data_4JGV
# 
_entry.id   4JGV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4JGV         
RCSB  RCSB078029   
WWPDB D_1000078029 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4KZI . unspecified 
PDB 4KZJ . unspecified 
PDB 4KZM . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4JGV 
_pdbx_database_status.recvd_initial_deposition_date   2013-03-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Q.' 1  
'Li, F.'    2  
'Li, A.'    3  
'Tian, X.'  4  
'Wan, W.'   5  
'Wan, Y.'   6  
'Chen, H.'  7  
'Xing, Y.'  8  
'Wu, Q.'    9  
'Lin, T.'   10 
# 
_citation.id                        primary 
_citation.title                     
'Orphan nuclear receptor TR3 acts in autophagic cell death via mitochondrial signaling pathway.' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            10 
_citation.page_first                133 
_citation.page_last                 140 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24316735 
_citation.pdbx_database_id_DOI      10.1038/nchembio.1406 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, W.'     1  
primary 'Wang, Y.'     2  
primary 'Chen, H.'     3  
primary 'Xing, Y.'     4  
primary 'Li, F.'       5  
primary 'Zhang, Q.'    6  
primary 'Zhou, B.'     7  
primary 'Zhang, H.'    8  
primary 'Zhang, J.'    9  
primary 'Bian, X.'     10 
primary 'Li, L.'       11 
primary 'Liu, Y.'      12 
primary 'Zhao, B.'     13 
primary 'Chen, Y.'     14 
primary 'Wu, R.'       15 
primary 'Li, A.'       16 
primary 'Yao, L.'      17 
primary 'Chen, P.'     18 
primary 'Zhang, Y.'    19 
primary 'Tian, X.'     20 
primary 'Beermann, F.' 21 
primary 'Wu, M.'       22 
primary 'Han, J.'      23 
primary 'Huang, P.'    24 
primary 'Lin, T.'      25 
primary 'Wu, Q.'       26 
# 
_cell.entry_id           4JGV 
_cell.length_a           74.084 
_cell.length_b           76.900 
_cell.length_c           128.137 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4JGV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nuclear receptor subfamily 4 group A member 1' 27630.041 2   ? ? 'LIGAND BINDING DOMAIN, UNP residues 351-598' 
? 
2 non-polymer syn '1-(3,4,5-trihydroxyphenyl)nonan-1-one'         266.333   1   ? ? ?                                             
? 
3 non-polymer syn GLYCEROL                                        92.094    7   ? ? ?                                             
? 
4 water       nat water                                           18.015    216 ? ? ?                                             
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Early response protein NAK1, Nuclear hormone receptor NUR/77, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   SER n 
1 3   LYS n 
1 4   PRO n 
1 5   LYS n 
1 6   GLN n 
1 7   PRO n 
1 8   PRO n 
1 9   ASP n 
1 10  ALA n 
1 11  SER n 
1 12  PRO n 
1 13  ALA n 
1 14  ASN n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  SER n 
1 19  LEU n 
1 20  VAL n 
1 21  ARG n 
1 22  ALA n 
1 23  HIS n 
1 24  LEU n 
1 25  ASP n 
1 26  SER n 
1 27  GLY n 
1 28  PRO n 
1 29  SER n 
1 30  THR n 
1 31  ALA n 
1 32  LYS n 
1 33  LEU n 
1 34  ASP n 
1 35  TYR n 
1 36  SER n 
1 37  LYS n 
1 38  PHE n 
1 39  GLN n 
1 40  GLU n 
1 41  LEU n 
1 42  VAL n 
1 43  LEU n 
1 44  PRO n 
1 45  HIS n 
1 46  PHE n 
1 47  GLY n 
1 48  LYS n 
1 49  GLU n 
1 50  ASP n 
1 51  ALA n 
1 52  GLY n 
1 53  ASP n 
1 54  VAL n 
1 55  GLN n 
1 56  GLN n 
1 57  PHE n 
1 58  TYR n 
1 59  ASP n 
1 60  LEU n 
1 61  LEU n 
1 62  SER n 
1 63  GLY n 
1 64  SER n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  ILE n 
1 69  ARG n 
1 70  LYS n 
1 71  TRP n 
1 72  ALA n 
1 73  GLU n 
1 74  LYS n 
1 75  ILE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  ALA n 
1 80  GLU n 
1 81  LEU n 
1 82  SER n 
1 83  PRO n 
1 84  ALA n 
1 85  ASP n 
1 86  GLN n 
1 87  ASP n 
1 88  LEU n 
1 89  LEU n 
1 90  LEU n 
1 91  GLU n 
1 92  SER n 
1 93  ALA n 
1 94  PHE n 
1 95  LEU n 
1 96  GLU n 
1 97  LEU n 
1 98  PHE n 
1 99  ILE n 
1 100 LEU n 
1 101 ARG n 
1 102 LEU n 
1 103 ALA n 
1 104 TYR n 
1 105 ARG n 
1 106 SER n 
1 107 LYS n 
1 108 PRO n 
1 109 GLY n 
1 110 GLU n 
1 111 GLY n 
1 112 LYS n 
1 113 LEU n 
1 114 ILE n 
1 115 PHE n 
1 116 CYS n 
1 117 SER n 
1 118 GLY n 
1 119 LEU n 
1 120 VAL n 
1 121 LEU n 
1 122 HIS n 
1 123 ARG n 
1 124 LEU n 
1 125 GLN n 
1 126 CYS n 
1 127 ALA n 
1 128 ARG n 
1 129 GLY n 
1 130 PHE n 
1 131 GLY n 
1 132 ASP n 
1 133 TRP n 
1 134 ILE n 
1 135 ASP n 
1 136 SER n 
1 137 ILE n 
1 138 LEU n 
1 139 ALA n 
1 140 PHE n 
1 141 SER n 
1 142 ARG n 
1 143 SER n 
1 144 LEU n 
1 145 HIS n 
1 146 SER n 
1 147 LEU n 
1 148 LEU n 
1 149 VAL n 
1 150 ASP n 
1 151 VAL n 
1 152 PRO n 
1 153 ALA n 
1 154 PHE n 
1 155 ALA n 
1 156 CYS n 
1 157 LEU n 
1 158 SER n 
1 159 ALA n 
1 160 LEU n 
1 161 VAL n 
1 162 LEU n 
1 163 ILE n 
1 164 THR n 
1 165 ASP n 
1 166 ARG n 
1 167 HIS n 
1 168 GLY n 
1 169 LEU n 
1 170 GLN n 
1 171 GLU n 
1 172 PRO n 
1 173 ARG n 
1 174 ARG n 
1 175 VAL n 
1 176 GLU n 
1 177 GLU n 
1 178 LEU n 
1 179 GLN n 
1 180 ASN n 
1 181 ARG n 
1 182 ILE n 
1 183 ALA n 
1 184 SER n 
1 185 CYS n 
1 186 LEU n 
1 187 LYS n 
1 188 GLU n 
1 189 HIS n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 GLY n 
1 196 GLU n 
1 197 PRO n 
1 198 GLN n 
1 199 PRO n 
1 200 ALA n 
1 201 SER n 
1 202 CYS n 
1 203 LEU n 
1 204 SER n 
1 205 ARG n 
1 206 LEU n 
1 207 LEU n 
1 208 GLY n 
1 209 LYS n 
1 210 LEU n 
1 211 PRO n 
1 212 GLU n 
1 213 LEU n 
1 214 ARG n 
1 215 THR n 
1 216 LEU n 
1 217 CYS n 
1 218 THR n 
1 219 GLN n 
1 220 GLY n 
1 221 LEU n 
1 222 GLN n 
1 223 ARG n 
1 224 ILE n 
1 225 PHE n 
1 226 TYR n 
1 227 LEU n 
1 228 LYS n 
1 229 LEU n 
1 230 GLU n 
1 231 ASP n 
1 232 LEU n 
1 233 VAL n 
1 234 PRO n 
1 235 PRO n 
1 236 PRO n 
1 237 PRO n 
1 238 ILE n 
1 239 ILE n 
1 240 ASP n 
1 241 LYS n 
1 242 ILE n 
1 243 PHE n 
1 244 MET n 
1 245 ASP n 
1 246 THR n 
1 247 LEU n 
1 248 PRO n 
1 249 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR4A1, GFRP1, HMR, NAK1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NR4A1_HUMAN 
_struct_ref.pdbx_db_accession          P22736 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAEL
SPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALV
LITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDK
IFMDTLPF
;
_struct_ref.pdbx_align_begin           351 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4JGV A 2 ? 249 ? P22736 351 ? 598 ? 351 598 
2 1 4JGV B 2 ? 249 ? P22736 351 ? 598 ? 351 598 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4JGV SER A 1 ? UNP P22736 ? ? 'EXPRESSION TAG' 350 1 
2 4JGV SER B 1 ? UNP P22736 ? ? 'EXPRESSION TAG' 350 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                 ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                               ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                                'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                               ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                           ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ?                               'C3 H7 N O3'     105.093 
T94 non-polymer         . '1-(3,4,5-trihydroxyphenyl)nonan-1-one' ?                               'C15 H22 O4'     266.333 
THR 'L-peptide linking' y THREONINE                               ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4JGV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.30 
_exptl_crystal.density_percent_sol   62.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '7% PEG 6000, pH 4.8, VAPOR DIFFUSION, HANGING DROP, EVAPORATION, temperature 289K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX-225' 
_diffrn_detector.pdbx_collection_date   2012-10-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97924 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97924 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4JGV 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   15103 
_reflns.number_all                   15133 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.103 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.05 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        6.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4JGV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     14304 
_refine.ls_number_reflns_all                     14389 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.30 
_refine.ls_d_res_high                            3.01 
_refine.ls_percent_reflns_obs                    99.41 
_refine.ls_R_factor_obs                          0.18175 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17791 
_refine.ls_R_factor_R_free                       0.25587 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  757 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.900 
_refine.B_iso_mean                               67.018 
_refine.aniso_B[1][1]                            0.53 
_refine.aniso_B[2][2]                            0.92 
_refine.aniso_B[3][3]                            -1.45 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.409 
_refine.overall_SU_ML                            0.282 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             15.362 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3616 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             216 
_refine_hist.number_atoms_total               3893 
_refine_hist.d_res_high                       3.01 
_refine_hist.d_res_low                        49.30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.019  ? 3743 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 3733 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.484  2.013  ? 5051 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.079  3.000  ? 8599 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.767  5.000  ? 452  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.880 23.290 ? 155  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.751 15.000 ? 653  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       25.049 15.000 ? 28   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.075  0.200  ? 587  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 4050 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.004  0.020  ? 808  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 13244 0.15 0.05 'interatomic distance' 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 13244 0.15 0.05 'interatomic distance' 1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.006 
_refine_ls_shell.d_res_low                        3.084 
_refine_ls_shell.number_reflns_R_work             1020 
_refine_ls_shell.R_factor_R_work                  0.207 
_refine_ls_shell.percent_reflns_obs               95.65 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4JGV 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 362 A 598 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 362 B 598 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4JGV 
_struct.title                     'Crystal Structure of Human Nur77 Ligand-binding Domain in Complex with THPN' 
_struct.pdbx_descriptor           'Nuclear receptor subfamily 4 group A member 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4JGV 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            Transcription 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 13  ? SER A 26  ? ALA A 362 SER A 375 1 ? 14 
HELX_P HELX_P2  2  SER A 29  ? LEU A 33  ? SER A 378 LEU A 382 5 ? 5  
HELX_P HELX_P3  3  ASP A 50  ? LYS A 74  ? ASP A 399 LYS A 423 1 ? 25 
HELX_P HELX_P4  4  GLY A 77  ? LEU A 81  ? GLY A 426 LEU A 430 5 ? 5  
HELX_P HELX_P5  5  SER A 82  ? SER A 106 ? SER A 431 SER A 455 1 ? 25 
HELX_P HELX_P6  6  LYS A 107 ? GLU A 110 ? LYS A 456 GLU A 459 5 ? 4  
HELX_P HELX_P7  7  ARG A 123 ? GLY A 131 ? ARG A 472 GLY A 480 1 ? 9  
HELX_P HELX_P8  8  ASP A 132 ? LEU A 147 ? ASP A 481 LEU A 496 1 ? 16 
HELX_P HELX_P9  9  ASP A 150 ? ILE A 163 ? ASP A 499 ILE A 512 1 ? 14 
HELX_P HELX_P10 10 GLU A 171 ? ALA A 194 ? GLU A 520 ALA A 543 1 ? 24 
HELX_P HELX_P11 11 SER A 204 ? GLY A 208 ? SER A 553 GLY A 557 1 ? 5  
HELX_P HELX_P12 12 LYS A 209 ? ASP A 231 ? LYS A 558 ASP A 580 1 ? 23 
HELX_P HELX_P13 13 PRO A 236 ? THR A 246 ? PRO A 585 THR A 595 1 ? 11 
HELX_P HELX_P14 14 ASN B 14  ? ASP B 25  ? ASN B 363 ASP B 374 1 ? 12 
HELX_P HELX_P15 15 SER B 29  ? LEU B 33  ? SER B 378 LEU B 382 5 ? 5  
HELX_P HELX_P16 16 ASP B 50  ? LYS B 74  ? ASP B 399 LYS B 423 1 ? 25 
HELX_P HELX_P17 17 GLY B 77  ? LEU B 81  ? GLY B 426 LEU B 430 5 ? 5  
HELX_P HELX_P18 18 SER B 82  ? SER B 106 ? SER B 431 SER B 455 1 ? 25 
HELX_P HELX_P19 19 LYS B 107 ? GLU B 110 ? LYS B 456 GLU B 459 5 ? 4  
HELX_P HELX_P20 20 ARG B 123 ? GLY B 131 ? ARG B 472 GLY B 480 1 ? 9  
HELX_P HELX_P21 21 ASP B 132 ? LEU B 147 ? ASP B 481 LEU B 496 1 ? 16 
HELX_P HELX_P22 22 ASP B 150 ? ILE B 163 ? ASP B 499 ILE B 512 1 ? 14 
HELX_P HELX_P23 23 GLU B 171 ? VAL B 193 ? GLU B 520 VAL B 542 1 ? 23 
HELX_P HELX_P24 24 GLY B 208 ? ASP B 231 ? GLY B 557 ASP B 580 1 ? 24 
HELX_P HELX_P25 25 PRO B 236 ? THR B 246 ? PRO B 585 THR B 595 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 199 A . ? PRO 548 A ALA 200 A ? ALA 549 A 1 10.66 
2 LEU 43  B . ? LEU 392 B PRO 44  B ? PRO 393 B 1 8.69  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 112 ? ILE A 114 ? LYS A 461 ILE A 463 
A 2 VAL A 120 ? HIS A 122 ? VAL A 469 HIS A 471 
B 1 LYS B 112 ? ILE B 114 ? LYS B 461 ILE B 463 
B 2 VAL B 120 ? HIS B 122 ? VAL B 469 HIS B 471 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 113 ? N LEU A 462 O LEU A 121 ? O LEU A 470 
B 1 2 N LEU B 113 ? N LEU B 462 O LEU B 121 ? O LEU B 470 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE T94 A 601' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 602' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 603' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 604' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 605' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE GOL A 606' 
AC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 607' 
AC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL B 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 GLU A 40  ? GLU A 389 . ? 4_455 ? 
2  AC1 11 LEU A 41  ? LEU A 390 . ? 4_455 ? 
3  AC1 11 HIS A 122 ? HIS A 471 . ? 4_455 ? 
4  AC1 11 LEU A 160 ? LEU A 509 . ? 1_555 ? 
5  AC1 11 VAL A 161 ? VAL A 510 . ? 1_555 ? 
6  AC1 11 ILE A 163 ? ILE A 512 . ? 1_555 ? 
7  AC1 11 THR A 164 ? THR A 513 . ? 1_555 ? 
8  AC1 11 GLN A 179 ? GLN A 528 . ? 1_555 ? 
9  AC1 11 LEU A 206 ? LEU A 555 . ? 1_555 ? 
10 AC1 11 LYS A 209 ? LYS A 558 . ? 1_555 ? 
11 AC1 11 HOH K .   ? HOH A 816 . ? 1_555 ? 
12 AC2 10 PRO A 108 ? PRO A 457 . ? 1_555 ? 
13 AC2 10 GLY A 109 ? GLY A 458 . ? 1_555 ? 
14 AC2 10 ARG A 142 ? ARG A 491 . ? 1_555 ? 
15 AC2 10 ARG A 166 ? ARG A 515 . ? 4_555 ? 
16 AC2 10 HIS A 167 ? HIS A 516 . ? 4_555 ? 
17 AC2 10 GLY A 168 ? GLY A 517 . ? 4_555 ? 
18 AC2 10 LEU A 169 ? LEU A 518 . ? 4_555 ? 
19 AC2 10 GOL F .   ? GOL A 604 . ? 1_555 ? 
20 AC2 10 HOH K .   ? HOH A 755 . ? 1_555 ? 
21 AC2 10 HOH K .   ? HOH A 806 . ? 1_555 ? 
22 AC3 6  ASP A 132 ? ASP A 481 . ? 1_555 ? 
23 AC3 6  ASP A 135 ? ASP A 484 . ? 1_555 ? 
24 AC3 6  ARG A 173 ? ARG A 522 . ? 4_555 ? 
25 AC3 6  GLU A 176 ? GLU A 525 . ? 4_555 ? 
26 AC3 6  GLU A 177 ? GLU A 526 . ? 4_555 ? 
27 AC3 6  ASN A 180 ? ASN A 529 . ? 4_555 ? 
28 AC4 6  PRO A 108 ? PRO A 457 . ? 1_555 ? 
29 AC4 6  GLY A 109 ? GLY A 458 . ? 1_555 ? 
30 AC4 6  GLU A 110 ? GLU A 459 . ? 1_555 ? 
31 AC4 6  HIS A 145 ? HIS A 494 . ? 1_555 ? 
32 AC4 6  HIS A 167 ? HIS A 516 . ? 4_555 ? 
33 AC4 6  GOL D .   ? GOL A 602 . ? 1_555 ? 
34 AC5 4  ARG A 223 ? ARG A 572 . ? 1_555 ? 
35 AC5 4  HOH K .   ? HOH A 793 . ? 1_555 ? 
36 AC5 4  HOH K .   ? HOH A 805 . ? 1_555 ? 
37 AC5 4  GLN B 222 ? GLN B 571 . ? 1_555 ? 
38 AC6 2  ASP A 150 ? ASP A 499 . ? 1_555 ? 
39 AC6 2  HOH K .   ? HOH A 758 . ? 1_555 ? 
40 AC7 10 HIS A 23  ? HIS A 372 . ? 1_555 ? 
41 AC7 10 LEU A 24  ? LEU A 373 . ? 1_555 ? 
42 AC7 10 SER A 26  ? SER A 375 . ? 1_555 ? 
43 AC7 10 GLY A 27  ? GLY A 376 . ? 1_555 ? 
44 AC7 10 PRO A 28  ? PRO A 377 . ? 1_555 ? 
45 AC7 10 ARG A 105 ? ARG A 454 . ? 1_555 ? 
46 AC7 10 HOH K .   ? HOH A 754 . ? 1_555 ? 
47 AC7 10 HOH K .   ? HOH A 794 . ? 1_555 ? 
48 AC7 10 HOH K .   ? HOH A 813 . ? 1_555 ? 
49 AC7 10 HOH K .   ? HOH A 818 . ? 1_555 ? 
50 AC8 7  HIS B 23  ? HIS B 372 . ? 1_555 ? 
51 AC8 7  GLY B 27  ? GLY B 376 . ? 1_555 ? 
52 AC8 7  PRO B 28  ? PRO B 377 . ? 1_555 ? 
53 AC8 7  ARG B 101 ? ARG B 450 . ? 1_555 ? 
54 AC8 7  ARG B 105 ? ARG B 454 . ? 1_555 ? 
55 AC8 7  HOH L .   ? HOH B 713 . ? 1_555 ? 
56 AC8 7  HOH L .   ? HOH B 722 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4JGV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4JGV 
_atom_sites.fract_transf_matrix[1][1]   0.013498 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013004 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007804 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 13  ? -10.836 23.105 -24.505 1.00 93.99  ? 362 ALA A N   1 
ATOM   2    C CA  . ALA A 1 13  ? -11.881 24.149 -24.259 1.00 91.85  ? 362 ALA A CA  1 
ATOM   3    C C   . ALA A 1 13  ? -11.241 25.543 -24.101 1.00 88.33  ? 362 ALA A C   1 
ATOM   4    O O   . ALA A 1 13  ? -10.047 25.667 -23.831 1.00 87.92  ? 362 ALA A O   1 
ATOM   5    C CB  . ALA A 1 13  ? -12.724 23.776 -23.036 1.00 86.74  ? 362 ALA A CB  1 
ATOM   6    N N   . ASN A 1 14  ? -12.033 26.585 -24.305 1.00 84.56  ? 363 ASN A N   1 
ATOM   7    C CA  . ASN A 1 14  ? -11.593 27.925 -23.989 1.00 83.73  ? 363 ASN A CA  1 
ATOM   8    C C   . ASN A 1 14  ? -11.708 28.140 -22.495 1.00 83.80  ? 363 ASN A C   1 
ATOM   9    O O   . ASN A 1 14  ? -11.079 29.044 -21.929 1.00 85.89  ? 363 ASN A O   1 
ATOM   10   C CB  . ASN A 1 14  ? -12.442 28.952 -24.701 1.00 89.10  ? 363 ASN A CB  1 
ATOM   11   C CG  . ASN A 1 14  ? -11.840 30.335 -24.619 1.00 97.06  ? 363 ASN A CG  1 
ATOM   12   O OD1 . ASN A 1 14  ? -10.710 30.554 -25.051 1.00 97.40  ? 363 ASN A OD1 1 
ATOM   13   N ND2 . ASN A 1 14  ? -12.577 31.271 -24.051 1.00 104.64 ? 363 ASN A ND2 1 
ATOM   14   N N   . LEU A 1 15  ? -12.541 27.315 -21.859 1.00 78.76  ? 364 LEU A N   1 
ATOM   15   C CA  . LEU A 1 15  ? -12.633 27.270 -20.401 1.00 66.20  ? 364 LEU A CA  1 
ATOM   16   C C   . LEU A 1 15  ? -11.361 26.698 -19.818 1.00 65.74  ? 364 LEU A C   1 
ATOM   17   O O   . LEU A 1 15  ? -10.690 27.340 -19.009 1.00 64.85  ? 364 LEU A O   1 
ATOM   18   C CB  . LEU A 1 15  ? -13.804 26.399 -19.957 1.00 58.11  ? 364 LEU A CB  1 
ATOM   19   C CG  . LEU A 1 15  ? -13.897 26.306 -18.441 1.00 51.70  ? 364 LEU A CG  1 
ATOM   20   C CD1 . LEU A 1 15  ? -14.005 27.690 -17.831 1.00 47.47  ? 364 LEU A CD1 1 
ATOM   21   C CD2 . LEU A 1 15  ? -15.051 25.435 -17.976 1.00 50.66  ? 364 LEU A CD2 1 
ATOM   22   N N   . LEU A 1 16  ? -11.033 25.482 -20.238 1.00 61.33  ? 365 LEU A N   1 
ATOM   23   C CA  . LEU A 1 16  ? -9.820  24.844 -19.789 1.00 61.00  ? 365 LEU A CA  1 
ATOM   24   C C   . LEU A 1 16  ? -8.668  25.811 -19.935 1.00 65.33  ? 365 LEU A C   1 
ATOM   25   O O   . LEU A 1 16  ? -7.943  26.079 -18.979 1.00 70.35  ? 365 LEU A O   1 
ATOM   26   C CB  . LEU A 1 16  ? -9.541  23.589 -20.598 1.00 62.36  ? 365 LEU A CB  1 
ATOM   27   C CG  . LEU A 1 16  ? -8.365  22.760 -20.096 1.00 68.65  ? 365 LEU A CG  1 
ATOM   28   C CD1 . LEU A 1 16  ? -8.524  22.468 -18.602 1.00 72.50  ? 365 LEU A CD1 1 
ATOM   29   C CD2 . LEU A 1 16  ? -8.211  21.463 -20.880 1.00 67.61  ? 365 LEU A CD2 1 
ATOM   30   N N   . THR A 1 17  ? -8.510  26.344 -21.139 1.00 68.19  ? 366 THR A N   1 
ATOM   31   C CA  . THR A 1 17  ? -7.472  27.326 -21.407 1.00 67.31  ? 366 THR A CA  1 
ATOM   32   C C   . THR A 1 17  ? -7.507  28.455 -20.398 1.00 61.01  ? 366 THR A C   1 
ATOM   33   O O   . THR A 1 17  ? -6.469  28.847 -19.882 1.00 64.75  ? 366 THR A O   1 
ATOM   34   C CB  . THR A 1 17  ? -7.619  27.929 -22.809 1.00 69.09  ? 366 THR A CB  1 
ATOM   35   O OG1 . THR A 1 17  ? -7.637  26.872 -23.774 1.00 76.67  ? 366 THR A OG1 1 
ATOM   36   C CG2 . THR A 1 17  ? -6.466  28.892 -23.119 1.00 67.66  ? 366 THR A CG2 1 
ATOM   37   N N   . SER A 1 18  ? -8.688  28.989 -20.137 1.00 55.25  ? 367 SER A N   1 
ATOM   38   C CA  . SER A 1 18  ? -8.799  30.084 -19.183 1.00 55.85  ? 367 SER A CA  1 
ATOM   39   C C   . SER A 1 18  ? -8.316  29.644 -17.823 1.00 56.85  ? 367 SER A C   1 
ATOM   40   O O   . SER A 1 18  ? -7.586  30.384 -17.164 1.00 54.15  ? 367 SER A O   1 
ATOM   41   C CB  . SER A 1 18  ? -10.239 30.571 -19.057 1.00 53.89  ? 367 SER A CB  1 
ATOM   42   O OG  . SER A 1 18  ? -10.597 31.326 -20.185 1.00 55.88  ? 367 SER A OG  1 
ATOM   43   N N   . LEU A 1 19  ? -8.730  28.437 -17.418 1.00 55.58  ? 368 LEU A N   1 
ATOM   44   C CA  . LEU A 1 19  ? -8.382  27.884 -16.104 1.00 54.11  ? 368 LEU A CA  1 
ATOM   45   C C   . LEU A 1 19  ? -6.869  27.676 -15.952 1.00 59.15  ? 368 LEU A C   1 
ATOM   46   O O   . LEU A 1 19  ? -6.295  28.019 -14.918 1.00 56.14  ? 368 LEU A O   1 
ATOM   47   C CB  . LEU A 1 19  ? -9.101  26.552 -15.868 1.00 49.90  ? 368 LEU A CB  1 
ATOM   48   C CG  . LEU A 1 19  ? -10.610 26.613 -15.636 1.00 45.96  ? 368 LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 19  ? -11.173 25.214 -15.611 1.00 44.71  ? 368 LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 19  ? -10.942 27.322 -14.344 1.00 46.71  ? 368 LEU A CD2 1 
ATOM   51   N N   . VAL A 1 20  ? -6.247  27.103 -16.989 1.00 58.08  ? 369 VAL A N   1 
ATOM   52   C CA  . VAL A 1 20  ? -4.813  26.849 -17.003 1.00 55.72  ? 369 VAL A CA  1 
ATOM   53   C C   . VAL A 1 20  ? -4.008  28.138 -16.997 1.00 58.57  ? 369 VAL A C   1 
ATOM   54   O O   . VAL A 1 20  ? -2.964  28.248 -16.323 1.00 55.53  ? 369 VAL A O   1 
ATOM   55   C CB  . VAL A 1 20  ? -4.388  26.052 -18.241 1.00 51.55  ? 369 VAL A CB  1 
ATOM   56   C CG1 . VAL A 1 20  ? -2.872  25.992 -18.330 1.00 49.37  ? 369 VAL A CG1 1 
ATOM   57   C CG2 . VAL A 1 20  ? -4.945  24.628 -18.192 1.00 53.06  ? 369 VAL A CG2 1 
ATOM   58   N N   . ARG A 1 21  ? -4.464  29.094 -17.785 1.00 58.92  ? 370 ARG A N   1 
ATOM   59   C CA  . ARG A 1 21  ? -3.762  30.330 -17.870 1.00 65.19  ? 370 ARG A CA  1 
ATOM   60   C C   . ARG A 1 21  ? -3.864  30.999 -16.516 1.00 64.28  ? 370 ARG A C   1 
ATOM   61   O O   . ARG A 1 21  ? -2.870  31.544 -16.019 1.00 70.86  ? 370 ARG A O   1 
ATOM   62   C CB  . ARG A 1 21  ? -4.290  31.216 -18.991 1.00 75.76  ? 370 ARG A CB  1 
ATOM   63   C CG  . ARG A 1 21  ? -3.520  32.532 -19.038 1.00 87.78  ? 370 ARG A CG  1 
ATOM   64   C CD  . ARG A 1 21  ? -3.008  32.971 -20.412 1.00 106.57 ? 370 ARG A CD  1 
ATOM   65   N NE  . ARG A 1 21  ? -4.015  33.230 -21.457 1.00 117.04 ? 370 ARG A NE  1 
ATOM   66   C CZ  . ARG A 1 21  ? -4.249  32.461 -22.529 1.00 114.65 ? 370 ARG A CZ  1 
ATOM   67   N NH1 . ARG A 1 21  ? -5.172  32.838 -23.407 1.00 112.84 ? 370 ARG A NH1 1 
ATOM   68   N NH2 . ARG A 1 21  ? -3.589  31.320 -22.737 1.00 109.59 ? 370 ARG A NH2 1 
ATOM   69   N N   . ALA A 1 22  ? -5.036  30.921 -15.892 1.00 60.08  ? 371 ALA A N   1 
ATOM   70   C CA  . ALA A 1 22  ? -5.231  31.550 -14.573 1.00 58.80  ? 371 ALA A CA  1 
ATOM   71   C C   . ALA A 1 22  ? -4.273  30.965 -13.522 1.00 54.09  ? 371 ALA A C   1 
ATOM   72   O O   . ALA A 1 22  ? -3.609  31.709 -12.796 1.00 50.21  ? 371 ALA A O   1 
ATOM   73   C CB  . ALA A 1 22  ? -6.671  31.403 -14.114 1.00 57.50  ? 371 ALA A CB  1 
ATOM   74   N N   . HIS A 1 23  ? -4.231  29.637 -13.468 1.00 48.47  ? 372 HIS A N   1 
ATOM   75   C CA  . HIS A 1 23  ? -3.309  28.870 -12.633 1.00 50.42  ? 372 HIS A CA  1 
ATOM   76   C C   . HIS A 1 23  ? -1.828  29.224 -12.793 1.00 50.71  ? 372 HIS A C   1 
ATOM   77   O O   . HIS A 1 23  ? -1.153  29.569 -11.823 1.00 48.01  ? 372 HIS A O   1 
ATOM   78   C CB  . HIS A 1 23  ? -3.461  27.373 -12.956 1.00 52.65  ? 372 HIS A CB  1 
ATOM   79   C CG  . HIS A 1 23  ? -2.486  26.503 -12.232 1.00 52.55  ? 372 HIS A CG  1 
ATOM   80   N ND1 . HIS A 1 23  ? -2.502  26.349 -10.860 1.00 52.76  ? 372 HIS A ND1 1 
ATOM   81   C CD2 . HIS A 1 23  ? -1.464  25.746 -12.686 1.00 51.49  ? 372 HIS A CD2 1 
ATOM   82   C CE1 . HIS A 1 23  ? -1.526  25.536 -10.502 1.00 53.66  ? 372 HIS A CE1 1 
ATOM   83   N NE2 . HIS A 1 23  ? -0.888  25.148 -11.593 1.00 54.80  ? 372 HIS A NE2 1 
ATOM   84   N N   . LEU A 1 24  ? -1.317  29.096 -14.012 1.00 51.20  ? 373 LEU A N   1 
ATOM   85   C CA  . LEU A 1 24  ? 0.085   29.397 -14.270 1.00 52.44  ? 373 LEU A CA  1 
ATOM   86   C C   . LEU A 1 24  ? 0.422   30.827 -13.914 1.00 53.82  ? 373 LEU A C   1 
ATOM   87   O O   . LEU A 1 24  ? 1.508   31.094 -13.411 1.00 57.23  ? 373 LEU A O   1 
ATOM   88   C CB  . LEU A 1 24  ? 0.442   29.169 -15.733 1.00 51.80  ? 373 LEU A CB  1 
ATOM   89   C CG  . LEU A 1 24  ? 0.856   27.785 -16.237 1.00 54.12  ? 373 LEU A CG  1 
ATOM   90   C CD1 . LEU A 1 24  ? 0.848   26.705 -15.160 1.00 59.10  ? 373 LEU A CD1 1 
ATOM   91   C CD2 . LEU A 1 24  ? 0.081   27.357 -17.478 1.00 51.46  ? 373 LEU A CD2 1 
ATOM   92   N N   . ASP A 1 25  ? -0.489  31.756 -14.178 1.00 52.53  ? 374 ASP A N   1 
ATOM   93   C CA  . ASP A 1 25  ? -0.204  33.145 -13.870 1.00 59.20  ? 374 ASP A CA  1 
ATOM   94   C C   . ASP A 1 25  ? -0.184  33.400 -12.382 1.00 55.99  ? 374 ASP A C   1 
ATOM   95   O O   . ASP A 1 25  ? 0.277   34.453 -11.978 1.00 63.78  ? 374 ASP A O   1 
ATOM   96   C CB  . ASP A 1 25  ? -1.208  34.102 -14.510 1.00 66.18  ? 374 ASP A CB  1 
ATOM   97   C CG  . ASP A 1 25  ? -1.044  34.216 -16.014 1.00 73.61  ? 374 ASP A CG  1 
ATOM   98   O OD1 . ASP A 1 25  ? 0.032   33.847 -16.561 1.00 77.97  ? 374 ASP A OD1 1 
ATOM   99   O OD2 . ASP A 1 25  ? -2.013  34.690 -16.649 1.00 80.29  ? 374 ASP A OD2 1 
ATOM   100  N N   . SER A 1 26  ? -0.652  32.445 -11.577 1.00 56.36  ? 375 SER A N   1 
ATOM   101  C CA  . SER A 1 26  ? -0.809  32.626 -10.120 1.00 55.74  ? 375 SER A CA  1 
ATOM   102  C C   . SER A 1 26  ? 0.345   32.055 -9.339  1.00 55.96  ? 375 SER A C   1 
ATOM   103  O O   . SER A 1 26  ? 0.232   31.793 -8.164  1.00 47.91  ? 375 SER A O   1 
ATOM   104  C CB  . SER A 1 26  ? -2.077  31.935 -9.633  1.00 56.46  ? 375 SER A CB  1 
ATOM   105  O OG  . SER A 1 26  ? -1.971  30.511 -9.700  1.00 52.85  ? 375 SER A OG  1 
ATOM   106  N N   . GLY A 1 27  ? 1.465   31.869 -10.006 1.00 67.33  ? 376 GLY A N   1 
ATOM   107  C CA  . GLY A 1 27  ? 2.577   31.207 -9.413  1.00 67.96  ? 376 GLY A CA  1 
ATOM   108  C C   . GLY A 1 27  ? 3.827   31.402 -10.224 1.00 68.96  ? 376 GLY A C   1 
ATOM   109  O O   . GLY A 1 27  ? 3.786   31.864 -11.374 1.00 77.12  ? 376 GLY A O   1 
ATOM   110  N N   . PRO A 1 28  ? 4.953   31.049 -9.629  1.00 66.46  ? 377 PRO A N   1 
ATOM   111  C CA  . PRO A 1 28  ? 6.233   31.338 -10.214 1.00 70.91  ? 377 PRO A CA  1 
ATOM   112  C C   . PRO A 1 28  ? 6.669   30.313 -11.248 1.00 73.66  ? 377 PRO A C   1 
ATOM   113  O O   . PRO A 1 28  ? 6.246   29.169 -11.180 1.00 70.01  ? 377 PRO A O   1 
ATOM   114  C CB  . PRO A 1 28  ? 7.152   31.296 -9.003  1.00 69.77  ? 377 PRO A CB  1 
ATOM   115  C CG  . PRO A 1 28  ? 6.554   30.230 -8.174  1.00 68.46  ? 377 PRO A CG  1 
ATOM   116  C CD  . PRO A 1 28  ? 5.081   30.457 -8.293  1.00 68.47  ? 377 PRO A CD  1 
ATOM   117  N N   . SER A 1 29  ? 7.499   30.751 -12.197 1.00 80.75  ? 378 SER A N   1 
ATOM   118  C CA  . SER A 1 29  ? 8.222   29.847 -13.124 1.00 82.96  ? 378 SER A CA  1 
ATOM   119  C C   . SER A 1 29  ? 9.585   29.477 -12.537 1.00 83.44  ? 378 SER A C   1 
ATOM   120  O O   . SER A 1 29  ? 10.168  30.264 -11.774 1.00 88.52  ? 378 SER A O   1 
ATOM   121  C CB  . SER A 1 29  ? 8.450   30.519 -14.490 1.00 83.97  ? 378 SER A CB  1 
ATOM   122  O OG  . SER A 1 29  ? 9.167   31.740 -14.343 1.00 81.17  ? 378 SER A OG  1 
ATOM   123  N N   . THR A 1 30  ? 10.107  28.306 -12.918 1.00 82.81  ? 379 THR A N   1 
ATOM   124  C CA  . THR A 1 30  ? 11.433  27.840 -12.438 1.00 91.09  ? 379 THR A CA  1 
ATOM   125  C C   . THR A 1 30  ? 12.463  28.937 -12.639 1.00 91.31  ? 379 THR A C   1 
ATOM   126  O O   . THR A 1 30  ? 13.317  29.163 -11.781 1.00 92.00  ? 379 THR A O   1 
ATOM   127  C CB  . THR A 1 30  ? 11.961  26.552 -13.146 1.00 91.84  ? 379 THR A CB  1 
ATOM   128  O OG1 . THR A 1 30  ? 10.914  25.899 -13.882 1.00 94.50  ? 379 THR A OG1 1 
ATOM   129  C CG2 . THR A 1 30  ? 12.570  25.556 -12.131 1.00 88.56  ? 379 THR A CG2 1 
ATOM   130  N N   . ALA A 1 31  ? 12.343  29.625 -13.768 1.00 97.07  ? 380 ALA A N   1 
ATOM   131  C CA  . ALA A 1 31  ? 13.090  30.853 -14.037 1.00 103.46 ? 380 ALA A CA  1 
ATOM   132  C C   . ALA A 1 31  ? 13.124  31.865 -12.873 1.00 100.52 ? 380 ALA A C   1 
ATOM   133  O O   . ALA A 1 31  ? 14.192  32.334 -12.508 1.00 111.79 ? 380 ALA A O   1 
ATOM   134  C CB  . ALA A 1 31  ? 12.545  31.526 -15.299 1.00 105.85 ? 380 ALA A CB  1 
ATOM   135  N N   . LYS A 1 32  ? 11.980  32.205 -12.285 1.00 98.62  ? 381 LYS A N   1 
ATOM   136  C CA  . LYS A 1 32  ? 11.935  33.317 -11.314 1.00 98.20  ? 381 LYS A CA  1 
ATOM   137  C C   . LYS A 1 32  ? 11.690  32.917 -9.839  1.00 98.05  ? 381 LYS A C   1 
ATOM   138  O O   . LYS A 1 32  ? 11.121  33.690 -9.041  1.00 94.78  ? 381 LYS A O   1 
ATOM   139  C CB  . LYS A 1 32  ? 10.920  34.367 -11.767 1.00 100.02 ? 381 LYS A CB  1 
ATOM   140  C CG  . LYS A 1 32  ? 9.549   33.814 -12.109 1.00 99.49  ? 381 LYS A CG  1 
ATOM   141  C CD  . LYS A 1 32  ? 8.474   34.879 -11.936 1.00 98.64  ? 381 LYS A CD  1 
ATOM   142  C CE  . LYS A 1 32  ? 7.729   34.711 -10.618 1.00 101.31 ? 381 LYS A CE  1 
ATOM   143  N NZ  . LYS A 1 32  ? 8.557   34.651 -9.371  1.00 97.17  ? 381 LYS A NZ  1 
ATOM   144  N N   . LEU A 1 33  ? 12.148  31.717 -9.480  1.00 92.19  ? 382 LEU A N   1 
ATOM   145  C CA  . LEU A 1 33  ? 12.220  31.292 -8.070  1.00 80.90  ? 382 LEU A CA  1 
ATOM   146  C C   . LEU A 1 33  ? 13.217  32.141 -7.285  1.00 75.81  ? 382 LEU A C   1 
ATOM   147  O O   . LEU A 1 33  ? 14.229  32.567 -7.822  1.00 76.25  ? 382 LEU A O   1 
ATOM   148  C CB  . LEU A 1 33  ? 12.640  29.835 -7.986  1.00 75.08  ? 382 LEU A CB  1 
ATOM   149  C CG  . LEU A 1 33  ? 11.649  28.823 -8.556  1.00 73.55  ? 382 LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 33  ? 12.150  27.402 -8.342  1.00 74.76  ? 382 LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 33  ? 10.283  29.021 -7.930  1.00 69.46  ? 382 LEU A CD2 1 
ATOM   152  N N   . ASP A 1 34  ? 12.917  32.372 -6.014  1.00 71.08  ? 383 ASP A N   1 
ATOM   153  C CA  . ASP A 1 34  ? 13.671  33.307 -5.189  1.00 66.10  ? 383 ASP A CA  1 
ATOM   154  C C   . ASP A 1 34  ? 14.363  32.543 -4.056  1.00 64.02  ? 383 ASP A C   1 
ATOM   155  O O   . ASP A 1 34  ? 13.738  32.187 -3.038  1.00 60.81  ? 383 ASP A O   1 
ATOM   156  C CB  . ASP A 1 34  ? 12.736  34.389 -4.651  1.00 63.27  ? 383 ASP A CB  1 
ATOM   157  C CG  . ASP A 1 34  ? 13.411  35.323 -3.675  1.00 66.75  ? 383 ASP A CG  1 
ATOM   158  O OD1 . ASP A 1 34  ? 14.652  35.253 -3.518  1.00 74.74  ? 383 ASP A OD1 1 
ATOM   159  O OD2 . ASP A 1 34  ? 12.699  36.132 -3.050  1.00 60.85  ? 383 ASP A OD2 1 
ATOM   160  N N   . TYR A 1 35  ? 15.659  32.294 -4.254  1.00 60.00  ? 384 TYR A N   1 
ATOM   161  C CA  . TYR A 1 35  ? 16.440  31.514 -3.315  1.00 58.94  ? 384 TYR A CA  1 
ATOM   162  C C   . TYR A 1 35  ? 17.177  32.377 -2.315  1.00 60.75  ? 384 TYR A C   1 
ATOM   163  O O   . TYR A 1 35  ? 17.928  31.850 -1.499  1.00 63.74  ? 384 TYR A O   1 
ATOM   164  C CB  . TYR A 1 35  ? 17.438  30.625 -4.048  1.00 56.74  ? 384 TYR A CB  1 
ATOM   165  C CG  . TYR A 1 35  ? 16.826  29.349 -4.557  1.00 57.39  ? 384 TYR A CG  1 
ATOM   166  C CD1 . TYR A 1 35  ? 16.690  28.245 -3.725  1.00 61.55  ? 384 TYR A CD1 1 
ATOM   167  C CD2 . TYR A 1 35  ? 16.386  29.233 -5.856  1.00 57.76  ? 384 TYR A CD2 1 
ATOM   168  C CE1 . TYR A 1 35  ? 16.133  27.053 -4.166  1.00 59.84  ? 384 TYR A CE1 1 
ATOM   169  C CE2 . TYR A 1 35  ? 15.827  28.046 -6.315  1.00 61.05  ? 384 TYR A CE2 1 
ATOM   170  C CZ  . TYR A 1 35  ? 15.699  26.960 -5.463  1.00 61.96  ? 384 TYR A CZ  1 
ATOM   171  O OH  . TYR A 1 35  ? 15.143  25.777 -5.912  1.00 65.21  ? 384 TYR A OH  1 
ATOM   172  N N   . SER A 1 36  ? 16.918  33.681 -2.332  1.00 64.57  ? 385 SER A N   1 
ATOM   173  C CA  . SER A 1 36  ? 17.615  34.627 -1.448  1.00 69.34  ? 385 SER A CA  1 
ATOM   174  C C   . SER A 1 36  ? 17.583  34.254 0.034   1.00 68.59  ? 385 SER A C   1 
ATOM   175  O O   . SER A 1 36  ? 18.605  34.308 0.708   1.00 74.13  ? 385 SER A O   1 
ATOM   176  C CB  . SER A 1 36  ? 17.062  36.044 -1.618  1.00 67.31  ? 385 SER A CB  1 
ATOM   177  O OG  . SER A 1 36  ? 15.647  36.055 -1.550  1.00 67.35  ? 385 SER A OG  1 
ATOM   178  N N   . LYS A 1 37  ? 16.431  33.840 0.538   1.00 69.06  ? 386 LYS A N   1 
ATOM   179  C CA  . LYS A 1 37  ? 16.335  33.478 1.950   1.00 67.81  ? 386 LYS A CA  1 
ATOM   180  C C   . LYS A 1 37  ? 16.445  31.971 2.180   1.00 60.21  ? 386 LYS A C   1 
ATOM   181  O O   . LYS A 1 37  ? 16.389  31.531 3.309   1.00 51.99  ? 386 LYS A O   1 
ATOM   182  C CB  . LYS A 1 37  ? 15.045  34.015 2.558   1.00 74.05  ? 386 LYS A CB  1 
ATOM   183  C CG  . LYS A 1 37  ? 14.775  35.486 2.267   1.00 80.87  ? 386 LYS A CG  1 
ATOM   184  C CD  . LYS A 1 37  ? 13.803  36.065 3.295   1.00 84.40  ? 386 LYS A CD  1 
ATOM   185  C CE  . LYS A 1 37  ? 12.769  37.006 2.681   1.00 90.32  ? 386 LYS A CE  1 
ATOM   186  N NZ  . LYS A 1 37  ? 11.559  37.136 3.545   1.00 89.52  ? 386 LYS A NZ  1 
ATOM   187  N N   . PHE A 1 38  ? 16.644  31.191 1.117   1.00 59.97  ? 387 PHE A N   1 
ATOM   188  C CA  . PHE A 1 38  ? 16.836  29.757 1.266   1.00 60.63  ? 387 PHE A CA  1 
ATOM   189  C C   . PHE A 1 38  ? 18.103  29.453 2.039   1.00 66.82  ? 387 PHE A C   1 
ATOM   190  O O   . PHE A 1 38  ? 19.151  30.021 1.753   1.00 79.68  ? 387 PHE A O   1 
ATOM   191  C CB  . PHE A 1 38  ? 16.940  29.050 -0.076  1.00 56.05  ? 387 PHE A CB  1 
ATOM   192  C CG  . PHE A 1 38  ? 16.948  27.546 0.042   1.00 57.39  ? 387 PHE A CG  1 
ATOM   193  C CD1 . PHE A 1 38  ? 15.788  26.849 0.397   1.00 61.86  ? 387 PHE A CD1 1 
ATOM   194  C CD2 . PHE A 1 38  ? 18.088  26.825 -0.180  1.00 57.82  ? 387 PHE A CD2 1 
ATOM   195  C CE1 . PHE A 1 38  ? 15.764  25.463 0.502   1.00 65.46  ? 387 PHE A CE1 1 
ATOM   196  C CE2 . PHE A 1 38  ? 18.077  25.439 -0.072  1.00 63.98  ? 387 PHE A CE2 1 
ATOM   197  C CZ  . PHE A 1 38  ? 16.917  24.753 0.263   1.00 65.46  ? 387 PHE A CZ  1 
ATOM   198  N N   . GLN A 1 39  ? 17.995  28.556 3.016   1.00 70.69  ? 388 GLN A N   1 
ATOM   199  C CA  . GLN A 1 39  ? 19.149  27.989 3.693   1.00 67.05  ? 388 GLN A CA  1 
ATOM   200  C C   . GLN A 1 39  ? 19.000  26.500 3.837   1.00 63.24  ? 388 GLN A C   1 
ATOM   201  O O   . GLN A 1 39  ? 18.034  26.006 4.411   1.00 60.04  ? 388 GLN A O   1 
ATOM   202  C CB  . GLN A 1 39  ? 19.350  28.627 5.042   1.00 73.19  ? 388 GLN A CB  1 
ATOM   203  C CG  . GLN A 1 39  ? 20.105  29.930 4.923   1.00 79.61  ? 388 GLN A CG  1 
ATOM   204  C CD  . GLN A 1 39  ? 20.297  30.547 6.269   1.00 89.01  ? 388 GLN A CD  1 
ATOM   205  O OE1 . GLN A 1 39  ? 19.411  31.259 6.747   1.00 89.73  ? 388 GLN A OE1 1 
ATOM   206  N NE2 . GLN A 1 39  ? 21.430  30.248 6.920   1.00 88.96  ? 388 GLN A NE2 1 
ATOM   207  N N   . GLU A 1 40  ? 20.015  25.810 3.342   1.00 66.18  ? 389 GLU A N   1 
ATOM   208  C CA  . GLU A 1 40  ? 20.014  24.367 3.148   1.00 66.52  ? 389 GLU A CA  1 
ATOM   209  C C   . GLU A 1 40  ? 19.918  23.659 4.515   1.00 64.50  ? 389 GLU A C   1 
