 ? 16.844  -41.131 -11.723 1.00 42.83 ? 121 THR C CB  1 
ATOM   2666 O OG1 . THR C 1 141 ? 15.484  -41.539 -11.570 1.00 41.90 ? 121 THR C OG1 1 
ATOM   2667 C CG2 . THR C 1 141 ? 17.535  -42.131 -12.606 1.00 44.04 ? 121 THR C CG2 1 
ATOM   2668 N N   . GLU C 1 142 ? 19.594  -40.140 -9.373  1.00 39.17 ? 122 GLU C N   1 
ATOM   2669 C CA  . GLU C 1 142 ? 20.785  -39.287 -9.221  1.00 37.31 ? 122 GLU C CA  1 
ATOM   2670 C C   . GLU C 1 142 ? 22.005  -39.824 -9.946  1.00 40.22 ? 122 GLU C C   1 
ATOM   2671 O O   . GLU C 1 142 ? 21.995  -40.966 -10.384 1.00 39.82 ? 122 GLU C O   1 
ATOM   2672 C CB  . GLU C 1 142 ? 21.131  -39.209 -7.744  1.00 39.07 ? 122 GLU C CB  1 
ATOM   2673 C CG  . GLU C 1 142 ? 21.969  -38.020 -7.313  1.00 38.28 ? 122 GLU C CG  1 
ATOM   2674 C CD  . GLU C 1 142 ? 21.147  -36.782 -7.146  1.00 36.23 ? 122 GLU C CD  1 
ATOM   2675 O OE1 . GLU C 1 142 ? 21.536  -35.726 -7.690  1.00 37.48 ? 122 GLU C OE1 1 
ATOM   2676 O OE2 . GLU C 1 142 ? 20.120  -36.883 -6.465  1.00 34.07 ? 122 GLU C OE2 1 
ATOM   2677 N N   . ARG C 1 143 ? 23.051  -38.993 -10.066 1.00 44.89 ? 123 ARG C N   1 
ATOM   2678 C CA  . ARG C 1 143 ? 24.313  -39.355 -10.741 1.00 46.72 ? 123 ARG C CA  1 
ATOM   2679 C C   . ARG C 1 143 ? 25.432  -38.349 -10.465 1.00 49.10 ? 123 ARG C C   1 
ATOM   2680 O O   . ARG C 1 143 ? 25.172  -37.146 -10.423 1.00 54.80 ? 123 ARG C O   1 
ATOM   2681 C CB  . ARG C 1 143 ? 24.070  -39.431 -12.252 1.00 47.22 ? 123 ARG C CB  1 
ATOM   2682 C CG  . ARG C 1 143 ? 25.309  -39.612 -13.122 1.00 44.81 ? 123 ARG C CG  1 
ATOM   2683 C CD  . ARG C 1 143 ? 24.949  -39.326 -14.570 1.00 44.98 ? 123 ARG C CD  1 
ATOM   2684 N NE  . ARG C 1 143 ? 26.027  -39.630 -15.506 1.00 45.95 ? 123 ARG C NE  1 
ATOM   2685 C CZ  . ARG C 1 143 ? 25.920  -39.498 -16.824 1.00 45.39 ? 123 ARG C CZ  1 
ATOM   2686 N NH1 . ARG C 1 143 ? 24.791  -39.042 -17.357 1.00 46.96 ? 123 ARG C NH1 1 
ATOM   2687 N NH2 . ARG C 1 143 ? 26.938  -39.816 -17.613 1.00 45.19 ? 123 ARG C NH2 1 
ATOM   2688 N N   . LEU C 1 144 ? 26.669  -38.834 -10.284 1.00 53.68 ? 124 LEU C N   1 
ATOM   2689 C CA  . LEU C 1 144 ? 27.863  -37.953 -10.174 1.00 52.59 ? 124 LEU C CA  1 
ATOM   2690 C C   . LEU C 1 144 ? 28.523  -37.681 -11.521 1.00 54.48 ? 124 LEU C C   1 
ATOM   2691 O O   . LEU C 1 144 ? 28.910  -38.613 -12.237 1.00 52.72 ? 124 LEU C O   1 
ATOM   2692 C CB  . LEU C 1 144 ? 28.943  -38.511 -9.240  1.00 51.13 ? 124 LEU C CB  1 
ATOM   2693 C CG  . LEU C 1 144 ? 30.270  -37.700 -9.310  1.00 52.35 ? 124 LEU C CG  1 
ATOM   2694 C CD1 . LEU C 1 144 ? 30.897  -37.483 -7.939  1.00 49.57 ? 124 LEU C CD1 1 
ATOM   2695 C CD2 . LEU C 1 144 ? 31.320  -38.270 -10.275 1.00 52.79 ? 124 LEU C CD2 1 
ATOM   2696 N N   . GLU C 1 145 ? 28.704  -36.392 -11.817 1.00 55.25 ? 125 GLU C N   1 
ATOM   2697 C CA  . GLU C 1 145 ? 29.301  -35.942 -13.060 1.00 51.59 ? 125 GLU C CA  1 
ATOM   2698 C C   . GLU C 1 145 ? 30.645  -35.251 -12.859 1.00 51.59 ? 125 GLU C C   1 
ATOM   2699 O O   . GLU C 1 145 ? 31.462  -35.235 -13.775 1.00 54.27 ? 125 GLU C O   1 
ATOM   2700 C CB  . GLU C 1 145 ? 28.326  -35.046 -13.816 1.00 52.78 ? 125 GLU C CB  1 
ATOM   2701 C CG  . GLU C 1 145 ? 27.665  -33.961 -12.990 1.00 51.39 ? 125 GLU C CG  1 
ATOM   2702 C CD  . GLU C 1 145 ? 27.012  -32.887 -13.844 1.00 50.33 ? 125 GLU C CD  1 
ATOM   2703 O OE1 . GLU C 1 145 ? 27.326  -31.698 -13.625 1.00 44.31 ? 125 GLU C OE1 1 
ATOM   2704 O OE2 . GLU C 1 145 ? 26.186  -33.232 -14.727 1.00 50.11 ? 125 GLU C OE2 1 
ATOM   2705 N N   . ILE C 1 146 ? 30.886  -34.700 -11.672 1.00 52.50 ? 126 ILE C N   1 
ATOM   2706 C CA  . ILE C 1 146 ? 32.189  -34.106 -11.336 1.00 51.88 ? 126 ILE C CA  1 
ATOM   2707 C C   . ILE C 1 146 ? 32.652  -34.606 -9.980  1.00 51.83 ? 126 ILE C C   1 
ATOM   2708 O O   . ILE C 1 146 ? 31.846  -34.707 -9.077  1.00 57.52 ? 126 ILE C O   1 
ATOM   2709 C CB  . ILE C 1 146 ? 32.103  -32.563 -11.266 1.00 52.42 ? 126 ILE C CB  1 
ATOM   2710 C CG1 . ILE C 1 146 ? 32.011  -31.951 -12.667 1.00 55.42 ? 126 ILE C CG1 1 
ATOM   2711 C CG2 . ILE C 1 146 ? 33.310  -31.976 -10.554 1.00 53.84 ? 126 ILE C CG2 1 
ATOM   2712 C CD1 . ILE C 1 146 ? 30.678  -31.311 -12.993 1.00 54.35 ? 126 ILE C CD1 1 
ATOM   2713 N N   . LEU C 1 147 ? 33.946  -34.893 -9.833  1.00 53.79 ? 127 LEU C N   1 
ATOM   2714 C CA  . LEU C 1 147 ? 34.551  -35.167 -8.514  1.00 53.03 ? 127 LEU C CA  1 
ATOM   2715 C C   . LEU C 1 147 ? 35.975  -34.596 -8.461  1.00 53.96 ? 127 LEU C C   1 
ATOM   2716 O O   . LEU C 1 147 ? 36.875  -35.098 -9.144  1.00 60.31 ? 127 LEU C O   1 
ATOM   2717 C CB  . LEU C 1 147 ? 34.566  -36.672 -8.227  1.00 52.96 ? 127 LEU C CB  1 
ATOM   2718 C CG  . LEU C 1 147 ? 34.208  -37.162 -6.811  1.00 51.99 ? 127 LEU C CG  1 
ATOM   2719 C CD1 . LEU C 1 147 ? 34.215  -38.672 -6.817  1.00 49.00 ? 127 LEU C CD1 1 
ATOM   2720 C CD2 . LEU C 1 147 ? 35.127  -36.637 -5.721  1.00 51.13 ? 127 LEU C CD2 1 
ATOM   2721 N N   . ASP C 1 148 ? 36.177  -33.547 -7.667  1.00 49.88 ? 128 ASP C N   1 
ATOM   2722 C CA  . ASP C 1 148 ? 37.466  -32.842 -7.632  1.00 47.92 ? 128 ASP C CA  1 
ATOM   2723 C C   . ASP C 1 148 ? 37.950  -32.716 -6.190  1.00 50.01 ? 128 ASP C C   1 
ATOM   2724 O O   . ASP C 1 148 ? 37.459  -31.872 -5.422  1.00 52.08 ? 128 ASP C O   1 
ATOM   2725 C CB  . ASP C 1 148 ? 37.324  -31.461 -8.295  1.00 47.45 ? 128 ASP C CB  1 
ATOM   2726 C CG  . ASP C 1 148 ? 38.594  -30.636 -8.233  1.00 42.79 ? 128 ASP C CG  1 
ATOM   2727 O OD1 . ASP C 1 148 ? 39.319  -30.767 -7.243  1.00 43.05 ? 128 ASP C OD1 1 
ATOM   2728 O OD2 . ASP C 1 148 ? 38.856  -29.844 -9.164  1.00 39.09 ? 128 ASP C OD2 1 
ATOM   2729 N N   . GLU C 1 149 ? 38.923  -33.547 -5.827  1.00 47.71 ? 129 GLU C N   1 
ATOM   2730 C CA  . GLU C 1 149 ? 39.421  -33.579 -4.453  1.00 47.95 ? 129 GLU C CA  1 
ATOM   2731 C C   . GLU C 1 149 ? 40.356  -32.405 -4.125  1.00 48.16 ? 129 GLU C C   1 
ATOM   2732 O O   . GLU C 1 149 ? 40.343  -31.874 -3.006  1.00 48.92 ? 129 GLU C O   1 
ATOM   2733 C CB  . GLU C 1 149 ? 40.127  -34.914 -4.181  1.00 47.90 ? 129 GLU C CB  1 
ATOM   2734 C CG  . GLU C 1 149 ? 39.292  -36.145 -4.540  1.00 46.88 ? 129 GLU C CG  1 
ATOM   2735 C CD  . GLU C 1 149 ? 39.365  -37.241 -3.495  1.00 46.41 ? 129 GLU C CD  1 
ATOM   2736 O OE1 . GLU C 1 149 ? 40.370  -37.989 -3.442  1.00 46.54 ? 129 GLU C OE1 1 
ATOM   2737 O OE2 . GLU C 1 149 ? 38.398  -37.353 -2.726  1.00 45.38 ? 129 GLU C OE2 1 
ATOM   2738 N N   . GLU C 1 150 ? 41.149  -31.994 -5.109  1.00 48.91 ? 130 GLU C N   1 
ATOM   2739 C CA  . GLU C 1 150 ? 42.200  -30.990 -4.901  1.00 48.45 ? 130 GLU C CA  1 
ATOM   2740 C C   . GLU C 1 150 ? 41.632  -29.586 -4.712  1.00 47.31 ? 130 GLU C C   1 
ATOM   2741 O O   . GLU C 1 150 ? 42.145  -28.800 -3.895  1.00 45.51 ? 130 GLU C O   1 
ATOM   2742 C CB  . GLU C 1 150 ? 43.207  -31.047 -6.065  1.00 49.12 ? 130 GLU C CB  1 
ATOM   2743 C CG  . GLU C 1 150 ? 43.840  -29.732 -6.516  1.00 48.54 ? 130 GLU C CG  1 
ATOM   2744 C CD  . GLU C 1 150 ? 45.162  -29.415 -5.855  1.00 49.01 ? 130 GLU C CD  1 
ATOM   2745 O OE1 . GLU C 1 150 ? 45.722  -30.271 -5.125  1.00 47.56 ? 130 GLU C OE1 1 
ATOM   2746 O OE2 . GLU C 1 150 ? 45.647  -28.284 -6.093  1.00 49.37 ? 130 GLU C OE2 1 
ATOM   2747 N N   . ARG C 1 151 ? 40.585  -29.278 -5.476  1.00 46.53 ? 131 ARG C N   1 
ATOM   2748 C CA  . ARG C 1 151 ? 39.930  -27.968 -5.431  1.00 44.33 ? 131 ARG C CA  1 
ATOM   2749 C C   . ARG C 1 151 ? 38.536  -27.986 -4.799  1.00 44.10 ? 131 ARG C C   1 
ATOM   2750 O O   . ARG C 1 151 ? 37.963  -26.921 -4.616  1.00 47.55 ? 131 ARG C O   1 
ATOM   2751 C CB  . ARG C 1 151 ? 39.815  -27.383 -6.845  1.00 42.56 ? 131 ARG C CB  1 
ATOM   2752 C CG  . ARG C 1 151 ? 41.119  -27.262 -7.623  1.00 39.15 ? 131 ARG C CG  1 
ATOM   2753 C CD  . ARG C 1 151 ? 40.853  -26.719 -9.022  1.00 38.61 ? 131 ARG C CD  1 
ATOM   2754 N NE  . ARG C 1 151 ? 41.455  -27.574 -10.042 1.00 40.86 ? 131 ARG C NE  1 
ATOM   2755 C CZ  . ARG C 1 151 ? 41.176  -27.552 -11.346 1.00 41.16 ? 131 ARG C CZ  1 
ATOM   2756 N NH1 . ARG C 1 151 ? 40.293  -26.682 -11.852 1.00 40.78 ? 131 ARG C NH1 1 
ATOM   2757 N NH2 . ARG C 1 151 ? 41.797  -28.417 -12.158 1.00 37.48 ? 131 ARG C NH2 1 
ATOM   2758 N N   . HIS C 1 152 ? 37.980  -29.170 -4.514  1.00 43.22 ? 132 HIS C N   1 
ATOM   2759 C CA  . HIS C 1 152 ? 36.684  -29.323 -3.804  1.00 44.40 ? 132 HIS C CA  1 
ATOM   2760 C C   . HIS C 1 152 ? 35.376  -29.160 -4.615  1.00 46.11 ? 132 HIS C C   1 
ATOM   2761 O O   . HIS C 1 152 ? 34.576  -28.292 -4.271  1.00 43.38 ? 132 HIS C O   1 
ATOM   2762 C CB  . HIS C 1 152 ? 36.591  -28.345 -2.615  1.00 44.60 ? 132 HIS C CB  1 
ATOM   2763 C CG  . HIS C 1 152 ? 37.384  -28.744 -1.406  1.00 44.44 ? 132 HIS C CG  1 
ATOM   2764 N ND1 . HIS C 1 152 ? 38.219  -29.838 -1.367  1.00 45.47 ? 132 HIS C ND1 1 
ATOM   2765 C CD2 . HIS C 1 152 ? 37.490  -28.151 -0.196  1.00 43.69 ? 132 HIS C CD2 1 
ATOM   2766 C CE1 . HIS C 1 152 ? 38.786  -29.914 -0.176  1.00 45.62 ? 132 HIS C CE1 1 
ATOM   2767 N NE2 . HIS C 1 152 ? 38.366  -28.896 0.551   1.00 43.98 ? 132 HIS C NE2 1 
ATOM   2768 N N   . VAL C 1 153 ? 35.103  -30.007 -5.618  1.00 46.50 ? 133 VAL C N   1 
ATOM   2769 C CA  . VAL C 1 153 ? 33.835  -29.886 -6.372  1.00 47.23 ? 133 VAL C CA  1 
ATOM   2770 C C   . VAL C 1 153 ? 33.122  -31.209 -6.766  1.00 48.67 ? 133 VAL C C   1 
ATOM   2771 O O   . VAL C 1 153 ? 33.686  -32.072 -7.454  1.00 46.28 ? 133 VAL C O   1 
ATOM   2772 C CB  . VAL C 1 153 ? 34.009  -29.026 -7.639  1.00 50.05 ? 133 VAL C CB  1 
ATOM   2773 C CG1 . VAL C 1 153 ? 32.711  -28.315 -7.964  1.00 50.59 ? 133 VAL C CG1 1 
ATOM   2774 C CG2 . VAL C 1 153 ? 35.103  -27.986 -7.467  1.00 51.26 ? 133 VAL C CG2 1 
ATOM   2775 N N   . ILE C 1 154 ? 31.857  -31.316 -6.338  1.00 48.34 ? 134 ILE C N   1 
ATOM   2776 C CA  . ILE C 1 154 ? 30.994  -32.500 -6.541  1.00 49.03 ? 134 ILE C CA  1 
ATOM   2777 C C   . ILE C 1 154 ? 29.654  -32.132 -7.191  1.00 52.82 ? 134 ILE C C   1 
ATOM   2778 O O   . ILE C 1 154 ? 28.772  -31.574 -6.529  1.00 51.57 ? 134 ILE C O   1 
ATOM   2779 C CB  . ILE C 1 154 ? 30.628  -33.213 -5.208  1.00 48.20 ? 134 ILE C CB  1 
ATOM   2780 C CG1 . ILE C 1 154 ? 30.240  -32.203 -4.111  1.00 49.95 ? 134 ILE C CG1 1 
ATOM   2781 C CG2 . ILE C 1 154 ? 31.757  -34.125 -4.756  1.00 45.26 ? 134 ILE C CG2 1 
ATOM   2782 C CD1 . ILE C 1 154 ? 29.055  -32.644 -3.281  1.00 50.95 ? 134 ILE C CD1 1 
ATOM   2783 N N   . SER C 1 155 ? 29.480  -32.464 -8.466  1.00 55.58 ? 135 SER C N   1 
ATOM   2784 C CA  . SER C 1 155 ? 28.269  -32.070 -9.184  1.00 58.19 ? 135 SER C CA  1 
ATOM   2785 C C   . SER C 1 155 ? 27.227  -33.194 -9.246  1.00 62.68 ? 135 SER C C   1 
ATOM   2786 O O   . SER C 1 155 ? 27.409  -34.174 -9.971  1.00 64.65 ? 135 SER C O   1 
ATOM   2787 C CB  . SER C 1 155 ? 28.623  -31.615 -10.594 1.00 59.00 ? 135 SER C CB  1 
ATOM   2788 O OG  . SER C 1 155 ? 27.466  -31.222 -11.323 1.00 57.98 ? 135 SER C OG  1 
ATOM   2789 N N   . PHE C 1 156 ? 26.141  -33.046 -8.481  1.00 60.52 ? 136 PHE C N   1 
ATOM   2790 C CA  . PHE C 1 156 ? 25.006  -33.970 -8.565  1.00 57.81 ? 136 PHE C CA  1 
ATOM   2791 C C   . PHE C 1 156 ? 24.316  -33.780 -9.908  1.00 58.72 ? 136 PHE C C   1 
ATOM   2792 O O   . PHE C 1 156 ? 24.615  -32.825 -10.630 1.00 60.47 ? 136 PHE C O   1 
ATOM   2793 C CB  . PHE C 1 156 ? 23.985  -33.728 -7.437  1.00 53.79 ? 136 PHE C CB  1 
ATOM   2794 C CG  . PHE C 1 156 ? 24.224  -34.529 -6.188  1.00 50.37 ? 136 PHE C CG  1 
ATOM   2795 C CD1 . PHE C 1 156 ? 24.490  -35.897 -6.241  1.00 53.13 ? 136 PHE C CD1 1 
ATOM   2796 C CD2 . PHE C 1 156 ? 24.140  -33.923 -4.949  1.00 51.03 ? 136 PHE C CD2 1 
ATOM   2797 C CE1 . PHE C 1 156 ? 24.699  -36.636 -5.080  1.00 53.47 ? 136 PHE C CE1 1 
ATOM   2798 C CE2 . PHE C 1 156 ? 24.345  -34.652 -3.782  1.00 54.69 ? 136 PHE C CE2 1 
ATOM   2799 C CZ  . PHE C 1 156 ? 24.623  -36.013 -3.846  1.00 54.65 ? 136 PHE C CZ  1 
ATOM   2800 N N   . SER C 1 157 ? 23.393  -34.688 -10.224 1.00 58.74 ? 137 SER C N   1 
ATOM   2801 C CA  . SER C 1 157 ? 22.586  -34.620 -11.450 1.00 59.61 ? 137 SER C CA  1 
ATOM   2802 C C   . SER C 1 157 ? 21.483  -35.671 -11.395 1.00 62.85 ? 137 SER C C   1 
ATOM   2803 O O   . SER C 1 157 ? 21.504  -36.547 -10.536 1.00 64.24 ? 137 SER C O   1 
ATOM   2804 C CB  . SER C 1 157 ? 23.453  -34.853 -12.691 1.00 58.70 ? 137 SER C CB  1 
ATOM   2805 O OG  . SER C 1 157 ? 22.662  -35.001 -13.863 1.00 58.50 ? 137 SER C OG  1 
ATOM   2806 N N   . VAL C 1 158 ? 20.525  -35.597 -12.313 1.00 65.70 ? 138 VAL C N   1 
ATOM   2807 C CA  . VAL C 1 158 ? 19.421  -36.557 -12.323 1.00 68.73 ? 138 VAL C CA  1 
ATOM   2808 C C   . VAL C 1 158 ? 19.256  -37.250 -13.678 1.00 70.04 ? 138 VAL C C   1 
ATOM   2809 O O   . VAL C 1 158 ? 19.776  -36.797 -14.701 1.00 70.19 ? 138 VAL C O   1 
ATOM   2810 C CB  . VAL C 1 158 ? 18.110  -35.896 -11.848 1.00 69.22 ? 138 VAL C CB  1 
ATOM   2811 C CG1 . VAL C 1 158 ? 16.908  -36.816 -12.026 1.00 73.04 ? 138 VAL C CG1 1 
ATOM   2812 C CG2 . VAL C 1 158 ? 18.228  -35.519 -10.378 1.00 69.17 ? 138 VAL C CG2 1 
ATOM   2813 N N   . VAL C 1 159 ? 18.575  -38.391 -13.643 1.00 71.10 ? 139 VAL C N   1 
ATOM   2814 C CA  . VAL C 1 159 ? 18.227  -39.159 -14.825 1.00 72.96 ? 139 VAL C CA  1 
ATOM   2815 C C   . VAL C 1 159 ? 16.787  -39.681 -14.714 1.00 72.06 ? 139 VAL C C   1 
ATOM   2816 O O   . VAL C 1 159 ? 16.007  -39.236 -13.867 1.00 69.31 ? 139 VAL C O   1 
ATOM   2817 C CB  . VAL C 1 159 ? 19.221  -40.325 -15.004 1.00 72.36 ? 139 VAL C CB  1 
ATOM   2818 C CG1 . VAL C 1 159 ? 18.596  -41.483 -15.770 1.00 72.67 ? 139 VAL C CG1 1 
ATOM   2819 C CG2 . VAL C 1 159 ? 20.482  -39.832 -15.698 1.00 73.59 ? 139 VAL C CG2 1 
ATOM   2820 N N   . ASN C 1 167 ? 15.081  -33.166 -14.056 1.00 35.75 ? 147 ASN C N   1 
ATOM   2821 C CA  . ASN C 1 167 ? 16.389  -32.642 -14.403 1.00 34.64 ? 147 ASN C CA  1 
ATOM   2822 C C   . ASN C 1 167 ? 16.873  -31.892 -13.177 1.00 36.58 ? 147 ASN C C   1 
ATOM   2823 O O   . ASN C 1 167 ? 16.180  -31.029 -12.661 1.00 39.29 ? 147 ASN C O   1 
ATOM   2824 C CB  . ASN C 1 167 ? 16.282  -31.708 -15.625 1.00 34.02 ? 147 ASN C CB  1 
ATOM   2825 C CG  . ASN C 1 167 ? 17.398  -31.915 -16.665 1.00 32.30 ? 147 ASN C CG  1 
ATOM   2826 O OD1 . ASN C 1 167 ? 18.585  -31.674 -16.399 1.00 33.17 ? 147 ASN C OD1 1 
ATOM   2827 N ND2 . ASN C 1 167 ? 17.007  -32.307 -17.876 1.00 28.46 ? 147 ASN C ND2 1 
ATOM   2828 N N   . TYR C 1 168 ? 18.034  -32.276 -12.674 1.00 40.50 ? 148 TYR C N   1 
ATOM   2829 C CA  . TYR C 1 168 ? 18.734  -31.524 -11.638 1.00 42.30 ? 148 TYR C CA  1 
ATOM   2830 C C   . TYR C 1 168 ? 20.172  -31.459 -12.139 1.00 39.66 ? 148 TYR C C   1 
ATOM   2831 O O   . TYR C 1 168 ? 20.536  -32.156 -13.096 1.00 39.12 ? 148 TYR C O   1 
ATOM   2832 C CB  . TYR C 1 168 ? 18.614  -32.238 -10.284 1.00 44.49 ? 148 TYR C CB  1 
ATOM   2833 C CG  . TYR C 1 168 ? 18.762  -31.383 -9.019  1.00 46.79 ? 148 TYR C CG  1 
ATOM   2834 C CD1 . TYR C 1 168 ? 17.984  -30.244 -8.812  1.00 45.50 ? 148 TYR C CD1 1 
ATOM   2835 C CD2 . TYR C 1 168 ? 19.644  -31.766 -8.000  1.00 49.38 ? 148 TYR C CD2 1 
ATOM   2836 C CE1 . TYR C 1 168 ? 18.106  -29.491 -7.653  1.00 45.96 ? 148 TYR C CE1 1 
ATOM   2837 C CE2 . TYR C 1 168 ? 19.771  -31.020 -6.838  1.00 49.81 ? 148 TYR C CE2 1 
ATOM   2838 C CZ  . TYR C 1 168 ? 19.005  -29.879 -6.667  1.00 47.75 ? 148 TYR C CZ  1 
ATOM   2839 O OH  . TYR C 1 168 ? 19.152  -29.141 -5.506  1.00 43.36 ? 148 TYR C OH  1 
ATOM   2840 N N   . ARG C 1 169 ? 20.967  -30.584 -11.553 1.00 37.93 ? 149 ARG C N   1 
ATOM   2841 C CA  . ARG C 1 169 ? 22.387  -30.506 -11.890 1.00 38.77 ? 149 ARG C CA  1 
ATOM   2842 C C   . ARG C 1 169 ? 23.062  -29.727 -10.771 1.00 38.49 ? 149 ARG C C   1 
ATOM   2843 O O   . ARG C 1 169 ? 23.752  -28.736 -10.986 1.00 41.48 ? 149 ARG C O   1 
ATOM   2844 C CB  . ARG C 1 169 ? 22.615  -29.895 -13.294 1.00 37.81 ? 149 ARG C CB  1 
ATOM   2845 C CG  . ARG C 1 169 ? 24.046  -30.015 -13.818 1.00 36.49 ? 149 ARG C CG  1 
ATOM   2846 C CD  . ARG C 1 169 ? 24.769  -28.660 -13.841 1.00 38.29 ? 149 ARG C CD  1 
ATOM   2847 N NE  . ARG C 1 169 ? 26.224  -28.808 -13.813 1.00 39.85 ? 149 ARG C NE  1 
ATOM   2848 C CZ  . ARG C 1 169 ? 27.116  -27.840 -14.024 1.00 39.04 ? 149 ARG C CZ  1 
ATOM   2849 N NH1 . ARG C 1 169 ? 26.738  -26.592 -14.295 1.00 39.92 ? 149 ARG C NH1 1 
ATOM   2850 N NH2 . ARG C 1 169 ? 28.413  -28.132 -13.950 1.00 36.86 ? 149 ARG C NH2 1 
ATOM   2851 N N   . SER C 1 170 ? 22.825  -30.203 -9.557  1.00 40.03 ? 150 SER C N   1 
ATOM   2852 C CA  . SER C 1 170 ? 23.373  -29.600 -8.346  1.00 39.86 ? 150 SER C CA  1 
ATOM   2853 C C   . SER C 1 170 ? 24.894  -29.511 -8.439  1.00 36.78 ? 150 SER C C   1 
ATOM   2854 O O   . SER C 1 170 ? 25.538  -30.432 -8.899  1.00 39.09 ? 150 SER C O   1 
ATOM   2855 C CB  . SER C 1 170 ? 22.905  -30.400 -7.108  1.00 39.75 ? 150 SER C CB  1 
ATOM   2856 O OG  . SER C 1 170 ? 23.955  -30.641 -6.194  1.00 43.05 ? 150 SER C OG  1 
ATOM   2857 N N   . VAL C 1 171 ? 25.441  -28.373 -8.043  1.00 36.96 ? 151 VAL C N   1 
ATOM   2858 C CA  . VAL C 1 171 ? 26.885  -28.177 -7.924  1.00 36.52 ? 151 VAL C CA  1 
ATOM   2859 C C   . VAL C 1 171 ? 27.166  -27.674 -6.526  1.00 35.27 ? 151 VAL C C   1 
ATOM   2860 O O   . VAL C 1 171 ? 26.360  -26.913 -5.979  1.00 36.82 ? 151 VAL C O   1 
ATOM   2861 C CB  . VAL C 1 171 ? 27.408  -27.111 -8.927  1.00 37.95 ? 151 VAL C CB  1 
ATOM   2862 N N   . THR C 1 172 ? 28.308  -28.070 -5.960  1.00 35.41 ? 152 THR C N   1 
ATOM   2863 C CA  . THR C 1 172 ? 28.696  -27.632 -4.606  1.00 35.29 ? 152 THR C CA  1 
ATOM   2864 C C   . THR C 1 172 ? 30.163  -27.206 -4.468  1.00 35.99 ? 152 THR C C   1 
ATOM   2865 O O   . THR C 1 172 ? 31.082  -27.929 -4.842  1.00 37.61 ? 152 THR C O   1 
ATOM   2866 C CB  . THR C 1 172 ? 28.398  -28.725 -3.572  1.00 33.73 ? 152 THR C CB  1 
ATOM   2867 O OG1 . THR C 1 172 ? 27.170  -29.380 -3.909  1.00 32.69 ? 152 THR C OG1 1 
ATOM   2868 C CG2 . THR C 1 172 ? 28.280  -28.097 -2.181  1.00 34.29 ? 152 THR C CG2 1 
ATOM   2869 N N   . THR C 1 173 ? 30.396  -26.037 -3.894  1.00 38.59 ? 153 THR C N   1 
ATOM   2870 C CA  . THR C 1 173 ? 31.770  -25.547 -3.784  1.00 38.87 ? 153 THR C CA  1 
ATOM   2871 C C   . THR C 1 173 ? 32.153  -25.107 -2.369  1.00 40.09 ? 153 THR C C   1 
ATOM   2872 O O   . THR C 1 173 ? 31.344  -25.155 -1.451  1.00 42.27 ? 153 THR C O   1 
ATOM   2873 C CB  . THR C 1 173 ? 32.028  -24.436 -4.814  1.00 38.15 ? 153 THR C CB  1 
ATOM   2874 O OG1 . THR C 1 173 ? 30.871  -23.605 -4.926  1.00 36.88 ? 153 THR C OG1 1 
ATOM   2875 C CG2 . THR C 1 173 ? 32.321  -25.048 -6.166  1.00 37.11 ? 153 THR C CG2 1 
ATOM   2876 N N   . LEU C 1 174 ? 33.422  -24.742 -2.212  1.00 43.83 ? 154 LEU C N   1 
ATOM   2877 C CA  . LEU C 1 174 ? 33.977  -24.296 -0.947  1.00 45.09 ? 154 LEU C CA  1 
ATOM   2878 C C   . LEU C 1 174 ? 34.839  -23.042 -1.155  1.00 45.83 ? 154 LEU C C   1 
ATOM   2879 O O   . LEU C 1 174 ? 34.592  -22.224 -2.053  1.00 41.08 ? 154 LEU C O   1 
ATOM   2880 C CB  . LEU C 1 174 ? 34.807  -25.422 -0.312  1.00 48.72 ? 154 LEU C CB  1 
ATOM   2881 C CG  . LEU C 1 174 ? 34.221  -26.100 0.937   1.00 51.70 ? 154 LEU C CG  1 
ATOM   2882 C CD1 . LEU C 1 174 ? 33.031  -26.995 0.629   1.00 54.56 ? 154 LEU C CD1 1 
ATOM   2883 C CD2 . LEU C 1 174 ? 35.264  -26.911 1.682   1.00 51.74 ? 154 LEU C CD2 1 
ATOM   2884 N N   . GLU C 1 180 ? 39.312  -17.371 8.898   1.00 45.58 ? 160 GLU C N   1 
ATOM   2885 C CA  . GLU C 1 180 ? 40.217  -18.430 9.338   1.00 40.47 ? 160 GLU C CA  1 
ATOM   2886 C C   . GLU C 1 180 ? 39.734  -19.846 9.028   1.00 40.82 ? 160 GLU C C   1 
ATOM   2887 O O   . GLU C 1 180 ? 40.374  -20.796 9.455   1.00 42.01 ? 160 GLU C O   1 
ATOM   2888 C CB  . GLU C 1 180 ? 40.452  -18.331 10.839  1.00 39.27 ? 160 GLU C CB  1 
ATOM   2889 N N   . GLY C 1 181 ? 38.632  -19.987 8.284   1.00 43.34 ? 161 GLY C N   1 
ATOM   2890 C CA  . GLY C 1 181 ? 38.032  -21.296 7.982   1.00 43.91 ? 161 GLY C CA  1 
ATOM   2891 C C   . GLY C 1 181 ? 37.627  -21.525 6.527   1.00 45.84 ? 161 GLY C C   1 
ATOM   2892 O O   . GLY C 1 181 ? 38.485  -21.763 5.676   1.00 48.41 ? 161 GLY C O   1 
ATOM   2893 N N   . THR C 1 182 ? 36.323  -21.451 6.242   1.00 48.26 ? 162 THR C N   1 
ATOM   2894 C CA  . THR C 1 182 ? 35.754  -21.910 4.959   1.00 47.93 ? 162 THR C CA  1 
ATOM   2895 C C   . THR C 1 182 ? 34.482  -21.166 4.551   1.00 50.54 ? 162 THR C C   1 
ATOM   2896 O O   . THR C 1 182 ? 33.832  -20.518 5.371   1.00 53.43 ? 162 THR C O   1 
ATOM   2897 C CB  . THR C 1 182 ? 35.452  -23.421 5.044   1.00 48.13 ? 162 THR C CB  1 
ATOM   2898 O OG1 . THR C 1 182 ? 36.679  -24.108 5.277   1.00 51.28 ? 162 THR C OG1 1 
ATOM   2899 C CG2 . THR C 1 182 ? 34.799  -23.997 3.776   1.00 45.70 ? 162 THR C CG2 1 
ATOM   2900 N N   . VAL C 1 183 ? 34.166  -21.253 3.260   1.00 50.92 ? 163 VAL C N   1 
ATOM   2901 C CA  . VAL C 1 183 ? 32.942  -20.734 2.669   1.00 50.61 ? 163 VAL C CA  1 
ATOM   2902 C C   . VAL C 1 183 ? 32.236  -21.936 2.009   1.00 52.38 ? 163 VAL C C   1 
ATOM   2903 O O   . VAL C 1 183 ? 32.897  -22.940 1.738   1.00 56.27 ? 163 VAL C O   1 
ATOM   2904 C CB  . VAL C 1 183 ? 33.316  -19.651 1.625   1.00 50.58 ? 163 VAL C CB  1 
ATOM   2905 C CG1 . VAL C 1 183 ? 32.092  -19.031 0.958   1.00 48.51 ? 163 VAL C CG1 1 
ATOM   2906 C CG2 . VAL C 1 183 ? 34.183  -18.583 2.277   1.00 51.48 ? 163 VAL C CG2 1 
ATOM   2907 N N   . VAL C 1 184 ? 30.917  -21.845 1.774   1.00 50.18 ? 164 VAL C N   1 
ATOM   2908 C CA  . VAL C 1 184 ? 30.138  -22.881 1.055   1.00 51.38 ? 164 VAL C CA  1 
ATOM   2909 C C   . VAL C 1 184 ? 28.930  -22.290 0.286   1.00 52.72 ? 164 VAL C C   1 