ATOM   210  O O   . GLU A 1 40  ? 19.289  22.601 4.669   1.00 58.78  ? 389 GLU A O   1 
ATOM   211  C CB  . GLU A 1 40  ? 21.280  23.991 2.347   1.00 67.70  ? 389 GLU A CB  1 
ATOM   212  C CG  . GLU A 1 40  ? 21.444  24.613 0.931   1.00 72.95  ? 389 GLU A CG  1 
ATOM   213  C CD  . GLU A 1 40  ? 22.082  26.048 0.820   1.00 73.72  ? 389 GLU A CD  1 
ATOM   214  O OE1 . GLU A 1 40  ? 22.375  26.750 1.835   1.00 69.59  ? 389 GLU A OE1 1 
ATOM   215  O OE2 . GLU A 1 40  ? 22.306  26.489 -0.337  1.00 67.04  ? 389 GLU A OE2 1 
ATOM   216  N N   . LEU A 1 41  ? 20.475  24.303 5.528   1.00 65.28  ? 390 LEU A N   1 
ATOM   217  C CA  . LEU A 1 41  ? 20.356  23.812 6.890   1.00 66.24  ? 390 LEU A CA  1 
ATOM   218  C C   . LEU A 1 41  ? 20.304  24.977 7.857   1.00 69.29  ? 390 LEU A C   1 
ATOM   219  O O   . LEU A 1 41  ? 21.186  25.832 7.860   1.00 75.90  ? 390 LEU A O   1 
ATOM   220  C CB  . LEU A 1 41  ? 21.534  22.912 7.222   1.00 65.76  ? 390 LEU A CB  1 
ATOM   221  C CG  . LEU A 1 41  ? 21.789  22.588 8.682   1.00 65.85  ? 390 LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 41  ? 20.807  21.548 9.173   1.00 67.02  ? 390 LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 41  ? 23.218  22.077 8.812   1.00 72.53  ? 390 LEU A CD2 1 
ATOM   224  N N   . VAL A 1 42  ? 19.259  25.016 8.668   1.00 70.06  ? 391 VAL A N   1 
ATOM   225  C CA  . VAL A 1 42  ? 19.142  25.987 9.723   1.00 71.40  ? 391 VAL A CA  1 
ATOM   226  C C   . VAL A 1 42  ? 19.031  25.108 10.980  1.00 70.30  ? 391 VAL A C   1 
ATOM   227  O O   . VAL A 1 42  ? 18.675  23.940 10.863  1.00 66.44  ? 391 VAL A O   1 
ATOM   228  C CB  . VAL A 1 42  ? 17.972  26.962 9.396   1.00 72.91  ? 391 VAL A CB  1 
ATOM   229  C CG1 . VAL A 1 42  ? 17.315  27.548 10.639  1.00 82.62  ? 391 VAL A CG1 1 
ATOM   230  C CG2 . VAL A 1 42  ? 18.480  28.071 8.486   1.00 70.15  ? 391 VAL A CG2 1 
ATOM   231  N N   . LEU A 1 43  ? 19.444  25.605 12.147  1.00 74.87  ? 392 LEU A N   1 
ATOM   232  C CA  . LEU A 1 43  ? 19.338  24.846 13.383  1.00 80.85  ? 392 LEU A CA  1 
ATOM   233  C C   . LEU A 1 43  ? 18.324  25.511 14.271  1.00 84.56  ? 392 LEU A C   1 
ATOM   234  O O   . LEU A 1 43  ? 18.666  26.451 14.977  1.00 86.10  ? 392 LEU A O   1 
ATOM   235  C CB  . LEU A 1 43  ? 20.690  24.768 14.099  1.00 83.85  ? 392 LEU A CB  1 
ATOM   236  C CG  . LEU A 1 43  ? 21.972  24.720 13.256  1.00 86.24  ? 392 LEU A CG  1 
ATOM   237  C CD1 . LEU A 1 43  ? 23.188  25.158 14.065  1.00 87.67  ? 392 LEU A CD1 1 
ATOM   238  C CD2 . LEU A 1 43  ? 22.159  23.321 12.691  1.00 85.21  ? 392 LEU A CD2 1 
ATOM   239  N N   . PRO A 1 44  ? 17.056  25.053 14.216  1.00 93.84  ? 393 PRO A N   1 
ATOM   240  C CA  . PRO A 1 44  ? 16.054  25.717 15.045  1.00 94.36  ? 393 PRO A CA  1 
ATOM   241  C C   . PRO A 1 44  ? 15.895  25.143 16.466  1.00 89.90  ? 393 PRO A C   1 
ATOM   242  O O   . PRO A 1 44  ? 16.416  24.072 16.782  1.00 82.58  ? 393 PRO A O   1 
ATOM   243  C CB  . PRO A 1 44  ? 14.759  25.594 14.201  1.00 94.89  ? 393 PRO A CB  1 
ATOM   244  C CG  . PRO A 1 44  ? 15.010  24.531 13.170  1.00 92.18  ? 393 PRO A CG  1 
ATOM   245  C CD  . PRO A 1 44  ? 16.438  24.057 13.316  1.00 97.16  ? 393 PRO A CD  1 
ATOM   246  N N   . HIS A 1 45  ? 15.227  25.922 17.311  1.00 87.92  ? 394 HIS A N   1 
ATOM   247  C CA  . HIS A 1 45  ? 14.792  25.491 18.619  1.00 87.27  ? 394 HIS A CA  1 
ATOM   248  C C   . HIS A 1 45  ? 13.332  25.052 18.480  1.00 82.40  ? 394 HIS A C   1 
ATOM   249  O O   . HIS A 1 45  ? 12.436  25.892 18.406  1.00 87.70  ? 394 HIS A O   1 
ATOM   250  C CB  . HIS A 1 45  ? 14.938  26.660 19.586  1.00 88.73  ? 394 HIS A CB  1 
ATOM   251  C CG  . HIS A 1 45  ? 14.749  26.290 21.023  1.00 93.46  ? 394 HIS A CG  1 
ATOM   252  N ND1 . HIS A 1 45  ? 15.534  26.812 22.032  1.00 100.93 ? 394 HIS A ND1 1 
ATOM   253  C CD2 . HIS A 1 45  ? 13.872  25.452 21.623  1.00 83.37  ? 394 HIS A CD2 1 
ATOM   254  C CE1 . HIS A 1 45  ? 15.146  26.314 23.192  1.00 93.29  ? 394 HIS A CE1 1 
ATOM   255  N NE2 . HIS A 1 45  ? 14.142  25.485 22.970  1.00 89.76  ? 394 HIS A NE2 1 
ATOM   256  N N   . PHE A 1 46  ? 13.104  23.741 18.430  1.00 80.42  ? 395 PHE A N   1 
ATOM   257  C CA  . PHE A 1 46  ? 11.793  23.161 18.039  1.00 79.70  ? 395 PHE A CA  1 
ATOM   258  C C   . PHE A 1 46  ? 10.698  23.271 19.141  1.00 76.64  ? 395 PHE A C   1 
ATOM   259  O O   . PHE A 1 46  ? 11.007  23.281 20.330  1.00 79.08  ? 395 PHE A O   1 
ATOM   260  C CB  . PHE A 1 46  ? 11.953  21.666 17.643  1.00 75.82  ? 395 PHE A CB  1 
ATOM   261  C CG  . PHE A 1 46  ? 12.884  21.397 16.461  1.00 72.23  ? 395 PHE A CG  1 
ATOM   262  C CD1 . PHE A 1 46  ? 12.482  21.659 15.149  1.00 71.92  ? 395 PHE A CD1 1 
ATOM   263  C CD2 . PHE A 1 46  ? 14.133  20.799 16.655  1.00 68.10  ? 395 PHE A CD2 1 
ATOM   264  C CE1 . PHE A 1 46  ? 13.320  21.373 14.068  1.00 67.38  ? 395 PHE A CE1 1 
ATOM   265  C CE2 . PHE A 1 46  ? 14.971  20.519 15.576  1.00 66.43  ? 395 PHE A CE2 1 
ATOM   266  C CZ  . PHE A 1 46  ? 14.566  20.807 14.284  1.00 65.62  ? 395 PHE A CZ  1 
ATOM   267  N N   . GLY A 1 47  ? 9.425   23.330 18.743  0.50 72.30  ? 396 GLY A N   1 
ATOM   268  C CA  . GLY A 1 47  ? 8.298   23.369 19.695  0.50 70.10  ? 396 GLY A CA  1 
ATOM   269  C C   . GLY A 1 47  ? 8.067   24.741 20.317  0.50 71.18  ? 396 GLY A C   1 
ATOM   270  O O   . GLY A 1 47  ? 7.330   24.881 21.290  0.50 67.64  ? 396 GLY A O   1 
ATOM   271  N N   . LYS A 1 48  ? 8.664   25.755 19.701  1.00 75.17  ? 397 LYS A N   1 
ATOM   272  C CA  . LYS A 1 48  ? 8.815   27.092 20.269  1.00 78.74  ? 397 LYS A CA  1 
ATOM   273  C C   . LYS A 1 48  ? 9.145   28.043 19.079  1.00 73.87  ? 397 LYS A C   1 
ATOM   274  O O   . LYS A 1 48  ? 9.536   27.544 18.006  1.00 74.39  ? 397 LYS A O   1 
ATOM   275  C CB  . LYS A 1 48  ? 9.884   27.029 21.381  1.00 87.76  ? 397 LYS A CB  1 
ATOM   276  C CG  . LYS A 1 48  ? 10.321  28.353 21.983  1.00 101.30 ? 397 LYS A CG  1 
ATOM   277  C CD  . LYS A 1 48  ? 11.696  28.764 21.450  1.00 108.50 ? 397 LYS A CD  1 
ATOM   278  C CE  . LYS A 1 48  ? 12.416  29.822 22.286  1.00 109.92 ? 397 LYS A CE  1 
ATOM   279  N NZ  . LYS A 1 48  ? 11.786  31.148 22.050  1.00 111.01 ? 397 LYS A NZ  1 
ATOM   280  N N   . GLU A 1 49  ? 8.902   29.363 19.234  1.00 66.62  ? 398 GLU A N   1 
ATOM   281  C CA  . GLU A 1 49  ? 9.049   30.375 18.151  1.00 58.62  ? 398 GLU A CA  1 
ATOM   282  C C   . GLU A 1 49  ? 9.131   31.826 18.608  1.00 55.66  ? 398 GLU A C   1 
ATOM   283  O O   . GLU A 1 49  ? 8.654   32.151 19.665  1.00 59.92  ? 398 GLU A O   1 
ATOM   284  C CB  . GLU A 1 49  ? 7.878   30.273 17.213  1.00 58.52  ? 398 GLU A CB  1 
ATOM   285  C CG  . GLU A 1 49  ? 6.509   30.490 17.852  1.00 60.74  ? 398 GLU A CG  1 
ATOM   286  C CD  . GLU A 1 49  ? 5.932   29.221 18.473  1.00 67.17  ? 398 GLU A CD  1 
ATOM   287  O OE1 . GLU A 1 49  ? 5.885   28.198 17.754  1.00 70.95  ? 398 GLU A OE1 1 
ATOM   288  O OE2 . GLU A 1 49  ? 5.499   29.227 19.649  1.00 65.23  ? 398 GLU A OE2 1 
ATOM   289  N N   . ASP A 1 50  ? 9.722   32.697 17.793  1.00 54.28  ? 399 ASP A N   1 
ATOM   290  C CA  . ASP A 1 50  ? 9.764   34.131 18.078  1.00 53.64  ? 399 ASP A CA  1 
ATOM   291  C C   . ASP A 1 50  ? 8.818   34.907 17.157  1.00 56.18  ? 399 ASP A C   1 
ATOM   292  O O   . ASP A 1 50  ? 8.187   34.333 16.283  1.00 59.22  ? 399 ASP A O   1 
ATOM   293  C CB  . ASP A 1 50  ? 11.170  34.675 17.948  1.00 54.59  ? 399 ASP A CB  1 
ATOM   294  C CG  . ASP A 1 50  ? 11.756  34.439 16.579  1.00 61.30  ? 399 ASP A CG  1 
ATOM   295  O OD1 . ASP A 1 50  ? 11.300  35.049 15.586  1.00 61.27  ? 399 ASP A OD1 1 
ATOM   296  O OD2 . ASP A 1 50  ? 12.716  33.645 16.513  1.00 69.77  ? 399 ASP A OD2 1 
ATOM   297  N N   . ALA A 1 51  ? 8.717   36.219 17.373  1.00 56.99  ? 400 ALA A N   1 
ATOM   298  C CA  . ALA A 1 51  ? 7.735   37.044 16.670  1.00 52.51  ? 400 ALA A CA  1 
ATOM   299  C C   . ALA A 1 51  ? 7.993   37.116 15.174  1.00 47.77  ? 400 ALA A C   1 
ATOM   300  O O   . ALA A 1 51  ? 7.067   37.282 14.382  1.00 50.95  ? 400 ALA A O   1 
ATOM   301  C CB  . ALA A 1 51  ? 7.704   38.435 17.255  1.00 51.75  ? 400 ALA A CB  1 
ATOM   302  N N   . GLY A 1 52  ? 9.249   36.984 14.792  1.00 43.67  ? 401 GLY A N   1 
ATOM   303  C CA  . GLY A 1 52  ? 9.614   37.008 13.393  1.00 42.34  ? 401 GLY A CA  1 
ATOM   304  C C   . GLY A 1 52  ? 9.150   35.755 12.692  1.00 43.91  ? 401 GLY A C   1 
ATOM   305  O O   . GLY A 1 52  ? 8.821   35.792 11.496  1.00 41.62  ? 401 GLY A O   1 
ATOM   306  N N   . ASP A 1 53  ? 9.155   34.640 13.420  1.00 45.66  ? 402 ASP A N   1 
ATOM   307  C CA  . ASP A 1 53  ? 8.698   33.393 12.851  1.00 48.94  ? 402 ASP A CA  1 
ATOM   308  C C   . ASP A 1 53  ? 7.233   33.499 12.587  1.00 50.12  ? 402 ASP A C   1 
ATOM   309  O O   . ASP A 1 53  ? 6.743   33.108 11.506  1.00 55.72  ? 402 ASP A O   1 
ATOM   310  C CB  . ASP A 1 53  ? 8.942   32.225 13.793  1.00 51.12  ? 402 ASP A CB  1 
ATOM   311  C CG  . ASP A 1 53  ? 10.407  31.900 13.965  1.00 52.75  ? 402 ASP A CG  1 
ATOM   312  O OD1 . ASP A 1 53  ? 11.218  32.171 13.040  1.00 52.72  ? 402 ASP A OD1 1 
ATOM   313  O OD2 . ASP A 1 53  ? 10.720  31.333 15.034  1.00 51.38  ? 402 ASP A OD2 1 
ATOM   314  N N   . VAL A 1 54  ? 6.529   34.039 13.571  1.00 47.75  ? 403 VAL A N   1 
ATOM   315  C CA  . VAL A 1 54  ? 5.087   34.097 13.493  1.00 47.77  ? 403 VAL A CA  1 
ATOM   316  C C   . VAL A 1 54  ? 4.658   35.092 12.403  1.00 52.82  ? 403 VAL A C   1 
ATOM   317  O O   . VAL A 1 54  ? 3.683   34.859 11.673  1.00 52.66  ? 403 VAL A O   1 
ATOM   318  C CB  . VAL A 1 54  ? 4.505   34.459 14.856  1.00 45.07  ? 403 VAL A CB  1 
ATOM   319  C CG1 . VAL A 1 54  ? 3.003   34.644 14.779  1.00 44.24  ? 403 VAL A CG1 1 
ATOM   320  C CG2 . VAL A 1 54  ? 4.843   33.366 15.849  1.00 47.22  ? 403 VAL A CG2 1 
ATOM   321  N N   . GLN A 1 55  ? 5.396   36.194 12.289  1.00 54.16  ? 404 GLN A N   1 
ATOM   322  C CA  . GLN A 1 55  ? 5.094   37.201 11.289  1.00 55.10  ? 404 GLN A CA  1 
ATOM   323  C C   . GLN A 1 55  ? 5.267   36.632 9.878   1.00 53.40  ? 404 GLN A C   1 
ATOM   324  O O   . GLN A 1 55  ? 4.443   36.847 8.977   1.00 47.21  ? 404 GLN A O   1 
ATOM   325  C CB  . GLN A 1 55  ? 5.988   38.414 11.485  1.00 54.66  ? 404 GLN A CB  1 
ATOM   326  C CG  . GLN A 1 55  ? 5.570   39.614 10.653  1.00 60.06  ? 404 GLN A CG  1 
ATOM   327  C CD  . GLN A 1 55  ? 4.151   40.066 10.973  1.00 62.85  ? 404 GLN A CD  1 
ATOM   328  O OE1 . GLN A 1 55  ? 3.834   40.393 12.118  1.00 61.24  ? 404 GLN A OE1 1 
ATOM   329  N NE2 . GLN A 1 55  ? 3.297   40.096 9.960   1.00 66.25  ? 404 GLN A NE2 1 
ATOM   330  N N   . GLN A 1 56  ? 6.324   35.870 9.701   1.00 51.45  ? 405 GLN A N   1 
ATOM   331  C CA  . GLN A 1 56  ? 6.567   35.302 8.424   1.00 54.61  ? 405 GLN A CA  1 
ATOM   332  C C   . GLN A 1 56  ? 5.471   34.327 8.047   1.00 54.02  ? 405 GLN A C   1 
ATOM   333  O O   . GLN A 1 56  ? 5.043   34.261 6.889   1.00 54.48  ? 405 GLN A O   1 
ATOM   334  C CB  . GLN A 1 56  ? 7.883   34.586 8.428   1.00 60.65  ? 405 GLN A CB  1 
ATOM   335  C CG  . GLN A 1 56  ? 8.156   34.151 7.017   1.00 63.93  ? 405 GLN A CG  1 
ATOM   336  C CD  . GLN A 1 56  ? 9.589   33.864 6.755   1.00 70.25  ? 405 GLN A CD  1 
ATOM   337  O OE1 . GLN A 1 56  ? 10.200  32.994 7.402   1.00 72.89  ? 405 GLN A OE1 1 
ATOM   338  N NE2 . GLN A 1 56  ? 10.154  34.588 5.784   1.00 72.14  ? 405 GLN A NE2 1 
ATOM   339  N N   . PHE A 1 57  ? 5.038   33.541 9.019   1.00 50.05  ? 406 PHE A N   1 
ATOM   340  C CA  . PHE A 1 57  ? 3.940   32.606 8.805   1.00 48.37  ? 406 PHE A CA  1 
ATOM   341  C C   . PHE A 1 57  ? 2.706   33.330 8.297   1.00 48.26  ? 406 PHE A C   1 
ATOM   342  O O   . PHE A 1 57  ? 2.120   32.962 7.289   1.00 47.97  ? 406 PHE A O   1 
ATOM   343  C CB  . PHE A 1 57  ? 3.651   31.922 10.115  1.00 49.05  ? 406 PHE A CB  1 
ATOM   344  C CG  . PHE A 1 57  ? 2.429   31.081 10.111  1.00 50.12  ? 406 PHE A CG  1 
ATOM   345  C CD1 . PHE A 1 57  ? 2.444   29.831 9.570   1.00 52.69  ? 406 PHE A CD1 1 
ATOM   346  C CD2 . PHE A 1 57  ? 1.292   31.516 10.720  1.00 54.44  ? 406 PHE A CD2 1 
ATOM   347  C CE1 . PHE A 1 57  ? 1.340   29.018 9.615   1.00 54.58  ? 406 PHE A CE1 1 
ATOM   348  C CE2 . PHE A 1 57  ? 0.171   30.715 10.764  1.00 57.52  ? 406 PHE A CE2 1 
ATOM   349  C CZ  . PHE A 1 57  ? 0.195   29.460 10.212  1.00 54.11  ? 406 PHE A CZ  1 
ATOM   350  N N   . TYR A 1 58  ? 2.336   34.391 8.993   1.00 48.23  ? 407 TYR A N   1 
ATOM   351  C CA  . TYR A 1 58  ? 1.168   35.149 8.618   1.00 44.49  ? 407 TYR A CA  1 
ATOM   352  C C   . TYR A 1 58  ? 1.375   35.828 7.290   1.00 45.51  ? 407 TYR A C   1 
ATOM   353  O O   . TYR A 1 58  ? 0.445   35.893 6.474   1.00 50.99  ? 407 TYR A O   1 
ATOM   354  C CB  . TYR A 1 58  ? 0.832   36.178 9.677   1.00 42.13  ? 407 TYR A CB  1 
ATOM   355  C CG  . TYR A 1 58  ? 0.181   35.619 10.915  1.00 41.90  ? 407 TYR A CG  1 
ATOM   356  C CD1 . TYR A 1 58  ? -0.908  34.773 10.821  1.00 44.22  ? 407 TYR A CD1 1 
ATOM   357  C CD2 . TYR A 1 58  ? 0.630   35.961 12.185  1.00 42.10  ? 407 TYR A CD2 1 
ATOM   358  C CE1 . TYR A 1 58  ? -1.521  34.261 11.951  1.00 45.95  ? 407 TYR A CE1 1 
ATOM   359  C CE2 . TYR A 1 58  ? 0.011   35.469 13.325  1.00 42.52  ? 407 TYR A CE2 1 
ATOM   360  C CZ  . TYR A 1 58  ? -1.060  34.619 13.204  1.00 44.34  ? 407 TYR A CZ  1 
ATOM   361  O OH  . TYR A 1 58  ? -1.689  34.093 14.319  1.00 46.08  ? 407 TYR A OH  1 
ATOM   362  N N   . ASP A 1 59  ? 2.568   36.355 7.067   1.00 44.41  ? 408 ASP A N   1 
ATOM   363  C CA  . ASP A 1 59  ? 2.838   37.031 5.799   1.00 50.56  ? 408 ASP A CA  1 
ATOM   364  C C   . ASP A 1 59  ? 2.630   36.065 4.667   1.00 50.16  ? 408 ASP A C   1 
ATOM   365  O O   . ASP A 1 59  ? 2.039   36.413 3.656   1.00 54.25  ? 408 ASP A O   1 
ATOM   366  C CB  . ASP A 1 59  ? 4.271   37.593 5.727   1.00 55.74  ? 408 ASP A CB  1 
ATOM   367  C CG  . ASP A 1 59  ? 4.483   38.796 6.639   1.00 57.13  ? 408 ASP A CG  1 
ATOM   368  O OD1 . ASP A 1 59  ? 3.494   39.331 7.188   1.00 52.52  ? 408 ASP A OD1 1 
ATOM   369  O OD2 . ASP A 1 59  ? 5.651   39.189 6.812   1.00 59.00  ? 408 ASP A OD2 1 
ATOM   370  N N   . LEU A 1 60  ? 3.111   34.840 4.839   1.00 52.36  ? 409 LEU A N   1 
ATOM   371  C CA  . LEU A 1 60  ? 3.027   33.838 3.777   1.00 52.49  ? 409 LEU A CA  1 
ATOM   372  C C   . LEU A 1 60  ? 1.590   33.474 3.465   1.00 52.24  ? 409 LEU A C   1 
ATOM   373  O O   . LEU A 1 60  ? 1.215   33.328 2.287   1.00 49.92  ? 409 LEU A O   1 
ATOM   374  C CB  . LEU A 1 60  ? 3.789   32.585 4.172   1.00 52.90  ? 409 LEU A CB  1 
ATOM   375  C CG  . LEU A 1 60  ? 5.302   32.785 4.203   1.00 52.07  ? 409 LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 60  ? 5.943   31.689 5.028   1.00 54.89  ? 409 LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 60  ? 5.877   32.784 2.800   1.00 52.43  ? 409 LEU A CD2 1 
ATOM   378  N N   . LEU A 1 61  ? 0.799   33.309 4.523   1.00 50.67  ? 410 LEU A N   1 
ATOM   379  C CA  . LEU A 1 61  ? -0.630  33.082 4.368   1.00 48.12  ? 410 LEU A CA  1 
ATOM   380  C C   . LEU A 1 61  ? -1.269  34.255 3.628   1.00 47.46  ? 410 LEU A C   1 
ATOM   381  O O   . LEU A 1 61  ? -1.970  34.056 2.633   1.00 49.01  ? 410 LEU A O   1 
ATOM   382  C CB  . LEU A 1 61  ? -1.315  32.898 5.719   1.00 42.68  ? 410 LEU A CB  1 
ATOM   383  C CG  . LEU A 1 61  ? -1.140  31.593 6.470   1.00 41.85  ? 410 LEU A CG  1 
ATOM   384  C CD1 . LEU A 1 61  ? -2.052  31.590 7.658   1.00 43.78  ? 410 LEU A CD1 1 
ATOM   385  C CD2 . LEU A 1 61  ? -1.466  30.375 5.635   1.00 44.29  ? 410 LEU A CD2 1 
ATOM   386  N N   . SER A 1 62  ? -0.998  35.464 4.114   1.00 48.48  ? 411 SER A N   1 
ATOM   387  C CA  . SER A 1 62  ? -1.538  36.688 3.519   1.00 51.53  ? 411 SER A CA  1 
ATOM   388  C C   . SER A 1 62  ? -1.222  36.788 2.039   1.00 47.18  ? 411 SER A C   1 
ATOM   389  O O   . SER A 1 62  ? -2.072  37.113 1.226   1.00 47.95  ? 411 SER A O   1 
ATOM   390  C CB  . SER A 1 62  ? -0.967  37.920 4.218   1.00 53.59  ? 411 SER A CB  1 
ATOM   391  O OG  . SER A 1 62  ? -1.393  37.990 5.565   1.00 61.71  ? 411 SER A OG  1 
ATOM   392  N N   . GLY A 1 63  ? 0.015   36.490 1.700   1.00 43.49  ? 412 GLY A N   1 
ATOM   393  C CA  . GLY A 1 63  ? 0.450   36.532 0.332   1.00 44.09  ? 412 GLY A CA  1 
ATOM   394  C C   . GLY A 1 63  ? -0.305  35.566 -0.527  1.00 49.21  ? 412 GLY A C   1 
ATOM   395  O O   . GLY A 1 63  ? -0.528  35.833 -1.702  1.00 55.57  ? 412 GLY A O   1 
ATOM   396  N N   . SER A 1 64  ? -0.693  34.432 0.041   1.00 50.73  ? 413 SER A N   1 
ATOM   397  C CA  . SER A 1 64  ? -1.393  33.446 -0.745  1.00 52.91  ? 413 SER A CA  1 
ATOM   398  C C   . SER A 1 64  ? -2.832  33.894 -0.988  1.00 50.70  ? 413 SER A C   1 
ATOM   399  O O   . SER A 1 64  ? -3.351  33.760 -2.098  1.00 48.13  ? 413 SER A O   1 
ATOM   400  C CB  . SER A 1 64  ? -1.394  32.082 -0.078  1.00 54.17  ? 413 SER A CB  1 
ATOM   401  O OG  . SER A 1 64  ? -1.390  31.049 -1.063  1.00 54.21  ? 413 SER A OG  1 
ATOM   402  N N   . LEU A 1 65  ? -3.485  34.413 0.041   1.00 47.91  ? 414 LEU A N   1 
ATOM   403  C CA  . LEU A 1 65  ? -4.816  34.950 -0.151  1.00 51.89  ? 414 LEU A CA  1 
ATOM   404  C C   . LEU A 1 65  ? -4.888  36.005 -1.284  1.00 58.61  ? 414 LEU A C   1 
ATOM   405  O O   . LEU A 1 65  ? -5.765  35.923 -2.156  1.00 60.93  ? 414 LEU A O   1 
ATOM   406  C CB  . LEU A 1 65  ? -5.340  35.477 1.153   1.00 52.29  ? 414 LEU A CB  1 
ATOM   407  C CG  . LEU A 1 65  ? -6.785  35.949 1.119   1.00 53.20  ? 414 LEU A CG  1 
ATOM   408  C CD1 . LEU A 1 65  ? -7.735  34.801 0.805   1.00 51.65  ? 414 LEU A CD1 1 
ATOM   409  C CD2 . LEU A 1 65  ? -7.035  36.588 2.485   1.00 53.75  ? 414 LEU A CD2 1 
ATOM   410  N N   . GLU A 1 66  ? -3.953  36.953 -1.306  1.00 59.25  ? 415 GLU A N   1 
ATOM   411  C CA  . GLU A 1 66  ? -3.963  37.984 -2.322  1.00 61.60  ? 415 GLU A CA  1 
ATOM   412  C C   . GLU A 1 66  ? -3.799  37.359 -3.701  1.00 54.03  ? 415 GLU A C   1 
ATOM   413  O O   . GLU A 1 66  ? -4.516  37.687 -4.654  1.00 53.48  ? 415 GLU A O   1 
ATOM   414  C CB  . GLU A 1 66  ? -2.867  39.027 -2.025  1.00 71.12  ? 415 GLU A CB  1 
ATOM   415  C CG  . GLU A 1 66  ? -3.040  40.373 -2.777  1.00 87.78  ? 415 GLU A CG  1 
ATOM   416  C CD  . GLU A 1 66  ? -4.494  40.858 -2.836  1.00 100.28 ? 415 GLU A CD  1 
ATOM   417  O OE1 . GLU A 1 66  ? -5.149  40.876 -1.771  1.00 99.70  ? 415 GLU A OE1 1 
ATOM   418  O OE2 . GLU A 1 66  ? -4.984  41.219 -3.938  1.00 107.81 ? 415 GLU A OE2 1 
ATOM   419  N N   . VAL A 1 67  ? -2.880  36.419 -3.793  1.00 50.54  ? 416 VAL A N   1 
ATOM   420  C CA  . VAL A 1 67  ? -2.677  35.674 -5.038  1.00 47.29  ? 416 VAL A CA  1 
ATOM   421  C C   . VAL A 1 67  ? -3.893  34.829 -5.396  1.00 45.62  ? 416 VAL A C   1 
ATOM   422  O O   . VAL A 1 67  ? -4.296  34.753 -6.549  1.00 43.60  ? 416 VAL A O   1 
ATOM   423  C CB  . VAL A 1 67  ? -1.468  34.741 -4.918  1.00 46.12  ? 416 VAL A CB  1 
ATOM   424  C CG1 . VAL A 1 67  ? -1.352  33.835 -6.133  1.00 44.10  ? 416 VAL A CG1 1 
ATOM   425  C CG2 . VAL A 1 67  ? -0.206  35.555 -4.739  1.00 47.16  ? 416 VAL A CG2 1 
ATOM   426  N N   . ILE A 1 68  ? -4.487  34.190 -4.399  1.00 46.08  ? 417 ILE A N   1 
ATOM   427  C CA  . ILE A 1 68  ? -5.628  33.346 -4.671  1.00 48.02  ? 417 ILE A CA  1 
ATOM   428  C C   . ILE A 1 68  ? -6.833  34.180 -5.115  1.00 51.09  ? 417 ILE A C   1 
ATOM   429  O O   . ILE A 1 68  ? -7.484  33.807 -6.081  1.00 43.09  ? 417 ILE A O   1 
ATOM   430  C CB  . ILE A 1 68  ? -5.960  32.438 -3.484  1.00 47.16  ? 417 ILE A CB  1 
ATOM   431  C CG1 . ILE A 1 68  ? -4.860  31.394 -3.373  1.00 49.28  ? 417 ILE A CG1 1 
ATOM   432  C CG2 . ILE A 1 68  ? -7.283  31.719 -3.709  1.00 45.80  ? 417 ILE A CG2 1 
ATOM   433  C CD1 . ILE A 1 68  ? -4.892  30.609 -2.087  1.00 53.31  ? 417 ILE A CD1 1 
ATOM   434  N N   . ARG A 1 69  ? -7.125  35.296 -4.430  1.00 51.51  ? 418 ARG A N   1 
ATOM   435  C CA  . ARG A 1 69  ? -8.163  36.205 -4.916  1.00 50.47  ? 418 ARG A CA  1 
ATOM   436  C C   . ARG A 1 69  ? -7.995  36.527 -6.379  1.00 47.79  ? 418 ARG A C   1 
ATOM   437  O O   . ARG A 1 69  ? -8.936  36.462 -7.145  1.00 48.25  ? 418 ARG A O   1 
ATOM   438  C CB  . ARG A 1 69  ? -8.130  37.548 -4.209  1.00 54.37  ? 418 ARG A CB  1 
ATOM   439  C CG  . ARG A 1 69  ? -8.957  37.643 -2.955  1.00 58.49  ? 418 ARG A CG  1 
ATOM   440  C CD  . ARG A 1 69  ? -9.242  39.091 -2.586  1.00 59.33  ? 418 ARG A CD  1 
ATOM   441  N NE  . ARG A 1 69  ? -9.264  39.274 -1.141  1.00 70.14  ? 418 ARG A NE  1 
ATOM   442  C CZ  . ARG A 1 69  ? -10.155 38.710 -0.304  1.00 85.94  ? 418 ARG A CZ  1 
ATOM   443  N NH1 . ARG A 1 69  ? -10.063 38.940 1.010   1.00 87.08  ? 418 ARG A NH1 1 
ATOM   444  N NH2 . ARG A 1 69  ? -11.146 37.922 -0.746  1.00 86.08  ? 418 ARG A NH2 1 
ATOM   445  N N   . LYS A 1 70  ? -6.798  36.936 -6.749  1.00 48.54  ? 419 LYS A N   1 
ATOM   446  C CA  . LYS A 1 70  ? -6.541  37.338 -8.121  1.00 52.94  ? 419 LYS A CA  1 
ATOM   447  C C   . LYS A 1 70  ? -6.718  36.177 -9.064  1.00 47.14  ? 419 LYS A C   1 
ATOM   448  O O   . LYS A 1 70  ? -7.299  36.332 -10.110 1.00 43.39  ? 419 LYS A O   1 
ATOM   449  C CB  . LYS A 1 70  ? -5.168  38.007 -8.255  1.00 60.96  ? 419 LYS A CB  1 
ATOM   450  C CG  . LYS A 1 70  ? -5.151  39.356 -7.524  1.00 71.52  ? 419 LYS A CG  1 
ATOM   451  C CD  . LYS A 1 70  ? -3.965  40.258 -7.860  1.00 78.64  ? 419 LYS A CD  1 
ATOM   452  C CE  . LYS A 1 70  ? -2.649  39.683 -7.359  1.00 91.49  ? 419 LYS A CE  1 
ATOM   453  N NZ  . LYS A 1 70  ? -1.793  40.726 -6.726  1.00 98.56  ? 419 LYS A NZ  1 
ATOM   454  N N   . TRP A 1 71  ? -6.231  35.009 -8.677  1.00 50.51  ? 420 TRP A N   1 
ATOM   455  C CA  . TRP A 1 71  ? -6.483  33.761 -9.437  1.00 49.33  ? 420 TRP A CA  1 
ATOM   456  C C   . TRP A 1 71  ? -7.984  33.468 -9.591  1.00 48.67  ? 420 TRP A C   1 
ATOM   457  O O   . TRP A 1 71  ? -8.450  33.155 -10.676 1.00 42.04  ? 420 TRP A O   1 
ATOM   458  C CB  . TRP A 1 71  ? -5.786  32.574 -8.758  1.00 45.54  ? 420 TRP A CB  1 
ATOM   459  C CG  . TRP A 1 71  ? -6.308  31.207 -9.141  1.00 42.53  ? 420 TRP A CG  1 
ATOM   460  C CD1 . TRP A 1 71  ? -5.972  30.512 -10.230 1.00 45.39  ? 420 TRP A CD1 1 
ATOM   461  C CD2 . TRP A 1 71  ? -7.198  30.366 -8.387  1.00 40.28  ? 420 TRP A CD2 1 
ATOM   462  N NE1 . TRP A 1 71  ? -6.589  29.289 -10.234 1.00 44.25  ? 420 TRP A NE1 1 
ATOM   463  C CE2 . TRP A 1 71  ? -7.349  29.174 -9.106  1.00 43.36  ? 420 TRP A CE2 1 
ATOM   464  C CE3 . TRP A 1 71  ? -7.886  30.513 -7.187  1.00 39.74  ? 420 TRP A CE3 1 
ATOM   465  C CZ2 . TRP A 1 71  ? -8.178  28.123 -8.672  1.00 44.57  ? 420 TRP A CZ2 1 
ATOM   466  C CZ3 . TRP A 1 71  ? -8.704  29.477 -6.747  1.00 42.27  ? 420 TRP A CZ3 1 
ATOM   467  C CH2 . TRP A 1 71  ? -8.849  28.297 -7.501  1.00 45.10  ? 420 TRP A CH2 1 
ATOM   468  N N   . ALA A 1 72  ? -8.729  33.567 -8.491  1.00 50.55  ? 421 ALA A N   1 
ATOM   469  C CA  . ALA A 1 72  ? -10.148 33.242 -8.508  1.00 53.25  ? 421 ALA A CA  1 
ATOM   470  C C   . ALA A 1 72  ? -10.859 34.123 -9.515  1.00 53.52  ? 421 ALA A C   1 
ATOM   471  O O   . ALA A 1 72  ? -11.681 33.638 -10.273 1.00 55.74  ? 421 ALA A O   1 
ATOM   472  C CB  . ALA A 1 72  ? -10.771 33.402 -7.120  1.00 53.47  ? 421 ALA A CB  1 
ATOM   473  N N   . GLU A 1 73  ? -10.520 35.406 -9.526  1.00 54.60  ? 422 GLU A N   1 
ATOM   474  C CA  . GLU A 1 73  ? -11.187 36.371 -10.386 1.00 56.28  ? 422 GLU A CA  1 
ATOM   475  C C   . GLU A 1 73  ? -10.986 36.091 -11.868 1.00 54.70  ? 422 GLU A C   1 
ATOM   476  O O   . GLU A 1 73  ? -11.780 36.510 -12.683 1.00 54.98  ? 422 GLU A O   1 
ATOM   477  C CB  . GLU A 1 73  ? -10.730 37.782 -10.061 1.00 62.09  ? 422 GLU A CB  1 
ATOM   478  C CG  . GLU A 1 73  ? -11.100 38.218 -8.647  1.00 72.45  ? 422 GLU A CG  1 
ATOM   479  C CD  . GLU A 1 73  ? -12.599 38.295 -8.399  1.00 79.84  ? 422 GLU A CD  1 
ATOM   480  O OE1 . GLU A 1 73  ? -13.348 38.680 -9.322  1.00 94.13  ? 422 GLU A OE1 1 
ATOM   481  O OE2 . GLU A 1 73  ? -13.030 37.989 -7.268  1.00 81.26  ? 422 GLU A OE2 1 
ATOM   482  N N   . LYS A 1 74  ? -9.933  35.368 -12.213 1.00 55.17  ? 423 LYS A N   1 
ATOM   483  C CA  . LYS A 1 74  ? -9.688  34.991 -13.596 1.00 56.20  ? 423 LYS A CA  1 
ATOM   484  C C   . LYS A 1 74  ? -10.424 33.724 -13.968 1.00 54.93  ? 423 LYS A C   1 
ATOM   485  O O   . LYS A 1 74  ? -10.299 33.266 -15.091 1.00 49.51  ? 423 LYS A O   1 
ATOM   486  C CB  . LYS A 1 74  ? -8.188  34.785 -13.850 1.00 61.27  ? 423 LYS A CB  1 
ATOM   487  C CG  . LYS A 1 74  ? -7.315  35.972 -13.471 1.00 66.35  ? 423 LYS A CG  1 
ATOM   488  C CD  . LYS A 1 74  ? -6.188  36.211 -14.472 1.00 72.52  ? 423 LYS A CD  1 
ATOM   489  C CE  . LYS A 1 74  ? -4.916  36.710 -13.794 1.00 76.13  ? 423 LYS A CE  1 
ATOM   490  N NZ  . LYS A 1 74  ? -4.128  35.597 -13.198 1.00 81.64  ? 423 LYS A NZ  1 
ATOM   491  N N   . ILE A 1 75  ? -11.130 33.115 -13.021 1.00 58.06  ? 424 ILE A N   1 
ATOM   492  C CA  . ILE A 1 75  ? -11.947 31.952 -13.338 1.00 61.09  ? 424 ILE A CA  1 
ATOM   493  C C   . ILE A 1 75  ? -13.223 32.477 -13.946 1.00 57.96  ? 424 ILE A C   1 
ATOM   494  O O   . ILE A 1 75  ? -13.905 33.285 -13.332 1.00 52.50  ? 424 ILE A O   1 
ATOM   495  C CB  . ILE A 1 75  ? -12.279 31.081 -12.108 1.00 64.54  ? 424 ILE A CB  1 
ATOM   496  C CG1 . ILE A 1 75  ? -11.034 30.318 -11.658 1.00 61.12  ? 424 ILE A CG1 1 
ATOM   497  C CG2 . ILE A 1 75  ? -13.382 30.079 -12.438 1.00 68.64  ? 424 ILE A CG2 1 
ATOM   498  C CD1 . ILE A 1 75  ? -11.136 29.761 -10.256 1.00 63.29  ? 424 ILE A CD1 1 
ATOM   499  N N   . PRO A 1 76  ? -13.546 32.014 -15.156 1.00 57.03  ? 425 PRO A N   1 
ATOM   500  C CA  . PRO A 1 76  ? -14.729 32.476 -15.868 1.00 56.23  ? 425 PRO A CA  1 
ATOM   501  C C   . PRO A 1 76  ? -16.003 32.261 -15.084 1.00 53.49  ? 425 PRO A C   1 
ATOM   502  O O   . PRO A 1 76  ? -16.330 31.132 -14.733 1.00 49.49  ? 425 PRO A O   1 
ATOM   503  C CB  . PRO A 1 76  ? -14.727 31.618 -17.137 1.00 56.83  ? 425 PRO A CB  1 
ATOM   504  C CG  . PRO A 1 76  ? -13.296 31.340 -17.382 1.00 58.15  ? 425 PRO A CG  1 
ATOM   505  C CD  . PRO A 1 76  ? -12.705 31.152 -16.004 1.00 58.68  ? 425 PRO A CD  1 
ATOM   506  N N   . GLY A 1 77  ? -16.699 33.353 -14.789 1.00 50.33  ? 426 GLY A N   1 
ATOM   507  C CA  . GLY A 1 77  ? -17.964 33.267 -14.071 1.00 51.90  ? 426 GLY A CA  1 
ATOM   508  C C   . GLY A 1 77  ? -17.799 33.578 -12.614 1.00 50.90  ? 426 GLY A C   1 
ATOM   509  O O   . GLY A 1 77  ? -18.749 33.966 -11.932 1.00 47.16  ? 426 GLY A O   1 
ATOM   510  N N   . PHE A 1 78  ? -16.587 33.392 -12.111 1.00 56.04  ? 427 PHE A N   1 
ATOM   511  C CA  . PHE A 1 78  ? -16.376 33.616 -10.698 1.00 54.34  ? 427 PHE A CA  1 
ATOM   512  C C   . PHE A 1 78  ? -16.675 35.060 -10.379 1.00 54.00  ? 427 PHE A C   1 
ATOM   513  O O   . PHE A 1 78  ? -17.344 35.370 -9.398  1.00 52.47  ? 427 PHE A O   1 
ATOM   514  C CB  . PHE A 1 78  ? -14.959 33.279 -10.226 1.00 51.03  ? 427 PHE A CB  1 
ATOM   515  C CG  . PHE A 1 78  ? -14.786 33.527 -8.770  1.00 46.20  ? 427 PHE A CG  1 
ATOM   516  C CD1 . PHE A 1 78  ? -15.236 32.600 -7.857  1.00 43.14  ? 427 PHE A CD1 1 
ATOM   517  C CD2 . PHE A 1 78  ? -14.306 34.736 -8.307  1.00 47.21  ? 427 PHE A CD2 1 
ATOM   518  C CE1 . PHE A 1 78  ? -15.159 32.844 -6.500  1.00 44.30  ? 427 PHE A CE1 1 
ATOM   519  C CE2 . PHE A 1 78  ? -14.218 34.987 -6.941  1.00 46.32  ? 427 PHE A CE2 1 
ATOM   520  C CZ  . PHE A 1 78  ? -14.655 34.044 -6.037  1.00 44.64  ? 427 PHE A CZ  1 
ATOM   521  N N   . ALA A 1 79  ? -16.186 35.944 -11.238 1.00 57.57  ? 428 ALA A N   1 
ATOM   522  C CA  . ALA A 1 79  ? -16.294 37.378 -10.991 1.00 55.30  ? 428 ALA A CA  1 
ATOM   523  C C   . ALA A 1 79  ? -17.717 37.908 -11.072 1.00 52.21  ? 428 ALA A C   1 
ATOM   524  O O   . ALA A 1 79  ? -17.977 39.014 -10.612 1.00 48.47  ? 428 ALA A O   1 
ATOM   525  C CB  . ALA A 1 79  ? -15.406 38.136 -11.959 1.00 55.39  ? 428 ALA A CB  1 
ATOM   526  N N   . GLU A 1 80  ? -18.626 37.126 -11.656 1.00 54.84  ? 429 GLU A N   1 
ATOM   527  C CA  . GLU A 1 80  ? -20.021 37.545 -11.792 1.00 55.69  ? 429 GLU A CA  1 
ATOM   528  C C   . GLU A 1 80  ? -20.872 37.204 -10.602 1.00 53.55  ? 429 GLU A C   1 
ATOM   529  O O   . GLU A 1 80  ? -22.039 37.520 -10.594 1.00 61.00  ? 429 GLU A O   1 
ATOM   530  C CB  . GLU A 1 80  ? -20.662 36.956 -13.051 1.00 60.08  ? 429 GLU A CB  1 
ATOM   531  C CG  . GLU A 1 80  ? -20.188 37.621 -14.315 1.00 64.12  ? 429 GLU A CG  1 
ATOM   532  C CD  . GLU A 1 80  ? -18.715 37.378 -14.577 1.00 65.46  ? 429 GLU A CD  1 
ATOM   533  O OE1 . GLU A 1 80  ? -18.310 36.207 -14.635 1.00 69.66  ? 429 GLU A OE1 1 
ATOM   534  O OE2 . GLU A 1 80  ? -17.956 38.355 -14.719 1.00 66.47  ? 429 GLU A OE2 1 
ATOM   535  N N   . LEU A 1 81  ? -20.323 36.546 -9.597  1.00 55.93  ? 430 LEU A N   1 
ATOM   536  C CA  . LEU A 1 81  ? -21.142 36.088 -8.482  1.00 56.35  ? 430 LEU A CA  1 
ATOM   537  C C   . LEU A 1 81  ? -21.360 37.251 -7.503  1.00 58.57  ? 430 LEU A C   1 
ATOM   538  O O   . LEU A 1 81  ? -20.621 38.237 -7.491  1.00 53.76  ? 430 LEU A O   1 
ATOM   539  C CB  . LEU A 1 81  ? -20.488 34.893 -7.792  1.00 56.87  ? 430 LEU A CB  1 
ATOM   540  C CG  . LEU A 1 81  ? -20.146 33.683 -8.683  1.00 63.73  ? 430 LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 81  ? -19.158 32.736 -8.014  1.00 61.03  ? 430 LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 81  ? -21.399 32.899 -9.074  1.00 68.57  ? 430 LEU A CD2 1 
ATOM   543  N N   . SER A 1 82  ? -22.403 37.140 -6.697  1.00 59.41  ? 431 SER A N   1 
ATOM   544  C CA  . SER A 1 82  ? -22.573 38.025 -5.572  1.00 59.15  ? 431 SER A CA  1 
ATOM   545  C C   . SER A 1 82  ? -21.202 38.296 -4.913  1.00 64.80  ? 431 SER A C   1 
ATOM   546  O O   . SER A 1 82  ? -20.423 37.371 -4.663  1.00 75.94  ? 431 SER A O   1 
ATOM   547  C CB  . SER A 1 82  ? -23.508 37.347 -4.568  1.00 60.01  ? 431 SER A CB  1 
ATOM   548  O OG  . SER A 1 82  ? -23.619 38.117 -3.382  1.00 62.87  ? 431 SER A OG  1 
ATOM   549  N N   . PRO A 1 83  ? -20.878 39.556 -4.651  1.00 66.16  ? 432 PRO A N   1 
ATOM   550  C CA  . PRO A 1 83  ? -19.682 39.823 -3.866  1.00 69.72  ? 432 PRO A CA  1 
ATOM   551  C C   . PRO A 1 83  ? -19.577 39.032 -2.573  1.00 67.19  ? 432 PRO A C   1 
ATOM   552  O O   . PRO A 1 83  ? -18.484 38.602 -2.221  1.00 73.25  ? 432 PRO A O   1 
ATOM   553  C CB  . PRO A 1 83  ? -19.806 41.312 -3.578  1.00 63.39  ? 432 PRO A CB  1 
ATOM   554  C CG  . PRO A 1 83  ? -20.360 41.825 -4.857  1.00 63.07  ? 432 PRO A CG  1 
ATOM   555  C CD  . PRO A 1 83  ? -21.311 40.764 -5.361  1.00 67.68  ? 432 PRO A CD  1 
ATOM   556  N N   . ALA A 1 84  ? -20.689 38.856 -1.869  1.00 65.86  ? 433 ALA A N   1 
ATOM   557  C CA  . ALA A 1 84  ? -20.690 38.050 -0.632  1.00 65.72  ? 433 ALA A CA  1 
ATOM   558  C C   . ALA A 1 84  ? -20.365 36.596 -0.928  1.00 59.29  ? 433 ALA A C   1 
ATOM   559  O O   . ALA A 1 84  ? -19.638 35.950 -0.172  1.00 52.12  ? 433 ALA A O   1 
ATOM   560  C CB  . ALA A 1 84  ? -22.030 38.142 0.087   1.00 64.36  ? 433 ALA A CB  1 
ATOM   561  N N   . ASP A 1 85  ? -20.922 36.092 -2.026  1.00 55.96  ? 434 ASP A N   1 
ATOM   562  C CA  . ASP A 1 85  ? -20.645 34.728 -2.463  1.00 57.80  ? 434 ASP A CA  1 
ATOM   563  C C   . ASP A 1 85  ? -19.179 34.558 -2.833  1.00 55.82  ? 434 ASP A C   1 
ATOM   564  O O   . ASP A 1 85  ? -18.554 33.536 -2.517  1.00 54.46  ? 434 ASP A O   1 
ATOM   565  C CB  . ASP A 1 85  ? -21.557 34.328 -3.629  1.00 59.01  ? 434 ASP A CB  1 
ATOM   566  C CG  . ASP A 1 85  ? -22.992 33.974 -3.168  1.00 61.45  ? 434 ASP A CG  1 
ATOM   567  O OD1 . ASP A 1 85  ? -23.352 34.321 -2.019  1.00 58.35  ? 434 ASP A OD1 1 
ATOM   568  O OD2 . ASP A 1 85  ? -23.752 33.329 -3.944  1.00 59.85  ? 434 ASP A OD2 1 
ATOM   569  N N   . GLN A 1 86  ? -18.616 35.576 -3.462  1.00 54.97  ? 435 GLN A N   1 
ATOM   570  C CA  . GLN A 1 86  ? -17.207 35.550 -3.800  1.00 54.48  ? 435 GLN A CA  1 
ATOM   571  C C   . GLN A 1 86  ? -16.354 35.412 -2.553  1.00 54.63  ? 435 GLN A C   1 
ATOM   572  O O   . GLN A 1 86  ? -15.501 34.519 -2.470  1.00 56.16  ? 435 GLN A O   1 
ATOM   573  C CB  . GLN A 1 86  ? -16.833 36.797 -4.588  1.00 56.39  ? 435 GLN A CB  1 
ATOM   574  C CG  . GLN A 1 86  ? -17.251 36.708 -6.051  1.00 58.83  ? 435 GLN A CG  1 
ATOM   575  C CD  . GLN A 1 86  ? -16.805 37.898 -6.884  1.00 59.80  ? 435 GLN A CD  1 
ATOM   576  O OE1 . GLN A 1 86  ? -15.751 38.484 -6.658  1.00 65.17  ? 435 GLN A OE1 1 
ATOM   577  N NE2 . GLN A 1 86  ? -17.606 38.251 -7.860  1.00 61.50  ? 435 GLN A NE2 1 
ATOM   578  N N   . ASP A 1 87  ? -16.617 36.269 -1.572  1.00 55.29  ? 436 ASP A N   1 
ATOM   579  C CA  . ASP A 1 87  ? -15.870 36.270 -0.313  1.00 56.79  ? 436 ASP A CA  1 
ATOM   580  C C   . ASP A 1 87  ? -16.064 34.995 0.452   1.00 54.49  ? 436 ASP A C   1 
ATOM   581  O O   . ASP A 1 87  ? -15.124 34.482 1.049   1.00 62.39  ? 436 ASP A O   1 
ATOM   582  C CB  . ASP A 1 87  ? -16.298 37.423 0.588   1.00 58.97  ? 436 ASP A CB  1 
ATOM   583  C CG  . ASP A 1 87  ? -16.036 38.773 -0.035  1.00 67.29  ? 436 ASP A CG  1 
ATOM   584  O OD1 . ASP A 1 87  ? -15.179 38.863 -0.956  1.00 69.02  ? 436 ASP A OD1 1 
ATOM   585  O OD2 . ASP A 1 87  ? -16.704 39.741 0.390   1.00 73.80  ? 436 ASP A OD2 1 
ATOM   586  N N   . LEU A 1 88  ? -17.290 34.497 0.448   1.00 50.57  ? 437 LEU A N   1 
ATOM   587  C CA  . LEU A 1 88  ? -17.610 33.280 1.169   1.00 47.91  ? 437 LEU A CA  1 
ATOM   588  C C   . LEU A 1 88  ? -16.860 32.123 0.565   1.00 46.03  ? 437 LEU A C   1 
ATOM   589  O O   . LEU A 1 88  ? -16.262 31.332 1.280   1.00 49.88  ? 437 LEU A O   1 
ATOM   590  C CB  . LEU A 1 88  ? -19.102 32.973 1.125   1.00 46.09  ? 437 LEU A CB  1 
ATOM   591  C CG  . LEU A 1 88  ? -19.521 31.765 1.962   1.00 41.86  ? 437 LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 88  ? -19.588 32.157 3.414   1.00 43.54  ? 437 LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 88  ? -20.864 31.200 1.551   1.00 42.50  ? 437 LEU A CD2 1 
ATOM   594  N N   . LEU A 1 89  ? -16.868 32.026 -0.754  1.00 44.38  ? 438 LEU A N   1 
ATOM   595  C CA  . LEU A 1 89  ? -16.222 30.878 -1.393  1.00 43.28  ? 438 LEU A CA  1 
ATOM   596  C C   . LEU A 1 89  ? -14.746 30.940 -1.139  1.00 41.41  ? 438 LEU A C   1 
ATOM   597  O O   . LEU A 1 89  ? -14.155 29.943 -0.823  1.00 42.70  ? 438 LEU A O   1 
ATOM   598  C CB  . LEU A 1 89  ? -16.508 30.818 -2.885  1.00 40.27  ? 438 LEU A CB  1 
ATOM   599  C CG  . LEU A 1 89  ? -17.950 30.475 -3.250  1.00 38.17  ? 438 LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 89  ? -18.172 30.866 -4.690  1.00 39.48  ? 438 LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 89  ? -18.304 29.007 -3.063  1.00 37.39  ? 438 LEU A CD2 1 
ATOM   602  N N   . LEU A 1 90  ? -14.177 32.132 -1.208  1.00 44.18  ? 439 LEU A N   1 
ATOM   603  C CA  . LEU A 1 90  ? -12.761 32.301 -0.947  1.00 47.15  ? 439 LEU A CA  1 
ATOM   604  C C   . LEU A 1 90  ? -12.334 32.031 0.489   1.00 46.13  ? 439 LEU A C   1 
ATOM   605  O O   . LEU A 1 90  ? -11.270 31.487 0.709   1.00 45.16  ? 439 LEU A O   1 
ATOM   606  C CB  . LEU A 1 90  ? -12.315 33.702 -1.317  1.00 49.11  ? 439 LEU A CB  1 
ATOM   607  C CG  . LEU A 1 90  ? -12.158 33.909 -2.810  1.00 50.01  ? 439 LEU A CG  1 
ATOM   608  C CD1 . LEU A 1 90  ? -12.075 35.391 -3.085  1.00 52.10  ? 439 LEU A CD1 1 
ATOM   609  C CD2 . LEU A 1 90  ? -10.917 33.204 -3.337  1.00 51.47  ? 439 LEU A CD2 1 
ATOM   610  N N   . GLU A 1 91  ? -13.132 32.433 1.457   1.00 43.95  ? 440 GLU A N   1 
ATOM   611  C CA  . GLU A 1 91  ? -12.789 32.173 2.836   1.00 47.97  ? 440 GLU A CA  1 
ATOM   612  C C   . GLU A 1 91  ? -12.874 30.713 3.197   1.00 49.94  ? 440 GLU A C   1 
ATOM   613  O O   . GLU A 1 91  ? -12.078 30.209 3.984   1.00 53.07  ? 440 GLU A O   1 
ATOM   614  C CB  . GLU A 1 91  ? -13.741 32.902 3.767   1.00 59.51  ? 440 GLU A CB  1 
ATOM   615  C CG  . GLU A 1 91  ? -13.513 34.394 3.881   1.00 65.58  ? 440 GLU A CG  1 
ATOM   616  C CD  . GLU A 1 91  ? -14.335 34.988 4.999   1.00 73.35  ? 440 GLU A CD  1 
ATOM   617  O OE1 . GLU A 1 91  ? -15.020 34.221 5.749   1.00 64.56  ? 440 GLU A OE1 1 
ATOM   618  O OE2 . GLU A 1 91  ? -14.299 36.232 5.099   1.00 90.15  ? 440 GLU A OE2 1 
ATOM   619  N N   . SER A 1 92  ? -13.901 30.049 2.679   1.00 53.37  ? 441 SER A N   1 
ATOM   620  C CA  . SER A 1 92  ? -14.173 28.658 2.995   1.00 47.72  ? 441 SER A CA  1 
ATOM   621  C C   . SER A 1 92  ? -13.115 27.805 2.364   1.00 46.98  ? 441 SER A C   1 
ATOM   622  O O   . SER A 1 92  ? -12.759 26.752 2.909   1.00 54.62  ? 441 SER A O   1 
ATOM   623  C CB  . SER A 1 92  ? -15.516 28.258 2.407   1.00 49.19  ? 441 SER A CB  1 
ATOM   624  O OG  . SER A 1 92  ? -16.507 29.182 2.773   1.00 50.14  ? 441 SER A OG  1 
ATOM   625  N N   . ALA A 1 93  ? -12.618 28.240 1.209   1.00 38.30  ? 442 ALA A N   1 
ATOM   626  C CA  . ALA A 1 93  ? -11.679 27.431 0.485   1.00 39.54  ? 442 ALA A CA  1 
ATOM   627  C C   . ALA A 1 93  ? -10.219 27.810 0.685   1.00 41.75  ? 442 ALA A C   1 
ATOM   628  O O   . ALA A 1 93  ? -9.335  27.191 0.118   1.00 43.92  ? 442 ALA A O   1 
ATOM   629  C CB  . ALA A 1 93  ? -12.026 27.477 -0.986  1.00 42.21  ? 442 ALA A CB  1 
ATOM   630  N N   . PHE A 1 94  ? -9.933  28.826 1.474   1.00 43.71  ? 443 PHE A N   1 
ATOM   631  C CA  . PHE A 1 94  ? -8.580  29.374 1.451   1.00 41.74  ? 443 PHE A CA  1 
ATOM   632  C C   . PHE A 1 94  ? -7.511  28.401 1.932   1.00 41.66  ? 443 PHE A C   1 
ATOM   633  O O   . PHE A 1 94  ? -6.579  28.107 1.201   1.00 38.02  ? 443 PHE A O   1 
ATOM   634  C CB  . PHE A 1 94  ? -8.489  30.640 2.263   1.00 41.27  ? 443 PHE A CB  1 
ATOM   635  C CG  . PHE A 1 94  ? -7.108  31.093 2.458   1.00 42.79  ? 443 PHE A CG  1 
ATOM   636  C CD1 . PHE A 1 94  ? -6.324  31.419 1.371   1.00 41.91  ? 443 PHE A CD1 1 
ATOM   637  C CD2 . PHE A 1 94  ? -6.561  31.156 3.729   1.00 44.82  ? 443 PHE A CD2 1 
ATOM   638  C CE1 . PHE A 1 94  ? -5.010  31.814 1.545   1.00 44.13  ? 443 PHE A CE1 1 
ATOM   639  C CE2 . PHE A 1 94  ? -5.248  31.559 3.907   1.00 43.39  ? 443 PHE A CE2 1 
ATOM   640  C CZ  . PHE A 1 94  ? -4.475  31.889 2.813   1.00 43.40  ? 443 PHE A CZ  1 
ATOM   641  N N   . LEU A 1 95  ? -7.627  27.937 3.172   1.00 43.20  ? 444 LEU A N   1 
ATOM   642  C CA  . LEU A 1 95  ? -6.634  27.025 3.740   1.00 41.83  ? 444 LEU A CA  1 
ATOM   643  C C   . LEU A 1 95  ? -6.446  25.839 2.845   1.00 42.24  ? 444 LEU A C   1 
ATOM   644  O O   . LEU A 1 95  ? -5.339  25.488 2.520   1.00 43.05  ? 444 LEU A O   1 
ATOM   645  C CB  . LEU A 1 95  ? -7.039  26.497 5.121   1.00 42.00  ? 444 LEU A CB  1 
ATOM   646  C CG  . LEU A 1 95  ? -6.579  27.333 6.294   1.00 46.72  ? 444 LEU A CG  1 
ATOM   647  C CD1 . LEU A 1 95  ? -6.983  26.680 7.610   1.00 48.82  ? 444 LEU A CD1 1 
ATOM   648  C CD2 . LEU A 1 95  ? -5.066  27.548 6.258   1.00 49.40  ? 444 LEU A CD2 1 
ATOM   649  N N   . GLU A 1 96  ? -7.540  25.200 2.462   1.00 44.95  ? 445 GLU A N   1 
ATOM   650  C CA  . GLU A 1 96  ? -7.455  24.028 1.626   1.00 41.73  ? 445 GLU A CA  1 
ATOM   651  C C   . GLU A 1 96  ? -6.795  24.365 0.315   1.00 38.60  ? 445 GLU A C   1 
ATOM   652  O O   . GLU A 1 96  ? -6.010  23.574 -0.161  1.00 40.83  ? 445 GLU A O   1 
ATOM   653  C CB  . GLU A 1 96  ? -8.854  23.504 1.354   1.00 45.32  ? 445 GLU A CB  1 
ATOM   654  C CG  . GLU A 1 96  ? -8.938  22.143 0.703   1.00 46.69  ? 445 GLU A CG  1 
ATOM   655  C CD  . GLU A 1 96  ? -10.371 21.658 0.615   1.00 53.99  ? 445 GLU A CD  1 
ATOM   656  O OE1 . GLU A 1 96  ? -11.290 22.385 1.105   1.00 59.27  ? 445 GLU A OE1 1 
ATOM   657  O OE2 . GLU A 1 96  ? -10.590 20.543 0.066   1.00 59.05  ? 445 GLU A OE2 1 
ATOM   658  N N   . LEU A 1 97  ? -7.065  25.532 -0.255  1.00 39.76  ? 446 LEU A N   1 
ATOM   659  C CA  . LEU A 1 97  ? -6.386  25.947 -1.513  1.00 43.33  ? 446 LEU A CA  1 
ATOM   660  C C   . LEU A 1 97  ? -4.884  26.216 -1.287  1.00 43.89  ? 446 LEU A C   1 
ATOM   661  O O   . LEU A 1 97  ? -4.041  25.821 -2.085  1.00 43.02  ? 446 LEU A O   1 
ATOM   662  C CB  . LEU A 1 97  ? -7.047  27.195 -2.160  1.00 42.01  ? 446 LEU A CB  1 
ATOM   663  C CG  . LEU A 1 97  ? -8.370  26.931 -2.898  1.00 39.44  ? 446 LEU A CG  1 
ATOM   664  C CD1 . LEU A 1 97  ? -9.070  28.225 -3.246  1.00 39.92  ? 446 LEU A CD1 1 
ATOM   665  C CD2 . LEU A 1 97  ? -8.162  26.109 -4.143  1.00 39.35  ? 446 LEU A CD2 1 
ATOM   666  N N   . PHE A 1 98  ? -4.566  26.902 -0.203  1.00 42.03  ? 447 PHE A N   1 
ATOM   667  C CA  . PHE A 1 98  ? -3.177  27.176 0.166   1.00 43.44  ? 447 PHE A CA  1 
ATOM   668  C C   . PHE A 1 98  ? -2.325  25.914 0.283   1.00 44.17  ? 447 PHE A C   1 
ATOM   669  O O   . PHE A 1 98  ? -1.204  25.851 -0.205  1.00 50.04  ? 447 PHE A O   1 
ATOM   670  C CB  . PHE A 1 98  ? -3.168  27.922 1.492   1.00 43.60  ? 447 PHE A CB  1 
ATOM   671  C CG  . PHE A 1 98  ? -1.816  28.097 2.084   1.00 43.04  ? 447 PHE A CG  1 
ATOM   672  C CD1 . PHE A 1 98  ? -0.946  29.033 1.568   1.00 47.27  ? 447 PHE A CD1 1 
ATOM   673  C CD2 . PHE A 1 98  ? -1.424  27.365 3.161   1.00 43.80  ? 447 PHE A CD2 1 
ATOM   674  C CE1 . PHE A 1 98  ? 0.305   29.228 2.113   1.00 48.55  ? 447 PHE A CE1 1 
ATOM   675  C CE2 . PHE A 1 98  ? -0.167  27.541 3.716   1.00 47.34  ? 447 PHE A CE2 1 
ATOM   676  C CZ  . PHE A 1 98  ? 0.703   28.475 3.187   1.00 48.01  ? 447 PHE A CZ  1 
ATOM   677  N N   . ILE A 1 99  ? -2.884  24.916 0.935   1.00 43.40  ? 448 ILE A N   1 
ATOM   678  C CA  . ILE A 1 99  ? -2.208  23.678 1.198   1.00 40.51  ? 448 ILE A CA  1 
ATOM   679  C C   . ILE A 1 99  ? -2.025  22.919 -0.093  1.00 43.09  ? 448 ILE A C   1 
ATOM   680  O O   . ILE A 1 99  ? -0.953  22.390 -0.357  1.00 48.06  ? 448 ILE A O   1 
ATOM   681  C CB  . ILE A 1 99  ? -3.054  22.809 2.137   1.00 37.74  ? 448 ILE A CB  1 
ATOM   682  C CG1 . ILE A 1 99  ? -3.110  23.446 3.524   1.00 36.61  ? 448 ILE A CG1 1 
ATOM   683  C CG2 . ILE A 1 99  ? -2.482  21.411 2.230   1.00 36.82  ? 448 ILE A CG2 1 
ATOM   684  C CD1 . ILE A 1 99  ? -4.229  22.925 4.391   1.00 36.16  ? 448 ILE A CD1 1 
ATOM   685  N N   . LEU A 1 100 ? -3.085  22.837 -0.885  1.00 42.49  ? 449 LEU A N   1 
ATOM   686  C CA  . LEU A 1 100 ? -3.065  22.025 -2.099  1.00 41.76  ? 449 LEU A CA  1 
ATOM   687  C C   . LEU A 1 100 ? -2.124  22.593 -3.120  1.00 41.56  ? 449 LEU A C   1 
ATOM   688  O O   . LEU A 1 100 ? -1.381  21.876 -3.745  1.00 42.26  ? 449 LEU A O   1 
ATOM   689  C CB  . LEU A 1 100 ? -4.461  21.975 -2.702  1.00 43.54  ? 449 LEU A CB  1 
ATOM   690  C CG  . LEU A 1 100 ? -4.622  21.263 -4.032  1.00 45.75  ? 449 LEU A CG  1 
ATOM   691  C CD1 . LEU A 1 100 ? -4.269  19.790 -3.893  1.00 47.78  ? 449 LEU A CD1 1 
ATOM   692  C CD2 . LEU A 1 100 ? -6.051  21.420 -4.503  1.00 47.51  ? 449 LEU A CD2 1 
ATOM   693  N N   . ARG A 1 101 ? -2.163  23.898 -3.290  1.00 44.61  ? 450 ARG A N   1 
ATOM   694  C CA  . ARG A 1 101 ? -1.311  24.546 -4.262  1.00 49.04  ? 450 ARG A CA  1 
ATOM   695  C C   . ARG A 1 101 ? 0.149   24.502 -3.831  1.00 50.98  ? 450 ARG A C   1 
ATOM   696  O O   . ARG A 1 101 ? 1.040   24.317 -4.659  1.00 56.54  ? 450 ARG A O   1 
ATOM   697  C CB  . ARG A 1 101 ? -1.745  25.993 -4.456  1.00 51.81  ? 450 ARG A CB  1 
ATOM   698  C CG  . ARG A 1 101 ? -3.123  26.122 -5.088  1.00 49.90  ? 450 ARG A CG  1 
ATOM   699  C CD  . ARG A 1 101 ? -3.745  27.487 -4.814  1.00 50.87  ? 450 ARG A CD  1 
ATOM   700  N NE  . ARG A 1 101 ? -2.810  28.579 -4.982  1.00 48.77  ? 450 ARG A NE  1 
ATOM   701  C CZ  . ARG A 1 101 ? -2.566  29.209 -6.117  1.00 49.82  ? 450 ARG A CZ  1 
ATOM   702  N NH1 . ARG A 1 101 ? -3.200  28.907 -7.250  1.00 46.94  ? 450 ARG A NH1 1 
ATOM   703  N NH2 . ARG A 1 101 ? -1.659  30.170 -6.105  1.00 56.71  ? 450 ARG A NH2 1 
ATOM   704  N N   . LEU A 1 102 ? 0.389   24.696 -2.542  1.00 46.75  ? 451 LEU A N   1 
ATOM   705  C CA  . LEU A 1 102 ? 1.724   24.560 -1.986  1.00 46.36  ? 451 LEU A CA  1 
ATOM   706  C C   . LEU A 1 102 ? 2.291   23.137 -2.115  1.00 44.45  ? 451 LEU A C   1 
ATOM   707  O O   . LEU A 1 102 ? 3.469   22.934 -2.415  1.00 43.82  ? 451 LEU A O   1 
ATOM   708  C CB  . LEU A 1 102 ? 1.675   24.930 -0.520  1.00 46.86  ? 451 LEU A CB  1 
ATOM   709  C CG  . LEU A 1 102 ? 2.993   24.927 0.226   1.00 48.26  ? 451 LEU A CG  1 
ATOM   710  C CD1 . LEU A 1 102 ? 3.940   25.963 -0.362  1.00 52.51  ? 451 LEU A CD1 1 
ATOM   711  C CD2 . LEU A 1 102 ? 2.752   25.236 1.690   1.00 50.05  ? 451 LEU A CD2 1 
ATOM   712  N N   . ALA A 1 103 ? 1.457   22.151 -1.853  1.00 43.68  ? 452 ALA A N   1 
ATOM   713  C CA  . ALA A 1 103 ? 1.888   20.771 -1.930  1.00 44.34  ? 452 ALA A CA  1 
ATOM   714  C C   . ALA A 1 103 ? 2.203   20.390 -3.375  1.00 43.39  ? 452 ALA A C   1 
ATOM   715  O O   . ALA A 1 103 ? 3.135   19.629 -3.633  1.00 48.89  ? 452 ALA A O   1 
ATOM   716  C CB  . ALA A 1 103 ? 0.824   19.857 -1.359  1.00 44.15  ? 452 ALA A CB  1 
ATOM   717  N N   . TYR A 1 104 ? 1.425   20.908 -4.310  1.00 42.05  ? 453 TYR A N   1 
ATOM   718  C CA  . TYR A 1 104 ? 1.630   20.586 -5.719  1.00 45.23  ? 453 TYR A CA  1 
ATOM   719  C C   . TYR A 1 104 ? 2.920   21.261 -6.233  1.00 43.36  ? 453 TYR A C   1 
ATOM   720  O O   . TYR A 1 104 ? 3.601   20.755 -7.095  1.00 41.11  ? 453 TYR A O   1 
ATOM   721  C CB  . TYR A 1 104 ? 0.417   21.053 -6.531  1.00 44.48  ? 453 TYR A CB  1 
ATOM   722  C CG  . TYR A 1 104 ? 0.366   20.650 -8.006  1.00 47.14  ? 453 TYR A CG  1 
ATOM   723  C CD1 . TYR A 1 104 ? 0.282   19.308 -8.390  1.00 47.51  ? 453 TYR A CD1 1 
ATOM   724  C CD2 . TYR A 1 104 ? 0.353   21.618 -9.017  1.00 47.99  ? 453 TYR A CD2 1 
ATOM   725  C CE1 . TYR A 1 104 ? 0.197   18.943 -9.737  1.00 47.24  ? 453 TYR A CE1 1 
ATOM   726  C CE2 . TYR A 1 104 ? 0.278   21.264 -10.356 1.00 47.88  ? 453 TYR A CE2 1 
ATOM   727  C CZ  . TYR A 1 104 ? 0.193   19.926 -10.714 1.00 49.27  ? 453 TYR A CZ  1 
ATOM   728  O OH  . TYR A 1 104 ? 0.107   19.564 -12.059 1.00 52.04  ? 453 TYR A OH  1 
ATOM   729  N N   . ARG A 1 105 ? 3.245   22.398 -5.662  1.00 44.17  ? 454 ARG A N   1 
ATOM   730  C CA  . ARG A 1 105 ? 4.346   23.236 -6.112  1.00 45.67  ? 454 ARG A CA  1 
ATOM   731  C C   . ARG A 1 105 ? 5.707   22.790 -5.518  1.00 44.59  ? 454 ARG A C   1 
ATOM   732  O O   . ARG A 1 105 ? 6.756   22.934 -6.119  1.00 41.78  ? 454 ARG A O   1 
ATOM   733  C CB  . ARG A 1 105 ? 4.013   24.662 -5.668  1.00 46.02  ? 454 ARG A CB  1 
ATOM   734  C CG  . ARG A 1 105 ? 4.865   25.736 -6.261  1.00 50.57  ? 454 ARG A CG  1 
ATOM   735  C CD  . ARG A 1 105 ? 4.568   27.079 -5.612  1.00 54.27  ? 454 ARG A CD  1 
ATOM   736  N NE  . ARG A 1 105 ? 3.179   27.533 -5.766  1.00 53.01  ? 454 ARG A NE  1 
ATOM   737  C CZ  . ARG A 1 105 ? 2.351   27.814 -4.765  1.00 56.41  ? 454 ARG A CZ  1 
ATOM   738  N NH1 . ARG A 1 105 ? 2.732   27.693 -3.496  1.00 58.70  ? 454 ARG A NH1 1 
ATOM   739  N NH2 . ARG A 1 105 ? 1.120   28.233 -5.034  1.00 59.03  ? 454 ARG A NH2 1 
ATOM   740  N N   . SER A 1 106 ? 5.666   22.245 -4.323  1.00 43.52  ? 455 SER A N   1 
ATOM   741  C CA  . SER A 1 106 ? 6.857   22.034 -3.560  1.00 45.21  ? 455 SER A CA  1 
ATOM   742  C C   . SER A 1 106 ? 7.606   20.773 -3.998  1.00 44.81  ? 455 SER A C   1 
ATOM   743  O O   . SER A 1 106 ? 7.127   20.033 -4.840  1.00 42.29  ? 455 SER A O   1 
ATOM   744  C CB  . SER A 1 106 ? 6.462   22.020 -2.090  1.00 47.62  ? 455 SER A CB  1 
ATOM   745  O OG  . SER A 1 106 ? 5.887   23.278 -1.730  1.00 47.42  ? 455 SER A OG  1 
ATOM   746  N N   . LYS A 1 107 ? 8.816   20.596 -3.465  1.00 48.21  ? 456 LYS A N   1 
ATOM   747  C CA  . LYS A 1 107 ? 9.676   19.470 -3.798  1.00 53.19  ? 456 LYS A CA  1 
ATOM   748  C C   . LYS A 1 107 ? 10.013  18.790 -2.501  1.00 49.26  ? 456 LYS A C   1 
ATOM   749  O O   . LYS A 1 107 ? 10.917  19.206 -1.804  1.00 47.96  ? 456 LYS A O   1 
ATOM   750  C CB  . LYS A 1 107 ? 10.979  19.909 -4.474  1.00 61.06  ? 456 LYS A CB  1 
ATOM   751  C CG  . LYS A 1 107 ? 10.897  21.135 -5.368  1.00 66.37  ? 456 LYS A CG  1 
ATOM   752  C CD  . LYS A 1 107 ? 10.812  20.828 -6.858  1.00 74.34  ? 456 LYS A CD  1 
ATOM   753  C CE  . LYS A 1 107 ? 11.561  21.914 -7.629  1.00 81.68  ? 456 LYS A CE  1 
ATOM   754  N NZ  . LYS A 1 107 ? 11.142  22.087 -9.049  1.00 83.75  ? 456 LYS A NZ  1 
ATOM   755  N N   . PRO A 1 108 ? 9.232   17.778 -2.139  1.00 51.18  ? 457 PRO A N   1 
ATOM   756  C CA  . PRO A 1 108 ? 9.444   17.159 -0.858  1.00 49.93  ? 457 PRO A CA  1 
ATOM   757  C C   . PRO A 1 108 ? 10.729  16.341 -0.802  1.00 52.30  ? 457 PRO A C   1 
ATOM   758  O O   . PRO A 1 108 ? 11.223  16.051 0.288   1.00 56.79  ? 457 PRO A O   1 
ATOM   759  C CB  . PRO A 1 108 ? 8.198   16.271 -0.693  1.00 50.06  ? 457 PRO A CB  1 
ATOM   760  C CG  . PRO A 1 108 ? 7.621   16.074 -2.049  1.00 47.49  ? 457 PRO A CG  1 
ATOM   761  C CD  . PRO A 1 108 ? 7.986   17.314 -2.795  1.00 51.71  ? 457 PRO A CD  1 
ATOM   762  N N   . GLY A 1 109 ? 11.236  15.948 -1.966  1.00 52.29  ? 458 GLY A N   1 
ATOM   763  C CA  . GLY A 1 109 ? 12.455  15.155 -2.068  1.00 52.76  ? 458 GLY A CA  1 
ATOM   764  C C   . GLY A 1 109 ? 13.716  15.924 -1.757  1.00 51.49  ? 458 GLY A C   1 
ATOM   765  O O   . GLY A 1 109 ? 14.780  15.335 -1.635  1.00 54.09  ? 458 GLY A O   1 
ATOM   766  N N   . GLU A 1 110 ? 13.600  17.242 -1.710  1.00 51.61  ? 459 GLU A N   1 
ATOM   767  C CA  . GLU A 1 110 ? 14.665  18.129 -1.254  1.00 51.30  ? 459 GLU A CA  1 
ATOM   768  C C   . GLU A 1 110 ? 14.288  18.862 0.008   1.00 52.17  ? 459 GLU A C   1 
ATOM   769  O O   . GLU A 1 110 ? 15.027  19.731 0.470   1.00 50.78  ? 459 GLU A O   1 
ATOM   770  C CB  . GLU A 1 110 ? 14.969  19.137 -2.333  1.00 50.63  ? 459 GLU A CB  1 
ATOM   771  C CG  . GLU A 1 110 ? 15.378  18.448 -3.614  1.00 56.60  ? 459 GLU A CG  1 
ATOM   772  C CD  . GLU A 1 110 ? 15.598  19.426 -4.741  1.00 59.44  ? 459 GLU A CD  1 
ATOM   773  O OE1 . GLU A 1 110 ? 15.860  20.615 -4.471  1.00 61.89  ? 459 GLU A OE1 1 
ATOM   774  O OE2 . GLU A 1 110 ? 15.492  19.002 -5.901  1.00 67.92  ? 459 GLU A OE2 1 
ATOM   775  N N   . GLY A 1 111 ? 13.154  18.482 0.590   1.00 51.83  ? 460 GLY A N   1 
ATOM   776  C CA  . GLY A 1 111 ? 12.670  19.131 1.790   1.00 50.52  ? 460 GLY A CA  1 
ATOM   777  C C   . GLY A 1 111 ? 12.341  20.597 1.602   1.00 48.52  ? 460 GLY A C   1 
ATOM   778  O O   . GLY A 1 111 ? 12.321  21.388 2.573   1.00 48.78  ? 460 GLY A O   1 
ATOM   779  N N   . LYS A 1 112 ? 12.054  20.979 0.366   1.00 48.49  ? 461 LYS A N   1 
ATOM   780  C CA  . LYS A 1 112 ? 11.861  22.389 0.107   1.00 52.13  ? 461 LYS A CA  1 
ATOM   781  C C   . LYS A 1 112 ? 10.431  22.752 -0.350  1.00 51.40  ? 461 LYS A C   1 
ATOM   782  O O   . LYS A 1 112 ? 9.848   22.128 -1.250  1.00 43.46  ? 461 LYS A O   1 
ATOM   783  C CB  . LYS A 1 112 ? 12.961  22.932 -0.819  1.00 51.30  ? 461 LYS A CB  1 
ATOM   784  C CG  . LYS A 1 112 ? 12.730  22.689 -2.284  1.00 54.02  ? 461 LYS A CG  1 
ATOM   785  C CD  . LYS A 1 112 ? 13.835  23.188 -3.192  1.00 58.46  ? 461 LYS A CD  1 
ATOM   786  C CE  . LYS A 1 112 ? 15.239  23.134 -2.625  1.00 59.44  ? 461 LYS A CE  1 
ATOM   787  N NZ  . LYS A 1 112 ? 16.149  23.561 -3.729  1.00 61.45  ? 461 LYS A NZ  1 
ATOM   788  N N   . LEU A 1 113 ? 9.929   23.795 0.325   1.00 51.84  ? 462 LEU A N   1 
ATOM   789  C CA  . LEU A 1 113 ? 8.616   24.378 0.155   1.00 51.35  ? 462 LEU A CA  1 
ATOM   790  C C   . LEU A 1 113 ? 8.741   25.576 -0.761  1.00 49.80  ? 462 LEU A C   1 
ATOM   791  O O   . LEU A 1 113 ? 9.585   26.435 -0.547  1.00 49.91  ? 462 LEU A O   1 
ATOM   792  C CB  . LEU A 1 113 ? 8.097   24.941 1.496   1.00 52.26  ? 462 LEU A CB  1 
ATOM   793  C CG  . LEU A 1 113 ? 7.704   24.099 2.707   1.00 49.39  ? 462 LEU A CG  1 
ATOM   794  C CD1 . LEU A 1 113 ? 6.605   23.122 2.334   1.00 49.35  ? 462 LEU A CD1 1 
ATOM   795  C CD2 . LEU A 1 113 ? 8.907   23.401 3.288   1.00 51.06  ? 462 LEU A CD2 1 
ATOM   796  N N   . ILE A 1 114 ? 7.870   25.664 -1.748  1.00 49.72  ? 463 ILE A N   1 
ATOM   797  C CA  . ILE A 1 114 ? 7.913   26.772 -2.669  1.00 47.19  ? 463 ILE A CA  1 
ATOM   798  C C   . ILE A 1 114 ? 6.607   27.508 -2.577  1.00 46.94  ? 463 ILE A C   1 
ATOM   799  O O   . ILE A 1 114 ? 5.547   26.934 -2.726  1.00 52.15  ? 463 ILE A O   1 
ATOM   800  C CB  . ILE A 1 114 ? 8.173   26.251 -4.081  1.00 46.02  ? 463 ILE A CB  1 
ATOM   801  C CG1 . ILE A 1 114 ? 9.487   25.464 -4.055  1.00 45.34  ? 463 ILE A CG1 1 
ATOM   802  C CG2 . ILE A 1 114 ? 8.223   27.400 -5.062  1.00 44.68  ? 463 ILE A CG2 1 
ATOM   803  C CD1 . ILE A 1 114 ? 9.912   24.934 -5.387  1.00 46.59  ? 463 ILE A CD1 1 
ATOM   804  N N   . PHE A 1 115 ? 6.682   28.785 -2.296  1.00 47.44  ? 464 PHE A N   1 
ATOM   805  C CA  . PHE A 1 115 ? 5.488   29.567 -2.124  1.00 48.93  ? 464 PHE A CA  1 
ATOM   806  C C   . PHE A 1 115 ? 5.198   30.283 -3.416  1.00 52.73  ? 464 PHE A C   1 
ATOM   807  O O   . PHE A 1 115 ? 6.020   30.255 -4.335  1.00 53.96  ? 464 PHE A O   1 
ATOM   808  C CB  . PHE A 1 115 ? 5.692   30.522 -0.961  1.00 49.91  ? 464 PHE A CB  1 
ATOM   809  C CG  . PHE A 1 115 ? 5.962   29.813 0.333   1.00 45.68  ? 464 PHE A CG  1 
ATOM   810  C CD1 . PHE A 1 115 ? 4.934   29.269 1.057   1.00 44.71  ? 464 PHE A CD1 1 
ATOM   811  C CD2 . PHE A 1 115 ? 7.241   29.637 0.785   1.00 48.44  ? 464 PHE A CD2 1 
ATOM   812  C CE1 . PHE A 1 115 ? 5.182   28.584 2.233   1.00 45.23  ? 464 PHE A CE1 1 
ATOM   813  C CE2 . PHE A 1 115 ? 7.493   28.958 1.974   1.00 50.56  ? 464 PHE A CE2 1 
ATOM   814  C CZ  . PHE A 1 115 ? 6.457   28.427 2.703   1.00 44.98  ? 464 PHE A CZ  1 
ATOM   815  N N   . CYS A 1 116 ? 4.031   30.913 -3.506  1.00 55.38  ? 465 CYS A N   1 
ATOM   816  C CA  . CYS A 1 116 ? 3.586   31.493 -4.777  1.00 56.33  ? 465 CYS A CA  1 
ATOM   817  C C   . CYS A 1 116 ? 4.324   32.772 -5.184  1.00 60.36  ? 465 CYS A C   1 
ATOM   818  O O   . CYS A 1 116 ? 4.235   33.211 -6.339  1.00 75.63  ? 465 CYS A O   1 
ATOM   819  C CB  . CYS A 1 116 ? 2.093   31.753 -4.715  1.00 54.75  ? 465 CYS A CB  1 
ATOM   820  S SG  . CYS A 1 116 ? 1.653   32.838 -3.327  1.00 55.85  ? 465 CYS A SG  1 
ATOM   821  N N   . SER A 1 117 ? 5.071   33.362 -4.257  1.00 60.80  ? 466 SER A N   1 
ATOM   822  C CA  . SER A 1 117 ? 5.953   34.474 -4.584  1.00 56.54  ? 466 SER A CA  1 
ATOM   823  C C   . SER A 1 117 ? 7.235   33.998 -5.237  1.00 59.01  ? 466 SER A C   1 
ATOM   824  O O   . SER A 1 117 ? 8.020   34.804 -5.699  1.00 71.75  ? 466 SER A O   1 
ATOM   825  C CB  . SER A 1 117 ? 6.335   35.202 -3.334  1.00 57.14  ? 466 SER A CB  1 
ATOM   826  O OG  . SER A 1 117 ? 6.955   34.293 -2.457  1.00 61.18  ? 466 SER A OG  1 
ATOM   827  N N   . GLY A 1 118 ? 7.439   32.691 -5.305  1.00 58.81  ? 467 GLY A N   1 
ATOM   828  C CA  . GLY A 1 118 ? 8.679   32.146 -5.809  1.00 55.17  ? 467 GLY A CA  1 
ATOM   829  C C   . GLY A 1 118 ? 9.570   31.833 -4.625  1.00 52.53  ? 467 GLY A C   1 
ATOM   830  O O   . GLY A 1 118 ? 10.554  31.112 -4.774  1.00 47.11  ? 467 GLY A O   1 
ATOM   831  N N   . LEU A 1 119 ? 9.242   32.395 -3.458  1.00 49.74  ? 468 LEU A N   1 
ATOM   832  C CA  . LEU A 1 119 ? 10.039  32.186 -2.264  1.00 51.84  ? 468 LEU A CA  1 
ATOM   833  C C   . LEU A 1 119 ? 10.231  30.708 -1.977  1.00 51.57  ? 468 LEU A C   1 
ATOM   834  O O   . LEU A 1 119 ? 9.294   29.922 -2.014  1.00 49.30  ? 468 LEU A O   1 
ATOM   835  C CB  . LEU A 1 119 ? 9.415   32.843 -1.040  1.00 53.19  ? 468 LEU A CB  1 
ATOM   836  C CG  . LEU A 1 119 ? 10.307  32.776 0.201   1.00 58.83  ? 468 LEU A CG  1 
ATOM   837  C CD1 . LEU A 1 119 ? 11.470  33.757 0.129   1.00 63.80  ? 468 LEU A CD1 1 
ATOM   838  C CD2 . LEU A 1 119 ? 9.505   33.055 1.446   1.00 62.72  ? 468 LEU A CD2 1 
ATOM   839  N N   . VAL A 1 120 ? 11.485  30.350 -1.730  1.00 52.24  ? 469 VAL A N   1 
ATOM   840  C CA  . VAL A 1 120 ? 11.852  28.989 -1.456  1.00 47.41  ? 469 VAL A CA  1 
ATOM   841  C C   . VAL A 1 120 ? 12.433  28.961 -0.075  1.00 47.28  ? 469 VAL A C   1 
ATOM   842  O O   . VAL A 1 120 ? 13.343  29.729 0.221   1.00 49.07  ? 469 VAL A O   1 
ATOM   843  C CB  . VAL A 1 120 ? 12.894  28.458 -2.455  1.00 46.67  ? 469 VAL A CB  1 
ATOM   844  C CG1 . VAL A 1 120 ? 13.102  26.961 -2.243  1.00 46.19  ? 469 VAL A CG1 1 
ATOM   845  C CG2 . VAL A 1 120 ? 12.470  28.733 -3.890  1.00 45.96  ? 469 VAL A CG2 1 
ATOM   846  N N   . LEU A 1 121 ? 11.878  28.087 0.764   1.00 51.41  ? 470 LEU A N   1 
ATOM   847  C CA  . LEU A 1 121 ? 12.339  27.864 2.125   1.00 54.43  ? 470 LEU A CA  1 
ATOM   848  C C   . LEU A 1 121 ? 12.376  26.370 2.390   1.00 53.10  ? 470 LEU A C   1 
ATOM   849  O O   . LEU A 1 121 ? 11.738  25.578 1.712   1.00 49.76  ? 470 LEU A O   1 
ATOM   850  C CB  . LEU A 1 121 ? 11.422  28.506 3.166   1.00 56.98  ? 470 LEU A CB  1 
ATOM   851  C CG  . LEU A 1 121 ? 11.287  30.031 3.192   1.00 61.71  ? 470 LEU A CG  1 
ATOM   852  C CD1 . LEU A 1 121 ? 10.466  30.472 4.403   1.00 61.79  ? 470 LEU A CD1 1 
ATOM   853  C CD2 . LEU A 1 121 ? 12.653  30.702 3.198   1.00 61.33  ? 470 LEU A CD2 1 
ATOM   854  N N   . HIS A 1 122 ? 13.162  26.006 3.384   1.00 53.84  ? 471 HIS A N   1 
ATOM   855  C CA  . HIS A 1 122 ? 13.448  24.628 3.656   1.00 49.79  ? 471 HIS A CA  1 
ATOM   856  C C   . HIS A 1 122 ? 12.607  24.253 4.825   1.00 52.32  ? 471 HIS A C   1 
ATOM   857  O O   . HIS A 1 122 ? 12.238  25.124 5.633   1.00 57.69  ? 471 HIS A O   1 
ATOM   858  C CB  . HIS A 1 122 ? 14.921  24.499 4.023   1.00 50.94  ? 471 HIS A CB  1 
ATOM   859  C CG  . HIS A 1 122 ? 15.389  23.083 4.123   1.00 45.01  ? 471 HIS A CG  1 
ATOM   860  N ND1 . HIS A 1 122 ? 15.380  22.374 5.301   1.00 40.74  ? 471 HIS A ND1 1 
ATOM   861  C CD2 . HIS A 1 122 ? 15.862  22.240 3.179   1.00 43.71  ? 471 HIS A CD2 1 
ATOM   862  C CE1 . HIS A 1 122 ? 15.838  21.156 5.084   1.00 42.70  ? 471 HIS A CE1 1 
ATOM   863  N NE2 . HIS A 1 122 ? 16.125  21.045 3.801   1.00 46.24  ? 471 HIS A NE2 1 
ATOM   864  N N   . ARG A 1 123 ? 12.317  22.962 4.932   1.00 52.73  ? 472 ARG A N   1 
ATOM   865  C CA  . ARG A 1 123 ? 11.555  22.411 6.067   1.00 55.42  ? 472 ARG A CA  1 
ATOM   866  C C   . ARG A 1 123 ? 11.867  23.022 7.421   1.00 54.17  ? 472 ARG A C   1 
ATOM   867  O O   . ARG A 1 123 ? 10.982  23.372 8.199   1.00 56.33  ? 472 ARG A O   1 
ATOM   868  C CB  . ARG A 1 123 ? 11.913  20.947 6.206   1.00 59.13  ? 472 ARG A CB  1 
ATOM   869  C CG  . ARG A 1 123 ? 10.825  19.954 5.989   1.00 63.46  ? 472 ARG A CG  1 
ATOM   870  C CD  . ARG A 1 123 ? 10.776  18.933 7.131   1.00 65.95  ? 472 ARG A CD  1 
ATOM   871  N NE  . ARG A 1 123 ? 12.056  18.363 7.571   1.00 57.12  ? 472 ARG A NE  1 
ATOM   872  C CZ  . ARG A 1 123 ? 12.380  18.134 8.841   1.00 58.73  ? 472 ARG A CZ  1 
ATOM   873  N NH1 . ARG A 1 123 ? 13.556  17.599 9.112   1.00 63.66  ? 472 ARG A NH1 1 
ATOM   874  N NH2 . ARG A 1 123 ? 11.551  18.423 9.844   1.00 58.26  ? 472 ARG A NH2 1 
ATOM   875  N N   . LEU A 1 124 ? 13.156  23.098 7.697   1.00 52.96  ? 473 LEU A N   1 
ATOM   876  C CA  . LEU A 1 124 ? 13.690  23.575 8.972   1.00 52.92  ? 473 LEU A CA  1 
ATOM   877  C C   . LEU A 1 124 ? 13.515  25.068 9.201   1.00 50.31  ? 473 LEU A C   1 
ATOM   878  O O   . LEU A 1 124 ? 13.413  25.511 10.336  1.00 49.00  ? 473 LEU A O   1 
ATOM   879  C CB  . LEU A 1 124 ? 15.174  23.242 9.054   1.00 49.40  ? 473 LEU A CB  1 
ATOM   880  C CG  . LEU A 1 124 ? 15.474  21.752 9.014   1.00 47.07  ? 473 LEU A CG  1 
ATOM   881  C CD1 . LEU A 1 124 ? 16.926  21.504 8.644   1.00 42.62  ? 473 LEU A CD1 1 
ATOM   882  C CD2 . LEU A 1 124 ? 15.129  21.140 10.363  1.00 51.08  ? 473 LEU A CD2 1 
ATOM   883  N N   . GLN A 1 125 ? 13.454  25.828 8.122   1.00 51.12  ? 474 GLN A N   1 
ATOM   884  C CA  . GLN A 1 125 ? 13.213  27.253 8.216   1.00 53.55  ? 474 GLN A CA  1 
ATOM   885  C C   . GLN A 1 125 ? 11.749  27.592 8.472   1.00 59.87  ? 474 GLN A C   1 
ATOM   886  O O   . GLN A 1 125 ? 11.450  28.720 8.898   1.00 54.14  ? 474 GLN A O   1 
ATOM   887  C CB  . GLN A 1 125 ? 13.611  27.939 6.934   1.00 54.80  ? 474 GLN A CB  1 
ATOM   888  C CG  . GLN A 1 125 ? 15.084  27.871 6.640   1.00 55.27  ? 474 GLN A CG  1 
ATOM   889  C CD  . GLN A 1 125 ? 15.396  28.559 5.343   1.00 49.90  ? 474 GLN A CD  1 
ATOM   890  O OE1 . GLN A 1 125 ? 15.236  27.977 4.269   1.00 48.27  ? 474 GLN A OE1 1 
ATOM   891  N NE2 . GLN A 1 125 ? 15.833  29.801 5.432   1.00 46.41  ? 474 GLN A NE2 1 
ATOM   892  N N   . CYS A 1 126 ? 10.835  26.656 8.166   1.00 61.51  ? 475 CYS A N   1 
ATOM   893  C CA  . CYS A 1 126 ? 9.412   26.860 8.411   1.00 57.82  ? 475 CYS A CA  1 
ATOM   894  C C   . CYS A 1 126 ? 8.955   26.143 9.672   1.00 59.06  ? 475 CYS A C   1 
ATOM   895  O O   . CYS A 1 126 ? 7.962   26.506 10.256  1.00 64.14  ? 475 CYS A O   1 
ATOM   896  C CB  . CYS A 1 126 ? 8.600   26.328 7.255   1.00 55.77  ? 475 CYS A CB  1 
ATOM   897  S SG  . CYS A 1 126 ? 9.210   26.730 5.620   1.00 56.10  ? 475 CYS A SG  1 
ATOM   898  N N   . ALA A 1 127 ? 9.674   25.108 10.070  1.00 63.63  ? 476 ALA A N   1 
ATOM   899  C CA  . ALA A 1 127 ? 9.343   24.342 11.264  1.00 66.31  ? 476 ALA A CA  1 
ATOM   900  C C   . ALA A 1 127 ? 9.019   25.209 12.481  1.00 61.41  ? 476 ALA A C   1 
ATOM   901  O O   . ALA A 1 127 ? 8.136   24.888 13.245  1.00 56.23  ? 476 ALA A O   1 
ATOM   902  C CB  . ALA A 1 127 ? 10.478  23.367 11.598  1.00 65.91  ? 476 ALA A CB  1 
ATOM   903  N N   . ARG A 1 128 ? 9.731   26.305 12.658  1.00 68.77  ? 477 ARG A N   1 
ATOM   904  C CA  . ARG A 1 128 ? 9.494   27.162 13.823  1.00 73.81  ? 477 ARG A CA  1 
ATOM   905  C C   . ARG A 1 128 ? 8.093   27.799 13.852  1.00 64.86  ? 477 ARG A C   1 
ATOM   906  O O   . ARG A 1 128 ? 7.358   27.637 14.813  1.00 59.10  ? 477 ARG A O   1 
ATOM   907  C CB  . ARG A 1 128 ? 10.613  28.206 13.952  1.00 79.78  ? 477 ARG A CB  1 
ATOM   908  C CG  . ARG A 1 128 ? 11.642  27.793 14.998  1.00 81.87  ? 477 ARG A CG  1 
ATOM   909  C CD  . ARG A 1 128 ? 12.460  28.950 15.539  1.00 82.16  ? 477 ARG A CD  1 
ATOM   910  N NE  . ARG A 1 128 ? 12.694  28.821 16.981  1.00 79.92  ? 477 ARG A NE  1 
ATOM   911  C CZ  . ARG A 1 128 ? 12.740  29.842 17.838  1.00 76.43  ? 477 ARG A CZ  1 
ATOM   912  N NH1 . ARG A 1 128 ? 12.591  31.094 17.432  1.00 75.12  ? 477 ARG A NH1 1 
ATOM   913  N NH2 . ARG A 1 128 ? 12.946  29.612 19.119  1.00 81.53  ? 477 ARG A NH2 1 
ATOM   914  N N   . GLY A 1 129 ? 7.734   28.500 12.788  1.00 58.72  ? 478 GLY A N   1 
ATOM   915  C CA  . GLY A 1 129 ? 6.441   29.168 12.690  1.00 56.88  ? 478 GLY A CA  1 
ATOM   916  C C   . GLY A 1 129 ? 5.250   28.322 12.291  1.00 51.30  ? 478 GLY A C   1 
ATOM   917  O O   . GLY A 1 129 ? 4.153   28.601 12.740  1.00 51.79  ? 478 GLY A O   1 
ATOM   918  N N   . PHE A 1 130 ? 5.438   27.335 11.418  1.00 50.68  ? 479 PHE A N   1 
ATOM   919  C CA  . PHE A 1 130 ? 4.351   26.406 11.016  1.00 53.47  ? 479 PHE A CA  1 
ATOM   920  C C   . PHE A 1 130 ? 4.163   25.221 11.948  1.00 53.30  ? 479 PHE A C   1 
ATOM   921  O O   . PHE A 1 130 ? 3.083   24.614 11.985  1.00 57.80  ? 479 PHE A O   1 
ATOM   922  C CB  . PHE A 1 130 ? 4.606   25.799 9.644   1.00 56.15  ? 479 PHE A CB  1 
ATOM   923  C CG  . PHE A 1 130 ? 4.351   26.731 8.511   1.00 60.56  ? 479 PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 130 ? 5.188   27.830 8.290   1.00 63.46  ? 479 PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 130 ? 3.280   26.503 7.647   1.00 63.70  ? 479 PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 130 ? 4.942   28.693 7.241   1.00 63.92  ? 479 PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 130 ? 3.041   27.356 6.594   1.00 66.59  ? 479 PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 130 ? 3.864   28.455 6.396   1.00 65.06  ? 479 PHE A CZ  1 
ATOM   929  N N   . GLY A 1 131 ? 5.206   24.891 12.697  1.00 52.55  ? 480 GLY A N   1 
ATOM   930  C CA  . GLY A 1 131 ? 5.211   23.672 13.485  1.00 53.89  ? 480 GLY A CA  1 
ATOM   931  C C   . GLY A 1 131 ? 5.154   22.437 12.596  1.00 53.77  ? 480 GLY A C   1 
ATOM   932  O O   . GLY A 1 131 ? 5.525   22.486 11.435  1.00 46.61  ? 480 GLY A O   1 
ATOM   933  N N   . ASP A 1 132 ? 4.619   21.356 13.168  1.00 59.88  ? 481 ASP A N   1 
ATOM   934  C CA  . ASP A 1 132 ? 4.425   20.052 12.512  1.00 58.93  ? 481 ASP A CA  1 
ATOM   935  C C   . ASP A 1 132 ? 3.697   20.083 11.199  1.00 51.71  ? 481 ASP A C   1 
ATOM   936  O O   . ASP A 1 132 ? 3.956   19.287 10.309  1.00 42.61  ? 481 ASP A O   1 
ATOM   937  C CB  . ASP A 1 132 ? 3.603   19.129 13.390  1.00 68.38  ? 481 ASP A CB  1 
ATOM   938  C CG  . ASP A 1 132 ? 4.230   17.802 13.507  1.00 81.98  ? 481 ASP A CG  1 
ATOM   939  O OD1 . ASP A 1 132 ? 5.288   17.744 14.157  1.00 91.45  ? 481 ASP A OD1 1 
ATOM   940  O OD2 . ASP A 1 132 ? 3.704   16.835 12.909  1.00 94.48  ? 481 ASP A OD2 1 
ATOM   941  N N   . TRP A 1 133 ? 2.743   20.989 11.119  1.00 49.26  ? 482 TRP A N   1 
ATOM   942  C CA  . TRP A 1 133 ? 1.914   21.139 9.943   1.00 48.95  ? 482 TRP A CA  1 
ATOM   943  C C   . TRP A 1 133 ? 2.767   21.094 8.667   1.00 50.34  ? 482 TRP A C   1 
ATOM   944  O O   . TRP A 1 133 ? 2.405   20.427 7.686   1.00 48.23  ? 482 TRP A O   1 
ATOM   945  C CB  . TRP A 1 133 ? 1.121   22.448 10.078  1.00 43.48  ? 482 TRP A CB  1 
ATOM   946  C CG  . TRP A 1 133 ? 0.078   22.663 9.106   1.00 39.35  ? 482 TRP A CG  1 
ATOM   947  C CD1 . TRP A 1 133 ? -0.694  21.733 8.522   1.00 42.75  ? 482 TRP A CD1 1 
ATOM   948  C CD2 . TRP A 1 133 ? -0.352  23.923 8.604   1.00 40.95  ? 482 TRP A CD2 1 
ATOM   949  N NE1 . TRP A 1 133 ? -1.577  22.329 7.639   1.00 43.90  ? 482 TRP A NE1 1 
ATOM   950  C CE2 . TRP A 1 133 ? -1.384  23.677 7.681   1.00 43.11  ? 482 TRP A CE2 1 
ATOM   951  C CE3 . TRP A 1 133 ? 0.047   25.244 8.831   1.00 40.79  ? 482 TRP A CE3 1 
ATOM   952  C CZ2 . TRP A 1 133 ? -2.040  24.705 6.992   1.00 45.22  ? 482 TRP A CZ2 1 
ATOM   953  C CZ3 . TRP A 1 133 ? -0.600  26.262 8.156   1.00 41.37  ? 482 TRP A CZ3 1 
ATOM   954  C CH2 . TRP A 1 133 ? -1.636  25.993 7.251   1.00 42.28  ? 482 TRP A CH2 1 
ATOM   955  N N   . ILE A 1 134 ? 3.914   21.765 8.688   1.00 49.90  ? 483 ILE A N   1 
ATOM   956  C CA  . ILE A 1 134 ? 4.718   21.827 7.494   1.00 49.30  ? 483 ILE A CA  1 
ATOM   957  C C   . ILE A 1 134 ? 5.247   20.458 7.074   1.00 52.31  ? 483 ILE A C   1 
ATOM   958  O O   . ILE A 1 134 ? 5.364   20.175 5.892   1.00 49.71  ? 483 ILE A O   1 
ATOM   959  C CB  . ILE A 1 134 ? 5.879   22.818 7.624   1.00 52.13  ? 483 ILE A CB  1 
ATOM   960  C CG1 . ILE A 1 134 ? 6.335   23.228 6.223   1.00 54.60  ? 483 ILE A CG1 1 
ATOM   961  C CG2 . ILE A 1 134 ? 7.053   22.235 8.409   1.00 54.48  ? 483 ILE A CG2 1 
ATOM   962  C CD1 . ILE A 1 134 ? 5.235   23.850 5.381   1.00 51.94  ? 483 ILE A CD1 1 
ATOM   963  N N   . ASP A 1 135 ? 5.544   19.609 8.046   1.00 53.57  ? 484 ASP A N   1 
ATOM   964  C CA  . ASP A 1 135 ? 5.999   18.267 7.766   1.00 52.40  ? 484 ASP A CA  1 
ATOM   965  C C   . ASP A 1 135 ? 4.864   17.451 7.134   1.00 54.21  ? 484 ASP A C   1 
ATOM   966  O O   . ASP A 1 135 ? 5.080   16.660 6.211   1.00 55.71  ? 484 ASP A O   1 
ATOM   967  C CB  . ASP A 1 135 ? 6.467   17.634 9.061   1.00 57.38  ? 484 ASP A CB  1 
ATOM   968  C CG  . ASP A 1 135 ? 7.666   18.365 9.669   1.00 63.41  ? 484 ASP A CG  1 
ATOM   969  O OD1 . ASP A 1 135 ? 8.686   18.449 8.976   1.00 71.96  ? 484 ASP A OD1 1 
ATOM   970  O OD2 . ASP A 1 135 ? 7.615   18.834 10.829  1.00 58.61  ? 484 ASP A OD2 1 
ATOM   971  N N   . SER A 1 136 ? 3.642   17.681 7.610   1.00 53.13  ? 485 SER A N   1 
ATOM   972  C CA  . SER A 1 136 ? 2.460   16.957 7.128   1.00 49.72  ? 485 SER A CA  1 
ATOM   973  C C   . SER A 1 136 ? 2.001   17.441 5.773   1.00 47.92  ? 485 SER A C   1 
ATOM   974  O O   . SER A 1 136 ? 1.467   16.675 4.966   1.00 49.01  ? 485 SER A O   1 
ATOM   975  C CB  . SER A 1 136 ? 1.330   17.166 8.107   1.00 52.77  ? 485 SER A CB  1 
ATOM   976  O OG  . SER A 1 136 ? 1.803   17.086 9.440   1.00 61.66  ? 485 SER A OG  1 
ATOM   977  N N   . ILE A 1 137 ? 2.184   18.729 5.525   1.00 45.74  ? 486 ILE A N   1 
ATOM   978  C CA  . ILE A 1 137 ? 1.934   19.254 4.197   1.00 47.54  ? 486 ILE A CA  1 
ATOM   979  C C   . ILE A 1 137 ? 2.883   18.570 3.238   1.00 46.23  ? 486 ILE A C   1 
ATOM   980  O O   . ILE A 1 137 ? 2.468   18.124 2.176   1.00 45.96  ? 486 ILE A O   1 
ATOM   981  C CB  . ILE A 1 137 ? 2.135   20.769 4.136   1.00 50.91  ? 486 ILE A CB  1 
ATOM   982  C CG1 . ILE A 1 137 ? 0.996   21.485 4.857   1.00 52.52  ? 486 ILE A CG1 1 
ATOM   983  C CG2 . ILE A 1 137 ? 2.184   21.254 2.702   1.00 50.15  ? 486 ILE A CG2 1 
ATOM   984  C CD1 . ILE A 1 137 ? 1.364   22.890 5.255   1.00 57.53  ? 486 ILE A CD1 1 
ATOM   985  N N   . LEU A 1 138 ? 4.148   18.446 3.636   1.00 47.75  ? 487 LEU A N   1 
ATOM   986  C CA  . LEU A 1 138 ? 5.155   17.784 2.774   1.00 47.87  ? 487 LEU A CA  1 
ATOM   987  C C   . LEU A 1 138 ? 4.875   16.335 2.500   1.00 45.73  ? 487 LEU A C   1 
ATOM   988  O O   . LEU A 1 138 ? 5.157   15.836 1.425   1.00 38.63  ? 487 LEU A O   1 
ATOM   989  C CB  . LEU A 1 138 ? 6.558   17.894 3.356   1.00 48.63  ? 487 LEU A CB  1 
ATOM   990  C CG  . LEU A 1 138 ? 7.245   19.200 2.958   1.00 48.95  ? 487 LEU A CG  1 
ATOM   991  C CD1 . LEU A 1 138 ? 8.546   19.324 3.704   1.00 50.02  ? 487 LEU A CD1 1 
ATOM   992  C CD2 . LEU A 1 138 ? 7.501   19.248 1.472   1.00 52.97  ? 487 LEU A CD2 1 
ATOM   993  N N   . ALA A 1 139 ? 4.307   15.663 3.488   1.00 50.28  ? 488 ALA A N   1 
ATOM   994  C CA  . ALA A 1 139 ? 3.937   14.263 3.333   1.00 48.30  ? 488 ALA A CA  1 
ATOM   995  C C   . ALA A 1 139 ? 2.874   14.173 2.285   1.00 47.44  ? 488 ALA A C   1 
ATOM   996  O O   . ALA A 1 139 ? 2.918   13.287 1.436   1.00 49.46  ? 488 ALA A O   1 
ATOM   997  C CB  . ALA A 1 139 ? 3.421   13.709 4.644   1.00 50.41  ? 488 ALA A CB  1 
ATOM   998  N N   . PHE A 1 140 ? 1.900   15.079 2.368   1.00 44.45  ? 489 PHE A N   1 
ATOM   999  C CA  . PHE A 1 140 ? 0.827   15.125 1.372   1.00 47.17  ? 489 PHE A CA  1 
ATOM   1000 C C   . PHE A 1 140 ? 1.350   15.430 -0.036  1.00 47.02  ? 489 PHE A C   1 
ATOM   1001 O O   . PHE A 1 140 ? 0.813   14.944 -1.031  1.00 47.01  ? 489 PHE A O   1 
ATOM   1002 C CB  . PHE A 1 140 ? -0.206  16.165 1.786   1.00 48.37  ? 489 PHE A CB  1 
ATOM   1003 C CG  . PHE A 1 140 ? -1.339  16.352 0.798   1.00 46.87  ? 489 PHE A CG  1 
ATOM   1004 C CD1 . PHE A 1 140 ? -2.301  15.384 0.634   1.00 46.40  ? 489 PHE A CD1 1 
ATOM   1005 C CD2 . PHE A 1 140 ? -1.457  17.522 0.075   1.00 47.01  ? 489 PHE A CD2 1 
ATOM   1006 C CE1 . PHE A 1 140 ? -3.346  15.572 -0.252  1.00 45.82  ? 489 PHE A CE1 1 
ATOM   1007 C CE2 . PHE A 1 140 ? -2.501  17.722 -0.811  1.00 47.14  ? 489 PHE A CE2 1 
ATOM   1008 C CZ  . PHE A 1 140 ? -3.442  16.739 -0.975  1.00 46.79  ? 489 PHE A CZ  1 
ATOM   1009 N N   . SER A 1 141 ? 2.393   16.249 -0.102  1.00 46.59  ? 490 SER A N   1 
ATOM   1010 C CA  . SER A 1 141 ? 2.958   16.663 -1.366  1.00 44.20  ? 490 SER A CA  1 
ATOM   1011 C C   . SER A 1 141 ? 3.521   15.455 -2.073  1.00 46.60  ? 490 SER A C   1 
ATOM   1012 O O   . SER A 1 141 ? 3.289   15.263 -3.267  1.00 46.37  ? 490 SER A O   1 
ATOM   1013 C CB  . SER A 1 141 ? 4.060   17.691 -1.133  1.00 41.52  ? 490 SER A CB  1 