ATOM   2910 O O   . VAL C 1 184 ? 27.857  -22.047 0.860   1.00 53.96 ? 164 VAL C O   1 
ATOM   2911 C CB  . VAL C 1 184 ? 29.596  -23.991 2.003   1.00 51.27 ? 164 VAL C CB  1 
ATOM   2912 C CG1 . VAL C 1 184 ? 28.930  -25.100 1.200   1.00 49.82 ? 164 VAL C CG1 1 
ATOM   2913 C CG2 . VAL C 1 184 ? 30.698  -24.567 2.885   1.00 52.72 ? 164 VAL C CG2 1 
ATOM   2914 N N   . VAL C 1 185 ? 29.095  -22.106 -1.018  1.00 48.22 ? 165 VAL C N   1 
ATOM   2915 C CA  . VAL C 1 185 ? 28.046  -21.553 -1.870  1.00 47.10 ? 165 VAL C CA  1 
ATOM   2916 C C   . VAL C 1 185 ? 27.158  -22.719 -2.341  1.00 47.52 ? 165 VAL C C   1 
ATOM   2917 O O   . VAL C 1 185 ? 27.442  -23.881 -2.029  1.00 44.22 ? 165 VAL C O   1 
ATOM   2918 C CB  . VAL C 1 185 ? 28.689  -20.801 -3.066  1.00 48.59 ? 165 VAL C CB  1 
ATOM   2919 C CG1 . VAL C 1 185 ? 27.647  -20.148 -3.964  1.00 50.83 ? 165 VAL C CG1 1 
ATOM   2920 C CG2 . VAL C 1 185 ? 29.663  -19.735 -2.577  1.00 46.06 ? 165 VAL C CG2 1 
ATOM   2921 N N   . GLU C 1 186 ? 26.078  -22.429 -3.068  1.00 47.73 ? 166 GLU C N   1 
ATOM   2922 C CA  . GLU C 1 186 ? 25.271  -23.499 -3.682  1.00 50.45 ? 166 GLU C CA  1 
ATOM   2923 C C   . GLU C 1 186 ? 24.435  -23.078 -4.887  1.00 50.51 ? 166 GLU C C   1 
ATOM   2924 O O   . GLU C 1 186 ? 23.968  -21.944 -4.975  1.00 57.31 ? 166 GLU C O   1 
ATOM   2925 C CB  . GLU C 1 186 ? 24.348  -24.159 -2.643  1.00 49.10 ? 166 GLU C CB  1 
ATOM   2926 C CG  . GLU C 1 186 ? 24.791  -25.558 -2.232  1.00 48.37 ? 166 GLU C CG  1 
ATOM   2927 C CD  . GLU C 1 186 ? 24.876  -26.519 -3.404  1.00 45.48 ? 166 GLU C CD  1 
ATOM   2928 O OE1 . GLU C 1 186 ? 23.915  -27.292 -3.602  1.00 42.23 ? 166 GLU C OE1 1 
ATOM   2929 N N   . SER C 1 187 ? 24.239  -24.027 -5.800  1.00 49.60 ? 167 SER C N   1 
ATOM   2930 C CA  . SER C 1 187 ? 23.454  -23.819 -7.011  1.00 46.00 ? 167 SER C CA  1 
ATOM   2931 C C   . SER C 1 187 ? 23.119  -25.152 -7.681  1.00 45.10 ? 167 SER C C   1 
ATOM   2932 O O   . SER C 1 187 ? 23.749  -26.188 -7.422  1.00 41.25 ? 167 SER C O   1 
ATOM   2933 C CB  . SER C 1 187 ? 24.192  -22.932 -8.014  1.00 46.06 ? 167 SER C CB  1 
ATOM   2934 O OG  . SER C 1 187 ? 24.534  -21.667 -7.471  1.00 47.48 ? 167 SER C OG  1 
ATOM   2935 N N   . TYR C 1 188 ? 22.136  -25.096 -8.571  1.00 43.40 ? 168 TYR C N   1 
ATOM   2936 C CA  . TYR C 1 188 ? 21.511  -26.283 -9.116  1.00 43.45 ? 168 TYR C CA  1 
ATOM   2937 C C   . TYR C 1 188 ? 20.875  -25.924 -10.459 1.00 45.12 ? 168 TYR C C   1 
ATOM   2938 O O   . TYR C 1 188 ? 21.290  -24.953 -11.085 1.00 55.10 ? 168 TYR C O   1 
ATOM   2939 C CB  . TYR C 1 188 ? 20.473  -26.809 -8.108  1.00 43.17 ? 168 TYR C CB  1 
ATOM   2940 C CG  . TYR C 1 188 ? 19.274  -25.902 -7.893  1.00 39.45 ? 168 TYR C CG  1 
ATOM   2941 C CD1 . TYR C 1 188 ? 18.097  -26.085 -8.624  1.00 39.06 ? 168 TYR C CD1 1 
ATOM   2942 C CD2 . TYR C 1 188 ? 19.309  -24.885 -6.952  1.00 36.80 ? 168 TYR C CD2 1 
ATOM   2943 C CE1 . TYR C 1 188 ? 16.998  -25.274 -8.440  1.00 36.79 ? 168 TYR C CE1 1 
ATOM   2944 C CE2 . TYR C 1 188 ? 18.213  -24.067 -6.760  1.00 36.80 ? 168 TYR C CE2 1 
ATOM   2945 C CZ  . TYR C 1 188 ? 17.068  -24.272 -7.517  1.00 36.18 ? 168 TYR C CZ  1 
ATOM   2946 O OH  . TYR C 1 188 ? 15.992  -23.470 -7.358  1.00 35.77 ? 168 TYR C OH  1 
ATOM   2947 N N   . ILE C 1 189 ? 19.913  -26.712 -10.916 1.00 40.74 ? 169 ILE C N   1 
ATOM   2948 C CA  . ILE C 1 189 ? 19.148  -26.407 -12.118 1.00 42.96 ? 169 ILE C CA  1 
ATOM   2949 C C   . ILE C 1 189 ? 17.800  -27.100 -11.945 1.00 44.83 ? 169 ILE C C   1 
ATOM   2950 O O   . ILE C 1 189 ? 17.657  -27.909 -11.026 1.00 51.19 ? 169 ILE C O   1 
ATOM   2951 C CB  . ILE C 1 189 ? 19.857  -26.944 -13.378 1.00 44.95 ? 169 ILE C CB  1 
ATOM   2952 C CG1 . ILE C 1 189 ? 20.074  -25.847 -14.430 1.00 44.74 ? 169 ILE C CG1 1 
ATOM   2953 C CD1 . ILE C 1 189 ? 18.804  -25.290 -15.041 1.00 44.39 ? 169 ILE C CD1 1 
ATOM   2954 N N   . VAL C 1 190 ? 16.800  -26.818 -12.776 1.00 42.22 ? 170 VAL C N   1 
ATOM   2955 C CA  . VAL C 1 190 ? 15.523  -27.529 -12.577 1.00 44.76 ? 170 VAL C CA  1 
ATOM   2956 C C   . VAL C 1 190 ? 14.473  -27.388 -13.678 1.00 42.65 ? 170 VAL C C   1 
ATOM   2957 O O   . VAL C 1 190 ? 14.772  -26.945 -14.780 1.00 41.14 ? 170 VAL C O   1 
ATOM   2958 C CB  . VAL C 1 190 ? 14.886  -27.168 -11.206 1.00 42.58 ? 170 VAL C CB  1 
ATOM   2959 N N   . ASP C 1 191 ? 13.247  -27.801 -13.350 1.00 39.87 ? 171 ASP C N   1 
ATOM   2960 C CA  . ASP C 1 191 ? 12.159  -27.900 -14.294 1.00 39.35 ? 171 ASP C CA  1 
ATOM   2961 C C   . ASP C 1 191 ? 10.862  -27.382 -13.654 1.00 41.78 ? 171 ASP C C   1 
ATOM   2962 O O   . ASP C 1 191 ? 10.603  -27.633 -12.473 1.00 41.50 ? 171 ASP C O   1 
ATOM   2963 C CB  . ASP C 1 191 ? 11.968  -29.369 -14.709 1.00 36.99 ? 171 ASP C CB  1 
ATOM   2964 C CG  . ASP C 1 191 ? 12.642  -29.708 -16.017 1.00 36.41 ? 171 ASP C CG  1 
ATOM   2965 O OD1 . ASP C 1 191 ? 13.820  -30.116 -15.999 1.00 38.18 ? 171 ASP C OD1 1 
ATOM   2966 O OD2 . ASP C 1 191 ? 11.991  -29.588 -17.074 1.00 36.35 ? 171 ASP C OD2 1 
ATOM   2967 N N   . VAL C 1 192 ? 10.048  -26.694 -14.451 1.00 42.48 ? 172 VAL C N   1 
ATOM   2968 C CA  . VAL C 1 192 ? 8.715   -26.274 -14.048 1.00 45.90 ? 172 VAL C CA  1 
ATOM   2969 C C   . VAL C 1 192 ? 7.690   -26.995 -14.921 1.00 49.83 ? 172 VAL C C   1 
ATOM   2970 O O   . VAL C 1 192 ? 7.115   -26.404 -15.831 1.00 52.78 ? 172 VAL C O   1 
ATOM   2971 C CB  . VAL C 1 192 ? 8.547   -24.754 -14.212 1.00 48.71 ? 172 VAL C CB  1 
ATOM   2972 C CG1 . VAL C 1 192 ? 7.257   -24.278 -13.558 1.00 47.41 ? 172 VAL C CG1 1 
ATOM   2973 C CG2 . VAL C 1 192 ? 9.755   -24.017 -13.630 1.00 51.42 ? 172 VAL C CG2 1 
ATOM   2974 N N   . PRO C 1 193 ? 7.465   -28.289 -14.662 1.00 52.79 ? 173 PRO C N   1 
ATOM   2975 C CA  . PRO C 1 193 ? 6.513   -29.003 -15.489 1.00 52.40 ? 173 PRO C CA  1 
ATOM   2976 C C   . PRO C 1 193 ? 5.090   -28.667 -15.066 1.00 57.50 ? 173 PRO C C   1 
ATOM   2977 O O   . PRO C 1 193 ? 4.766   -28.813 -13.879 1.00 62.87 ? 173 PRO C O   1 
ATOM   2978 C CB  . PRO C 1 193 ? 6.835   -30.467 -15.197 1.00 53.52 ? 173 PRO C CB  1 
ATOM   2979 C CG  . PRO C 1 193 ? 7.343   -30.470 -13.796 1.00 53.90 ? 173 PRO C CG  1 
ATOM   2980 C CD  . PRO C 1 193 ? 8.026   -29.141 -13.595 1.00 54.04 ? 173 PRO C CD  1 
ATOM   2981 N N   . PRO C 1 194 ? 4.241   -28.229 -16.022 1.00 57.66 ? 174 PRO C N   1 
ATOM   2982 C CA  . PRO C 1 194 ? 2.874   -27.799 -15.739 1.00 57.04 ? 174 PRO C CA  1 
ATOM   2983 C C   . PRO C 1 194 ? 2.284   -28.375 -14.449 1.00 57.18 ? 174 PRO C C   1 
ATOM   2984 O O   . PRO C 1 194 ? 2.160   -29.594 -14.297 1.00 58.25 ? 174 PRO C O   1 
ATOM   2985 C CB  . PRO C 1 194 ? 2.119   -28.268 -16.980 1.00 58.66 ? 174 PRO C CB  1 
ATOM   2986 C CG  . PRO C 1 194 ? 3.128   -28.108 -18.093 1.00 57.97 ? 174 PRO C CG  1 
ATOM   2987 C CD  . PRO C 1 194 ? 4.508   -28.171 -17.474 1.00 57.69 ? 174 PRO C CD  1 
ATOM   2988 N N   . GLY C 1 195 ? 1.952   -27.483 -13.520 1.00 56.51 ? 175 GLY C N   1 
ATOM   2989 C CA  . GLY C 1 195 ? 1.571   -27.878 -12.173 1.00 56.08 ? 175 GLY C CA  1 
ATOM   2990 C C   . GLY C 1 195 ? 1.809   -26.819 -11.104 1.00 57.07 ? 175 GLY C C   1 
ATOM   2991 O O   . GLY C 1 195 ? 1.116   -26.827 -10.084 1.00 53.18 ? 175 GLY C O   1 
ATOM   2992 N N   . ASN C 1 196 ? 2.777   -25.919 -11.329 1.00 56.15 ? 176 ASN C N   1 
ATOM   2993 C CA  . ASN C 1 196 ? 3.134   -24.865 -10.354 1.00 52.54 ? 176 ASN C CA  1 
ATOM   2994 C C   . ASN C 1 196 ? 3.747   -23.582 -11.006 1.00 52.55 ? 176 ASN C C   1 
ATOM   2995 O O   . ASN C 1 196 ? 3.477   -23.286 -12.178 1.00 54.26 ? 176 ASN C O   1 
ATOM   2996 C CB  . ASN C 1 196 ? 4.056   -25.466 -9.277  1.00 50.16 ? 176 ASN C CB  1 
ATOM   2997 C CG  . ASN C 1 196 ? 3.293   -26.019 -8.086  1.00 51.28 ? 176 ASN C CG  1 
ATOM   2998 O OD1 . ASN C 1 196 ? 2.153   -25.647 -7.837  1.00 49.38 ? 176 ASN C OD1 1 
ATOM   2999 N ND2 . ASN C 1 196 ? 3.932   -26.909 -7.332  1.00 54.03 ? 176 ASN C ND2 1 
ATOM   3000 N N   . THR C 1 197 ? 4.497   -22.795 -10.226 1.00 49.89 ? 177 THR C N   1 
ATOM   3001 C CA  . THR C 1 197 ? 5.234   -21.623 -10.717 1.00 48.14 ? 177 THR C CA  1 
ATOM   3002 C C   . THR C 1 197 ? 6.601   -21.549 -10.008 1.00 50.31 ? 177 THR C C   1 
ATOM   3003 O O   . THR C 1 197 ? 6.778   -22.073 -8.901  1.00 49.53 ? 177 THR C O   1 
ATOM   3004 C CB  . THR C 1 197 ? 4.472   -20.276 -10.483 1.00 47.76 ? 177 THR C CB  1 
ATOM   3005 O OG1 . THR C 1 197 ? 4.897   -19.658 -9.262  1.00 45.84 ? 177 THR C OG1 1 
ATOM   3006 C CG2 . THR C 1 197 ? 2.950   -20.453 -10.447 1.00 46.25 ? 177 THR C CG2 1 
ATOM   3007 N N   . GLU C 1 198 ? 7.563   -20.889 -10.647 1.00 51.32 ? 178 GLU C N   1 
ATOM   3008 C CA  . GLU C 1 198 ? 8.939   -20.783 -10.112 1.00 50.08 ? 178 GLU C CA  1 
ATOM   3009 C C   . GLU C 1 198 ? 9.021   -20.250 -8.668  1.00 51.90 ? 178 GLU C C   1 
ATOM   3010 O O   . GLU C 1 198 ? 9.908   -20.661 -7.913  1.00 47.18 ? 178 GLU C O   1 
ATOM   3011 C CB  . GLU C 1 198 ? 9.819   -19.924 -11.033 1.00 49.83 ? 178 GLU C CB  1 
ATOM   3012 C CG  . GLU C 1 198 ? 9.115   -18.690 -11.578 1.00 50.61 ? 178 GLU C CG  1 
ATOM   3013 C CD  . GLU C 1 198 ? 10.049  -17.556 -11.972 1.00 52.47 ? 178 GLU C CD  1 
ATOM   3014 O OE1 . GLU C 1 198 ? 9.857   -16.991 -13.077 1.00 50.08 ? 178 GLU C OE1 1 
ATOM   3015 O OE2 . GLU C 1 198 ? 10.950  -17.212 -11.170 1.00 54.66 ? 178 GLU C OE2 1 
ATOM   3016 N N   . GLU C 1 199 ? 8.096   -19.349 -8.295  1.00 52.34 ? 179 GLU C N   1 
ATOM   3017 C CA  . GLU C 1 199 ? 7.996   -18.808 -6.922  1.00 49.74 ? 179 GLU C CA  1 
ATOM   3018 C C   . GLU C 1 199 ? 7.223   -19.742 -5.971  1.00 48.03 ? 179 GLU C C   1 
ATOM   3019 O O   . GLU C 1 199 ? 6.548   -19.302 -5.047  1.00 45.40 ? 179 GLU C O   1 
ATOM   3020 C CB  . GLU C 1 199 ? 7.329   -17.436 -6.942  1.00 48.47 ? 179 GLU C CB  1 
ATOM   3021 C CG  . GLU C 1 199 ? 8.063   -16.418 -7.778  1.00 49.17 ? 179 GLU C CG  1 
ATOM   3022 C CD  . GLU C 1 199 ? 7.410   -15.058 -7.739  1.00 51.35 ? 179 GLU C CD  1 
ATOM   3023 O OE1 . GLU C 1 199 ? 6.628   -14.798 -6.792  1.00 49.55 ? 179 GLU C OE1 1 
ATOM   3024 O OE2 . GLU C 1 199 ? 7.672   -14.256 -8.669  1.00 53.46 ? 179 GLU C OE2 1 
ATOM   3025 N N   . GLU C 1 200 ? 7.312   -21.034 -6.248  1.00 50.44 ? 180 GLU C N   1 
ATOM   3026 C CA  . GLU C 1 200 ? 6.851   -22.097 -5.366  1.00 48.90 ? 180 GLU C CA  1 
ATOM   3027 C C   . GLU C 1 200 ? 7.877   -23.223 -5.406  1.00 51.01 ? 180 GLU C C   1 
ATOM   3028 O O   . GLU C 1 200 ? 8.207   -23.778 -4.364  1.00 55.05 ? 180 GLU C O   1 
ATOM   3029 C CB  . GLU C 1 200 ? 5.520   -22.652 -5.848  1.00 48.17 ? 180 GLU C CB  1 
ATOM   3030 C CG  . GLU C 1 200 ? 4.358   -21.675 -5.844  1.00 47.84 ? 180 GLU C CG  1 
ATOM   3031 C CD  . GLU C 1 200 ? 3.260   -22.121 -6.773  1.00 44.49 ? 180 GLU C CD  1 
ATOM   3032 O OE1 . GLU C 1 200 ? 2.074   -21.976 -6.424  1.00 44.96 ? 180 GLU C OE1 1 
ATOM   3033 O OE2 . GLU C 1 200 ? 3.595   -22.627 -7.852  1.00 41.17 ? 180 GLU C OE2 1 
ATOM   3034 N N   . THR C 1 201 ? 8.331   -23.556 -6.626  1.00 49.78 ? 181 THR C N   1 
ATOM   3035 C CA  . THR C 1 201 ? 9.325   -24.600 -6.918  1.00 47.44 ? 181 THR C CA  1 
ATOM   3036 C C   . THR C 1 201 ? 10.746  -24.216 -6.552  1.00 48.43 ? 181 THR C C   1 
ATOM   3037 O O   . THR C 1 201 ? 11.409  -24.898 -5.783  1.00 50.57 ? 181 THR C O   1 
ATOM   3038 C CB  . THR C 1 201 ? 9.360   -24.927 -8.429  1.00 46.45 ? 181 THR C CB  1 
ATOM   3039 O OG1 . THR C 1 201 ? 8.081   -25.412 -8.855  1.00 46.54 ? 181 THR C OG1 1 
ATOM   3040 C CG2 . THR C 1 201 ? 10.446  -25.963 -8.739  1.00 45.76 ? 181 THR C CG2 1 
ATOM   3041 N N   . LEU C 1 202 ? 11.240  -23.137 -7.143  1.00 52.90 ? 182 LEU C N   1 
ATOM   3042 C CA  . LEU C 1 202 ? 12.583  -22.677 -6.840  1.00 52.34 ? 182 LEU C CA  1 
ATOM   3043 C C   . LEU C 1 202 ? 12.594  -22.143 -5.406  1.00 52.75 ? 182 LEU C C   1 
ATOM   3044 O O   . LEU C 1 202 ? 13.647  -21.806 -4.901  1.00 55.75 ? 182 LEU C O   1 
ATOM   3045 C CB  . LEU C 1 202 ? 13.055  -21.591 -7.819  1.00 55.76 ? 182 LEU C CB  1 
ATOM   3046 C CG  . LEU C 1 202 ? 12.761  -21.629 -9.337  1.00 55.55 ? 182 LEU C CG  1 
ATOM   3047 C CD1 . LEU C 1 202 ? 13.850  -20.846 -10.065 1.00 53.86 ? 182 LEU C CD1 1 
ATOM   3048 C CD2 . LEU C 1 202 ? 12.625  -23.020 -9.938  1.00 54.70 ? 182 LEU C CD2 1 
ATOM   3049 N N   . SER C 1 203 ? 11.411  -22.035 -4.785  1.00 52.71 ? 183 SER C N   1 
ATOM   3050 C CA  . SER C 1 203 ? 11.242  -21.784 -3.341  1.00 50.99 ? 183 SER C CA  1 
ATOM   3051 C C   . SER C 1 203 ? 10.732  -23.055 -2.612  1.00 51.55 ? 183 SER C C   1 
ATOM   3052 O O   . SER C 1 203 ? 10.302  -23.007 -1.456  1.00 51.31 ? 183 SER C O   1 
ATOM   3053 C CB  . SER C 1 203 ? 10.276  -20.617 -3.126  1.00 47.76 ? 183 SER C CB  1 
ATOM   3054 O OG  . SER C 1 203 ? 10.720  -19.477 -3.838  1.00 46.03 ? 183 SER C OG  1 
ATOM   3055 N N   . PHE C 1 204 ? 10.751  -24.166 -3.339  1.00 51.86 ? 184 PHE C N   1 
ATOM   3056 C CA  . PHE C 1 204 ? 10.462  -25.504 -2.838  1.00 53.13 ? 184 PHE C CA  1 
ATOM   3057 C C   . PHE C 1 204 ? 11.739  -26.335 -2.983  1.00 56.71 ? 184 PHE C C   1 
ATOM   3058 O O   . PHE C 1 204 ? 11.969  -27.264 -2.216  1.00 62.15 ? 184 PHE C O   1 
ATOM   3059 C CB  . PHE C 1 204 ? 9.244   -26.073 -3.597  1.00 53.58 ? 184 PHE C CB  1 
ATOM   3060 C CG  . PHE C 1 204 ? 9.273   -27.560 -3.875  1.00 56.46 ? 184 PHE C CG  1 
ATOM   3061 C CD1 . PHE C 1 204 ? 9.440   -28.491 -2.860  1.00 56.15 ? 184 PHE C CD1 1 
ATOM   3062 C CD2 . PHE C 1 204 ? 9.026   -28.025 -5.162  1.00 56.53 ? 184 PHE C CD2 1 
ATOM   3063 C CE1 . PHE C 1 204 ? 9.426   -29.845 -3.139  1.00 56.41 ? 184 PHE C CE1 1 
ATOM   3064 C CE2 . PHE C 1 204 ? 9.009   -29.375 -5.444  1.00 57.42 ? 184 PHE C CE2 1 
ATOM   3065 C CZ  . PHE C 1 204 ? 9.209   -30.288 -4.431  1.00 57.12 ? 184 PHE C CZ  1 
ATOM   3066 N N   . VAL C 1 205 ? 12.577  -25.974 -3.953  1.00 55.73 ? 185 VAL C N   1 
ATOM   3067 C CA  . VAL C 1 205 ? 13.922  -26.522 -4.083  1.00 57.90 ? 185 VAL C CA  1 
ATOM   3068 C C   . VAL C 1 205 ? 14.969  -25.560 -3.476  1.00 56.14 ? 185 VAL C C   1 
ATOM   3069 O O   . VAL C 1 205 ? 16.153  -25.909 -3.351  1.00 51.50 ? 185 VAL C O   1 
ATOM   3070 C CB  . VAL C 1 205 ? 14.209  -26.869 -5.566  1.00 58.37 ? 185 VAL C CB  1 
ATOM   3071 C CG1 . VAL C 1 205 ? 15.689  -27.128 -5.817  1.00 60.90 ? 185 VAL C CG1 1 
ATOM   3072 C CG2 . VAL C 1 205 ? 13.404  -28.098 -5.959  1.00 59.17 ? 185 VAL C CG2 1 
ATOM   3073 N N   . ASP C 1 206 ? 14.522  -24.361 -3.088  1.00 52.45 ? 186 ASP C N   1 
ATOM   3074 C CA  . ASP C 1 206 ? 15.364  -23.391 -2.385  1.00 48.70 ? 186 ASP C CA  1 
ATOM   3075 C C   . ASP C 1 206 ? 15.437  -23.767 -0.916  1.00 46.52 ? 186 ASP C C   1 
ATOM   3076 O O   . ASP C 1 206 ? 16.514  -23.939 -0.371  1.00 51.91 ? 186 ASP C O   1 
ATOM   3077 C CB  . ASP C 1 206 ? 14.768  -21.981 -2.505  1.00 48.02 ? 186 ASP C CB  1 
ATOM   3078 C CG  . ASP C 1 206 ? 15.795  -20.871 -2.350  1.00 48.32 ? 186 ASP C CG  1 
ATOM   3079 O OD1 . ASP C 1 206 ? 16.593  -20.651 -3.300  1.00 46.65 ? 186 ASP C OD1 1 
ATOM   3080 O OD2 . ASP C 1 206 ? 15.759  -20.190 -1.297  1.00 45.28 ? 186 ASP C OD2 1 
ATOM   3081 N N   . THR C 1 207 ? 14.280  -23.900 -0.275  1.00 43.71 ? 187 THR C N   1 
ATOM   3082 C CA  . THR C 1 207 ? 14.232  -23.940 1.176   1.00 42.03 ? 187 THR C CA  1 
ATOM   3083 C C   . THR C 1 207 ? 14.923  -25.163 1.688   1.00 42.33 ? 187 THR C C   1 
ATOM   3084 O O   . THR C 1 207 ? 15.451  -25.140 2.794   1.00 46.08 ? 187 THR C O   1 
ATOM   3085 C CB  . THR C 1 207 ? 12.798  -23.844 1.740   1.00 42.12 ? 187 THR C CB  1 
ATOM   3086 O OG1 . THR C 1 207 ? 12.285  -22.519 1.537   1.00 43.73 ? 187 THR C OG1 1 
ATOM   3087 C CG2 . THR C 1 207 ? 12.792  -24.086 3.218   1.00 42.88 ? 187 THR C CG2 1 
ATOM   3088 N N   . ILE C 1 208 ? 14.954  -26.219 0.881   1.00 41.47 ? 188 ILE C N   1 
ATOM   3089 C CA  . ILE C 1 208 ? 15.600  -27.455 1.301   1.00 40.98 ? 188 ILE C CA  1 
ATOM   3090 C C   . ILE C 1 208 ? 17.115  -27.257 1.409   1.00 41.77 ? 188 ILE C C   1 
ATOM   3091 O O   . ILE C 1 208 ? 17.708  -27.689 2.403   1.00 39.72 ? 188 ILE C O   1 
ATOM   3092 C CB  . ILE C 1 208 ? 15.299  -28.670 0.387   1.00 42.09 ? 188 ILE C CB  1 
ATOM   3093 C CG1 . ILE C 1 208 ? 13.828  -28.739 -0.041  1.00 43.57 ? 188 ILE C CG1 1 
ATOM   3094 C CG2 . ILE C 1 208 ? 15.625  -29.959 1.124   1.00 42.26 ? 188 ILE C CG2 1 
ATOM   3095 C CD1 . ILE C 1 208 ? 13.578  -29.689 -1.198  1.00 44.73 ? 188 ILE C CD1 1 
ATOM   3096 N N   . VAL C 1 209 ? 17.740  -26.588 0.427   1.00 42.96 ? 189 VAL C N   1 
ATOM   3097 C CA  . VAL C 1 209 ? 19.216  -26.451 0.456   1.00 45.86 ? 189 VAL C CA  1 
ATOM   3098 C C   . VAL C 1 209 ? 19.714  -25.800 1.731   1.00 46.59 ? 189 VAL C C   1 
ATOM   3099 O O   . VAL C 1 209 ? 20.672  -26.285 2.348   1.00 47.29 ? 189 VAL C O   1 
ATOM   3100 C CB  . VAL C 1 209 ? 19.856  -25.722 -0.751  1.00 47.47 ? 189 VAL C CB  1 
ATOM   3101 C CG1 . VAL C 1 209 ? 19.920  -26.650 -1.962  1.00 49.93 ? 189 VAL C CG1 1 
ATOM   3102 C CG2 . VAL C 1 209 ? 19.150  -24.421 -1.085  1.00 48.52 ? 189 VAL C CG2 1 
ATOM   3103 N N   . ARG C 1 210 ? 19.070  -24.720 2.148   1.00 44.83 ? 190 ARG C N   1 
ATOM   3104 C CA  . ARG C 1 210 ? 19.444  -24.140 3.423   1.00 43.34 ? 190 ARG C CA  1 
ATOM   3105 C C   . ARG C 1 210 ? 19.393  -25.229 4.486   1.00 40.84 ? 190 ARG C C   1 
ATOM   3106 O O   . ARG C 1 210 ? 20.326  -25.349 5.280   1.00 40.62 ? 190 ARG C O   1 
ATOM   3107 C CB  . ARG C 1 210 ? 18.602  -22.914 3.821   1.00 44.49 ? 190 ARG C CB  1 
ATOM   3108 C CG  . ARG C 1 210 ? 17.165  -22.819 3.267   1.00 44.81 ? 190 ARG C CG  1 
ATOM   3109 C CD  . ARG C 1 210 ? 16.748  -21.359 3.121   1.00 44.72 ? 190 ARG C CD  1 
ATOM   3110 N NE  . ARG C 1 210 ? 17.949  -20.521 3.040   1.00 44.23 ? 190 ARG C NE  1 
ATOM   3111 C CZ  . ARG C 1 210 ? 18.593  -20.179 1.925   1.00 42.10 ? 190 ARG C CZ  1 
ATOM   3112 N NH1 . ARG C 1 210 ? 18.132  -20.536 0.733   1.00 39.34 ? 190 ARG C NH1 1 
ATOM   3113 N NH2 . ARG C 1 210 ? 19.705  -19.436 2.020   1.00 41.99 ? 190 ARG C NH2 1 
ATOM   3114 N N   . CYS C 1 211 ? 18.353  -26.060 4.471   1.00 36.84 ? 191 CYS C N   1 
ATOM   3115 C CA  . CYS C 1 211 ? 18.237  -27.125 5.485   1.00 38.45 ? 191 CYS C CA  1 
ATOM   3116 C C   . CYS C 1 211 ? 19.185  -28.296 5.194   1.00 39.96 ? 191 CYS C C   1 
ATOM   3117 O O   . CYS C 1 211 ? 19.077  -29.363 5.806   1.00 42.85 ? 191 CYS C O   1 
ATOM   3118 C CB  . CYS C 1 211 ? 16.805  -27.667 5.574   1.00 37.41 ? 191 CYS C CB  1 
ATOM   3119 S SG  . CYS C 1 211 ? 15.580  -26.823 4.562   1.00 35.99 ? 191 CYS C SG  1 
ATOM   3120 N N   . ASN C 1 212 ? 20.070  -28.115 4.222   1.00 36.98 ? 192 ASN C N   1 
ATOM   3121 C CA  . ASN C 1 212 ? 21.015  -29.127 3.873   1.00 36.47 ? 192 ASN C CA  1 
ATOM   3122 C C   . ASN C 1 212 ? 22.425  -28.645 4.095   1.00 39.08 ? 192 ASN C C   1 
ATOM   3123 O O   . ASN C 1 212 ? 23.263  -29.394 4.621   1.00 41.81 ? 192 ASN C O   1 
ATOM   3124 C CB  . ASN C 1 212 ? 20.789  -29.579 2.441   1.00 36.63 ? 192 ASN C CB  1 
ATOM   3125 C CG  . ASN C 1 212 ? 19.594  -30.504 2.321   1.00 35.56 ? 192 ASN C CG  1 
ATOM   3126 O OD1 . ASN C 1 212 ? 18.592  -30.337 3.033   1.00 36.86 ? 192 ASN C OD1 1 
ATOM   3127 N ND2 . ASN C 1 212 ? 19.703  -31.498 1.462   1.00 32.17 ? 192 ASN C ND2 1 
ATOM   3128 N N   . LEU C 1 213 ? 22.697  -27.402 3.713   1.00 38.73 ? 193 LEU C N   1 
ATOM   3129 C CA  . LEU C 1 213 ? 23.950  -26.758 4.112   1.00 38.66 ? 193 LEU C CA  1 
ATOM   3130 C C   . LEU C 1 213 ? 23.901  -26.222 5.525   1.00 35.68 ? 193 LEU C C   1 
ATOM   3131 O O   . LEU C 1 213 ? 24.889  -25.702 6.006   1.00 34.75 ? 193 LEU C O   1 
ATOM   3132 C CB  . LEU C 1 213 ? 24.322  -25.616 3.164   1.00 38.91 ? 193 LEU C CB  1 
ATOM   3133 C CG  . LEU C 1 213 ? 24.522  -25.991 1.702   1.00 39.59 ? 193 LEU C CG  1 
ATOM   3134 C CD1 . LEU C 1 213 ? 25.421  -24.960 1.042   1.00 41.92 ? 193 LEU C CD1 1 
ATOM   3135 C CD2 . LEU C 1 213 ? 25.093  -27.384 1.540   1.00 40.00 ? 193 LEU C CD2 1 
ATOM   3136 N N   . GLN C 1 214 ? 22.758  -26.307 6.186   1.00 38.94 ? 194 GLN C N   1 
ATOM   3137 C CA  . GLN C 1 214 ? 22.693  -25.901 7.592   1.00 40.57 ? 194 GLN C CA  1 
ATOM   3138 C C   . GLN C 1 214 ? 23.056  -27.104 8.446   1.00 39.01 ? 194 GLN C C   1 
ATOM   3139 O O   . GLN C 1 214 ? 23.797  -26.971 9.413   1.00 40.47 ? 194 GLN C O   1 
ATOM   3140 C CB  . GLN C 1 214 ? 21.331  -25.282 7.968   1.00 39.21 ? 194 GLN C CB  1 
ATOM   3141 C CG  . GLN C 1 214 ? 21.237  -23.808 7.624   1.00 38.03 ? 194 GLN C CG  1 
ATOM   3142 C CD  . GLN C 1 214 ? 19.816  -23.258 7.487   1.00 39.50 ? 194 GLN C CD  1 
ATOM   3143 O OE1 . GLN C 1 214 ? 18.818  -23.963 7.672   1.00 37.42 ? 194 GLN C OE1 1 
ATOM   3144 N NE2 . GLN C 1 214 ? 19.731  -21.979 7.125   1.00 39.51 ? 194 GLN C NE2 1 
ATOM   3145 N N   . SER C 1 215 ? 22.553  -28.270 8.048   1.00 40.09 ? 195 SER C N   1 
ATOM   3146 C CA  . SER C 1 215 ? 22.988  -29.583 8.566   1.00 42.34 ? 195 SER C CA  1 
ATOM   3147 C C   . SER C 1 215 ? 24.522  -29.789 8.617   1.00 47.34 ? 195 SER C C   1 
ATOM   3148 O O   . SER C 1 215 ? 25.021  -30.528 9.461   1.00 49.34 ? 195 SER C O   1 
ATOM   3149 C CB  . SER C 1 215 ? 22.409  -30.684 7.667   1.00 40.79 ? 195 SER C CB  1 
ATOM   3150 O OG  . SER C 1 215 ? 21.115  -30.364 7.190   1.00 36.74 ? 195 SER C OG  1 
ATOM   3151 N N   . LEU C 1 216 ? 25.239  -29.161 7.676   1.00 49.43 ? 196 LEU C N   1 
ATOM   3152 C CA  . LEU C 1 216 ? 26.693  -29.300 7.511   1.00 48.27 ? 196 LEU C CA  1 
ATOM   3153 C C   . LEU C 1 216 ? 27.497  -28.434 8.488   1.00 48.06 ? 196 LEU C C   1 