ATOM   1014 O OG  . SER A 1 141 ? 4.620   18.095 -2.363  1.00 40.56  ? 490 SER A OG  1 
ATOM   1015 N N   . ARG A 1 142 ? 4.290   14.668 -1.330  1.00 47.47  ? 491 ARG A N   1 
ATOM   1016 C CA  . ARG A 1 142 ? 4.753   13.370 -1.787  1.00 48.76  ? 491 ARG A CA  1 
ATOM   1017 C C   . ARG A 1 142 ? 3.599   12.574 -2.362  1.00 49.15  ? 491 ARG A C   1 
ATOM   1018 O O   . ARG A 1 142 ? 3.611   12.170 -3.524  1.00 50.06  ? 491 ARG A O   1 
ATOM   1019 C CB  . ARG A 1 142 ? 5.352   12.598 -0.598  1.00 53.61  ? 491 ARG A CB  1 
ATOM   1020 C CG  . ARG A 1 142 ? 6.822   12.868 -0.389  1.00 54.42  ? 491 ARG A CG  1 
ATOM   1021 C CD  . ARG A 1 142 ? 7.331   12.411 0.994   1.00 56.31  ? 491 ARG A CD  1 
ATOM   1022 N NE  . ARG A 1 142 ? 8.427   13.301 1.406   1.00 61.49  ? 491 ARG A NE  1 
ATOM   1023 C CZ  . ARG A 1 142 ? 8.513   13.979 2.550   1.00 63.11  ? 491 ARG A CZ  1 
ATOM   1024 N NH1 . ARG A 1 142 ? 7.597   13.853 3.519   1.00 66.36  ? 491 ARG A NH1 1 
ATOM   1025 N NH2 . ARG A 1 142 ? 9.567   14.774 2.736   1.00 60.53  ? 491 ARG A NH2 1 
ATOM   1026 N N   . SER A 1 143 ? 2.585   12.347 -1.539  1.00 51.83  ? 492 SER A N   1 
ATOM   1027 C CA  . SER A 1 143 ? 1.491   11.460 -1.952  1.00 55.49  ? 492 SER A CA  1 
ATOM   1028 C C   . SER A 1 143 ? 0.679   12.026 -3.118  1.00 52.04  ? 492 SER A C   1 
ATOM   1029 O O   . SER A 1 143 ? 0.178   11.274 -3.928  1.00 56.60  ? 492 SER A O   1 
ATOM   1030 C CB  . SER A 1 143 ? 0.599   11.068 -0.770  1.00 53.67  ? 492 SER A CB  1 
ATOM   1031 O OG  . SER A 1 143 ? -0.385  12.019 -0.521  1.00 55.50  ? 492 SER A OG  1 
ATOM   1032 N N   . LEU A 1 144 ? 0.587   13.345 -3.215  1.00 50.31  ? 493 LEU A N   1 
ATOM   1033 C CA  . LEU A 1 144 ? -0.046  13.992 -4.361  1.00 48.28  ? 493 LEU A CA  1 
ATOM   1034 C C   . LEU A 1 144 ? 0.755   13.749 -5.599  1.00 49.30  ? 493 LEU A C   1 
ATOM   1035 O O   . LEU A 1 144 ? 0.235   13.386 -6.616  1.00 45.80  ? 493 LEU A O   1 
ATOM   1036 C CB  . LEU A 1 144 ? -0.122  15.501 -4.154  1.00 49.25  ? 493 LEU A CB  1 
ATOM   1037 C CG  . LEU A 1 144 ? -0.827  16.332 -5.233  1.00 50.46  ? 493 LEU A CG  1 
ATOM   1038 C CD1 . LEU A 1 144 ? -2.210  15.784 -5.530  1.00 51.50  ? 493 LEU A CD1 1 
ATOM   1039 C CD2 . LEU A 1 144 ? -0.935  17.790 -4.809  1.00 50.41  ? 493 LEU A CD2 1 
ATOM   1040 N N   . HIS A 1 145 ? 2.049   13.997 -5.499  1.00 58.29  ? 494 HIS A N   1 
ATOM   1041 C CA  . HIS A 1 145 ? 2.942   13.877 -6.638  1.00 55.44  ? 494 HIS A CA  1 
ATOM   1042 C C   . HIS A 1 145 ? 2.940   12.479 -7.195  1.00 55.27  ? 494 HIS A C   1 
ATOM   1043 O O   . HIS A 1 145 ? 3.206   12.303 -8.372  1.00 56.82  ? 494 HIS A O   1 
ATOM   1044 C CB  . HIS A 1 145 ? 4.366   14.269 -6.251  1.00 54.95  ? 494 HIS A CB  1 
ATOM   1045 C CG  . HIS A 1 145 ? 4.590   15.744 -6.193  1.00 55.62  ? 494 HIS A CG  1 
ATOM   1046 N ND1 . HIS A 1 145 ? 5.578   16.321 -5.423  1.00 59.41  ? 494 HIS A ND1 1 
ATOM   1047 C CD2 . HIS A 1 145 ? 3.957   16.765 -6.816  1.00 57.68  ? 494 HIS A CD2 1 
ATOM   1048 C CE1 . HIS A 1 145 ? 5.537   17.634 -5.566  1.00 57.62  ? 494 HIS A CE1 1 
ATOM   1049 N NE2 . HIS A 1 145 ? 4.559   17.930 -6.401  1.00 57.94  ? 494 HIS A NE2 1 
ATOM   1050 N N   . SER A 1 146 ? 2.646   11.487 -6.365  1.00 55.83  ? 495 SER A N   1 
ATOM   1051 C CA  . SER A 1 146 ? 2.712   10.102 -6.820  1.00 61.25  ? 495 SER A CA  1 
ATOM   1052 C C   . SER A 1 146 ? 1.585   9.739  -7.794  1.00 59.13  ? 495 SER A C   1 
ATOM   1053 O O   . SER A 1 146 ? 1.823   8.996  -8.734  1.00 61.78  ? 495 SER A O   1 
ATOM   1054 C CB  . SER A 1 146 ? 2.794   9.130  -5.630  1.00 64.20  ? 495 SER A CB  1 
ATOM   1055 O OG  . SER A 1 146 ? 1.545   9.007  -4.972  1.00 66.19  ? 495 SER A OG  1 
ATOM   1056 N N   . LEU A 1 147 ? 0.384   10.281 -7.594  1.00 61.72  ? 496 LEU A N   1 
ATOM   1057 C CA  . LEU A 1 147 ? -0.650  10.264 -8.667  1.00 63.86  ? 496 LEU A CA  1 
ATOM   1058 C C   . LEU A 1 147 ? -0.110  11.352 -9.520  1.00 67.13  ? 496 LEU A C   1 
ATOM   1059 O O   . LEU A 1 147 ? 0.403   12.311 -8.971  1.00 95.09  ? 496 LEU A O   1 
ATOM   1060 C CB  . LEU A 1 147 ? -2.027  10.703 -8.213  1.00 61.99  ? 496 LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 147 ? -2.414  10.282 -6.785  1.00 65.10  ? 496 LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 147 ? -3.254  11.318 -6.051  1.00 67.31  ? 496 LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 147 ? -3.143  8.958  -6.872  1.00 67.25  ? 496 LEU A CD2 1 
ATOM   1064 N N   . LEU A 1 148 ? -0.170  11.265 -10.828 1.00 60.26  ? 497 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 148 ? 0.638   12.214 -11.585 1.00 62.29  ? 497 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 148 ? -0.306  13.169 -12.256 1.00 62.53  ? 497 LEU A C   1 
ATOM   1067 O O   . LEU A 1 148 ? -0.737  12.909 -13.356 1.00 72.69  ? 497 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 148 ? 1.533   11.455 -12.572 1.00 68.14  ? 497 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 148 ? 2.379   10.351 -11.895 1.00 68.05  ? 497 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 148 ? 2.039   8.955  -12.429 1.00 63.96  ? 497 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 148 ? 3.870   10.651 -11.992 1.00 63.44  ? 497 LEU A CD2 1 
ATOM   1072 N N   . VAL A 1 149 ? -0.659  14.261 -11.581 1.00 60.78  ? 498 VAL A N   1 
ATOM   1073 C CA  . VAL A 1 149 ? -1.763  15.115 -12.028 1.00 57.38  ? 498 VAL A CA  1 
ATOM   1074 C C   . VAL A 1 149 ? -1.257  16.257 -12.898 1.00 58.14  ? 498 VAL A C   1 
ATOM   1075 O O   . VAL A 1 149 ? -0.551  17.163 -12.428 1.00 46.99  ? 498 VAL A O   1 
ATOM   1076 C CB  . VAL A 1 149 ? -2.542  15.693 -10.831 1.00 57.12  ? 498 VAL A CB  1 
ATOM   1077 C CG1 . VAL A 1 149 ? -3.590  16.705 -11.283 1.00 55.45  ? 498 VAL A CG1 1 
ATOM   1078 C CG2 . VAL A 1 149 ? -3.207  14.574 -10.040 1.00 59.25  ? 498 VAL A CG2 1 
ATOM   1079 N N   . ASP A 1 150 ? -1.646  16.223 -14.169 1.00 60.39  ? 499 ASP A N   1 
ATOM   1080 C CA  . ASP A 1 150 ? -1.174  17.220 -15.104 1.00 61.24  ? 499 ASP A CA  1 
ATOM   1081 C C   . ASP A 1 150 ? -1.840  18.563 -14.870 1.00 58.33  ? 499 ASP A C   1 
ATOM   1082 O O   . ASP A 1 150 ? -2.937  18.676 -14.337 1.00 60.58  ? 499 ASP A O   1 
ATOM   1083 C CB  . ASP A 1 150 ? -1.384  16.769 -16.540 1.00 68.18  ? 499 ASP A CB  1 
ATOM   1084 C CG  . ASP A 1 150 ? -2.822  16.450 -16.828 1.00 75.62  ? 499 ASP A CG  1 
ATOM   1085 O OD1 . ASP A 1 150 ? -3.543  17.385 -17.197 1.00 83.36  ? 499 ASP A OD1 1 
ATOM   1086 O OD2 . ASP A 1 150 ? -3.243  15.282 -16.667 1.00 80.17  ? 499 ASP A OD2 1 
ATOM   1087 N N   . VAL A 1 151 ? -1.158  19.592 -15.317 1.00 58.20  ? 500 VAL A N   1 
ATOM   1088 C CA  . VAL A 1 151 ? -1.527  20.951 -14.978 1.00 55.67  ? 500 VAL A CA  1 
ATOM   1089 C C   . VAL A 1 151 ? -2.979  21.295 -15.283 1.00 52.08  ? 500 VAL A C   1 
ATOM   1090 O O   . VAL A 1 151 ? -3.642  21.881 -14.453 1.00 49.12  ? 500 VAL A O   1 
ATOM   1091 C CB  . VAL A 1 151 ? -0.552  21.954 -15.621 1.00 53.66  ? 500 VAL A CB  1 
ATOM   1092 C CG1 . VAL A 1 151 ? -1.045  23.390 -15.483 1.00 54.37  ? 500 VAL A CG1 1 
ATOM   1093 C CG2 . VAL A 1 151 ? 0.800   21.803 -14.951 1.00 54.45  ? 500 VAL A CG2 1 
ATOM   1094 N N   . PRO A 1 152 ? -3.478  20.929 -16.464 1.00 57.34  ? 501 PRO A N   1 
ATOM   1095 C CA  . PRO A 1 152 ? -4.894  21.215 -16.719 1.00 55.95  ? 501 PRO A CA  1 
ATOM   1096 C C   . PRO A 1 152 ? -5.827  20.526 -15.720 1.00 48.42  ? 501 PRO A C   1 
ATOM   1097 O O   . PRO A 1 152 ? -6.714  21.181 -15.180 1.00 42.99  ? 501 PRO A O   1 
ATOM   1098 C CB  . PRO A 1 152 ? -5.116  20.687 -18.140 1.00 59.35  ? 501 PRO A CB  1 
ATOM   1099 C CG  . PRO A 1 152 ? -3.760  20.651 -18.753 1.00 60.42  ? 501 PRO A CG  1 
ATOM   1100 C CD  . PRO A 1 152 ? -2.823  20.319 -17.632 1.00 60.39  ? 501 PRO A CD  1 
ATOM   1101 N N   . ALA A 1 153 ? -5.608  19.239 -15.449 1.00 44.91  ? 502 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 153 ? -6.370  18.549 -14.399 1.00 45.64  ? 502 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 153 ? -6.281  19.263 -13.045 1.00 45.68  ? 502 ALA A C   1 
ATOM   1104 O O   . ALA A 1 153 ? -7.281  19.386 -12.342 1.00 46.16  ? 502 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 153 ? -5.925  17.107 -14.250 1.00 44.14  ? 502 ALA A CB  1 
ATOM   1106 N N   . PHE A 1 154 ? -5.096  19.758 -12.701 1.00 45.08  ? 503 PHE A N   1 
ATOM   1107 C CA  . PHE A 1 154 ? -4.951  20.510 -11.477 1.00 41.14  ? 503 PHE A CA  1 
ATOM   1108 C C   . PHE A 1 154 ? -5.679  21.836 -11.549 1.00 42.07  ? 503 PHE A C   1 
ATOM   1109 O O   . PHE A 1 154 ? -6.221  22.296 -10.546 1.00 47.03  ? 503 PHE A O   1 
ATOM   1110 C CB  . PHE A 1 154 ? -3.480  20.753 -11.126 1.00 39.23  ? 503 PHE A CB  1 
ATOM   1111 C CG  . PHE A 1 154 ? -3.290  21.314 -9.733  1.00 35.99  ? 503 PHE A CG  1 
ATOM   1112 C CD1 . PHE A 1 154 ? -3.229  20.487 -8.609  1.00 32.03  ? 503 PHE A CD1 1 
ATOM   1113 C CD2 . PHE A 1 154 ? -3.241  22.679 -9.552  1.00 35.40  ? 503 PHE A CD2 1 
ATOM   1114 C CE1 . PHE A 1 154 ? -3.109  21.019 -7.327  1.00 31.78  ? 503 PHE A CE1 1 
ATOM   1115 C CE2 . PHE A 1 154 ? -3.114  23.210 -8.299  1.00 33.49  ? 503 PHE A CE2 1 
ATOM   1116 C CZ  . PHE A 1 154 ? -3.047  22.384 -7.178  1.00 32.15  ? 503 PHE A CZ  1 
ATOM   1117 N N   . ALA A 1 155 ? -5.661  22.475 -12.711 1.00 42.91  ? 504 ALA A N   1 
ATOM   1118 C CA  . ALA A 1 155 ? -6.266  23.792 -12.859 1.00 45.24  ? 504 ALA A CA  1 
ATOM   1119 C C   . ALA A 1 155 ? -7.768  23.639 -12.671 1.00 45.56  ? 504 ALA A C   1 
ATOM   1120 O O   . ALA A 1 155 ? -8.435  24.550 -12.178 1.00 43.57  ? 504 ALA A O   1 
ATOM   1121 C CB  . ALA A 1 155 ? -5.932  24.421 -14.217 1.00 46.30  ? 504 ALA A CB  1 
ATOM   1122 N N   . CYS A 1 156 ? -8.294  22.479 -13.041 1.00 45.85  ? 505 CYS A N   1 
ATOM   1123 C CA  . CYS A 1 156 ? -9.713  22.202 -12.848 1.00 50.80  ? 505 CYS A CA  1 
ATOM   1124 C C   . CYS A 1 156 ? -10.023 21.870 -11.401 1.00 49.89  ? 505 CYS A C   1 
ATOM   1125 O O   . CYS A 1 156 ? -10.962 22.402 -10.810 1.00 53.12  ? 505 CYS A O   1 
ATOM   1126 C CB  . CYS A 1 156 ? -10.154 21.053 -13.746 1.00 54.56  ? 505 CYS A CB  1 
ATOM   1127 S SG  . CYS A 1 156 ? -10.136 21.534 -15.480 1.00 62.39  ? 505 CYS A SG  1 
ATOM   1128 N N   . LEU A 1 157 ? -9.231  20.988 -10.826 1.00 49.11  ? 506 LEU A N   1 
ATOM   1129 C CA  . LEU A 1 157 ? -9.447  20.586 -9.447  1.00 49.00  ? 506 LEU A CA  1 
ATOM   1130 C C   . LEU A 1 157 ? -9.359  21.720 -8.478  1.00 43.94  ? 506 LEU A C   1 
ATOM   1131 O O   . LEU A 1 157 ? -10.166 21.813 -7.608  1.00 45.20  ? 506 LEU A O   1 
ATOM   1132 C CB  . LEU A 1 157 ? -8.442  19.512 -9.077  1.00 56.94  ? 506 LEU A CB  1 
ATOM   1133 C CG  . LEU A 1 157 ? -8.919  18.188 -9.703  1.00 60.67  ? 506 LEU A CG  1 
ATOM   1134 C CD1 . LEU A 1 157 ? -7.797  17.218 -10.038 1.00 60.07  ? 506 LEU A CD1 1 
ATOM   1135 C CD2 . LEU A 1 157 ? -9.954  17.518 -8.813  1.00 65.72  ? 506 LEU A CD2 1 
ATOM   1136 N N   . SER A 1 158 ? -8.389  22.600 -8.635  1.00 46.02  ? 507 SER A N   1 
ATOM   1137 C CA  . SER A 1 158 ? -8.243  23.715 -7.713  1.00 47.40  ? 507 SER A CA  1 
ATOM   1138 C C   . SER A 1 158 ? -9.509  24.562 -7.776  1.00 45.86  ? 507 SER A C   1 
ATOM   1139 O O   . SER A 1 158 ? -10.029 25.017 -6.760  1.00 42.91  ? 507 SER A O   1 
ATOM   1140 C CB  . SER A 1 158 ? -6.984  24.551 -8.026  1.00 47.01  ? 507 SER A CB  1 
ATOM   1141 O OG  . SER A 1 158 ? -6.851  24.825 -9.406  1.00 47.85  ? 507 SER A OG  1 
ATOM   1142 N N   . ALA A 1 159 ? -9.999  24.782 -8.986  1.00 44.12  ? 508 ALA A N   1 
ATOM   1143 C CA  . ALA A 1 159 ? -11.189 25.591 -9.175  1.00 44.24  ? 508 ALA A CA  1 
ATOM   1144 C C   . ALA A 1 159 ? -12.363 24.917 -8.504  1.00 40.41  ? 508 ALA A C   1 
ATOM   1145 O O   . ALA A 1 159 ? -13.215 25.580 -7.917  1.00 38.61  ? 508 ALA A O   1 
ATOM   1146 C CB  . ALA A 1 159 ? -11.472 25.766 -10.657 1.00 47.73  ? 508 ALA A CB  1 
ATOM   1147 N N   . LEU A 1 160 ? -12.403 23.593 -8.595  1.00 37.36  ? 509 LEU A N   1 
ATOM   1148 C CA  . LEU A 1 160 ? -13.483 22.831 -7.983  1.00 38.96  ? 509 LEU A CA  1 
ATOM   1149 C C   . LEU A 1 160 ? -13.515 22.893 -6.458  1.00 40.00  ? 509 LEU A C   1 
ATOM   1150 O O   . LEU A 1 160 ? -14.558 22.731 -5.843  1.00 48.52  ? 509 LEU A O   1 
ATOM   1151 C CB  . LEU A 1 160 ? -13.416 21.394 -8.440  1.00 40.38  ? 509 LEU A CB  1 
ATOM   1152 C CG  . LEU A 1 160 ? -14.051 21.252 -9.814  1.00 45.20  ? 509 LEU A CG  1 
ATOM   1153 C CD1 . LEU A 1 160 ? -13.636 19.949 -10.484 1.00 46.49  ? 509 LEU A CD1 1 
ATOM   1154 C CD2 . LEU A 1 160 ? -15.580 21.346 -9.707  1.00 47.94  ? 509 LEU A CD2 1 
ATOM   1155 N N   . VAL A 1 161 ? -12.366 23.123 -5.853  1.00 41.11  ? 510 VAL A N   1 
ATOM   1156 C CA  . VAL A 1 161 ? -12.251 23.241 -4.424  1.00 39.63  ? 510 VAL A CA  1 
ATOM   1157 C C   . VAL A 1 161 ? -12.917 24.537 -4.047  1.00 37.34  ? 510 VAL A C   1 
ATOM   1158 O O   . VAL A 1 161 ? -13.554 24.630 -3.017  1.00 40.85  ? 510 VAL A O   1 
ATOM   1159 C CB  . VAL A 1 161 ? -10.744 23.238 -3.993  1.00 39.29  ? 510 VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 161 ? -10.564 23.735 -2.566  1.00 40.98  ? 510 VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 161 ? -10.131 21.854 -4.154  1.00 35.36  ? 510 VAL A CG2 1 
ATOM   1162 N N   . LEU A 1 162 ? -12.736 25.552 -4.872  1.00 37.08  ? 511 LEU A N   1 
ATOM   1163 C CA  . LEU A 1 162 ? -13.253 26.893 -4.575  1.00 39.81  ? 511 LEU A CA  1 
ATOM   1164 C C   . LEU A 1 162 ? -14.758 26.973 -4.838  1.00 42.38  ? 511 LEU A C   1 
ATOM   1165 O O   . LEU A 1 162 ? -15.517 27.493 -4.026  1.00 37.86  ? 511 LEU A O   1 
ATOM   1166 C CB  . LEU A 1 162 ? -12.543 27.915 -5.481  1.00 37.93  ? 511 LEU A CB  1 
ATOM   1167 C CG  . LEU A 1 162 ? -13.035 29.349 -5.454  1.00 34.77  ? 511 LEU A CG  1 
ATOM   1168 C CD1 . LEU A 1 162 ? -12.756 29.934 -4.077  1.00 36.54  ? 511 LEU A CD1 1 
ATOM   1169 C CD2 . LEU A 1 162 ? -12.368 30.153 -6.552  1.00 33.24  ? 511 LEU A CD2 1 
ATOM   1170 N N   . ILE A 1 163 ? -15.139 26.487 -6.021  1.00 43.48  ? 512 ILE A N   1 
ATOM   1171 C CA  . ILE A 1 163 ? -16.466 26.657 -6.567  1.00 47.66  ? 512 ILE A CA  1 
ATOM   1172 C C   . ILE A 1 163 ? -17.251 25.425 -6.164  1.00 50.47  ? 512 ILE A C   1 
ATOM   1173 O O   . ILE A 1 163 ? -17.219 24.401 -6.849  1.00 52.39  ? 512 ILE A O   1 
ATOM   1174 C CB  . ILE A 1 163 ? -16.479 26.666 -8.120  1.00 46.85  ? 512 ILE A CB  1 
ATOM   1175 C CG1 . ILE A 1 163 ? -15.445 27.579 -8.767  1.00 47.79  ? 512 ILE A CG1 1 
ATOM   1176 C CG2 . ILE A 1 163 ? -17.875 26.939 -8.640  1.00 49.27  ? 512 ILE A CG2 1 
ATOM   1177 C CD1 . ILE A 1 163 ? -15.744 29.042 -8.770  1.00 49.93  ? 512 ILE A CD1 1 
ATOM   1178 N N   . THR A 1 164 ? -17.975 25.528 -5.069  1.00 48.52  ? 513 THR A N   1 
ATOM   1179 C CA  . THR A 1 164 ? -18.571 24.366 -4.466  1.00 47.52  ? 513 THR A CA  1 
ATOM   1180 C C   . THR A 1 164 ? -19.628 24.853 -3.491  1.00 47.75  ? 513 THR A C   1 
ATOM   1181 O O   . THR A 1 164 ? -19.596 26.010 -3.062  1.00 47.43  ? 513 THR A O   1 
ATOM   1182 C CB  . THR A 1 164 ? -17.501 23.572 -3.710  1.00 46.53  ? 513 THR A CB  1 
ATOM   1183 O OG1 . THR A 1 164 ? -18.031 22.310 -3.318  1.00 50.89  ? 513 THR A OG1 1 
ATOM   1184 C CG2 . THR A 1 164 ? -17.054 24.314 -2.455  1.00 49.61  ? 513 THR A CG2 1 
ATOM   1185 N N   . ASP A 1 165 ? -20.545 23.979 -3.119  1.00 44.87  ? 514 ASP A N   1 
ATOM   1186 C CA  . ASP A 1 165 ? -21.550 24.357 -2.158  1.00 48.30  ? 514 ASP A CA  1 
ATOM   1187 C C   . ASP A 1 165 ? -20.933 24.757 -0.824  1.00 46.15  ? 514 ASP A C   1 
ATOM   1188 O O   . ASP A 1 165 ? -20.123 24.026 -0.279  1.00 45.99  ? 514 ASP A O   1 
ATOM   1189 C CB  . ASP A 1 165 ? -22.543 23.199 -1.963  1.00 51.65  ? 514 ASP A CB  1 
ATOM   1190 C CG  . ASP A 1 165 ? -23.606 23.170 -3.053  1.00 52.81  ? 514 ASP A CG  1 
ATOM   1191 O OD1 . ASP A 1 165 ? -24.381 24.150 -3.184  1.00 61.80  ? 514 ASP A OD1 1 
ATOM   1192 O OD2 . ASP A 1 165 ? -23.654 22.198 -3.803  1.00 47.65  ? 514 ASP A OD2 1 
ATOM   1193 N N   . ARG A 1 166 ? -21.307 25.930 -0.324  1.00 47.05  ? 515 ARG A N   1 
ATOM   1194 C CA  . ARG A 1 166 ? -21.006 26.332 1.052   1.00 51.37  ? 515 ARG A CA  1 
ATOM   1195 C C   . ARG A 1 166 ? -22.296 26.834 1.681   1.00 53.91  ? 515 ARG A C   1 
ATOM   1196 O O   . ARG A 1 166 ? -23.149 27.429 1.017   1.00 55.26  ? 515 ARG A O   1 
ATOM   1197 C CB  . ARG A 1 166 ? -19.968 27.467 1.156   1.00 51.24  ? 515 ARG A CB  1 
ATOM   1198 C CG  . ARG A 1 166 ? -18.621 27.250 0.479   1.00 52.99  ? 515 ARG A CG  1 
ATOM   1199 C CD  . ARG A 1 166 ? -17.890 26.028 0.990   1.00 54.16  ? 515 ARG A CD  1 
ATOM   1200 N NE  . ARG A 1 166 ? -16.524 25.925 0.493   1.00 51.96  ? 515 ARG A NE  1 
ATOM   1201 C CZ  . ARG A 1 166 ? -15.650 25.030 0.927   1.00 57.35  ? 515 ARG A CZ  1 
ATOM   1202 N NH1 . ARG A 1 166 ? -15.994 24.147 1.849   1.00 60.01  ? 515 ARG A NH1 1 
ATOM   1203 N NH2 . ARG A 1 166 ? -14.416 25.011 0.449   1.00 66.31  ? 515 ARG A NH2 1 
ATOM   1204 N N   . HIS A 1 167 ? -22.415 26.624 2.977   1.00 51.51  ? 516 HIS A N   1 
ATOM   1205 C CA  . HIS A 1 167 ? -23.535 27.129 3.696   1.00 52.86  ? 516 HIS A CA  1 
ATOM   1206 C C   . HIS A 1 167 ? -23.494 28.654 3.729   1.00 55.46  ? 516 HIS A C   1 
ATOM   1207 O O   . HIS A 1 167 ? -22.492 29.248 4.143   1.00 62.40  ? 516 HIS A O   1 
ATOM   1208 C CB  . HIS A 1 167 ? -23.522 26.592 5.114   1.00 55.96  ? 516 HIS A CB  1 
ATOM   1209 C CG  . HIS A 1 167 ? -24.662 27.081 5.945   1.00 61.61  ? 516 HIS A CG  1 
ATOM   1210 N ND1 . HIS A 1 167 ? -24.645 28.297 6.594   1.00 64.90  ? 516 HIS A ND1 1 
ATOM   1211 C CD2 . HIS A 1 167 ? -25.863 26.527 6.216   1.00 64.68  ? 516 HIS A CD2 1 
ATOM   1212 C CE1 . HIS A 1 167 ? -25.776 28.461 7.255   1.00 63.76  ? 516 HIS A CE1 1 
ATOM   1213 N NE2 . HIS A 1 167 ? -26.531 27.400 7.042   1.00 69.81  ? 516 HIS A NE2 1 
ATOM   1214 N N   . GLY A 1 168 ? -24.592 29.283 3.329   1.00 55.01  ? 517 GLY A N   1 
ATOM   1215 C CA  . GLY A 1 168 ? -24.720 30.752 3.384   1.00 56.58  ? 517 GLY A CA  1 
ATOM   1216 C C   . GLY A 1 168 ? -24.677 31.450 2.035   1.00 54.25  ? 517 GLY A C   1 
ATOM   1217 O O   . GLY A 1 168 ? -24.839 32.661 1.947   1.00 47.41  ? 517 GLY A O   1 
ATOM   1218 N N   . LEU A 1 169 ? -24.455 30.677 0.978   1.00 57.13  ? 518 LEU A N   1 
ATOM   1219 C CA  . LEU A 1 169 ? -24.446 31.228 -0.365  1.00 54.83  ? 518 LEU A CA  1 
ATOM   1220 C C   . LEU A 1 169 ? -25.786 31.887 -0.680  1.00 56.61  ? 518 LEU A C   1 
ATOM   1221 O O   . LEU A 1 169 ? -26.849 31.334 -0.391  1.00 52.83  ? 518 LEU A O   1 
ATOM   1222 C CB  . LEU A 1 169 ? -24.167 30.134 -1.407  1.00 51.21  ? 518 LEU A CB  1 
ATOM   1223 C CG  . LEU A 1 169 ? -22.741 29.653 -1.604  1.00 48.40  ? 518 LEU A CG  1 
ATOM   1224 C CD1 . LEU A 1 169 ? -22.725 28.561 -2.664  1.00 46.28  ? 518 LEU A CD1 1 
ATOM   1225 C CD2 . LEU A 1 169 ? -21.836 30.809 -2.009  1.00 50.98  ? 518 LEU A CD2 1 
ATOM   1226 N N   . GLN A 1 170 ? -25.710 33.055 -1.307  1.00 58.02  ? 519 GLN A N   1 
ATOM   1227 C CA  . GLN A 1 170 ? -26.886 33.727 -1.841  1.00 56.65  ? 519 GLN A CA  1 
ATOM   1228 C C   . GLN A 1 170 ? -27.409 33.088 -3.107  1.00 54.78  ? 519 GLN A C   1 
ATOM   1229 O O   . GLN A 1 170 ? -28.594 33.002 -3.278  1.00 61.10  ? 519 GLN A O   1 
ATOM   1230 C CB  . GLN A 1 170 ? -26.580 35.186 -2.131  1.00 56.26  ? 519 GLN A CB  1 
ATOM   1231 C CG  . GLN A 1 170 ? -26.350 36.007 -0.876  1.00 55.44  ? 519 GLN A CG  1 
ATOM   1232 C CD  . GLN A 1 170 ? -25.827 37.391 -1.198  1.00 53.87  ? 519 GLN A CD  1 
ATOM   1233 O OE1 . GLN A 1 170 ? -25.594 37.731 -2.354  1.00 53.03  ? 519 GLN A OE1 1 
ATOM   1234 N NE2 . GLN A 1 170 ? -25.645 38.189 -0.181  1.00 52.17  ? 519 GLN A NE2 1 
ATOM   1235 N N   . GLU A 1 171 ? -26.541 32.648 -4.002  1.00 57.38  ? 520 GLU A N   1 
ATOM   1236 C CA  . GLU A 1 171 ? -27.005 32.084 -5.250  1.00 58.46  ? 520 GLU A CA  1 
ATOM   1237 C C   . GLU A 1 171 ? -26.407 30.678 -5.449  1.00 58.40  ? 520 GLU A C   1 
ATOM   1238 O O   . GLU A 1 171 ? -25.701 30.410 -6.414  1.00 54.52  ? 520 GLU A O   1 
ATOM   1239 C CB  . GLU A 1 171 ? -26.677 33.045 -6.396  1.00 64.45  ? 520 GLU A CB  1 
ATOM   1240 C CG  . GLU A 1 171 ? -27.269 34.439 -6.175  1.00 70.90  ? 520 GLU A CG  1 
ATOM   1241 C CD  . GLU A 1 171 ? -27.144 35.412 -7.349  1.00 83.95  ? 520 GLU A CD  1 
ATOM   1242 O OE1 . GLU A 1 171 ? -26.275 36.329 -7.329  1.00 82.95  ? 520 GLU A OE1 1 
ATOM   1243 O OE2 . GLU A 1 171 ? -27.957 35.289 -8.295  1.00 102.23 ? 520 GLU A OE2 1 
ATOM   1244 N N   . PRO A 1 172 ? -26.729 29.756 -4.537  1.00 57.90  ? 521 PRO A N   1 
ATOM   1245 C CA  . PRO A 1 172 ? -26.196 28.396 -4.599  1.00 57.55  ? 521 PRO A CA  1 
ATOM   1246 C C   . PRO A 1 172 ? -26.229 27.748 -5.979  1.00 59.57  ? 521 PRO A C   1 
ATOM   1247 O O   . PRO A 1 172 ? -25.338 26.970 -6.305  1.00 69.90  ? 521 PRO A O   1 
ATOM   1248 C CB  . PRO A 1 172 ? -27.122 27.614 -3.660  1.00 59.45  ? 521 PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 172 ? -27.678 28.625 -2.718  1.00 60.51  ? 521 PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 172 ? -27.642 29.957 -3.395  1.00 56.53  ? 521 PRO A CD  1 
ATOM   1251 N N   . ARG A 1 173 ? -27.260 28.032 -6.765  1.00 60.38  ? 522 ARG A N   1 
ATOM   1252 C CA  . ARG A 1 173 ? -27.483 27.337 -8.038  1.00 63.87  ? 522 ARG A CA  1 
ATOM   1253 C C   . ARG A 1 173 ? -26.524 27.787 -9.154  1.00 59.29  ? 522 ARG A C   1 
ATOM   1254 O O   . ARG A 1 173 ? -26.108 26.972 -10.004 1.00 47.56  ? 522 ARG A O   1 
ATOM   1255 C CB  . ARG A 1 173 ? -28.933 27.548 -8.503  1.00 73.08  ? 522 ARG A CB  1 
ATOM   1256 C CG  . ARG A 1 173 ? -30.012 27.310 -7.437  1.00 77.23  ? 522 ARG A CG  1 
ATOM   1257 C CD  . ARG A 1 173 ? -30.137 25.838 -7.070  1.00 81.40  ? 522 ARG A CD  1 
ATOM   1258 N NE  . ARG A 1 173 ? -30.360 24.992 -8.238  1.00 82.76  ? 522 ARG A NE  1 
ATOM   1259 C CZ  . ARG A 1 173 ? -31.556 24.763 -8.779  1.00 82.18  ? 522 ARG A CZ  1 
ATOM   1260 N NH1 . ARG A 1 173 ? -31.670 23.955 -9.838  1.00 79.41  ? 522 ARG A NH1 1 
ATOM   1261 N NH2 . ARG A 1 173 ? -32.648 25.315 -8.262  1.00 80.33  ? 522 ARG A NH2 1 
ATOM   1262 N N   . ARG A 1 174 ? -26.187 29.080 -9.147  1.00 58.26  ? 523 ARG A N   1 
ATOM   1263 C CA  . ARG A 1 174 ? -25.202 29.635 -10.099 1.00 61.21  ? 523 ARG A CA  1 
ATOM   1264 C C   . ARG A 1 174 ? -23.841 29.020 -9.853  1.00 57.77  ? 523 ARG A C   1 
ATOM   1265 O O   . ARG A 1 174 ? -23.067 28.773 -10.784 1.00 64.18  ? 523 ARG A O   1 
ATOM   1266 C CB  . ARG A 1 174 ? -25.065 31.162 -9.964  1.00 58.45  ? 523 ARG A CB  1 
ATOM   1267 C CG  . ARG A 1 174 ? -26.306 32.008 -10.222 1.00 56.81  ? 523 ARG A CG  1 
ATOM   1268 C CD  . ARG A 1 174 ? -26.015 33.507 -10.164 1.00 56.99  ? 523 ARG A CD  1 
ATOM   1269 N NE  . ARG A 1 174 ? -24.983 33.927 -11.104 1.00 58.52  ? 523 ARG A NE  1 
ATOM   1270 C CZ  . ARG A 1 174 ? -24.302 35.075 -11.001 1.00 60.95  ? 523 ARG A CZ  1 
ATOM   1271 N NH1 . ARG A 1 174 ? -23.366 35.349 -11.892 1.00 63.71  ? 523 ARG A NH1 1 
ATOM   1272 N NH2 . ARG A 1 174 ? -24.525 35.949 -10.008 1.00 60.23  ? 523 ARG A NH2 1 
ATOM   1273 N N   . VAL A 1 175 ? -23.553 28.809 -8.574  1.00 53.05  ? 524 VAL A N   1 
ATOM   1274 C CA  . VAL A 1 175 ? -22.324 28.194 -8.140  1.00 47.40  ? 524 VAL A CA  1 
ATOM   1275 C C   . VAL A 1 175 ? -22.327 26.742 -8.592  1.00 48.11  ? 524 VAL A C   1 
ATOM   1276 O O   . VAL A 1 175 ? -21.344 26.271 -9.147  1.00 51.67  ? 524 VAL A O   1 
ATOM   1277 C CB  . VAL A 1 175 ? -22.180 28.334 -6.627  1.00 46.79  ? 524 VAL A CB  1 
ATOM   1278 C CG1 . VAL A 1 175 ? -21.066 27.465 -6.102  1.00 54.29  ? 524 VAL A CG1 1 
ATOM   1279 C CG2 . VAL A 1 175 ? -21.900 29.777 -6.264  1.00 46.52  ? 524 VAL A CG2 1 
ATOM   1280 N N   . GLU A 1 176 ? -23.429 26.035 -8.373  1.00 48.17  ? 525 GLU A N   1 
ATOM   1281 C CA  . GLU A 1 176 ? -23.525 24.632 -8.793  1.00 49.07  ? 525 GLU A CA  1 
ATOM   1282 C C   . GLU A 1 176 ? -23.433 24.500 -10.288 1.00 51.63  ? 525 GLU A C   1 
ATOM   1283 O O   . GLU A 1 176 ? -22.946 23.496 -10.803 1.00 47.53  ? 525 GLU A O   1 
ATOM   1284 C CB  . GLU A 1 176 ? -24.829 24.011 -8.326  1.00 50.45  ? 525 GLU A CB  1 
ATOM   1285 C CG  . GLU A 1 176 ? -24.793 23.708 -6.846  1.00 54.80  ? 525 GLU A CG  1 
ATOM   1286 C CD  . GLU A 1 176 ? -26.121 23.343 -6.253  1.00 57.01  ? 525 GLU A CD  1 
ATOM   1287 O OE1 . GLU A 1 176 ? -27.099 23.108 -7.014  1.00 69.45  ? 525 GLU A OE1 1 
ATOM   1288 O OE2 . GLU A 1 176 ? -26.177 23.315 -5.003  1.00 53.62  ? 525 GLU A OE2 1 
ATOM   1289 N N   . GLU A 1 177 ? -23.930 25.504 -10.997 1.00 55.58  ? 526 GLU A N   1 
ATOM   1290 C CA  . GLU A 1 177 ? -23.852 25.476 -12.450 1.00 61.51  ? 526 GLU A CA  1 
ATOM   1291 C C   . GLU A 1 177 ? -22.420 25.578 -12.880 1.00 56.65  ? 526 GLU A C   1 
ATOM   1292 O O   . GLU A 1 177 ? -21.960 24.829 -13.737 1.00 55.66  ? 526 GLU A O   1 
ATOM   1293 C CB  . GLU A 1 177 ? -24.656 26.643 -13.036 1.00 68.53  ? 526 GLU A CB  1 
ATOM   1294 C CG  . GLU A 1 177 ? -24.532 26.903 -14.523 1.00 69.43  ? 526 GLU A CG  1 
ATOM   1295 C CD  . GLU A 1 177 ? -24.927 25.713 -15.376 1.00 82.27  ? 526 GLU A CD  1 
ATOM   1296 O OE1 . GLU A 1 177 ? -25.646 24.809 -14.889 1.00 88.03  ? 526 GLU A OE1 1 
ATOM   1297 O OE2 . GLU A 1 177 ? -24.514 25.675 -16.549 1.00 94.10  ? 526 GLU A OE2 1 
ATOM   1298 N N   . LEU A 1 178 ? -21.737 26.534 -12.272 1.00 53.45  ? 527 LEU A N   1 
ATOM   1299 C CA  . LEU A 1 178 ? -20.357 26.797 -12.569 1.00 48.61  ? 527 LEU A CA  1 
ATOM   1300 C C   . LEU A 1 178 ? -19.496 25.596 -12.193 1.00 49.22  ? 527 LEU A C   1 
ATOM   1301 O O   . LEU A 1 178 ? -18.613 25.214 -12.942 1.00 51.67  ? 527 LEU A O   1 
ATOM   1302 C CB  . LEU A 1 178 ? -19.944 28.029 -11.816 1.00 47.94  ? 527 LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 178 ? -18.579 28.571 -12.165 1.00 53.79  ? 527 LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 178 ? -18.353 28.669 -13.663 1.00 56.23  ? 527 LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 178 ? -18.403 29.940 -11.511 1.00 56.11  ? 527 LEU A CD2 1 
ATOM   1306 N N   . GLN A 1 179 ? -19.797 24.966 -11.066 1.00 49.63  ? 528 GLN A N   1 
ATOM   1307 C CA  . GLN A 1 179 ? -19.283 23.622 -10.765 1.00 53.70  ? 528 GLN A CA  1 
ATOM   1308 C C   . GLN A 1 179 ? -19.446 22.669 -11.912 1.00 54.21  ? 528 GLN A C   1 
ATOM   1309 O O   . GLN A 1 179 ? -18.467 22.029 -12.320 1.00 65.69  ? 528 GLN A O   1 
ATOM   1310 C CB  . GLN A 1 179 ? -20.046 22.972 -9.613  1.00 58.60  ? 528 GLN A CB  1 
ATOM   1311 C CG  . GLN A 1 179 ? -19.344 22.851 -8.285  1.00 64.67  ? 528 GLN A CG  1 
ATOM   1312 C CD  . GLN A 1 179 ? -19.894 21.683 -7.469  1.00 63.31  ? 528 GLN A CD  1 
ATOM   1313 O OE1 . GLN A 1 179 ? -21.084 21.423 -7.465  1.00 58.25  ? 528 GLN A OE1 1 
ATOM   1314 N NE2 . GLN A 1 179 ? -19.026 21.007 -6.756  1.00 72.16  ? 528 GLN A NE2 1 
ATOM   1315 N N   . ASN A 1 180 ? -20.679 22.522 -12.394 1.00 52.98  ? 529 ASN A N   1 
ATOM   1316 C CA  . ASN A 1 180 ? -20.981 21.511 -13.415 1.00 57.49  ? 529 ASN A CA  1 
ATOM   1317 C C   . ASN A 1 180 ? -20.128 21.787 -14.639 1.00 55.86  ? 529 ASN A C   1 
ATOM   1318 O O   . ASN A 1 180 ? -19.553 20.872 -15.208 1.00 50.74  ? 529 ASN A O   1 
ATOM   1319 C CB  . ASN A 1 180 ? -22.471 21.527 -13.848 1.00 60.03  ? 529 ASN A CB  1 
ATOM   1320 C CG  . ASN A 1 180 ? -23.440 21.005 -12.782 1.00 57.04  ? 529 ASN A CG  1 
ATOM   1321 O OD1 . ASN A 1 180 ? -23.106 20.141 -11.971 1.00 59.73  ? 529 ASN A OD1 1 
ATOM   1322 N ND2 . ASN A 1 180 ? -24.663 21.512 -12.817 1.00 50.49  ? 529 ASN A ND2 1 
ATOM   1323 N N   . ARG A 1 181 ? -20.043 23.051 -15.030 1.00 55.45  ? 530 ARG A N   1 
ATOM   1324 C CA  . ARG A 1 181 ? -19.232 23.430 -16.184 1.00 63.62  ? 530 ARG A CA  1 
ATOM   1325 C C   . ARG A 1 181 ? -17.786 22.989 -16.050 1.00 64.33  ? 530 ARG A C   1 
ATOM   1326 O O   . ARG A 1 181 ? -17.213 22.410 -16.979 1.00 68.31  ? 530 ARG A O   1 
ATOM   1327 C CB  . ARG A 1 181 ? -19.266 24.944 -16.389 1.00 68.13  ? 530 ARG A CB  1 
ATOM   1328 C CG  . ARG A 1 181 ? -20.304 25.369 -17.396 1.00 78.40  ? 530 ARG A CG  1 
ATOM   1329 C CD  . ARG A 1 181 ? -20.652 26.824 -17.293 1.00 92.70  ? 530 ARG A CD  1 
ATOM   1330 N NE  . ARG A 1 181 ? -21.728 27.143 -18.226 1.00 112.27 ? 530 ARG A NE  1 
ATOM   1331 C CZ  . ARG A 1 181 ? -22.478 28.244 -18.180 1.00 131.67 ? 530 ARG A CZ  1 
ATOM   1332 N NH1 . ARG A 1 181 ? -23.420 28.432 -19.099 1.00 141.89 ? 530 ARG A NH1 1 
ATOM   1333 N NH2 . ARG A 1 181 ? -22.303 29.154 -17.221 1.00 133.24 ? 530 ARG A NH2 1 
ATOM   1334 N N   . ILE A 1 182 ? -17.210 23.258 -14.883 1.00 61.31  ? 531 ILE A N   1 
ATOM   1335 C CA  . ILE A 1 182 ? -15.800 22.967 -14.632 1.00 55.74  ? 531 ILE A CA  1 
ATOM   1336 C C   . ILE A 1 182 ? -15.563 21.474 -14.530 1.00 50.01  ? 531 ILE A C   1 
ATOM   1337 O O   . ILE A 1 182 ? -14.532 20.977 -14.955 1.00 48.31  ? 531 ILE A O   1 
ATOM   1338 C CB  . ILE A 1 182 ? -15.285 23.673 -13.363 1.00 51.85  ? 531 ILE A CB  1 
ATOM   1339 C CG1 . ILE A 1 182 ? -15.348 25.175 -13.568 1.00 50.10  ? 531 ILE A CG1 1 
ATOM   1340 C CG2 . ILE A 1 182 ? -13.844 23.280 -13.080 1.00 49.54  ? 531 ILE A CG2 1 
ATOM   1341 C CD1 . ILE A 1 182 ? -15.237 25.950 -12.282 1.00 51.55  ? 531 ILE A CD1 1 
ATOM   1342 N N   . ALA A 1 183 ? -16.524 20.761 -13.972 1.00 48.50  ? 532 ALA A N   1 
ATOM   1343 C CA  . ALA A 1 183 ? -16.419 19.313 -13.926 1.00 51.64  ? 532 ALA A CA  1 
ATOM   1344 C C   . ALA A 1 183 ? -16.454 18.678 -15.319 1.00 53.31  ? 532 ALA A C   1 
ATOM   1345 O O   . ALA A 1 183 ? -15.756 17.714 -15.558 1.00 60.17  ? 532 ALA A O   1 
ATOM   1346 C CB  . ALA A 1 183 ? -17.512 18.737 -13.053 1.00 50.63  ? 532 ALA A CB  1 
ATOM   1347 N N   . SER A 1 184 ? -17.268 19.205 -16.229 1.00 56.67  ? 533 SER A N   1 
ATOM   1348 C CA  . SER A 1 184 ? -17.324 18.691 -17.596 1.00 55.65  ? 533 SER A CA  1 
ATOM   1349 C C   . SER A 1 184 ? -15.979 18.908 -18.232 1.00 55.86  ? 533 SER A C   1 
ATOM   1350 O O   . SER A 1 184 ? -15.437 18.033 -18.909 1.00 61.41  ? 533 SER A O   1 
ATOM   1351 C CB  . SER A 1 184 ? -18.348 19.455 -18.428 1.00 57.38  ? 533 SER A CB  1 
ATOM   1352 O OG  . SER A 1 184 ? -19.618 19.443 -17.814 1.00 60.90  ? 533 SER A OG  1 
ATOM   1353 N N   . CYS A 1 185 ? -15.466 20.111 -18.035 1.00 54.08  ? 534 CYS A N   1 
ATOM   1354 C CA  . CYS A 1 185 ? -14.193 20.511 -18.592 1.00 56.07  ? 534 CYS A CA  1 
ATOM   1355 C C   . CYS A 1 185 ? -13.107 19.494 -18.227 1.00 57.84  ? 534 CYS A C   1 
ATOM   1356 O O   . CYS A 1 185 ? -12.328 19.026 -19.076 1.00 61.03  ? 534 CYS A O   1 
ATOM   1357 C CB  . CYS A 1 185 ? -13.847 21.875 -18.024 1.00 54.86  ? 534 CYS A CB  1 
ATOM   1358 S SG  . CYS A 1 185 ? -12.402 22.617 -18.748 1.00 65.13  ? 534 CYS A SG  1 
ATOM   1359 N N   . LEU A 1 186 ? -13.080 19.155 -16.946 1.00 54.09  ? 535 LEU A N   1 
ATOM   1360 C CA  . LEU A 1 186 ? -12.116 18.233 -16.429 1.00 53.85  ? 535 LEU A CA  1 
ATOM   1361 C C   . LEU A 1 186 ? -12.316 16.876 -17.091 1.00 54.21  ? 535 LEU A C   1 
ATOM   1362 O O   . LEU A 1 186 ? -11.352 16.262 -17.548 1.00 58.69  ? 535 LEU A O   1 
ATOM   1363 C CB  . LEU A 1 186 ? -12.242 18.147 -14.900 1.00 55.38  ? 535 LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 186 ? -11.349 17.130 -14.172 1.00 58.27  ? 535 LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 186 ? -9.873  17.339 -14.486 1.00 62.25  ? 535 LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 186 ? -11.562 17.201 -12.674 1.00 57.42  ? 535 LEU A CD2 1 
ATOM   1367 N N   . LYS A 1 187 ? -13.562 16.416 -17.120 1.00 56.68  ? 536 LYS A N   1 
ATOM   1368 C CA  . LYS A 1 187 ? -13.931 15.135 -17.724 1.00 63.03  ? 536 LYS A CA  1 
ATOM   1369 C C   . LYS A 1 187 ? -13.420 15.003 -19.147 1.00 63.52  ? 536 LYS A C   1 
ATOM   1370 O O   . LYS A 1 187 ? -12.834 13.982 -19.500 1.00 64.83  ? 536 LYS A O   1 
ATOM   1371 C CB  . LYS A 1 187 ? -15.455 14.947 -17.730 1.00 65.45  ? 536 LYS A CB  1 
ATOM   1372 C CG  . LYS A 1 187 ? -15.943 13.514 -18.003 1.00 72.33  ? 536 LYS A CG  1 
ATOM   1373 C CD  . LYS A 1 187 ? -17.277 13.506 -18.777 1.00 74.24  ? 536 LYS A CD  1 
ATOM   1374 C CE  . LYS A 1 187 ? -18.339 12.508 -18.266 1.00 74.82  ? 536 LYS A CE  1 
ATOM   1375 N NZ  . LYS A 1 187 ? -17.960 11.083 -17.988 1.00 72.34  ? 536 LYS A NZ  1 
ATOM   1376 N N   . GLU A 1 188 ? -13.658 16.023 -19.961 1.00 67.12  ? 537 GLU A N   1 
ATOM   1377 C CA  . GLU A 1 188 ? -13.252 15.981 -21.363 1.00 74.46  ? 537 GLU A CA  1 
ATOM   1378 C C   . GLU A 1 188 ? -11.760 15.959 -21.443 1.00 70.92  ? 537 GLU A C   1 
ATOM   1379 O O   . GLU A 1 188 ? -11.205 15.194 -22.221 1.00 75.57  ? 537 GLU A O   1 
ATOM   1380 C CB  . GLU A 1 188 ? -13.812 17.161 -22.166 1.00 85.00  ? 537 GLU A CB  1 
ATOM   1381 C CG  . GLU A 1 188 ? -15.285 16.982 -22.532 1.00 93.68  ? 537 GLU A CG  1 
ATOM   1382 C CD  . GLU A 1 188 ? -16.055 18.293 -22.583 1.00 98.48  ? 537 GLU A CD  1 
ATOM   1383 O OE1 . GLU A 1 188 ? -15.490 19.293 -23.077 1.00 104.87 ? 537 GLU A OE1 1 
ATOM   1384 O OE2 . GLU A 1 188 ? -17.222 18.324 -22.116 1.00 97.56  ? 537 GLU A OE2 1 
ATOM   1385 N N   . HIS A 1 189 ? -11.104 16.769 -20.619 1.00 71.72  ? 538 HIS A N   1 
ATOM   1386 C CA  . HIS A 1 189 ? -9.651  16.731 -20.578 1.00 71.32  ? 538 HIS A CA  1 
ATOM   1387 C C   . HIS A 1 189 ? -9.079  15.374 -20.189 1.00 71.41  ? 538 HIS A C   1 
ATOM   1388 O O   . HIS A 1 189 ? -8.118  14.920 -20.790 1.00 74.19  ? 538 HIS A O   1 
ATOM   1389 C CB  . HIS A 1 189 ? -9.071  17.752 -19.626 1.00 70.40  ? 538 HIS A CB  1 
ATOM   1390 C CG  . HIS A 1 189 ? -7.595  17.599 -19.457 1.00 68.42  ? 538 HIS A CG  1 
ATOM   1391 N ND1 . HIS A 1 189 ? -6.688  18.048 -20.394 1.00 65.99  ? 538 HIS A ND1 1 
ATOM   1392 C CD2 . HIS A 1 189 ? -6.872  16.984 -18.496 1.00 68.70  ? 538 HIS A CD2 1 
ATOM   1393 C CE1 . HIS A 1 189 ? -5.466  17.749 -19.996 1.00 65.65  ? 538 HIS A CE1 1 
ATOM   1394 N NE2 . HIS A 1 189 ? -5.551  17.099 -18.849 1.00 69.13  ? 538 HIS A NE2 1 
ATOM   1395 N N   . VAL A 1 190 ? -9.648  14.734 -19.178 1.00 71.73  ? 539 VAL A N   1 
ATOM   1396 C CA  . VAL A 1 190 ? -9.178  13.420 -18.773 1.00 73.64  ? 539 VAL A CA  1 
ATOM   1397 C C   . VAL A 1 190 ? -9.359  12.372 -19.884 1.00 79.03  ? 539 VAL A C   1 
ATOM   1398 O O   . VAL A 1 190 ? -8.499  11.501 -20.061 1.00 93.84  ? 539 VAL A O   1 
ATOM   1399 C CB  . VAL A 1 190 ? -9.875  12.979 -17.469 1.00 75.01  ? 539 VAL A CB  1 
ATOM   1400 C CG1 . VAL A 1 190 ? -10.030 11.457 -17.378 1.00 78.50  ? 539 VAL A CG1 1 
ATOM   1401 C CG2 . VAL A 1 190 ? -9.117  13.540 -16.270 1.00 75.62  ? 539 VAL A CG2 1 
ATOM   1402 N N   . ALA A 1 191 ? -10.461 12.463 -20.625 1.00 79.58  ? 540 ALA A N   1 
ATOM   1403 C CA  . ALA A 1 191 ? -10.718 11.590 -21.780 1.00 75.78  ? 540 ALA A CA  1 
ATOM   1404 C C   . ALA A 1 191 ? -9.784  11.884 -22.968 1.00 70.74  ? 540 ALA A C   1 
ATOM   1405 O O   . ALA A 1 191 ? -9.256  10.957 -23.582 1.00 67.60  ? 540 ALA A O   1 
ATOM   1406 C CB  . ALA A 1 191 ? -12.173 11.703 -22.207 1.00 72.49  ? 540 ALA A CB  1 
ATOM   1407 N N   . ALA A 1 192 ? -9.594  13.167 -23.276 1.00 65.49  ? 541 ALA A N   1 
ATOM   1408 C CA  . ALA A 1 192 ? -8.598  13.613 -24.261 1.00 67.08  ? 541 ALA A CA  1 
ATOM   1409 C C   . ALA A 1 192 ? -7.200  12.979 -24.061 1.00 68.69  ? 541 ALA A C   1 
ATOM   1410 O O   . ALA A 1 192 ? -6.584  12.497 -25.008 1.00 66.82  ? 541 ALA A O   1 
ATOM   1411 C CB  . ALA A 1 192 ? -8.484  15.133 -24.238 1.00 65.96  ? 541 ALA A CB  1 
ATOM   1412 N N   . VAL A 1 193 ? -6.720  12.977 -22.824 1.00 70.62  ? 542 VAL A N   1 
ATOM   1413 C CA  . VAL A 1 193 ? -5.475  12.282 -22.457 1.00 73.57  ? 542 VAL A CA  1 
ATOM   1414 C C   . VAL A 1 193 ? -5.498  10.748 -22.614 1.00 75.05  ? 542 VAL A C   1 
ATOM   1415 O O   . VAL A 1 193 ? -4.576  10.197 -23.210 1.00 72.84  ? 542 VAL A O   1 
ATOM   1416 C CB  . VAL A 1 193 ? -5.044  12.660 -21.018 1.00 71.56  ? 542 VAL A CB  1 
ATOM   1417 C CG1 . VAL A 1 193 ? -3.952  11.736 -20.485 1.00 68.64  ? 542 VAL A CG1 1 
ATOM   1418 C CG2 . VAL A 1 193 ? -4.583  14.113 -21.001 1.00 70.29  ? 542 VAL A CG2 1 
ATOM   1419 N N   . ALA A 1 194 ? -6.506  10.062 -22.074 1.00 79.26  ? 543 ALA A N   1 
ATOM   1420 C CA  . ALA A 1 194 ? -6.555  8.585  -22.150 1.00 88.50  ? 543 ALA A CA  1 
ATOM   1421 C C   . ALA A 1 194 ? -7.787  8.092  -22.910 1.00 88.95  ? 543 ALA A C   1 
ATOM   1422 O O   . ALA A 1 194 ? -7.785  8.052  -24.142 1.00 93.34  ? 543 ALA A O   1 
ATOM   1423 C CB  . ALA A 1 194 ? -6.495  7.961  -20.753 1.00 87.80  ? 543 ALA A CB  1 
ATOM   1424 N N   . GLU A 1 196 ? -12.171 7.841  -22.290 1.00 118.23 ? 545 GLU A N   1 
ATOM   1425 C CA  . GLU A 1 196 ? -13.613 7.812  -22.034 1.00 126.87 ? 545 GLU A CA  1 
ATOM   1426 C C   . GLU A 1 196 ? -13.830 7.086  -20.684 1.00 140.09 ? 545 GLU A C   1 
ATOM   1427 O O   . GLU A 1 196 ? -13.508 5.902  -20.579 1.00 157.35 ? 545 GLU A O   1 
ATOM   1428 C CB  . GLU A 1 196 ? -14.364 7.120  -23.191 1.00 116.37 ? 545 GLU A CB  1 
ATOM   1429 C CG  . GLU A 1 196 ? -13.505 6.764  -24.402 1.00 117.38 ? 545 GLU A CG  1 
ATOM   1430 C CD  . GLU A 1 196 ? -12.561 7.884  -24.835 1.00 124.67 ? 545 GLU A CD  1 
ATOM   1431 O OE1 . GLU A 1 196 ? -13.062 8.981  -25.164 1.00 116.55 ? 545 GLU A OE1 1 
ATOM   1432 O OE2 . GLU A 1 196 ? -11.318 7.672  -24.848 1.00 117.19 ? 545 GLU A OE2 1 
ATOM   1433 N N   . PRO A 1 197 ? -14.352 7.790  -19.645 1.00 140.07 ? 546 PRO A N   1 
ATOM   1434 C CA  . PRO A 1 197 ? -14.269 7.297  -18.262 1.00 128.37 ? 546 PRO A CA  1 
ATOM   1435 C C   . PRO A 1 197 ? -15.504 6.630  -17.683 1.00 107.96 ? 546 PRO A C   1 
ATOM   1436 O O   . PRO A 1 197 ? -15.494 6.316  -16.488 1.00 81.67  ? 546 PRO A O   1 
ATOM   1437 C CB  . PRO A 1 197 ? -14.021 8.583  -17.475 1.00 144.11 ? 546 PRO A CB  1 
ATOM   1438 C CG  . PRO A 1 197 ? -14.707 9.648  -18.263 1.00 148.37 ? 546 PRO A CG  1 
ATOM   1439 C CD  . PRO A 1 197 ? -14.922 9.150  -19.671 1.00 146.88 ? 546 PRO A CD  1 
ATOM   1440 N N   . PRO A 1 199 ? -15.942 8.548  -14.235 1.00 101.80 ? 548 PRO A N   1 
ATOM   1441 C CA  . PRO A 1 199 ? -15.460 8.910  -12.893 1.00 104.89 ? 548 PRO A CA  1 
ATOM   1442 C C   . PRO A 1 199 ? -14.829 7.719  -12.147 1.00 101.94 ? 548 PRO A C   1 
ATOM   1443 O O   . PRO A 1 199 ? -15.564 7.053  -11.398 1.00 90.21  ? 548 PRO A O   1 
ATOM   1444 C CB  . PRO A 1 199 ? -16.746 9.381  -12.170 1.00 95.23  ? 548 PRO A CB  1 
ATOM   1445 C CG  . PRO A 1 199 ? -17.828 9.430  -13.215 1.00 93.70  ? 548 PRO A CG  1 
ATOM   1446 C CD  . PRO A 1 199 ? -17.193 9.244  -14.564 1.00 95.21  ? 548 PRO A CD  1 
ATOM   1447 N N   . ALA A 1 200 ? -13.527 7.414  -12.314 1.00 94.93  ? 549 ALA A N   1 
ATOM   1448 C CA  . ALA A 1 200 ? -12.473 8.216  -12.996 1.00 89.94  ? 549 ALA A CA  1 
ATOM   1449 C C   . ALA A 1 200 ? -12.859 8.978  -14.263 1.00 88.16  ? 549 ALA A C   1 
ATOM   1450 O O   . ALA A 1 200 ? -12.264 10.020 -14.580 1.00 79.73  ? 549 ALA A O   1 
ATOM   1451 C CB  . ALA A 1 200 ? -11.272 7.314  -13.296 1.00 89.89  ? 549 ALA A CB  1 
ATOM   1452 N N   . LEU A 1 203 ? -9.642  9.007  -10.974 1.00 108.95 ? 552 LEU A N   1 
ATOM   1453 C CA  . LEU A 1 203 ? -10.285 9.991  -10.113 1.00 106.00 ? 552 LEU A CA  1 
ATOM   1454 C C   . LEU A 1 203 ? -10.496 9.529  -8.666  1.00 103.83 ? 552 LEU A C   1 
ATOM   1455 O O   . LEU A 1 203 ? -10.318 10.306 -7.725  1.00 103.34 ? 552 LEU A O   1 
ATOM   1456 C CB  . LEU A 1 203 ? -11.633 10.369 -10.700 1.00 105.29 ? 552 LEU A CB  1 
ATOM   1457 C CG  . LEU A 1 203 ? -12.610 11.169 -9.834  1.00 116.95 ? 552 LEU A CG  1 
ATOM   1458 C CD1 . LEU A 1 203 ? -12.648 12.629 -10.281 1.00 108.68 ? 552 LEU A CD1 1 
ATOM   1459 C CD2 . LEU A 1 203 ? -13.995 10.511 -9.883  1.00 117.47 ? 552 LEU A CD2 1 
ATOM   1460 N N   . SER A 1 204 ? -10.904 8.283  -8.472  1.00 96.40  ? 553 SER A N   1 
ATOM   1461 C CA  . SER A 1 204 ? -11.213 7.840  -7.121  1.00 92.33  ? 553 SER A CA  1 
ATOM   1462 C C   . SER A 1 204 ? -9.948  7.660  -6.342  1.00 89.31  ? 553 SER A C   1 
ATOM   1463 O O   . SER A 1 204 ? -9.964  7.682  -5.112  1.00 83.30  ? 553 SER A O   1 
ATOM   1464 C CB  . SER A 1 204 ? -11.952 6.512  -7.132  1.00 90.76  ? 553 SER A CB  1 
ATOM   1465 O OG  . SER A 1 204 ? -13.080 6.588  -7.968  1.00 96.28  ? 553 SER A OG  1 
ATOM   1466 N N   . ARG A 1 205 ? -8.860  7.427  -7.072  1.00 92.30  ? 554 ARG A N   1 
ATOM   1467 C CA  . ARG A 1 205 ? -7.541  7.291  -6.462  1.00 91.19  ? 554 ARG A CA  1 
ATOM   1468 C C   . ARG A 1 205 ? -7.099  8.629  -5.873  1.00 79.53  ? 554 ARG A C   1 
ATOM   1469 O O   . ARG A 1 205 ? -6.513  8.693  -4.792  1.00 65.10  ? 554 ARG A O   1 
ATOM   1470 C CB  . ARG A 1 205 ? -6.525  6.773  -7.481  1.00 90.82  ? 554 ARG A CB  1 
ATOM   1471 C CG  . ARG A 1 205 ? -6.358  5.262  -7.427  1.00 96.48  ? 554 ARG A CG  1 
ATOM   1472 C CD  . ARG A 1 205 ? -5.403  4.877  -6.303  1.00 104.36 ? 554 ARG A CD  1 
ATOM   1473 N NE  . ARG A 1 205 ? -3.981  5.040  -6.663  1.00 116.07 ? 554 ARG A NE  1 
ATOM   1474 C CZ  . ARG A 1 205 ? -2.996  5.331  -5.800  1.00 124.61 ? 554 ARG A CZ  1 
ATOM   1475 N NH1 . ARG A 1 205 ? -3.237  5.528  -4.503  1.00 127.13 ? 554 ARG A NH1 1 
ATOM   1476 N NH2 . ARG A 1 205 ? -1.745  5.454  -6.243  1.00 125.74 ? 554 ARG A NH2 1 
ATOM   1477 N N   . LEU A 1 206 ? -7.420  9.688  -6.592  1.00 69.93  ? 555 LEU A N   1 
ATOM   1478 C CA  . LEU A 1 206 ? -7.161  11.023 -6.137  1.00 72.72  ? 555 LEU A CA  1 
ATOM   1479 C C   . LEU A 1 206 ? -8.034  11.439 -4.943  1.00 78.35  ? 555 LEU A C   1 
ATOM   1480 O O   . LEU A 1 206 ? -7.543  12.030 -3.975  1.00 81.27  ? 555 LEU A O   1 
ATOM   1481 C CB  . LEU A 1 206 ? -7.418  11.942 -7.308  1.00 69.77  ? 555 LEU A CB  1 
ATOM   1482 C CG  . LEU A 1 206 ? -7.061  13.386 -7.178  1.00 72.05  ? 555 LEU A CG  1 
ATOM   1483 C CD1 . LEU A 1 206 ? -5.559  13.498 -7.033  1.00 76.75  ? 555 LEU A CD1 1 
ATOM   1484 C CD2 . LEU A 1 206 ? -7.552  14.127 -8.405  1.00 72.10  ? 555 LEU A CD2 1 
ATOM   1485 N N   . LEU A 1 207 ? -9.329  11.149 -5.022  1.00 76.28  ? 556 LEU A N   1 
ATOM   1486 C CA  . LEU A 1 207 ? -10.250 11.449 -3.926  1.00 70.00  ? 556 LEU A CA  1 
ATOM   1487 C C   . LEU A 1 207 ? -9.912  10.674 -2.657  1.00 71.30  ? 556 LEU A C   1 
ATOM   1488 O O   . LEU A 1 207 ? -10.305 11.059 -1.552  1.00 70.57  ? 556 LEU A O   1 
ATOM   1489 C CB  . LEU A 1 207 ? -11.674 11.120 -4.340  1.00 74.79  ? 556 LEU A CB  1 
ATOM   1490 C CG  . LEU A 1 207 ? -12.322 11.992 -5.419  1.00 80.54  ? 556 LEU A CG  1 
ATOM   1491 C CD1 . LEU A 1 207 ? -13.821 11.712 -5.416  1.00 82.83  ? 556 LEU A CD1 1 
ATOM   1492 C CD2 . LEU A 1 207 ? -12.061 13.480 -5.216  1.00 76.03  ? 556 LEU A CD2 1 
ATOM   1493 N N   . GLY A 1 208 ? -9.205  9.558  -2.825  1.00 76.09  ? 557 GLY A N   1 
ATOM   1494 C CA  . GLY A 1 208 ? -8.697  8.777  -1.698  1.00 72.15  ? 557 GLY A CA  1 
ATOM   1495 C C   . GLY A 1 208 ? -7.735  9.579  -0.855  1.00 73.44  ? 557 GLY A C   1 
ATOM   1496 O O   . GLY A 1 208 ? -7.555  9.269  0.312   1.00 71.92  ? 557 GLY A O   1 
ATOM   1497 N N   . LYS A 1 209 ? -7.148  10.621 -1.461  1.00 77.19  ? 558 LYS A N   1 
ATOM   1498 C CA  . LYS A 1 209 ? -6.123  11.493 -0.860  1.00 76.77  ? 558 LYS A CA  1 
ATOM   1499 C C   . LYS A 1 209 ? -6.742  12.700 -0.145  1.00 72.66  ? 558 LYS A C   1 
ATOM   1500 O O   . LYS A 1 209 ? -6.067  13.460 0.551   1.00 80.61  ? 558 LYS A O   1 
ATOM   1501 C CB  . LYS A 1 209 ? -5.161  11.984 -1.961  1.00 77.74  ? 558 LYS A CB  1 
ATOM   1502 C CG  . LYS A 1 209 ? -3.873  11.181 -2.096  1.00 78.12  ? 558 LYS A CG  1 
ATOM   1503 C CD  . LYS A 1 209 ? -4.121  9.697  -2.314  1.00 85.02  ? 558 LYS A CD  1 
ATOM   1504 C CE  . LYS A 1 209 ? -2.829  8.896  -2.273  1.00 88.48  ? 558 LYS A CE  1 
ATOM   1505 N NZ  . LYS A 1 209 ? -2.320  8.747  -0.881  1.00 91.36  ? 558 LYS A NZ  1 
ATOM   1506 N N   . LEU A 1 210 ? -8.043  12.858 -0.316  1.00 70.73  ? 559 LEU A N   1 
ATOM   1507 C CA  . LEU A 1 210 ? -8.795  14.024 0.148   1.00 71.82  ? 559 LEU A CA  1 
ATOM   1508 C C   . LEU A 1 210 ? -9.037  14.144 1.675   1.00 68.04  ? 559 LEU A C   1 
ATOM   1509 O O   . LEU A 1 210 ? -9.126  15.259 2.178   1.00 64.00  ? 559 LEU A O   1 
ATOM   1510 C CB  . LEU A 1 210 ? -10.112 14.027 -0.590  1.00 71.74  ? 559 LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 210 ? -11.117 15.094 -0.286  1.00 76.76  ? 559 LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 210 ? -10.552 16.475 -0.536  1.00 82.90  ? 559 LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 210 ? -12.299 14.827 -1.183  1.00 81.57  ? 559 LEU A CD2 1 
ATOM   1514 N N   . PRO A 1 211 ? -9.204  13.015 2.391   1.00 63.71  ? 560 PRO A N   1 
ATOM   1515 C CA  . PRO A 1 211 ? -9.052  12.941 3.848   1.00 62.58  ? 560 PRO A CA  1 
ATOM   1516 C C   . PRO A 1 211 ? -7.738  13.497 4.394   1.00 67.35  ? 560 PRO A C   1 
ATOM   1517 O O   . PRO A 1 211 ? -7.728  14.135 5.435   1.00 70.87  ? 560 PRO A O   1 
ATOM   1518 C CB  . PRO A 1 211 ? -9.084  11.441 4.126   1.00 58.66  ? 560 PRO A CB  1 
ATOM   1519 C CG  . PRO A 1 211 ? -9.848  10.859 3.007   1.00 65.50  ? 560 PRO A CG  1 
ATOM   1520 C CD  . PRO A 1 211 ? -10.008 11.887 1.907   1.00 66.88  ? 560 PRO A CD  1 
ATOM   1521 N N   . GLU A 1 212 ? -6.628  13.242 3.716   1.00 71.33  ? 561 GLU A N   1 
ATOM   1522 C CA  . GLU A 1 212 ? -5.350  13.767 4.182   1.00 67.37  ? 561 GLU A CA  1 
ATOM   1523 C C   . GLU A 1 212 ? -5.438  15.285 4.140   1.00 66.11  ? 561 GLU A C   1 
ATOM   1524 O O   . GLU A 1 212 ? -4.992  15.969 5.061   1.00 70.37  ? 561 GLU A O   1 
ATOM   1525 C CB  . GLU A 1 212 ? -4.221  13.246 3.280   1.00 73.06  ? 561 GLU A CB  1 
ATOM   1526 C CG  . GLU A 1 212 ? -2.800  13.262 3.838   1.00 77.77  ? 561 GLU A CG  1 
ATOM   1527 C CD  . GLU A 1 212 ? -1.819  12.462 2.959   1.00 82.11  ? 561 GLU A CD  1 
ATOM   1528 O OE1 . GLU A 1 212 ? -2.287  11.687 2.068   1.00 75.64  ? 561 GLU A OE1 1 
ATOM   1529 O OE2 . GLU A 1 212 ? -0.580  12.608 3.160   1.00 69.00  ? 561 GLU A OE2 1 
ATOM   1530 N N   . LEU A 1 213 ? -6.076  15.802 3.093   1.00 55.87  ? 562 LEU A N   1 
ATOM   1531 C CA  . LEU A 1 213 ? -6.180  17.237 2.894   1.00 51.65  ? 562 LEU A CA  1 
ATOM   1532 C C   . LEU A 1 213 ? -7.091  17.894 3.893   1.00 50.98  ? 562 LEU A C   1 
ATOM   1533 O O   . LEU A 1 213 ? -6.835  18.991 4.333   1.00 55.17  ? 562 LEU A O   1 
ATOM   1534 C CB  . LEU A 1 213 ? -6.677  17.533 1.491   1.00 50.86  ? 562 LEU A CB  1 
ATOM   1535 C CG  . LEU A 1 213 ? -6.730  19.004 1.066   1.00 51.33  ? 562 LEU A CG  1 
ATOM   1536 C CD1 . LEU A 1 213 ? -5.380  19.706 1.082   1.00 50.96  ? 562 LEU A CD1 1 
ATOM   1537 C CD2 . LEU A 1 213 ? -7.320  19.065 -0.335  1.00 51.36  ? 562 LEU A CD2 1 
ATOM   1538 N N   . ARG A 1 214 ? -8.181  17.240 4.238   1.00 55.87  ? 563 ARG A N   1 
ATOM   1539 C CA  . ARG A 1 214 ? -9.103  17.811 5.207   1.00 58.19  ? 563 ARG A CA  1 
ATOM   1540 C C   . ARG A 1 214 ? -8.406  17.925 6.537   1.00 48.64  ? 563 ARG A C   1 
ATOM   1541 O O   . ARG A 1 214 ? -8.492  18.947 7.221   1.00 45.36  ? 563 ARG A O   1 
ATOM   1542 C CB  . ARG A 1 214 ? -10.368 16.954 5.344   1.00 65.69  ? 563 ARG A CB  1 
ATOM   1543 C CG  . ARG A 1 214 ? -11.344 17.166 4.187   1.00 74.03  ? 563 ARG A CG  1 
ATOM   1544 C CD  . ARG A 1 214 ? -12.753 16.641 4.471   1.00 80.48  ? 563 ARG A CD  1 
ATOM   1545 N NE  . ARG A 1 214 ? -13.384 16.084 3.267   1.00 86.78  ? 563 ARG A NE  1 
ATOM   1546 C CZ  . ARG A 1 214 ? -13.269 14.814 2.853   1.00 97.67  ? 563 ARG A CZ  1 
ATOM   1547 N NH1 . ARG A 1 214 ? -12.552 13.914 3.529   1.00 96.31  ? 563 ARG A NH1 1 
ATOM   1548 N NH2 . ARG A 1 214 ? -13.882 14.434 1.738   1.00 106.00 ? 563 ARG A NH2 1 
ATOM   1549 N N   . THR A 1 215 ? -7.713  16.859 6.882   1.00 42.68  ? 564 THR A N   1 
ATOM   1550 C CA  . THR A 1 215 ? -6.973  16.807 8.106   1.00 44.80  ? 564 THR A CA  1 
ATOM   1551 C C   . THR A 1 215 ? -5.970  17.921 8.196   1.00 44.70  ? 564 THR A C   1 
ATOM   1552 O O   . THR A 1 215 ? -5.794  18.513 9.243   1.00 45.85  ? 564 THR A O   1 
ATOM   1553 C CB  . THR A 1 215 ? -6.190  15.506 8.182   1.00 47.01  ? 564 THR A CB  1 
ATOM   1554 O OG1 . THR A 1 215 ? -7.069  14.434 7.845   1.00 52.09  ? 564 THR A OG1 1 
ATOM   1555 C CG2 . THR A 1 215 ? -5.625  15.301 9.577   1.00 47.04  ? 564 THR A CG2 1 
ATOM   1556 N N   . LEU A 1 216 ? -5.304  18.188 7.087   1.00 40.96  ? 565 LEU A N   1 
ATOM   1557 C CA  . LEU A 1 216 ? -4.322  19.240 7.031   1.00 37.49  ? 565 LEU A CA  1 
ATOM   1558 C C   . LEU A 1 216 ? -4.925  20.642 7.211   1.00 39.38  ? 565 LEU A C   1 
ATOM   1559 O O   . LEU A 1 216 ? -4.295  21.519 7.838   1.00 36.47  ? 565 LEU A O   1 
ATOM   1560 C CB  . LEU A 1 216 ? -3.625  19.136 5.691   1.00 38.97  ? 565 LEU A CB  1 
ATOM   1561 C CG  . LEU A 1 216 ? -2.554  18.051 5.507   1.00 38.74  ? 565 LEU A CG  1 
ATOM   1562 C CD1 . LEU A 1 216 ? -1.988  18.084 4.093   1.00 37.29  ? 565 LEU A CD1 1 
ATOM   1563 C CD2 . LEU A 1 216 ? -1.463  18.230 6.552   1.00 36.87  ? 565 LEU A CD2 1 
ATOM   1564 N N   . CYS A 1 217 ? -6.131  20.861 6.682   1.00 39.32  ? 566 CYS A N   1 
ATOM   1565 C CA  . CYS A 1 217 ? -6.848  22.090 6.993   1.00 42.81  ? 566 CYS A CA  1 
ATOM   1566 C C   . CYS A 1 217 ? -7.110  22.219 8.506   1.00 42.61  ? 566 CYS A C   1 
ATOM   1567 O O   . CYS A 1 217 ? -6.951  23.293 9.101   1.00 48.62  ? 566 CYS A O   1 
ATOM   1568 C CB  . CYS A 1 217 ? -8.152  22.091 6.266   1.00 44.70  ? 566 CYS A CB  1 
ATOM   1569 S SG  . CYS A 1 217 ? -7.990  21.844 4.485   1.00 52.60  ? 566 CYS A SG  1 
ATOM   1570 N N   . THR A 1 218 ? -7.440  21.119 9.149   1.00 37.30  ? 567 THR A N   1 
ATOM   1571 C CA  . THR A 1 218 ? -7.626  21.174 10.564  1.00 41.30  ? 567 THR A CA  1 
ATOM   1572 C C   . THR A 1 218 ? -6.360  21.591 11.288  1.00 46.32  ? 567 THR A C   1 
ATOM   1573 O O   . THR A 1 218 ? -6.400  22.495 12.117  1.00 50.11  ? 567 THR A O   1 
ATOM   1574 C CB  . THR A 1 218 ? -8.052  19.812 11.100  1.00 43.92  ? 567 THR A CB  1 
ATOM   1575 O OG1 . THR A 1 218 ? -9.305  19.479 10.526  1.00 42.88  ? 567 THR A OG1 1 
ATOM   1576 C CG2 . THR A 1 218 ? -8.189  19.832 12.612  1.00 44.72  ? 567 THR A CG2 1 
ATOM   1577 N N   . GLN A 1 219 ? -5.244  20.924 10.991  1.00 49.71  ? 568 GLN A N   1 
ATOM   1578 C CA  . GLN A 1 219 ? -3.942  21.318 11.527  1.00 51.92  ? 568 GLN A CA  1 
ATOM   1579 C C   . GLN A 1 219 ? -3.656  22.814 11.363  1.00 53.72  ? 568 GLN A C   1 
ATOM   1580 O O   . GLN A 1 219 ? -3.131  23.469 12.284  1.00 54.18  ? 568 GLN A O   1 
ATOM   1581 C CB  . GLN A 1 219 ? -2.839  20.597 10.816  1.00 52.13  ? 568 GLN A CB  1 
ATOM   1582 C CG  . GLN A 1 219 ? -2.837  19.110 11.003  1.00 57.09  ? 568 GLN A CG  1 
ATOM   1583 C CD  . GLN A 1 219 ? -1.458  18.543 10.682  1.00 58.99  ? 568 GLN A CD  1 
ATOM   1584 O OE1 . GLN A 1 219 ? -1.347  17.722 9.789   1.00 60.59  ? 568 GLN A OE1 1 
ATOM   1585 N NE2 . GLN A 1 219 ? -0.397  19.023 11.368  1.00 55.33  ? 568 GLN A NE2 1 
ATOM   1586 N N   . GLY A 1 220 ? -4.003  23.339 10.193  1.00 45.28  ? 569 GLY A N   1 
ATOM   1587 C CA  . GLY A 1 220 ? -3.855  24.745 9.949   1.00 44.77  ? 569 GLY A CA  1 
ATOM   1588 C C   . GLY A 1 220 ? -4.616  25.539 10.975  1.00 45.37  ? 569 GLY A C   1 
ATOM   1589 O O   . GLY A 1 220 ? -4.080  26.496 11.580  1.00 48.35  ? 569 GLY A O   1 
ATOM   1590 N N   . LEU A 1 221 ? -5.873  25.157 11.175  1.00 43.89  ? 570 LEU A N   1 
ATOM   1591 C CA  . LEU A 1 221 ? -6.736  25.886 12.116  1.00 43.40  ? 570 LEU A CA  1 
ATOM   1592 C C   . LEU A 1 221 ? -6.198  25.785 13.530  1.00 43.20  ? 570 LEU A C   1 
ATOM   1593 O O   . LEU A 1 221 ? -6.200  26.756 14.286  1.00 42.63  ? 570 LEU A O   1 
ATOM   1594 C CB  . LEU A 1 221 ? -8.167  25.371 12.056  1.00 41.71  ? 570 LEU A CB  1 
ATOM   1595 C CG  . LEU A 1 221 ? -8.936  25.725 10.779  1.00 41.21  ? 570 LEU A CG  1 
ATOM   1596 C CD1 . LEU A 1 221 ? -10.258 24.993 10.764  1.00 42.01  ? 570 LEU A CD1 1 
ATOM   1597 C CD2 . LEU A 1 221 ? -9.217  27.214 10.678  1.00 41.23  ? 570 LEU A CD2 1 
ATOM   1598 N N   . GLN A 1 222 ? -5.656  24.621 13.848  1.00 43.55  ? 571 GLN A N   1 
ATOM   1599 C CA  . GLN A 1 222 ? -5.126  24.381 15.169  1.00 45.72  ? 571 GLN A CA  1 
ATOM   1600 C C   . GLN A 1 222 ? -3.882  25.188 15.454  1.00 45.46  ? 571 GLN A C   1 
ATOM   1601 O O   . GLN A 1 222 ? -3.649  25.605 16.588  1.00 43.84  ? 571 GLN A O   1 
ATOM   1602 C CB  . GLN A 1 222 ? -4.748  22.938 15.296  1.00 49.30  ? 571 GLN A CB  1 
ATOM   1603 C CG  . GLN A 1 222 ? -5.883  21.978 15.068  1.00 52.16  ? 571 GLN A CG  1 
ATOM   1604 C CD  . GLN A 1 222 ? -5.540  20.628 15.603  1.00 54.87  ? 571 GLN A CD  1 
ATOM   1605 O OE1 . GLN A 1 222 ? -5.344  19.669 14.845  1.00 51.62  ? 571 GLN A OE1 1 
ATOM   1606 N NE2 . GLN A 1 222 ? -5.415  20.548 16.934  1.00 57.14  ? 571 GLN A NE2 1 
ATOM   1607 N N   . ARG A 1 223 ? -3.082  25.374 14.413  1.00 44.99  ? 572 ARG A N   1 
ATOM   1608 C CA  . ARG A 1 223 ? -1.869  26.138 14.517  1.00 44.86  ? 572 ARG A CA  1 
ATOM   1609 C C   . ARG A 1 223 ? -2.186  27.584 14.759  1.00 45.99  ? 572 ARG A C   1 
ATOM   1610 O O   . ARG A 1 223 ? -1.534  28.239 15.555  1.00 50.70  ? 572 ARG A O   1 
ATOM   1611 C CB  . ARG A 1 223 ? -1.051  26.016 13.235  1.00 46.12  ? 572 ARG A CB  1 
ATOM   1612 C CG  . ARG A 1 223 ? 0.293   26.726 13.282  1.00 47.52  ? 572 ARG A CG  1 
ATOM   1613 C CD  . ARG A 1 223 ? 1.201   26.078 14.332  1.00 49.19  ? 572 ARG A CD  1 
ATOM   1614 N NE  . ARG A 1 223 ? 2.463   26.779 14.475  1.00 48.53  ? 572 ARG A NE  1 
ATOM   1615 C CZ  . ARG A 1 223 ? 3.210   26.790 15.572  1.00 49.98  ? 572 ARG A CZ  1 
ATOM   1616 N NH1 . ARG A 1 223 ? 2.851   26.120 16.648  1.00 47.53  ? 572 ARG A NH1 1 
ATOM   1617 N NH2 . ARG A 1 223 ? 4.335   27.498 15.582  1.00 55.90  ? 572 ARG A NH2 1 
ATOM   1618 N N   . ILE A 1 224 ? -3.188  28.094 14.059  1.00 47.71  ? 573 ILE A N   1 
ATOM   1619 C CA  . ILE A 1 224 ? -3.554  29.503 14.184  1.00 44.18  ? 573 ILE A CA  1 
ATOM   1620 C C   . ILE A 1 224 ? -4.150  29.745 15.536  1.00 43.59  ? 573 ILE A C   1 
ATOM   1621 O O   . ILE A 1 224 ? -3.858  30.749 16.164  1.00 49.41  ? 573 ILE A O   1 
ATOM   1622 C CB  . ILE A 1 224 ? -4.566  29.912 13.120  1.00 42.98  ? 573 ILE A CB  1 
ATOM   1623 C CG1 . ILE A 1 224 ? -3.881  29.873 11.771  1.00 44.25  ? 573 ILE A CG1 1 
ATOM   1624 C CG2 . ILE A 1 224 ? -5.108  31.295 13.425  1.00 43.18  ? 573 ILE A CG2 1 
ATOM   1625 C CD1 . ILE A 1 224 ? -4.790  30.088 10.607  1.00 44.43  ? 573 ILE A CD1 1 
ATOM   1626 N N   . PHE A 1 225 ? -4.979  28.813 15.983  1.00 43.68  ? 574 PHE A N   1 
ATOM   1627 C CA  . PHE A 1 225 ? -5.503  28.865 17.320  1.00 45.41  ? 574 PHE A CA  1 
ATOM   1628 C C   . PHE A 1 225 ? -4.378  28.998 18.317  1.00 45.57  ? 574 PHE A C   1 
ATOM   1629 O O   . PHE A 1 225 ? -4.464  29.767 19.259  1.00 47.96  ? 574 PHE A O   1 
ATOM   1630 C CB  . PHE A 1 225 ? -6.279  27.597 17.634  1.00 49.77  ? 574 PHE A CB  1 
ATOM   1631 C CG  . PHE A 1 225 ? -6.734  27.521 19.051  1.00 50.90  ? 574 PHE A CG  1 
ATOM   1632 C CD1 . PHE A 1 225 ? -7.779  28.316 19.498  1.00 49.89  ? 574 PHE A CD1 1 
ATOM   1633 C CD2 . PHE A 1 225 ? -6.108  26.677 19.944  1.00 50.78  ? 574 PHE A CD2 1 
ATOM   1634 C CE1 . PHE A 1 225 ? -8.201  28.261 20.806  1.00 52.76  ? 574 PHE A CE1 1 
ATOM   1635 C CE2 . PHE A 1 225 ? -6.517  26.632 21.263  1.00 54.28  ? 574 PHE A CE2 1 
ATOM   1636 C CZ  . PHE A 1 225 ? -7.566  27.422 21.696  1.00 53.89  ? 574 PHE A CZ  1 
ATOM   1637 N N   . TYR A 1 226 ? -3.333  28.206 18.127  1.00 48.72  ? 575 TYR A N   1 
ATOM   1638 C CA  . TYR A 1 226 ? -2.236  28.153 19.082  1.00 48.61  ? 575 TYR A CA  1 
ATOM   1639 C C   . TYR A 1 226 ? -1.434  29.434 19.078  1.00 47.61  ? 575 TYR A C   1 
ATOM   1640 O O   . TYR A 1 226 ? -0.976  29.910 20.130  1.00 45.62  ? 575 TYR A O   1 
ATOM   1641 C CB  . TYR A 1 226 ? -1.308  26.997 18.758  1.00 49.07  ? 575 TYR A CB  1 
ATOM   1642 C CG  . TYR A 1 226 ? -0.029  27.067 19.536  1.00 52.56  ? 575 TYR A CG  1 
ATOM   1643 C CD1 . TYR A 1 226 ? 0.056   26.546 20.807  1.00 52.82  ? 575 TYR A CD1 1 
ATOM   1644 C CD2 . TYR A 1 226 ? 1.081   27.709 19.012  1.00 55.60  ? 575 TYR A CD2 1 
ATOM   1645 C CE1 . TYR A 1 226 ? 1.225   26.639 21.530  1.00 57.71  ? 575 TYR A CE1 1 
ATOM   1646 C CE2 . TYR A 1 226 ? 2.252   27.801 19.726  1.00 57.48  ? 575 TYR A CE2 1 
ATOM   1647 C CZ  . TYR A 1 226 ? 2.320   27.264 20.980  1.00 59.75  ? 575 TYR A CZ  1 
ATOM   1648 O OH  . TYR A 1 226 ? 3.490   27.358 21.686  1.00 66.74  ? 575 TYR A OH  1 
ATOM   1649 N N   . LEU A 1 227 ? -1.240  29.972 17.889  1.00 44.62  ? 576 LEU A N   1 
ATOM   1650 C CA  . LEU A 1 227 ? -0.494  31.199 17.760  1.00 47.88  ? 576 LEU A CA  1 
ATOM   1651 C C   . LEU A 1 227 ? -1.334  32.346 18.275  1.00 51.62  ? 576 LEU A C   1 
ATOM   1652 O O   . LEU A 1 227 ? -0.813  33.336 18.791  1.00 55.75  ? 576 LEU A O   1 
ATOM   1653 C CB  . LEU A 1 227 ? -0.127  31.470 16.311  1.00 46.57  ? 576 LEU A CB  1 
ATOM   1654 C CG  . LEU A 1 227 ? 0.774   30.445 15.644  1.00 44.57  ? 576 LEU A CG  1 
ATOM   1655 C CD1 . LEU A 1 227 ? 0.895   30.802 14.179  1.00 43.65  ? 576 LEU A CD1 1 
ATOM   1656 C CD2 . LEU A 1 227 ? 2.129   30.387 16.307  1.00 45.22  ? 576 LEU A CD2 1 
ATOM   1657 N N   . LYS A 1 228 ? -2.643  32.216 18.123  1.00 52.00  ? 577 LYS A N   1 
ATOM   1658 C CA  . LYS A 1 228 ? -3.553  33.235 18.616  1.00 54.52  ? 577 LYS A CA  1 
ATOM   1659 C C   . LYS A 1 228 ? -3.570  33.253 20.135  1.00 52.93  ? 577 LYS A C   1 
ATOM   1660 O O   . LYS A 1 228 ? -3.667  34.311 20.736  1.00 55.33  ? 577 LYS A O   1 
ATOM   1661 C CB  . LYS A 1 228 ? -4.966  33.033 18.041  1.00 54.64  ? 577 LYS A CB  1 
ATOM   1662 C CG  . LYS A 1 228 ? -5.142  33.644 16.645  1.00 55.94  ? 577 LYS A CG  1 
ATOM   1663 C CD  . LYS A 1 228 ? -6.591  33.751 16.240  1.00 57.20  ? 577 LYS A CD  1 
ATOM   1664 C CE  . LYS A 1 228 ? -7.393  34.512 17.288  1.00 62.26  ? 577 LYS A CE  1 
ATOM   1665 N NZ  . LYS A 1 228 ? -8.322  35.508 16.703  1.00 65.60  ? 577 LYS A NZ  1 
ATOM   1666 N N   . LEU A 1 229 ? -3.500  32.079 20.740  1.00 55.38  ? 578 LEU A N   1 
ATOM   1667 C CA  . LEU A 1 229 ? -3.272  31.978 22.171  1.00 61.99  ? 578 LEU A CA  1 
ATOM   1668 C C   . LEU A 1 229 ? -2.017  32.730 22.568  1.00 60.84  ? 578 LEU A C   1 
ATOM   1669 O O   . LEU A 1 229 ? -2.059  33.644 23.359  1.00 62.98  ? 578 LEU A O   1 
ATOM   1670 C CB  . LEU A 1 229 ? -3.128  30.517 22.603  1.00 65.90  ? 578 LEU A CB  1 
ATOM   1671 C CG  . LEU A 1 229 ? -4.436  29.810 22.925  1.00 72.60  ? 578 LEU A CG  1 
ATOM   1672 C CD1 . LEU A 1 229 ? -4.200  28.319 23.091  1.00 80.72  ? 578 LEU A CD1 1 
ATOM   1673 C CD2 . LEU A 1 229 ? -5.048  30.392 24.185  1.00 71.55  ? 578 LEU A CD2 1 
ATOM   1674 N N   . GLU A 1 230 ? -0.900  32.321 22.001  1.00 61.40  ? 579 GLU A N   1 
ATOM   1675 C CA  . GLU A 1 230 ? 0.409   32.842 22.331  1.00 60.01  ? 579 GLU A CA  1 
ATOM   1676 C C   . GLU A 1 230 ? 0.525   34.337 22.042  1.00 56.12  ? 579 GLU A C   1 
ATOM   1677 O O   . GLU A 1 230 ? 1.128   35.109 22.775  1.00 60.55  ? 579 GLU A O   1 
ATOM   1678 C CB  . GLU A 1 230 ? 1.377   32.060 21.465  1.00 61.86  ? 579 GLU A CB  1 
ATOM   1679 C CG  . GLU A 1 230 ? 2.833   32.309 21.676  1.00 63.23  ? 579 GLU A CG  1 
ATOM   1680 C CD  . GLU A 1 230 ? 3.631   31.602 20.618  1.00 63.89  ? 579 GLU A CD  1 
ATOM   1681 O OE1 . GLU A 1 230 ? 3.411   31.891 19.426  1.00 62.94  ? 579 GLU A OE1 1 
ATOM   1682 O OE2 . GLU A 1 230 ? 4.443   30.731 20.971  1.00 62.33  ? 579 GLU A OE2 1 
ATOM   1683 N N   . ASP A 1 231 ? -0.069  34.734 20.952  1.00 55.84  ? 580 ASP A N   1 
ATOM   1684 C CA  . ASP A 1 231 ? -0.128  36.122 20.579  1.00 60.52  ? 580 ASP A CA  1 
ATOM   1685 C C   . ASP A 1 231 ? 1.181   36.923 20.613  1.00 54.66  ? 580 ASP A C   1 
ATOM   1686 O O   . ASP A 1 231 ? 1.216   38.023 21.111  1.00 63.77  ? 580 ASP A O   1 
ATOM   1687 C CB  . ASP A 1 231 ? -1.173  36.845 21.412  1.00 65.36  ? 580 ASP A CB  1 
ATOM   1688 C CG  . ASP A 1 231 ? -1.658  38.078 20.718  1.00 75.69  ? 580 ASP A CG  1 
ATOM   1689 O OD1 . ASP A 1 231 ? -2.273  37.888 19.637  1.00 85.90  ? 580 ASP A OD1 1 
ATOM   1690 O OD2 . ASP A 1 231 ? -1.370  39.206 21.192  1.00 79.51  ? 580 ASP A OD2 1 
ATOM   1691 N N   . LEU A 1 232 ? 2.243   36.401 20.045  1.00 54.65  ? 581 LEU A N   1 
ATOM   1692 C CA  . LEU A 1 232 ? 3.446   37.193 19.891  1.00 53.24  ? 581 LEU A CA  1 
ATOM   1693 C C   . LEU A 1 232 ? 3.184   38.346 18.948  1.00 55.65  ? 581 LEU A C   1 
ATOM   1694 O O   . LEU A 1 232 ? 3.653   39.458 19.166  1.00 56.15  ? 581 LEU A O   1 
ATOM   1695 C CB  . LEU A 1 232 ? 4.578   36.354 19.315  1.00 52.74  ? 581 LEU A CB  1 
ATOM   1696 C CG  . LEU A 1 232 ? 4.884   35.079 20.063  1.00 50.40  ? 581 LEU A CG  1 
ATOM   1697 C CD1 . LEU A 1 232 ? 6.208   34.525 19.551  1.00 50.04  ? 581 LEU A CD1 1 
ATOM   1698 C CD2 . LEU A 1 232 ? 4.910   35.330 21.569  1.00 50.12  ? 581 LEU A CD2 1 
ATOM   1699 N N   . VAL A 1 233 ? 2.500   38.037 17.855  1.00 58.30  ? 582 VAL A N   1 
ATOM   1700 C CA  . VAL A 1 233 ? 1.974   39.047 16.958  1.00 61.18  ? 582 VAL A CA  1 
ATOM   1701 C C   . VAL A 1 233 ? 0.575   38.604 16.575  1.00 61.02  ? 582 VAL A C   1 
ATOM   1702 O O   . VAL A 1 233 ? 0.313   37.411 16.474  1.00 64.38  ? 582 VAL A O   1 
ATOM   1703 C CB  . VAL A 1 233 ? 2.851   39.247 15.696  1.00 62.47  ? 582 VAL A CB  1 
ATOM   1704 C CG1 . VAL A 1 233 ? 4.322   39.222 16.056  1.00 65.26  ? 582 VAL A CG1 1 
ATOM   1705 C CG2 . VAL A 1 233 ? 2.584   38.187 14.645  1.00 63.08  ? 582 VAL A CG2 1 
ATOM   1706 N N   . PRO A 1 234 ? -0.330  39.559 16.361  1.00 64.08  ? 583 PRO A N   1 
ATOM   1707 C CA  . PRO A 1 234 ? -1.716  39.209 16.060  1.00 63.73  ? 583 PRO A CA  1 
ATOM   1708 C C   . PRO A 1 234 ? -1.921  38.844 14.599  1.00 59.97  ? 583 PRO A C   1 
ATOM   1709 O O   . PRO A 1 234 ? -1.158  39.287 13.734  1.00 52.48  ? 583 PRO A O   1 
ATOM   1710 C CB  . PRO A 1 234 ? -2.461  40.498 16.353  1.00 67.32  ? 583 PRO A CB  1 
ATOM   1711 C CG  . PRO A 1 234 ? -1.460  41.559 16.020  1.00 66.03  ? 583 PRO A CG  1 
ATOM   1712 C CD  . PRO A 1 234 ? -0.137  41.015 16.463  1.00 62.57  ? 583 PRO A CD  1 
ATOM   1713 N N   . PRO A 1 235 ? -2.962  38.055 14.317  1.00 55.51  ? 584 PRO A N   1 
ATOM   1714 C CA  . PRO A 1 235 ? -3.136  37.687 12.939  1.00 57.15  ? 584 PRO A CA  1 
ATOM   1715 C C   . PRO A 1 235 ? -3.530  38.911 12.155  1.00 56.15  ? 584 PRO A C   1 
ATOM   1716 O O   . PRO A 1 235 ? -4.129  39.820 12.728  1.00 60.65  ? 584 PRO A O   1 
ATOM   1717 C CB  . PRO A 1 235 ? -4.289  36.680 12.959  1.00 57.52  ? 584 PRO A CB  1 
ATOM   1718 C CG  . PRO A 1 235 ? -4.591  36.398 14.380  1.00 60.26  ? 584 PRO A CG  1 
ATOM   1719 C CD  . PRO A 1 235 ? -4.029  37.537 15.174  1.00 58.29  ? 584 PRO A CD  1 
ATOM   1720 N N   . PRO A 1 236 ? -3.203  38.935 10.853  1.00 50.46  ? 585 PRO A N   1 
ATOM   1721 C CA  . PRO A 1 236 ? -3.758  39.967 10.024  1.00 49.70  ? 585 PRO A CA  1 
ATOM   1722 C C   . PRO A 1 236 ? -5.260  39.816 9.987   1.00 52.95  ? 585 PRO A C   1 
ATOM   1723 O O   . PRO A 1 236 ? -5.760  38.704 10.067  1.00 56.63  ? 585 PRO A O   1 
ATOM   1724 C CB  . PRO A 1 236 ? -3.171  39.690 8.648   1.00 48.81  ? 585 PRO A CB  1 
ATOM   1725 C CG  . PRO A 1 236 ? -2.227  38.560 8.801   1.00 48.46  ? 585 PRO A CG  1 
ATOM   1726 C CD  . PRO A 1 236 ? -2.575  37.872 10.064  1.00 49.12  ? 585 PRO A CD  1 
ATOM   1727 N N   . PRO A 1 237 ? -5.984  40.926 9.882   1.00 59.23  ? 586 PRO A N   1 
ATOM   1728 C CA  . PRO A 1 237 ? -7.439  40.908 10.048  1.00 58.88  ? 586 PRO A CA  1 
ATOM   1729 C C   . PRO A 1 237 ? -8.169  39.957 9.111   1.00 58.79  ? 586 PRO A C   1 
ATOM   1730 O O   . PRO A 1 237 ? -9.134  39.310 9.527   1.00 49.92  ? 586 PRO A O   1 
ATOM   1731 C CB  . PRO A 1 237 ? -7.840  42.344 9.737   1.00 59.08  ? 586 PRO A CB  1 
ATOM   1732 C CG  . PRO A 1 237 ? -6.632  43.146 10.056  1.00 61.30  ? 586 PRO A CG  1 
ATOM   1733 C CD  . PRO A 1 237 ? -5.461  42.290 9.713   1.00 60.99  ? 586 PRO A CD  1 
ATOM   1734 N N   . ILE A 1 238 ? -7.711  39.886 7.861   1.00 64.27  ? 587 ILE A N   1 
ATOM   1735 C CA  . ILE A 1 238 ? -8.408  39.097 6.849   1.00 66.84  ? 587 ILE A CA  1 
ATOM   1736 C C   . ILE A 1 238 ? -8.277  37.623 7.175   1.00 72.50  ? 587 ILE A C   1 
ATOM   1737 O O   . ILE A 1 238 ? -9.215  36.854 6.970   1.00 75.38  ? 587 ILE A O   1 
ATOM   1738 C CB  . ILE A 1 238 ? -7.857  39.264 5.428   1.00 76.14  ? 587 ILE A CB  1 
ATOM   1739 C CG1 . ILE A 1 238 ? -7.263  40.650 5.186   1.00 89.81  ? 587 ILE A CG1 1 
ATOM   1740 C CG2 . ILE A 1 238 ? -8.957  38.970 4.425   1.00 76.31  ? 587 ILE A CG2 1 
ATOM   1741 C CD1 . ILE A 1 238 ? -7.108  41.041 3.719   1.00 87.86  ? 587 ILE A CD1 1 
ATOM   1742 N N   . ILE A 1 239 ? -7.091  37.235 7.657   1.00 70.28  ? 588 ILE A N   1 
ATOM   1743 C CA  . ILE A 1 239 ? -6.793  35.849 8.043   1.00 64.29  ? 588 ILE A CA  1 
ATOM   1744 C C   . ILE A 1 239 ? -7.552  35.500 9.303   1.00 58.64  ? 588 ILE A C   1 
ATOM   1745 O O   . ILE A 1 239 ? -8.155  34.444 9.408   1.00 55.51  ? 588 ILE A O   1 
ATOM   1746 C CB  . ILE A 1 239 ? -5.287  35.645 8.318   1.00 63.02  ? 588 ILE A CB  1 
ATOM   1747 C CG1 . ILE A 1 239 ? -4.454  35.884 7.040   1.00 60.03  ? 588 ILE A CG1 1 
ATOM   1748 C CG2 . ILE A 1 239 ? -5.012  34.256 8.890   1.00 61.40  ? 588 ILE A CG2 1 
ATOM   1749 C CD1 . ILE A 1 239 ? -4.747  34.955 5.885   1.00 57.05  ? 588 ILE A CD1 1 
ATOM   1750 N N   . ASP A 1 240 ? -7.500  36.404 10.260  1.00 57.82  ? 589 ASP A N   1 
ATOM   1751 C CA  . ASP A 1 240 ? -8.258  36.272 11.493  1.00 60.80  ? 589 ASP A CA  1 
ATOM   1752 C C   . ASP A 1 240 ? -9.774  36.124 11.236  1.00 62.36  ? 589 ASP A C   1 
ATOM   1753 O O   . ASP A 1 240 ? -10.465 35.354 11.914  1.00 57.48  ? 589 ASP A O   1 
ATOM   1754 C CB  . ASP A 1 240 ? -8.001  37.508 12.351  1.00 62.96  ? 589 ASP A CB  1 
ATOM   1755 C CG  . ASP A 1 240 ? -8.293  37.283 13.796  1.00 65.45  ? 589 ASP A CG  1 
ATOM   1756 O OD1 . ASP A 1 240 ? -8.860  36.231 14.139  1.00 65.93  ? 589 ASP A OD1 1 
ATOM   1757 O OD2 . ASP A 1 240 ? -7.951  38.176 14.594  1.00 77.14  ? 589 ASP A OD2 1 
ATOM   1758 N N   . LYS A 1 241 ? -10.283 36.855 10.248  1.00 62.26  ? 590 LYS A N   1 
ATOM   1759 C CA  . LYS A 1 241 ? -11.694 36.772 9.901   1.00 63.49  ? 590 LYS A CA  1 
ATOM   1760 C C   . LYS A 1 241 ? -12.059 35.377 9.388   1.00 59.24  ? 590 LYS A C   1 
ATOM   1761 O O   . LYS A 1 241 ? -13.113 34.839 9.715   1.00 54.15  ? 590 LYS A O   1 
ATOM   1762 C CB  . LYS A 1 241 ? -12.044 37.816 8.851   1.00 68.00  ? 590 LYS A CB  1 
ATOM   1763 C CG  . LYS A 1 241 ? -13.528 38.076 8.739   1.00 74.41  ? 590 LYS A CG  1 
ATOM   1764 C CD  . LYS A 1 241 ? -13.859 38.909 7.516   1.00 86.84  ? 590 LYS A CD  1 
ATOM   1765 C CE  . LYS A 1 241 ? -15.337 39.265 7.478   1.00 99.66  ? 590 LYS A CE  1 
ATOM   1766 N NZ  . LYS A 1 241 ? -16.176 38.104 7.079   1.00 105.23 ? 590 LYS A NZ  1 
ATOM   1767 N N   . ILE A 1 242 ? -11.175 34.815 8.572   1.00 55.68  ? 591 ILE A N   1 
ATOM   1768 C CA  . ILE A 1 242 ? -11.364 33.494 7.999   1.00 52.72  ? 591 ILE A CA  1 
ATOM   1769 C C   . ILE A 1 242 ? -11.338 32.456 9.094   1.00 52.26  ? 591 ILE A C   1 
ATOM   1770 O O   . ILE A 1 242 ? -12.163 31.543 9.119   1.00 53.94  ? 591 ILE A O   1 
ATOM   1771 C CB  . ILE A 1 242 ? -10.253 33.184 6.974   1.00 52.92  ? 591 ILE A CB  1 
ATOM   1772 C CG1 . ILE A 1 242 ? -10.456 34.033 5.717   1.00 50.72  ? 591 ILE A CG1 1 
ATOM   1773 C CG2 . ILE A 1 242 ? -10.241 31.706 6.609   1.00 51.86  ? 591 ILE A CG2 1 
ATOM   1774 C CD1 . ILE A 1 242 ? -9.219  34.218 4.871   1.00 50.43  ? 591 ILE A CD1 1 
ATOM   1775 N N   . PHE A 1 243 ? -10.381 32.608 10.000  1.00 52.87  ? 592 PHE A N   1 
ATOM   1776 C CA  . PHE A 1 243 ? -10.242 31.697 11.110  1.00 55.85  ? 592 PHE A CA  1 
ATOM   1777 C C   . PHE A 1 243 ? -11.563 31.625 11.840  1.00 59.74  ? 592 PHE A C   1 
ATOM   1778 O O   . PHE A 1 243 ? -12.088 30.541 12.048  1.00 62.70  ? 592 PHE A O   1 
ATOM   1779 C CB  . PHE A 1 243 ? -9.149  32.162 12.068  1.00 56.20  ? 592 PHE A CB  1 
ATOM   1780 C CG  . PHE A 1 243 ? -9.020  31.308 13.302  1.00 58.09  ? 592 PHE A CG  1 
ATOM   1781 C CD1 . PHE A 1 243 ? -8.539  30.008 13.222  1.00 56.88  ? 592 PHE A CD1 1 
ATOM   1782 C CD2 . PHE A 1 243 ? -9.383  31.802 14.544  1.00 56.68  ? 592 PHE A CD2 1 
ATOM   1783 C CE1 . PHE A 1 243 ? -8.419  29.226 14.364  1.00 54.36  ? 592 PHE A CE1 1 
ATOM   1784 C CE2 . PHE A 1 243 ? -9.262  31.026 15.677  1.00 55.11  ? 592 PHE A CE2 1 
ATOM   1785 C CZ  . PHE A 1 243 ? -8.779  29.733 15.589  1.00 52.34  ? 592 PHE A CZ  1 
ATOM   1786 N N   . MET A 1 244 ? -12.113 32.789 12.188  1.00 64.78  ? 593 MET A N   1 
ATOM   1787 C CA  . MET A 1 244 ? -13.331 32.855 12.991  1.00 61.33  ? 593 MET A CA  1 
ATOM   1788 C C   . MET A 1 244 ? -14.535 32.377 12.197  1.00 61.08  ? 593 MET A C   1 
ATOM   1789 O O   . MET A 1 244 ? -15.305 31.549 12.688  1.00 60.32  ? 593 MET A O   1 
ATOM   1790 C CB  . MET A 1 244 ? -13.565 34.262 13.489  1.00 59.90  ? 593 MET A CB  1 
ATOM   1791 C CG  . MET A 1 244 ? -12.413 34.857 14.307  1.00 62.52  ? 593 MET A CG  1 
ATOM   1792 S SD  . MET A 1 244 ? -12.144 34.253 15.984  1.00 64.32  ? 593 MET A SD  1 
ATOM   1793 C CE  . MET A 1 244 ? -13.770 33.627 16.398  1.00 65.11  ? 593 MET A CE  1 
ATOM   1794 N N   . ASP A 1 245 ? -14.675 32.856 10.962  1.00 65.25  ? 594 ASP A N   1 
ATOM   1795 C CA  . ASP A 1 245 ? -15.872 32.558 10.147  1.00 66.04  ? 594 ASP A CA  1 
ATOM   1796 C C   . ASP A 1 245 ? -15.991 31.077 9.873   1.00 67.75  ? 594 ASP A C   1 
ATOM   1797 O O   . ASP A 1 245 ? -17.093 30.547 9.773   1.00 65.16  ? 594 ASP A O   1 
ATOM   1798 C CB  . ASP A 1 245 ? -15.863 33.321 8.812   1.00 62.92  ? 594 ASP A CB  1 
ATOM   1799 C CG  . ASP A 1 245 ? -15.996 34.842 8.983   1.00 67.83  ? 594 ASP A CG  1 
ATOM   1800 O OD1 . ASP A 1 245 ? -16.263 35.354 10.098  1.00 69.17  ? 594 ASP A OD1 1 
ATOM   1801 O OD2 . ASP A 1 245 ? -15.811 35.558 7.974   1.00 71.51  ? 594 ASP A OD2 1 
ATOM   1802 N N   . THR A 1 246 ? -14.848 30.408 9.750   1.00 74.13  ? 595 THR A N   1 
ATOM   1803 C CA  . THR A 1 246 ? -14.822 29.003 9.347   1.00 75.50  ? 595 THR A CA  1 
ATOM   1804 C C   . THR A 1 246 ? -14.927 28.049 10.542  1.00 82.07  ? 595 THR A C   1 
ATOM   1805 O O   . THR A 1 246 ? -14.870 26.834 10.376  1.00 79.87  ? 595 THR A O   1 
ATOM   1806 C CB  . THR A 1 246 ? -13.569 28.706 8.500   1.00 72.64  ? 595 THR A CB  1 
ATOM   1807 O OG1 . THR A 1 246 ? -12.404 29.158 9.199   1.00 71.73  ? 595 THR A OG1 1 
ATOM   1808 C CG2 . THR A 1 246 ? -13.674 29.423 7.132   1.00 69.06  ? 595 THR A CG2 1 
ATOM   1809 N N   . LEU A 1 247 ? -15.084 28.598 11.746  1.00 89.67  ? 596 LEU A N   1 
ATOM   1810 C CA  . LEU A 1 247 ? -15.322 27.775 12.932  1.00 91.05  ? 596 LEU A CA  1 
ATOM   1811 C C   . LEU A 1 247 ? -16.803 27.475 13.042  1.00 101.29 ? 596 LEU A C   1 
ATOM   1812 O O   . LEU A 1 247 ? -17.592 28.417 13.166  1.00 114.31 ? 596 LEU A O   1 
ATOM   1813 C CB  . LEU A 1 247 ? -14.877 28.484 14.218  1.00 82.65  ? 596 LEU A CB  1 
ATOM   1814 C CG  . LEU A 1 247 ? -13.470 28.333 14.798  1.00 83.30  ? 596 LEU A CG  1 
ATOM   1815 C CD1 . LEU A 1 247 ? -12.495 27.751 13.797  1.00 77.48  ? 596 LEU A CD1 1 