ATOM   3154 O O   . LEU C 1 216 ? 28.577  -28.826 8.937   1.00 44.28 ? 196 LEU C O   1 
ATOM   3155 C CB  . LEU C 1 216 ? 27.094  -28.946 6.062   1.00 48.63 ? 196 LEU C CB  1 
ATOM   3156 C CG  . LEU C 1 216 ? 27.472  -30.092 5.116   1.00 51.11 ? 196 LEU C CG  1 
ATOM   3157 C CD1 . LEU C 1 216 ? 26.368  -31.128 4.957   1.00 52.40 ? 196 LEU C CD1 1 
ATOM   3158 C CD2 . LEU C 1 216 ? 27.831  -29.513 3.759   1.00 53.36 ? 196 LEU C CD2 1 
ATOM   3159 N N   . ALA C 1 217 ? 26.987  -27.242 8.779   1.00 48.80 ? 197 ALA C N   1 
ATOM   3160 C CA  . ALA C 1 217 ? 27.628  -26.340 9.743   1.00 49.12 ? 197 ALA C CA  1 
ATOM   3161 C C   . ALA C 1 217 ? 27.609  -26.885 11.181  1.00 47.89 ? 197 ALA C C   1 
ATOM   3162 O O   . ALA C 1 217 ? 28.629  -26.876 11.858  1.00 50.54 ? 197 ALA C O   1 
ATOM   3163 C CB  . ALA C 1 217 ? 26.988  -24.957 9.680   1.00 48.69 ? 197 ALA C CB  1 
ATOM   3164 N N   . ARG C 1 218 ? 26.466  -27.375 11.645  1.00 48.58 ? 198 ARG C N   1 
ATOM   3165 C CA  . ARG C 1 218 ? 26.409  -28.036 12.958  1.00 50.60 ? 198 ARG C CA  1 
ATOM   3166 C C   . ARG C 1 218 ? 27.518  -29.076 13.133  1.00 52.20 ? 198 ARG C C   1 
ATOM   3167 O O   . ARG C 1 218 ? 28.142  -29.134 14.201  1.00 56.03 ? 198 ARG C O   1 
ATOM   3168 C CB  . ARG C 1 218 ? 25.059  -28.715 13.198  1.00 50.80 ? 198 ARG C CB  1 
ATOM   3169 C CG  . ARG C 1 218 ? 24.581  -29.596 12.055  1.00 51.82 ? 198 ARG C CG  1 
ATOM   3170 C CD  . ARG C 1 218 ? 24.223  -31.001 12.512  1.00 48.84 ? 198 ARG C CD  1 
ATOM   3171 N NE  . ARG C 1 218 ? 23.490  -31.743 11.487  1.00 47.49 ? 198 ARG C NE  1 
ATOM   3172 C CZ  . ARG C 1 218 ? 22.166  -31.705 11.312  1.00 46.31 ? 198 ARG C CZ  1 
ATOM   3173 N NH1 . ARG C 1 218 ? 21.407  -30.943 12.085  1.00 46.23 ? 198 ARG C NH1 1 
ATOM   3174 N NH2 . ARG C 1 218 ? 21.589  -32.435 10.354  1.00 45.59 ? 198 ARG C NH2 1 
ATOM   3175 N N   . SER C 1 219 ? 27.776  -29.863 12.080  1.00 48.52 ? 199 SER C N   1 
ATOM   3176 C CA  . SER C 1 219 ? 28.717  -30.980 12.138  1.00 45.37 ? 199 SER C CA  1 
ATOM   3177 C C   . SER C 1 219 ? 30.150  -30.491 12.120  1.00 49.55 ? 199 SER C C   1 
ATOM   3178 O O   . SER C 1 219 ? 31.077  -31.275 12.297  1.00 56.66 ? 199 SER C O   1 
ATOM   3179 C CB  . SER C 1 219 ? 28.498  -31.950 10.971  1.00 43.05 ? 199 SER C CB  1 
ATOM   3180 O OG  . SER C 1 219 ? 27.239  -32.601 11.041  1.00 39.35 ? 199 SER C OG  1 
ATOM   3181 N N   . THR C 1 220 ? 30.332  -29.196 11.894  1.00 53.15 ? 200 THR C N   1 
ATOM   3182 C CA  . THR C 1 220 ? 31.645  -28.558 11.956  1.00 54.77 ? 200 THR C CA  1 
ATOM   3183 C C   . THR C 1 220 ? 31.491  -27.162 12.574  1.00 59.31 ? 200 THR C C   1 
ATOM   3184 O O   . THR C 1 220 ? 31.502  -26.139 11.868  1.00 56.88 ? 200 THR C O   1 
ATOM   3185 C CB  . THR C 1 220 ? 32.250  -28.469 10.549  1.00 54.66 ? 200 THR C CB  1 
ATOM   3186 O OG1 . THR C 1 220 ? 31.199  -28.577 9.579   1.00 56.15 ? 200 THR C OG1 1 
ATOM   3187 C CG2 . THR C 1 220 ? 33.240  -29.593 10.323  1.00 55.64 ? 200 THR C CG2 1 
ATOM   3188 N N   . ASN C 1 221 ? 31.327  -27.140 13.897  1.00 62.04 ? 201 ASN C N   1 
ATOM   3189 C CA  . ASN C 1 221 ? 30.984  -25.918 14.625  1.00 67.60 ? 201 ASN C CA  1 
ATOM   3190 C C   . ASN C 1 221 ? 31.887  -24.734 14.327  1.00 71.73 ? 201 ASN C C   1 
ATOM   3191 O O   . ASN C 1 221 ? 33.093  -24.891 14.072  1.00 64.24 ? 201 ASN C O   1 
ATOM   3192 C CB  . ASN C 1 221 ? 30.993  -26.147 16.137  1.00 69.38 ? 201 ASN C CB  1 
ATOM   3193 C CG  . ASN C 1 221 ? 29.709  -26.768 16.657  1.00 71.02 ? 201 ASN C CG  1 
ATOM   3194 O OD1 . ASN C 1 221 ? 29.570  -26.968 17.868  1.00 73.91 ? 201 ASN C OD1 1 
ATOM   3195 N ND2 . ASN C 1 221 ? 28.769  -27.086 15.764  1.00 68.95 ? 201 ASN C ND2 1 
ATOM   3196 N N   . ARG C 1 222 ? 31.269  -23.553 14.410  1.00 71.68 ? 202 ARG C N   1 
ATOM   3197 C CA  . ARG C 1 222 ? 31.880  -22.288 14.037  1.00 70.47 ? 202 ARG C CA  1 
ATOM   3198 C C   . ARG C 1 222 ? 31.726  -22.087 12.543  1.00 64.27 ? 202 ARG C C   1 
ATOM   3199 O O   . ARG C 1 222 ? 31.717  -20.958 12.063  1.00 60.96 ? 202 ARG C O   1 
ATOM   3200 C CB  . ARG C 1 222 ? 33.358  -22.240 14.446  1.00 78.25 ? 202 ARG C CB  1 
HETATM 3201 C C1  . GOL D 2 .   ? 19.437  -43.125 20.184  1.00 15.92 ? 301 GOL A C1  1 
HETATM 3202 O O1  . GOL D 2 .   ? 20.166  -44.283 19.800  1.00 15.85 ? 301 GOL A O1  1 
HETATM 3203 C C2  . GOL D 2 .   ? 19.973  -42.651 21.523  1.00 15.96 ? 301 GOL A C2  1 
HETATM 3204 O O2  . GOL D 2 .   ? 20.514  -43.808 22.151  1.00 16.43 ? 301 GOL A O2  1 
HETATM 3205 C C3  . GOL D 2 .   ? 21.065  -41.592 21.344  1.00 16.42 ? 301 GOL A C3  1 
HETATM 3206 O O3  . GOL D 2 .   ? 21.029  -40.554 22.342  1.00 16.41 ? 301 GOL A O3  1 
HETATM 3207 C C1  . GOL E 2 .   ? 25.667  -35.594 28.200  1.00 31.96 ? 302 GOL A C1  1 
HETATM 3208 O O1  . GOL E 2 .   ? 26.726  -35.529 29.171  1.00 33.40 ? 302 GOL A O1  1 
HETATM 3209 C C2  . GOL E 2 .   ? 26.134  -34.779 27.003  1.00 32.08 ? 302 GOL A C2  1 
HETATM 3210 O O2  . GOL E 2 .   ? 26.899  -33.663 27.523  1.00 30.01 ? 302 GOL A O2  1 
HETATM 3211 C C3  . GOL E 2 .   ? 26.947  -35.681 26.056  1.00 29.97 ? 302 GOL A C3  1 
HETATM 3212 O O3  . GOL E 2 .   ? 27.337  -35.014 24.856  1.00 28.47 ? 302 GOL A O3  1 
HETATM 3213 C C1  . GOL F 2 .   ? 17.452  -38.960 13.028  1.00 33.48 ? 303 GOL A C1  1 
HETATM 3214 O O1  . GOL F 2 .   ? 16.572  -38.115 12.248  1.00 30.85 ? 303 GOL A O1  1 
HETATM 3215 C C2  . GOL F 2 .   ? 18.378  -39.805 12.120  1.00 34.39 ? 303 GOL A C2  1 
HETATM 3216 O O2  . GOL F 2 .   ? 19.751  -39.392 12.192  1.00 33.81 ? 303 GOL A O2  1 
HETATM 3217 C C3  . GOL F 2 .   ? 18.345  -41.281 12.502  1.00 34.90 ? 303 GOL A C3  1 
HETATM 3218 O O3  . GOL F 2 .   ? 19.075  -42.079 11.555  1.00 34.49 ? 303 GOL A O3  1 
HETATM 3219 C C1  . GOL G 2 .   ? 29.880  -34.359 35.329  1.00 40.60 ? 304 GOL A C1  1 
HETATM 3220 O O1  . GOL G 2 .   ? 29.674  -33.406 34.269  1.00 43.27 ? 304 GOL A O1  1 
HETATM 3221 C C2  . GOL G 2 .   ? 31.372  -34.469 35.601  1.00 41.82 ? 304 GOL A C2  1 
HETATM 3222 O O2  . GOL G 2 .   ? 31.689  -33.813 36.839  1.00 41.21 ? 304 GOL A O2  1 
HETATM 3223 C C3  . GOL G 2 .   ? 31.799  -35.942 35.625  1.00 43.17 ? 304 GOL A C3  1 
HETATM 3224 O O3  . GOL G 2 .   ? 33.225  -36.082 35.739  1.00 41.80 ? 304 GOL A O3  1 
HETATM 3225 C C1  . GOL H 2 .   ? 9.521   -48.021 26.674  1.00 33.47 ? 305 GOL A C1  1 
HETATM 3226 O O1  . GOL H 2 .   ? 9.769   -49.263 27.364  1.00 34.10 ? 305 GOL A O1  1 
HETATM 3227 C C2  . GOL H 2 .   ? 10.734  -47.096 26.739  1.00 32.59 ? 305 GOL A C2  1 
HETATM 3228 O O2  . GOL H 2 .   ? 11.772  -47.658 25.931  1.00 33.41 ? 305 GOL A O2  1 
HETATM 3229 C C3  . GOL H 2 .   ? 10.338  -45.699 26.255  1.00 31.83 ? 305 GOL A C3  1 
HETATM 3230 O O3  . GOL H 2 .   ? 11.339  -45.155 25.395  1.00 30.64 ? 305 GOL A O3  1 
HETATM 3231 C C1  . GOL I 2 .   ? 20.944  -19.439 28.742  1.00 45.15 ? 306 GOL A C1  1 
HETATM 3232 O O1  . GOL I 2 .   ? 22.055  -19.244 27.841  1.00 42.93 ? 306 GOL A O1  1 
HETATM 3233 C C2  . GOL I 2 .   ? 20.041  -20.597 28.282  1.00 45.86 ? 306 GOL A C2  1 
HETATM 3234 O O2  . GOL I 2 .   ? 18.704  -20.513 28.819  1.00 47.77 ? 306 GOL A O2  1 
HETATM 3235 C C3  . GOL I 2 .   ? 20.612  -21.919 28.767  1.00 47.18 ? 306 GOL A C3  1 
HETATM 3236 O O3  . GOL I 2 .   ? 20.413  -22.040 30.189  1.00 45.85 ? 306 GOL A O3  1 
HETATM 3237 C C1  . GOL J 2 .   ? 25.913  -18.451 30.577  1.00 42.25 ? 307 GOL A C1  1 
HETATM 3238 O O1  . GOL J 2 .   ? 26.789  -18.275 29.445  1.00 45.31 ? 307 GOL A O1  1 
HETATM 3239 C C2  . GOL J 2 .   ? 24.799  -19.440 30.201  1.00 41.59 ? 307 GOL A C2  1 
HETATM 3240 O O2  . GOL J 2 .   ? 23.739  -19.478 31.166  1.00 38.01 ? 307 GOL A O2  1 
HETATM 3241 C C3  . GOL J 2 .   ? 25.432  -20.818 30.048  1.00 39.81 ? 307 GOL A C3  1 
HETATM 3242 O O3  . GOL J 2 .   ? 26.235  -20.827 28.860  1.00 37.27 ? 307 GOL A O3  1 
HETATM 3243 C C1  . GOL K 2 .   ? 11.711  22.511  -3.669  1.00 39.55 ? 301 GOL B C1  1 
HETATM 3244 O O1  . GOL K 2 .   ? 11.214  23.844  -3.538  1.00 39.21 ? 301 GOL B O1  1 
HETATM 3245 C C2  . GOL K 2 .   ? 12.375  22.094  -2.357  1.00 39.85 ? 301 GOL B C2  1 
HETATM 3246 O O2  . GOL K 2 .   ? 11.992  23.006  -1.316  1.00 43.11 ? 301 GOL B O2  1 
HETATM 3247 C C3  . GOL K 2 .   ? 12.014  20.663  -1.976  1.00 40.47 ? 301 GOL B C3  1 
HETATM 3248 O O3  . GOL K 2 .   ? 11.741  20.574  -0.577  1.00 43.33 ? 301 GOL B O3  1 
HETATM 3249 C C1  . GOL L 2 .   ? 25.651  19.081  10.427  1.00 44.31 ? 302 GOL B C1  1 
HETATM 3250 O O1  . GOL L 2 .   ? 25.366  19.245  9.036   1.00 40.43 ? 302 GOL B O1  1 
HETATM 3251 C C2  . GOL L 2 .   ? 26.931  19.852  10.801  1.00 48.50 ? 302 GOL B C2  1 
HETATM 3252 O O2  . GOL L 2 .   ? 26.637  21.246  10.899  1.00 47.40 ? 302 GOL B O2  1 
HETATM 3253 C C3  . GOL L 2 .   ? 27.533  19.344  12.128  1.00 48.34 ? 302 GOL B C3  1 
HETATM 3254 O O3  . GOL L 2 .   ? 28.412  20.309  12.729  1.00 46.21 ? 302 GOL B O3  1 
HETATM 3255 C C1  . GOL M 2 .   ? 11.170  20.880  -9.603  1.00 41.27 ? 303 GOL B C1  1 
HETATM 3256 O O1  . GOL M 2 .   ? 10.717  20.232  -8.400  1.00 38.13 ? 303 GOL B O1  1 
HETATM 3257 C C2  . GOL M 2 .   ? 12.130  19.976  -10.385 1.00 40.70 ? 303 GOL B C2  1 
HETATM 3258 O O2  . GOL M 2 .   ? 13.238  19.626  -9.536  1.00 37.15 ? 303 GOL B O2  1 
HETATM 3259 C C3  . GOL M 2 .   ? 12.595  20.649  -11.686 1.00 40.96 ? 303 GOL B C3  1 
HETATM 3260 O O3  . GOL M 2 .   ? 13.944  21.153  -11.615 1.00 41.38 ? 303 GOL B O3  1 
HETATM 3261 C C1  . GOL N 2 .   ? 39.894  -2.916  17.438  1.00 45.38 ? 304 GOL B C1  1 
HETATM 3262 O O1  . GOL N 2 .   ? 40.007  -1.643  16.775  1.00 44.77 ? 304 GOL B O1  1 
HETATM 3263 C C2  . GOL N 2 .   ? 41.130  -3.802  17.251  1.00 44.79 ? 304 GOL B C2  1 
HETATM 3264 O O2  . GOL N 2 .   ? 40.845  -5.096  17.781  1.00 46.56 ? 304 GOL B O2  1 
HETATM 3265 C C3  . GOL N 2 .   ? 41.541  -3.991  15.795  1.00 47.31 ? 304 GOL B C3  1 
HETATM 3266 O O3  . GOL N 2 .   ? 42.779  -4.727  15.673  1.00 47.79 ? 304 GOL B O3  1 
HETATM 3267 C C1  . GOL O 2 .   ? -0.163  -31.797 -20.061 1.00 25.57 ? 301 GOL C C1  1 
HETATM 3268 O O1  . GOL O 2 .   ? -0.172  -32.463 -18.793 1.00 24.15 ? 301 GOL C O1  1 
HETATM 3269 C C2  . GOL O 2 .   ? -1.505  -32.032 -20.776 1.00 25.92 ? 301 GOL C C2  1 
HETATM 3270 O O2  . GOL O 2 .   ? -2.583  -31.308 -20.108 1.00 26.99 ? 301 GOL C O2  1 
HETATM 3271 C C3  . GOL O 2 .   ? -1.353  -31.631 -22.240 1.00 24.11 ? 301 GOL C C3  1 
HETATM 3272 O O3  . GOL O 2 .   ? -2.597  -31.176 -22.775 1.00 24.93 ? 301 GOL C O3  1 
HETATM 3273 O O   . HOH P 3 .   ? -2.215  -43.686 29.086  1.00 30.03 ? 401 HOH A O   1 
HETATM 3274 O O   . HOH P 3 .   ? 19.274  -35.848 36.534  1.00 31.80 ? 402 HOH A O   1 
HETATM 3275 O O   . HOH P 3 .   ? -4.416  -31.152 21.588  1.00 37.38 ? 403 HOH A O   1 
HETATM 3276 O O   . HOH P 3 .   ? 1.697   -32.258 29.659  1.00 32.64 ? 404 HOH A O   1 
HETATM 3277 O O   . HOH P 3 .   ? 23.292  -27.853 45.680  1.00 19.07 ? 405 HOH A O   1 
HETATM 3278 O O   . HOH P 3 .   ? -13.060 -24.092 18.314  1.00 31.25 ? 406 HOH A O   1 
HETATM 3279 O O   . HOH P 3 .   ? -3.612  -18.169 -0.259  1.00 32.63 ? 407 HOH A O   1 
HETATM 3280 O O   . HOH P 3 .   ? 22.490  -26.494 37.819  1.00 15.51 ? 408 HOH A O   1 
HETATM 3281 O O   . HOH P 3 .   ? 24.349  -12.807 22.517  1.00 40.64 ? 409 HOH A O   1 
HETATM 3282 O O   . HOH P 3 .   ? -16.324 -31.583 11.549  1.00 38.72 ? 410 HOH A O   1 
HETATM 3283 O O   . HOH P 3 .   ? -5.856  -48.817 5.979   1.00 30.63 ? 411 HOH A O   1 
HETATM 3284 O O   . HOH P 3 .   ? -6.261  -31.600 17.285  1.00 20.56 ? 412 HOH A O   1 
HETATM 3285 O O   . HOH P 3 .   ? 4.448   -13.614 4.952   1.00 30.93 ? 413 HOH A O   1 
HETATM 3286 O O   . HOH P 3 .   ? 12.225  -39.803 22.650  1.00 26.44 ? 414 HOH A O   1 
HETATM 3287 O O   . HOH P 3 .   ? 18.261  -35.875 8.157   1.00 37.86 ? 415 HOH A O   1 
HETATM 3288 O O   . HOH P 3 .   ? 5.784   -39.280 27.689  1.00 40.08 ? 416 HOH A O   1 
HETATM 3289 O O   . HOH P 3 .   ? 19.695  -36.864 27.400  1.00 18.04 ? 417 HOH A O   1 
HETATM 3290 O O   . HOH P 3 .   ? 7.021   -10.363 27.663  1.00 37.32 ? 418 HOH A O   1 
HETATM 3291 O O   . HOH P 3 .   ? 5.016   -26.772 -2.619  1.00 25.23 ? 419 HOH A O   1 
HETATM 3292 O O   . HOH P 3 .   ? 24.613  -26.685 41.069  1.00 21.15 ? 420 HOH A O   1 
HETATM 3293 O O   . HOH P 3 .   ? -8.804  -46.669 15.108  1.00 49.77 ? 421 HOH A O   1 
HETATM 3294 O O   . HOH P 3 .   ? -11.566 -38.082 24.031  1.00 43.89 ? 422 HOH A O   1 
HETATM 3295 O O   . HOH P 3 .   ? 23.960  -41.504 10.538  0.50 30.24 ? 423 HOH A O   1 
HETATM 3296 O O   . HOH P 3 .   ? 4.443   -48.327 19.803  1.00 48.71 ? 424 HOH A O   1 
HETATM 3297 O O   . HOH P 3 .   ? -15.905 -20.534 7.761   1.00 22.70 ? 425 HOH A O   1 
HETATM 3298 O O   . HOH P 3 .   ? 25.499  -13.997 30.471  1.00 26.10 ? 426 HOH A O   1 
HETATM 3299 O O   . HOH P 3 .   ? 10.502  -47.141 21.504  1.00 19.29 ? 427 HOH A O   1 
HETATM 3300 O O   . HOH P 3 .   ? 33.550  -23.111 25.255  1.00 14.42 ? 428 HOH A O   1 
HETATM 3301 O O   . HOH P 3 .   ? 16.874  -38.079 9.272   1.00 34.11 ? 429 HOH A O   1 
HETATM 3302 O O   . HOH P 3 .   ? 2.316   -32.476 6.622   1.00 9.97  ? 430 HOH A O   1 
HETATM 3303 O O   . HOH P 3 .   ? 12.191  -44.066 21.069  1.00 50.64 ? 431 HOH A O   1 
HETATM 3304 O O   . HOH P 3 .   ? -2.136  -12.842 24.657  1.00 39.28 ? 432 HOH A O   1 
HETATM 3305 O O   . HOH P 3 .   ? 0.043   -35.891 -1.590  1.00 55.17 ? 433 HOH A O   1 
HETATM 3306 O O   . HOH P 3 .   ? 2.027   -13.151 19.713  1.00 25.98 ? 434 HOH A O   1 
HETATM 3307 O O   . HOH P 3 .   ? 29.187  -30.134 30.543  1.00 25.21 ? 435 HOH A O   1 
HETATM 3308 O O   . HOH P 3 .   ? 12.171  -18.962 4.903   1.00 23.37 ? 436 HOH A O   1 
HETATM 3309 O O   . HOH P 3 .   ? -0.903  -46.404 26.337  1.00 40.41 ? 437 HOH A O   1 
HETATM 3310 O O   . HOH P 3 .   ? 1.413   -54.588 12.084  1.00 20.03 ? 438 HOH A O   1 
HETATM 3311 O O   . HOH P 3 .   ? 16.586  -38.944 23.826  1.00 17.13 ? 439 HOH A O   1 
HETATM 3312 O O   . HOH P 3 .   ? -11.059 -17.192 18.602  1.00 50.77 ? 440 HOH A O   1 
HETATM 3313 O O   . HOH P 3 .   ? -8.800  -47.978 8.252   1.00 9.28  ? 441 HOH A O   1 
HETATM 3314 O O   . HOH P 3 .   ? 26.274  -21.853 42.640  1.00 20.17 ? 442 HOH A O   1 
HETATM 3315 O O   . HOH P 3 .   ? -11.384 -27.324 7.820   1.00 29.49 ? 443 HOH A O   1 
HETATM 3316 O O   . HOH P 3 .   ? 13.732  -47.740 10.707  1.00 15.37 ? 444 HOH A O   1 
HETATM 3317 O O   . HOH P 3 .   ? -10.679 -35.293 13.313  1.00 31.44 ? 445 HOH A O   1 
HETATM 3318 O O   . HOH P 3 .   ? 17.917  -16.559 32.142  1.00 23.22 ? 446 HOH A O   1 
HETATM 3319 O O   . HOH P 3 .   ? 7.617   -39.641 31.362  1.00 21.38 ? 447 HOH A O   1 
HETATM 3320 O O   . HOH P 3 .   ? -9.479  -45.762 2.450   1.00 32.51 ? 448 HOH A O   1 
HETATM 3321 O O   . HOH P 3 .   ? -15.467 -24.125 13.442  1.00 25.63 ? 449 HOH A O   1 
HETATM 3322 O O   . HOH P 3 .   ? 16.713  -28.771 39.846  1.00 31.44 ? 450 HOH A O   1 
HETATM 3323 O O   . HOH P 3 .   ? 13.598  -21.000 36.497  1.00 33.83 ? 451 HOH A O   1 
HETATM 3324 O O   . HOH P 3 .   ? 6.113   -51.959 12.586  1.00 22.27 ? 452 HOH A O   1 
HETATM 3325 O O   . HOH P 3 .   ? 16.500  -37.810 21.506  1.00 22.36 ? 453 HOH A O   1 
HETATM 3326 O O   . HOH P 3 .   ? 9.527   -42.251 20.635  1.00 20.04 ? 454 HOH A O   1 
HETATM 3327 O O   . HOH P 3 .   ? -14.096 -32.997 19.210  1.00 38.71 ? 455 HOH A O   1 
HETATM 3328 O O   . HOH P 3 .   ? -14.897 -28.785 16.511  1.00 21.80 ? 456 HOH A O   1 
HETATM 3329 O O   . HOH P 3 .   ? 26.593  -27.364 35.952  1.00 34.44 ? 457 HOH A O   1 
HETATM 3330 O O   . HOH P 3 .   ? 18.288  -31.607 41.787  1.00 31.19 ? 458 HOH A O   1 
HETATM 3331 O O   . HOH P 3 .   ? 37.562  -17.977 20.523  1.00 17.20 ? 459 HOH A O   1 
HETATM 3332 O O   . HOH P 3 .   ? 23.780  -34.867 20.917  1.00 35.01 ? 460 HOH A O   1 
HETATM 3333 O O   . HOH P 3 .   ? 3.723   -31.794 2.854   1.00 42.84 ? 461 HOH A O   1 
HETATM 3334 O O   . HOH P 3 .   ? 4.630   -31.612 -8.284  1.00 23.04 ? 462 HOH A O   1 
HETATM 3335 O O   . HOH P 3 .   ? 2.557   -54.675 20.449  1.00 20.44 ? 463 HOH A O   1 
HETATM 3336 O O   . HOH P 3 .   ? -8.692  -34.992 22.420  1.00 26.87 ? 464 HOH A O   1 
HETATM 3337 O O   . HOH P 3 .   ? 17.892  -36.834 25.619  1.00 10.50 ? 465 HOH A O   1 
HETATM 3338 O O   . HOH P 3 .   ? 19.004  -11.968 32.478  1.00 33.80 ? 466 HOH A O   1 
HETATM 3339 O O   . HOH P 3 .   ? 27.664  -25.716 29.012  1.00 38.73 ? 467 HOH A O   1 
HETATM 3340 O O   . HOH P 3 .   ? -7.276  -19.397 2.105   1.00 13.62 ? 468 HOH A O   1 
HETATM 3341 O O   . HOH P 3 .   ? 6.845   -45.093 18.894  1.00 6.40  ? 469 HOH A O   1 
HETATM 3342 O O   . HOH P 3 .   ? 0.084   -49.171 17.487  1.00 31.95 ? 470 HOH A O   1 
HETATM 3343 O O   . HOH P 3 .   ? 22.820  -39.067 13.986  1.00 21.03 ? 471 HOH A O   1 
HETATM 3344 O O   . HOH P 3 .   ? 28.734  -12.433 16.782  1.00 20.97 ? 472 HOH A O   1 
HETATM 3345 O O   . HOH P 3 .   ? 14.565  -35.972 33.260  1.00 24.44 ? 473 HOH A O   1 
HETATM 3346 O O   . HOH P 3 .   ? -8.865  -40.158 25.217  1.00 34.00 ? 474 HOH A O   1 
HETATM 3347 O O   . HOH P 3 .   ? -8.714  -41.413 17.782  1.00 46.93 ? 475 HOH A O   1 
HETATM 3348 O O   . HOH P 3 .   ? 1.430   -12.576 8.600   1.00 29.90 ? 476 HOH A O   1 
HETATM 3349 O O   . HOH P 3 .   ? 33.102  -21.347 20.430  1.00 39.16 ? 477 HOH A O   1 
HETATM 3350 O O   . HOH P 3 .   ? -7.748  -37.912 6.247   1.00 33.28 ? 478 HOH A O   1 
HETATM 3351 O O   . HOH P 3 .   ? -16.967 -29.381 15.862  1.00 7.42  ? 479 HOH A O   1 
HETATM 3352 O O   . HOH P 3 .   ? 10.270  -37.031 34.987  1.00 38.78 ? 480 HOH A O   1 
HETATM 3353 O O   . HOH P 3 .   ? -1.567  -50.013 8.098   1.00 49.32 ? 481 HOH A O   1 
HETATM 3354 O O   . HOH P 3 .   ? 10.498  -41.585 27.654  1.00 31.20 ? 482 HOH A O   1 
HETATM 3355 O O   . HOH P 3 .   ? 5.249   -44.025 31.570  1.00 56.17 ? 483 HOH A O   1 
HETATM 3356 O O   . HOH P 3 .   ? 27.928  -11.165 23.932  1.00 43.19 ? 484 HOH A O   1 
HETATM 3357 O O   . HOH P 3 .   ? -9.387  -16.138 21.729  1.00 29.83 ? 485 HOH A O   1 
HETATM 3358 O O   . HOH P 3 .   ? 29.772  -11.318 21.768  1.00 34.98 ? 486 HOH A O   1 
HETATM 3359 O O   . HOH P 3 .   ? -2.625  -49.005 28.395  1.00 21.81 ? 487 HOH A O   1 
HETATM 3360 O O   . HOH P 3 .   ? 21.591  -22.474 12.563  1.00 33.10 ? 488 HOH A O   1 
HETATM 3361 O O   . HOH P 3 .   ? 32.787  -12.563 26.787  1.00 15.30 ? 489 HOH A O   1 
HETATM 3362 O O   . HOH P 3 .   ? 26.725  -20.931 18.204  1.00 7.18  ? 490 HOH A O   1 
HETATM 3363 O O   . HOH P 3 .   ? 10.124  -27.380 10.411  1.00 27.08 ? 491 HOH A O   1 
HETATM 3364 O O   . HOH P 3 .   ? 1.533   -10.466 21.126  1.00 28.61 ? 492 HOH A O   1 
HETATM 3365 O O   . HOH P 3 .   ? 20.594  -21.285 24.208  1.00 36.61 ? 493 HOH A O   1 
HETATM 3366 O O   . HOH P 3 .   ? -0.148  -49.112 23.249  1.00 46.84 ? 494 HOH A O   1 
HETATM 3367 O O   . HOH P 3 .   ? 6.039   -26.645 38.445  1.00 25.88 ? 495 HOH A O   1 
HETATM 3368 O O   . HOH P 3 .   ? -6.186  -40.377 10.254  1.00 5.06  ? 496 HOH A O   1 
HETATM 3369 O O   . HOH P 3 .   ? -1.647  -51.361 21.772  1.00 42.69 ? 497 HOH A O   1 
HETATM 3370 O O   . HOH P 3 .   ? 33.559  -18.026 28.536  1.00 59.92 ? 498 HOH A O   1 
HETATM 3371 O O   . HOH P 3 .   ? -2.487  -12.559 27.551  1.00 30.43 ? 499 HOH A O   1 
HETATM 3372 O O   . HOH P 3 .   ? 33.305  -28.700 26.379  1.00 24.30 ? 500 HOH A O   1 
HETATM 3373 O O   . HOH P 3 .   ? -14.493 -27.702 6.886   1.00 31.88 ? 501 HOH A O   1 
HETATM 3374 O O   . HOH P 3 .   ? 29.699  -25.786 24.883  1.00 28.08 ? 502 HOH A O   1 
HETATM 3375 O O   . HOH P 3 .   ? 24.360  -34.591 37.479  1.00 32.72 ? 503 HOH A O   1 
HETATM 3376 O O   . HOH P 3 .   ? -12.220 -36.464 -1.728  1.00 24.40 ? 504 HOH A O   1 
HETATM 3377 O O   . HOH P 3 .   ? 29.853  -17.059 28.292  1.00 22.08 ? 505 HOH A O   1 
HETATM 3378 O O   . HOH P 3 .   ? 1.253   -50.340 6.917   1.00 34.70 ? 506 HOH A O   1 
HETATM 3379 O O   . HOH P 3 .   ? 5.842   -25.945 8.364   1.00 15.65 ? 507 HOH A O   1 
HETATM 3380 O O   . HOH P 3 .   ? 0.660   -22.397 32.913  1.00 43.50 ? 508 HOH A O   1 
HETATM 3381 O O   . HOH P 3 .   ? 23.849  -29.552 22.367  1.00 27.87 ? 509 HOH A O   1 
HETATM 3382 O O   . HOH P 3 .   ? -12.545 -32.443 17.021  1.00 31.60 ? 510 HOH A O   1 
HETATM 3383 O O   . HOH P 3 .   ? 16.260  -41.263 22.983  1.00 13.70 ? 511 HOH A O   1 
HETATM 3384 O O   . HOH P 3 .   ? -0.121  -47.567 28.694  1.00 65.47 ? 512 HOH A O   1 
HETATM 3385 O O   . HOH P 3 .   ? 22.833  -12.311 27.321  1.00 29.25 ? 513 HOH A O   1 
HETATM 3386 O O   . HOH P 3 .   ? 19.165  -28.185 40.842  1.00 48.82 ? 514 HOH A O   1 
HETATM 3387 O O   . HOH P 3 .   ? 18.715  -42.113 15.858  1.00 33.03 ? 515 HOH A O   1 
HETATM 3388 O O   . HOH P 3 .   ? 34.281  -10.828 23.622  1.00 34.00 ? 516 HOH A O   1 
HETATM 3389 O O   . HOH P 3 .   ? 22.715  -21.794 40.998  1.00 47.92 ? 517 HOH A O   1 
HETATM 3390 O O   . HOH P 3 .   ? -2.834  -34.551 27.354  1.00 25.75 ? 518 HOH A O   1 
HETATM 3391 O O   . HOH P 3 .   ? -1.149  -15.408 29.435  1.00 34.75 ? 519 HOH A O   1 
HETATM 3392 O O   . HOH P 3 .   ? 24.744  -17.096 28.128  1.00 39.52 ? 520 HOH A O   1 
HETATM 3393 O O   . HOH P 3 .   ? 4.169   -42.443 29.526  1.00 22.42 ? 521 HOH A O   1 
HETATM 3394 O O   . HOH P 3 .   ? 20.804  -23.317 40.289  1.00 36.67 ? 522 HOH A O   1 
HETATM 3395 O O   . HOH P 3 .   ? -7.401  -46.433 9.419   1.00 21.80 ? 523 HOH A O   1 
HETATM 3396 O O   . HOH P 3 .   ? 9.622   -29.477 5.573   1.00 39.47 ? 524 HOH A O   1 
HETATM 3397 O O   . HOH P 3 .   ? 1.459   -28.210 -1.907  1.00 22.76 ? 525 HOH A O   1 
HETATM 3398 O O   . HOH P 3 .   ? 4.039   -40.849 31.475  1.00 35.49 ? 526 HOH A O   1 