ATOM   1816 C CD2 . LEU A 1 247 ? -12.964 29.642 15.391  1.00 88.72  ? 596 LEU A CD2 1 
ATOM   1817 N N   . PRO A 1 248 ? -17.189 26.176 13.036  1.00 105.52 ? 597 PRO A N   1 
ATOM   1818 C CA  . PRO A 1 248 ? -18.602 25.813 13.196  1.00 106.50 ? 597 PRO A CA  1 
ATOM   1819 C C   . PRO A 1 248 ? -19.105 25.925 14.652  1.00 98.83  ? 597 PRO A C   1 
ATOM   1820 O O   . PRO A 1 248 ? -19.636 24.959 15.199  1.00 99.12  ? 597 PRO A O   1 
ATOM   1821 C CB  . PRO A 1 248 ? -18.649 24.366 12.679  1.00 113.58 ? 597 PRO A CB  1 
ATOM   1822 C CG  . PRO A 1 248 ? -17.282 23.820 12.934  1.00 113.60 ? 597 PRO A CG  1 
ATOM   1823 C CD  . PRO A 1 248 ? -16.328 24.983 12.887  1.00 109.63 ? 597 PRO A CD  1 
ATOM   1824 N N   . PHE A 1 249 ? -18.938 27.109 15.250  1.00 98.04  ? 598 PHE A N   1 
ATOM   1825 C CA  . PHE A 1 249 ? -19.442 27.438 16.602  1.00 95.61  ? 598 PHE A CA  1 
ATOM   1826 C C   . PHE A 1 249 ? -19.110 28.895 16.952  1.00 84.21  ? 598 PHE A C   1 
ATOM   1827 O O   . PHE A 1 249 ? -19.132 29.771 16.084  1.00 69.54  ? 598 PHE A O   1 
ATOM   1828 C CB  . PHE A 1 249 ? -18.896 26.476 17.693  1.00 103.42 ? 598 PHE A CB  1 
ATOM   1829 C CG  . PHE A 1 249 ? -17.381 26.355 17.724  1.00 103.34 ? 598 PHE A CG  1 
ATOM   1830 C CD1 . PHE A 1 249 ? -16.603 27.262 18.457  1.00 100.66 ? 598 PHE A CD1 1 
ATOM   1831 C CD2 . PHE A 1 249 ? -16.733 25.342 17.026  1.00 91.99  ? 598 PHE A CD2 1 
ATOM   1832 C CE1 . PHE A 1 249 ? -15.220 27.159 18.482  1.00 86.53  ? 598 PHE A CE1 1 
ATOM   1833 C CE2 . PHE A 1 249 ? -15.351 25.241 17.059  1.00 88.29  ? 598 PHE A CE2 1 
ATOM   1834 C CZ  . PHE A 1 249 ? -14.597 26.149 17.783  1.00 82.68  ? 598 PHE A CZ  1 
ATOM   1835 N N   . ALA B 1 13  ? 1.718   26.129 61.019  1.00 111.85 ? 362 ALA B N   1 
ATOM   1836 C CA  . ALA B 1 13  ? 0.695   27.220 60.996  1.00 102.70 ? 362 ALA B CA  1 
ATOM   1837 C C   . ALA B 1 13  ? -0.730  26.644 61.061  1.00 92.73  ? 362 ALA B C   1 
ATOM   1838 O O   . ALA B 1 13  ? -0.957  25.466 60.781  1.00 87.06  ? 362 ALA B O   1 
ATOM   1839 C CB  . ALA B 1 13  ? 0.883   28.089 59.755  1.00 98.20  ? 362 ALA B CB  1 
ATOM   1840 N N   . ASN B 1 14  ? -1.683  27.473 61.467  1.00 91.59  ? 363 ASN B N   1 
ATOM   1841 C CA  . ASN B 1 14  ? -3.087  27.106 61.374  1.00 86.82  ? 363 ASN B CA  1 
ATOM   1842 C C   . ASN B 1 14  ? -3.545  27.282 59.940  1.00 81.93  ? 363 ASN B C   1 
ATOM   1843 O O   . ASN B 1 14  ? -4.556  26.703 59.528  1.00 72.89  ? 363 ASN B O   1 
ATOM   1844 C CB  . ASN B 1 14  ? -3.944  27.979 62.277  1.00 88.09  ? 363 ASN B CB  1 
ATOM   1845 C CG  . ASN B 1 14  ? -5.360  27.458 62.397  1.00 91.90  ? 363 ASN B CG  1 
ATOM   1846 O OD1 . ASN B 1 14  ? -5.572  26.320 62.812  1.00 99.47  ? 363 ASN B OD1 1 
ATOM   1847 N ND2 . ASN B 1 14  ? -6.334  28.275 62.020  1.00 92.93  ? 363 ASN B ND2 1 
ATOM   1848 N N   . LEU B 1 15  ? -2.809  28.116 59.204  1.00 72.35  ? 364 LEU B N   1 
ATOM   1849 C CA  . LEU B 1 15  ? -3.009  28.251 57.787  1.00 67.18  ? 364 LEU B CA  1 
ATOM   1850 C C   . LEU B 1 15  ? -2.614  26.963 57.081  1.00 67.28  ? 364 LEU B C   1 
ATOM   1851 O O   . LEU B 1 15  ? -3.420  26.350 56.373  1.00 70.18  ? 364 LEU B O   1 
ATOM   1852 C CB  . LEU B 1 15  ? -2.173  29.398 57.217  1.00 62.90  ? 364 LEU B CB  1 
ATOM   1853 C CG  . LEU B 1 15  ? -2.350  29.530 55.687  1.00 61.28  ? 364 LEU B CG  1 
ATOM   1854 C CD1 . LEU B 1 15  ? -3.824  29.714 55.336  1.00 57.77  ? 364 LEU B CD1 1 
ATOM   1855 C CD2 . LEU B 1 15  ? -1.519  30.649 55.082  1.00 60.32  ? 364 LEU B CD2 1 
ATOM   1856 N N   . LEU B 1 16  ? -1.356  26.575 57.248  1.00 65.52  ? 365 LEU B N   1 
ATOM   1857 C CA  . LEU B 1 16  ? -0.863  25.347 56.654  1.00 65.79  ? 365 LEU B CA  1 
ATOM   1858 C C   . LEU B 1 16  ? -1.833  24.204 56.944  1.00 64.73  ? 365 LEU B C   1 
ATOM   1859 O O   . LEU B 1 16  ? -2.306  23.534 56.039  1.00 64.36  ? 365 LEU B O   1 
ATOM   1860 C CB  . LEU B 1 16  ? 0.508   25.004 57.215  1.00 66.95  ? 365 LEU B CB  1 
ATOM   1861 C CG  . LEU B 1 16  ? 1.188   23.824 56.529  1.00 71.84  ? 365 LEU B CG  1 
ATOM   1862 C CD1 . LEU B 1 16  ? 1.191   24.014 55.019  1.00 73.15  ? 365 LEU B CD1 1 
ATOM   1863 C CD2 . LEU B 1 16  ? 2.611   23.639 57.048  1.00 72.16  ? 365 LEU B CD2 1 
ATOM   1864 N N   . THR B 1 17  ? -2.163  24.032 58.214  1.00 64.06  ? 366 THR B N   1 
ATOM   1865 C CA  . THR B 1 17  ? -3.139  23.032 58.625  1.00 68.91  ? 366 THR B CA  1 
ATOM   1866 C C   . THR B 1 17  ? -4.430  23.142 57.845  1.00 63.33  ? 366 THR B C   1 
ATOM   1867 O O   . THR B 1 17  ? -4.969  22.136 57.394  1.00 64.85  ? 366 THR B O   1 
ATOM   1868 C CB  . THR B 1 17  ? -3.486  23.155 60.121  1.00 70.12  ? 366 THR B CB  1 
ATOM   1869 O OG1 . THR B 1 17  ? -2.276  23.110 60.879  1.00 69.92  ? 366 THR B OG1 1 
ATOM   1870 C CG2 . THR B 1 17  ? -4.431  22.027 60.567  1.00 63.93  ? 366 THR B CG2 1 
ATOM   1871 N N   . SER B 1 18  ? -4.936  24.359 57.706  1.00 62.11  ? 367 SER B N   1 
ATOM   1872 C CA  . SER B 1 18  ? -6.185  24.567 56.971  1.00 63.57  ? 367 SER B CA  1 
ATOM   1873 C C   . SER B 1 18  ? -6.027  24.119 55.532  1.00 60.24  ? 367 SER B C   1 
ATOM   1874 O O   . SER B 1 18  ? -6.916  23.455 54.981  1.00 54.50  ? 367 SER B O   1 
ATOM   1875 C CB  . SER B 1 18  ? -6.613  26.035 57.000  1.00 68.20  ? 367 SER B CB  1 
ATOM   1876 O OG  . SER B 1 18  ? -7.129  26.397 58.268  1.00 70.28  ? 367 SER B OG  1 
ATOM   1877 N N   . LEU B 1 19  ? -4.877  24.462 54.946  1.00 59.52  ? 368 LEU B N   1 
ATOM   1878 C CA  . LEU B 1 19  ? -4.578  24.133 53.548  1.00 61.08  ? 368 LEU B CA  1 
ATOM   1879 C C   . LEU B 1 19  ? -4.463  22.640 53.299  1.00 59.32  ? 368 LEU B C   1 
ATOM   1880 O O   . LEU B 1 19  ? -5.031  22.114 52.326  1.00 62.67  ? 368 LEU B O   1 
ATOM   1881 C CB  . LEU B 1 19  ? -3.287  24.814 53.107  1.00 63.44  ? 368 LEU B CB  1 
ATOM   1882 C CG  . LEU B 1 19  ? -3.340  26.331 52.926  1.00 64.02  ? 368 LEU B CG  1 
ATOM   1883 C CD1 . LEU B 1 19  ? -1.941  26.843 52.657  1.00 69.25  ? 368 LEU B CD1 1 
ATOM   1884 C CD2 . LEU B 1 19  ? -4.271  26.738 51.795  1.00 62.27  ? 368 LEU B CD2 1 
ATOM   1885 N N   . VAL B 1 20  ? -3.751  21.962 54.194  1.00 60.31  ? 369 VAL B N   1 
ATOM   1886 C CA  . VAL B 1 20  ? -3.580  20.499 54.130  1.00 62.05  ? 369 VAL B CA  1 
ATOM   1887 C C   . VAL B 1 20  ? -4.890  19.735 54.330  1.00 59.97  ? 369 VAL B C   1 
ATOM   1888 O O   . VAL B 1 20  ? -5.160  18.732 53.656  1.00 52.65  ? 369 VAL B O   1 
ATOM   1889 C CB  . VAL B 1 20  ? -2.588  20.005 55.206  1.00 64.17  ? 369 VAL B CB  1 
ATOM   1890 C CG1 . VAL B 1 20  ? -2.588  18.490 55.254  1.00 64.89  ? 369 VAL B CG1 1 
ATOM   1891 C CG2 . VAL B 1 20  ? -1.177  20.519 54.935  1.00 65.59  ? 369 VAL B CG2 1 
ATOM   1892 N N   . ARG B 1 21  ? -5.687  20.200 55.288  1.00 63.78  ? 370 ARG B N   1 
ATOM   1893 C CA  . ARG B 1 21  ? -6.962  19.568 55.565  1.00 67.80  ? 370 ARG B CA  1 
ATOM   1894 C C   . ARG B 1 21  ? -7.821  19.725 54.326  1.00 62.40  ? 370 ARG B C   1 
ATOM   1895 O O   . ARG B 1 21  ? -8.465  18.765 53.897  1.00 54.64  ? 370 ARG B O   1 
ATOM   1896 C CB  . ARG B 1 21  ? -7.618  20.170 56.821  1.00 73.70  ? 370 ARG B CB  1 
ATOM   1897 C CG  . ARG B 1 21  ? -9.069  19.767 57.121  1.00 88.92  ? 370 ARG B CG  1 
ATOM   1898 C CD  . ARG B 1 21  ? -9.514  20.294 58.489  1.00 97.85  ? 370 ARG B CD  1 
ATOM   1899 N NE  . ARG B 1 21  ? -8.510  20.013 59.524  1.00 106.09 ? 370 ARG B NE  1 
ATOM   1900 C CZ  . ARG B 1 21  ? -8.154  20.829 60.522  1.00 100.04 ? 370 ARG B CZ  1 
ATOM   1901 N NH1 . ARG B 1 21  ? -7.222  20.428 61.382  1.00 96.80  ? 370 ARG B NH1 1 
ATOM   1902 N NH2 . ARG B 1 21  ? -8.698  22.033 60.675  1.00 96.44  ? 370 ARG B NH2 1 
ATOM   1903 N N   . ALA B 1 22  ? -7.790  20.916 53.727  1.00 58.52  ? 371 ALA B N   1 
ATOM   1904 C CA  . ALA B 1 22  ? -8.626  21.179 52.548  1.00 63.90  ? 371 ALA B CA  1 
ATOM   1905 C C   . ALA B 1 22  ? -8.282  20.250 51.389  1.00 65.47  ? 371 ALA B C   1 
ATOM   1906 O O   . ALA B 1 22  ? -9.179  19.643 50.774  1.00 68.08  ? 371 ALA B O   1 
ATOM   1907 C CB  . ALA B 1 22  ? -8.503  22.622 52.116  1.00 62.61  ? 371 ALA B CB  1 
ATOM   1908 N N   . HIS B 1 23  ? -6.981  20.159 51.116  1.00 61.74  ? 372 HIS B N   1 
ATOM   1909 C CA  . HIS B 1 23  ? -6.418  19.247 50.126  1.00 59.08  ? 372 HIS B CA  1 
ATOM   1910 C C   . HIS B 1 23  ? -6.821  17.774 50.284  1.00 57.51  ? 372 HIS B C   1 
ATOM   1911 O O   . HIS B 1 23  ? -7.350  17.144 49.356  1.00 56.18  ? 372 HIS B O   1 
ATOM   1912 C CB  . HIS B 1 23  ? -4.896  19.321 50.192  1.00 56.10  ? 372 HIS B CB  1 
ATOM   1913 C CG  . HIS B 1 23  ? -4.224  18.311 49.320  1.00 56.77  ? 372 HIS B CG  1 
ATOM   1914 N ND1 . HIS B 1 23  ? -4.349  18.320 47.947  1.00 55.31  ? 372 HIS B ND1 1 
ATOM   1915 C CD2 . HIS B 1 23  ? -3.444  17.247 49.622  1.00 57.70  ? 372 HIS B CD2 1 
ATOM   1916 C CE1 . HIS B 1 23  ? -3.673  17.305 47.440  1.00 53.59  ? 372 HIS B CE1 1 
ATOM   1917 N NE2 . HIS B 1 23  ? -3.118  16.636 48.436  1.00 57.65  ? 372 HIS B NE2 1 
ATOM   1918 N N   . LEU B 1 24  ? -6.535  17.215 51.450  1.00 56.35  ? 373 LEU B N   1 
ATOM   1919 C CA  . LEU B 1 24  ? -6.831  15.802 51.700  1.00 56.30  ? 373 LEU B CA  1 
ATOM   1920 C C   . LEU B 1 24  ? -8.314  15.503 51.590  1.00 55.24  ? 373 LEU B C   1 
ATOM   1921 O O   . LEU B 1 24  ? -8.703  14.446 51.139  1.00 49.28  ? 373 LEU B O   1 
ATOM   1922 C CB  . LEU B 1 24  ? -6.343  15.412 53.088  1.00 59.20  ? 373 LEU B CB  1 
ATOM   1923 C CG  . LEU B 1 24  ? -4.813  15.454 53.234  1.00 65.22  ? 373 LEU B CG  1 
ATOM   1924 C CD1 . LEU B 1 24  ? -4.430  15.496 54.705  1.00 71.09  ? 373 LEU B CD1 1 
ATOM   1925 C CD2 . LEU B 1 24  ? -4.077  14.338 52.498  1.00 64.30  ? 373 LEU B CD2 1 
ATOM   1926 N N   . ASP B 1 25  ? -9.151  16.446 52.003  1.00 60.36  ? 374 ASP B N   1 
ATOM   1927 C CA  . ASP B 1 25  ? -10.585 16.221 51.951  1.00 59.63  ? 374 ASP B CA  1 
ATOM   1928 C C   . ASP B 1 25  ? -11.084 16.235 50.535  1.00 56.12  ? 374 ASP B C   1 
ATOM   1929 O O   . ASP B 1 25  ? -12.213 15.845 50.320  1.00 53.09  ? 374 ASP B O   1 
ATOM   1930 C CB  . ASP B 1 25  ? -11.352 17.261 52.779  1.00 67.02  ? 374 ASP B CB  1 
ATOM   1931 C CG  . ASP B 1 25  ? -11.197 17.063 54.294  1.00 73.29  ? 374 ASP B CG  1 
ATOM   1932 O OD1 . ASP B 1 25  ? -10.819 15.963 54.747  1.00 75.46  ? 374 ASP B OD1 1 
ATOM   1933 O OD2 . ASP B 1 25  ? -11.459 18.030 55.043  1.00 85.37  ? 374 ASP B OD2 1 
ATOM   1934 N N   . SER B 1 26  ? -10.250 16.684 49.584  1.00 57.87  ? 375 SER B N   1 
ATOM   1935 C CA  . SER B 1 26  ? -10.647 16.896 48.179  1.00 57.06  ? 375 SER B CA  1 
ATOM   1936 C C   . SER B 1 26  ? -10.249 15.775 47.226  1.00 56.97  ? 375 SER B C   1 
ATOM   1937 O O   . SER B 1 26  ? -10.179 15.986 46.026  1.00 54.97  ? 375 SER B O   1 
ATOM   1938 C CB  . SER B 1 26  ? -10.049 18.217 47.668  1.00 58.84  ? 375 SER B CB  1 
ATOM   1939 O OG  . SER B 1 26  ? -8.647  18.104 47.488  1.00 62.43  ? 375 SER B OG  1 
ATOM   1940 N N   . GLY B 1 27  ? -9.996  14.584 47.744  1.00 62.38  ? 376 GLY B N   1 
ATOM   1941 C CA  . GLY B 1 27  ? -9.627  13.467 46.881  1.00 65.89  ? 376 GLY B CA  1 
ATOM   1942 C C   . GLY B 1 27  ? -9.930  12.143 47.519  1.00 70.33  ? 376 GLY B C   1 
ATOM   1943 O O   . GLY B 1 27  ? -10.390 12.105 48.651  1.00 72.62  ? 376 GLY B O   1 
ATOM   1944 N N   . PRO B 1 28  ? -9.690  11.042 46.782  1.00 70.49  ? 377 PRO B N   1 
ATOM   1945 C CA  . PRO B 1 28  ? -9.973  9.730  47.299  1.00 66.11  ? 377 PRO B CA  1 
ATOM   1946 C C   . PRO B 1 28  ? -8.910  9.237  48.259  1.00 68.65  ? 377 PRO B C   1 
ATOM   1947 O O   . PRO B 1 28  ? -7.742  9.635  48.147  1.00 60.41  ? 377 PRO B O   1 
ATOM   1948 C CB  . PRO B 1 28  ? -9.973  8.867  46.047  1.00 65.01  ? 377 PRO B CB  1 
ATOM   1949 C CG  . PRO B 1 28  ? -8.968  9.507  45.182  1.00 66.03  ? 377 PRO B CG  1 
ATOM   1950 C CD  . PRO B 1 28  ? -9.167  10.970 45.407  1.00 68.60  ? 377 PRO B CD  1 
ATOM   1951 N N   . SER B 1 29  ? -9.351  8.389  49.195  1.00 76.10  ? 378 SER B N   1 
ATOM   1952 C CA  . SER B 1 29  ? -8.500  7.614  50.091  1.00 80.78  ? 378 SER B CA  1 
ATOM   1953 C C   . SER B 1 29  ? -8.006  6.390  49.365  1.00 82.78  ? 378 SER B C   1 
ATOM   1954 O O   . SER B 1 29  ? -8.764  5.797  48.598  1.00 89.55  ? 378 SER B O   1 
ATOM   1955 C CB  . SER B 1 29  ? -9.309  7.129  51.289  1.00 80.34  ? 378 SER B CB  1 
ATOM   1956 O OG  . SER B 1 29  ? -9.278  8.047  52.356  1.00 89.92  ? 378 SER B OG  1 
ATOM   1957 N N   . THR B 1 30  ? -6.766  5.978  49.626  1.00 82.97  ? 379 THR B N   1 
ATOM   1958 C CA  . THR B 1 30  ? -6.250  4.728  49.059  1.00 85.79  ? 379 THR B CA  1 
ATOM   1959 C C   . THR B 1 30  ? -7.270  3.620  49.301  1.00 86.75  ? 379 THR B C   1 
ATOM   1960 O O   . THR B 1 30  ? -7.485  2.753  48.444  1.00 82.80  ? 379 THR B O   1 
ATOM   1961 C CB  . THR B 1 30  ? -4.903  4.355  49.662  1.00 83.71  ? 379 THR B CB  1 
ATOM   1962 O OG1 . THR B 1 30  ? -5.061  4.295  51.074  1.00 88.28  ? 379 THR B OG1 1 
ATOM   1963 C CG2 . THR B 1 30  ? -3.827  5.397  49.278  1.00 83.29  ? 379 THR B CG2 1 
ATOM   1964 N N   . ALA B 1 31  ? -7.907  3.675  50.470  1.00 87.26  ? 380 ALA B N   1 
ATOM   1965 C CA  . ALA B 1 31  ? -9.075  2.840  50.777  1.00 93.10  ? 380 ALA B CA  1 
ATOM   1966 C C   . ALA B 1 31  ? -10.160 2.791  49.673  1.00 83.68  ? 380 ALA B C   1 
ATOM   1967 O O   . ALA B 1 31  ? -10.602 1.715  49.295  1.00 87.34  ? 380 ALA B O   1 
ATOM   1968 C CB  . ALA B 1 31  ? -9.692  3.281  52.107  1.00 99.00  ? 380 ALA B CB  1 
ATOM   1969 N N   . LYS B 1 32  ? -10.589 3.933  49.158  1.00 79.29  ? 381 LYS B N   1 
ATOM   1970 C CA  . LYS B 1 32  ? -11.753 3.947  48.269  1.00 82.06  ? 381 LYS B CA  1 
ATOM   1971 C C   . LYS B 1 32  ? -11.421 4.232  46.786  1.00 76.57  ? 381 LYS B C   1 
ATOM   1972 O O   . LYS B 1 32  ? -12.249 4.782  46.053  1.00 65.23  ? 381 LYS B O   1 
ATOM   1973 C CB  . LYS B 1 32  ? -12.823 4.907  48.814  1.00 86.04  ? 381 LYS B CB  1 
ATOM   1974 C CG  . LYS B 1 32  ? -12.289 6.279  49.181  1.00 95.68  ? 381 LYS B CG  1 
ATOM   1975 C CD  . LYS B 1 32  ? -13.353 7.378  49.192  1.00 110.26 ? 381 LYS B CD  1 
ATOM   1976 C CE  . LYS B 1 32  ? -12.763 8.719  48.765  1.00 115.39 ? 381 LYS B CE  1 
ATOM   1977 N NZ  . LYS B 1 32  ? -13.687 9.884  48.864  1.00 117.05 ? 381 LYS B NZ  1 
ATOM   1978 N N   . LEU B 1 33  ? -10.216 3.845  46.357  1.00 72.06  ? 382 LEU B N   1 
ATOM   1979 C CA  . LEU B 1 33  ? -9.865  3.818  44.945  1.00 68.22  ? 382 LEU B CA  1 
ATOM   1980 C C   . LEU B 1 33  ? -10.703 2.792  44.212  1.00 67.70  ? 382 LEU B C   1 
ATOM   1981 O O   . LEU B 1 33  ? -11.004 1.730  44.743  1.00 68.99  ? 382 LEU B O   1 
ATOM   1982 C CB  . LEU B 1 33  ? -8.397  3.452  44.750  1.00 68.28  ? 382 LEU B CB  1 
ATOM   1983 C CG  . LEU B 1 33  ? -7.386  4.462  45.278  1.00 69.96  ? 382 LEU B CG  1 
ATOM   1984 C CD1 . LEU B 1 33  ? -5.961  4.024  44.952  1.00 68.12  ? 382 LEU B CD1 1 
ATOM   1985 C CD2 . LEU B 1 33  ? -7.677  5.830  44.683  1.00 67.78  ? 382 LEU B CD2 1 
ATOM   1986 N N   . ASP B 1 34  ? -11.032 3.095  42.966  1.00 66.82  ? 383 ASP B N   1 
ATOM   1987 C CA  . ASP B 1 34  ? -11.938 2.275  42.195  1.00 66.54  ? 383 ASP B CA  1 
ATOM   1988 C C   . ASP B 1 34  ? -11.217 1.681  40.977  1.00 64.76  ? 383 ASP B C   1 
ATOM   1989 O O   . ASP B 1 34  ? -11.042 2.346  39.944  1.00 67.44  ? 383 ASP B O   1 
ATOM   1990 C CB  . ASP B 1 34  ? -13.148 3.123  41.790  1.00 73.23  ? 383 ASP B CB  1 
ATOM   1991 C CG  . ASP B 1 34  ? -14.120 2.378  40.886  1.00 79.50  ? 383 ASP B CG  1 
ATOM   1992 O OD1 . ASP B 1 34  ? -13.961 1.149  40.693  1.00 70.41  ? 383 ASP B OD1 1 
ATOM   1993 O OD2 . ASP B 1 34  ? -15.045 3.044  40.367  1.00 86.07  ? 383 ASP B OD2 1 
ATOM   1994 N N   . TYR B 1 35  ? -10.840 0.407  41.099  1.00 60.56  ? 384 TYR B N   1 
ATOM   1995 C CA  . TYR B 1 35  ? -10.115 -0.298 40.033  1.00 59.93  ? 384 TYR B CA  1 
ATOM   1996 C C   . TYR B 1 35  ? -11.006 -1.041 39.074  1.00 60.72  ? 384 TYR B C   1 
ATOM   1997 O O   . TYR B 1 35  ? -10.499 -1.712 38.193  1.00 53.64  ? 384 TYR B O   1 
ATOM   1998 C CB  . TYR B 1 35  ? -9.099  -1.271 40.620  1.00 56.66  ? 384 TYR B CB  1 
ATOM   1999 C CG  . TYR B 1 35  ? -7.830  -0.601 41.042  1.00 50.88  ? 384 TYR B CG  1 
ATOM   2000 C CD1 . TYR B 1 35  ? -6.810  -0.403 40.139  1.00 49.32  ? 384 TYR B CD1 1 
ATOM   2001 C CD2 . TYR B 1 35  ? -7.665  -0.149 42.345  1.00 50.18  ? 384 TYR B CD2 1 
ATOM   2002 C CE1 . TYR B 1 35  ? -5.644  0.229  40.521  1.00 48.60  ? 384 TYR B CE1 1 
ATOM   2003 C CE2 . TYR B 1 35  ? -6.507  0.481  42.738  1.00 51.52  ? 384 TYR B CE2 1 
ATOM   2004 C CZ  . TYR B 1 35  ? -5.499  0.675  41.818  1.00 50.41  ? 384 TYR B CZ  1 
ATOM   2005 O OH  . TYR B 1 35  ? -4.345  1.307  42.216  1.00 51.33  ? 384 TYR B OH  1 
ATOM   2006 N N   . SER B 1 36  ? -12.324 -0.921 39.242  1.00 67.99  ? 385 SER B N   1 
ATOM   2007 C CA  . SER B 1 36  ? -13.287 -1.698 38.451  1.00 67.38  ? 385 SER B CA  1 
ATOM   2008 C C   . SER B 1 36  ? -13.052 -1.568 36.955  1.00 69.38  ? 385 SER B C   1 
ATOM   2009 O O   . SER B 1 36  ? -13.098 -2.552 36.233  1.00 73.20  ? 385 SER B O   1 
ATOM   2010 C CB  . SER B 1 36  ? -14.724 -1.297 38.794  1.00 69.24  ? 385 SER B CB  1 
ATOM   2011 O OG  . SER B 1 36  ? -14.873 0.117  38.818  1.00 79.52  ? 385 SER B OG  1 
ATOM   2012 N N   . LYS B 1 37  ? -12.807 -0.360 36.474  1.00 75.16  ? 386 LYS B N   1 
ATOM   2013 C CA  . LYS B 1 37  ? -12.683 -0.192 35.047  1.00 75.36  ? 386 LYS B CA  1 
ATOM   2014 C C   . LYS B 1 37  ? -11.231 -0.214 34.626  1.00 79.62  ? 386 LYS B C   1 
ATOM   2015 O O   . LYS B 1 37  ? -10.933 -0.041 33.448  1.00 81.72  ? 386 LYS B O   1 
ATOM   2016 C CB  . LYS B 1 37  ? -13.384 1.087  34.591  1.00 78.75  ? 386 LYS B CB  1 
ATOM   2017 C CG  . LYS B 1 37  ? -14.833 1.234  35.066  1.00 81.72  ? 386 LYS B CG  1 
ATOM   2018 C CD  . LYS B 1 37  ? -15.595 2.198  34.154  1.00 96.57  ? 386 LYS B CD  1 
ATOM   2019 C CE  . LYS B 1 37  ? -16.514 3.163  34.899  1.00 101.61 ? 386 LYS B CE  1 
ATOM   2020 N NZ  . LYS B 1 37  ? -16.796 4.389  34.085  1.00 95.31  ? 386 LYS B NZ  1 
ATOM   2021 N N   . PHE B 1 38  ? -10.320 -0.403 35.577  1.00 85.53  ? 387 PHE B N   1 
ATOM   2022 C CA  . PHE B 1 38  ? -8.900  -0.485 35.250  1.00 86.37  ? 387 PHE B CA  1 
ATOM   2023 C C   . PHE B 1 38  ? -8.629  -1.694 34.373  1.00 88.34  ? 387 PHE B C   1 
ATOM   2024 O O   . PHE B 1 38  ? -9.073  -2.785 34.705  1.00 88.54  ? 387 PHE B O   1 
ATOM   2025 C CB  . PHE B 1 38  ? -8.036  -0.581 36.519  1.00 86.78  ? 387 PHE B CB  1 
ATOM   2026 C CG  . PHE B 1 38  ? -6.566  -0.494 36.238  1.00 84.67  ? 387 PHE B CG  1 
ATOM   2027 C CD1 . PHE B 1 38  ? -5.996  0.709  35.863  1.00 84.42  ? 387 PHE B CD1 1 
ATOM   2028 C CD2 . PHE B 1 38  ? -5.761  -1.613 36.306  1.00 87.30  ? 387 PHE B CD2 1 
ATOM   2029 C CE1 . PHE B 1 38  ? -4.648  0.793  35.565  1.00 83.20  ? 387 PHE B CE1 1 
ATOM   2030 C CE2 . PHE B 1 38  ? -4.409  -1.533 36.019  1.00 90.31  ? 387 PHE B CE2 1 
ATOM   2031 C CZ  . PHE B 1 38  ? -3.851  -0.325 35.641  1.00 85.55  ? 387 PHE B CZ  1 
ATOM   2032 N N   . GLN B 1 39  ? -7.925  -1.483 33.256  1.00 99.07  ? 388 GLN B N   1 
ATOM   2033 C CA  . GLN B 1 39  ? -7.446  -2.562 32.373  1.00 106.31 ? 388 GLN B CA  1 
ATOM   2034 C C   . GLN B 1 39  ? -5.976  -2.339 32.040  1.00 118.22 ? 388 GLN B C   1 
ATOM   2035 O O   . GLN B 1 39  ? -5.614  -1.304 31.466  1.00 126.02 ? 388 GLN B O   1 
ATOM   2036 C CB  . GLN B 1 39  ? -8.187  -2.590 31.025  1.00 106.20 ? 388 GLN B CB  1 
ATOM   2037 C CG  . GLN B 1 39  ? -9.687  -2.890 31.020  1.00 108.58 ? 388 GLN B CG  1 
ATOM   2038 C CD  . GLN B 1 39  ? -10.054 -4.306 31.436  1.00 106.30 ? 388 GLN B CD  1 
ATOM   2039 O OE1 . GLN B 1 39  ? -9.215  -5.210 31.504  1.00 96.75  ? 388 GLN B OE1 1 
ATOM   2040 N NE2 . GLN B 1 39  ? -11.339 -4.501 31.716  1.00 111.06 ? 388 GLN B NE2 1 
ATOM   2041 N N   . GLU B 1 40  ? -5.143  -3.333 32.346  1.00 131.92 ? 389 GLU B N   1 
ATOM   2042 C CA  . GLU B 1 40  ? -3.707  -3.284 32.037  1.00 134.88 ? 389 GLU B CA  1 
ATOM   2043 C C   . GLU B 1 40  ? -3.470  -3.272 30.521  1.00 137.94 ? 389 GLU B C   1 
ATOM   2044 O O   . GLU B 1 40  ? -2.524  -2.653 30.035  1.00 127.54 ? 389 GLU B O   1 
ATOM   2045 C CB  . GLU B 1 40  ? -2.982  -4.493 32.633  1.00 130.10 ? 389 GLU B CB  1 
ATOM   2046 C CG  . GLU B 1 40  ? -1.469  -4.319 32.747  1.00 133.39 ? 389 GLU B CG  1 
ATOM   2047 C CD  . GLU B 1 40  ? -1.007  -3.381 33.864  1.00 134.56 ? 389 GLU B CD  1 
ATOM   2048 O OE1 . GLU B 1 40  ? -1.510  -3.456 35.010  1.00 132.38 ? 389 GLU B OE1 1 
ATOM   2049 O OE2 . GLU B 1 40  ? -0.102  -2.561 33.594  1.00 129.76 ? 389 GLU B OE2 1 
ATOM   2050 N N   . LEU B 1 41  ? -4.349  -3.955 29.792  1.00 134.75 ? 390 LEU B N   1 
ATOM   2051 C CA  . LEU B 1 41  ? -4.131  -4.297 28.394  1.00 134.94 ? 390 LEU B CA  1 
ATOM   2052 C C   . LEU B 1 41  ? -5.342  -3.881 27.530  1.00 129.54 ? 390 LEU B C   1 
ATOM   2053 O O   . LEU B 1 41  ? -6.475  -3.845 28.020  1.00 132.97 ? 390 LEU B O   1 
ATOM   2054 C CB  . LEU B 1 41  ? -3.876  -5.819 28.332  1.00 135.41 ? 390 LEU B CB  1 
ATOM   2055 C CG  . LEU B 1 41  ? -2.926  -6.456 27.296  1.00 128.56 ? 390 LEU B CG  1 
ATOM   2056 C CD1 . LEU B 1 41  ? -2.337  -7.773 27.786  1.00 115.99 ? 390 LEU B CD1 1 
ATOM   2057 C CD2 . LEU B 1 41  ? -3.622  -6.654 25.955  1.00 130.68 ? 390 LEU B CD2 1 
ATOM   2058 N N   . VAL B 1 42  ? -5.081  -3.548 26.263  1.00 119.73 ? 391 VAL B N   1 
ATOM   2059 C CA  . VAL B 1 42  ? -6.120  -3.109 25.291  1.00 127.60 ? 391 VAL B CA  1 
ATOM   2060 C C   . VAL B 1 42  ? -5.525  -2.934 23.884  1.00 130.31 ? 391 VAL B C   1 
ATOM   2061 O O   . VAL B 1 42  ? -4.317  -3.085 23.713  1.00 125.64 ? 391 VAL B O   1 
ATOM   2062 C CB  . VAL B 1 42  ? -6.756  -1.727 25.654  1.00 133.17 ? 391 VAL B CB  1 
ATOM   2063 C CG1 . VAL B 1 42  ? -7.832  -1.843 26.733  1.00 131.71 ? 391 VAL B CG1 1 
ATOM   2064 C CG2 . VAL B 1 42  ? -5.694  -0.709 26.059  1.00 132.46 ? 391 VAL B CG2 1 
ATOM   2065 N N   . LEU B 1 43  ? -6.387  -2.633 22.898  1.00 129.19 ? 392 LEU B N   1 
ATOM   2066 C CA  . LEU B 1 43  ? -5.993  -1.996 21.584  1.00 123.20 ? 392 LEU B CA  1 
ATOM   2067 C C   . LEU B 1 43  ? -7.214  -1.764 20.637  1.00 127.60 ? 392 LEU B C   1 
ATOM   2068 O O   . LEU B 1 43  ? -8.263  -2.392 20.822  1.00 122.52 ? 392 LEU B O   1 
ATOM   2069 C CB  . LEU B 1 43  ? -4.821  -2.713 20.854  1.00 115.63 ? 392 LEU B CB  1 
ATOM   2070 C CG  . LEU B 1 43  ? -5.083  -3.600 19.630  1.00 111.10 ? 392 LEU B CG  1 
ATOM   2071 C CD1 . LEU B 1 43  ? -4.027  -3.379 18.556  1.00 114.55 ? 392 LEU B CD1 1 
ATOM   2072 C CD2 . LEU B 1 43  ? -5.165  -5.077 20.010  1.00 103.86 ? 392 LEU B CD2 1 
ATOM   2073 N N   . PRO B 1 44  ? -7.077  -0.890 19.604  1.00 132.29 ? 393 PRO B N   1 
ATOM   2074 C CA  . PRO B 1 44  ? -5.888  -0.210 19.093  1.00 130.88 ? 393 PRO B CA  1 
ATOM   2075 C C   . PRO B 1 44  ? -5.741  1.236  19.587  1.00 117.42 ? 393 PRO B C   1 
ATOM   2076 O O   . PRO B 1 44  ? -5.276  2.102  18.840  1.00 102.56 ? 393 PRO B O   1 
ATOM   2077 C CB  . PRO B 1 44  ? -6.121  -0.234 17.573  1.00 130.68 ? 393 PRO B CB  1 
ATOM   2078 C CG  . PRO B 1 44  ? -7.612  -0.381 17.396  1.00 128.40 ? 393 PRO B CG  1 
ATOM   2079 C CD  . PRO B 1 44  ? -8.235  -0.573 18.749  1.00 128.22 ? 393 PRO B CD  1 
ATOM   2080 N N   . LYS B 1 48  ? -9.688  8.312  14.886  1.00 120.21 ? 397 LYS B N   1 
ATOM   2081 C CA  . LYS B 1 48  ? -8.837  7.804  15.965  1.00 118.28 ? 397 LYS B CA  1 
ATOM   2082 C C   . LYS B 1 48  ? -9.634  7.526  17.241  1.00 112.08 ? 397 LYS B C   1 
ATOM   2083 O O   . LYS B 1 48  ? -9.328  6.571  17.971  1.00 110.53 ? 397 LYS B O   1 
ATOM   2084 C CB  . LYS B 1 48  ? -7.711  8.811  16.234  1.00 122.54 ? 397 LYS B CB  1 
ATOM   2085 C CG  . LYS B 1 48  ? -6.687  8.449  17.318  1.00 122.16 ? 397 LYS B CG  1 
ATOM   2086 C CD  . LYS B 1 48  ? -6.951  9.178  18.630  1.00 121.99 ? 397 LYS B CD  1 
ATOM   2087 C CE  . LYS B 1 48  ? -6.275  10.537 18.733  1.00 115.83 ? 397 LYS B CE  1 
ATOM   2088 N NZ  . LYS B 1 48  ? -5.027  10.513 19.540  1.00 111.92 ? 397 LYS B NZ  1 
ATOM   2089 N N   . GLU B 1 49  ? -10.643 8.359  17.512  1.00 101.48 ? 398 GLU B N   1 
ATOM   2090 C CA  . GLU B 1 49  ? -11.461 8.194  18.705  1.00 101.40 ? 398 GLU B CA  1 
ATOM   2091 C C   . GLU B 1 49  ? -12.938 8.295  18.391  1.00 91.87  ? 398 GLU B C   1 
ATOM   2092 O O   . GLU B 1 49  ? -13.338 8.958  17.447  1.00 88.18  ? 398 GLU B O   1 
ATOM   2093 C CB  . GLU B 1 49  ? -11.121 9.217  19.800  1.00 107.64 ? 398 GLU B CB  1 
ATOM   2094 C CG  . GLU B 1 49  ? -11.614 10.636 19.530  1.00 108.54 ? 398 GLU B CG  1 
ATOM   2095 C CD  . GLU B 1 49  ? -10.733 11.386 18.544  1.00 112.68 ? 398 GLU B CD  1 
ATOM   2096 O OE1 . GLU B 1 49  ? -9.516  11.101 18.437  1.00 122.44 ? 398 GLU B OE1 1 
ATOM   2097 O OE2 . GLU B 1 49  ? -11.259 12.273 17.852  1.00 107.11 ? 398 GLU B OE2 1 
ATOM   2098 N N   . ASP B 1 50  ? -13.740 7.666  19.233  1.00 84.08  ? 399 ASP B N   1 
ATOM   2099 C CA  . ASP B 1 50  ? -15.177 7.668  19.065  1.00 84.92  ? 399 ASP B CA  1 
ATOM   2100 C C   . ASP B 1 50  ? -15.838 8.547  20.120  1.00 87.54  ? 399 ASP B C   1 
ATOM   2101 O O   . ASP B 1 50  ? -15.168 9.139  20.978  1.00 91.34  ? 399 ASP B O   1 
ATOM   2102 C CB  . ASP B 1 50  ? -15.711 6.237  19.119  1.00 88.41  ? 399 ASP B CB  1 
ATOM   2103 C CG  . ASP B 1 50  ? -15.348 5.523  20.397  1.00 94.71  ? 399 ASP B CG  1 
ATOM   2104 O OD1 . ASP B 1 50  ? -15.837 5.904  21.486  1.00 98.92  ? 399 ASP B OD1 1 
ATOM   2105 O OD2 . ASP B 1 50  ? -14.545 4.583  20.315  1.00 99.84  ? 399 ASP B OD2 1 
ATOM   2106 N N   . ALA B 1 51  ? -17.162 8.627  20.056  1.00 86.58  ? 400 ALA B N   1 
ATOM   2107 C CA  . ALA B 1 51  ? -17.924 9.524  20.924  1.00 83.47  ? 400 ALA B CA  1 
ATOM   2108 C C   . ALA B 1 51  ? -17.818 9.153  22.392  1.00 79.64  ? 400 ALA B C   1 
ATOM   2109 O O   . ALA B 1 51  ? -17.917 10.012 23.257  1.00 80.00  ? 400 ALA B O   1 
ATOM   2110 C CB  . ALA B 1 51  ? -19.379 9.544  20.493  1.00 87.46  ? 400 ALA B CB  1 
ATOM   2111 N N   . GLY B 1 52  ? -17.632 7.865  22.662  1.00 79.92  ? 401 GLY B N   1 
ATOM   2112 C CA  . GLY B 1 52  ? -17.497 7.365  24.023  1.00 77.37  ? 401 GLY B CA  1 
ATOM   2113 C C   . GLY B 1 52  ? -16.187 7.791  24.646  1.00 74.81  ? 401 GLY B C   1 
ATOM   2114 O O   . GLY B 1 52  ? -16.120 8.067  25.846  1.00 73.49  ? 401 GLY B O   1 
ATOM   2115 N N   . ASP B 1 53  ? -15.151 7.893  23.820  1.00 72.81  ? 402 ASP B N   1 
ATOM   2116 C CA  . ASP B 1 53  ? -13.856 8.402  24.278  1.00 72.90  ? 402 ASP B CA  1 
ATOM   2117 C C   . ASP B 1 53  ? -13.972 9.876  24.654  1.00 69.60  ? 402 ASP B C   1 
ATOM   2118 O O   . ASP B 1 53  ? -13.502 10.310 25.703  1.00 66.54  ? 402 ASP B O   1 
ATOM   2119 C CB  . ASP B 1 53  ? -12.791 8.230  23.198  1.00 75.63  ? 402 ASP B CB  1 
ATOM   2120 C CG  . ASP B 1 53  ? -12.510 6.766  22.881  1.00 74.64  ? 402 ASP B CG  1 
ATOM   2121 O OD1 . ASP B 1 53  ? -12.702 5.900  23.759  1.00 70.68  ? 402 ASP B OD1 1 
ATOM   2122 O OD2 . ASP B 1 53  ? -12.110 6.478  21.739  1.00 71.49  ? 402 ASP B OD2 1 
ATOM   2123 N N   . VAL B 1 54  ? -14.647 10.628 23.804  1.00 67.89  ? 403 VAL B N   1 
ATOM   2124 C CA  . VAL B 1 54  ? -14.770 12.058 24.004  1.00 68.97  ? 403 VAL B CA  1 
ATOM   2125 C C   . VAL B 1 54  ? -15.661 12.355 25.208  1.00 66.84  ? 403 VAL B C   1 
ATOM   2126 O O   . VAL B 1 54  ? -15.402 13.278 25.979  1.00 64.70  ? 403 VAL B O   1 
ATOM   2127 C CB  . VAL B 1 54  ? -15.303 12.725 22.725  1.00 69.98  ? 403 VAL B CB  1 
ATOM   2128 C CG1 . VAL B 1 54  ? -15.541 14.207 22.935  1.00 72.66  ? 403 VAL B CG1 1 
ATOM   2129 C CG2 . VAL B 1 54  ? -14.307 12.524 21.594  1.00 72.33  ? 403 VAL B CG2 1 
ATOM   2130 N N   . GLN B 1 55  ? -16.710 11.563 25.369  1.00 67.52  ? 404 GLN B N   1 
ATOM   2131 C CA  . GLN B 1 55  ? -17.623 11.735 26.494  1.00 65.19  ? 404 GLN B CA  1 
ATOM   2132 C C   . GLN B 1 55  ? -16.893 11.478 27.820  1.00 63.45  ? 404 GLN B C   1 
ATOM   2133 O O   . GLN B 1 55  ? -17.049 12.215 28.789  1.00 59.85  ? 404 GLN B O   1 
ATOM   2134 C CB  . GLN B 1 55  ? -18.819 10.785 26.343  1.00 64.08  ? 404 GLN B CB  1 
ATOM   2135 C CG  . GLN B 1 55  ? -19.949 11.038 27.322  1.00 65.98  ? 404 GLN B CG  1 
ATOM   2136 C CD  . GLN B 1 55  ? -20.523 12.430 27.177  1.00 69.08  ? 404 GLN B CD  1 
ATOM   2137 O OE1 . GLN B 1 55  ? -20.966 12.821 26.087  1.00 75.11  ? 404 GLN B OE1 1 
ATOM   2138 N NE2 . GLN B 1 55  ? -20.472 13.212 28.260  1.00 66.50  ? 404 GLN B NE2 1 
ATOM   2139 N N   . GLN B 1 56  ? -16.075 10.435 27.842  1.00 61.50  ? 405 GLN B N   1 
ATOM   2140 C CA  . GLN B 1 56  ? -15.335 10.097 29.034  1.00 60.66  ? 405 GLN B CA  1 
ATOM   2141 C C   . GLN B 1 56  ? -14.380 11.221 29.400  1.00 57.65  ? 405 GLN B C   1 
ATOM   2142 O O   . GLN B 1 56  ? -14.252 11.585 30.561  1.00 59.95  ? 405 GLN B O   1 
ATOM   2143 C CB  . GLN B 1 56  ? -14.564 8.809  28.795  1.00 64.42  ? 405 GLN B CB  1 
ATOM   2144 C CG  . GLN B 1 56  ? -13.677 8.290  29.917  1.00 68.47  ? 405 GLN B CG  1 
ATOM   2145 C CD  . GLN B 1 56  ? -12.531 7.471  29.355  1.00 71.08  ? 405 GLN B CD  1 
ATOM   2146 O OE1 . GLN B 1 56  ? -12.495 6.258  29.516  1.00 78.59  ? 405 GLN B OE1 1 
ATOM   2147 N NE2 . GLN B 1 56  ? -11.599 8.137  28.667  1.00 70.48  ? 405 GLN B NE2 1 
ATOM   2148 N N   . PHE B 1 57  ? -13.710 11.769 28.403  1.00 56.21  ? 406 PHE B N   1 
ATOM   2149 C CA  . PHE B 1 57  ? -12.829 12.908 28.609  1.00 53.47  ? 406 PHE B CA  1 
ATOM   2150 C C   . PHE B 1 57  ? -13.563 14.064 29.283  1.00 52.79  ? 406 PHE B C   1 
ATOM   2151 O O   . PHE B 1 57  ? -13.115 14.600 30.297  1.00 53.82  ? 406 PHE B O   1 
ATOM   2152 C CB  . PHE B 1 57  ? -12.325 13.345 27.249  1.00 54.38  ? 406 PHE B CB  1 
ATOM   2153 C CG  . PHE B 1 57  ? -11.563 14.619 27.249  1.00 55.45  ? 406 PHE B CG  1 
ATOM   2154 C CD1 . PHE B 1 57  ? -10.258 14.648 27.690  1.00 57.28  ? 406 PHE B CD1 1 
ATOM   2155 C CD2 . PHE B 1 57  ? -12.138 15.792 26.772  1.00 54.73  ? 406 PHE B CD2 1 
ATOM   2156 C CE1 . PHE B 1 57  ? -9.529  15.829 27.678  1.00 57.14  ? 406 PHE B CE1 1 
ATOM   2157 C CE2 . PHE B 1 57  ? -11.413 16.972 26.753  1.00 54.40  ? 406 PHE B CE2 1 
ATOM   2158 C CZ  . PHE B 1 57  ? -10.097 16.990 27.201  1.00 53.59  ? 406 PHE B CZ  1 
ATOM   2159 N N   . TYR B 1 58  ? -14.704 14.441 28.724  1.00 53.96  ? 407 TYR B N   1 
ATOM   2160 C CA  . TYR B 1 58  ? -15.484 15.543 29.272  1.00 56.38  ? 407 TYR B CA  1 
ATOM   2161 C C   . TYR B 1 58  ? -16.039 15.197 30.641  1.00 59.72  ? 407 TYR B C   1 
ATOM   2162 O O   . TYR B 1 58  ? -16.032 16.041 31.540  1.00 58.77  ? 407 TYR B O   1 
ATOM   2163 C CB  . TYR B 1 58  ? -16.633 15.908 28.350  1.00 58.90  ? 407 TYR B CB  1 
ATOM   2164 C CG  . TYR B 1 58  ? -16.222 16.696 27.124  1.00 66.46  ? 407 TYR B CG  1 
ATOM   2165 C CD1 . TYR B 1 58  ? -15.424 17.830 27.232  1.00 65.01  ? 407 TYR B CD1 1 
ATOM   2166 C CD2 . TYR B 1 58  ? -16.660 16.324 25.848  1.00 70.38  ? 407 TYR B CD2 1 
ATOM   2167 C CE1 . TYR B 1 58  ? -15.056 18.565 26.112  1.00 64.42  ? 407 TYR B CE1 1 
ATOM   2168 C CE2 . TYR B 1 58  ? -16.301 17.060 24.726  1.00 70.51  ? 407 TYR B CE2 1 
ATOM   2169 C CZ  . TYR B 1 58  ? -15.494 18.185 24.866  1.00 68.22  ? 407 TYR B CZ  1 
ATOM   2170 O OH  . TYR B 1 58  ? -15.149 18.947 23.768  1.00 68.52  ? 407 TYR B OH  1 
ATOM   2171 N N   . ASP B 1 59  ? -16.500 13.958 30.811  1.00 60.91  ? 408 ASP B N   1 
ATOM   2172 C CA  . ASP B 1 59  ? -16.994 13.516 32.115  1.00 60.24  ? 408 ASP B CA  1 
ATOM   2173 C C   . ASP B 1 59  ? -15.907 13.683 33.166  1.00 60.61  ? 408 ASP B C   1 
ATOM   2174 O O   . ASP B 1 59  ? -16.170 14.212 34.245  1.00 59.59  ? 408 ASP B O   1 
ATOM   2175 C CB  . ASP B 1 59  ? -17.463 12.060 32.109  1.00 58.90  ? 408 ASP B CB  1 
ATOM   2176 C CG  . ASP B 1 59  ? -18.721 11.864 31.313  1.00 63.04  ? 408 ASP B CG  1 
ATOM   2177 O OD1 . ASP B 1 59  ? -19.353 12.876 30.916  1.00 65.08  ? 408 ASP B OD1 1 
ATOM   2178 O OD2 . ASP B 1 59  ? -19.076 10.696 31.058  1.00 67.58  ? 408 ASP B OD2 1 
ATOM   2179 N N   . LEU B 1 60  ? -14.692 13.261 32.842  1.00 56.35  ? 409 LEU B N   1 
ATOM   2180 C CA  . LEU B 1 60  ? -13.603 13.328 33.801  1.00 59.03  ? 409 LEU B CA  1 
ATOM   2181 C C   . LEU B 1 60  ? -13.261 14.759 34.198  1.00 58.19  ? 409 LEU B C   1 
ATOM   2182 O O   . LEU B 1 60  ? -13.023 15.047 35.373  1.00 57.55  ? 409 LEU B O   1 
ATOM   2183 C CB  . LEU B 1 60  ? -12.380 12.652 33.227  1.00 63.61  ? 409 LEU B CB  1 
ATOM   2184 C CG  . LEU B 1 60  ? -12.528 11.140 33.079  1.00 68.97  ? 409 LEU B CG  1 
ATOM   2185 C CD1 . LEU B 1 60  ? -11.489 10.624 32.104  1.00 71.41  ? 409 LEU B CD1 1 
ATOM   2186 C CD2 . LEU B 1 60  ? -12.413 10.426 34.415  1.00 70.41  ? 409 LEU B CD2 1 
ATOM   2187 N N   . LEU B 1 61  ? -13.235 15.652 33.214  1.00 55.65  ? 410 LEU B N   1 
ATOM   2188 C CA  . LEU B 1 61  ? -13.078 17.075 33.492  1.00 58.37  ? 410 LEU B CA  1 
ATOM   2189 C C   . LEU B 1 61  ? -14.200 17.579 34.389  1.00 59.17  ? 410 LEU B C   1 
ATOM   2190 O O   . LEU B 1 61  ? -13.935 18.251 35.394  1.00 49.89  ? 410 LEU B O   1 
ATOM   2191 C CB  . LEU B 1 61  ? -13.078 17.888 32.185  1.00 62.70  ? 410 LEU B CB  1 
ATOM   2192 C CG  . LEU B 1 61  ? -11.847 17.855 31.282  1.00 62.48  ? 410 LEU B CG  1 
ATOM   2193 C CD1 . LEU B 1 61  ? -12.023 18.862 30.168  1.00 64.04  ? 410 LEU B CD1 1 
ATOM   2194 C CD2 . LEU B 1 61  ? -10.579 18.195 32.033  1.00 60.15  ? 410 LEU B CD2 1 
ATOM   2195 N N   . SER B 1 62  ? -15.446 17.275 33.989  1.00 60.17  ? 411 SER B N   1 
ATOM   2196 C CA  . SER B 1 62  ? -16.636 17.715 34.712  1.00 62.90  ? 411 SER B CA  1 
ATOM   2197 C C   . SER B 1 62  ? -16.578 17.262 36.156  1.00 63.41  ? 411 SER B C   1 
ATOM   2198 O O   . SER B 1 62  ? -16.880 18.017 37.074  1.00 66.04  ? 411 SER B O   1 
ATOM   2199 C CB  . SER B 1 62  ? -17.898 17.143 34.082  1.00 69.25  ? 411 SER B CB  1 
ATOM   2200 O OG  . SER B 1 62  ? -18.124 17.675 32.788  1.00 75.76  ? 411 SER B OG  1 
ATOM   2201 N N   . GLY B 1 63  ? -16.167 16.022 36.355  1.00 62.20  ? 412 GLY B N   1 
ATOM   2202 C CA  . GLY B 1 63  ? -16.063 15.459 37.693  1.00 58.58  ? 412 GLY B CA  1 
ATOM   2203 C C   . GLY B 1 63  ? -15.124 16.222 38.578  1.00 56.39  ? 412 GLY B C   1 
ATOM   2204 O O   . GLY B 1 63  ? -15.316 16.271 39.768  1.00 65.79  ? 412 GLY B O   1 
ATOM   2205 N N   . SER B 1 64  ? -14.106 16.835 38.003  1.00 59.62  ? 413 SER B N   1 
ATOM   2206 C CA  . SER B 1 64  ? -13.129 17.585 38.798  1.00 59.13  ? 413 SER B CA  1 
ATOM   2207 C C   . SER B 1 64  ? -13.679 18.956 39.239  1.00 60.22  ? 413 SER B C   1 
ATOM   2208 O O   . SER B 1 64  ? -13.254 19.516 40.261  1.00 64.21  ? 413 SER B O   1 
ATOM   2209 C CB  . SER B 1 64  ? -11.813 17.695 38.007  1.00 59.34  ? 413 SER B CB  1 
ATOM   2210 O OG  . SER B 1 64  ? -10.685 17.639 38.859  1.00 60.02  ? 413 SER B OG  1 
ATOM   2211 N N   . LEU B 1 65  ? -14.669 19.464 38.507  1.00 63.06  ? 414 LEU B N   1 
ATOM   2212 C CA  . LEU B 1 65  ? -15.179 20.835 38.713  1.00 66.09  ? 414 LEU B CA  1 
ATOM   2213 C C   . LEU B 1 65  ? -15.650 21.155 40.104  1.00 61.32  ? 414 LEU B C   1 
ATOM   2214 O O   . LEU B 1 65  ? -15.183 22.108 40.728  1.00 60.58  ? 414 LEU B O   1 
ATOM   2215 C CB  . LEU B 1 65  ? -16.413 21.089 37.832  1.00 68.68  ? 414 LEU B CB  1 
ATOM   2216 C CG  . LEU B 1 65  ? -16.207 21.444 36.363  1.00 72.74  ? 414 LEU B CG  1 
ATOM   2217 C CD1 . LEU B 1 65  ? -17.506 21.296 35.547  1.00 67.60  ? 414 LEU B CD1 1 
ATOM   2218 C CD2 . LEU B 1 65  ? -15.593 22.848 36.272  1.00 69.60  ? 414 LEU B CD2 1 