HETATM 3399 O O   . HOH P 3 .   ? 0.930   -14.692 28.047  1.00 22.34 ? 527 HOH A O   1 
HETATM 3400 O O   . HOH P 3 .   ? -12.117 -30.173 9.511   1.00 41.75 ? 528 HOH A O   1 
HETATM 3401 O O   . HOH P 3 .   ? -8.916  -46.077 20.680  1.00 13.65 ? 529 HOH A O   1 
HETATM 3402 O O   . HOH P 3 .   ? -7.749  -32.304 10.909  1.00 41.53 ? 530 HOH A O   1 
HETATM 3403 O O   . HOH P 3 .   ? 26.976  -35.609 35.332  1.00 35.54 ? 531 HOH A O   1 
HETATM 3404 O O   . HOH P 3 .   ? 16.254  -12.481 31.601  1.00 36.40 ? 532 HOH A O   1 
HETATM 3405 O O   . HOH P 3 .   ? 5.070   -29.867 9.844   1.00 30.43 ? 533 HOH A O   1 
HETATM 3406 O O   . HOH P 3 .   ? 23.438  -23.117 33.817  1.00 28.11 ? 534 HOH A O   1 
HETATM 3407 O O   . HOH P 3 .   ? 7.626   -49.479 28.663  1.00 11.63 ? 535 HOH A O   1 
HETATM 3408 O O   . HOH P 3 .   ? -12.343 -37.087 2.714   1.00 28.66 ? 536 HOH A O   1 
HETATM 3409 O O   . HOH P 3 .   ? 18.603  -44.838 15.428  1.00 13.14 ? 537 HOH A O   1 
HETATM 3410 O O   . HOH P 3 .   ? 24.932  -32.362 32.345  1.00 32.37 ? 538 HOH A O   1 
HETATM 3411 O O   . HOH P 3 .   ? 12.869  -36.418 6.362   1.00 26.15 ? 539 HOH A O   1 
HETATM 3412 O O   . HOH P 3 .   ? 35.805  -22.428 21.435  1.00 19.55 ? 540 HOH A O   1 
HETATM 3413 O O   . HOH P 3 .   ? 10.881  -11.278 31.698  1.00 22.67 ? 541 HOH A O   1 
HETATM 3414 O O   . HOH P 3 .   ? 13.731  -43.493 12.560  1.00 21.29 ? 542 HOH A O   1 
HETATM 3415 O O   . HOH P 3 .   ? 18.776  -38.855 18.356  1.00 35.41 ? 543 HOH A O   1 
HETATM 3416 O O   . HOH P 3 .   ? -10.777 -32.645 1.220   1.00 37.37 ? 544 HOH A O   1 
HETATM 3417 O O   . HOH P 3 .   ? -5.016  -33.400 -2.733  1.00 24.14 ? 545 HOH A O   1 
HETATM 3418 O O   . HOH P 3 .   ? 14.158  -31.621 42.929  1.00 34.81 ? 546 HOH A O   1 
HETATM 3419 O O   . HOH P 3 .   ? -11.234 -22.139 6.849   1.00 34.45 ? 547 HOH A O   1 
HETATM 3420 O O   . HOH P 3 .   ? -8.511  -38.461 18.484  1.00 28.21 ? 548 HOH A O   1 
HETATM 3421 O O   . HOH P 3 .   ? -9.546  -32.817 -4.137  1.00 26.04 ? 549 HOH A O   1 
HETATM 3422 O O   . HOH P 3 .   ? 20.698  -36.808 10.481  1.00 47.59 ? 550 HOH A O   1 
HETATM 3423 O O   . HOH P 3 .   ? -10.616 -39.164 9.170   1.00 34.42 ? 551 HOH A O   1 
HETATM 3424 O O   . HOH P 3 .   ? 19.511  -14.293 33.812  1.00 37.88 ? 552 HOH A O   1 
HETATM 3425 O O   . HOH P 3 .   ? 5.730   -48.254 23.135  1.00 20.57 ? 553 HOH A O   1 
HETATM 3426 O O   . HOH P 3 .   ? 22.750  -37.625 25.489  1.00 22.00 ? 554 HOH A O   1 
HETATM 3427 O O   . HOH P 3 .   ? -15.872 -17.270 13.100  1.00 25.01 ? 555 HOH A O   1 
HETATM 3428 O O   . HOH P 3 .   ? 20.822  -15.466 30.314  1.00 44.37 ? 556 HOH A O   1 
HETATM 3429 O O   . HOH P 3 .   ? -1.126  -41.767 4.497   1.00 24.71 ? 557 HOH A O   1 
HETATM 3430 O O   . HOH P 3 .   ? 2.930   -49.851 10.880  1.00 31.27 ? 558 HOH A O   1 
HETATM 3431 O O   . HOH P 3 .   ? -1.734  -34.227 -3.046  1.00 66.52 ? 559 HOH A O   1 
HETATM 3432 O O   . HOH P 3 .   ? 12.026  -14.057 33.009  1.00 38.63 ? 560 HOH A O   1 
HETATM 3433 O O   . HOH P 3 .   ? 35.329  -18.697 23.628  1.00 36.31 ? 561 HOH A O   1 
HETATM 3434 O O   . HOH P 3 .   ? 15.421  -42.940 11.049  1.00 34.94 ? 562 HOH A O   1 
HETATM 3435 O O   . HOH P 3 .   ? 33.322  -25.185 23.496  1.00 29.15 ? 563 HOH A O   1 
HETATM 3436 O O   . HOH P 3 .   ? 22.924  -29.253 37.045  1.00 31.76 ? 564 HOH A O   1 
HETATM 3437 O O   . HOH P 3 .   ? 34.568  -13.665 22.793  1.00 30.00 ? 565 HOH A O   1 
HETATM 3438 O O   . HOH P 3 .   ? 10.286  -34.689 31.036  1.00 9.41  ? 566 HOH A O   1 
HETATM 3439 O O   . HOH P 3 .   ? -4.364  -33.788 20.317  1.00 40.46 ? 567 HOH A O   1 
HETATM 3440 O O   . HOH P 3 .   ? 15.247  -41.976 16.664  1.00 25.45 ? 568 HOH A O   1 
HETATM 3441 O O   . HOH P 3 .   ? -5.027  -44.421 29.252  1.00 35.00 ? 569 HOH A O   1 
HETATM 3442 O O   . HOH P 3 .   ? 6.485   -30.736 4.903   1.00 33.57 ? 570 HOH A O   1 
HETATM 3443 O O   . HOH P 3 .   ? -13.849 -25.809 8.657   1.00 37.33 ? 571 HOH A O   1 
HETATM 3444 O O   . HOH P 3 .   ? 7.371   -50.508 19.033  1.00 42.03 ? 572 HOH A O   1 
HETATM 3445 O O   . HOH P 3 .   ? -4.840  -49.040 25.860  1.00 48.89 ? 573 HOH A O   1 
HETATM 3446 O O   . HOH P 3 .   ? 17.086  -36.480 40.922  1.00 8.13  ? 574 HOH A O   1 
HETATM 3447 O O   . HOH P 3 .   ? 15.888  -34.783 44.810  1.00 32.98 ? 575 HOH A O   1 
HETATM 3448 O O   . HOH P 3 .   ? 8.011   -24.531 11.903  1.00 43.98 ? 576 HOH A O   1 
HETATM 3449 O O   . HOH P 3 .   ? 24.730  -37.740 24.555  1.00 16.33 ? 577 HOH A O   1 
HETATM 3450 O O   . HOH P 3 .   ? -4.249  -8.600  27.299  1.00 42.56 ? 578 HOH A O   1 
HETATM 3451 O O   . HOH P 3 .   ? -12.513 -35.889 8.485   1.00 30.22 ? 579 HOH A O   1 
HETATM 3452 O O   . HOH P 3 .   ? 15.447  -43.613 27.178  1.00 19.18 ? 580 HOH A O   1 
HETATM 3453 O O   . HOH P 3 .   ? 22.485  -39.086 20.559  1.00 19.33 ? 581 HOH A O   1 
HETATM 3454 O O   . HOH P 3 .   ? 8.621   -49.083 23.393  1.00 48.53 ? 582 HOH A O   1 
HETATM 3455 O O   . HOH P 3 .   ? -10.182 -23.041 4.310   1.00 16.63 ? 583 HOH A O   1 
HETATM 3456 O O   . HOH P 3 .   ? -6.607  -44.796 26.808  1.00 27.50 ? 584 HOH A O   1 
HETATM 3457 O O   . HOH P 3 .   ? -11.013 -30.647 -0.984  1.00 35.67 ? 585 HOH A O   1 
HETATM 3458 O O   . HOH P 3 .   ? 26.600  -29.453 23.993  1.00 33.24 ? 586 HOH A O   1 
HETATM 3459 O O   . HOH P 3 .   ? -6.678  -33.384 1.605   1.00 34.67 ? 587 HOH A O   1 
HETATM 3460 O O   . HOH P 3 .   ? 17.665  -32.136 26.538  1.00 44.77 ? 588 HOH A O   1 
HETATM 3461 O O   . HOH P 3 .   ? 28.210  -6.211  21.747  1.00 29.06 ? 589 HOH A O   1 
HETATM 3462 O O   . HOH P 3 .   ? 28.208  -9.292  20.414  1.00 36.39 ? 590 HOH A O   1 
HETATM 3463 O O   . HOH P 3 .   ? 25.260  -9.775  20.937  1.00 59.74 ? 591 HOH A O   1 
HETATM 3464 O O   . HOH P 3 .   ? 28.536  -5.125  25.937  1.00 22.81 ? 592 HOH A O   1 
HETATM 3465 O O   . HOH P 3 .   ? 41.311  -20.255 16.750  1.00 15.41 ? 593 HOH A O   1 
HETATM 3466 O O   . HOH P 3 .   ? -7.709  -41.074 -4.469  1.00 58.62 ? 594 HOH A O   1 
HETATM 3467 O O   . HOH P 3 .   ? -2.783  -36.850 -5.349  1.00 33.89 ? 595 HOH A O   1 
HETATM 3468 O O   . HOH P 3 .   ? -9.051  -39.646 1.205   1.00 25.07 ? 596 HOH A O   1 
HETATM 3469 O O   . HOH P 3 .   ? -4.946  -35.518 -7.721  1.00 18.27 ? 597 HOH A O   1 
HETATM 3470 O O   . HOH P 3 .   ? 26.320  -33.123 20.367  1.00 41.77 ? 598 HOH A O   1 
HETATM 3471 O O   . HOH P 3 .   ? -9.887  -43.638 -1.255  1.00 26.98 ? 599 HOH A O   1 
HETATM 3472 O O   . HOH P 3 .   ? 42.525  -16.122 15.180  1.00 48.77 ? 600 HOH A O   1 
HETATM 3473 O O   . HOH P 3 .   ? 40.705  -17.075 19.388  1.00 43.76 ? 601 HOH A O   1 
HETATM 3474 O O   . HOH P 3 .   ? 29.819  -34.308 19.283  1.00 46.56 ? 602 HOH A O   1 
HETATM 3475 O O   . HOH P 3 .   ? 5.747   -19.012 0.652   1.00 14.50 ? 603 HOH A O   1 
HETATM 3476 O O   . HOH P 3 .   ? 38.199  -20.710 18.495  1.00 41.67 ? 604 HOH A O   1 
HETATM 3477 O O   . HOH P 3 .   ? 6.483   -27.010 -5.104  1.00 47.49 ? 605 HOH A O   1 
HETATM 3478 O O   . HOH P 3 .   ? 6.729   -30.695 -8.432  1.00 25.14 ? 606 HOH A O   1 
HETATM 3479 O O   . HOH P 3 .   ? 20.238  -23.835 45.252  1.00 14.46 ? 607 HOH A O   1 
HETATM 3480 O O   . HOH P 3 .   ? -5.930  -21.925 0.258   1.00 49.62 ? 608 HOH A O   1 
HETATM 3481 O O   . HOH P 3 .   ? 4.665   -55.400 15.579  1.00 57.00 ? 609 HOH A O   1 
HETATM 3482 O O   . HOH P 3 .   ? -17.981 -29.820 21.045  1.00 8.49  ? 610 HOH A O   1 
HETATM 3483 O O   . HOH P 3 .   ? -16.410 -28.255 19.892  1.00 29.80 ? 611 HOH A O   1 
HETATM 3484 O O   . HOH P 3 .   ? 21.307  -46.086 17.517  1.00 28.80 ? 612 HOH A O   1 
HETATM 3485 O O   . HOH P 3 .   ? 13.169  -40.101 40.418  1.00 30.27 ? 613 HOH A O   1 
HETATM 3486 O O   . HOH Q 3 .   ? 13.689  -11.357 -12.054 1.00 32.54 ? 401 HOH B O   1 
HETATM 3487 O O   . HOH Q 3 .   ? 32.716  6.365   -4.804  1.00 28.66 ? 402 HOH B O   1 
HETATM 3488 O O   . HOH Q 3 .   ? 27.636  -1.693  -7.860  1.00 12.08 ? 403 HOH B O   1 
HETATM 3489 O O   . HOH Q 3 .   ? 12.313  25.935  -3.136  1.00 34.78 ? 404 HOH B O   1 
HETATM 3490 O O   . HOH Q 3 .   ? 29.059  2.663   -0.516  1.00 34.63 ? 405 HOH B O   1 
HETATM 3491 O O   . HOH Q 3 .   ? 3.658   9.932   14.195  1.00 40.96 ? 406 HOH B O   1 
HETATM 3492 O O   . HOH Q 3 .   ? 5.445   -11.037 12.429  1.00 11.47 ? 407 HOH B O   1 
HETATM 3493 O O   . HOH Q 3 .   ? 15.949  -11.291 13.871  1.00 32.98 ? 408 HOH B O   1 
HETATM 3494 O O   . HOH Q 3 .   ? 5.279   -0.682  -9.076  1.00 42.94 ? 409 HOH B O   1 
HETATM 3495 O O   . HOH Q 3 .   ? -0.191  -7.582  -0.485  1.00 41.74 ? 410 HOH B O   1 
HETATM 3496 O O   . HOH Q 3 .   ? 28.061  -4.945  15.803  1.00 36.56 ? 411 HOH B O   1 
HETATM 3497 O O   . HOH Q 3 .   ? 17.011  0.861   7.712   1.00 21.32 ? 412 HOH B O   1 
HETATM 3498 O O   . HOH Q 3 .   ? 24.905  16.874  -2.066  1.00 31.26 ? 413 HOH B O   1 
HETATM 3499 O O   . HOH Q 3 .   ? 20.572  -10.528 9.668   1.00 37.21 ? 414 HOH B O   1 
HETATM 3500 O O   . HOH Q 3 .   ? 6.884   22.529  -2.034  1.00 18.38 ? 415 HOH B O   1 
HETATM 3501 O O   . HOH Q 3 .   ? 23.275  8.829   5.100   1.00 31.55 ? 416 HOH B O   1 
HETATM 3502 O O   . HOH Q 3 .   ? 3.246   2.559   15.987  1.00 34.21 ? 417 HOH B O   1 
HETATM 3503 O O   . HOH Q 3 .   ? 22.538  18.878  9.735   1.00 28.48 ? 418 HOH B O   1 
HETATM 3504 O O   . HOH Q 3 .   ? 26.387  -15.574 5.905   1.00 15.83 ? 419 HOH B O   1 
HETATM 3505 O O   . HOH Q 3 .   ? 26.555  9.695   1.805   1.00 27.85 ? 420 HOH B O   1 
HETATM 3506 O O   . HOH Q 3 .   ? 11.390  0.101   -15.931 1.00 11.59 ? 421 HOH B O   1 
HETATM 3507 O O   . HOH Q 3 .   ? 31.653  5.394   23.150  1.00 20.90 ? 422 HOH B O   1 
HETATM 3508 O O   . HOH Q 3 .   ? 16.174  21.194  2.989   1.00 14.76 ? 423 HOH B O   1 
HETATM 3509 O O   . HOH Q 3 .   ? 35.047  9.949   17.799  1.00 15.87 ? 424 HOH B O   1 
HETATM 3510 O O   . HOH Q 3 .   ? 35.142  0.147   14.887  1.00 26.49 ? 425 HOH B O   1 
HETATM 3511 O O   . HOH Q 3 .   ? 6.953   -1.290  -12.787 1.00 21.74 ? 426 HOH B O   1 
HETATM 3512 O O   . HOH Q 3 .   ? 4.259   4.186   25.591  1.00 40.43 ? 427 HOH B O   1 
HETATM 3513 O O   . HOH Q 3 .   ? 35.696  -4.810  23.393  1.00 17.12 ? 428 HOH B O   1 
HETATM 3514 O O   . HOH Q 3 .   ? 25.895  -3.593  -7.829  1.00 48.20 ? 429 HOH B O   1 
HETATM 3515 O O   . HOH Q 3 .   ? 19.253  23.839  -12.879 1.00 20.91 ? 430 HOH B O   1 
HETATM 3516 O O   . HOH Q 3 .   ? 13.683  -8.240  27.768  1.00 34.45 ? 431 HOH B O   1 
HETATM 3517 O O   . HOH Q 3 .   ? 5.028   2.490   -8.785  1.00 43.06 ? 432 HOH B O   1 
HETATM 3518 O O   . HOH Q 3 .   ? 22.714  19.631  19.645  1.00 29.63 ? 433 HOH B O   1 
HETATM 3519 O O   . HOH Q 3 .   ? 12.452  6.522   24.469  1.00 26.11 ? 434 HOH B O   1 
HETATM 3520 O O   . HOH Q 3 .   ? 12.436  8.356   -15.967 1.00 14.86 ? 435 HOH B O   1 
HETATM 3521 O O   . HOH Q 3 .   ? 31.890  -4.404  8.588   1.00 34.25 ? 436 HOH B O   1 
HETATM 3522 O O   . HOH Q 3 .   ? 20.007  21.804  16.814  1.00 21.84 ? 437 HOH B O   1 
HETATM 3523 O O   . HOH Q 3 .   ? 9.303   13.639  -18.122 1.00 32.15 ? 438 HOH B O   1 
HETATM 3524 O O   . HOH Q 3 .   ? 23.902  10.424  28.228  1.00 18.16 ? 439 HOH B O   1 
HETATM 3525 O O   . HOH Q 3 .   ? 27.125  3.499   28.212  1.00 22.20 ? 440 HOH B O   1 
HETATM 3526 O O   . HOH Q 3 .   ? 2.685   12.123  6.051   1.00 2.06  ? 441 HOH B O   1 
HETATM 3527 O O   . HOH Q 3 .   ? 18.243  -9.855  -9.209  1.00 30.79 ? 442 HOH B O   1 
HETATM 3528 O O   . HOH Q 3 .   ? 30.683  -8.949  9.586   1.00 33.39 ? 443 HOH B O   1 
HETATM 3529 O O   . HOH Q 3 .   ? 22.893  9.507   -8.033  1.00 36.82 ? 444 HOH B O   1 
HETATM 3530 O O   . HOH Q 3 .   ? 5.742   11.657  24.894  1.00 28.11 ? 445 HOH B O   1 
HETATM 3531 O O   . HOH Q 3 .   ? 33.815  4.956   1.457   1.00 29.30 ? 446 HOH B O   1 
HETATM 3532 O O   . HOH Q 3 .   ? 26.138  23.192  -6.254  1.00 31.82 ? 447 HOH B O   1 
HETATM 3533 O O   . HOH Q 3 .   ? 35.608  -5.996  5.928   1.00 34.54 ? 448 HOH B O   1 
HETATM 3534 O O   . HOH Q 3 .   ? 30.236  16.418  5.677   1.00 27.88 ? 449 HOH B O   1 
HETATM 3535 O O   . HOH Q 3 .   ? 10.230  24.088  -9.153  1.00 41.93 ? 450 HOH B O   1 
HETATM 3536 O O   . HOH Q 3 .   ? -1.688  -2.454  -12.551 1.00 32.40 ? 451 HOH B O   1 
HETATM 3537 O O   . HOH Q 3 .   ? 0.881   17.534  -0.590  1.00 75.29 ? 452 HOH B O   1 
HETATM 3538 O O   . HOH Q 3 .   ? 10.400  17.723  -17.465 1.00 36.60 ? 453 HOH B O   1 
HETATM 3539 O O   . HOH Q 3 .   ? 12.467  -0.465  -0.906  1.00 16.49 ? 454 HOH B O   1 
HETATM 3540 O O   . HOH Q 3 .   ? 27.270  5.520   1.070   1.00 22.84 ? 455 HOH B O   1 
HETATM 3541 O O   . HOH Q 3 .   ? 30.120  6.036   26.628  1.00 24.62 ? 456 HOH B O   1 
HETATM 3542 O O   . HOH Q 3 .   ? 0.644   -6.651  -10.996 1.00 46.32 ? 457 HOH B O   1 
HETATM 3543 O O   . HOH Q 3 .   ? 3.722   -8.465  8.538   1.00 20.90 ? 458 HOH B O   1 
HETATM 3544 O O   . HOH Q 3 .   ? 30.725  17.219  17.525  1.00 40.37 ? 459 HOH B O   1 
HETATM 3545 O O   . HOH Q 3 .   ? 30.543  5.530   11.265  1.00 12.08 ? 460 HOH B O   1 
HETATM 3546 O O   . HOH Q 3 .   ? 25.509  7.312   -7.846  1.00 11.94 ? 461 HOH B O   1 
HETATM 3547 O O   . HOH Q 3 .   ? 4.808   21.959  -10.299 1.00 32.95 ? 462 HOH B O   1 
HETATM 3548 O O   . HOH Q 3 .   ? 32.275  4.662   16.983  1.00 26.13 ? 463 HOH B O   1 
HETATM 3549 O O   . HOH Q 3 .   ? 23.414  15.358  -5.320  1.00 37.52 ? 464 HOH B O   1 
HETATM 3550 O O   . HOH Q 3 .   ? 32.744  -1.341  9.291   1.00 23.90 ? 465 HOH B O   1 
HETATM 3551 O O   . HOH Q 3 .   ? 20.866  -17.131 -1.642  1.00 40.94 ? 466 HOH B O   1 
HETATM 3552 O O   . HOH Q 3 .   ? 28.787  20.349  -0.494  1.00 36.03 ? 467 HOH B O   1 
HETATM 3553 O O   . HOH Q 3 .   ? -2.700  15.366  -8.623  1.00 37.63 ? 468 HOH B O   1 
HETATM 3554 O O   . HOH Q 3 .   ? 29.628  -0.164  -0.485  1.00 34.40 ? 469 HOH B O   1 
HETATM 3555 O O   . HOH Q 3 .   ? 27.394  -13.605 10.488  1.00 18.85 ? 470 HOH B O   1 
HETATM 3556 O O   . HOH Q 3 .   ? 35.521  -8.815  12.599  1.00 42.69 ? 471 HOH B O   1 
HETATM 3557 O O   . HOH Q 3 .   ? 20.221  16.496  8.763   1.00 11.79 ? 472 HOH B O   1 
HETATM 3558 O O   . HOH Q 3 .   ? 15.778  -15.400 3.131   1.00 41.54 ? 473 HOH B O   1 
HETATM 3559 O O   . HOH Q 3 .   ? 29.882  -1.615  -5.851  1.00 24.58 ? 474 HOH B O   1 
HETATM 3560 O O   . HOH Q 3 .   ? 22.946  19.736  -6.239  1.00 34.29 ? 475 HOH B O   1 
HETATM 3561 O O   . HOH Q 3 .   ? 13.839  0.859   20.453  1.00 29.46 ? 476 HOH B O   1 
HETATM 3562 O O   . HOH Q 3 .   ? 5.766   10.375  11.455  1.00 27.95 ? 477 HOH B O   1 
HETATM 3563 O O   . HOH Q 3 .   ? 36.479  -5.258  15.841  1.00 39.25 ? 478 HOH B O   1 
HETATM 3564 O O   . HOH Q 3 .   ? 3.520   16.618  -15.052 1.00 20.17 ? 479 HOH B O   1 
HETATM 3565 O O   . HOH Q 3 .   ? 0.300   -3.800  23.057  1.00 34.93 ? 480 HOH B O   1 
HETATM 3566 O O   . HOH Q 3 .   ? 12.503  14.713  8.094   1.00 25.67 ? 481 HOH B O   1 
HETATM 3567 O O   . HOH Q 3 .   ? 1.099   -1.650  -5.650  1.00 47.58 ? 482 HOH B O   1 
HETATM 3568 O O   . HOH Q 3 .   ? 16.161  22.912  -2.210  1.00 29.60 ? 483 HOH B O   1 
HETATM 3569 O O   . HOH Q 3 .   ? 31.035  -5.311  20.257  1.00 26.30 ? 484 HOH B O   1 
HETATM 3570 O O   . HOH Q 3 .   ? 31.444  9.637   19.696  1.00 24.46 ? 485 HOH B O   1 
HETATM 3571 O O   . HOH Q 3 .   ? 3.621   5.831   -11.673 1.00 26.79 ? 486 HOH B O   1 
HETATM 3572 O O   . HOH Q 3 .   ? 16.242  23.223  23.978  1.00 39.89 ? 487 HOH B O   1 
HETATM 3573 O O   . HOH Q 3 .   ? 14.194  -8.306  -14.775 1.00 38.46 ? 488 HOH B O   1 
HETATM 3574 O O   . HOH Q 3 .   ? 24.595  14.004  22.235  1.00 60.25 ? 489 HOH B O   1 
HETATM 3575 O O   . HOH Q 3 .   ? 7.833   14.608  26.019  1.00 33.49 ? 490 HOH B O   1 
HETATM 3576 O O   . HOH Q 3 .   ? 21.458  20.580  -15.557 1.00 35.29 ? 491 HOH B O   1 
HETATM 3577 O O   . HOH Q 3 .   ? 10.516  3.388   29.726  1.00 51.25 ? 492 HOH B O   1 
HETATM 3578 O O   . HOH Q 3 .   ? 2.927   -1.932  -10.668 1.00 23.98 ? 493 HOH B O   1 
HETATM 3579 O O   . HOH Q 3 .   ? 26.879  13.183  0.117   1.00 41.05 ? 494 HOH B O   1 
HETATM 3580 O O   . HOH Q 3 .   ? 20.864  23.543  2.481   1.00 54.13 ? 495 HOH B O   1 
HETATM 3581 O O   . HOH Q 3 .   ? 20.458  22.549  7.968   1.00 22.63 ? 496 HOH B O   1 
HETATM 3582 O O   . HOH Q 3 .   ? 33.202  9.139   13.250  1.00 23.69 ? 497 HOH B O   1 
HETATM 3583 O O   . HOH Q 3 .   ? 24.976  4.490   23.350  1.00 55.16 ? 498 HOH B O   1 
HETATM 3584 O O   . HOH Q 3 .   ? 34.030  -0.427  27.538  1.00 36.51 ? 499 HOH B O   1 
HETATM 3585 O O   . HOH Q 3 .   ? 0.832   1.063   16.116  1.00 23.58 ? 500 HOH B O   1 
HETATM 3586 O O   . HOH Q 3 .   ? 27.650  13.783  20.702  1.00 61.76 ? 501 HOH B O   1 
HETATM 3587 O O   . HOH Q 3 .   ? 23.066  5.719   25.412  1.00 21.40 ? 502 HOH B O   1 
HETATM 3588 O O   . HOH Q 3 .   ? 37.842  5.505   17.696  1.00 34.05 ? 503 HOH B O   1 
HETATM 3589 O O   . HOH Q 3 .   ? 27.893  -8.360  8.585   1.00 31.55 ? 504 HOH B O   1 
HETATM 3590 O O   . HOH Q 3 .   ? 27.561  -10.130 1.902   1.00 50.22 ? 505 HOH B O   1 
HETATM 3591 O O   . HOH Q 3 .   ? 9.987   16.798  -12.380 1.00 33.88 ? 506 HOH B O   1 
HETATM 3592 O O   . HOH Q 3 .   ? -0.716  9.516   -5.435  1.00 32.19 ? 507 HOH B O   1 
HETATM 3593 O O   . HOH Q 3 .   ? -1.315  9.649   4.526   1.00 33.87 ? 508 HOH B O   1 
HETATM 3594 O O   . HOH Q 3 .   ? 10.774  17.036  -7.891  1.00 27.46 ? 509 HOH B O   1 
HETATM 3595 O O   . HOH Q 3 .   ? 20.151  10.554  25.356  1.00 32.71 ? 510 HOH B O   1 
HETATM 3596 O O   . HOH Q 3 .   ? 28.837  -5.461  -2.179  1.00 50.74 ? 511 HOH B O   1 
HETATM 3597 O O   . HOH Q 3 .   ? 8.625   -2.651  -5.231  1.00 41.50 ? 512 HOH B O   1 
HETATM 3598 O O   . HOH Q 3 .   ? 32.229  12.734  13.697  1.00 32.40 ? 513 HOH B O   1 
HETATM 3599 O O   . HOH Q 3 .   ? 22.323  3.709   26.536  1.00 21.43 ? 514 HOH B O   1 
HETATM 3600 O O   . HOH Q 3 .   ? -1.236  -4.002  -10.638 1.00 24.04 ? 515 HOH B O   1 
HETATM 3601 O O   . HOH Q 3 .   ? 31.911  0.291   1.891   1.00 29.05 ? 516 HOH B O   1 
HETATM 3602 O O   . HOH Q 3 .   ? 3.545   13.141  -14.946 1.00 19.36 ? 517 HOH B O   1 
HETATM 3603 O O   . HOH Q 3 .   ? 3.848   10.018  -16.417 1.00 26.57 ? 518 HOH B O   1 
HETATM 3604 O O   . HOH Q 3 .   ? 26.520  16.345  2.732   1.00 14.32 ? 519 HOH B O   1 
HETATM 3605 O O   . HOH Q 3 .   ? -1.004  13.905  -13.270 1.00 15.97 ? 520 HOH B O   1 
HETATM 3606 O O   . HOH Q 3 .   ? 4.490   23.985  -3.515  1.00 30.62 ? 521 HOH B O   1 
HETATM 3607 O O   . HOH Q 3 .   ? 15.679  15.050  -14.833 1.00 15.24 ? 522 HOH B O   1 
HETATM 3608 O O   . HOH Q 3 .   ? 8.304   -2.205  -16.443 1.00 16.10 ? 523 HOH B O   1 
HETATM 3609 O O   . HOH Q 3 .   ? 31.951  -0.007  22.390  1.00 44.61 ? 524 HOH B O   1 
HETATM 3610 O O   . HOH Q 3 .   ? 19.042  8.436   -11.542 1.00 10.56 ? 525 HOH B O   1 
HETATM 3611 O O   . HOH Q 3 .   ? 2.906   -7.155  23.471  1.00 32.32 ? 526 HOH B O   1 
HETATM 3612 O O   . HOH Q 3 .   ? 5.853   -2.299  -20.056 1.00 17.71 ? 527 HOH B O   1 
HETATM 3613 O O   . HOH Q 3 .   ? 13.945  14.725  -10.360 1.00 20.50 ? 528 HOH B O   1 
HETATM 3614 O O   . HOH Q 3 .   ? 25.538  -9.526  10.096  1.00 18.02 ? 529 HOH B O   1 
HETATM 3615 O O   . HOH Q 3 .   ? 6.816   4.559   -4.193  1.00 27.60 ? 530 HOH B O   1 
HETATM 3616 O O   . HOH Q 3 .   ? 30.002  -1.082  13.266  1.00 27.31 ? 531 HOH B O   1 
HETATM 3617 O O   . HOH Q 3 .   ? 23.282  4.882   -1.710  1.00 22.37 ? 532 HOH B O   1 
HETATM 3618 O O   . HOH Q 3 .   ? 3.781   -6.908  -15.032 1.00 22.40 ? 533 HOH B O   1 
HETATM 3619 O O   . HOH Q 3 .   ? 27.279  23.737  2.014   1.00 34.22 ? 534 HOH B O   1 
HETATM 3620 O O   . HOH Q 3 .   ? 7.506   0.622   -4.222  1.00 23.83 ? 535 HOH B O   1 
HETATM 3621 O O   . HOH Q 3 .   ? 25.021  19.886  -11.596 1.00 32.80 ? 536 HOH B O   1 
HETATM 3622 O O   . HOH Q 3 .   ? 23.097  20.058  -3.396  1.00 25.74 ? 537 HOH B O   1 
HETATM 3623 O O   . HOH Q 3 .   ? 21.585  20.029  15.233  1.00 19.94 ? 538 HOH B O   1 
HETATM 3624 O O   . HOH Q 3 .   ? 19.967  21.437  -4.292  1.00 42.37 ? 539 HOH B O   1 
HETATM 3625 O O   . HOH Q 3 .   ? 33.394  -4.866  18.847  1.00 27.77 ? 540 HOH B O   1 
HETATM 3626 O O   . HOH Q 3 .   ? 36.220  0.244   19.726  1.00 33.14 ? 541 HOH B O   1 
HETATM 3627 O O   . HOH Q 3 .   ? 27.228  -6.619  28.273  1.00 43.37 ? 542 HOH B O   1 
HETATM 3628 O O   . HOH Q 3 .   ? 26.258  7.488   -2.957  1.00 21.93 ? 543 HOH B O   1 
HETATM 3629 O O   . HOH Q 3 .   ? 21.677  9.275   -5.021  1.00 28.23 ? 544 HOH B O   1 
HETATM 3630 O O   . HOH Q 3 .   ? 32.867  10.681  7.875   1.00 33.07 ? 545 HOH B O   1 
HETATM 3631 O O   . HOH Q 3 .   ? 3.571   -4.136  -13.526 1.00 48.15 ? 546 HOH B O   1 
HETATM 3632 O O   . HOH Q 3 .   ? 4.227   5.955   20.450  1.00 9.14  ? 547 HOH B O   1 
HETATM 3633 O O   . HOH Q 3 .   ? 16.535  -17.466 1.622   1.00 34.09 ? 548 HOH B O   1 
HETATM 3634 O O   . HOH Q 3 .   ? 2.178   6.666   18.827  1.00 23.18 ? 549 HOH B O   1 
HETATM 3635 O O   . HOH Q 3 .   ? 36.743  -11.659 10.137  1.00 18.77 ? 550 HOH B O   1 
HETATM 3636 O O   . HOH Q 3 .   ? 27.816  9.059   7.840   1.00 24.96 ? 551 HOH B O   1 
HETATM 3637 O O   . HOH Q 3 .   ? 0.227   -7.064  -16.186 1.00 22.77 ? 552 HOH B O   1 
HETATM 3638 O O   . HOH Q 3 .   ? 28.355  -2.111  11.464  1.00 40.55 ? 553 HOH B O   1 
HETATM 3639 O O   . HOH Q 3 .   ? 33.673  -4.763  24.613  1.00 22.84 ? 554 HOH B O   1 
HETATM 3640 O O   . HOH Q 3 .   ? 12.709  17.441  -5.192  1.00 11.22 ? 555 HOH B O   1 
HETATM 3641 O O   . HOH Q 3 .   ? 9.114   16.386  -9.845  1.00 20.17 ? 556 HOH B O   1 
HETATM 3642 O O   . HOH Q 3 .   ? 34.766  -1.659  11.252  1.00 15.50 ? 557 HOH B O   1 
HETATM 3643 O O   . HOH Q 3 .   ? 34.092  6.865   12.441  1.00 42.33 ? 558 HOH B O   1 
HETATM 3644 O O   . HOH Q 3 .   ? 5.786   17.592  -15.291 1.00 32.62 ? 559 HOH B O   1 
HETATM 3645 O O   . HOH Q 3 .   ? -0.822  -0.059  -13.582 0.50 2.00  ? 560 HOH B O   1 
HETATM 3646 O O   . HOH Q 3 .   ? 30.087  16.945  14.414  1.00 58.65 ? 561 HOH B O   1 
HETATM 3647 O O   . HOH Q 3 .   ? 7.885   3.266   -14.184 1.00 4.97  ? 562 HOH B O   1 
HETATM 3648 O O   . HOH Q 3 .   ? 28.072  3.701   22.889  1.00 38.22 ? 563 HOH B O   1 
HETATM 3649 O O   . HOH Q 3 .   ? 33.055  3.075   21.878  1.00 14.63 ? 564 HOH B O   1 
HETATM 3650 O O   . HOH Q 3 .   ? 8.051   0.863   -19.091 1.00 26.25 ? 565 HOH B O   1 
HETATM 3651 O O   . HOH Q 3 .   ? 34.272  3.056   9.309   1.00 13.92 ? 566 HOH B O   1 
HETATM 3652 O O   . HOH Q 3 .   ? 8.262   -1.788  -0.086  1.00 14.49 ? 567 HOH B O   1 
HETATM 3653 O O   . HOH Q 3 .   ? 16.403  22.289  -8.084  1.00 29.21 ? 568 HOH B O   1 
HETATM 3654 O O   . HOH Q 3 .   ? 31.683  1.690   26.981  1.00 22.39 ? 569 HOH B O   1 
HETATM 3655 O O   . HOH Q 3 .   ? 25.430  23.326  6.211   1.00 35.08 ? 570 HOH B O   1 
HETATM 3656 O O   . HOH Q 3 .   ? 31.181  15.734  2.187   1.00 32.75 ? 571 HOH B O   1 
HETATM 3657 O O   . HOH Q 3 .   ? 2.776   7.003   -6.962  1.00 45.48 ? 572 HOH B O   1 
HETATM 3658 O O   . HOH Q 3 .   ? 24.403  0.944   22.647  1.00 53.71 ? 573 HOH B O   1 
HETATM 3659 O O   . HOH Q 3 .   ? 20.843  23.030  -1.024  1.00 31.32 ? 574 HOH B O   1 
HETATM 3660 O O   . HOH Q 3 .   ? 31.755  -9.629  4.676   1.00 13.98 ? 575 HOH B O   1 
HETATM 3661 O O   . HOH Q 3 .   ? 30.493  20.103  2.606   1.00 23.99 ? 576 HOH B O   1 
HETATM 3662 O O   . HOH Q 3 .   ? 6.003   20.963  -8.336  1.00 27.09 ? 577 HOH B O   1 
HETATM 3663 O O   . HOH Q 3 .   ? 27.158  7.527   -0.349  1.00 26.17 ? 578 HOH B O   1 
HETATM 3664 O O   . HOH Q 3 .   ? 6.612   13.820  -18.346 1.00 23.20 ? 579 HOH B O   1 
HETATM 3665 O O   . HOH Q 3 .   ? 8.827   24.491  -0.875  1.00 36.65 ? 580 HOH B O   1 
HETATM 3666 O O   . HOH Q 3 .   ? 12.632  18.978  2.186   1.00 41.78 ? 581 HOH B O   1 
HETATM 3667 O O   . HOH Q 3 .   ? 12.612  12.127  19.497  1.00 26.89 ? 582 HOH B O   1 
HETATM 3668 O O   . HOH Q 3 .   ? 29.599  2.815   -3.387  1.00 25.06 ? 583 HOH B O   1 
HETATM 3669 O O   . HOH Q 3 .   ? 31.719  8.579   15.354  1.00 24.79 ? 584 HOH B O   1 
HETATM 3670 O O   . HOH Q 3 .   ? 7.209   -16.931 -2.082  1.00 15.83 ? 585 HOH B O   1 
HETATM 3671 O O   . HOH Q 3 .   ? 10.629  -14.646 -8.448  1.00 27.20 ? 586 HOH B O   1 
HETATM 3672 O O   . HOH Q 3 .   ? 38.161  -10.001 15.371  1.00 52.42 ? 587 HOH B O   1 
HETATM 3673 O O   . HOH Q 3 .   ? 16.618  -13.244 -13.101 1.00 19.67 ? 588 HOH B O   1 
HETATM 3674 O O   . HOH Q 3 .   ? 7.618   25.607  -9.356  1.00 30.38 ? 589 HOH B O   1 
HETATM 3675 O O   . HOH R 3 .   ? 41.881  -30.015 16.988  1.00 13.22 ? 401 HOH C O   1 
HETATM 3676 O O   . HOH R 3 .   ? 41.171  -7.910  -10.630 1.00 39.15 ? 402 HOH C O   1 
HETATM 3677 O O   . HOH R 3 .   ? 43.902  -29.783 13.884  1.00 24.18 ? 403 HOH C O   1 
HETATM 3678 O O   . HOH R 3 .   ? 15.051  -28.174 -25.740 1.00 22.02 ? 404 HOH C O   1 
HETATM 3679 O O   . HOH R 3 .   ? 31.068  -26.225 22.290  1.00 29.13 ? 405 HOH C O   1 
HETATM 3680 O O   . HOH R 3 .   ? 25.310  -24.011 15.291  1.00 21.52 ? 406 HOH C O   1 
HETATM 3681 O O   . HOH R 3 .   ? 30.696  -30.408 22.530  1.00 12.93 ? 407 HOH C O   1 
HETATM 3682 O O   . HOH R 3 .   ? 34.733  -27.349 17.099  1.00 45.81 ? 408 HOH C O   1 
HETATM 3683 O O   . HOH R 3 .   ? -0.173  -23.697 -3.619  1.00 23.93 ? 409 HOH C O   1 
HETATM 3684 O O   . HOH R 3 .   ? 30.633  -18.846 16.322  1.00 19.97 ? 410 HOH C O   1 
HETATM 3685 O O   . HOH R 3 .   ? 30.769  -23.212 20.523  1.00 34.34 ? 411 HOH C O   1 
HETATM 3686 O O   . HOH R 3 .   ? 20.284  -17.082 4.627   1.00 41.74 ? 412 HOH C O   1 
HETATM 3687 O O   . HOH R 3 .   ? 18.034  -17.283 -5.375  1.00 44.10 ? 413 HOH C O   1 
HETATM 3688 O O   . HOH R 3 .   ? 12.333  -13.085 -14.481 1.00 32.64 ? 414 HOH C O   1 
HETATM 3689 O O   . HOH R 3 .   ? 16.822  -14.566 -6.517  1.00 33.84 ? 415 HOH C O   1 
HETATM 3690 O O   . HOH R 3 .   ? 34.079  -13.744 2.551   1.00 38.98 ? 416 HOH C O   1 
HETATM 3691 O O   . HOH R 3 .   ? 3.257   -39.822 4.788   1.00 36.73 ? 417 HOH C O   1 
HETATM 3692 O O   . HOH R 3 .   ? 28.963  -24.057 11.916  1.00 16.82 ? 418 HOH C O   1 
HETATM 3693 O O   . HOH R 3 .   ? 16.526  -35.995 -6.024  1.00 42.97 ? 419 HOH C O   1 
HETATM 3694 O O   . HOH R 3 .   ? 36.724  -8.775  -1.331  1.00 7.69  ? 420 HOH C O   1 
HETATM 3695 O O   . HOH R 3 .   ? 23.224  -17.355 -15.128 1.00 6.58  ? 421 HOH C O   1 
HETATM 3696 O O   . HOH R 3 .   ? 1.968   -39.902 -5.189  1.00 36.28 ? 422 HOH C O   1 
HETATM 3697 O O   . HOH R 3 .   ? 32.555  -20.486 -1.984  1.00 39.71 ? 423 HOH C O   1 
HETATM 3698 O O   . HOH R 3 .   ? 20.889  -42.084 -22.592 0.50 2.00  ? 424 HOH C O   1 
HETATM 3699 O O   . HOH R 3 .   ? 28.161  -29.563 -16.254 1.00 17.12 ? 425 HOH C O   1 
HETATM 3700 O O   . HOH R 3 .   ? 18.926  -18.534 -22.104 1.00 26.49 ? 426 HOH C O   1 
HETATM 3701 O O   . HOH R 3 .   ? 24.842  -18.194 -18.387 1.00 33.66 ? 427 HOH C O   1 
HETATM 3702 O O   . HOH R 3 .   ? 47.694  -21.329 10.060  1.00 61.27 ? 428 HOH C O   1 
HETATM 3703 O O   . HOH R 3 .   ? 48.981  -26.275 -3.444  1.00 16.39 ? 429 HOH C O   1 
HETATM 3704 O O   . HOH R 3 .   ? 21.870  -34.049 -17.267 1.00 23.12 ? 430 HOH C O   1 
HETATM 3705 O O   . HOH R 3 .   ? 25.029  -17.416 -10.321 1.00 35.66 ? 431 HOH C O   1 
HETATM 3706 O O   . HOH R 3 .   ? 0.409   -18.316 -16.085 1.00 14.13 ? 432 HOH C O   1 
HETATM 3707 O O   . HOH R 3 .   ? 13.051  -36.784 -24.891 1.00 38.71 ? 433 HOH C O   1 
HETATM 3708 O O   . HOH R 3 .   ? 14.143  -15.870 -11.029 1.00 46.84 ? 434 HOH C O   1 
HETATM 3709 O O   . HOH R 3 .   ? 0.719   -40.447 -10.625 1.00 46.91 ? 435 HOH C O   1 
HETATM 3710 O O   . HOH R 3 .   ? 49.438  -25.736 -8.106  1.00 18.81 ? 436 HOH C O   1 
HETATM 3711 O O   . HOH R 3 .   ? 2.667   -40.486 -13.777 1.00 45.90 ? 437 HOH C O   1 
HETATM 3712 O O   . HOH R 3 .   ? 27.433  -42.718 -0.094  1.00 20.51 ? 438 HOH C O   1 
HETATM 3713 O O   . HOH R 3 .   ? 44.165  -23.744 0.713   1.00 51.00 ? 439 HOH C O   1 
HETATM 3714 O O   . HOH R 3 .   ? 41.195  -12.273 -9.293  1.00 15.26 ? 440 HOH C O   1 
HETATM 3715 O O   . HOH R 3 .   ? 29.844  -32.686 -18.601 1.00 32.82 ? 441 HOH C O   1 
HETATM 3716 O O   . HOH R 3 .   ? 43.891  -18.444 -2.493  1.00 35.43 ? 442 HOH C O   1 
HETATM 3717 O O   . HOH R 3 .   ? 50.169  -30.070 -4.374  1.00 38.49 ? 443 HOH C O   1 
HETATM 3718 O O   . HOH R 3 .   ? 33.272  -34.860 -16.262 1.00 49.18 ? 444 HOH C O   1 
HETATM 3719 O O   . HOH R 3 .   ? 35.404  -27.776 13.951  1.00 26.46 ? 445 HOH C O   1 
HETATM 3720 O O   . HOH R 3 .   ? 17.210  -29.779 -22.118 1.00 34.66 ? 446 HOH C O   1 
HETATM 3721 O O   . HOH R 3 .   ? 6.536   -38.371 -12.147 1.00 22.37 ? 447 HOH C O   1 
HETATM 3722 O O   . HOH R 3 .   ? 34.280  -30.502 19.106  1.00 60.57 ? 448 HOH C O   1 
HETATM 3723 O O   . HOH R 3 .   ? -2.025  -34.439 -18.200 1.00 57.46 ? 449 HOH C O   1 
HETATM 3724 O O   . HOH R 3 .   ? -2.635  -33.673 -12.744 1.00 39.42 ? 450 HOH C O   1 
HETATM 3725 O O   . HOH R 3 .   ? -1.204  -46.061 -3.175  1.00 28.68 ? 451 HOH C O   1 
HETATM 3726 O O   . HOH R 3 .   ? 42.931  -23.475 -9.538  1.00 40.49 ? 452 HOH C O   1 
HETATM 3727 O O   . HOH R 3 .   ? 43.879  -20.007 3.045   1.00 38.93 ? 453 HOH C O   1 
HETATM 3728 O O   . HOH R 3 .   ? 9.415   -43.044 -14.479 1.00 15.22 ? 454 HOH C O   1 
HETATM 3729 O O   . HOH R 3 .   ? 0.879   -28.591 -20.241 1.00 22.06 ? 455 HOH C O   1 
HETATM 3730 O O   . HOH R 3 .   ? 43.414  -21.031 -1.557  1.00 39.49 ? 456 HOH C O   1 
HETATM 3731 O O   . HOH R 3 .   ? 45.453  -26.016 -4.734  1.00 25.38 ? 457 HOH C O   1 
HETATM 3732 O O   . HOH R 3 .   ? 8.553   -36.682 -16.892 1.00 14.02 ? 458 HOH C O   1 
HETATM 3733 O O   . HOH R 3 .   ? 40.101  -14.945 16.734  1.00 41.20 ? 459 HOH C O   1 
HETATM 3734 O O   . HOH R 3 .   ? 36.429  -20.872 1.234   1.00 42.87 ? 460 HOH C O   1 
HETATM 3735 O O   . HOH R 3 .   ? 41.641  -22.685 -13.109 1.00 29.49 ? 461 HOH C O   1 
HETATM 3736 O O   . HOH R 3 .   ? 4.119   -43.572 -8.418  1.00 31.52 ? 462 HOH C O   1 
HETATM 3737 O O   . HOH R 3 .   ? 34.943  -19.313 -1.620  1.00 23.85 ? 463 HOH C O   1 
HETATM 3738 O O   . HOH R 3 .   ? 21.353  -32.240 -22.214 1.00 47.54 ? 464 HOH C O   1 
HETATM 3739 O O   . HOH R 3 .   ? 20.777  -18.732 7.834   1.00 24.50 ? 465 HOH C O   1 
HETATM 3740 O O   . HOH R 3 .   ? 5.444   -39.677 6.292   1.00 7.96  ? 466 HOH C O   1 
HETATM 3741 O O   . HOH R 3 .   ? 33.666  -10.315 -10.116 1.00 39.97 ? 467 HOH C O   1 
HETATM 3742 O O   . HOH R 3 .   ? 24.298  -8.735  -7.309  1.00 18.51 ? 468 HOH C O   1 
HETATM 3743 O O   . HOH R 3 .   ? 20.663  -18.564 -19.595 1.00 27.99 ? 469 HOH C O   1 
HETATM 3744 O O   . HOH R 3 .   ? 39.035  -37.096 -17.834 1.00 23.31 ? 470 HOH C O   1 
HETATM 3745 O O   . HOH R 3 .   ? 44.443  -15.756 -11.540 1.00 25.32 ? 471 HOH C O   1 
HETATM 3746 O O   . HOH R 3 .   ? 40.301  -10.496 -5.241  1.00 25.22 ? 472 HOH C O   1 
HETATM 3747 O O   . HOH R 3 .   ? 50.712  -26.209 1.515   1.00 53.41 ? 473 HOH C O   1 
HETATM 3748 O O   . HOH R 3 .   ? -1.649  -43.172 -6.465  1.00 66.37 ? 474 HOH C O   1 
HETATM 3749 O O   . HOH R 3 .   ? 12.624  -39.632 -18.051 1.00 36.09 ? 475 HOH C O   1 
HETATM 3750 O O   . HOH R 3 .   ? 43.581  -35.947 -4.854  1.00 27.89 ? 476 HOH C O   1 
HETATM 3751 O O   . HOH R 3 .   ? 19.588  -34.656 -5.070  1.00 20.63 ? 477 HOH C O   1 
HETATM 3752 O O   . HOH R 3 .   ? 10.639  -19.212 0.052   1.00 19.29 ? 478 HOH C O   1 
HETATM 3753 O O   . HOH R 3 .   ? 30.567  -18.614 10.014  1.00 35.05 ? 479 HOH C O   1 
HETATM 3754 O O   . HOH R 3 .   ? 35.864  -34.340 -11.555 1.00 34.25 ? 480 HOH C O   1 
HETATM 3755 O O   . HOH R 3 .   ? 36.912  -27.898 -11.277 1.00 24.89 ? 481 HOH C O   1 
HETATM 3756 O O   . HOH R 3 .   ? 33.637  -36.499 -18.475 1.00 43.17 ? 482 HOH C O   1 
HETATM 3757 O O   . HOH R 3 .   ? 6.129   -46.600 -11.716 1.00 33.41 ? 483 HOH C O   1 
HETATM 3758 O O   . HOH R 3 .   ? 30.625  -10.305 -3.153  1.00 35.49 ? 484 HOH C O   1 
HETATM 3759 O O   . HOH R 3 .   ? 25.099  -16.550 -16.292 1.00 21.00 ? 485 HOH C O   1 
HETATM 3760 O O   . HOH R 3 .   ? 27.285  -36.571 4.317   1.00 35.39 ? 486 HOH C O   1 
HETATM 3761 O O   . HOH R 3 .   ? -1.119  -39.920 1.048   1.00 34.22 ? 487 HOH C O   1 
HETATM 3762 O O   . HOH R 3 .   ? 43.324  -27.246 9.530   1.00 19.18 ? 488 HOH C O   1 
HETATM 3763 O O   . HOH R 3 .   ? 49.578  -31.826 -8.554  1.00 50.53 ? 489 HOH C O   1 
HETATM 3764 O O   . HOH R 3 .   ? 15.445  -17.723 -22.189 1.00 19.67 ? 490 HOH C O   1 
HETATM 3765 O O   . HOH R 3 .   ? 6.185   -43.478 0.113   1.00 37.50 ? 491 HOH C O   1 
HETATM 3766 O O   . HOH R 3 .   ? 34.457  -9.000  -2.076  1.00 8.12  ? 492 HOH C O   1 
HETATM 3767 O O   . HOH R 3 .   ? 29.933  -17.039 -6.945  1.00 34.74 ? 493 HOH C O   1 
HETATM 3768 O O   . HOH R 3 .   ? 15.839  -30.980 -5.087  1.00 20.77 ? 494 HOH C O   1 
HETATM 3769 O O   . HOH R 3 .   ? 29.291  -36.859 -17.929 1.00 37.45 ? 495 HOH C O   1 
HETATM 3770 O O   . HOH R 3 .   ? 14.951  -35.414 -1.562  1.00 27.18 ? 496 HOH C O   1 
HETATM 3771 O O   . HOH R 3 .   ? 40.249  -14.878 -1.972  1.00 33.60 ? 497 HOH C O   1 
HETATM 3772 O O   . HOH R 3 .   ? 6.386   -41.045 1.726   1.00 51.78 ? 498 HOH C O   1 
HETATM 3773 O O   . HOH R 3 .   ? 15.308  -16.333 -8.190  1.00 35.72 ? 499 HOH C O   1 
HETATM 3774 O O   . HOH R 3 .   ? 22.926  -11.009 -8.342  1.00 16.25 ? 500 HOH C O   1 
HETATM 3775 O O   . HOH R 3 .   ? 39.022  -20.221 -12.548 1.00 41.12 ? 501 HOH C O   1 
HETATM 3776 O O   . HOH R 3 .   ? 47.120  -27.682 4.301   1.00 22.70 ? 502 HOH C O   1 
HETATM 3777 O O   . HOH R 3 .   ? 46.179  -30.614 -1.532  1.00 45.63 ? 503 HOH C O   1 
HETATM 3778 O O   . HOH R 3 .   ? 37.807  -18.843 5.261   1.00 44.28 ? 504 HOH C O   1 
HETATM 3779 O O   . HOH R 3 .   ? -0.480  -35.421 -20.693 1.00 38.29 ? 505 HOH C O   1 
HETATM 3780 O O   . HOH R 3 .   ? 27.143  -35.619 -0.542  1.00 8.58  ? 506 HOH C O   1 
HETATM 3781 O O   . HOH R 3 .   ? 45.467  -18.870 -4.125  1.00 30.25 ? 507 HOH C O   1 
HETATM 3782 O O   . HOH R 3 .   ? 41.106  -22.877 11.344  1.00 73.17 ? 508 HOH C O   1 
HETATM 3783 O O   . HOH R 3 .   ? 29.788  -33.971 15.247  1.00 16.27 ? 509 HOH C O   1 
HETATM 3784 O O   . HOH R 3 .   ? 44.623  -19.855 -9.127  1.00 6.02  ? 510 HOH C O   1 
HETATM 3785 O O   . HOH R 3 .   ? 47.859  -26.760 -12.233 1.00 31.66 ? 511 HOH C O   1 
HETATM 3786 O O   . HOH R 3 .   ? 13.002  -42.584 -21.809 1.00 42.02 ? 512 HOH C O   1 
HETATM 3787 O O   . HOH R 3 .   ? 40.530  -20.843 -1.736  1.00 36.38 ? 513 HOH C O   1 
HETATM 3788 O O   . HOH R 3 .   ? 52.683  -29.945 -6.139  1.00 27.73 ? 514 HOH C O   1 
HETATM 3789 O O   . HOH R 3 .   ? 5.474   -28.564 -10.598 1.00 41.63 ? 515 HOH C O   1 
HETATM 3790 O O   . HOH R 3 .   ? 35.638  -30.121 15.111  1.00 34.02 ? 516 HOH C O   1 
HETATM 3791 O O   . HOH R 3 .   ? 27.015  -33.827 15.478  1.00 20.11 ? 517 HOH C O   1 
HETATM 3792 O O   . HOH R 3 .   ? 44.592  -16.037 -0.493  1.00 26.65 ? 518 HOH C O   1 
HETATM 3793 O O   . HOH R 3 .   ? 2.187   -31.611 -24.946 1.00 24.75 ? 519 HOH C O   1 
HETATM 3794 O O   . HOH R 3 .   ? 46.089  -18.752 5.396   1.00 59.07 ? 520 HOH C O   1 
HETATM 3795 O O   . HOH R 3 .   ? 5.966   -15.636 -11.384 1.00 14.96 ? 521 HOH C O   1 
HETATM 3796 O O   . HOH R 3 .   ? 5.158   -41.828 -14.577 1.00 39.79 ? 522 HOH C O   1 
HETATM 3797 O O   . HOH R 3 .   ? 30.594  -15.397 0.039   1.00 27.20 ? 523 HOH C O   1 
HETATM 3798 O O   . HOH R 3 .   ? 42.983  -11.532 -0.687  1.00 32.88 ? 524 HOH C O   1 
HETATM 3799 O O   . HOH R 3 .   ? 19.337  -27.762 -23.354 1.00 34.64 ? 525 HOH C O   1 
HETATM 3800 O O   . HOH R 3 .   ? 47.088  -23.902 4.679   1.00 20.04 ? 526 HOH C O   1 
HETATM 3801 O O   . HOH R 3 .   ? -1.147  -21.130 -9.550  1.00 40.89 ? 527 HOH C O   1 
HETATM 3802 O O   . HOH R 3 .   ? 9.840   -36.061 -19.156 1.00 25.94 ? 528 HOH C O   1 
HETATM 3803 O O   . HOH R 3 .   ? -2.625  -24.543 -7.563  1.00 48.13 ? 529 HOH C O   1 
HETATM 3804 O O   . HOH R 3 .   ? 0.032   -42.823 -8.942  1.00 69.32 ? 530 HOH C O   1 
HETATM 3805 O O   . HOH R 3 .   ? 7.227   -17.244 -12.559 1.00 21.08 ? 531 HOH C O   1 
HETATM 3806 O O   . HOH R 3 .   ? 53.988  -30.394 -3.152  1.00 48.49 ? 532 HOH C O   1 
HETATM 3807 O O   . HOH R 3 .   ? 8.439   -28.799 -17.809 1.00 30.65 ? 533 HOH C O   1 
HETATM 3808 O O   . HOH R 3 .   ? 11.326  -33.528 -2.214  1.00 23.26 ? 534 HOH C O   1 
HETATM 3809 O O   . HOH R 3 .   ? 42.955  -14.510 12.924  1.00 50.03 ? 535 HOH C O   1 
HETATM 3810 O O   . HOH R 3 .   ? 8.457   -36.063 -0.599  1.00 26.65 ? 536 HOH C O   1 
HETATM 3811 O O   . HOH R 3 .   ? 1.624   -46.195 -2.572  1.00 24.44 ? 537 HOH C O   1 
HETATM 3812 O O   . HOH R 3 .   ? 15.715  -43.208 -15.760 1.00 27.52 ? 538 HOH C O   1 
HETATM 3813 O O   . HOH R 3 .   ? 18.088  -34.957 -24.895 1.00 21.96 ? 539 HOH C O   1 
HETATM 3814 O O   . HOH R 3 .   ? 31.425  -35.853 12.472  1.00 45.89 ? 540 HOH C O   1 
HETATM 3815 O O   . HOH R 3 .   ? 34.534  -16.843 13.008  1.00 58.97 ? 541 HOH C O   1 
HETATM 3816 O O   . HOH R 3 .   ? 51.249  -30.822 -12.488 1.00 28.67 ? 542 HOH C O   1 
HETATM 3817 O O   . HOH R 3 .   ? 5.687   -31.929 -24.448 1.00 60.12 ? 543 HOH C O   1 
HETATM 3818 O O   . HOH R 3 .   ? 48.034  -21.521 -5.853  1.00 23.80 ? 544 HOH C O   1 
HETATM 3819 O O   . HOH R 3 .   ? 30.622  -38.963 -22.450 1.00 16.85 ? 545 HOH C O   1 
HETATM 3820 O O   . HOH R 3 .   ? 3.711   -37.860 -16.464 1.00 69.03 ? 546 HOH C O   1 
HETATM 3821 O O   . HOH R 3 .   ? 16.457  -37.124 -23.404 1.00 42.54 ? 547 HOH C O   1 
HETATM 3822 O O   . HOH R 3 .   ? 28.586  -43.362 -21.766 1.00 28.19 ? 548 HOH C O   1 
HETATM 3823 O O   . HOH R 3 .   ? 25.352  -34.400 -23.610 1.00 29.67 ? 549 HOH C O   1 
HETATM 3824 O O   . HOH R 3 .   ? 49.950  -36.418 -8.162  1.00 42.27 ? 550 HOH C O   1 
HETATM 3825 O O   . HOH R 3 .   ? 34.299  -34.294 -22.338 1.00 58.69 ? 551 HOH C O   1 
HETATM 3826 O O   . HOH R 3 .   ? 33.403  -33.669 18.410  1.00 14.31 ? 552 HOH C O   1 
HETATM 3827 O O   . HOH R 3 .   ? 23.002  -40.535 -21.131 1.00 67.13 ? 553 HOH C O   1 
HETATM 3828 O O   . HOH R 3 .   ? 38.521  -30.885 -14.114 1.00 34.85 ? 554 HOH C O   1 
HETATM 3829 O O   . HOH R 3 .   ? 33.246  -17.207 15.641  1.00 61.66 ? 555 HOH C O   1 
HETATM 3830 O O   . HOH R 3 .   ? 14.631  -35.526 -19.096 1.00 29.51 ? 556 HOH C O   1 
HETATM 3831 O O   . HOH R 3 .   ? 4.166   -33.223 -11.802 1.00 34.51 ? 557 HOH C O   1 
HETATM 3832 O O   . HOH R 3 .   ? 23.813  -27.602 -23.705 1.00 33.18 ? 558 HOH C O   1 
HETATM 3833 O O   . HOH R 3 .   ? 37.409  -14.152 11.905  1.00 29.88 ? 559 HOH C O   1 
HETATM 3834 O O   . HOH R 3 .   ? 23.960  -41.504 4.974   0.50 30.82 ? 560 HOH C O   1 
HETATM 3835 O O   . HOH R 3 .   ? 35.819  -12.994 -8.590  1.00 25.17 ? 561 HOH C O   1 
HETATM 3836 O O   . HOH R 3 .   ? 40.850  -30.629 -16.687 1.00 43.18 ? 562 HOH C O   1 
HETATM 3837 O O   . HOH R 3 .   ? -4.989  -23.383 -14.807 1.00 49.05 ? 563 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  SER 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  GLY 12  -8  ?   ?   ?   A . n 
A 1 13  GLU 13  -7  ?   ?   ?   A . n 
A 1 14  ASN 14  -6  ?   ?   ?   A . n 
A 1 15  LEU 15  -5  ?   ?   ?   A . n 
A 1 16  TYR 16  -4  ?   ?   ?   A . n 
A 1 17  PHE 17  -3  ?   ?   ?   A . n 
A 1 18  GLN 18  -2  ?   ?   ?   A . n 
A 1 19  GLY 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  ARG 22  2   ?   ?   ?   A . n 
A 1 23  SER 23  3   ?   ?   ?   A . n 
A 1 24  PRO 24  4   ?   ?   ?   A . n 
A 1 25  VAL 25  5   ?   ?   ?   A . n 
A 1 26  GLN 26  6   ?   ?   ?   A . n 
A 1 27  LEU 27  7   ?   ?   ?   A . n 
A 1 28  GLN 28  8   ?   ?   ?   A . n 
A 1 29  HIS 29  9   ?   ?   ?   A . n 
A 1 30  GLY 30  10  ?   ?   ?   A . n 
A 1 31  SER 31  11  ?   ?   ?   A . n 
A 1 32  ASP 32  12  ?   ?   ?   A . n 
A 1 33  ALA 33  13  ?   ?   ?   A . n 
A 1 34  THR 34  14  ?   ?   ?   A . n 
A 1 35  ASN 35  15  ?   ?   ?   A . n 
A 1 36  GLY 36  16  ?   ?   ?   A . n 
A 1 37  PHE 37  17  ?   ?   ?   A . n 
A 1 38  HIS 38  18  ?   ?   ?   A . n 
A 1 39  THR 39  19  ?   ?   ?   A . n 
A 1 40  LEU 40  20  ?   ?   ?   A . n 
A 1 41  GLN 41  21  ?   ?   ?   A . n 
A 1 42  PRO 42  22  ?   ?   ?   A . n 
A 1 43  HIS 43  23  ?   ?   ?   A . n 
A 1 44  ASP 44  24  ?   ?   ?   A . n 
A 1 45  GLN 45  25  ?   ?   ?   A . n 
A 1 46  THR 46  26  ?   ?   ?   A . n 
A 1 47  ASP 47  27  ?   ?   ?   A . n 
A 1 48  GLY 48  28  ?   ?   ?   A . n 
A 1 49  PRO 49  29  ?   ?   ?   A . n 
A 1 50  ILE 50  30  ?   ?   ?   A . n 
A 1 51  LYS 51  31  ?   ?   ?   A . n 
A 1 52  ARG 52  32  ?   ?   ?   A . n 
A 1 53  VAL 53  33  ?   ?   ?   A . n 
A 1 54  CYS 54  34  ?   ?   ?   A . n 
A 1 55  LEU 55  35  ?   ?   ?   A . n 
A 1 56  THR 56  36  ?   ?   ?   A . n 
A 1 57  ARG 57  37  37  ARG ARG A . n 
A 1 58  GLY 58  38  38  GLY GLY A . n 
A 1 59  MET 59  39  39  MET MET A . n 
A 1 60  HIS 60  40  40  HIS HIS A . n 
A 1 61  VAL 61  41  41  VAL VAL A . n 
A 1 62  PRO 62  42  42  PRO PRO A . n 
A 1 63  GLU 63  43  43  GLU GLU A . n 
A 1 64  HIS 64  44  44  HIS HIS A . n 
A 1 65  VAL 65  45  45  VAL VAL A . n 
A 1 66  ALA 66  46  46  ALA ALA A . n 
A 1 67  MET 67  47  47  MET MET A . n 
A 1 68  HIS 68  48  48  HIS HIS A . n 
A 1 69  HIS 69  49  49  HIS HIS A . n 
A 1 70  THR 70  50  50  THR THR A . n 
A 1 71  HIS 71  51  51  HIS HIS A . n 
A 1 72  ASP 72  52  52  ASP ASP A . n 
A 1 73  VAL 73  53  53  VAL VAL A . n 
A 1 74  GLY 74  54  54  GLY GLY A . n 
A 1 75  PRO 75  55  55  PRO PRO A . n 
A 1 76  ASP 76  56  56  ASP ASP A . n 
A 1 77  GLN 77  57  57  GLN GLN A . n 
A 1 78  CYS 78  58  58  CYS CYS A . n 
A 1 79  CYS 79  59  59  CYS CYS A . n 
A 1 80  SER 80  60  60  SER SER A . n 
A 1 81  SER 81  61  61  SER SER A . n 
A 1 82  VAL 82  62  62  VAL VAL A . n 
A 1 83  VAL 83  63  63  VAL VAL A . n 
A 1 84  GLN 84  64  64  GLN GLN A . n 
A 1 85  MET 85  65  65  MET MET A . n 
A 1 86  ILE 86  66  66  ILE ILE A . n 
A 1 87  HIS 87  67  67  HIS HIS A . n 
A 1 88  ALA 88  68  68  ALA ALA A . n 
A 1 89  PRO 89  69  69  PRO PRO A . n 
A 1 90  PRO 90  70  70  PRO PRO A . n 
A 1 91  GLU 91  71  71  GLU GLU A . n 
A 1 92  SER 92  72  72  SER SER A . n 
A 1 93  VAL 93  73  73  VAL VAL A . n 
A 1 94  TRP 94  74  74  TRP TRP A . n 
A 1 95  ALA 95  75  75  ALA ALA A . n 
A 1 96  LEU 96  76  76  LEU LEU A . n 
A 1 97  VAL 97  77  77  VAL VAL A . n 
A 1 98  ARG 98  78  78  ARG ARG A . n 
A 1 99  ARG 99  79  79  ARG ARG A . n 
A 1 100 PHE 100 80  80  PHE PHE A . n 
A 1 101 ASP 101 81  81  ASP ASP A . n 
A 1 102 ASN 102 82  82  ASN ASN A . n 
A 1 103 PRO 103 83  83  PRO PRO A . n 
A 1 104 LYS 104 84  84  LYS LYS A . n 
A 1 105 VAL 105 85  85  VAL VAL A . n 
A 1 106 TYR 106 86  86  TYR TYR A . n 
A 1 107 LYS 107 87  87  LYS LYS A . n 
A 1 108 ASN 108 88  88  ASN ASN A . n 
A 1 109 PHE 109 89  89  PHE PHE A . n 
A 1 110 ILE 110 90  90  ILE ILE A . n 
A 1 111 ARG 111 91  91  ARG ARG A . n 
A 1 112 GLN 112 92  92  GLN GLN A . n 
A 1 113 CYS 113 93  93  CYS CYS A . n 
A 1 114 ARG 114 94  94  ARG ARG A . n 
A 1 115 ILE 115 95  95  ILE ILE A . n 
A 1 116 VAL 116 96  96  VAL VAL A . n 
A 1 117 GLN 117 97  97  GLN GLN A . n 
A 1 118 GLY 118 98  ?   ?   ?   A . n 
A 1 119 ASP 119 99  ?   ?   ?   A . n 
A 1 120 GLY 120 100 ?   ?   ?   A . n 
A 1 121 LEU 121 101 101 LEU LEU A . n 
A 1 122 HIS 122 102 102 HIS HIS A . n 
A 1 123 VAL 123 103 103 VAL VAL A . n 