ATOM   2219 N N   . GLU B 1 66  ? -16.636 20.386 40.544  1.00 63.67  ? 415 GLU B N   1 
ATOM   2220 C CA  . GLU B 1 66  ? -17.306 20.657 41.808  1.00 72.08  ? 415 GLU B CA  1 
ATOM   2221 C C   . GLU B 1 66  ? -16.394 20.352 42.959  1.00 67.25  ? 415 GLU B C   1 
ATOM   2222 O O   . GLU B 1 66  ? -16.506 21.001 43.978  1.00 64.54  ? 415 GLU B O   1 
ATOM   2223 C CB  . GLU B 1 66  ? -18.631 19.924 41.982  1.00 84.15  ? 415 GLU B CB  1 
ATOM   2224 C CG  . GLU B 1 66  ? -18.714 18.584 41.284  1.00 102.84 ? 415 GLU B CG  1 
ATOM   2225 C CD  . GLU B 1 66  ? -18.924 18.682 39.754  1.00 113.70 ? 415 GLU B CD  1 
ATOM   2226 O OE1 . GLU B 1 66  ? -18.333 17.892 38.969  1.00 113.82 ? 415 GLU B OE1 1 
ATOM   2227 O OE2 . GLU B 1 66  ? -19.701 19.560 39.320  1.00 130.93 ? 415 GLU B OE2 1 
ATOM   2228 N N   . VAL B 1 67  ? -15.485 19.392 42.793  1.00 62.29  ? 416 VAL B N   1 
ATOM   2229 C CA  . VAL B 1 67  ? -14.493 19.110 43.822  1.00 60.09  ? 416 VAL B CA  1 
ATOM   2230 C C   . VAL B 1 67  ? -13.616 20.329 44.058  1.00 60.83  ? 416 VAL B C   1 
ATOM   2231 O O   . VAL B 1 67  ? -13.292 20.677 45.210  1.00 62.68  ? 416 VAL B O   1 
ATOM   2232 C CB  . VAL B 1 67  ? -13.583 17.928 43.438  1.00 60.39  ? 416 VAL B CB  1 
ATOM   2233 C CG1 . VAL B 1 67  ? -12.458 17.745 44.447  1.00 61.09  ? 416 VAL B CG1 1 
ATOM   2234 C CG2 . VAL B 1 67  ? -14.405 16.654 43.346  1.00 63.26  ? 416 VAL B CG2 1 
ATOM   2235 N N   . ILE B 1 68  ? -13.212 20.973 42.975  1.00 53.82  ? 417 ILE B N   1 
ATOM   2236 C CA  . ILE B 1 68  ? -12.296 22.066 43.122  1.00 53.36  ? 417 ILE B CA  1 
ATOM   2237 C C   . ILE B 1 68  ? -12.966 23.277 43.755  1.00 53.85  ? 417 ILE B C   1 
ATOM   2238 O O   . ILE B 1 68  ? -12.383 23.871 44.678  1.00 54.55  ? 417 ILE B O   1 
ATOM   2239 C CB  . ILE B 1 68  ? -11.609 22.398 41.807  1.00 57.13  ? 417 ILE B CB  1 
ATOM   2240 C CG1 . ILE B 1 68  ? -10.677 21.247 41.448  1.00 59.01  ? 417 ILE B CG1 1 
ATOM   2241 C CG2 . ILE B 1 68  ? -10.798 23.677 41.959  1.00 57.03  ? 417 ILE B CG2 1 
ATOM   2242 C CD1 . ILE B 1 68  ? -10.145 21.274 40.039  1.00 60.14  ? 417 ILE B CD1 1 
ATOM   2243 N N   . ARG B 1 69  ? -14.177 23.630 43.315  1.00 52.76  ? 418 ARG B N   1 
ATOM   2244 C CA  . ARG B 1 69  ? -14.913 24.710 43.987  1.00 55.86  ? 418 ARG B CA  1 
ATOM   2245 C C   . ARG B 1 69  ? -15.023 24.475 45.520  1.00 54.48  ? 418 ARG B C   1 
ATOM   2246 O O   . ARG B 1 69  ? -14.728 25.374 46.317  1.00 48.68  ? 418 ARG B O   1 
ATOM   2247 C CB  . ARG B 1 69  ? -16.239 25.019 43.297  1.00 63.60  ? 418 ARG B CB  1 
ATOM   2248 C CG  . ARG B 1 69  ? -17.446 24.184 43.691  1.00 81.11  ? 418 ARG B CG  1 
ATOM   2249 C CD  . ARG B 1 69  ? -18.742 24.785 43.159  1.00 91.02  ? 418 ARG B CD  1 
ATOM   2250 N NE  . ARG B 1 69  ? -18.487 25.943 42.286  1.00 97.12  ? 418 ARG B NE  1 
ATOM   2251 C CZ  . ARG B 1 69  ? -18.214 25.877 40.979  1.00 103.57 ? 418 ARG B CZ  1 
ATOM   2252 N NH1 . ARG B 1 69  ? -18.164 24.706 40.342  1.00 103.72 ? 418 ARG B NH1 1 
ATOM   2253 N NH2 . ARG B 1 69  ? -17.989 26.998 40.300  1.00 105.18 ? 418 ARG B NH2 1 
ATOM   2254 N N   . LYS B 1 70  ? -15.347 23.247 45.927  1.00 57.51  ? 419 LYS B N   1 
ATOM   2255 C CA  . LYS B 1 70  ? -15.477 22.933 47.344  1.00 56.13  ? 419 LYS B CA  1 
ATOM   2256 C C   . LYS B 1 70  ? -14.142 23.030 48.042  1.00 53.96  ? 419 LYS B C   1 
ATOM   2257 O O   . LYS B 1 70  ? -14.061 23.620 49.113  1.00 55.84  ? 419 LYS B O   1 
ATOM   2258 C CB  . LYS B 1 70  ? -16.111 21.564 47.548  1.00 58.37  ? 419 LYS B CB  1 
ATOM   2259 C CG  . LYS B 1 70  ? -17.563 21.553 47.086  1.00 65.62  ? 419 LYS B CG  1 
ATOM   2260 C CD  . LYS B 1 70  ? -18.365 20.338 47.544  1.00 76.68  ? 419 LYS B CD  1 
ATOM   2261 C CE  . LYS B 1 70  ? -17.853 19.028 46.936  1.00 83.36  ? 419 LYS B CE  1 
ATOM   2262 N NZ  . LYS B 1 70  ? -18.965 18.144 46.489  1.00 83.86  ? 419 LYS B NZ  1 
ATOM   2263 N N   . TRP B 1 71  ? -13.090 22.504 47.419  1.00 49.49  ? 420 TRP B N   1 
ATOM   2264 C CA  . TRP B 1 71  ? -11.711 22.709 47.920  1.00 47.70  ? 420 TRP B CA  1 
ATOM   2265 C C   . TRP B 1 71  ? -11.319 24.203 48.070  1.00 48.23  ? 420 TRP B C   1 
ATOM   2266 O O   . TRP B 1 71  ? -10.803 24.620 49.114  1.00 48.35  ? 420 TRP B O   1 
ATOM   2267 C CB  . TRP B 1 71  ? -10.704 21.988 47.005  1.00 43.61  ? 420 TRP B CB  1 
ATOM   2268 C CG  . TRP B 1 71  ? -9.295  22.424 47.151  1.00 40.71  ? 420 TRP B CG  1 
ATOM   2269 C CD1 . TRP B 1 71  ? -8.419  22.011 48.092  1.00 44.03  ? 420 TRP B CD1 1 
ATOM   2270 C CD2 . TRP B 1 71  ? -8.582  23.335 46.321  1.00 41.24  ? 420 TRP B CD2 1 
ATOM   2271 N NE1 . TRP B 1 71  ? -7.198  22.613 47.919  1.00 44.26  ? 420 TRP B NE1 1 
ATOM   2272 C CE2 . TRP B 1 71  ? -7.270  23.428 46.829  1.00 43.88  ? 420 TRP B CE2 1 
ATOM   2273 C CE3 . TRP B 1 71  ? -8.915  24.075 45.188  1.00 43.88  ? 420 TRP B CE3 1 
ATOM   2274 C CZ2 . TRP B 1 71  ? -6.290  24.246 46.253  1.00 45.90  ? 420 TRP B CZ2 1 
ATOM   2275 C CZ3 . TRP B 1 71  ? -7.937  24.879 44.600  1.00 42.19  ? 420 TRP B CZ3 1 
ATOM   2276 C CH2 . TRP B 1 71  ? -6.642  24.963 45.141  1.00 43.24  ? 420 TRP B CH2 1 
ATOM   2277 N N   . ALA B 1 72  ? -11.568 25.003 47.037  1.00 47.15  ? 421 ALA B N   1 
ATOM   2278 C CA  . ALA B 1 72  ? -11.191 26.406 47.076  1.00 47.53  ? 421 ALA B CA  1 
ATOM   2279 C C   . ALA B 1 72  ? -11.830 27.112 48.253  1.00 52.96  ? 421 ALA B C   1 
ATOM   2280 O O   . ALA B 1 72  ? -11.172 27.901 48.940  1.00 50.14  ? 421 ALA B O   1 
ATOM   2281 C CB  . ALA B 1 72  ? -11.596 27.096 45.804  1.00 47.24  ? 421 ALA B CB  1 
ATOM   2282 N N   . GLU B 1 73  ? -13.107 26.818 48.502  1.00 59.86  ? 422 GLU B N   1 
ATOM   2283 C CA  . GLU B 1 73  ? -13.858 27.507 49.557  1.00 67.43  ? 422 GLU B CA  1 
ATOM   2284 C C   . GLU B 1 73  ? -13.325 27.225 50.951  1.00 67.76  ? 422 GLU B C   1 
ATOM   2285 O O   . GLU B 1 73  ? -13.536 28.026 51.859  1.00 69.50  ? 422 GLU B O   1 
ATOM   2286 C CB  . GLU B 1 73  ? -15.334 27.145 49.489  1.00 71.67  ? 422 GLU B CB  1 
ATOM   2287 C CG  . GLU B 1 73  ? -15.998 27.631 48.203  1.00 80.05  ? 422 GLU B CG  1 
ATOM   2288 C CD  . GLU B 1 73  ? -16.014 29.156 48.062  1.00 84.94  ? 422 GLU B CD  1 
ATOM   2289 O OE1 . GLU B 1 73  ? -16.155 29.879 49.076  1.00 93.98  ? 422 GLU B OE1 1 
ATOM   2290 O OE2 . GLU B 1 73  ? -15.898 29.644 46.927  1.00 79.44  ? 422 GLU B OE2 1 
ATOM   2291 N N   . LYS B 1 74  ? -12.609 26.115 51.105  1.00 64.55  ? 423 LYS B N   1 
ATOM   2292 C CA  . LYS B 1 74  ? -11.976 25.782 52.371  1.00 62.53  ? 423 LYS B CA  1 
ATOM   2293 C C   . LYS B 1 74  ? -10.613 26.427 52.527  1.00 59.50  ? 423 LYS B C   1 
ATOM   2294 O O   . LYS B 1 74  ? -9.968  26.254 53.561  1.00 58.16  ? 423 LYS B O   1 
ATOM   2295 C CB  . LYS B 1 74  ? -11.813 24.270 52.524  1.00 66.70  ? 423 LYS B CB  1 
ATOM   2296 C CG  . LYS B 1 74  ? -13.094 23.471 52.332  1.00 69.43  ? 423 LYS B CG  1 
ATOM   2297 C CD  . LYS B 1 74  ? -13.196 22.315 53.314  1.00 80.74  ? 423 LYS B CD  1 
ATOM   2298 C CE  . LYS B 1 74  ? -13.859 21.088 52.701  1.00 88.15  ? 423 LYS B CE  1 
ATOM   2299 N NZ  . LYS B 1 74  ? -12.907 20.281 51.877  1.00 96.05  ? 423 LYS B NZ  1 
ATOM   2300 N N   . ILE B 1 75  ? -10.165 27.169 51.519  1.00 60.75  ? 424 ILE B N   1 
ATOM   2301 C CA  . ILE B 1 75  ? -8.939  27.958 51.662  1.00 64.85  ? 424 ILE B CA  1 
ATOM   2302 C C   . ILE B 1 75  ? -9.269  29.244 52.406  1.00 63.13  ? 424 ILE B C   1 
ATOM   2303 O O   . ILE B 1 75  ? -10.135 29.998 51.977  1.00 62.79  ? 424 ILE B O   1 
ATOM   2304 C CB  . ILE B 1 75  ? -8.288  28.308 50.312  1.00 66.02  ? 424 ILE B CB  1 
ATOM   2305 C CG1 . ILE B 1 75  ? -7.706  27.045 49.694  1.00 70.28  ? 424 ILE B CG1 1 
ATOM   2306 C CG2 . ILE B 1 75  ? -7.188  29.355 50.488  1.00 61.97  ? 424 ILE B CG2 1 
ATOM   2307 C CD1 . ILE B 1 75  ? -7.431  27.186 48.215  1.00 76.17  ? 424 ILE B CD1 1 
ATOM   2308 N N   . PRO B 1 76  ? -8.586  29.488 53.530  1.00 64.53  ? 425 PRO B N   1 
ATOM   2309 C CA  . PRO B 1 76  ? -8.817  30.693 54.323  1.00 68.61  ? 425 PRO B CA  1 
ATOM   2310 C C   . PRO B 1 76  ? -8.643  32.002 53.538  1.00 68.01  ? 425 PRO B C   1 
ATOM   2311 O O   . PRO B 1 76  ? -7.574  32.289 53.005  1.00 63.46  ? 425 PRO B O   1 
ATOM   2312 C CB  . PRO B 1 76  ? -7.774  30.586 55.439  1.00 63.36  ? 425 PRO B CB  1 
ATOM   2313 C CG  . PRO B 1 76  ? -7.544  29.136 55.579  1.00 62.69  ? 425 PRO B CG  1 
ATOM   2314 C CD  . PRO B 1 76  ? -7.636  28.581 54.192  1.00 63.88  ? 425 PRO B CD  1 
ATOM   2315 N N   . GLY B 1 77  ? -9.713  32.779 53.474  1.00 69.34  ? 426 GLY B N   1 
ATOM   2316 C CA  . GLY B 1 77  ? -9.667  34.060 52.808  1.00 68.89  ? 426 GLY B CA  1 
ATOM   2317 C C   . GLY B 1 77  ? -10.249 33.961 51.425  1.00 67.19  ? 426 GLY B C   1 
ATOM   2318 O O   . GLY B 1 77  ? -10.686 34.969 50.854  1.00 72.65  ? 426 GLY B O   1 
ATOM   2319 N N   . PHE B 1 78  ? -10.248 32.759 50.865  1.00 62.63  ? 427 PHE B N   1 
ATOM   2320 C CA  . PHE B 1 78  ? -10.745 32.626 49.525  1.00 62.77  ? 427 PHE B CA  1 
ATOM   2321 C C   . PHE B 1 78  ? -12.203 33.025 49.527  1.00 64.34  ? 427 PHE B C   1 
ATOM   2322 O O   . PHE B 1 78  ? -12.649 33.753 48.634  1.00 71.26  ? 427 PHE B O   1 
ATOM   2323 C CB  . PHE B 1 78  ? -10.611 31.214 48.946  1.00 59.75  ? 427 PHE B CB  1 
ATOM   2324 C CG  . PHE B 1 78  ? -11.153 31.122 47.557  1.00 53.10  ? 427 PHE B CG  1 
ATOM   2325 C CD1 . PHE B 1 78  ? -10.391 31.554 46.486  1.00 51.02  ? 427 PHE B CD1 1 
ATOM   2326 C CD2 . PHE B 1 78  ? -12.453 30.707 47.334  1.00 52.55  ? 427 PHE B CD2 1 
ATOM   2327 C CE1 . PHE B 1 78  ? -10.892 31.529 45.209  1.00 49.16  ? 427 PHE B CE1 1 
ATOM   2328 C CE2 . PHE B 1 78  ? -12.962 30.667 46.056  1.00 52.84  ? 427 PHE B CE2 1 
ATOM   2329 C CZ  . PHE B 1 78  ? -12.185 31.087 44.991  1.00 52.16  ? 427 PHE B CZ  1 
ATOM   2330 N N   . ALA B 1 79  ? -12.934 32.550 50.527  1.00 62.11  ? 428 ALA B N   1 
ATOM   2331 C CA  . ALA B 1 79  ? -14.371 32.746 50.562  1.00 70.30  ? 428 ALA B CA  1 
ATOM   2332 C C   . ALA B 1 79  ? -14.764 34.211 50.808  1.00 74.15  ? 428 ALA B C   1 
ATOM   2333 O O   . ALA B 1 79  ? -15.908 34.575 50.587  1.00 68.76  ? 428 ALA B O   1 
ATOM   2334 C CB  . ALA B 1 79  ? -14.998 31.829 51.600  1.00 73.28  ? 428 ALA B CB  1 
ATOM   2335 N N   . GLU B 1 80  ? -13.797 35.031 51.236  1.00 82.28  ? 429 GLU B N   1 
ATOM   2336 C CA  . GLU B 1 80  ? -13.956 36.469 51.499  1.00 82.77  ? 429 GLU B CA  1 
ATOM   2337 C C   . GLU B 1 80  ? -13.399 37.357 50.385  1.00 78.84  ? 429 GLU B C   1 
ATOM   2338 O O   . GLU B 1 80  ? -12.929 38.467 50.640  1.00 72.56  ? 429 GLU B O   1 
ATOM   2339 C CB  . GLU B 1 80  ? -13.195 36.834 52.773  1.00 87.80  ? 429 GLU B CB  1 
ATOM   2340 C CG  . GLU B 1 80  ? -13.589 36.026 54.004  1.00 96.86  ? 429 GLU B CG  1 
ATOM   2341 C CD  . GLU B 1 80  ? -12.741 36.373 55.207  1.00 107.39 ? 429 GLU B CD  1 
ATOM   2342 O OE1 . GLU B 1 80  ? -12.146 37.483 55.217  1.00 111.99 ? 429 GLU B OE1 1 
ATOM   2343 O OE2 . GLU B 1 80  ? -12.683 35.539 56.139  1.00 104.99 ? 429 GLU B OE2 1 
ATOM   2344 N N   . LEU B 1 81  ? -13.389 36.839 49.167  1.00 75.74  ? 430 LEU B N   1 
ATOM   2345 C CA  . LEU B 1 81  ? -13.191 37.660 47.986  1.00 71.71  ? 430 LEU B CA  1 
ATOM   2346 C C   . LEU B 1 81  ? -14.507 37.958 47.254  1.00 73.83  ? 430 LEU B C   1 
ATOM   2347 O O   . LEU B 1 81  ? -15.534 37.274 47.415  1.00 65.46  ? 430 LEU B O   1 
ATOM   2348 C CB  . LEU B 1 81  ? -12.235 36.955 47.035  1.00 73.30  ? 430 LEU B CB  1 
ATOM   2349 C CG  . LEU B 1 81  ? -10.911 36.512 47.671  1.00 76.23  ? 430 LEU B CG  1 
ATOM   2350 C CD1 . LEU B 1 81  ? -10.206 35.490 46.795  1.00 71.98  ? 430 LEU B CD1 1 
ATOM   2351 C CD2 . LEU B 1 81  ? -9.994  37.698 47.916  1.00 78.52  ? 430 LEU B CD2 1 
ATOM   2352 N N   . SER B 1 82  ? -14.481 39.005 46.447  1.00 74.48  ? 431 SER B N   1 
ATOM   2353 C CA  . SER B 1 82  ? -15.575 39.261 45.539  1.00 78.73  ? 431 SER B CA  1 
ATOM   2354 C C   . SER B 1 82  ? -16.093 37.929 44.946  1.00 73.11  ? 431 SER B C   1 
ATOM   2355 O O   . SER B 1 82  ? -15.309 37.128 44.480  1.00 86.09  ? 431 SER B O   1 
ATOM   2356 C CB  . SER B 1 82  ? -15.074 40.208 44.442  1.00 77.72  ? 431 SER B CB  1 
ATOM   2357 O OG  . SER B 1 82  ? -16.080 40.426 43.465  1.00 94.01  ? 431 SER B OG  1 
ATOM   2358 N N   . PRO B 1 83  ? -17.408 37.675 44.981  1.00 70.53  ? 432 PRO B N   1 
ATOM   2359 C CA  . PRO B 1 83  ? -17.942 36.550 44.222  1.00 70.77  ? 432 PRO B CA  1 
ATOM   2360 C C   . PRO B 1 83  ? -17.469 36.449 42.775  1.00 69.85  ? 432 PRO B C   1 
ATOM   2361 O O   . PRO B 1 83  ? -17.187 35.349 42.315  1.00 71.80  ? 432 PRO B O   1 
ATOM   2362 C CB  . PRO B 1 83  ? -19.443 36.802 44.260  1.00 71.44  ? 432 PRO B CB  1 
ATOM   2363 C CG  . PRO B 1 83  ? -19.631 37.350 45.621  1.00 71.86  ? 432 PRO B CG  1 
ATOM   2364 C CD  . PRO B 1 83  ? -18.416 38.201 45.909  1.00 71.42  ? 432 PRO B CD  1 
ATOM   2365 N N   . ALA B 1 84  ? -17.366 37.577 42.071  1.00 70.87  ? 433 ALA B N   1 
ATOM   2366 C CA  . ALA B 1 84  ? -16.833 37.575 40.698  1.00 69.61  ? 433 ALA B CA  1 
ATOM   2367 C C   . ALA B 1 84  ? -15.376 37.153 40.678  1.00 68.80  ? 433 ALA B C   1 
ATOM   2368 O O   . ALA B 1 84  ? -14.959 36.391 39.792  1.00 70.94  ? 433 ALA B O   1 
ATOM   2369 C CB  . ALA B 1 84  ? -16.965 38.944 40.051  1.00 68.48  ? 433 ALA B CB  1 
ATOM   2370 N N   . ASP B 1 85  ? -14.602 37.665 41.638  1.00 63.34  ? 434 ASP B N   1 
ATOM   2371 C CA  . ASP B 1 85  ? -13.199 37.288 41.766  1.00 65.20  ? 434 ASP B CA  1 
ATOM   2372 C C   . ASP B 1 85  ? -13.053 35.781 42.043  1.00 61.58  ? 434 ASP B C   1 
ATOM   2373 O O   . ASP B 1 85  ? -12.176 35.111 41.511  1.00 60.53  ? 434 ASP B O   1 
ATOM   2374 C CB  . ASP B 1 85  ? -12.502 38.134 42.844  1.00 69.51  ? 434 ASP B CB  1 
ATOM   2375 C CG  . ASP B 1 85  ? -12.144 39.557 42.352  1.00 75.69  ? 434 ASP B CG  1 
ATOM   2376 O OD1 . ASP B 1 85  ? -12.692 39.979 41.313  1.00 71.81  ? 434 ASP B OD1 1 
ATOM   2377 O OD2 . ASP B 1 85  ? -11.308 40.257 42.996  1.00 75.48  ? 434 ASP B OD2 1 
ATOM   2378 N N   . GLN B 1 86  ? -13.933 35.250 42.869  1.00 62.77  ? 435 GLN B N   1 
ATOM   2379 C CA  . GLN B 1 86  ? -13.937 33.832 43.164  1.00 61.64  ? 435 GLN B CA  1 
ATOM   2380 C C   . GLN B 1 86  ? -14.134 33.006 41.894  1.00 59.63  ? 435 GLN B C   1 
ATOM   2381 O O   . GLN B 1 86  ? -13.348 32.101 41.611  1.00 58.84  ? 435 GLN B O   1 
ATOM   2382 C CB  . GLN B 1 86  ? -15.010 33.512 44.214  1.00 64.01  ? 435 GLN B CB  1 
ATOM   2383 C CG  . GLN B 1 86  ? -14.602 33.896 45.633  1.00 61.90  ? 435 GLN B CG  1 
ATOM   2384 C CD  . GLN B 1 86  ? -15.626 33.490 46.685  1.00 62.87  ? 435 GLN B CD  1 
ATOM   2385 O OE1 . GLN B 1 86  ? -16.299 32.463 46.570  1.00 63.09  ? 435 GLN B OE1 1 
ATOM   2386 N NE2 . GLN B 1 86  ? -15.721 34.281 47.733  1.00 65.09  ? 435 GLN B NE2 1 
ATOM   2387 N N   . ASP B 1 87  ? -15.165 33.343 41.131  1.00 61.07  ? 436 ASP B N   1 
ATOM   2388 C CA  . ASP B 1 87  ? -15.486 32.620 39.902  1.00 69.51  ? 436 ASP B CA  1 
ATOM   2389 C C   . ASP B 1 87  ? -14.393 32.768 38.871  1.00 69.25  ? 436 ASP B C   1 
ATOM   2390 O O   . ASP B 1 87  ? -14.084 31.834 38.144  1.00 72.11  ? 436 ASP B O   1 
ATOM   2391 C CB  . ASP B 1 87  ? -16.774 33.150 39.292  1.00 75.97  ? 436 ASP B CB  1 
ATOM   2392 C CG  . ASP B 1 87  ? -17.962 32.967 40.200  1.00 81.77  ? 436 ASP B CG  1 
ATOM   2393 O OD1 . ASP B 1 87  ? -17.909 32.090 41.094  1.00 83.20  ? 436 ASP B OD1 1 
ATOM   2394 O OD2 . ASP B 1 87  ? -18.949 33.706 40.009  1.00 90.93  ? 436 ASP B OD2 1 
ATOM   2395 N N   . LEU B 1 88  ? -13.837 33.968 38.798  1.00 69.84  ? 437 LEU B N   1 
ATOM   2396 C CA  . LEU B 1 88  ? -12.792 34.248 37.849  1.00 67.13  ? 437 LEU B CA  1 
ATOM   2397 C C   . LEU B 1 88  ? -11.596 33.395 38.197  1.00 65.82  ? 437 LEU B C   1 
ATOM   2398 O O   . LEU B 1 88  ? -11.009 32.783 37.306  1.00 72.12  ? 437 LEU B O   1 
ATOM   2399 C CB  . LEU B 1 88  ? -12.384 35.743 37.862  1.00 65.30  ? 437 LEU B CB  1 
ATOM   2400 C CG  . LEU B 1 88  ? -11.343 36.134 36.800  1.00 60.56  ? 437 LEU B CG  1 
ATOM   2401 C CD1 . LEU B 1 88  ? -12.033 36.267 35.462  1.00 59.71  ? 437 LEU B CD1 1 
ATOM   2402 C CD2 . LEU B 1 88  ? -10.596 37.412 37.111  1.00 62.57  ? 437 LEU B CD2 1 
ATOM   2403 N N   . LEU B 1 89  ? -11.206 33.380 39.473  1.00 60.19  ? 438 LEU B N   1 
ATOM   2404 C CA  . LEU B 1 89  ? -9.990  32.679 39.851  1.00 55.17  ? 438 LEU B CA  1 
ATOM   2405 C C   . LEU B 1 89  ? -10.195 31.217 39.584  1.00 55.49  ? 438 LEU B C   1 
ATOM   2406 O O   . LEU B 1 89  ? -9.309  30.569 39.070  1.00 57.78  ? 438 LEU B O   1 
ATOM   2407 C CB  . LEU B 1 89  ? -9.618  32.913 41.291  1.00 54.80  ? 438 LEU B CB  1 
ATOM   2408 C CG  . LEU B 1 89  ? -9.124  34.328 41.594  1.00 57.67  ? 438 LEU B CG  1 
ATOM   2409 C CD1 . LEU B 1 89  ? -9.181  34.532 43.091  1.00 60.39  ? 438 LEU B CD1 1 
ATOM   2410 C CD2 . LEU B 1 89  ? -7.705  34.608 41.116  1.00 59.13  ? 438 LEU B CD2 1 
ATOM   2411 N N   . LEU B 1 90  ? -11.387 30.710 39.860  1.00 54.21  ? 439 LEU B N   1 
ATOM   2412 C CA  . LEU B 1 90  ? -11.674 29.307 39.599  1.00 55.61  ? 439 LEU B CA  1 
ATOM   2413 C C   . LEU B 1 90  ? -11.712 28.909 38.138  1.00 57.46  ? 439 LEU B C   1 
ATOM   2414 O O   . LEU B 1 90  ? -11.282 27.812 37.788  1.00 66.23  ? 439 LEU B O   1 
ATOM   2415 C CB  . LEU B 1 90  ? -12.990 28.909 40.224  1.00 55.43  ? 439 LEU B CB  1 
ATOM   2416 C CG  . LEU B 1 90  ? -12.894 28.710 41.726  1.00 58.32  ? 439 LEU B CG  1 
ATOM   2417 C CD1 . LEU B 1 90  ? -14.290 28.688 42.311  1.00 58.37  ? 439 LEU B CD1 1 
ATOM   2418 C CD2 . LEU B 1 90  ? -12.160 27.421 42.059  1.00 61.64  ? 439 LEU B CD2 1 
ATOM   2419 N N   . GLU B 1 91  ? -12.258 29.753 37.281  1.00 59.02  ? 440 GLU B N   1 
ATOM   2420 C CA  . GLU B 1 91  ? -12.315 29.416 35.859  1.00 62.32  ? 440 GLU B CA  1 
ATOM   2421 C C   . GLU B 1 91  ? -10.940 29.467 35.220  1.00 58.37  ? 440 GLU B C   1 
ATOM   2422 O O   . GLU B 1 91  ? -10.604 28.650 34.378  1.00 55.19  ? 440 GLU B O   1 
ATOM   2423 C CB  . GLU B 1 91  ? -13.210 30.380 35.120  1.00 68.39  ? 440 GLU B CB  1 
ATOM   2424 C CG  . GLU B 1 91  ? -14.698 30.168 35.343  1.00 77.95  ? 440 GLU B CG  1 
ATOM   2425 C CD  . GLU B 1 91  ? -15.529 30.830 34.248  1.00 88.56  ? 440 GLU B CD  1 
ATOM   2426 O OE1 . GLU B 1 91  ? -14.916 31.540 33.404  1.00 85.17  ? 440 GLU B OE1 1 
ATOM   2427 O OE2 . GLU B 1 91  ? -16.777 30.633 34.220  1.00 94.01  ? 440 GLU B OE2 1 
ATOM   2428 N N   . SER B 1 92  ? -10.150 30.443 35.628  1.00 58.29  ? 441 SER B N   1 
ATOM   2429 C CA  . SER B 1 92  ? -8.821  30.631 35.076  1.00 57.63  ? 441 SER B CA  1 
ATOM   2430 C C   . SER B 1 92  ? -7.891  29.533 35.495  1.00 59.98  ? 441 SER B C   1 
ATOM   2431 O O   . SER B 1 92  ? -7.002  29.132 34.739  1.00 73.45  ? 441 SER B O   1 
ATOM   2432 C CB  . SER B 1 92  ? -8.248  31.934 35.585  1.00 59.14  ? 441 SER B CB  1 
ATOM   2433 O OG  . SER B 1 92  ? -9.196  32.972 35.431  1.00 56.98  ? 441 SER B OG  1 
ATOM   2434 N N   . ALA B 1 93  ? -8.094  29.040 36.713  1.00 54.66  ? 442 ALA B N   1 
ATOM   2435 C CA  . ALA B 1 93  ? -7.212  28.034 37.264  1.00 50.58  ? 442 ALA B CA  1 
ATOM   2436 C C   . ALA B 1 93  ? -7.724  26.611 37.122  1.00 50.29  ? 442 ALA B C   1 
ATOM   2437 O O   . ALA B 1 93  ? -7.042  25.688 37.532  1.00 56.45  ? 442 ALA B O   1 
ATOM   2438 C CB  . ALA B 1 93  ? -6.950  28.334 38.719  1.00 51.54  ? 442 ALA B CB  1 
ATOM   2439 N N   . PHE B 1 94  ? -8.889  26.395 36.523  1.00 50.39  ? 443 PHE B N   1 
ATOM   2440 C CA  . PHE B 1 94  ? -9.456  25.050 36.551  1.00 49.83  ? 443 PHE B CA  1 
ATOM   2441 C C   . PHE B 1 94  ? -8.583  24.007 35.888  1.00 46.87  ? 443 PHE B C   1 
ATOM   2442 O O   . PHE B 1 94  ? -8.215  23.036 36.504  1.00 48.34  ? 443 PHE B O   1 
ATOM   2443 C CB  . PHE B 1 94  ? -10.836 24.986 35.928  1.00 50.24  ? 443 PHE B CB  1 
ATOM   2444 C CG  . PHE B 1 94  ? -11.288 23.581 35.700  1.00 50.63  ? 443 PHE B CG  1 
ATOM   2445 C CD1 . PHE B 1 94  ? -11.479 22.734 36.759  1.00 53.25  ? 443 PHE B CD1 1 
ATOM   2446 C CD2 . PHE B 1 94  ? -11.458 23.101 34.433  1.00 55.45  ? 443 PHE B CD2 1 
ATOM   2447 C CE1 . PHE B 1 94  ? -11.884 21.429 36.564  1.00 59.36  ? 443 PHE B CE1 1 
ATOM   2448 C CE2 . PHE B 1 94  ? -11.852 21.800 34.214  1.00 60.10  ? 443 PHE B CE2 1 
ATOM   2449 C CZ  . PHE B 1 94  ? -12.073 20.956 35.281  1.00 61.66  ? 443 PHE B CZ  1 
ATOM   2450 N N   . LEU B 1 95  ? -8.254  24.223 34.626  1.00 49.83  ? 444 LEU B N   1 
ATOM   2451 C CA  . LEU B 1 95  ? -7.404  23.296 33.907  1.00 48.30  ? 444 LEU B CA  1 
ATOM   2452 C C   . LEU B 1 95  ? -6.116  23.099 34.630  1.00 47.39  ? 444 LEU B C   1 
ATOM   2453 O O   . LEU B 1 95  ? -5.705  21.983 34.858  1.00 43.32  ? 444 LEU B O   1 
ATOM   2454 C CB  . LEU B 1 95  ? -7.064  23.821 32.517  1.00 51.45  ? 444 LEU B CB  1 
ATOM   2455 C CG  . LEU B 1 95  ? -8.022  23.427 31.397  1.00 51.64  ? 444 LEU B CG  1 
ATOM   2456 C CD1 . LEU B 1 95  ? -7.523  23.996 30.069  1.00 52.50  ? 444 LEU B CD1 1 
ATOM   2457 C CD2 . LEU B 1 95  ? -8.168  21.926 31.330  1.00 51.31  ? 444 LEU B CD2 1 
ATOM   2458 N N   . GLU B 1 96  ? -5.448  24.184 34.970  1.00 50.30  ? 445 GLU B N   1 
ATOM   2459 C CA  . GLU B 1 96  ? -4.133  24.029 35.580  1.00 57.68  ? 445 GLU B CA  1 
ATOM   2460 C C   . GLU B 1 96  ? -4.256  23.296 36.914  1.00 58.17  ? 445 GLU B C   1 
ATOM   2461 O O   . GLU B 1 96  ? -3.369  22.545 37.278  1.00 63.09  ? 445 GLU B O   1 
ATOM   2462 C CB  . GLU B 1 96  ? -3.348  25.317 35.662  1.00 59.63  ? 445 GLU B CB  1 
ATOM   2463 C CG  . GLU B 1 96  ? -4.020  26.489 34.992  1.00 67.98  ? 445 GLU B CG  1 
ATOM   2464 C CD  . GLU B 1 96  ? -3.203  27.739 35.150  1.00 76.96  ? 445 GLU B CD  1 
ATOM   2465 O OE1 . GLU B 1 96  ? -2.091  27.646 35.741  1.00 73.06  ? 445 GLU B OE1 1 
ATOM   2466 O OE2 . GLU B 1 96  ? -3.682  28.805 34.688  1.00 85.96  ? 445 GLU B OE2 1 
ATOM   2467 N N   . LEU B 1 97  ? -5.388  23.422 37.590  1.00 53.60  ? 446 LEU B N   1 
ATOM   2468 C CA  . LEU B 1 97  ? -5.582  22.687 38.852  1.00 53.71  ? 446 LEU B CA  1 
ATOM   2469 C C   . LEU B 1 97  ? -5.860  21.224 38.635  1.00 48.18  ? 446 LEU B C   1 
ATOM   2470 O O   . LEU B 1 97  ? -5.345  20.370 39.339  1.00 50.56  ? 446 LEU B O   1 
ATOM   2471 C CB  . LEU B 1 97  ? -6.690  23.325 39.700  1.00 52.84  ? 446 LEU B CB  1 
ATOM   2472 C CG  . LEU B 1 97  ? -6.233  24.612 40.393  1.00 52.50  ? 446 LEU B CG  1 
ATOM   2473 C CD1 . LEU B 1 97  ? -7.409  25.355 40.975  1.00 53.00  ? 446 LEU B CD1 1 
ATOM   2474 C CD2 . LEU B 1 97  ? -5.193  24.328 41.464  1.00 52.52  ? 446 LEU B CD2 1 
ATOM   2475 N N   . PHE B 1 98  ? -6.696  20.950 37.659  1.00 49.72  ? 447 PHE B N   1 
ATOM   2476 C CA  . PHE B 1 98  ? -7.016  19.595 37.265  1.00 53.42  ? 447 PHE B CA  1 
ATOM   2477 C C   . PHE B 1 98  ? -5.753  18.806 36.912  1.00 55.94  ? 447 PHE B C   1 
ATOM   2478 O O   . PHE B 1 98  ? -5.592  17.655 37.280  1.00 58.38  ? 447 PHE B O   1 
ATOM   2479 C CB  . PHE B 1 98  ? -7.932  19.660 36.050  1.00 53.41  ? 447 PHE B CB  1 
ATOM   2480 C CG  . PHE B 1 98  ? -8.134  18.356 35.400  1.00 56.52  ? 447 PHE B CG  1 
ATOM   2481 C CD1 . PHE B 1 98  ? -8.969  17.412 35.970  1.00 56.80  ? 447 PHE B CD1 1 
ATOM   2482 C CD2 . PHE B 1 98  ? -7.480  18.063 34.219  1.00 64.25  ? 447 PHE B CD2 1 
ATOM   2483 C CE1 . PHE B 1 98  ? -9.177  16.185 35.368  1.00 58.45  ? 447 PHE B CE1 1 
ATOM   2484 C CE2 . PHE B 1 98  ? -7.681  16.842 33.599  1.00 69.22  ? 447 PHE B CE2 1 
ATOM   2485 C CZ  . PHE B 1 98  ? -8.533  15.897 34.178  1.00 65.27  ? 447 PHE B CZ  1 
ATOM   2486 N N   . ILE B 1 99  ? -4.856  19.456 36.189  1.00 58.99  ? 448 ILE B N   1 
ATOM   2487 C CA  . ILE B 1 99  ? -3.635  18.840 35.707  1.00 55.49  ? 448 ILE B CA  1 
ATOM   2488 C C   . ILE B 1 99  ? -2.694  18.592 36.857  1.00 51.29  ? 448 ILE B C   1 
ATOM   2489 O O   . ILE B 1 99  ? -2.121  17.523 36.972  1.00 51.52  ? 448 ILE B O   1 
ATOM   2490 C CB  . ILE B 1 99  ? -2.921  19.783 34.733  1.00 58.73  ? 448 ILE B CB  1 
ATOM   2491 C CG1 . ILE B 1 99  ? -3.706  19.944 33.430  1.00 57.53  ? 448 ILE B CG1 1 
ATOM   2492 C CG2 . ILE B 1 99  ? -1.513  19.303 34.430  1.00 62.20  ? 448 ILE B CG2 1 
ATOM   2493 C CD1 . ILE B 1 99  ? -3.320  21.198 32.651  1.00 55.85  ? 448 ILE B CD1 1 
ATOM   2494 N N   . LEU B 1 100 ? -2.509  19.604 37.688  1.00 50.89  ? 449 LEU B N   1 
ATOM   2495 C CA  . LEU B 1 100 ? -1.555  19.513 38.790  1.00 51.12  ? 449 LEU B CA  1 
ATOM   2496 C C   . LEU B 1 100 ? -1.960  18.471 39.805  1.00 49.21  ? 449 LEU B C   1 
ATOM   2497 O O   . LEU B 1 100 ? -1.152  17.704 40.270  1.00 51.57  ? 449 LEU B O   1 
ATOM   2498 C CB  . LEU B 1 100 ? -1.451  20.844 39.483  1.00 51.88  ? 449 LEU B CB  1 
ATOM   2499 C CG  . LEU B 1 100 ? -0.574  20.925 40.712  1.00 54.80  ? 449 LEU B CG  1 
ATOM   2500 C CD1 . LEU B 1 100 ? 0.870   20.638 40.363  1.00 58.45  ? 449 LEU B CD1 1 
ATOM   2501 C CD2 . LEU B 1 100 ? -0.700  22.310 41.332  1.00 55.25  ? 449 LEU B CD2 1 
ATOM   2502 N N   . ARG B 1 101 ? -3.226  18.448 40.142  1.00 51.91  ? 450 ARG B N   1 
ATOM   2503 C CA  . ARG B 1 101 ? -3.717  17.503 41.121  1.00 57.02  ? 450 ARG B CA  1 
ATOM   2504 C C   . ARG B 1 101 ? -3.705  16.098 40.577  1.00 57.14  ? 450 ARG B C   1 
ATOM   2505 O O   . ARG B 1 101 ? -3.409  15.166 41.300  1.00 56.43  ? 450 ARG B O   1 
ATOM   2506 C CB  . ARG B 1 101 ? -5.132  17.866 41.531  1.00 58.31  ? 450 ARG B CB  1 
ATOM   2507 C CG  . ARG B 1 101 ? -5.189  19.181 42.269  1.00 58.76  ? 450 ARG B CG  1 
ATOM   2508 C CD  . ARG B 1 101 ? -6.615  19.667 42.392  1.00 57.22  ? 450 ARG B CD  1 
ATOM   2509 N NE  . ARG B 1 101 ? -7.085  19.250 43.696  1.00 54.93  ? 450 ARG B NE  1 
ATOM   2510 C CZ  . ARG B 1 101 ? -8.123  18.486 43.936  1.00 53.51  ? 450 ARG B CZ  1 
ATOM   2511 N NH1 . ARG B 1 101 ? -8.902  18.027 42.955  1.00 57.49  ? 450 ARG B NH1 1 
ATOM   2512 N NH2 . ARG B 1 101 ? -8.390  18.216 45.193  1.00 51.91  ? 450 ARG B NH2 1 
ATOM   2513 N N   . LEU B 1 102 ? -4.052  15.956 39.304  1.00 58.51  ? 451 LEU B N   1 
ATOM   2514 C CA  . LEU B 1 102 ? -3.976  14.668 38.620  1.00 54.53  ? 451 LEU B CA  1 
ATOM   2515 C C   . LEU B 1 102 ? -2.536  14.147 38.525  1.00 59.78  ? 451 LEU B C   1 
ATOM   2516 O O   . LEU B 1 102 ? -2.279  12.965 38.734  1.00 59.77  ? 451 LEU B O   1 
ATOM   2517 C CB  . LEU B 1 102 ? -4.538  14.804 37.217  1.00 46.49  ? 451 LEU B CB  1 
ATOM   2518 C CG  . LEU B 1 102 ? -4.610  13.525 36.412  1.00 48.05  ? 451 LEU B CG  1 
ATOM   2519 C CD1 . LEU B 1 102 ? -5.546  12.529 37.074  1.00 48.39  ? 451 LEU B CD1 1 
ATOM   2520 C CD2 . LEU B 1 102 ? -5.073  13.822 35.005  1.00 48.27  ? 451 LEU B CD2 1 
ATOM   2521 N N   . ALA B 1 103 ? -1.607  15.034 38.194  1.00 61.70  ? 452 ALA B N   1 
ATOM   2522 C CA  . ALA B 1 103 ? -0.220  14.658 38.054  1.00 59.89  ? 452 ALA B CA  1 
ATOM   2523 C C   . ALA B 1 103 ? 0.355   14.242 39.398  1.00 64.46  ? 452 ALA B C   1 
ATOM   2524 O O   . ALA B 1 103 ? 1.160   13.317 39.489  1.00 69.14  ? 452 ALA B O   1 
ATOM   2525 C CB  . ALA B 1 103 ? 0.572   15.815 37.481  1.00 59.09  ? 452 ALA B CB  1 
ATOM   2526 N N   . TYR B 1 104 ? -0.052  14.923 40.457  1.00 61.31  ? 453 TYR B N   1 
ATOM   2527 C CA  . TYR B 1 104 ? 0.468   14.600 41.778  1.00 61.96  ? 453 TYR B CA  1 
ATOM   2528 C C   . TYR B 1 104 ? -0.107  13.264 42.284  1.00 63.32  ? 453 TYR B C   1 
ATOM   2529 O O   . TYR B 1 104 ? 0.533   12.540 43.042  1.00 71.93  ? 453 TYR B O   1 
ATOM   2530 C CB  . TYR B 1 104 ? 0.098   15.717 42.741  1.00 61.83  ? 453 TYR B CB  1 
ATOM   2531 C CG  . TYR B 1 104 ? 0.724   15.625 44.123  1.00 66.84  ? 453 TYR B CG  1 
ATOM   2532 C CD1 . TYR B 1 104 ? 2.104   15.731 44.287  1.00 69.51  ? 453 TYR B CD1 1 
ATOM   2533 C CD2 . TYR B 1 104 ? -0.069  15.499 45.277  1.00 65.79  ? 453 TYR B CD2 1 
ATOM   2534 C CE1 . TYR B 1 104 ? 2.676   15.698 45.535  1.00 68.87  ? 453 TYR B CE1 1 
ATOM   2535 C CE2 . TYR B 1 104 ? 0.503   15.452 46.538  1.00 66.00  ? 453 TYR B CE2 1 
ATOM   2536 C CZ  . TYR B 1 104 ? 1.875   15.552 46.659  1.00 70.27  ? 453 TYR B CZ  1 
ATOM   2537 O OH  . TYR B 1 104 ? 2.470   15.511 47.893  1.00 77.22  ? 453 TYR B OH  1 
ATOM   2538 N N   . ARG B 1 105 ? -1.330  12.969 41.865  1.00 61.35  ? 454 ARG B N   1 
ATOM   2539 C CA  . ARG B 1 105 ? -2.122  11.877 42.405  1.00 58.30  ? 454 ARG B CA  1 
ATOM   2540 C C   . ARG B 1 105 ? -1.764  10.585 41.681  1.00 60.69  ? 454 ARG B C   1 
ATOM   2541 O O   . ARG B 1 105 ? -1.807  9.503  42.248  1.00 59.73  ? 454 ARG B O   1 
ATOM   2542 C CB  . ARG B 1 105 ? -3.603  12.211 42.192  1.00 58.97  ? 454 ARG B CB  1 
ATOM   2543 C CG  . ARG B 1 105 ? -4.601  11.326 42.901  1.00 60.24  ? 454 ARG B CG  1 
ATOM   2544 C CD  . ARG B 1 105 ? -6.034  11.599 42.437  1.00 62.15  ? 454 ARG B CD  1 
ATOM   2545 N NE  . ARG B 1 105 ? -6.497  12.956 42.705  1.00 59.62  ? 454 ARG B NE  1 
ATOM   2546 C CZ  . ARG B 1 105 ? -6.894  13.830 41.781  1.00 60.39  ? 454 ARG B CZ  1 
ATOM   2547 N NH1 . ARG B 1 105 ? -6.922  13.516 40.490  1.00 65.54  ? 454 ARG B NH1 1 
ATOM   2548 N NH2 . ARG B 1 105 ? -7.273  15.038 42.156  1.00 60.32  ? 454 ARG B NH2 1 
ATOM   2549 N N   . SER B 1 106 ? -1.368  10.714 40.424  1.00 61.92  ? 455 SER B N   1 
ATOM   2550 C CA  . SER B 1 106 ? -1.198  9.576  39.567  1.00 58.06  ? 455 SER B CA  1 
ATOM   2551 C C   . SER B 1 106 ? 0.157   8.902  39.780  1.00 64.58  ? 455 SER B C   1 
ATOM   2552 O O   . SER B 1 106 ? 1.014   9.395  40.500  1.00 66.10  ? 455 SER B O   1 
ATOM   2553 C CB  . SER B 1 106 ? -1.390  10.037 38.129  1.00 57.32  ? 455 SER B CB  1 
ATOM   2554 O OG  . SER B 1 106 ? -2.700  10.582 37.996  1.00 51.21  ? 455 SER B OG  1 
ATOM   2555 N N   . LYS B 1 107 ? 0.313   7.729  39.184  1.00 75.52  ? 456 LYS B N   1 
ATOM   2556 C CA  . LYS B 1 107 ? 1.535   6.927  39.289  1.00 73.16  ? 456 LYS B CA  1 
ATOM   2557 C C   . LYS B 1 107 ? 2.018   6.705  37.862  1.00 65.98  ? 456 LYS B C   1 
ATOM   2558 O O   . LYS B 1 107 ? 1.527   5.811  37.181  1.00 57.58  ? 456 LYS B O   1 
ATOM   2559 C CB  . LYS B 1 107 ? 1.257   5.582  39.958  1.00 80.73  ? 456 LYS B CB  1 
ATOM   2560 C CG  . LYS B 1 107 ? 0.167   5.581  41.023  1.00 89.98  ? 456 LYS B CG  1 
ATOM   2561 C CD  . LYS B 1 107 ? 0.667   5.604  42.463  1.00 96.08  ? 456 LYS B CD  1 
ATOM   2562 C CE  . LYS B 1 107 ? -0.271  4.740  43.325  1.00 114.42 ? 456 LYS B CE  1 
ATOM   2563 N NZ  . LYS B 1 107 ? -0.248  5.057  44.775  1.00 123.14 ? 456 LYS B NZ  1 
ATOM   2564 N N   . PRO B 1 108 ? 2.934   7.557  37.381  1.00 64.68  ? 457 PRO B N   1 
ATOM   2565 C CA  . PRO B 1 108 ? 3.388   7.456  35.992  1.00 67.00  ? 457 PRO B CA  1 
ATOM   2566 C C   . PRO B 1 108 ? 4.261   6.241  35.737  1.00 75.07  ? 457 PRO B C   1 
ATOM   2567 O O   . PRO B 1 108 ? 4.373   5.808  34.589  1.00 70.66  ? 457 PRO B O   1 
ATOM   2568 C CB  . PRO B 1 108 ? 4.216   8.727  35.786  1.00 66.66  ? 457 PRO B CB  1 
ATOM   2569 C CG  . PRO B 1 108 ? 4.565   9.202  37.143  1.00 64.77  ? 457 PRO B CG  1 
ATOM   2570 C CD  . PRO B 1 108 ? 3.448   8.763  38.041  1.00 65.13  ? 457 PRO B CD  1 
ATOM   2571 N N   . GLY B 1 109 ? 4.852   5.682  36.801  1.00 83.80  ? 458 GLY B N   1 
ATOM   2572 C CA  . GLY B 1 109 ? 5.698   4.503  36.671  1.00 79.28  ? 458 GLY B CA  1 
ATOM   2573 C C   . GLY B 1 109 ? 4.867   3.335  36.177  1.00 75.66  ? 458 GLY B C   1 
ATOM   2574 O O   . GLY B 1 109 ? 5.328   2.529  35.371  1.00 81.70  ? 458 GLY B O   1 
ATOM   2575 N N   . GLU B 1 110 ? 3.609   3.293  36.601  1.00 69.94  ? 459 GLU B N   1 
ATOM   2576 C CA  . GLU B 1 110 ? 2.724   2.195  36.268  1.00 68.15  ? 459 GLU B CA  1 
ATOM   2577 C C   . GLU B 1 110 ? 1.797   2.596  35.159  1.00 62.49  ? 459 GLU B C   1 
ATOM   2578 O O   . GLU B 1 110 ? 0.881   1.853  34.821  1.00 69.19  ? 459 GLU B O   1 
ATOM   2579 C CB  . GLU B 1 110 ? 1.922   1.772  37.491  1.00 70.78  ? 459 GLU B CB  1 
ATOM   2580 C CG  . GLU B 1 110 ? 2.837   1.339  38.609  1.00 78.23  ? 459 GLU B CG  1 
ATOM   2581 C CD  . GLU B 1 110 ? 2.106   1.038  39.878  1.00 86.65  ? 459 GLU B CD  1 
ATOM   2582 O OE1 . GLU B 1 110 ? 1.659   1.996  40.526  1.00 91.07  ? 459 GLU B OE1 1 
ATOM   2583 O OE2 . GLU B 1 110 ? 2.025   -0.147 40.246  1.00 97.00  ? 459 GLU B OE2 1 
ATOM   2584 N N   . GLY B 1 111 ? 2.038   3.765  34.586  1.00 59.44  ? 460 GLY B N   1 
ATOM   2585 C CA  . GLY B 1 111 ? 1.187   4.298  33.530  1.00 62.78  ? 460 GLY B CA  1 
ATOM   2586 C C   . GLY B 1 111 ? -0.247  4.511  33.980  1.00 61.59  ? 460 GLY B C   1 
ATOM   2587 O O   . GLY B 1 111 ? -1.155  4.501  33.158  1.00 63.18  ? 460 GLY B O   1 
ATOM   2588 N N   . LYS B 1 112 ? -0.468  4.720  35.275  1.00 59.70  ? 461 LYS B N   1 
ATOM   2589 C CA  . LYS B 1 112 ? -1.829  4.801  35.746  1.00 62.16  ? 461 LYS B CA  1 
ATOM   2590 C C   . LYS B 1 112 ? -2.205  6.145  36.348  1.00 64.32  ? 461 LYS B C   1 
ATOM   2591 O O   . LYS B 1 112 ? -1.499  6.720  37.185  1.00 57.48  ? 461 LYS B O   1 
ATOM   2592 C CB  . LYS B 1 112 ? -2.171  3.644  36.673  1.00 65.95  ? 461 LYS B CB  1 
ATOM   2593 C CG  . LYS B 1 112 ? -1.757  3.798  38.109  1.00 71.82  ? 461 LYS B CG  1 
ATOM   2594 C CD  . LYS B 1 112 ? -2.034  2.448  38.748  1.00 78.79  ? 461 LYS B CD  1 
ATOM   2595 C CE  . LYS B 1 112 ? -1.669  2.372  40.215  1.00 83.84  ? 461 LYS B CE  1 
ATOM   2596 N NZ  . LYS B 1 112 ? -1.953  0.991  40.676  1.00 84.93  ? 461 LYS B NZ  1 
ATOM   2597 N N   . LEU B 1 113 ? -3.354  6.609  35.868  1.00 64.25  ? 462 LEU B N   1 
ATOM   2598 C CA  . LEU B 1 113 ? -3.945  7.879  36.202  1.00 60.72  ? 462 LEU B CA  1 
ATOM   2599 C C   . LEU B 1 113 ? -4.983  7.677  37.238  1.00 56.31  ? 462 LEU B C   1 
ATOM   2600 O O   . LEU B 1 113 ? -5.838  6.834  37.085  1.00 54.49  ? 462 LEU B O   1 
ATOM   2601 C CB  . LEU B 1 113 ? -4.655  8.424  34.983  1.00 59.67  ? 462 LEU B CB  1 
ATOM   2602 C CG  . LEU B 1 113 ? -3.679  8.589  33.843  1.00 63.51  ? 462 LEU B CG  1 
ATOM   2603 C CD1 . LEU B 1 113 ? -4.354  8.548  32.485  1.00 63.39  ? 462 LEU B CD1 1 
ATOM   2604 C CD2 . LEU B 1 113 ? -2.885  9.869  34.042  1.00 70.42  ? 462 LEU B CD2 1 
ATOM   2605 N N   . ILE B 1 114 ? -4.966  8.508  38.257  1.00 56.33  ? 463 ILE B N   1 
ATOM   2606 C CA  . ILE B 1 114 ? -5.964  8.411  39.298  1.00 58.57  ? 463 ILE B CA  1 
ATOM   2607 C C   . ILE B 1 114 ? -6.765  9.704  39.341  1.00 56.81  ? 463 ILE B C   1 
ATOM   2608 O O   . ILE B 1 114 ? -6.209  10.779 39.462  1.00 55.12  ? 463 ILE B O   1 
ATOM   2609 C CB  . ILE B 1 114 ? -5.287  8.114  40.634  1.00 59.45  ? 463 ILE B CB  1 
ATOM   2610 C CG1 . ILE B 1 114 ? -4.465  6.827  40.469  1.00 58.96  ? 463 ILE B CG1 1 
ATOM   2611 C CG2 . ILE B 1 114 ? -6.322  8.000  41.749  1.00 60.93  ? 463 ILE B CG2 1 
ATOM   2612 C CD1 . ILE B 1 114 ? -3.765  6.352  41.721  1.00 55.73  ? 463 ILE B CD1 1 
ATOM   2613 N N   . PHE B 1 115 ? -8.073  9.593  39.219  1.00 54.90  ? 464 PHE B N   1 
ATOM   2614 C CA  . PHE B 1 115 ? -8.903  10.772 39.192  1.00 58.51  ? 464 PHE B CA  1 
ATOM   2615 C C   . PHE B 1 115 ? -9.469  11.009 40.581  1.00 64.26  ? 464 PHE B C   1 
ATOM   2616 O O   . PHE B 1 115 ? -9.317  10.145 41.442  1.00 69.89  ? 464 PHE B O   1 
ATOM   2617 C CB  . PHE B 1 115 ? -9.960  10.567 38.138  1.00 54.79  ? 464 PHE B CB  1 
ATOM   2618 C CG  . PHE B 1 115 ? -9.375  10.376 36.786  1.00 55.57  ? 464 PHE B CG  1 
ATOM   2619 C CD1 . PHE B 1 115 ? -8.910  11.464 36.066  1.00 57.31  ? 464 PHE B CD1 1 
ATOM   2620 C CD2 . PHE B 1 115 ? -9.224  9.120  36.249  1.00 61.35  ? 464 PHE B CD2 1 
ATOM   2621 C CE1 . PHE B 1 115 ? -8.351  11.312 34.807  1.00 57.38  ? 464 PHE B CE1 1 
ATOM   2622 C CE2 . PHE B 1 115 ? -8.657  8.952  34.987  1.00 63.36  ? 464 PHE B CE2 1 