A 1 124 GLY 124 104 104 GLY GLY A . n 
A 1 125 ASP 125 105 105 ASP ASP A . n 
A 1 126 LEU 126 106 106 LEU LEU A . n 
A 1 127 ARG 127 107 107 ARG ARG A . n 
A 1 128 GLU 128 108 108 GLU GLU A . n 
A 1 129 VAL 129 109 109 VAL VAL A . n 
A 1 130 MET 130 110 110 MET MET A . n 
A 1 131 VAL 131 111 111 VAL VAL A . n 
A 1 132 VAL 132 112 ?   ?   ?   A . n 
A 1 133 SER 133 113 ?   ?   ?   A . n 
A 1 134 GLY 134 114 ?   ?   ?   A . n 
A 1 135 LEU 135 115 115 LEU LEU A . n 
A 1 136 PRO 136 116 116 PRO PRO A . n 
A 1 137 ALA 137 117 117 ALA ALA A . n 
A 1 138 VAL 138 118 118 VAL VAL A . n 
A 1 139 SER 139 119 119 SER SER A . n 
A 1 140 SER 140 120 120 SER SER A . n 
A 1 141 THR 141 121 121 THR THR A . n 
A 1 142 GLU 142 122 122 GLU GLU A . n 
A 1 143 ARG 143 123 123 ARG ARG A . n 
A 1 144 LEU 144 124 124 LEU LEU A . n 
A 1 145 GLU 145 125 125 GLU GLU A . n 
A 1 146 ILE 146 126 126 ILE ILE A . n 
A 1 147 LEU 147 127 127 LEU LEU A . n 
A 1 148 ASP 148 128 128 ASP ASP A . n 
A 1 149 GLU 149 129 129 GLU GLU A . n 
A 1 150 GLU 150 130 130 GLU GLU A . n 
A 1 151 ARG 151 131 131 ARG ARG A . n 
A 1 152 HIS 152 132 132 HIS HIS A . n 
A 1 153 VAL 153 133 133 VAL VAL A . n 
A 1 154 ILE 154 134 134 ILE ILE A . n 
A 1 155 SER 155 135 135 SER SER A . n 
A 1 156 PHE 156 136 136 PHE PHE A . n 
A 1 157 SER 157 137 137 SER SER A . n 
A 1 158 VAL 158 138 138 VAL VAL A . n 
A 1 159 VAL 159 139 139 VAL VAL A . n 
A 1 160 GLY 160 140 140 GLY GLY A . n 
A 1 161 GLY 161 141 141 GLY GLY A . n 
A 1 162 ASP 162 142 142 ASP ASP A . n 
A 1 163 HIS 163 143 143 HIS HIS A . n 
A 1 164 ARG 164 144 144 ARG ARG A . n 
A 1 165 LEU 165 145 145 LEU LEU A . n 
A 1 166 LYS 166 146 146 LYS LYS A . n 
A 1 167 ASN 167 147 147 ASN ASN A . n 
A 1 168 TYR 168 148 148 TYR TYR A . n 
A 1 169 ARG 169 149 149 ARG ARG A . n 
A 1 170 SER 170 150 150 SER SER A . n 
A 1 171 VAL 171 151 151 VAL VAL A . n 
A 1 172 THR 172 152 152 THR THR A . n 
A 1 173 THR 173 153 153 THR THR A . n 
A 1 174 LEU 174 154 154 LEU LEU A . n 
A 1 175 HIS 175 155 ?   ?   ?   A . n 
A 1 176 ALA 176 156 ?   ?   ?   A . n 
A 1 177 SER 177 157 ?   ?   ?   A . n 
A 1 178 ASP 178 158 ?   ?   ?   A . n 
A 1 179 ASP 179 159 ?   ?   ?   A . n 
A 1 180 GLU 180 160 ?   ?   ?   A . n 
A 1 181 GLY 181 161 ?   ?   ?   A . n 
A 1 182 THR 182 162 ?   ?   ?   A . n 
A 1 183 VAL 183 163 163 VAL VAL A . n 
A 1 184 VAL 184 164 164 VAL VAL A . n 
A 1 185 VAL 185 165 165 VAL VAL A . n 
A 1 186 GLU 186 166 166 GLU GLU A . n 
A 1 187 SER 187 167 167 SER SER A . n 
A 1 188 TYR 188 168 168 TYR TYR A . n 
A 1 189 ILE 189 169 169 ILE ILE A . n 
A 1 190 VAL 190 170 170 VAL VAL A . n 
A 1 191 ASP 191 171 171 ASP ASP A . n 
A 1 192 VAL 192 172 172 VAL VAL A . n 
A 1 193 PRO 193 173 173 PRO PRO A . n 
A 1 194 PRO 194 174 174 PRO PRO A . n 
A 1 195 GLY 195 175 175 GLY GLY A . n 
A 1 196 ASN 196 176 176 ASN ASN A . n 
A 1 197 THR 197 177 177 THR THR A . n 
A 1 198 GLU 198 178 178 GLU GLU A . n 
A 1 199 GLU 199 179 179 GLU GLU A . n 
A 1 200 GLU 200 180 180 GLU GLU A . n 
A 1 201 THR 201 181 181 THR THR A . n 
A 1 202 LEU 202 182 182 LEU LEU A . n 
A 1 203 SER 203 183 183 SER SER A . n 
A 1 204 PHE 204 184 184 PHE PHE A . n 
A 1 205 VAL 205 185 185 VAL VAL A . n 
A 1 206 ASP 206 186 186 ASP ASP A . n 
A 1 207 THR 207 187 187 THR THR A . n 
A 1 208 ILE 208 188 188 ILE ILE A . n 
A 1 209 VAL 209 189 189 VAL VAL A . n 
A 1 210 ARG 210 190 190 ARG ARG A . n 
A 1 211 CYS 211 191 191 CYS CYS A . n 
A 1 212 ASN 212 192 192 ASN ASN A . n 
A 1 213 LEU 213 193 193 LEU LEU A . n 
A 1 214 GLN 214 194 194 GLN GLN A . n 
A 1 215 SER 215 195 195 SER SER A . n 
A 1 216 LEU 216 196 196 LEU LEU A . n 
A 1 217 ALA 217 197 197 ALA ALA A . n 
A 1 218 ARG 218 198 198 ARG ARG A . n 
A 1 219 SER 219 199 199 SER SER A . n 
A 1 220 THR 220 200 200 THR THR A . n 
A 1 221 ASN 221 201 201 ASN ASN A . n 
A 1 222 ARG 222 202 202 ARG ARG A . n 
A 1 223 GLN 223 203 203 GLN GLN A . n 
B 1 1   MET 1   -19 ?   ?   ?   B . n 
B 1 2   GLY 2   -18 ?   ?   ?   B . n 
B 1 3   SER 3   -17 ?   ?   ?   B . n 
B 1 4   SER 4   -16 ?   ?   ?   B . n 
B 1 5   HIS 5   -15 ?   ?   ?   B . n 
B 1 6   HIS 6   -14 ?   ?   ?   B . n 
B 1 7   HIS 7   -13 ?   ?   ?   B . n 
B 1 8   HIS 8   -12 ?   ?   ?   B . n 
B 1 9   HIS 9   -11 ?   ?   ?   B . n 
B 1 10  SER 10  -10 ?   ?   ?   B . n 
B 1 11  SER 11  -9  ?   ?   ?   B . n 
B 1 12  GLY 12  -8  ?   ?   ?   B . n 
B 1 13  GLU 13  -7  ?   ?   ?   B . n 
B 1 14  ASN 14  -6  ?   ?   ?   B . n 
B 1 15  LEU 15  -5  ?   ?   ?   B . n 
B 1 16  TYR 16  -4  ?   ?   ?   B . n 
B 1 17  PHE 17  -3  ?   ?   ?   B . n 
B 1 18  GLN 18  -2  ?   ?   ?   B . n 
B 1 19  GLY 19  -1  ?   ?   ?   B . n 
B 1 20  HIS 20  0   ?   ?   ?   B . n 
B 1 21  MET 21  1   ?   ?   ?   B . n 
B 1 22  ARG 22  2   ?   ?   ?   B . n 
B 1 23  SER 23  3   ?   ?   ?   B . n 
B 1 24  PRO 24  4   ?   ?   ?   B . n 
B 1 25  VAL 25  5   ?   ?   ?   B . n 
B 1 26  GLN 26  6   ?   ?   ?   B . n 
B 1 27  LEU 27  7   ?   ?   ?   B . n 
B 1 28  GLN 28  8   ?   ?   ?   B . n 
B 1 29  HIS 29  9   ?   ?   ?   B . n 
B 1 30  GLY 30  10  ?   ?   ?   B . n 
B 1 31  SER 31  11  ?   ?   ?   B . n 
B 1 32  ASP 32  12  ?   ?   ?   B . n 
B 1 33  ALA 33  13  ?   ?   ?   B . n 
B 1 34  THR 34  14  ?   ?   ?   B . n 
B 1 35  ASN 35  15  ?   ?   ?   B . n 
B 1 36  GLY 36  16  ?   ?   ?   B . n 
B 1 37  PHE 37  17  ?   ?   ?   B . n 
B 1 38  HIS 38  18  ?   ?   ?   B . n 
B 1 39  THR 39  19  ?   ?   ?   B . n 
B 1 40  LEU 40  20  ?   ?   ?   B . n 
B 1 41  GLN 41  21  ?   ?   ?   B . n 
B 1 42  PRO 42  22  ?   ?   ?   B . n 
B 1 43  HIS 43  23  ?   ?   ?   B . n 
B 1 44  ASP 44  24  ?   ?   ?   B . n 
B 1 45  GLN 45  25  ?   ?   ?   B . n 
B 1 46  THR 46  26  ?   ?   ?   B . n 
B 1 47  ASP 47  27  ?   ?   ?   B . n 
B 1 48  GLY 48  28  ?   ?   ?   B . n 
B 1 49  PRO 49  29  ?   ?   ?   B . n 
B 1 50  ILE 50  30  ?   ?   ?   B . n 
B 1 51  LYS 51  31  ?   ?   ?   B . n 
B 1 52  ARG 52  32  ?   ?   ?   B . n 
B 1 53  VAL 53  33  ?   ?   ?   B . n 
B 1 54  CYS 54  34  ?   ?   ?   B . n 
B 1 55  LEU 55  35  ?   ?   ?   B . n 
B 1 56  THR 56  36  36  THR THR B . n 
B 1 57  ARG 57  37  37  ARG ARG B . n 
B 1 58  GLY 58  38  38  GLY GLY B . n 
B 1 59  MET 59  39  39  MET MET B . n 
B 1 60  HIS 60  40  40  HIS HIS B . n 
B 1 61  VAL 61  41  41  VAL VAL B . n 
B 1 62  PRO 62  42  42  PRO PRO B . n 
B 1 63  GLU 63  43  43  GLU GLU B . n 
B 1 64  HIS 64  44  44  HIS HIS B . n 
B 1 65  VAL 65  45  45  VAL VAL B . n 
B 1 66  ALA 66  46  46  ALA ALA B . n 
B 1 67  MET 67  47  47  MET MET B . n 
B 1 68  HIS 68  48  48  HIS HIS B . n 
B 1 69  HIS 69  49  49  HIS HIS B . n 
B 1 70  THR 70  50  50  THR THR B . n 
B 1 71  HIS 71  51  51  HIS HIS B . n 
B 1 72  ASP 72  52  52  ASP ASP B . n 
B 1 73  VAL 73  53  53  VAL VAL B . n 
B 1 74  GLY 74  54  54  GLY GLY B . n 
B 1 75  PRO 75  55  55  PRO PRO B . n 
B 1 76  ASP 76  56  56  ASP ASP B . n 
B 1 77  GLN 77  57  57  GLN GLN B . n 
B 1 78  CYS 78  58  58  CYS CYS B . n 
B 1 79  CYS 79  59  59  CYS CYS B . n 
B 1 80  SER 80  60  60  SER SER B . n 
B 1 81  SER 81  61  61  SER SER B . n 
B 1 82  VAL 82  62  62  VAL VAL B . n 
B 1 83  VAL 83  63  63  VAL VAL B . n 
B 1 84  GLN 84  64  64  GLN GLN B . n 
B 1 85  MET 85  65  65  MET MET B . n 
B 1 86  ILE 86  66  66  ILE ILE B . n 
B 1 87  HIS 87  67  67  HIS HIS B . n 
B 1 88  ALA 88  68  68  ALA ALA B . n 
B 1 89  PRO 89  69  69  PRO PRO B . n 
B 1 90  PRO 90  70  70  PRO PRO B . n 
B 1 91  GLU 91  71  71  GLU GLU B . n 
B 1 92  SER 92  72  72  SER SER B . n 
B 1 93  VAL 93  73  73  VAL VAL B . n 
B 1 94  TRP 94  74  74  TRP TRP B . n 
B 1 95  ALA 95  75  75  ALA ALA B . n 
B 1 96  LEU 96  76  76  LEU LEU B . n 
B 1 97  VAL 97  77  77  VAL VAL B . n 
B 1 98  ARG 98  78  78  ARG ARG B . n 
B 1 99  ARG 99  79  79  ARG ARG B . n 
B 1 100 PHE 100 80  80  PHE PHE B . n 
B 1 101 ASP 101 81  81  ASP ASP B . n 
B 1 102 ASN 102 82  82  ASN ASN B . n 
B 1 103 PRO 103 83  83  PRO PRO B . n 
B 1 104 LYS 104 84  84  LYS LYS B . n 
B 1 105 VAL 105 85  85  VAL VAL B . n 
B 1 106 TYR 106 86  86  TYR TYR B . n 
B 1 107 LYS 107 87  87  LYS LYS B . n 
B 1 108 ASN 108 88  88  ASN ASN B . n 
B 1 109 PHE 109 89  89  PHE PHE B . n 
B 1 110 ILE 110 90  90  ILE ILE B . n 
B 1 111 ARG 111 91  91  ARG ARG B . n 
B 1 112 GLN 112 92  92  GLN GLN B . n 
B 1 113 CYS 113 93  93  CYS CYS B . n 
B 1 114 ARG 114 94  94  ARG ARG B . n 
B 1 115 ILE 115 95  95  ILE ILE B . n 
B 1 116 VAL 116 96  96  VAL VAL B . n 
B 1 117 GLN 117 97  ?   ?   ?   B . n 
B 1 118 GLY 118 98  ?   ?   ?   B . n 
B 1 119 ASP 119 99  ?   ?   ?   B . n 
B 1 120 GLY 120 100 ?   ?   ?   B . n 
B 1 121 LEU 121 101 101 LEU LEU B . n 
B 1 122 HIS 122 102 102 HIS HIS B . n 
B 1 123 VAL 123 103 103 VAL VAL B . n 
B 1 124 GLY 124 104 104 GLY GLY B . n 
B 1 125 ASP 125 105 105 ASP ASP B . n 
B 1 126 LEU 126 106 106 LEU LEU B . n 
B 1 127 ARG 127 107 107 ARG ARG B . n 
B 1 128 GLU 128 108 108 GLU GLU B . n 
B 1 129 VAL 129 109 109 VAL VAL B . n 
B 1 130 MET 130 110 110 MET MET B . n 
B 1 131 VAL 131 111 111 VAL VAL B . n 
B 1 132 VAL 132 112 ?   ?   ?   B . n 
B 1 133 SER 133 113 ?   ?   ?   B . n 
B 1 134 GLY 134 114 ?   ?   ?   B . n 
B 1 135 LEU 135 115 ?   ?   ?   B . n 
B 1 136 PRO 136 116 116 PRO PRO B . n 
B 1 137 ALA 137 117 117 ALA ALA B . n 
B 1 138 VAL 138 118 118 VAL VAL B . n 
B 1 139 SER 139 119 119 SER SER B . n 
B 1 140 SER 140 120 120 SER SER B . n 
B 1 141 THR 141 121 121 THR THR B . n 
B 1 142 GLU 142 122 122 GLU GLU B . n 
B 1 143 ARG 143 123 123 ARG ARG B . n 
B 1 144 LEU 144 124 124 LEU LEU B . n 
B 1 145 GLU 145 125 125 GLU GLU B . n 
B 1 146 ILE 146 126 126 ILE ILE B . n 
B 1 147 LEU 147 127 127 LEU LEU B . n 
B 1 148 ASP 148 128 128 ASP ASP B . n 
B 1 149 GLU 149 129 129 GLU GLU B . n 
B 1 150 GLU 150 130 130 GLU GLU B . n 
B 1 151 ARG 151 131 131 ARG ARG B . n 
B 1 152 HIS 152 132 132 HIS HIS B . n 
B 1 153 VAL 153 133 133 VAL VAL B . n 
B 1 154 ILE 154 134 134 ILE ILE B . n 
B 1 155 SER 155 135 135 SER SER B . n 
B 1 156 PHE 156 136 136 PHE PHE B . n 
B 1 157 SER 157 137 137 SER SER B . n 
B 1 158 VAL 158 138 138 VAL VAL B . n 
B 1 159 VAL 159 139 139 VAL VAL B . n 
B 1 160 GLY 160 140 140 GLY GLY B . n 
B 1 161 GLY 161 141 141 GLY GLY B . n 
B 1 162 ASP 162 142 142 ASP ASP B . n 
B 1 163 HIS 163 143 143 HIS HIS B . n 
B 1 164 ARG 164 144 144 ARG ARG B . n 
B 1 165 LEU 165 145 145 LEU LEU B . n 
B 1 166 LYS 166 146 146 LYS LYS B . n 
B 1 167 ASN 167 147 147 ASN ASN B . n 
B 1 168 TYR 168 148 148 TYR TYR B . n 
B 1 169 ARG 169 149 149 ARG ARG B . n 
B 1 170 SER 170 150 150 SER SER B . n 
B 1 171 VAL 171 151 151 VAL VAL B . n 
B 1 172 THR 172 152 152 THR THR B . n 
B 1 173 THR 173 153 153 THR THR B . n 
B 1 174 LEU 174 154 154 LEU LEU B . n 
B 1 175 HIS 175 155 155 HIS HIS B . n 
B 1 176 ALA 176 156 156 ALA ALA B . n 
B 1 177 SER 177 157 157 SER SER B . n 
B 1 178 ASP 178 158 ?   ?   ?   B . n 
B 1 179 ASP 179 159 ?   ?   ?   B . n 
B 1 180 GLU 180 160 ?   ?   ?   B . n 
B 1 181 GLY 181 161 ?   ?   ?   B . n 
B 1 182 THR 182 162 ?   ?   ?   B . n 
B 1 183 VAL 183 163 163 VAL VAL B . n 
B 1 184 VAL 184 164 164 VAL VAL B . n 
B 1 185 VAL 185 165 165 VAL VAL B . n 
B 1 186 GLU 186 166 166 GLU GLU B . n 
B 1 187 SER 187 167 167 SER SER B . n 
B 1 188 TYR 188 168 168 TYR TYR B . n 
B 1 189 ILE 189 169 169 ILE ILE B . n 
B 1 190 VAL 190 170 170 VAL VAL B . n 
B 1 191 ASP 191 171 171 ASP ASP B . n 
B 1 192 VAL 192 172 172 VAL VAL B . n 
B 1 193 PRO 193 173 173 PRO PRO B . n 
B 1 194 PRO 194 174 174 PRO PRO B . n 
B 1 195 GLY 195 175 175 GLY GLY B . n 
B 1 196 ASN 196 176 176 ASN ASN B . n 
B 1 197 THR 197 177 177 THR THR B . n 
B 1 198 GLU 198 178 178 GLU GLU B . n 
B 1 199 GLU 199 179 179 GLU GLU B . n 
B 1 200 GLU 200 180 180 GLU GLU B . n 
B 1 201 THR 201 181 181 THR THR B . n 
B 1 202 LEU 202 182 182 LEU LEU B . n 
B 1 203 SER 203 183 183 SER SER B . n 
B 1 204 PHE 204 184 184 PHE PHE B . n 
B 1 205 VAL 205 185 185 VAL VAL B . n 
B 1 206 ASP 206 186 186 ASP ASP B . n 
B 1 207 THR 207 187 187 THR THR B . n 
B 1 208 ILE 208 188 188 ILE ILE B . n 
B 1 209 VAL 209 189 189 VAL VAL B . n 
B 1 210 ARG 210 190 190 ARG ARG B . n 
B 1 211 CYS 211 191 191 CYS CYS B . n 
B 1 212 ASN 212 192 192 ASN ASN B . n 
B 1 213 LEU 213 193 193 LEU LEU B . n 
B 1 214 GLN 214 194 194 GLN GLN B . n 
B 1 215 SER 215 195 195 SER SER B . n 
B 1 216 LEU 216 196 196 LEU LEU B . n 
B 1 217 ALA 217 197 197 ALA ALA B . n 
B 1 218 ARG 218 198 198 ARG ARG B . n 
B 1 219 SER 219 199 199 SER SER B . n 
B 1 220 THR 220 200 200 THR THR B . n 
B 1 221 ASN 221 201 201 ASN ASN B . n 
B 1 222 ARG 222 202 202 ARG ARG B . n 
B 1 223 GLN 223 203 ?   ?   ?   B . n 
C 1 1   MET 1   -19 ?   ?   ?   C . n 
C 1 2   GLY 2   -18 ?   ?   ?   C . n 
C 1 3   SER 3   -17 ?   ?   ?   C . n 
C 1 4   SER 4   -16 ?   ?   ?   C . n 
C 1 5   HIS 5   -15 ?   ?   ?   C . n 
C 1 6   HIS 6   -14 ?   ?   ?   C . n 
C 1 7   HIS 7   -13 ?   ?   ?   C . n 
C 1 8   HIS 8   -12 ?   ?   ?   C . n 
C 1 9   HIS 9   -11 ?   ?   ?   C . n 
C 1 10  SER 10  -10 ?   ?   ?   C . n 
C 1 11  SER 11  -9  ?   ?   ?   C . n 
C 1 12  GLY 12  -8  ?   ?   ?   C . n 
C 1 13  GLU 13  -7  ?   ?   ?   C . n 
C 1 14  ASN 14  -6  ?   ?   ?   C . n 
C 1 15  LEU 15  -5  ?   ?   ?   C . n 
C 1 16  TYR 16  -4  ?   ?   ?   C . n 
C 1 17  PHE 17  -3  ?   ?   ?   C . n 
C 1 18  GLN 18  -2  ?   ?   ?   C . n 
C 1 19  GLY 19  -1  ?   ?   ?   C . n 
C 1 20  HIS 20  0   ?   ?   ?   C . n 
C 1 21  MET 21  1   ?   ?   ?   C . n 
C 1 22  ARG 22  2   ?   ?   ?   C . n 
C 1 23  SER 23  3   ?   ?   ?   C . n 
C 1 24  PRO 24  4   ?   ?   ?   C . n 
C 1 25  VAL 25  5   ?   ?   ?   C . n 
C 1 26  GLN 26  6   ?   ?   ?   C . n 
C 1 27  LEU 27  7   ?   ?   ?   C . n 
C 1 28  GLN 28  8   ?   ?   ?   C . n 
C 1 29  HIS 29  9   ?   ?   ?   C . n 
C 1 30  GLY 30  10  ?   ?   ?   C . n 
C 1 31  SER 31  11  ?   ?   ?   C . n 
C 1 32  ASP 32  12  ?   ?   ?   C . n 
C 1 33  ALA 33  13  ?   ?   ?   C . n 
C 1 34  THR 34  14  ?   ?   ?   C . n 
C 1 35  ASN 35  15  ?   ?   ?   C . n 
C 1 36  GLY 36  16  ?   ?   ?   C . n 
C 1 37  PHE 37  17  ?   ?   ?   C . n 
C 1 38  HIS 38  18  ?   ?   ?   C . n 
C 1 39  THR 39  19  ?   ?   ?   C . n 
C 1 40  LEU 40  20  ?   ?   ?   C . n 
C 1 41  GLN 41  21  ?   ?   ?   C . n 
C 1 42  PRO 42  22  ?   ?   ?   C . n 
C 1 43  HIS 43  23  ?   ?   ?   C . n 
C 1 44  ASP 44  24  ?   ?   ?   C . n 
C 1 45  GLN 45  25  ?   ?   ?   C . n 
C 1 46  THR 46  26  ?   ?   ?   C . n 
C 1 47  ASP 47  27  ?   ?   ?   C . n 
C 1 48  GLY 48  28  ?   ?   ?   C . n 
C 1 49  PRO 49  29  ?   ?   ?   C . n 
C 1 50  ILE 50  30  ?   ?   ?   C . n 
C 1 51  LYS 51  31  ?   ?   ?   C . n 
C 1 52  ARG 52  32  ?   ?   ?   C . n 
C 1 53  VAL 53  33  ?   ?   ?   C . n 
C 1 54  CYS 54  34  ?   ?   ?   C . n 
C 1 55  LEU 55  35  ?   ?   ?   C . n 
C 1 56  THR 56  36  ?   ?   ?   C . n 
C 1 57  ARG 57  37  37  ARG ARG C . n 
C 1 58  GLY 58  38  38  GLY GLY C . n 
C 1 59  MET 59  39  39  MET MET C . n 
C 1 60  HIS 60  40  40  HIS HIS C . n 
C 1 61  VAL 61  41  41  VAL VAL C . n 
C 1 62  PRO 62  42  42  PRO PRO C . n 
C 1 63  GLU 63  43  43  GLU GLU C . n 
C 1 64  HIS 64  44  44  HIS HIS C . n 
C 1 65  VAL 65  45  45  VAL VAL C . n 
C 1 66  ALA 66  46  46  ALA ALA C . n 
C 1 67  MET 67  47  47  MET MET C . n 
C 1 68  HIS 68  48  48  HIS HIS C . n 
C 1 69  HIS 69  49  49  HIS HIS C . n 
C 1 70  THR 70  50  50  THR THR C . n 
C 1 71  HIS 71  51  51  HIS HIS C . n 
C 1 72  ASP 72  52  52  ASP ASP C . n 
C 1 73  VAL 73  53  53  VAL VAL C . n 
C 1 74  GLY 74  54  54  GLY GLY C . n 
C 1 75  PRO 75  55  55  PRO PRO C . n 
C 1 76  ASP 76  56  56  ASP ASP C . n 
C 1 77  GLN 77  57  57  GLN GLN C . n 
C 1 78  CYS 78  58  58  CYS CYS C . n 
C 1 79  CYS 79  59  59  CYS CYS C . n 
C 1 80  SER 80  60  60  SER SER C . n 
C 1 81  SER 81  61  61  SER SER C . n 
C 1 82  VAL 82  62  62  VAL VAL C . n 
C 1 83  VAL 83  63  63  VAL VAL C . n 
C 1 84  GLN 84  64  64  GLN GLN C . n 
C 1 85  MET 85  65  65  MET MET C . n 
C 1 86  ILE 86  66  66  ILE ILE C . n 
C 1 87  HIS 87  67  67  HIS HIS C . n 
C 1 88  ALA 88  68  68  ALA ALA C . n 
C 1 89  PRO 89  69  69  PRO PRO C . n 
C 1 90  PRO 90  70  70  PRO PRO C . n 
C 1 91  GLU 91  71  71  GLU GLU C . n 
C 1 92  SER 92  72  72  SER SER C . n 
C 1 93  VAL 93  73  73  VAL VAL C . n 
C 1 94  TRP 94  74  74  TRP TRP C . n 
C 1 95  ALA 95  75  75  ALA ALA C . n 
C 1 96  LEU 96  76  76  LEU LEU C . n 
C 1 97  VAL 97  77  77  VAL VAL C . n 
C 1 98  ARG 98  78  78  ARG ARG C . n 
C 1 99  ARG 99  79  79  ARG ARG C . n 
C 1 100 PHE 100 80  80  PHE PHE C . n 
C 1 101 ASP 101 81  ?   ?   ?   C . n 
C 1 102 ASN 102 82  ?   ?   ?   C . n 
C 1 103 PRO 103 83  ?   ?   ?   C . n 
C 1 104 LYS 104 84  84  LYS LYS C . n 
C 1 105 VAL 105 85  85  VAL VAL C . n 
C 1 106 TYR 106 86  ?   ?   ?   C . n 
C 1 107 LYS 107 87  ?   ?   ?   C . n 
C 1 108 ASN 108 88  ?   ?   ?   C . n 
C 1 109 PHE 109 89  ?   ?   ?   C . n 
C 1 110 ILE 110 90  ?   ?   ?   C . n 
C 1 111 ARG 111 91  ?   ?   ?   C . n 
C 1 112 GLN 112 92  ?   ?   ?   C . n 
C 1 113 CYS 113 93  ?   ?   ?   C . n 
C 1 114 ARG 114 94  ?   ?   ?   C . n 
C 1 115 ILE 115 95  ?   ?   ?   C . n 
C 1 116 VAL 116 96  ?   ?   ?   C . n 
C 1 117 GLN 117 97  ?   ?   ?   C . n 
C 1 118 GLY 118 98  ?   ?   ?   C . n 
C 1 119 ASP 119 99  ?   ?   ?   C . n 
C 1 120 GLY 120 100 ?   ?   ?   C . n 
C 1 121 LEU 121 101 ?   ?   ?   C . n 
C 1 122 HIS 122 102 ?   ?   ?   C . n 
C 1 123 VAL 123 103 ?   ?   ?   C . n 
C 1 124 GLY 124 104 ?   ?   ?   C . n 
C 1 125 ASP 125 105 ?   ?   ?   C . n 
C 1 126 LEU 126 106 ?   ?   ?   C . n 
C 1 127 ARG 127 107 ?   ?   ?   C . n 
C 1 128 GLU 128 108 ?   ?   ?   C . n 
C 1 129 VAL 129 109 ?   ?   ?   C . n 
C 1 130 MET 130 110 ?   ?   ?   C . n 
C 1 131 VAL 131 111 111 VAL VAL C . n 
C 1 132 VAL 132 112 112 VAL VAL C . n 
C 1 133 SER 133 113 113 SER SER C . n 
C 1 134 GLY 134 114 114 GLY GLY C . n 
C 1 135 LEU 135 115 115 LEU LEU C . n 
C 1 136 PRO 136 116 116 PRO PRO C . n 
C 1 137 ALA 137 117 117 ALA ALA C . n 
C 1 138 VAL 138 118 118 VAL VAL C . n 
C 1 139 SER 139 119 119 SER SER C . n 
C 1 140 SER 140 120 120 SER SER C . n 
C 1 141 THR 141 121 121 THR THR C . n 
C 1 142 GLU 142 122 122 GLU GLU C . n 
C 1 143 ARG 143 123 123 ARG ARG C . n 
C 1 144 LEU 144 124 124 LEU LEU C . n 
C 1 145 GLU 145 125 125 GLU GLU C . n 
C 1 146 ILE 146 126 126 ILE ILE C . n 
C 1 147 LEU 147 127 127 LEU LEU C . n 
C 1 148 ASP 148 128 128 ASP ASP C . n 
C 1 149 GLU 149 129 129 GLU GLU C . n 
C 1 150 GLU 150 130 130 GLU GLU C . n 
C 1 151 ARG 151 131 131 ARG ARG C . n 
C 1 152 HIS 152 132 132 HIS HIS C . n 
C 1 153 VAL 153 133 133 VAL VAL C . n 
C 1 154 ILE 154 134 134 ILE ILE C . n 
C 1 155 SER 155 135 135 SER SER C . n 
C 1 156 PHE 156 136 136 PHE PHE C . n 
C 1 157 SER 157 137 137 SER SER C . n 
C 1 158 VAL 158 138 138 VAL VAL C . n 
C 1 159 VAL 159 139 139 VAL VAL C . n 
C 1 160 GLY 160 140 ?   ?   ?   C . n 
C 1 161 GLY 161 141 ?   ?   ?   C . n 
C 1 162 ASP 162 142 ?   ?   ?   C . n 
C 1 163 HIS 163 143 ?   ?   ?   C . n 
C 1 164 ARG 164 144 ?   ?   ?   C . n 
C 1 165 LEU 165 145 ?   ?   ?   C . n 
C 1 166 LYS 166 146 ?   ?   ?   C . n 
C 1 167 ASN 167 147 147 ASN ASN C . n 
C 1 168 TYR 168 148 148 TYR TYR C . n 
C 1 169 ARG 169 149 149 ARG ARG C . n 
C 1 170 SER 170 150 150 SER SER C . n 
C 1 171 VAL 171 151 151 VAL VAL C . n 
C 1 172 THR 172 152 152 THR THR C . n 
C 1 173 THR 173 153 153 THR THR C . n 
C 1 174 LEU 174 154 154 LEU LEU C . n 
C 1 175 HIS 175 155 ?   ?   ?   C . n 
C 1 176 ALA 176 156 ?   ?   ?   C . n 
C 1 177 SER 177 157 ?   ?   ?   C . n 
C 1 178 ASP 178 158 ?   ?   ?   C . n 
C 1 179 ASP 179 159 ?   ?   ?   C . n 
C 1 180 GLU 180 160 160 GLU GLU C . n 
C 1 181 GLY 181 161 161 GLY GLY C . n 
C 1 182 THR 182 162 162 THR THR C . n 
C 1 183 VAL 183 163 163 VAL VAL C . n 
C 1 184 VAL 184 164 164 VAL VAL C . n 
C 1 185 VAL 185 165 165 VAL VAL C . n 
C 1 186 GLU 186 166 166 GLU GLU C . n 
C 1 187 SER 187 167 167 SER SER C . n 
C 1 188 TYR 188 168 168 TYR TYR C . n 
C 1 189 ILE 189 169 169 ILE ILE C . n 
C 1 190 VAL 190 170 170 VAL VAL C . n 
C 1 191 ASP 191 171 171 ASP ASP C . n 
C 1 192 VAL 192 172 172 VAL VAL C . n 
C 1 193 PRO 193 173 173 PRO PRO C . n 
C 1 194 PRO 194 174 174 PRO PRO C . n 
C 1 195 GLY 195 175 175 GLY GLY C . n 
C 1 196 ASN 196 176 176 ASN ASN C . n 
C 1 197 THR 197 177 177 THR THR C . n 
C 1 198 GLU 198 178 178 GLU GLU C . n 
C 1 199 GLU 199 179 179 GLU GLU C . n 
C 1 200 GLU 200 180 180 GLU GLU C . n 
C 1 201 THR 201 181 181 THR THR C . n 
C 1 202 LEU 202 182 182 LEU LEU C . n 
C 1 203 SER 203 183 183 SER SER C . n 
C 1 204 PHE 204 184 184 PHE PHE C . n 
C 1 205 VAL 205 185 185 VAL VAL C . n 
C 1 206 ASP 206 186 186 ASP ASP C . n 
C 1 207 THR 207 187 187 THR THR C . n 
C 1 208 ILE 208 188 188 ILE ILE C . n 
C 1 209 VAL 209 189 189 VAL VAL C . n 
C 1 210 ARG 210 190 190 ARG ARG C . n 
C 1 211 CYS 211 191 191 CYS CYS C . n 
C 1 212 ASN 212 192 192 ASN ASN C . n 
C 1 213 LEU 213 193 193 LEU LEU C . n 
C 1 214 GLN 214 194 194 GLN GLN C . n 
C 1 215 SER 215 195 195 SER SER C . n 
C 1 216 LEU 216 196 196 LEU LEU C . n 
C 1 217 ALA 217 197 197 ALA ALA C . n 
C 1 218 ARG 218 198 198 ARG ARG C . n 
C 1 219 SER 219 199 199 SER SER C . n 
C 1 220 THR 220 200 200 THR THR C . n 
C 1 221 ASN 221 201 201 ASN ASN C . n 
C 1 222 ARG 222 202 202 ARG ARG C . n 
C 1 223 GLN 223 203 ?   ?   ?   C . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,C,D,E,F,G,H,I,J,O,P,R 
2 1,2 B,K,L,M,N,Q             
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 4_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 423 ? P HOH . 
2 1 C HOH 560 ? R HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-03-13 
2 'Structure model' 1 1 2013-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
BALBES    phasing           .        ? 2 
REFMAC    refinement        5.7.0029 ? 3 
HKL-2000  'data reduction'  .        ? 4 
HKL-2000  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG A SER 120 ? ? OE2 A GLU 122 ? ? 2.16 
2 1 O  A HOH 554 ? ? O   A HOH 577 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 43  ? ? -29.34  -51.97  
2  1 HIS A 48  ? ? -103.37 -77.88  
3  1 THR A 50  ? ? -60.22  95.57   
4  1 ASP A 56  ? ? -110.63 52.10   
5  1 SER A 61  ? ? -81.77  -151.10 
6  1 VAL A 62  ? ? -179.28 94.35   
7  1 ARG A 79  ? ? -48.93  97.26   
8  1 ASP A 81  ? ? -42.14  -82.12  
9  1 VAL A 85  ? ? -29.45  -42.79  
10 1 TYR A 86  ? ? -148.70 -17.41  
11 1 ARG A 94  ? ? -100.82 -152.57 
12 1 HIS A 102 ? ? -173.39 -179.35 
13 1 PRO A 116 ? ? -91.74  -104.25 
14 1 VAL A 118 ? ? 158.72  138.27  
15 1 HIS A 132 ? ? -47.62  98.18   
16 1 VAL A 138 ? ? -99.39  42.36   
17 1 LYS A 146 ? ? -75.11  -120.63 
18 1 ARG A 149 ? ? -163.09 66.71   
19 1 SER A 150 ? ? -65.22  88.14   
20 1 ASP A 171 ? ? -43.69  107.17  
21 1 ASN A 176 ? ? -164.15 -153.80 
22 1 THR A 177 ? ? -79.71  -165.31 
23 1 GLU A 180 ? ? -130.90 -45.73  
24 1 VAL B 41  ? ? 179.83  129.62  
25 1 VAL B 45  ? ? -48.30  -10.05  
26 1 CYS B 59  ? ? 171.78  146.40  
27 1 SER B 60  ? ? -175.27 121.06  
28 1 SER B 61  ? ? -76.29  -162.72 
29 1 TRP B 74  ? ? -37.14  -37.02  
30 1 ARG B 79  ? ? -52.48  102.20  
31 1 ARG B 94  ? ? -120.02 -154.35 
32 1 HIS B 102 ? ? -111.95 -166.18 
33 1 LEU B 106 ? ? -49.17  156.71  
34 1 VAL B 118 ? ? -169.79 108.17  
35 1 SER B 120 ? ? -66.79  -168.50 
36 1 THR B 121 ? ? -152.58 72.37   
37 1 HIS B 132 ? ? 57.71   13.57   
38 1 VAL B 139 ? ? -111.54 55.51   
39 1 ASP B 142 ? ? -104.31 67.95   
40 1 LEU B 145 ? ? -174.74 -36.95  
41 1 LYS B 146 ? ? 75.94   -130.09 
42 1 THR B 153 ? ? -36.99  127.26  
43 1 HIS B 155 ? ? -76.46  -142.07 
44 1 VAL B 170 ? ? -90.99  -146.62 
45 1 THR B 177 ? ? -78.58  -156.11 
46 1 SER B 199 ? ? -57.63  -74.06  
47 1 ASN B 201 ? ? -77.51  -157.40 
48 1 MET C 39  ? ? -67.77  -159.94 
49 1 ALA C 46  ? ? -61.12  -86.26  
50 1 HIS C 48  ? ? -68.73  -83.43  
51 1 CYS C 59  ? ? 176.11  164.06  
52 1 ARG C 79  ? ? -103.80 68.78   
53 1 SER C 113 ? ? 57.17   -143.92 
54 1 VAL C 118 ? ? -161.36 105.71  
55 1 HIS C 132 ? ? 80.72   62.55   
56 1 ARG C 149 ? ? -163.21 53.22   
57 1 TYR C 168 ? ? -157.07 -158.90 
58 1 VAL C 170 ? ? -169.29 -166.60 
59 1 VAL C 172 ? ? -114.89 74.97   
60 1 PRO C 174 ? ? -23.12  118.18  
61 1 ASN C 176 ? ? -152.91 -157.90 
62 1 GLU C 179 ? ? -82.45  30.21   
63 1 GLU C 180 ? ? -139.46 -44.49  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   THR 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    200 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    201 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -137.11 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A MET 39  ? CG  ? A MET 59  CG  
2   1 Y 1 A MET 39  ? SD  ? A MET 59  SD  
3   1 Y 1 A MET 39  ? CE  ? A MET 59  CE  
4   1 Y 1 A VAL 45  ? CG1 ? A VAL 65  CG1 
5   1 Y 1 A VAL 45  ? CG2 ? A VAL 65  CG2 
6   1 Y 1 A THR 50  ? OG1 ? A THR 70  OG1 
7   1 Y 1 A THR 50  ? CG2 ? A THR 70  CG2 
8   1 Y 1 A VAL 53  ? CG1 ? A VAL 73  CG1 
9   1 Y 1 A VAL 53  ? CG2 ? A VAL 73  CG2 
10  1 Y 1 A ASP 56  ? CG  ? A ASP 76  CG  
11  1 Y 1 A ASP 56  ? OD1 ? A ASP 76  OD1 
12  1 Y 1 A ASP 56  ? OD2 ? A ASP 76  OD2 
13  1 Y 1 A CYS 59  ? SG  ? A CYS 79  SG  
14  1 Y 1 A VAL 62  ? CG1 ? A VAL 82  CG1 
15  1 Y 1 A VAL 62  ? CG2 ? A VAL 82  CG2 
16  1 Y 1 A GLU 71  ? CG  ? A GLU 91  CG  
17  1 Y 1 A GLU 71  ? CD  ? A GLU 91  CD  
18  1 Y 1 A GLU 71  ? OE1 ? A GLU 91  OE1 
19  1 Y 1 A GLU 71  ? OE2 ? A GLU 91  OE2 
20  1 Y 1 A LEU 76  ? CD1 ? A LEU 96  CD1 
21  1 Y 1 A LEU 76  ? CD2 ? A LEU 96  CD2 
22  1 Y 1 A ASP 81  ? CG  ? A ASP 101 CG  
23  1 Y 1 A ASP 81  ? OD1 ? A ASP 101 OD1 
24  1 Y 1 A ASP 81  ? OD2 ? A ASP 101 OD2 
25  1 Y 1 A LYS 87  ? CG  ? A LYS 107 CG  
26  1 Y 1 A LYS 87  ? CD  ? A LYS 107 CD  
27  1 Y 1 A LYS 87  ? CE  ? A LYS 107 CE  
28  1 Y 1 A LYS 87  ? NZ  ? A LYS 107 NZ  
29  1 Y 1 A ARG 91  ? NH1 ? A ARG 111 NH1 
30  1 Y 1 A ARG 91  ? NH2 ? A ARG 111 NH2 
31  1 Y 1 A ARG 94  ? NH1 ? A ARG 114 NH1 
32  1 Y 1 A GLN 97  ? CG  ? A GLN 117 CG  
33  1 Y 1 A GLN 97  ? CD  ? A GLN 117 CD  
34  1 Y 1 A GLN 97  ? OE1 ? A GLN 117 OE1 
35  1 Y 1 A GLN 97  ? NE2 ? A GLN 117 NE2 
36  1 Y 1 A VAL 103 ? CG1 ? A VAL 123 CG1 
37  1 Y 1 A VAL 103 ? CG2 ? A VAL 123 CG2 
38  1 Y 1 A GLU 108 ? CG  ? A GLU 128 CG  
39  1 Y 1 A GLU 108 ? CD  ? A GLU 128 CD  
40  1 Y 1 A GLU 108 ? OE1 ? A GLU 128 OE1 
41  1 Y 1 A GLU 108 ? OE2 ? A GLU 128 OE2 
42  1 Y 1 A VAL 109 ? CG1 ? A VAL 129 CG1 
43  1 Y 1 A VAL 109 ? CG2 ? A VAL 129 CG2 
44  1 Y 1 A THR 121 ? OG1 ? A THR 141 OG1 
45  1 Y 1 A THR 121 ? CG2 ? A THR 141 CG2 
46  1 Y 1 A LYS 146 ? CG  ? A LYS 166 CG  
47  1 Y 1 A LYS 146 ? CD  ? A LYS 166 CD  
48  1 Y 1 A LYS 146 ? CE  ? A LYS 166 CE  
49  1 Y 1 A LYS 146 ? NZ  ? A LYS 166 NZ  
50  1 Y 1 A ASN 147 ? CG  ? A ASN 167 CG  
51  1 Y 1 A ASN 147 ? OD1 ? A ASN 167 OD1 
52  1 Y 1 A ASN 147 ? ND2 ? A ASN 167 ND2 
53  1 Y 1 A VAL 151 ? CG1 ? A VAL 171 CG1 
54  1 Y 1 A VAL 151 ? CG2 ? A VAL 171 CG2 
55  1 Y 1 A VAL 170 ? CG1 ? A VAL 190 CG1 
56  1 Y 1 A VAL 170 ? CG2 ? A VAL 190 CG2 
57  1 Y 1 A ASP 171 ? CG  ? A ASP 191 CG  
58  1 Y 1 A ASP 171 ? OD1 ? A ASP 191 OD1 
59  1 Y 1 A ASP 171 ? OD2 ? A ASP 191 OD2 
60  1 Y 1 A VAL 172 ? CG1 ? A VAL 192 CG1 
61  1 Y 1 A VAL 172 ? CG2 ? A VAL 192 CG2 
62  1 Y 1 A ASN 176 ? ND2 ? A ASN 196 ND2 
63  1 Y 1 A GLU 178 ? CG  ? A GLU 198 CG  
64  1 Y 1 A GLU 178 ? CD  ? A GLU 198 CD  
65  1 Y 1 A GLU 178 ? OE1 ? A GLU 198 OE1 
66  1 Y 1 A GLU 178 ? OE2 ? A GLU 198 OE2 
67  1 Y 1 A ASN 192 ? CG  ? A ASN 212 CG  
68  1 Y 1 A ASN 192 ? OD1 ? A ASN 212 OD1 
69  1 Y 1 A ASN 192 ? ND2 ? A ASN 212 ND2 
70  1 Y 1 A ARG 202 ? CG  ? A ARG 222 CG  
71  1 Y 1 A ARG 202 ? CD  ? A ARG 222 CD  
72  1 Y 1 A ARG 202 ? NE  ? A ARG 222 NE  
73  1 Y 1 A ARG 202 ? CZ  ? A ARG 222 CZ  
74  1 Y 1 A ARG 202 ? NH1 ? A ARG 222 NH1 
75  1 Y 1 A ARG 202 ? NH2 ? A ARG 222 NH2 
76  1 Y 1 A GLN 203 ? CG  ? A GLN 223 CG  
77  1 Y 1 A GLN 203 ? CD  ? A GLN 223 CD  
78  1 Y 1 A GLN 203 ? OE1 ? A GLN 223 OE1 
79  1 Y 1 A GLN 203 ? NE2 ? A GLN 223 NE2 
80  1 Y 1 B HIS 40  ? CG  ? B HIS 60  CG  
81  1 Y 1 B HIS 40  ? ND1 ? B HIS 60  ND1 
82  1 Y 1 B HIS 40  ? CD2 ? B HIS 60  CD2 
83  1 Y 1 B HIS 40  ? CE1 ? B HIS 60  CE1 
84  1 Y 1 B HIS 40  ? NE2 ? B HIS 60  NE2 
85  1 Y 1 B VAL 41  ? CG1 ? B VAL 61  CG1 
86  1 Y 1 B VAL 41  ? CG2 ? B VAL 61  CG2 
87  1 Y 1 B GLU 43  ? CG  ? B GLU 63  CG  
88  1 Y 1 B GLU 43  ? CD  ? B GLU 63  CD  
89  1 Y 1 B GLU 43  ? OE1 ? B GLU 63  OE1 
90  1 Y 1 B GLU 43  ? OE2 ? B GLU 63  OE2 
91  1 Y 1 B HIS 44  ? CG  ? B HIS 64  CG  
92  1 Y 1 B HIS 44  ? ND1 ? B HIS 64  ND1 
93  1 Y 1 B HIS 44  ? CD2 ? B HIS 64  CD2 
94  1 Y 1 B HIS 44  ? CE1 ? B HIS 64  CE1 
95  1 Y 1 B HIS 44  ? NE2 ? B HIS 64  NE2 
96  1 Y 1 B VAL 45  ? CG1 ? B VAL 65  CG1 
97  1 Y 1 B VAL 45  ? CG2 ? B VAL 65  CG2 
98  1 Y 1 B THR 50  ? OG1 ? B THR 70  OG1 
99  1 Y 1 B THR 50  ? CG2 ? B THR 70  CG2 
100 1 Y 1 B HIS 51  ? CG  ? B HIS 71  CG  
101 1 Y 1 B HIS 51  ? ND1 ? B HIS 71  ND1 
102 1 Y 1 B HIS 51  ? CD2 ? B HIS 71  CD2 
103 1 Y 1 B HIS 51  ? CE1 ? B HIS 71  CE1 
104 1 Y 1 B HIS 51  ? NE2 ? B HIS 71  NE2 
105 1 Y 1 B ASP 52  ? CG  ? B ASP 72  CG  
106 1 Y 1 B ASP 52  ? OD1 ? B ASP 72  OD1 
107 1 Y 1 B ASP 52  ? OD2 ? B ASP 72  OD2 
108 1 Y 1 B ASP 56  ? CG  ? B ASP 76  CG  
109 1 Y 1 B ASP 56  ? OD1 ? B ASP 76  OD1 
110 1 Y 1 B ASP 56  ? OD2 ? B ASP 76  OD2 
111 1 Y 1 B GLN 64  ? CG  ? B GLN 84  CG  
112 1 Y 1 B GLN 64  ? CD  ? B GLN 84  CD  
113 1 Y 1 B GLN 64  ? OE1 ? B GLN 84  OE1 
114 1 Y 1 B GLN 64  ? NE2 ? B GLN 84  NE2 
115 1 Y 1 B ILE 66  ? CG1 ? B ILE 86  CG1 
116 1 Y 1 B ILE 66  ? CG2 ? B ILE 86  CG2 
117 1 Y 1 B ILE 66  ? CD1 ? B ILE 86  CD1 
118 1 Y 1 B LEU 76  ? CG  ? B LEU 96  CG  
119 1 Y 1 B LEU 76  ? CD1 ? B LEU 96  CD1 
120 1 Y 1 B LEU 76  ? CD2 ? B LEU 96  CD2 
121 1 Y 1 B ASP 81  ? CG  ? B ASP 101 CG  
122 1 Y 1 B ASP 81  ? OD1 ? B ASP 101 OD1 
123 1 Y 1 B ASP 81  ? OD2 ? B ASP 101 OD2 
124 1 Y 1 B ILE 95  ? CG1 ? B ILE 115 CG1 
125 1 Y 1 B ILE 95  ? CG2 ? B ILE 115 CG2 
126 1 Y 1 B ILE 95  ? CD1 ? B ILE 115 CD1 
127 1 Y 1 B ASP 105 ? CG  ? B ASP 125 CG  
128 1 Y 1 B ASP 105 ? OD1 ? B ASP 125 OD1 
129 1 Y 1 B ASP 105 ? OD2 ? B ASP 125 OD2 
130 1 Y 1 B VAL 109 ? CG2 ? B VAL 129 CG2 
131 1 Y 1 B VAL 111 ? CG1 ? B VAL 131 CG1 
132 1 Y 1 B VAL 111 ? CG2 ? B VAL 131 CG2 
133 1 Y 1 B THR 121 ? OG1 ? B THR 141 OG1 
134 1 Y 1 B THR 121 ? CG2 ? B THR 141 CG2 
135 1 Y 1 B LEU 145 ? CD2 ? B LEU 165 CD2 
136 1 Y 1 B LYS 146 ? CG  ? B LYS 166 CG  
137 1 Y 1 B LYS 146 ? CD  ? B LYS 166 CD  
138 1 Y 1 B LYS 146 ? CE  ? B LYS 166 CE  
139 1 Y 1 B LYS 146 ? NZ  ? B LYS 166 NZ  
140 1 Y 1 B ASN 147 ? CG  ? B ASN 167 CG  
141 1 Y 1 B ASN 147 ? OD1 ? B ASN 167 OD1 
142 1 Y 1 B ASN 147 ? ND2 ? B ASN 167 ND2 
143 1 Y 1 B TYR 168 ? OH  ? B TYR 188 OH  
144 1 Y 1 B ILE 169 ? CG1 ? B ILE 189 CG1 
145 1 Y 1 B ILE 169 ? CG2 ? B ILE 189 CG2 
146 1 Y 1 B ILE 169 ? CD1 ? B ILE 189 CD1 
147 1 Y 1 B VAL 170 ? CG1 ? B VAL 190 CG1 
148 1 Y 1 B VAL 170 ? CG2 ? B VAL 190 CG2 
149 1 Y 1 B VAL 172 ? CG1 ? B VAL 192 CG1 
150 1 Y 1 B VAL 172 ? CG2 ? B VAL 192 CG2 
151 1 Y 1 B THR 177 ? OG1 ? B THR 197 OG1 
152 1 Y 1 B THR 177 ? CG2 ? B THR 197 CG2 
153 1 Y 1 B GLU 178 ? CG  ? B GLU 198 CG  
154 1 Y 1 B GLU 178 ? CD  ? B GLU 198 CD  
155 1 Y 1 B GLU 178 ? OE1 ? B GLU 198 OE1 
156 1 Y 1 B GLU 178 ? OE2 ? B GLU 198 OE2 
157 1 Y 1 B GLU 180 ? CG  ? B GLU 200 CG  
158 1 Y 1 B GLU 180 ? CD  ? B GLU 200 CD  
159 1 Y 1 B GLU 180 ? OE1 ? B GLU 200 OE1 
160 1 Y 1 B GLU 180 ? OE2 ? B GLU 200 OE2 
161 1 Y 1 B LEU 182 ? CG  ? B LEU 202 CG  
162 1 Y 1 B LEU 182 ? CD1 ? B LEU 202 CD1 
163 1 Y 1 B LEU 182 ? CD2 ? B LEU 202 CD2 
164 1 Y 1 B VAL 185 ? CG1 ? B VAL 205 CG1 
165 1 Y 1 B VAL 185 ? CG2 ? B VAL 205 CG2 
166 1 Y 1 B VAL 189 ? CG1 ? B VAL 209 CG1 
167 1 Y 1 B VAL 189 ? CG2 ? B VAL 209 CG2 
168 1 Y 1 B ARG 198 ? CZ  ? B ARG 218 CZ  
169 1 Y 1 B ARG 198 ? NH1 ? B ARG 218 NH1 
170 1 Y 1 B ARG 198 ? NH2 ? B ARG 218 NH2 
171 1 Y 1 B ARG 202 ? CG  ? B ARG 222 CG  
172 1 Y 1 B ARG 202 ? CD  ? B ARG 222 CD  
173 1 Y 1 B ARG 202 ? NE  ? B ARG 222 NE  
174 1 Y 1 B ARG 202 ? CZ  ? B ARG 222 CZ  
175 1 Y 1 B ARG 202 ? NH1 ? B ARG 222 NH1 
176 1 Y 1 B ARG 202 ? NH2 ? B ARG 222 NH2 
177 1 Y 1 C MET 39  ? CG  ? C MET 59  CG  
178 1 Y 1 C MET 39  ? SD  ? C MET 59  SD  
179 1 Y 1 C MET 39  ? CE  ? C MET 59  CE  
180 1 Y 1 C HIS 40  ? CG  ? C HIS 60  CG  
181 1 Y 1 C HIS 40  ? ND1 ? C HIS 60  ND1 
182 1 Y 1 C HIS 40  ? CD2 ? C HIS 60  CD2 
183 1 Y 1 C HIS 40  ? CE1 ? C HIS 60  CE1 
184 1 Y 1 C HIS 40  ? NE2 ? C HIS 60  NE2 
185 1 Y 1 C VAL 41  ? CG1 ? C VAL 61  CG1 
186 1 Y 1 C VAL 41  ? CG2 ? C VAL 61  CG2 
187 1 Y 1 C HIS 44  ? CG  ? C HIS 64  CG  
188 1 Y 1 C HIS 44  ? ND1 ? C HIS 64  ND1 
189 1 Y 1 C HIS 44  ? CD2 ? C HIS 64  CD2 
190 1 Y 1 C HIS 44  ? CE1 ? C HIS 64  CE1 
191 1 Y 1 C HIS 44  ? NE2 ? C HIS 64  NE2 
192 1 Y 1 C VAL 45  ? CG1 ? C VAL 65  CG1 
193 1 Y 1 C VAL 45  ? CG2 ? C VAL 65  CG2 
194 1 Y 1 C ASP 56  ? CG  ? C ASP 76  CG  
195 1 Y 1 C ASP 56  ? OD1 ? C ASP 76  OD1 
196 1 Y 1 C ASP 56  ? OD2 ? C ASP 76  OD2 
197 1 Y 1 C VAL 62  ? CG1 ? C VAL 82  CG1 
198 1 Y 1 C VAL 62  ? CG2 ? C VAL 82  CG2 
199 1 Y 1 C LYS 84  ? CG  ? C LYS 104 CG  
200 1 Y 1 C LYS 84  ? CD  ? C LYS 104 CD  
201 1 Y 1 C LYS 84  ? CE  ? C LYS 104 CE  
202 1 Y 1 C LYS 84  ? NZ  ? C LYS 104 NZ  
203 1 Y 1 C VAL 111 ? CG1 ? C VAL 131 CG1 
204 1 Y 1 C VAL 111 ? CG2 ? C VAL 131 CG2 
205 1 Y 1 C VAL 112 ? CG1 ? C VAL 132 CG1 
206 1 Y 1 C VAL 112 ? CG2 ? C VAL 132 CG2 
207 1 Y 1 C LEU 115 ? CD1 ? C LEU 135 CD1 
208 1 Y 1 C LEU 115 ? CD2 ? C LEU 135 CD2 
209 1 Y 1 C VAL 151 ? CG1 ? C VAL 171 CG1 
210 1 Y 1 C VAL 151 ? CG2 ? C VAL 171 CG2 
211 1 Y 1 C GLU 160 ? CG  ? C GLU 180 CG  
212 1 Y 1 C GLU 160 ? CD  ? C GLU 180 CD  
213 1 Y 1 C GLU 160 ? OE1 ? C GLU 180 OE1 
214 1 Y 1 C GLU 160 ? OE2 ? C GLU 180 OE2 
215 1 Y 1 C GLU 166 ? OE2 ? C GLU 186 OE2 
216 1 Y 1 C ILE 169 ? CG2 ? C ILE 189 CG2 
217 1 Y 1 C VAL 170 ? CG1 ? C VAL 190 CG1 
218 1 Y 1 C VAL 170 ? CG2 ? C VAL 190 CG2 
219 1 Y 1 C ARG 202 ? CG  ? C ARG 222 CG  
220 1 Y 1 C ARG 202 ? CD  ? C ARG 222 CD  
221 1 Y 1 C ARG 202 ? NE  ? C ARG 222 NE  
222 1 Y 1 C ARG 202 ? CZ  ? C ARG 222 CZ  
223 1 Y 1 C ARG 202 ? NH1 ? C ARG 222 NH1 
224 1 Y 1 C ARG 202 ? NH2 ? C ARG 222 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -19 ? A MET 1   
2   1 Y 1 A GLY -18 ? A GLY 2   
3   1 Y 1 A SER -17 ? A SER 3   
4   1 Y 1 A SER -16 ? A SER 4   
5   1 Y 1 A HIS -15 ? A HIS 5   
6   1 Y 1 A HIS -14 ? A HIS 6   
7   1 Y 1 A HIS -13 ? A HIS 7   
8   1 Y 1 A HIS -12 ? A HIS 8   
9   1 Y 1 A HIS -11 ? A HIS 9   
10  1 Y 1 A SER -10 ? A SER 10  
11  1 Y 1 A SER -9  ? A SER 11  
12  1 Y 1 A GLY -8  ? A GLY 12  
13  1 Y 1 A GLU -7  ? A GLU 13  
14  1 Y 1 A ASN -6  ? A ASN 14  
15  1 Y 1 A LEU -5  ? A LEU 15  
16  1 Y 1 A TYR -4  ? A TYR 16  
17  1 Y 1 A PHE -3  ? A PHE 17  
18  1 Y 1 A GLN -2  ? A GLN 18  
19  1 Y 1 A GLY -1  ? A GLY 19  
20  1 Y 1 A HIS 0   ? A HIS 20  
21  1 Y 1 A MET 1   ? A MET 21  
22  1 Y 1 A ARG 2   ? A ARG 22  
23  1 Y 1 A SER 3   ? A SER 23  
24  1 Y 1 A PRO 4   ? A PRO 24  
25  1 Y 1 A VAL 5   ? A VAL 25  
26  1 Y 1 A GLN 6   ? A GLN 26  
27  1 Y 1 A LEU 7   ? A LEU 27  
28  1 Y 1 A GLN 8   ? A GLN 28  
29  1 Y 1 A HIS 9   ? A HIS 29  
30  1 Y 1 A GLY 10  ? A GLY 30  
31  1 Y 1 A SER 11  ? A SER 31  
32  1 Y 1 A ASP 12  ? A ASP 32  
33  1 Y 1 A ALA 13  ? A ALA 33  
34  1 Y 1 A THR 14  ? A THR 34  
35  1 Y 1 A ASN 15  ? A ASN 35  
36  1 Y 1 A GLY 16  ? A GLY 36  
37  1 Y 1 A PHE 17  ? A PHE 37  
38  1 Y 1 A HIS 18  ? A HIS 38  
39  1 Y 1 A THR 19  ? A THR 39  
40  1 Y 1 A LEU 20  ? A LEU 40  
41  1 Y 1 A GLN 21  ? A GLN 41  
42  1 Y 1 A PRO 22  ? A PRO 42  
43  1 Y 1 A HIS 23  ? A HIS 43  
44  1 Y 1 A ASP 24  ? A ASP 44  
45  1 Y 1 A GLN 25  ? A GLN 45  
46  1 Y 1 A THR 26  ? A THR 46  
47  1 Y 1 A ASP 27  ? A ASP 47  
48  1 Y 1 A GLY 28  ? A GLY 48  
49  1 Y 1 A PRO 29  ? A PRO 49  
50  1 Y 1 A ILE 30  ? A ILE 50  
51  1 Y 1 A LYS 31  ? A LYS 51  
52  1 Y 1 A ARG 32  ? A ARG 52  
53  1 Y 1 A VAL 33  ? A VAL 53  
54  1 Y 1 A CYS 34  ? A CYS 54  
55  1 Y 1 A LEU 35  ? A LEU 55  
56  1 Y 1 A THR 36  ? A THR 56  
57  1 Y 1 A GLY 98  ? A GLY 118 
58  1 Y 1 A ASP 99  ? A ASP 119 
59  1 Y 1 A GLY 100 ? A GLY 120 
60  1 Y 1 A VAL 112 ? A VAL 132 
61  1 Y 1 A SER 113 ? A SER 133 
62  1 Y 1 A GLY 114 ? A GLY 134 
63  1 Y 1 A HIS 155 ? A HIS 175 
64  1 Y 1 A ALA 156 ? A ALA 176 
65  1 Y 1 A SER 157 ? A SER 177 
66  1 Y 1 A ASP 158 ? A ASP 178 
67  1 Y 1 A ASP 159 ? A ASP 179 
68  1 Y 1 A GLU 160 ? A GLU 180 
69  1 Y 1 A GLY 161 ? A GLY 181 
70  1 Y 1 A THR 162 ? A THR 182 
71  1 Y 1 B MET -19 ? B MET 1   
72  1 Y 1 B GLY -18 ? B GLY 2   
73  1 Y 1 B SER -17 ? B SER 3   
74  1 Y 1 B SER -16 ? B SER 4   
75  1 Y 1 B HIS -15 ? B HIS 5   
76  1 Y 1 B HIS -14 ? B HIS 6   
77  1 Y 1 B HIS -13 ? B HIS 7   
78  1 Y 1 B HIS -12 ? B HIS 8   
79  1 Y 1 B HIS -11 ? B HIS 9   
80  1 Y 1 B SER -10 ? B SER 10  
81  1 Y 1 B SER -9  ? B SER 11  
82  1 Y 1 B GLY -8  ? B GLY 12  
83  1 Y 1 B GLU -7  ? B GLU 13  
84  1 Y 1 B ASN -6  ? B ASN 14  
85  1 Y 1 B LEU -5  ? B LEU 15  
86  1 Y 1 B TYR -4  ? B TYR 16  
87  1 Y 1 B PHE -3  ? B PHE 17  
88  1 Y 1 B GLN -2  ? B GLN 18  
89  1 Y 1 B GLY -1  ? B GLY 19  
90  1 Y 1 B HIS 0   ? B HIS 20  
91  1 Y 1 B MET 1   ? B MET 21  
92  1 Y 1 B ARG 2   ? B ARG 22  
93  1 Y 1 B SER 3   ? B SER 23  
94  1 Y 1 B PRO 4   ? B PRO 24  
95  1 Y 1 B VAL 5   ? B VAL 25  
96  1 Y 1 B GLN 6   ? B GLN 26  
97  1 Y 1 B LEU 7   ? B LEU 27  
98  1 Y 1 B GLN 8   ? B GLN 28  
99  1 Y 1 B HIS 9   ? B HIS 29  
100 1 Y 1 B GLY 10  ? B GLY 30  
101 1 Y 1 B SER 11  ? B SER 31  
102 1 Y 1 B ASP 12  ? B ASP 32  
103 1 Y 1 B ALA 13  ? B ALA 33  
104 1 Y 1 B THR 14  ? B THR 34  
105 1 Y 1 B ASN 15  ? B ASN 35  
106 1 Y 1 B GLY 16  ? B GLY 36  
107 1 Y 1 B PHE 17  ? B PHE 37  
108 1 Y 1 B HIS 18  ? B HIS 38  
109 1 Y 1 B THR 19  ? B THR 39  
110 1 Y 1 B LEU 20  ? B LEU 40  
111 1 Y 1 B GLN 21  ? B GLN 41  
112 1 Y 1 B PRO 22  ? B PRO 42  
113 1 Y 1 B HIS 23  ? B HIS 43  
114 1 Y 1 B ASP 24  ? B ASP 44  
115 1 Y 1 B GLN 25  ? B GLN 45  
116 1 Y 1 B THR 26  ? B THR 46  
117 1 Y 1 B ASP 27  ? B ASP 47  
118 1 Y 1 B GLY 28  ? B GLY 48  
119 1 Y 1 B PRO 29  ? B PRO 49  
120 1 Y 1 B ILE 30  ? B ILE 50  
121 1 Y 1 B LYS 31  ? B LYS 51  
122 1 Y 1 B ARG 32  ? B ARG 52  
123 1 Y 1 B VAL 33  ? B VAL 53  
124 1 Y 1 B CYS 34  ? B CYS 54  
125 1 Y 1 B LEU 35  ? B LEU 55  
126 1 Y 1 B GLN 97  ? B GLN 117 
127 1 Y 1 B GLY 98  ? B GLY 118 
128 1 Y 1 B ASP 99  ? B ASP 119 
129 1 Y 1 B GLY 100 ? B GLY 120 
130 1 Y 1 B VAL 112 ? B VAL 132 
131 1 Y 1 B SER 113 ? B SER 133 
132 1 Y 1 B GLY 114 ? B GLY 134 
133 1 Y 1 B LEU 115 ? B LEU 135 
134 1 Y 1 B ASP 158 ? B ASP 178 
135 1 Y 1 B ASP 159 ? B ASP 179 
136 1 Y 1 B GLU 160 ? B GLU 180 
137 1 Y 1 B GLY 161 ? B GLY 181 
138 1 Y 1 B THR 162 ? B THR 182 
139 1 Y 1 B GLN 203 ? B GLN 223 
140 1 Y 1 C MET -19 ? C MET 1   
141 1 Y 1 C GLY -18 ? C GLY 2   
142 1 Y 1 C SER -17 ? C SER 3   
143 1 Y 1 C SER -16 ? C SER 4   
144 1 Y 1 C HIS -15 ? C HIS 5   
145 1 Y 1 C HIS -14 ? C HIS 6   
146 1 Y 1 C HIS -13 ? C HIS 7   
147 1 Y 1 C HIS -12 ? C HIS 8   
148 1 Y 1 C HIS -11 ? C HIS 9   
149 1 Y 1 C SER -10 ? C SER 10  
150 1 Y 1 C SER -9  ? C SER 11  
151 1 Y 1 C GLY -8  ? C GLY 12  
152 1 Y 1 C GLU -7  ? C GLU 13  
153 1 Y 1 C ASN -6  ? C ASN 14  
154 1 Y 1 C LEU -5  ? C LEU 15  
155 1 Y 1 C TYR -4  ? C TYR 16  
156 1 Y 1 C PHE -3  ? C PHE 17  
157 1 Y 1 C GLN -2  ? C GLN 18  
158 1 Y 1 C GLY -1  ? C GLY 19  
159 1 Y 1 C HIS 0   ? C HIS 20  
160 1 Y 1 C MET 1   ? C MET 21  
161 1 Y 1 C ARG 2   ? C ARG 22  
162 1 Y 1 C SER 3   ? C SER 23  
163 1 Y 1 C PRO 4   ? C PRO 24  
164 1 Y 1 C VAL 5   ? C VAL 25  
165 1 Y 1 C GLN 6   ? C GLN 26  
166 1 Y 1 C LEU 7   ? C LEU 27  
167 1 Y 1 C GLN 8   ? C GLN 28  
168 1 Y 1 C HIS 9   ? C HIS 29  
169 1 Y 1 C GLY 10  ? C GLY 30  
170 1 Y 1 C SER 11  ? C SER 31  
171 1 Y 1 C ASP 12  ? C ASP 32  
172 1 Y 1 C ALA 13  ? C ALA 33  
173 1 Y 1 C THR 14  ? C THR 34  
174 1 Y 1 C ASN 15  ? C ASN 35  
175 1 Y 1 C GLY 16  ? C GLY 36  
176 1 Y 1 C PHE 17  ? C PHE 37  
177 1 Y 1 C HIS 18  ? C HIS 38  
178 1 Y 1 C THR 19  ? C THR 39  
179 1 Y 1 C LEU 20  ? C LEU 40  
180 1 Y 1 C GLN 21  ? C GLN 41  
181 1 Y 1 C PRO 22  ? C PRO 42  
182 1 Y 1 C HIS 23  ? C HIS 43  
183 1 Y 1 C ASP 24  ? C ASP 44  
184 1 Y 1 C GLN 25  ? C GLN 45  
185 1 Y 1 C THR 26  ? C THR 46  
186 1 Y 1 C ASP 27  ? C ASP 47  
187 1 Y 1 C GLY 28  ? C GLY 48  
188 1 Y 1 C PRO 29  ? C PRO 49  
189 1 Y 1 C ILE 30  ? C ILE 50  
190 1 Y 1 C LYS 31  ? C LYS 51  
191 1 Y 1 C ARG 32  ? C ARG 52  
192 1 Y 1 C VAL 33  ? C VAL 53  
193 1 Y 1 C CYS 34  ? C CYS 54  
194 1 Y 1 C LEU 35  ? C LEU 55  
195 1 Y 1 C THR 36  ? C THR 56  
196 1 Y 1 C ASP 81  ? C ASP 101 
197 1 Y 1 C ASN 82  ? C ASN 102 
198 1 Y 1 C PRO 83  ? C PRO 103 
199 1 Y 1 C TYR 86  ? C TYR 106 
200 1 Y 1 C LYS 87  ? C LYS 107 
201 1 Y 1 C ASN 88  ? C ASN 108 
202 1 Y 1 C PHE 89  ? C PHE 109 
203 1 Y 1 C ILE 90  ? C ILE 110 
204 1 Y 1 C ARG 91  ? C ARG 111 
205 1 Y 1 C GLN 92  ? C GLN 112 
206 1 Y 1 C CYS 93  ? C CYS 113 
207 1 Y 1 C ARG 94  ? C ARG 114 
208 1 Y 1 C ILE 95  ? C ILE 115 
209 1 Y 1 C VAL 96  ? C VAL 116 
210 1 Y 1 C GLN 97  ? C GLN 117 
211 1 Y 1 C GLY 98  ? C GLY 118 
212 1 Y 1 C ASP 99  ? C ASP 119 
213 1 Y 1 C GLY 100 ? C GLY 120 
214 1 Y 1 C LEU 101 ? C LEU 121 
215 1 Y 1 C HIS 102 ? C HIS 122 
216 1 Y 1 C VAL 103 ? C VAL 123 
217 1 Y 1 C GLY 104 ? C GLY 124 
218 1 Y 1 C ASP 105 ? C ASP 125 
219 1 Y 1 C LEU 106 ? C LEU 126 
220 1 Y 1 C ARG 107 ? C ARG 127 
221 1 Y 1 C GLU 108 ? C GLU 128 
222 1 Y 1 C VAL 109 ? C VAL 129 
223 1 Y 1 C MET 110 ? C MET 130 
224 1 Y 1 C GLY 140 ? C GLY 160 
225 1 Y 1 C GLY 141 ? C GLY 161 
226 1 Y 1 C ASP 142 ? C ASP 162 
227 1 Y 1 C HIS 143 ? C HIS 163 
228 1 Y 1 C ARG 144 ? C ARG 164 
229 1 Y 1 C LEU 145 ? C LEU 165 
230 1 Y 1 C LYS 146 ? C LYS 166 
231 1 Y 1 C HIS 155 ? C HIS 175 
232 1 Y 1 C ALA 156 ? C ALA 176 
233 1 Y 1 C SER 157 ? C SER 177 
234 1 Y 1 C ASP 158 ? C ASP 178 
235 1 Y 1 C ASP 159 ? C ASP 179 
236 1 Y 1 C GLN 203 ? C GLN 223 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
# 
loop_
_pdbx_reflns_twin.domain_id 
_pdbx_reflns_twin.crystal_id 
_pdbx_reflns_twin.diffrn_id 
_pdbx_reflns_twin.type 
_pdbx_reflns_twin.operator 
_pdbx_reflns_twin.fraction 
1 1 1 ? 'H, K, L'  0.500 
2 1 1 ? 'K, H, -L' 0.500 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 GOL 1   301 204 GOL GOL A . 
E 2 GOL 1   302 205 GOL GOL A . 
F 2 GOL 1   303 206 GOL GOL A . 
G 2 GOL 1   304 207 GOL GOL A . 
H 2 GOL 1   305 208 GOL GOL A . 
I 2 GOL 1   306 209 GOL GOL A . 
J 2 GOL 1   307 210 GOL GOL A . 
K 2 GOL 1   301 204 GOL GOL B . 
L 2 GOL 1   302 205 GOL GOL B . 
M 2 GOL 1   303 206 GOL GOL B . 
N 2 GOL 1   304 207 GOL GOL B . 
O 2 GOL 1   301 204 GOL GOL C . 
P 3 HOH 1   401 213 HOH HOH A . 
P 3 HOH 2   402 214 HOH HOH A . 
P 3 HOH 3   403 215 HOH HOH A . 
P 3 HOH 4   404 216 HOH HOH A . 
P 3 HOH 5   405 217 HOH HOH A . 
P 3 HOH 6   406 218 HOH HOH A . 
P 3 HOH 7   407 219 HOH HOH A . 
P 3 HOH 8   408 221 HOH HOH A . 
P 3 HOH 9   409 222 HOH HOH A . 
P 3 HOH 10  410 223 HOH HOH A . 
P 3 HOH 11  411 224 HOH HOH A . 
P 3 HOH 12  412 225 HOH HOH A . 
P 3 HOH 13  413 226 HOH HOH A . 
P 3 HOH 14  414 227 HOH HOH A . 
P 3 HOH 15  415 228 HOH HOH A . 
P 3 HOH 16  416 229 HOH HOH A . 
P 3 HOH 17  417 230 HOH HOH A . 
P 3 HOH 18  418 231 HOH HOH A . 
P 3 HOH 19  419 232 HOH HOH A . 
P 3 HOH 20  420 233 HOH HOH A . 
P 3 HOH 21  421 234 HOH HOH A . 
P 3 HOH 22  422 235 HOH HOH A . 
P 3 HOH 23  423 236 HOH HOH A . 
P 3 HOH 24  424 237 HOH HOH A . 
P 3 HOH 25  425 239 HOH HOH A . 
P 3 HOH 26  426 240 HOH HOH A . 
P 3 HOH 27  427 241 HOH HOH A . 
P 3 HOH 28  428 242 HOH HOH A . 
P 3 HOH 29  429 243 HOH HOH A . 
P 3 HOH 30  430 244 HOH HOH A . 
P 3 HOH 31  431 245 HOH HOH A . 
P 3 HOH 32  432 247 HOH HOH A . 
P 3 HOH 33  433 249 HOH HOH A . 
P 3 HOH 34  434 250 HOH HOH A . 
P 3 HOH 35  435 251 HOH HOH A . 
P 3 HOH 36  436 254 HOH HOH A . 
P 3 HOH 37  437 255 HOH HOH A . 
P 3 HOH 38  438 257 HOH HOH A . 
P 3 HOH 39  439 260 HOH HOH A . 
P 3 HOH 40  440 261 HOH HOH A . 
P 3 HOH 41  441 262 HOH HOH A . 
P 3 HOH 42  442 263 HOH HOH A . 
P 3 HOH 43  443 264 HOH HOH A . 
P 3 HOH 44  444 265 HOH HOH A . 
P 3 HOH 45  445 266 HOH HOH A . 
P 3 HOH 46  446 267 HOH HOH A . 
P 3 HOH 47  447 269 HOH HOH A . 
P 3 HOH 48  448 270 HOH HOH A . 
P 3 HOH 49  449 271 HOH HOH A . 
P 3 HOH 50  450 272 HOH HOH A . 
P 3 HOH 51  451 273 HOH HOH A . 
P 3 HOH 52  452 274 HOH HOH A . 
P 3 HOH 53  453 275 HOH HOH A . 
P 3 HOH 54  454 276 HOH HOH A . 
P 3 HOH 55  455 277 HOH HOH A . 
P 3 HOH 56  456 278 HOH HOH A . 
P 3 HOH 57  457 279 HOH HOH A . 
P 3 HOH 58  458 280 HOH HOH A . 
P 3 HOH 59  459 281 HOH HOH A . 
P 3 HOH 60  460 282 HOH HOH A . 
P 3 HOH 61  461 283 HOH HOH A . 
P 3 HOH 62  462 284 HOH HOH A . 
P 3 HOH 63  463 285 HOH HOH A . 
P 3 HOH 64  464 286 HOH HOH A . 
P 3 HOH 65  465 287 HOH HOH A . 
P 3 HOH 66  466 288 HOH HOH A . 
P 3 HOH 67  467 290 HOH HOH A . 
P 3 HOH 68  468 291 HOH HOH A . 
P 3 HOH 69  469 292 HOH HOH A . 
P 3 HOH 70  470 293 HOH HOH A . 
P 3 HOH 71  471 294 HOH HOH A . 
P 3 HOH 72  472 295 HOH HOH A . 
P 3 HOH 73  473 296 HOH HOH A . 
P 3 HOH 74  474 297 HOH HOH A . 
P 3 HOH 75  475 298 HOH HOH A . 
P 3 HOH 76  476 299 HOH HOH A . 
P 3 HOH 77  477 300 HOH HOH A . 
P 3 HOH 78  478 302 HOH HOH A . 
P 3 HOH 79  479 303 HOH HOH A . 
P 3 HOH 80  480 304 HOH HOH A . 
P 3 HOH 81  481 305 HOH HOH A . 
P 3 HOH 82  482 306 HOH HOH A . 
P 3 HOH 83  483 307 HOH HOH A . 
P 3 HOH 84  484 309 HOH HOH A . 
P 3 HOH 85  485 311 HOH HOH A . 
P 3 HOH 86  486 313 HOH HOH A . 
P 3 HOH 87  487 314 HOH HOH A . 
P 3 HOH 88  488 315 HOH HOH A . 
P 3 HOH 89  489 316 HOH HOH A . 
P 3 HOH 90  490 317 HOH HOH A . 
P 3 HOH 91  491 318 HOH HOH A . 
P 3 HOH 92  492 319 HOH HOH A . 
P 3 HOH 93  493 320 HOH HOH A . 
P 3 HOH 94  494 321 HOH HOH A . 
P 3 HOH 95  495 322 HOH HOH A . 
P 3 HOH 96  496 323 HOH HOH A . 
P 3 HOH 97  497 324 HOH HOH A . 
P 3 HOH 98  498 326 HOH HOH A . 
P 3 HOH 99  499 327 HOH HOH A . 
P 3 HOH 100 500 328 HOH HOH A . 
P 3 HOH 101 501 329 HOH HOH A . 
P 3 HOH 102 502 330 HOH HOH A . 
P 3 HOH 103 503 331 HOH HOH A . 
P 3 HOH 104 504 332 HOH HOH A . 
P 3 HOH 105 505 333 HOH HOH A . 
P 3 HOH 106 506 334 HOH HOH A . 
P 3 HOH 107 507 336 HOH HOH A . 
P 3 HOH 108 508 337 HOH HOH A . 
P 3 HOH 109 509 338 HOH HOH A . 
P 3 HOH 110 510 339 HOH HOH A . 
P 3 HOH 111 511 340 HOH HOH A . 
P 3 HOH 112 512 342 HOH HOH A . 
P 3 HOH 113 513 344 HOH HOH A . 
P 3 HOH 114 514 346 HOH HOH A . 
P 3 HOH 115 515 347 HOH HOH A . 
P 3 HOH 116 516 349 HOH HOH A . 
P 3 HOH 117 517 350 HOH HOH A . 
P 3 HOH 118 518 351 HOH HOH A . 
P 3 HOH 119 519 352 HOH HOH A . 
P 3 HOH 120 520 353 HOH HOH A . 
P 3 HOH 121 521 354 HOH HOH A . 
P 3 HOH 122 522 355 HOH HOH A . 
P 3 HOH 123 523 356 HOH HOH A . 
P 3 HOH 124 524 360 HOH HOH A . 
P 3 HOH 125 525 361 HOH HOH A . 
P 3 HOH 126 526 363 HOH HOH A . 
P 3 HOH 127 527 365 HOH HOH A . 
P 3 HOH 128 528 366 HOH HOH A . 
P 3 HOH 129 529 367 HOH HOH A . 
P 3 HOH 130 530 368 HOH HOH A . 
P 3 HOH 131 531 369 HOH HOH A . 
P 3 HOH 132 532 370 HOH HOH A . 
P 3 HOH 133 533 372 HOH HOH A . 
P 3 HOH 134 534 376 HOH HOH A . 
P 3 HOH 135 535 377 HOH HOH A . 
P 3 HOH 136 536 378 HOH HOH A . 
P 3 HOH 137 537 380 HOH HOH A . 
P 3 HOH 138 538 381 HOH HOH A . 
P 3 HOH 139 539 382 HOH HOH A . 
P 3 HOH 140 540 384 HOH HOH A . 
P 3 HOH 141 541 385 HOH HOH A . 
P 3 HOH 142 542 386 HOH HOH A . 
P 3 HOH 143 543 387 HOH HOH A . 
P 3 HOH 144 544 388 HOH HOH A . 
P 3 HOH 145 545 389 HOH HOH A . 
P 3 HOH 146 546 391 HOH HOH A . 
P 3 HOH 147 547 392 HOH HOH A . 
P 3 HOH 148 548 393 HOH HOH A . 
P 3 HOH 149 549 395 HOH HOH A . 
P 3 HOH 150 550 396 HOH HOH A . 
P 3 HOH 151 551 397 HOH HOH A . 
P 3 HOH 152 552 398 HOH HOH A . 
P 3 HOH 153 553 399 HOH HOH A . 
P 3 HOH 154 554 400 HOH HOH A . 
P 3 HOH 155 555 401 HOH HOH A . 
P 3 HOH 156 556 402 HOH HOH A . 
P 3 HOH 157 557 404 HOH HOH A . 
P 3 HOH 158 558 406 HOH HOH A . 
P 3 HOH 159 559 407 HOH HOH A . 
P 3 HOH 160 560 409 HOH HOH A . 
P 3 HOH 161 561 410 HOH HOH A . 
P 3 HOH 162 562 411 HOH HOH A . 
P 3 HOH 163 563 414 HOH HOH A . 
P 3 HOH 164 564 415 HOH HOH A . 
P 3 HOH 165 565 416 HOH HOH A . 
P 3 HOH 166 566 418 HOH HOH A . 
P 3 HOH 167 567 419 HOH HOH A . 
P 3 HOH 168 568 420 HOH HOH A . 
P 3 HOH 169 569 421 HOH HOH A . 
P 3 HOH 170 570 422 HOH HOH A . 
P 3 HOH 171 571 423 HOH HOH A . 
P 3 HOH 172 572 424 HOH HOH A . 
P 3 HOH 173 573 428 HOH HOH A . 
P 3 HOH 174 574 430 HOH HOH A . 
P 3 HOH 175 575 432 HOH HOH A . 
P 3 HOH 176 576 433 HOH HOH A . 
P 3 HOH 177 577 434 HOH HOH A . 
P 3 HOH 178 578 435 HOH HOH A . 
P 3 HOH 179 579 436 HOH HOH A . 
P 3 HOH 180 580 438 HOH HOH A . 
P 3 HOH 181 581 439 HOH HOH A . 
P 3 HOH 182 582 440 HOH HOH A . 
P 3 HOH 183 583 441 HOH HOH A . 
P 3 HOH 184 584 445 HOH HOH A . 
P 3 HOH 185 585 446 HOH HOH A . 
P 3 HOH 186 586 447 HOH HOH A . 
P 3 HOH 187 587 448 HOH HOH A . 
P 3 HOH 188 588 449 HOH HOH A . 
P 3 HOH 189 589 332 HOH HOH A . 
P 3 HOH 190 590 370 HOH HOH A . 
P 3 HOH 191 591 388 HOH HOH A . 
P 3 HOH 192 592 407 HOH HOH A . 
P 3 HOH 193 593 211 HOH HOH A . 
P 3 HOH 194 594 223 HOH HOH A . 
P 3 HOH 195 595 237 HOH HOH A . 
P 3 HOH 196 596 252 HOH HOH A . 
P 3 HOH 197 597 267 HOH HOH A . 
P 3 HOH 198 598 297 HOH HOH A . 
P 3 HOH 199 599 354 HOH HOH A . 
P 3 HOH 200 600 366 HOH HOH A . 
P 3 HOH 201 601 367 HOH HOH A . 
P 3 HOH 202 602 373 HOH HOH A . 
P 3 HOH 203 603 381 HOH HOH A . 
P 3 HOH 204 604 382 HOH HOH A . 
P 3 HOH 205 605 384 HOH HOH A . 
P 3 HOH 206 606 388 HOH HOH A . 
P 3 HOH 207 607 235 HOH HOH A . 
P 3 HOH 208 608 360 HOH HOH A . 
P 3 HOH 209 609 247 HOH HOH A . 
P 3 HOH 210 610 281 HOH HOH A . 
P 3 HOH 211 611 282 HOH HOH A . 
P 3 HOH 212 612 379 HOH HOH A . 
P 3 HOH 213 613 394 HOH HOH A . 
Q 3 HOH 1   401 238 HOH HOH B . 
Q 3 HOH 2   402 335 HOH HOH B . 
Q 3 HOH 3   403 359 HOH HOH B . 
Q 3 HOH 4   404 405 HOH HOH B . 
Q 3 HOH 5   405 417 HOH HOH B . 
Q 3 HOH 6   406 268 HOH HOH B . 
Q 3 HOH 7   407 220 HOH HOH B . 
Q 3 HOH 8   408 208 HOH HOH B . 
Q 3 HOH 9   409 209 HOH HOH B . 
Q 3 HOH 10  410 210 HOH HOH B . 
Q 3 HOH 11  411 211 HOH HOH B . 
Q 3 HOH 12  412 212 HOH HOH B . 
Q 3 HOH 13  413 213 HOH HOH B . 
Q 3 HOH 14  414 214 HOH HOH B . 
Q 3 HOH 15  415 215 HOH HOH B . 
Q 3 HOH 16  416 216 HOH HOH B . 
Q 3 HOH 17  417 217 HOH HOH B . 
Q 3 HOH 18  418 218 HOH HOH B . 
Q 3 HOH 19  419 219 HOH HOH B . 
Q 3 HOH 20  420 220 HOH HOH B . 
Q 3 HOH 21  421 221 HOH HOH B . 
Q 3 HOH 22  422 223 HOH HOH B . 
Q 3 HOH 23  423 224 HOH HOH B . 
Q 3 HOH 24  424 225 HOH HOH B . 
Q 3 HOH 25  425 226 HOH HOH B . 
Q 3 HOH 26  426 227 HOH HOH B . 
Q 3 HOH 27  427 228 HOH HOH B . 
Q 3 HOH 28  428 230 HOH HOH B . 
Q 3 HOH 29  429 231 HOH HOH B . 
Q 3 HOH 30  430 232 HOH HOH B . 
Q 3 HOH 31  431 233 HOH HOH B . 
Q 3 HOH 32  432 234 HOH HOH B . 
Q 3 HOH 33  433 237 HOH HOH B . 
Q 3 HOH 34  434 238 HOH HOH B . 
Q 3 HOH 35  435 239 HOH HOH B . 
Q 3 HOH 36  436 240 HOH HOH B . 
Q 3 HOH 37  437 241 HOH HOH B . 
Q 3 HOH 38  438 242 HOH HOH B . 
Q 3 HOH 39  439 244 HOH HOH B . 
Q 3 HOH 40  440 246 HOH HOH B . 
Q 3 HOH 41  441 247 HOH HOH B . 
Q 3 HOH 42  442 249 HOH HOH B . 
Q 3 HOH 43  443 251 HOH HOH B . 
Q 3 HOH 44  444 252 HOH HOH B . 
Q 3 HOH 45  445 253 HOH HOH B . 
Q 3 HOH 46  446 254 HOH HOH B . 
Q 3 HOH 47  447 255 HOH HOH B . 
Q 3 HOH 48  448 256 HOH HOH B . 
Q 3 HOH 49  449 257 HOH HOH B . 
Q 3 HOH 50  450 258 HOH HOH B . 
Q 3 HOH 51  451 259 HOH HOH B . 
Q 3 HOH 52  452 260 HOH HOH B . 
Q 3 HOH 53  453 261 HOH HOH B . 
Q 3 HOH 54  454 262 HOH HOH B . 
Q 3 HOH 55  455 263 HOH HOH B . 
Q 3 HOH 56  456 264 HOH HOH B . 
Q 3 HOH 57  457 265 HOH HOH B . 
Q 3 HOH 58  458 266 HOH HOH B . 
Q 3 HOH 59  459 267 HOH HOH B . 
Q 3 HOH 60  460 269 HOH HOH B . 
Q 3 HOH 61  461 270 HOH HOH B . 
Q 3 HOH 62  462 271 HOH HOH B . 
Q 3 HOH 63  463 272 HOH HOH B . 
Q 3 HOH 64  464 273 HOH HOH B . 
Q 3 HOH 65  465 274 HOH HOH B . 
Q 3 HOH 66  466 275 HOH HOH B . 
Q 3 HOH 67  467 276 HOH HOH B . 
Q 3 HOH 68  468 277 HOH HOH B . 
Q 3 HOH 69  469 278 HOH HOH B . 
Q 3 HOH 70  470 280 HOH HOH B . 
Q 3 HOH 71  471 281 HOH HOH B . 
Q 3 HOH 72  472 282 HOH HOH B . 
Q 3 HOH 73  473 283 HOH HOH B . 
Q 3 HOH 74  474 284 HOH HOH B . 
Q 3 HOH 75  475 285 HOH HOH B . 
Q 3 HOH 76  476 286 HOH HOH B . 
Q 3 HOH 77  477 287 HOH HOH B . 
Q 3 HOH 78  478 288 HOH HOH B . 
Q 3 HOH 79  479 289 HOH HOH B . 
Q 3 HOH 80  480 290 HOH HOH B . 
Q 3 HOH 81  481 292 HOH HOH B . 
Q 3 HOH 82  482 294 HOH HOH B . 
Q 3 HOH 83  483 295 HOH HOH B . 
Q 3 HOH 84  484 296 HOH HOH B . 
Q 3 HOH 85  485 297 HOH HOH B . 
Q 3 HOH 86  486 298 HOH HOH B . 
Q 3 HOH 87  487 299 HOH HOH B . 
Q 3 HOH 88  488 301 HOH HOH B . 
Q 3 HOH 89  489 302 HOH HOH B . 
Q 3 HOH 90  490 303 HOH HOH B . 
Q 3 HOH 91  491 304 HOH HOH B . 
Q 3 HOH 92  492 305 HOH HOH B . 
Q 3 HOH 93  493 306 HOH HOH B . 
Q 3 HOH 94  494 307 HOH HOH B . 
Q 3 HOH 95  495 308 HOH HOH B . 
Q 3 HOH 96  496 309 HOH HOH B . 
Q 3 HOH 97  497 310 HOH HOH B . 
Q 3 HOH 98  498 311 HOH HOH B . 
Q 3 HOH 99  499 312 HOH HOH B . 
Q 3 HOH 100 500 313 HOH HOH B . 
Q 3 HOH 101 501 314 HOH HOH B . 
Q 3 HOH 102 502 315 HOH HOH B . 
Q 3 HOH 103 503 316 HOH HOH B . 
Q 3 HOH 104 504 317 HOH HOH B . 
Q 3 HOH 105 505 318 HOH HOH B . 
Q 3 HOH 106 506 319 HOH HOH B . 
Q 3 HOH 107 507 320 HOH HOH B . 
Q 3 HOH 108 508 321 HOH HOH B . 
Q 3 HOH 109 509 322 HOH HOH B . 
Q 3 HOH 110 510 323 HOH HOH B . 
Q 3 HOH 111 511 324 HOH HOH B . 
Q 3 HOH 112 512 326 HOH HOH B . 
Q 3 HOH 113 513 327 HOH HOH B . 
Q 3 HOH 114 514 328 HOH HOH B . 
Q 3 HOH 115 515 329 HOH HOH B . 
Q 3 HOH 116 516 330 HOH HOH B . 
Q 3 HOH 117 517 333 HOH HOH B . 
Q 3 HOH 118 518 334 HOH HOH B . 
Q 3 HOH 119 519 335 HOH HOH B . 
Q 3 HOH 120 520 336 HOH HOH B . 
Q 3 HOH 121 521 337 HOH HOH B . 
Q 3 HOH 122 522 338 HOH HOH B . 
Q 3 HOH 123 523 341 HOH HOH B . 
Q 3 HOH 124 524 342 HOH HOH B . 
Q 3 HOH 125 525 343 HOH HOH B . 
Q 3 HOH 126 526 344 HOH HOH B . 
Q 3 HOH 127 527 345 HOH HOH B . 
Q 3 HOH 128 528 346 HOH HOH B . 
Q 3 HOH 129 529 347 HOH HOH B . 
Q 3 HOH 130 530 350 HOH HOH B . 
Q 3 HOH 131 531 351 HOH HOH B . 
Q 3 HOH 132 532 352 HOH HOH B . 
Q 3 HOH 133 533 353 HOH HOH B . 
Q 3 HOH 134 534 354 HOH HOH B . 
Q 3 HOH 135 535 355 HOH HOH B . 
Q 3 HOH 136 536 356 HOH HOH B . 
Q 3 HOH 137 537 357 HOH HOH B . 
Q 3 HOH 138 538 358 HOH HOH B . 
Q 3 HOH 139 539 359 HOH HOH B . 
Q 3 HOH 140 540 361 HOH HOH B . 
Q 3 HOH 141 541 362 HOH HOH B . 
Q 3 HOH 142 542 363 HOH HOH B . 
Q 3 HOH 143 543 364 HOH HOH B . 
Q 3 HOH 144 544 365 HOH HOH B . 
Q 3 HOH 145 545 366 HOH HOH B . 
Q 3 HOH 146 546 367 HOH HOH B . 
Q 3 HOH 147 547 368 HOH HOH B . 
Q 3 HOH 148 548 369 HOH HOH B . 
Q 3 HOH 149 549 371 HOH HOH B . 
Q 3 HOH 150 550 372 HOH HOH B . 
Q 3 HOH 151 551 373 HOH HOH B . 
Q 3 HOH 152 552 374 HOH HOH B . 
Q 3 HOH 153 553 376 HOH HOH B . 
Q 3 HOH 154 554 377 HOH HOH B . 
Q 3 HOH 155 555 378 HOH HOH B . 
Q 3 HOH 156 556 379 HOH HOH B . 
Q 3 HOH 157 557 381 HOH HOH B . 
Q 3 HOH 158 558 382 HOH HOH B . 
Q 3 HOH 159 559 383 HOH HOH B . 
Q 3 HOH 160 560 384 HOH HOH B . 
Q 3 HOH 161 561 385 HOH HOH B . 
Q 3 HOH 162 562 386 HOH HOH B . 
Q 3 HOH 163 563 387 HOH HOH B . 
Q 3 HOH 164 564 389 HOH HOH B . 
Q 3 HOH 165 565 390 HOH HOH B . 
Q 3 HOH 166 566 391 HOH HOH B . 
Q 3 HOH 167 567 394 HOH HOH B . 
Q 3 HOH 168 568 395 HOH HOH B . 
Q 3 HOH 169 569 396 HOH HOH B . 
Q 3 HOH 170 570 397 HOH HOH B . 
Q 3 HOH 171 571 398 HOH HOH B . 
Q 3 HOH 172 572 399 HOH HOH B . 
Q 3 HOH 173 573 400 HOH HOH B . 
Q 3 HOH 174 574 401 HOH HOH B . 
Q 3 HOH 175 575 402 HOH HOH B . 
Q 3 HOH 176 576 403 HOH HOH B . 
Q 3 HOH 177 577 405 HOH HOH B . 
Q 3 HOH 178 578 408 HOH HOH B . 
Q 3 HOH 179 579 409 HOH HOH B . 
Q 3 HOH 180 580 410 HOH HOH B . 
Q 3 HOH 181 581 411 HOH HOH B . 
Q 3 HOH 182 582 412 HOH HOH B . 
Q 3 HOH 183 583 413 HOH HOH B . 
Q 3 HOH 184 584 414 HOH HOH B . 
Q 3 HOH 185 585 226 HOH HOH B . 
Q 3 HOH 186 586 271 HOH HOH B . 
Q 3 HOH 187 587 386 HOH HOH B . 
Q 3 HOH 188 588 315 HOH HOH B . 
Q 3 HOH 189 589 398 HOH HOH B . 
R 3 HOH 1   401 310 HOH HOH C . 
R 3 HOH 2   402 325 HOH HOH C . 
R 3 HOH 3   403 358 HOH HOH C . 
R 3 HOH 4   404 371 HOH HOH C . 
R 3 HOH 5   405 212 HOH HOH C . 
R 3 HOH 6   406 248 HOH HOH C . 
R 3 HOH 7   407 268 HOH HOH C . 
R 3 HOH 8   408 301 HOH HOH C . 
R 3 HOH 9   409 343 HOH HOH C . 
R 3 HOH 10  410 357 HOH HOH C . 
R 3 HOH 11  411 425 HOH HOH C . 
R 3 HOH 12  412 229 HOH HOH C . 
R 3 HOH 13  413 279 HOH HOH C . 
R 3 HOH 14  414 291 HOH HOH C . 
R 3 HOH 15  415 331 HOH HOH C . 
R 3 HOH 16  416 348 HOH HOH C . 
R 3 HOH 17  417 206 HOH HOH C . 
R 3 HOH 18  418 207 HOH HOH C . 
R 3 HOH 19  419 209 HOH HOH C . 
R 3 HOH 20  420 210 HOH HOH C . 
R 3 HOH 21  421 213 HOH HOH C . 
R 3 HOH 22  422 214 HOH HOH C . 
R 3 HOH 23  423 215 HOH HOH C . 
R 3 HOH 24  424 217 HOH HOH C . 
R 3 HOH 25  425 218 HOH HOH C . 
R 3 HOH 26  426 219 HOH HOH C . 
R 3 HOH 27  427 220 HOH HOH C . 
R 3 HOH 28  428 221 HOH HOH C . 
R 3 HOH 29  429 222 HOH HOH C . 
R 3 HOH 30  430 224 HOH HOH C . 
R 3 HOH 31  431 225 HOH HOH C . 
R 3 HOH 32  432 227 HOH HOH C . 
R 3 HOH 33  433 228 HOH HOH C . 
R 3 HOH 34  434 229 HOH HOH C . 
R 3 HOH 35  435 230 HOH HOH C . 
R 3 HOH 36  436 231 HOH HOH C . 
R 3 HOH 37  437 232 HOH HOH C . 
R 3 HOH 38  438 233 HOH HOH C . 
R 3 HOH 39  439 234 HOH HOH C . 
R 3 HOH 40  440 235 HOH HOH C . 
R 3 HOH 41  441 236 HOH HOH C . 
R 3 HOH 42  442 238 HOH HOH C . 
R 3 HOH 43  443 239 HOH HOH C . 
R 3 HOH 44  444 240 HOH HOH C . 
R 3 HOH 45  445 242 HOH HOH C . 
R 3 HOH 46  446 243 HOH HOH C . 
R 3 HOH 47  447 245 HOH HOH C . 
R 3 HOH 48  448 246 HOH HOH C . 
R 3 HOH 49  449 248 HOH HOH C . 
R 3 HOH 50  450 249 HOH HOH C . 
R 3 HOH 51  451 250 HOH HOH C . 
R 3 HOH 52  452 253 HOH HOH C . 
R 3 HOH 53  453 255 HOH HOH C . 
R 3 HOH 54  454 256 HOH HOH C . 
R 3 HOH 55  455 257 HOH HOH C . 
R 3 HOH 56  456 258 HOH HOH C . 
R 3 HOH 57  457 260 HOH HOH C . 
R 3 HOH 58  458 261 HOH HOH C . 
R 3 HOH 59  459 262 HOH HOH C . 
R 3 HOH 60  460 263 HOH HOH C . 
R 3 HOH 61  461 264 HOH HOH C . 
R 3 HOH 62  462 265 HOH HOH C . 
R 3 HOH 63  463 266 HOH HOH C . 
R 3 HOH 64  464 268 HOH HOH C . 
R 3 HOH 65  465 269 HOH HOH C . 
R 3 HOH 66  466 270 HOH HOH C . 
R 3 HOH 67  467 272 HOH HOH C . 
R 3 HOH 68  468 273 HOH HOH C . 
R 3 HOH 69  469 274 HOH HOH C . 
R 3 HOH 70  470 275 HOH HOH C . 
R 3 HOH 71  471 276 HOH HOH C . 
R 3 HOH 72  472 278 HOH HOH C . 
R 3 HOH 73  473 280 HOH HOH C . 
R 3 HOH 74  474 283 HOH HOH C . 
R 3 HOH 75  475 284 HOH HOH C . 
R 3 HOH 76  476 285 HOH HOH C . 
R 3 HOH 77  477 286 HOH HOH C . 
R 3 HOH 78  478 287 HOH HOH C . 
R 3 HOH 79  479 288 HOH HOH C . 
R 3 HOH 80  480 289 HOH HOH C . 
R 3 HOH 81  481 291 HOH HOH C . 
R 3 HOH 82  482 292 HOH HOH C . 
R 3 HOH 83  483 293 HOH HOH C . 
R 3 HOH 84  484 294 HOH HOH C . 
R 3 HOH 85  485 295 HOH HOH C . 
R 3 HOH 86  486 296 HOH HOH C . 
R 3 HOH 87  487 298 HOH HOH C . 
R 3 HOH 88  488 300 HOH HOH C . 
R 3 HOH 89  489 301 HOH HOH C . 
R 3 HOH 90  490 302 HOH HOH C . 
R 3 HOH 91  491 303 HOH HOH C . 
R 3 HOH 92  492 304 HOH HOH C . 
R 3 HOH 93  493 305 HOH HOH C . 
R 3 HOH 94  494 307 HOH HOH C . 
R 3 HOH 95  495 308 HOH HOH C . 
R 3 HOH 96  496 309 HOH HOH C . 
R 3 HOH 97  497 310 HOH HOH C . 
R 3 HOH 98  498 312 HOH HOH C . 
R 3 HOH 99  499 313 HOH HOH C . 
R 3 HOH 100 500 314 HOH HOH C . 
R 3 HOH 101 501 316 HOH HOH C . 
R 3 HOH 102 502 317 HOH HOH C . 
R 3 HOH 103 503 318 HOH HOH C . 
R 3 HOH 104 504 319 HOH HOH C . 
R 3 HOH 105 505 322 HOH HOH C . 
R 3 HOH 106 506 323 HOH HOH C . 
R 3 HOH 107 507 324 HOH HOH C . 
R 3 HOH 108 508 325 HOH HOH C . 
R 3 HOH 109 509 326 HOH HOH C . 
R 3 HOH 110 510 327 HOH HOH C . 
R 3 HOH 111 511 329 HOH HOH C . 
R 3 HOH 112 512 330 HOH HOH C . 
R 3 HOH 113 513 331 HOH HOH C . 
R 3 HOH 114 514 332 HOH HOH C . 
R 3 HOH 115 515 333 HOH HOH C . 
R 3 HOH 116 516 334 HOH HOH C . 
R 3 HOH 117 517 335 HOH HOH C . 
R 3 HOH 118 518 336 HOH HOH C . 
R 3 HOH 119 519 338 HOH HOH C . 
R 3 HOH 120 520 340 HOH HOH C . 
R 3 HOH 121 521 341 HOH HOH C . 
R 3 HOH 122 522 342 HOH HOH C . 
R 3 HOH 123 523 343 HOH HOH C . 
R 3 HOH 124 524 344 HOH HOH C . 
R 3 HOH 125 525 345 HOH HOH C . 
R 3 HOH 126 526 346 HOH HOH C . 
R 3 HOH 127 527 347 HOH HOH C . 
R 3 HOH 128 528 348 HOH HOH C . 
R 3 HOH 129 529 349 HOH HOH C . 
R 3 HOH 130 530 350 HOH HOH C . 
R 3 HOH 131 531 351 HOH HOH C . 
R 3 HOH 132 532 352 HOH HOH C . 
R 3 HOH 133 533 353 HOH HOH C . 
R 3 HOH 134 534 355 HOH HOH C . 
R 3 HOH 135 535 356 HOH HOH C . 
R 3 HOH 136 536 357 HOH HOH C . 
R 3 HOH 137 537 358 HOH HOH C . 
R 3 HOH 138 538 359 HOH HOH C . 
R 3 HOH 139 539 360 HOH HOH C . 
R 3 HOH 140 540 361 HOH HOH C . 
R 3 HOH 141 541 362 HOH HOH C . 
R 3 HOH 142 542 363 HOH HOH C . 
R 3 HOH 143 543 364 HOH HOH C . 
R 3 HOH 144 544 365 HOH HOH C . 
R 3 HOH 145 545 368 HOH HOH C . 
R 3 HOH 146 546 369 HOH HOH C . 
R 3 HOH 147 547 370 HOH HOH C . 
R 3 HOH 148 548 371 HOH HOH C . 
R 3 HOH 149 549 372 HOH HOH C . 
R 3 HOH 150 550 374 HOH HOH C . 
R 3 HOH 151 551 378 HOH HOH C . 
R 3 HOH 152 552 380 HOH HOH C . 
R 3 HOH 153 553 383 HOH HOH C . 
R 3 HOH 154 554 385 HOH HOH C . 
R 3 HOH 155 555 387 HOH HOH C . 
R 3 HOH 156 556 389 HOH HOH C . 
R 3 HOH 157 557 390 HOH HOH C . 
R 3 HOH 158 558 391 HOH HOH C . 
R 3 HOH 159 559 392 HOH HOH C . 
R 3 HOH 160 560 393 HOH HOH C . 
R 3 HOH 161 561 395 HOH HOH C . 
R 3 HOH 162 562 396 HOH HOH C . 
R 3 HOH 163 563 397 HOH HOH C . 
#