ATOM   2623 C CZ  . PHE B 1 115 ? -8.230  10.052 34.263  1.00 59.44  ? 464 PHE B CZ  1 
ATOM   2624 N N   . CYS B 1 116 ? -10.092 12.166 40.809  1.00 62.69  ? 465 CYS B N   1 
ATOM   2625 C CA  . CYS B 1 116 ? -10.530 12.543 42.164  1.00 62.97  ? 465 CYS B CA  1 
ATOM   2626 C C   . CYS B 1 116 ? -11.769 11.775 42.651  1.00 60.90  ? 465 CYS B C   1 
ATOM   2627 O O   . CYS B 1 116 ? -12.120 11.838 43.820  1.00 64.95  ? 465 CYS B O   1 
ATOM   2628 C CB  . CYS B 1 116 ? -10.748 14.054 42.277  1.00 62.43  ? 465 CYS B CB  1 
ATOM   2629 S SG  . CYS B 1 116 ? -11.853 14.736 41.065  1.00 72.34  ? 465 CYS B SG  1 
ATOM   2630 N N   . SER B 1 117 ? -12.421 11.045 41.757  1.00 58.09  ? 466 SER B N   1 
ATOM   2631 C CA  . SER B 1 117 ? -13.494 10.162 42.143  1.00 59.74  ? 466 SER B CA  1 
ATOM   2632 C C   . SER B 1 117 ? -12.942 8.888  42.733  1.00 67.92  ? 466 SER B C   1 
ATOM   2633 O O   . SER B 1 117 ? -13.705 8.066  43.219  1.00 78.28  ? 466 SER B O   1 
ATOM   2634 C CB  . SER B 1 117 ? -14.322 9.778  40.916  1.00 62.65  ? 466 SER B CB  1 
ATOM   2635 O OG  . SER B 1 117 ? -13.528 9.138  39.926  1.00 64.20  ? 466 SER B OG  1 
ATOM   2636 N N   . GLY B 1 118 ? -11.631 8.677  42.612  1.00 67.55  ? 467 GLY B N   1 
ATOM   2637 C CA  . GLY B 1 118 ? -11.025 7.385  42.930  1.00 66.12  ? 467 GLY B CA  1 
ATOM   2638 C C   . GLY B 1 118 ? -10.832 6.495  41.709  1.00 63.80  ? 467 GLY B C   1 
ATOM   2639 O O   . GLY B 1 118 ? -10.037 5.538  41.734  1.00 59.46  ? 467 GLY B O   1 
ATOM   2640 N N   . LEU B 1 119 ? -11.525 6.829  40.625  1.00 61.29  ? 468 LEU B N   1 
ATOM   2641 C CA  . LEU B 1 119 ? -11.380 6.079  39.389  1.00 61.82  ? 468 LEU B CA  1 
ATOM   2642 C C   . LEU B 1 119 ? -9.910  5.961  38.978  1.00 61.63  ? 468 LEU B C   1 
ATOM   2643 O O   . LEU B 1 119 ? -9.157  6.950  38.964  1.00 63.03  ? 468 LEU B O   1 
ATOM   2644 C CB  . LEU B 1 119 ? -12.171 6.729  38.263  1.00 58.61  ? 468 LEU B CB  1 
ATOM   2645 C CG  . LEU B 1 119 ? -12.186 5.883  36.992  1.00 58.09  ? 468 LEU B CG  1 
ATOM   2646 C CD1 . LEU B 1 119 ? -13.088 4.666  37.111  1.00 57.02  ? 468 LEU B CD1 1 
ATOM   2647 C CD2 . LEU B 1 119 ? -12.620 6.728  35.816  1.00 62.34  ? 468 LEU B CD2 1 
ATOM   2648 N N   . VAL B 1 120 ? -9.519  4.740  38.634  1.00 61.14  ? 469 VAL B N   1 
ATOM   2649 C CA  . VAL B 1 120 ? -8.170  4.454  38.172  1.00 62.46  ? 469 VAL B CA  1 
ATOM   2650 C C   . VAL B 1 120 ? -8.253  3.920  36.749  1.00 58.65  ? 469 VAL B C   1 
ATOM   2651 O O   . VAL B 1 120 ? -8.999  2.979  36.479  1.00 62.22  ? 469 VAL B O   1 
ATOM   2652 C CB  . VAL B 1 120 ? -7.479  3.404  39.062  1.00 62.33  ? 469 VAL B CB  1 
ATOM   2653 C CG1 . VAL B 1 120 ? -6.011  3.277  38.676  1.00 63.47  ? 469 VAL B CG1 1 
ATOM   2654 C CG2 . VAL B 1 120 ? -7.634  3.762  40.536  1.00 60.98  ? 469 VAL B CG2 1 
ATOM   2655 N N   . LEU B 1 121 ? -7.509  4.549  35.855  1.00 53.31  ? 470 LEU B N   1 
ATOM   2656 C CA  . LEU B 1 121 ? -7.434  4.137  34.464  1.00 58.06  ? 470 LEU B CA  1 
ATOM   2657 C C   . LEU B 1 121 ? -5.991  4.138  34.037  1.00 63.59  ? 470 LEU B C   1 
ATOM   2658 O O   . LEU B 1 121 ? -5.150  4.811  34.640  1.00 64.87  ? 470 LEU B O   1 
ATOM   2659 C CB  . LEU B 1 121 ? -8.214  5.084  33.541  1.00 58.73  ? 470 LEU B CB  1 
ATOM   2660 C CG  . LEU B 1 121 ? -9.731  5.159  33.691  1.00 63.17  ? 470 LEU B CG  1 
ATOM   2661 C CD1 . LEU B 1 121 ? -10.332 6.021  32.585  1.00 65.90  ? 470 LEU B CD1 1 
ATOM   2662 C CD2 . LEU B 1 121 ? -10.333 3.764  33.675  1.00 64.08  ? 470 LEU B CD2 1 
ATOM   2663 N N   . HIS B 1 122 ? -5.728  3.427  32.948  1.00 65.75  ? 471 HIS B N   1 
ATOM   2664 C CA  . HIS B 1 122 ? -4.400  3.247  32.457  1.00 70.68  ? 471 HIS B CA  1 
ATOM   2665 C C   . HIS B 1 122 ? -4.215  4.253  31.335  1.00 66.11  ? 471 HIS B C   1 
ATOM   2666 O O   . HIS B 1 122 ? -5.168  4.641  30.666  1.00 60.64  ? 471 HIS B O   1 
ATOM   2667 C CB  . HIS B 1 122 ? -4.252  1.816  31.970  1.00 80.28  ? 471 HIS B CB  1 
ATOM   2668 C CG  . HIS B 1 122 ? -2.847  1.422  31.679  1.00 96.92  ? 471 HIS B CG  1 
ATOM   2669 N ND1 . HIS B 1 122 ? -2.292  1.548  30.423  1.00 110.53 ? 471 HIS B ND1 1 
ATOM   2670 C CD2 . HIS B 1 122 ? -1.877  0.916  32.473  1.00 103.69 ? 471 HIS B CD2 1 
ATOM   2671 C CE1 . HIS B 1 122 ? -1.038  1.138  30.454  1.00 114.25 ? 471 HIS B CE1 1 
ATOM   2672 N NE2 . HIS B 1 122 ? -0.759  0.753  31.688  1.00 116.65 ? 471 HIS B NE2 1 
ATOM   2673 N N   . ARG B 1 123 ? -2.982  4.684  31.128  1.00 65.66  ? 472 ARG B N   1 
ATOM   2674 C CA  . ARG B 1 123 ? -2.728  5.756  30.178  1.00 71.10  ? 472 ARG B CA  1 
ATOM   2675 C C   . ARG B 1 123 ? -3.310  5.466  28.788  1.00 72.21  ? 472 ARG B C   1 
ATOM   2676 O O   . ARG B 1 123 ? -3.806  6.362  28.144  1.00 78.69  ? 472 ARG B O   1 
ATOM   2677 C CB  . ARG B 1 123 ? -1.251  6.191  30.179  1.00 76.36  ? 472 ARG B CB  1 
ATOM   2678 C CG  . ARG B 1 123 ? -0.405  5.726  29.015  1.00 84.11  ? 472 ARG B CG  1 
ATOM   2679 C CD  . ARG B 1 123 ? 0.037   6.854  28.106  1.00 85.19  ? 472 ARG B CD  1 
ATOM   2680 N NE  . ARG B 1 123 ? 1.044   6.311  27.212  1.00 89.95  ? 472 ARG B NE  1 
ATOM   2681 C CZ  . ARG B 1 123 ? 0.766   5.704  26.070  1.00 95.93  ? 472 ARG B CZ  1 
ATOM   2682 N NH1 . ARG B 1 123 ? 1.750   5.217  25.316  1.00 100.08 ? 472 ARG B NH1 1 
ATOM   2683 N NH2 . ARG B 1 123 ? -0.495  5.595  25.672  1.00 96.36  ? 472 ARG B NH2 1 
ATOM   2684 N N   . LEU B 1 124 ? -3.314  4.207  28.372  1.00 78.44  ? 473 LEU B N   1 
ATOM   2685 C CA  . LEU B 1 124 ? -3.884  3.816  27.085  1.00 82.52  ? 473 LEU B CA  1 
ATOM   2686 C C   . LEU B 1 124 ? -5.398  3.929  27.051  1.00 78.75  ? 473 LEU B C   1 
ATOM   2687 O O   . LEU B 1 124 ? -5.970  4.133  25.987  1.00 83.58  ? 473 LEU B O   1 
ATOM   2688 C CB  . LEU B 1 124 ? -3.505  2.371  26.758  1.00 92.81  ? 473 LEU B CB  1 
ATOM   2689 C CG  . LEU B 1 124 ? -2.007  2.109  26.604  1.00 99.00  ? 473 LEU B CG  1 
ATOM   2690 C CD1 . LEU B 1 124 ? -1.701  0.618  26.748  1.00 107.41 ? 473 LEU B CD1 1 
ATOM   2691 C CD2 . LEU B 1 124 ? -1.527  2.653  25.271  1.00 87.48  ? 473 LEU B CD2 1 
ATOM   2692 N N   . GLN B 1 125 ? -6.045  3.746  28.196  1.00 74.35  ? 474 GLN B N   1 
ATOM   2693 C CA  . GLN B 1 125 ? -7.502  3.754  28.255  1.00 78.06  ? 474 GLN B CA  1 
ATOM   2694 C C   . GLN B 1 125 ? -8.066  5.146  28.098  1.00 80.95  ? 474 GLN B C   1 
ATOM   2695 O O   . GLN B 1 125 ? -9.281  5.290  27.881  1.00 87.09  ? 474 GLN B O   1 
ATOM   2696 C CB  . GLN B 1 125 ? -8.006  3.195  29.580  1.00 77.54  ? 474 GLN B CB  1 
ATOM   2697 C CG  . GLN B 1 125 ? -7.808  1.715  29.759  1.00 76.26  ? 474 GLN B CG  1 
ATOM   2698 C CD  . GLN B 1 125 ? -8.307  1.262  31.110  1.00 76.39  ? 474 GLN B CD  1 
ATOM   2699 O OE1 . GLN B 1 125 ? -7.617  1.400  32.122  1.00 73.60  ? 474 GLN B OE1 1 
ATOM   2700 N NE2 . GLN B 1 125 ? -9.517  0.731  31.142  1.00 75.40  ? 474 GLN B NE2 1 
ATOM   2701 N N   . CYS B 1 126 ? -7.215  6.165  28.239  1.00 73.82  ? 475 CYS B N   1 
ATOM   2702 C CA  . CYS B 1 126 ? -7.667  7.535  27.960  1.00 71.17  ? 475 CYS B CA  1 
ATOM   2703 C C   . CYS B 1 126 ? -6.765  8.360  27.036  1.00 72.94  ? 475 CYS B C   1 
ATOM   2704 O O   . CYS B 1 126 ? -7.097  9.492  26.711  1.00 78.03  ? 475 CYS B O   1 
ATOM   2705 C CB  . CYS B 1 126 ? -8.012  8.276  29.256  1.00 69.75  ? 475 CYS B CB  1 
ATOM   2706 S SG  . CYS B 1 126 ? -6.852  8.045  30.613  1.00 69.09  ? 475 CYS B SG  1 
ATOM   2707 N N   . ALA B 1 127 ? -5.663  7.789  26.564  1.00 73.63  ? 476 ALA B N   1 
ATOM   2708 C CA  . ALA B 1 127 ? -4.952  8.337  25.404  1.00 71.36  ? 476 ALA B CA  1 
ATOM   2709 C C   . ALA B 1 127 ? -5.901  8.738  24.279  1.00 65.43  ? 476 ALA B C   1 
ATOM   2710 O O   . ALA B 1 127 ? -5.689  9.751  23.631  1.00 54.92  ? 476 ALA B O   1 
ATOM   2711 C CB  . ALA B 1 127 ? -3.962  7.308  24.867  1.00 73.22  ? 476 ALA B CB  1 
ATOM   2712 N N   . ARG B 1 128 ? -6.936  7.935  24.041  1.00 68.89  ? 477 ARG B N   1 
ATOM   2713 C CA  . ARG B 1 128 ? -7.743  8.088  22.830  1.00 73.20  ? 477 ARG B CA  1 
ATOM   2714 C C   . ARG B 1 128 ? -8.480  9.403  22.866  1.00 64.40  ? 477 ARG B C   1 
ATOM   2715 O O   . ARG B 1 128 ? -8.454  10.154 21.891  1.00 67.72  ? 477 ARG B O   1 
ATOM   2716 C CB  . ARG B 1 128 ? -8.727  6.906  22.640  1.00 85.62  ? 477 ARG B CB  1 
ATOM   2717 C CG  . ARG B 1 128 ? -8.715  6.295  21.217  1.00 97.02  ? 477 ARG B CG  1 
ATOM   2718 C CD  . ARG B 1 128 ? -8.424  4.793  21.223  1.00 107.03 ? 477 ARG B CD  1 
ATOM   2719 N NE  . ARG B 1 128 ? -9.047  4.027  20.133  1.00 122.08 ? 477 ARG B NE  1 
ATOM   2720 C CZ  . ARG B 1 128 ? -10.045 3.147  20.274  1.00 127.74 ? 477 ARG B CZ  1 
ATOM   2721 N NH1 . ARG B 1 128 ? -10.591 2.906  21.458  1.00 133.31 ? 477 ARG B NH1 1 
ATOM   2722 N NH2 . ARG B 1 128 ? -10.511 2.498  19.212  1.00 125.34 ? 477 ARG B NH2 1 
ATOM   2723 N N   . GLY B 1 129 ? -9.095  9.692  24.009  1.00 62.19  ? 478 GLY B N   1 
ATOM   2724 C CA  . GLY B 1 129 ? -9.831  10.930 24.209  1.00 60.41  ? 478 GLY B CA  1 
ATOM   2725 C C   . GLY B 1 129 ? -9.034  12.175 24.608  1.00 61.19  ? 478 GLY B C   1 
ATOM   2726 O O   . GLY B 1 129 ? -9.416  13.286 24.255  1.00 64.72  ? 478 GLY B O   1 
ATOM   2727 N N   . PHE B 1 130 ? -7.941  12.008 25.343  1.00 58.91  ? 479 PHE B N   1 
ATOM   2728 C CA  . PHE B 1 130 ? -7.051  13.140 25.697  1.00 59.37  ? 479 PHE B CA  1 
ATOM   2729 C C   . PHE B 1 130 ? -6.043  13.508 24.611  1.00 59.54  ? 479 PHE B C   1 
ATOM   2730 O O   . PHE B 1 130 ? -5.461  14.586 24.627  1.00 61.36  ? 479 PHE B O   1 
ATOM   2731 C CB  . PHE B 1 130 ? -6.238  12.802 26.955  1.00 59.36  ? 479 PHE B CB  1 
ATOM   2732 C CG  . PHE B 1 130 ? -7.015  12.891 28.236  1.00 60.35  ? 479 PHE B CG  1 
ATOM   2733 C CD1 . PHE B 1 130 ? -8.023  11.985 28.515  1.00 66.83  ? 479 PHE B CD1 1 
ATOM   2734 C CD2 . PHE B 1 130 ? -6.735  13.867 29.160  1.00 59.03  ? 479 PHE B CD2 1 
ATOM   2735 C CE1 . PHE B 1 130 ? -8.748  12.064 29.692  1.00 69.83  ? 479 PHE B CE1 1 
ATOM   2736 C CE2 . PHE B 1 130 ? -7.444  13.953 30.333  1.00 63.61  ? 479 PHE B CE2 1 
ATOM   2737 C CZ  . PHE B 1 130 ? -8.453  13.046 30.608  1.00 68.25  ? 479 PHE B CZ  1 
ATOM   2738 N N   . GLY B 1 131 ? -5.745  12.562 23.739  1.00 62.07  ? 480 GLY B N   1 
ATOM   2739 C CA  . GLY B 1 131 ? -4.611  12.699 22.843  1.00 63.52  ? 480 GLY B CA  1 
ATOM   2740 C C   . GLY B 1 131 ? -3.286  12.815 23.569  1.00 60.53  ? 480 GLY B C   1 
ATOM   2741 O O   . GLY B 1 131 ? -3.134  12.314 24.663  1.00 59.13  ? 480 GLY B O   1 
ATOM   2742 N N   . ASP B 1 132 ? -2.327  13.444 22.905  1.00 68.69  ? 481 ASP B N   1 
ATOM   2743 C CA  . ASP B 1 132 ? -0.951  13.657 23.389  1.00 77.31  ? 481 ASP B CA  1 
ATOM   2744 C C   . ASP B 1 132 ? -0.861  14.216 24.782  1.00 76.40  ? 481 ASP B C   1 
ATOM   2745 O O   . ASP B 1 132 ? 0.069   13.918 25.551  1.00 81.39  ? 481 ASP B O   1 
ATOM   2746 C CB  . ASP B 1 132 ? -0.287  14.704 22.482  1.00 85.72  ? 481 ASP B CB  1 
ATOM   2747 C CG  . ASP B 1 132 ? 0.770   14.130 21.577  1.00 94.01  ? 481 ASP B CG  1 
ATOM   2748 O OD1 . ASP B 1 132 ? 1.173   12.949 21.733  1.00 92.33  ? 481 ASP B OD1 1 
ATOM   2749 O OD2 . ASP B 1 132 ? 1.194   14.894 20.682  1.00 102.35 ? 481 ASP B OD2 1 
ATOM   2750 N N   . TRP B 1 133 ? -1.802  15.102 25.072  1.00 71.19  ? 482 TRP B N   1 
ATOM   2751 C CA  . TRP B 1 133 ? -1.848  15.788 26.344  1.00 63.27  ? 482 TRP B CA  1 
ATOM   2752 C C   . TRP B 1 133 ? -1.645  14.814 27.517  1.00 62.56  ? 482 TRP B C   1 
ATOM   2753 O O   . TRP B 1 133 ? -0.915  15.127 28.462  1.00 58.99  ? 482 TRP B O   1 
ATOM   2754 C CB  . TRP B 1 133 ? -3.179  16.508 26.440  1.00 62.77  ? 482 TRP B CB  1 
ATOM   2755 C CG  . TRP B 1 133 ? -3.325  17.468 27.554  1.00 58.67  ? 482 TRP B CG  1 
ATOM   2756 C CD1 . TRP B 1 133 ? -2.371  18.274 28.088  1.00 57.81  ? 482 TRP B CD1 1 
ATOM   2757 C CD2 . TRP B 1 133 ? -4.520  17.754 28.235  1.00 52.70  ? 482 TRP B CD2 1 
ATOM   2758 N NE1 . TRP B 1 133 ? -2.902  19.050 29.075  1.00 50.49  ? 482 TRP B NE1 1 
ATOM   2759 C CE2 . TRP B 1 133 ? -4.230  18.747 29.185  1.00 52.70  ? 482 TRP B CE2 1 
ATOM   2760 C CE3 . TRP B 1 133 ? -5.819  17.267 28.134  1.00 52.40  ? 482 TRP B CE3 1 
ATOM   2761 C CZ2 . TRP B 1 133 ? -5.191  19.252 30.032  1.00 53.33  ? 482 TRP B CZ2 1 
ATOM   2762 C CZ3 . TRP B 1 133 ? -6.767  17.764 28.970  1.00 53.49  ? 482 TRP B CZ3 1 
ATOM   2763 C CH2 . TRP B 1 133 ? -6.453  18.749 29.915  1.00 56.59  ? 482 TRP B CH2 1 
ATOM   2764 N N   . ILE B 1 134 ? -2.242  13.619 27.440  1.00 58.51  ? 483 ILE B N   1 
ATOM   2765 C CA  . ILE B 1 134 ? -2.136  12.676 28.544  1.00 57.74  ? 483 ILE B CA  1 
ATOM   2766 C C   . ILE B 1 134 ? -0.714  12.227 28.773  1.00 56.03  ? 483 ILE B C   1 
ATOM   2767 O O   . ILE B 1 134 ? -0.315  12.011 29.905  1.00 54.83  ? 483 ILE B O   1 
ATOM   2768 C CB  . ILE B 1 134 ? -3.046  11.453 28.388  1.00 61.48  ? 483 ILE B CB  1 
ATOM   2769 C CG1 . ILE B 1 134 ? -3.289  10.820 29.765  1.00 63.43  ? 483 ILE B CG1 1 
ATOM   2770 C CG2 . ILE B 1 134 ? -2.470  10.429 27.416  1.00 61.48  ? 483 ILE B CG2 1 
ATOM   2771 C CD1 . ILE B 1 134 ? -3.886  11.765 30.794  1.00 63.42  ? 483 ILE B CD1 1 
ATOM   2772 N N   . ASP B 1 135 ? 0.052   12.112 27.699  1.00 58.97  ? 484 ASP B N   1 
ATOM   2773 C CA  . ASP B 1 135 ? 1.459   11.750 27.808  1.00 60.31  ? 484 ASP B CA  1 
ATOM   2774 C C   . ASP B 1 135 ? 2.238   12.864 28.493  1.00 55.64  ? 484 ASP B C   1 
ATOM   2775 O O   . ASP B 1 135 ? 3.117   12.611 29.336  1.00 57.23  ? 484 ASP B O   1 
ATOM   2776 C CB  . ASP B 1 135 ? 2.025   11.446 26.425  1.00 59.75  ? 484 ASP B CB  1 
ATOM   2777 C CG  . ASP B 1 135 ? 1.363   10.238 25.793  1.00 66.19  ? 484 ASP B CG  1 
ATOM   2778 O OD1 . ASP B 1 135 ? 1.400   9.163  26.435  1.00 65.31  ? 484 ASP B OD1 1 
ATOM   2779 O OD2 . ASP B 1 135 ? 0.774   10.366 24.684  1.00 76.61  ? 484 ASP B OD2 1 
ATOM   2780 N N   . SER B 1 136 ? 1.882   14.090 28.151  1.00 49.72  ? 485 SER B N   1 
ATOM   2781 C CA  . SER B 1 136 ? 2.569   15.261 28.670  1.00 52.53  ? 485 SER B CA  1 
ATOM   2782 C C   . SER B 1 136 ? 2.187   15.528 30.116  1.00 49.73  ? 485 SER B C   1 
ATOM   2783 O O   . SER B 1 136 ? 2.979   16.029 30.907  1.00 40.43  ? 485 SER B O   1 
ATOM   2784 C CB  . SER B 1 136 ? 2.201   16.484 27.842  1.00 55.48  ? 485 SER B CB  1 
ATOM   2785 O OG  . SER B 1 136 ? 2.169   16.180 26.464  1.00 58.26  ? 485 SER B OG  1 
ATOM   2786 N N   . ILE B 1 137 ? 0.944   15.222 30.450  1.00 53.34  ? 486 ILE B N   1 
ATOM   2787 C CA  . ILE B 1 137 ? 0.541   15.269 31.838  1.00 57.08  ? 486 ILE B CA  1 
ATOM   2788 C C   . ILE B 1 137 ? 1.386   14.259 32.602  1.00 58.78  ? 486 ILE B C   1 
ATOM   2789 O O   . ILE B 1 137 ? 1.924   14.586 33.658  1.00 54.85  ? 486 ILE B O   1 
ATOM   2790 C CB  . ILE B 1 137 ? -0.957  14.960 32.032  1.00 56.96  ? 486 ILE B CB  1 
ATOM   2791 C CG1 . ILE B 1 137 ? -1.811  16.103 31.503  1.00 54.74  ? 486 ILE B CG1 1 
ATOM   2792 C CG2 . ILE B 1 137 ? -1.283  14.755 33.506  1.00 57.98  ? 486 ILE B CG2 1 
ATOM   2793 C CD1 . ILE B 1 137 ? -3.227  15.673 31.242  1.00 53.36  ? 486 ILE B CD1 1 
ATOM   2794 N N   . LEU B 1 138 ? 1.510   13.042 32.059  1.00 58.48  ? 487 LEU B N   1 
ATOM   2795 C CA  . LEU B 1 138 ? 2.269   11.984 32.736  1.00 57.34  ? 487 LEU B CA  1 
ATOM   2796 C C   . LEU B 1 138 ? 3.729   12.302 32.842  1.00 59.03  ? 487 LEU B C   1 
ATOM   2797 O O   . LEU B 1 138 ? 4.353   11.933 33.838  1.00 60.09  ? 487 LEU B O   1 
ATOM   2798 C CB  . LEU B 1 138 ? 2.091   10.629 32.079  1.00 53.75  ? 487 LEU B CB  1 
ATOM   2799 C CG  . LEU B 1 138 ? 0.847   9.906  32.594  1.00 57.54  ? 487 LEU B CG  1 
ATOM   2800 C CD1 . LEU B 1 138 ? 0.594   8.657  31.776  1.00 59.41  ? 487 LEU B CD1 1 
ATOM   2801 C CD2 . LEU B 1 138 ? 0.971   9.542  34.073  1.00 59.54  ? 487 LEU B CD2 1 
ATOM   2802 N N   . ALA B 1 139 ? 4.261   12.999 31.836  1.00 58.54  ? 488 ALA B N   1 
ATOM   2803 C CA  . ALA B 1 139 ? 5.649   13.426 31.863  1.00 59.12  ? 488 ALA B CA  1 
ATOM   2804 C C   . ALA B 1 139 ? 5.861   14.379 33.008  1.00 62.59  ? 488 ALA B C   1 
ATOM   2805 O O   . ALA B 1 139 ? 6.834   14.274 33.745  1.00 69.00  ? 488 ALA B O   1 
ATOM   2806 C CB  . ALA B 1 139 ? 6.019   14.113 30.575  1.00 58.69  ? 488 ALA B CB  1 
ATOM   2807 N N   . PHE B 1 140 ? 4.930   15.316 33.145  1.00 63.29  ? 489 PHE B N   1 
ATOM   2808 C CA  . PHE B 1 140 ? 4.957   16.289 34.228  1.00 58.96  ? 489 PHE B CA  1 
ATOM   2809 C C   . PHE B 1 140 ? 4.830   15.608 35.593  1.00 53.98  ? 489 PHE B C   1 
ATOM   2810 O O   . PHE B 1 140 ? 5.440   16.054 36.551  1.00 45.55  ? 489 PHE B O   1 
ATOM   2811 C CB  . PHE B 1 140 ? 3.822   17.293 34.014  1.00 56.50  ? 489 PHE B CB  1 
ATOM   2812 C CG  . PHE B 1 140 ? 3.706   18.339 35.080  1.00 56.44  ? 489 PHE B CG  1 
ATOM   2813 C CD1 . PHE B 1 140 ? 4.613   19.374 35.155  1.00 58.70  ? 489 PHE B CD1 1 
ATOM   2814 C CD2 . PHE B 1 140 ? 2.664   18.310 35.983  1.00 57.17  ? 489 PHE B CD2 1 
ATOM   2815 C CE1 . PHE B 1 140 ? 4.486   20.363 36.119  1.00 59.52  ? 489 PHE B CE1 1 
ATOM   2816 C CE2 . PHE B 1 140 ? 2.543   19.281 36.952  1.00 59.17  ? 489 PHE B CE2 1 
ATOM   2817 C CZ  . PHE B 1 140 ? 3.450   20.313 37.023  1.00 57.38  ? 489 PHE B CZ  1 
ATOM   2818 N N   . SER B 1 141 ? 4.041   14.536 35.658  1.00 50.56  ? 490 SER B N   1 
ATOM   2819 C CA  . SER B 1 141 ? 3.819   13.836 36.896  1.00 56.75  ? 490 SER B CA  1 
ATOM   2820 C C   . SER B 1 141 ? 5.124   13.226 37.394  1.00 65.60  ? 490 SER B C   1 
ATOM   2821 O O   . SER B 1 141 ? 5.467   13.361 38.580  1.00 70.17  ? 490 SER B O   1 
ATOM   2822 C CB  . SER B 1 141 ? 2.792   12.738 36.714  1.00 57.04  ? 490 SER B CB  1 
ATOM   2823 O OG  . SER B 1 141 ? 2.561   12.071 37.950  1.00 60.63  ? 490 SER B OG  1 
ATOM   2824 N N   . ARG B 1 142 ? 5.832   12.548 36.487  1.00 67.46  ? 491 ARG B N   1 
ATOM   2825 C CA  . ARG B 1 142 ? 7.201   12.077 36.734  1.00 68.86  ? 491 ARG B CA  1 
ATOM   2826 C C   . ARG B 1 142 ? 8.048   13.202 37.285  1.00 67.35  ? 491 ARG B C   1 
ATOM   2827 O O   . ARG B 1 142 ? 8.590   13.095 38.374  1.00 68.00  ? 491 ARG B O   1 
ATOM   2828 C CB  . ARG B 1 142 ? 7.840   11.592 35.443  1.00 75.41  ? 491 ARG B CB  1 
ATOM   2829 C CG  . ARG B 1 142 ? 9.118   10.755 35.545  1.00 84.16  ? 491 ARG B CG  1 
ATOM   2830 C CD  . ARG B 1 142 ? 9.457   10.040 34.235  1.00 96.76  ? 491 ARG B CD  1 
ATOM   2831 N NE  . ARG B 1 142 ? 8.298   9.320  33.661  1.00 109.63 ? 491 ARG B NE  1 
ATOM   2832 C CZ  . ARG B 1 142 ? 7.808   9.464  32.422  1.00 114.54 ? 491 ARG B CZ  1 
ATOM   2833 N NH1 . ARG B 1 142 ? 8.369   10.290 31.533  1.00 112.83 ? 491 ARG B NH1 1 
ATOM   2834 N NH2 . ARG B 1 142 ? 6.739   8.752  32.065  1.00 111.52 ? 491 ARG B NH2 1 
ATOM   2835 N N   . SER B 1 143 ? 8.127   14.293 36.541  1.00 62.57  ? 492 SER B N   1 
ATOM   2836 C CA  . SER B 1 143 ? 8.991   15.376 36.909  1.00 65.42  ? 492 SER B CA  1 
ATOM   2837 C C   . SER B 1 143 ? 8.615   16.002 38.260  1.00 68.05  ? 492 SER B C   1 
ATOM   2838 O O   . SER B 1 143 ? 9.486   16.425 39.036  1.00 65.62  ? 492 SER B O   1 
ATOM   2839 C CB  . SER B 1 143 ? 8.978   16.423 35.802  1.00 69.81  ? 492 SER B CB  1 
ATOM   2840 O OG  . SER B 1 143 ? 9.569   17.621 36.264  1.00 76.68  ? 492 SER B OG  1 
ATOM   2841 N N   . LEU B 1 144 ? 7.315   16.066 38.524  1.00 71.86  ? 493 LEU B N   1 
ATOM   2842 C CA  . LEU B 1 144 ? 6.798   16.596 39.778  1.00 71.00  ? 493 LEU B CA  1 
ATOM   2843 C C   . LEU B 1 144 ? 7.198   15.697 40.901  1.00 66.59  ? 493 LEU B C   1 
ATOM   2844 O O   . LEU B 1 144 ? 7.665   16.163 41.930  1.00 69.20  ? 493 LEU B O   1 
ATOM   2845 C CB  . LEU B 1 144 ? 5.269   16.661 39.753  1.00 74.27  ? 493 LEU B CB  1 
ATOM   2846 C CG  . LEU B 1 144 ? 4.565   17.253 40.976  1.00 67.37  ? 493 LEU B CG  1 
ATOM   2847 C CD1 . LEU B 1 144 ? 5.116   18.628 41.293  1.00 63.27  ? 493 LEU B CD1 1 
ATOM   2848 C CD2 . LEU B 1 144 ? 3.074   17.339 40.723  1.00 69.50  ? 493 LEU B CD2 1 
ATOM   2849 N N   . HIS B 1 145 ? 6.994   14.407 40.692  1.00 64.74  ? 494 HIS B N   1 
ATOM   2850 C CA  . HIS B 1 145 ? 7.353   13.424 41.681  1.00 68.54  ? 494 HIS B CA  1 
ATOM   2851 C C   . HIS B 1 145 ? 8.838   13.355 41.945  1.00 70.58  ? 494 HIS B C   1 
ATOM   2852 O O   . HIS B 1 145 ? 9.228   13.106 43.070  1.00 73.43  ? 494 HIS B O   1 
ATOM   2853 C CB  . HIS B 1 145 ? 6.905   12.035 41.271  1.00 70.16  ? 494 HIS B CB  1 
ATOM   2854 C CG  . HIS B 1 145 ? 5.445   11.800 41.448  1.00 75.74  ? 494 HIS B CG  1 
ATOM   2855 N ND1 . HIS B 1 145 ? 4.762   10.866 40.705  1.00 82.17  ? 494 HIS B ND1 1 
ATOM   2856 C CD2 . HIS B 1 145 ? 4.535   12.358 42.282  1.00 75.10  ? 494 HIS B CD2 1 
ATOM   2857 C CE1 . HIS B 1 145 ? 3.492   10.861 41.064  1.00 78.29  ? 494 HIS B CE1 1 
ATOM   2858 N NE2 . HIS B 1 145 ? 3.326   11.757 42.018  1.00 79.04  ? 494 HIS B NE2 1 
ATOM   2859 N N   . SER B 1 146 ? 9.678   13.566 40.938  1.00 74.42  ? 495 SER B N   1 
ATOM   2860 C CA  . SER B 1 146 ? 11.120  13.444 41.164  1.00 79.31  ? 495 SER B CA  1 
ATOM   2861 C C   . SER B 1 146 ? 11.548  14.476 42.212  1.00 75.58  ? 495 SER B C   1 
ATOM   2862 O O   . SER B 1 146 ? 12.430  14.232 43.029  1.00 80.46  ? 495 SER B O   1 
ATOM   2863 C CB  . SER B 1 146 ? 11.922  13.598 39.862  1.00 83.14  ? 495 SER B CB  1 
ATOM   2864 O OG  . SER B 1 146 ? 11.944  14.938 39.394  1.00 92.54  ? 495 SER B OG  1 
ATOM   2865 N N   . LEU B 1 147 ? 10.891  15.623 42.190  1.00 72.81  ? 496 LEU B N   1 
ATOM   2866 C CA  . LEU B 1 147 ? 11.110  16.651 43.165  1.00 75.71  ? 496 LEU B CA  1 
ATOM   2867 C C   . LEU B 1 147 ? 10.612  16.251 44.555  1.00 71.47  ? 496 LEU B C   1 
ATOM   2868 O O   . LEU B 1 147 ? 10.939  16.901 45.524  1.00 71.05  ? 496 LEU B O   1 
ATOM   2869 C CB  . LEU B 1 147 ? 10.401  17.914 42.676  1.00 79.50  ? 496 LEU B CB  1 
ATOM   2870 C CG  . LEU B 1 147 ? 10.826  19.270 43.169  1.00 88.42  ? 496 LEU B CG  1 
ATOM   2871 C CD1 . LEU B 1 147 ? 12.332  19.421 43.252  1.00 90.07  ? 496 LEU B CD1 1 
ATOM   2872 C CD2 . LEU B 1 147 ? 10.215  20.313 42.250  1.00 89.57  ? 496 LEU B CD2 1 
ATOM   2873 N N   . LEU B 1 148 ? 9.827   15.190 44.657  1.00 75.32  ? 497 LEU B N   1 
ATOM   2874 C CA  . LEU B 1 148 ? 9.366   14.680 45.955  1.00 79.15  ? 497 LEU B CA  1 
ATOM   2875 C C   . LEU B 1 148 ? 8.756   15.781 46.788  1.00 77.46  ? 497 LEU B C   1 
ATOM   2876 O O   . LEU B 1 148 ? 9.328   16.199 47.800  1.00 72.05  ? 497 LEU B O   1 
ATOM   2877 C CB  . LEU B 1 148 ? 10.502  14.054 46.753  1.00 84.43  ? 497 LEU B CB  1 
ATOM   2878 C CG  . LEU B 1 148 ? 11.128  12.768 46.195  1.00 89.67  ? 497 LEU B CG  1 
ATOM   2879 C CD1 . LEU B 1 148 ? 12.637  12.920 45.982  1.00 89.17  ? 497 LEU B CD1 1 
ATOM   2880 C CD2 . LEU B 1 148 ? 10.793  11.567 47.074  1.00 85.11  ? 497 LEU B CD2 1 
ATOM   2881 N N   . VAL B 1 149 ? 7.596   16.249 46.348  1.00 75.65  ? 498 VAL B N   1 
ATOM   2882 C CA  . VAL B 1 149 ? 6.917   17.357 47.009  1.00 77.16  ? 498 VAL B CA  1 
ATOM   2883 C C   . VAL B 1 149 ? 5.960   16.823 48.084  1.00 75.44  ? 498 VAL B C   1 
ATOM   2884 O O   . VAL B 1 149 ? 4.988   16.140 47.766  1.00 70.54  ? 498 VAL B O   1 
ATOM   2885 C CB  . VAL B 1 149 ? 6.156   18.216 45.981  1.00 78.66  ? 498 VAL B CB  1 
ATOM   2886 C CG1 . VAL B 1 149 ? 5.265   19.234 46.669  1.00 78.36  ? 498 VAL B CG1 1 
ATOM   2887 C CG2 . VAL B 1 149 ? 7.126   18.908 45.037  1.00 80.05  ? 498 VAL B CG2 1 
ATOM   2888 N N   . ASP B 1 150 ? 6.235   17.140 49.351  1.00 73.05  ? 499 ASP B N   1 
ATOM   2889 C CA  . ASP B 1 150 ? 5.401   16.648 50.452  1.00 73.02  ? 499 ASP B CA  1 
ATOM   2890 C C   . ASP B 1 150 ? 4.054   17.341 50.511  1.00 73.61  ? 499 ASP B C   1 
ATOM   2891 O O   . ASP B 1 150 ? 3.876   18.452 50.019  1.00 72.37  ? 499 ASP B O   1 
ATOM   2892 C CB  . ASP B 1 150 ? 6.103   16.754 51.807  1.00 75.74  ? 499 ASP B CB  1 
ATOM   2893 C CG  . ASP B 1 150 ? 6.487   18.159 52.181  1.00 81.98  ? 499 ASP B CG  1 
ATOM   2894 O OD1 . ASP B 1 150 ? 6.246   19.124 51.430  1.00 87.51  ? 499 ASP B OD1 1 
ATOM   2895 O OD2 . ASP B 1 150 ? 7.049   18.295 53.277  1.00 91.43  ? 499 ASP B OD2 1 
ATOM   2896 N N   . VAL B 1 151 ? 3.107   16.676 51.150  1.00 73.25  ? 500 VAL B N   1 
ATOM   2897 C CA  . VAL B 1 151 ? 1.713   17.093 51.079  1.00 71.39  ? 500 VAL B CA  1 
ATOM   2898 C C   . VAL B 1 151 ? 1.491   18.545 51.466  1.00 67.36  ? 500 VAL B C   1 
ATOM   2899 O O   . VAL B 1 151 ? 0.779   19.251 50.766  1.00 75.04  ? 500 VAL B O   1 
ATOM   2900 C CB  . VAL B 1 151 ? 0.806   16.134 51.865  1.00 67.08  ? 500 VAL B CB  1 
ATOM   2901 C CG1 . VAL B 1 151 ? -0.602  16.679 51.984  1.00 70.60  ? 500 VAL B CG1 1 
ATOM   2902 C CG2 . VAL B 1 151 ? 0.777   14.793 51.148  1.00 67.79  ? 500 VAL B CG2 1 
ATOM   2903 N N   . PRO B 1 152 ? 2.118   19.007 52.549  1.00 66.68  ? 501 PRO B N   1 
ATOM   2904 C CA  . PRO B 1 152 ? 1.924   20.416 52.889  1.00 64.75  ? 501 PRO B CA  1 
ATOM   2905 C C   . PRO B 1 152 ? 2.439   21.356 51.791  1.00 62.91  ? 501 PRO B C   1 
ATOM   2906 O O   . PRO B 1 152 ? 1.744   22.289 51.413  1.00 63.24  ? 501 PRO B O   1 
ATOM   2907 C CB  . PRO B 1 152 ? 2.711   20.579 54.196  1.00 62.36  ? 501 PRO B CB  1 
ATOM   2908 C CG  . PRO B 1 152 ? 2.808   19.212 54.755  1.00 64.63  ? 501 PRO B CG  1 
ATOM   2909 C CD  . PRO B 1 152 ? 2.898   18.295 53.571  1.00 66.58  ? 501 PRO B CD  1 
ATOM   2910 N N   . ALA B 1 153 ? 3.634   21.100 51.270  1.00 62.51  ? 502 ALA B N   1 
ATOM   2911 C CA  . ALA B 1 153 ? 4.151   21.891 50.153  1.00 59.87  ? 502 ALA B CA  1 
ATOM   2912 C C   . ALA B 1 153 ? 3.192   21.855 48.967  1.00 61.12  ? 502 ALA B C   1 
ATOM   2913 O O   . ALA B 1 153 ? 2.992   22.858 48.281  1.00 66.40  ? 502 ALA B O   1 
ATOM   2914 C CB  . ALA B 1 153 ? 5.526   21.395 49.738  1.00 57.45  ? 502 ALA B CB  1 
ATOM   2915 N N   . PHE B 1 154 ? 2.586   20.700 48.715  1.00 59.28  ? 503 PHE B N   1 
ATOM   2916 C CA  . PHE B 1 154 ? 1.601   20.621 47.647  1.00 56.79  ? 503 PHE B CA  1 
ATOM   2917 C C   . PHE B 1 154 ? 0.318   21.387 47.959  1.00 55.56  ? 503 PHE B C   1 
ATOM   2918 O O   . PHE B 1 154 ? -0.297  21.978 47.080  1.00 54.09  ? 503 PHE B O   1 
ATOM   2919 C CB  . PHE B 1 154 ? 1.236   19.188 47.311  1.00 55.15  ? 503 PHE B CB  1 
ATOM   2920 C CG  . PHE B 1 154 ? 0.387   19.102 46.098  1.00 53.74  ? 503 PHE B CG  1 
ATOM   2921 C CD1 . PHE B 1 154 ? 0.975   19.204 44.863  1.00 54.31  ? 503 PHE B CD1 1 
ATOM   2922 C CD2 . PHE B 1 154 ? -1.003  19.038 46.189  1.00 55.16  ? 503 PHE B CD2 1 
ATOM   2923 C CE1 . PHE B 1 154 ? 0.209   19.176 43.731  1.00 54.88  ? 503 PHE B CE1 1 
ATOM   2924 C CE2 . PHE B 1 154 ? -1.788  18.996 45.055  1.00 57.08  ? 503 PHE B CE2 1 
ATOM   2925 C CZ  . PHE B 1 154 ? -1.173  19.060 43.818  1.00 59.62  ? 503 PHE B CZ  1 
ATOM   2926 N N   . ALA B 1 155 ? -0.087  21.350 49.214  1.00 57.35  ? 504 ALA B N   1 
ATOM   2927 C CA  . ALA B 1 155 ? -1.300  22.009 49.619  1.00 57.03  ? 504 ALA B CA  1 
ATOM   2928 C C   . ALA B 1 155 ? -1.132  23.507 49.438  1.00 62.36  ? 504 ALA B C   1 
ATOM   2929 O O   . ALA B 1 155 ? -2.088  24.215 49.109  1.00 69.89  ? 504 ALA B O   1 
ATOM   2930 C CB  . ALA B 1 155 ? -1.643  21.648 51.049  1.00 54.45  ? 504 ALA B CB  1 
ATOM   2931 N N   . CYS B 1 156 ? 0.100   23.981 49.585  1.00 66.18  ? 505 CYS B N   1 
ATOM   2932 C CA  . CYS B 1 156 ? 0.409   25.386 49.344  1.00 67.66  ? 505 CYS B CA  1 
ATOM   2933 C C   . CYS B 1 156 ? 0.480   25.704 47.858  1.00 66.51  ? 505 CYS B C   1 
ATOM   2934 O O   . CYS B 1 156 ? -0.115  26.676 47.394  1.00 75.10  ? 505 CYS B O   1 
ATOM   2935 C CB  . CYS B 1 156 ? 1.715   25.757 50.027  1.00 71.37  ? 505 CYS B CB  1 
ATOM   2936 S SG  . CYS B 1 156 ? 1.582   25.710 51.838  1.00 72.77  ? 505 CYS B SG  1 
ATOM   2937 N N   . LEU B 1 157 ? 1.193   24.881 47.102  1.00 61.54  ? 506 LEU B N   1 
ATOM   2938 C CA  . LEU B 1 157 ? 1.304   25.108 45.660  1.00 61.78  ? 506 LEU B CA  1 
ATOM   2939 C C   . LEU B 1 157 ? -0.035  25.160 44.949  1.00 59.02  ? 506 LEU B C   1 
ATOM   2940 O O   . LEU B 1 157 ? -0.239  25.999 44.087  1.00 55.17  ? 506 LEU B O   1 
ATOM   2941 C CB  . LEU B 1 157 ? 2.113   24.016 44.984  1.00 63.62  ? 506 LEU B CB  1 
ATOM   2942 C CG  . LEU B 1 157 ? 3.571   24.253 44.670  1.00 71.50  ? 506 LEU B CG  1 
ATOM   2943 C CD1 . LEU B 1 157 ? 4.007   23.045 43.867  1.00 76.50  ? 506 LEU B CD1 1 
ATOM   2944 C CD2 . LEU B 1 157 ? 3.765   25.540 43.884  1.00 72.67  ? 506 LEU B CD2 1 
ATOM   2945 N N   . SER B 1 158 ? -0.923  24.226 45.273  1.00 54.24  ? 507 SER B N   1 
ATOM   2946 C CA  . SER B 1 158 ? -2.188  24.142 44.568  1.00 50.09  ? 507 SER B CA  1 
ATOM   2947 C C   . SER B 1 158 ? -2.962  25.422 44.809  1.00 50.16  ? 507 SER B C   1 
ATOM   2948 O O   . SER B 1 158 ? -3.536  26.015 43.888  1.00 46.78  ? 507 SER B O   1 
ATOM   2949 C CB  . SER B 1 158 ? -2.985  22.908 45.006  1.00 48.86  ? 507 SER B CB  1 
ATOM   2950 O OG  . SER B 1 158 ? -2.963  22.748 46.415  1.00 49.14  ? 507 SER B OG  1 
ATOM   2951 N N   . ALA B 1 159 ? -2.912  25.882 46.049  1.00 53.07  ? 508 ALA B N   1 
ATOM   2952 C CA  . ALA B 1 159 ? -3.565  27.125 46.414  1.00 52.54  ? 508 ALA B CA  1 
ATOM   2953 C C   . ALA B 1 159 ? -2.979  28.288 45.630  1.00 54.43  ? 508 ALA B C   1 
ATOM   2954 O O   . ALA B 1 159 ? -3.700  29.190 45.211  1.00 54.64  ? 508 ALA B O   1 
ATOM   2955 C CB  . ALA B 1 159 ? -3.414  27.363 47.898  1.00 49.06  ? 508 ALA B CB  1 
ATOM   2956 N N   . LEU B 1 160 ? -1.665  28.248 45.427  1.00 59.26  ? 509 LEU B N   1 
ATOM   2957 C CA  . LEU B 1 160 ? -0.969  29.307 44.707  1.00 65.18  ? 509 LEU B CA  1 
ATOM   2958 C C   . LEU B 1 160 ? -1.318  29.400 43.232  1.00 63.36  ? 509 LEU B C   1 
ATOM   2959 O O   . LEU B 1 160 ? -1.220  30.461 42.626  1.00 71.50  ? 509 LEU B O   1 
ATOM   2960 C CB  . LEU B 1 160 ? 0.536   29.154 44.883  1.00 65.88  ? 509 LEU B CB  1 
ATOM   2961 C CG  . LEU B 1 160 ? 0.975   29.742 46.223  1.00 72.09  ? 509 LEU B CG  1 
ATOM   2962 C CD1 . LEU B 1 160 ? 2.360   29.238 46.614  1.00 72.25  ? 509 LEU B CD1 1 
ATOM   2963 C CD2 . LEU B 1 160 ? 0.929   31.267 46.182  1.00 72.41  ? 509 LEU B CD2 1 
ATOM   2964 N N   . VAL B 1 161 ? -1.733  28.287 42.664  1.00 58.91  ? 510 VAL B N   1 
ATOM   2965 C CA  . VAL B 1 161 ? -2.150  28.250 41.273  1.00 58.84  ? 510 VAL B CA  1 
ATOM   2966 C C   . VAL B 1 161 ? -3.486  28.963 41.144  1.00 56.23  ? 510 VAL B C   1 
ATOM   2967 O O   . VAL B 1 161 ? -3.751  29.653 40.173  1.00 50.93  ? 510 VAL B O   1 
ATOM   2968 C CB  . VAL B 1 161 ? -2.290  26.788 40.803  1.00 61.40  ? 510 VAL B CB  1 
ATOM   2969 C CG1 . VAL B 1 161 ? -3.050  26.686 39.486  1.00 63.14  ? 510 VAL B CG1 1 
ATOM   2970 C CG2 . VAL B 1 161 ? -0.921  26.134 40.693  1.00 60.95  ? 510 VAL B CG2 1 
ATOM   2971 N N   . LEU B 1 162 ? -4.315  28.796 42.156  1.00 56.96  ? 511 LEU B N   1 
ATOM   2972 C CA  . LEU B 1 162 ? -5.642  29.376 42.154  1.00 57.05  ? 511 LEU B CA  1 
ATOM   2973 C C   . LEU B 1 162 ? -5.583  30.873 42.454  1.00 58.98  ? 511 LEU B C   1 
ATOM   2974 O O   . LEU B 1 162 ? -6.207  31.691 41.772  1.00 55.79  ? 511 LEU B O   1 
ATOM   2975 C CB  . LEU B 1 162 ? -6.475  28.685 43.226  1.00 51.22  ? 511 LEU B CB  1 
ATOM   2976 C CG  . LEU B 1 162 ? -7.857  29.250 43.470  1.00 52.57  ? 511 LEU B CG  1 
ATOM   2977 C CD1 . LEU B 1 162 ? -8.726  29.052 42.227  1.00 52.35  ? 511 LEU B CD1 1 
ATOM   2978 C CD2 . LEU B 1 162 ? -8.465  28.591 44.698  1.00 50.95  ? 511 LEU B CD2 1 
ATOM   2979 N N   . ILE B 1 163 ? -4.822  31.208 43.491  1.00 62.66  ? 512 ILE B N   1 
ATOM   2980 C CA  . ILE B 1 163 ? -4.794  32.548 44.047  1.00 64.90  ? 512 ILE B CA  1 
ATOM   2981 C C   . ILE B 1 163 ? -3.617  33.276 43.475  1.00 66.97  ? 512 ILE B C   1 
ATOM   2982 O O   . ILE B 1 163 ? -2.497  33.124 43.944  1.00 72.38  ? 512 ILE B O   1 
ATOM   2983 C CB  . ILE B 1 163 ? -4.759  32.475 45.567  1.00 64.79  ? 512 ILE B CB  1 
ATOM   2984 C CG1 . ILE B 1 163 ? -6.094  31.894 45.934  1.00 63.21  ? 512 ILE B CG1 1 
ATOM   2985 C CG2 . ILE B 1 163 ? -4.631  33.854 46.211  1.00 62.73  ? 512 ILE B CG2 1 
ATOM   2986 C CD1 . ILE B 1 163 ? -6.154  31.328 47.292  1.00 68.51  ? 512 ILE B CD1 1 
ATOM   2987 N N   . THR B 1 164 ? -3.895  34.046 42.432  1.00 66.34  ? 513 THR B N   1 
ATOM   2988 C CA  . THR B 1 164 ? -2.861  34.593 41.586  1.00 70.34  ? 513 THR B CA  1 
ATOM   2989 C C   . THR B 1 164 ? -3.468  35.678 40.721  1.00 74.40  ? 513 THR B C   1 
ATOM   2990 O O   . THR B 1 164 ? -4.686  35.702 40.538  1.00 76.35  ? 513 THR B O   1 
ATOM   2991 C CB  . THR B 1 164 ? -2.300  33.493 40.668  1.00 70.43  ? 513 THR B CB  1 
ATOM   2992 O OG1 . THR B 1 164 ? -1.096  33.946 40.065  1.00 72.02  ? 513 THR B OG1 1 
ATOM   2993 C CG2 . THR B 1 164 ? -3.303  33.126 39.567  1.00 70.33  ? 513 THR B CG2 1 
ATOM   2994 N N   . ASP B 1 165 ? -2.637  36.566 40.178  1.00 77.75  ? 514 ASP B N   1 
ATOM   2995 C CA  . ASP B 1 165 ? -3.155  37.632 39.322  1.00 81.15  ? 514 ASP B CA  1 
ATOM   2996 C C   . ASP B 1 165 ? -3.831  37.066 38.074  1.00 78.21  ? 514 ASP B C   1 
ATOM   2997 O O   . ASP B 1 165 ? -3.268  36.201 37.398  1.00 82.26  ? 514 ASP B O   1 
ATOM   2998 C CB  . ASP B 1 165 ? -2.077  38.653 38.946  1.00 88.44  ? 514 ASP B CB  1 
ATOM   2999 C CG  . ASP B 1 165 ? -2.091  39.879 39.849  1.00 99.24  ? 514 ASP B CG  1 
ATOM   3000 O OD1 . ASP B 1 165 ? -3.122  40.600 39.901  1.00 100.53 ? 514 ASP B OD1 1 
ATOM   3001 O OD2 . ASP B 1 165 ? -1.055  40.130 40.504  1.00 111.59 ? 514 ASP B OD2 1 
ATOM   3002 N N   . ARG B 1 166 ? -5.069  37.494 37.836  1.00 71.09  ? 515 ARG B N   1 
ATOM   3003 C CA  . ARG B 1 166 ? -5.764  37.245 36.569  1.00 73.57  ? 515 ARG B CA  1 
ATOM   3004 C C   . ARG B 1 166 ? -6.315  38.567 36.071  1.00 76.74  ? 515 ARG B C   1 
ATOM   3005 O O   . ARG B 1 166 ? -6.666  39.448 36.862  1.00 74.59  ? 515 ARG B O   1 
ATOM   3006 C CB  . ARG B 1 166 ? -6.954  36.281 36.696  1.00 74.89  ? 515 ARG B CB  1 
ATOM   3007 C CG  . ARG B 1 166 ? -6.687  34.908 37.290  1.00 77.27  ? 515 ARG B CG  1 
ATOM   3008 C CD  . ARG B 1 166 ? -5.651  34.124 36.515  1.00 75.24  ? 515 ARG B CD  1 
ATOM   3009 N NE  . ARG B 1 166 ? -5.543  32.736 36.961  1.00 73.41  ? 515 ARG B NE  1 
ATOM   3010 C CZ  . ARG B 1 166 ? -4.787  31.822 36.359  1.00 75.25  ? 515 ARG B CZ  1 
ATOM   3011 N NH1 . ARG B 1 166 ? -4.083  32.146 35.282  1.00 80.49  ? 515 ARG B NH1 1 
ATOM   3012 N NH2 . ARG B 1 166 ? -4.730  30.587 36.825  1.00 70.81  ? 515 ARG B NH2 1 
ATOM   3013 N N   . HIS B 1 167 ? -6.416  38.684 34.755  1.00 76.94  ? 516 HIS B N   1 
ATOM   3014 C CA  . HIS B 1 167 ? -6.970  39.867 34.152  1.00 83.06  ? 516 HIS B CA  1 
ATOM   3015 C C   . HIS B 1 167 ? -8.454  39.944 34.437  1.00 79.77  ? 516 HIS B C   1 
ATOM   3016 O O   . HIS B 1 167 ? -9.184  38.996 34.177  1.00 74.32  ? 516 HIS B O   1 
ATOM   3017 C CB  . HIS B 1 167 ? -6.725  39.858 32.644  1.00 95.57  ? 516 HIS B CB  1 
ATOM   3018 C CG  . HIS B 1 167 ? -7.169  41.113 31.963  1.00 104.48 ? 516 HIS B CG  1 
ATOM   3019 N ND1 . HIS B 1 167 ? -6.467  42.296 32.061  1.00 103.15 ? 516 HIS B ND1 1 
ATOM   3020 C CD2 . HIS B 1 167 ? -8.256  41.381 31.202  1.00 108.00 ? 516 HIS B CD2 1 
ATOM   3021 C CE1 . HIS B 1 167 ? -7.093  43.235 31.377  1.00 109.20 ? 516 HIS B CE1 1 
ATOM   3022 N NE2 . HIS B 1 167 ? -8.180  42.705 30.844  1.00 114.89 ? 516 HIS B NE2 1 
ATOM   3023 N N   . GLY B 1 168 ? -8.888  41.071 34.996  1.00 85.81  ? 517 GLY B N   1 
ATOM   3024 C CA  . GLY B 1 168 ? -10.305 41.294 35.296  1.00 83.12  ? 517 GLY B CA  1 
ATOM   3025 C C   . GLY B 1 168 ? -10.662 41.245 36.775  1.00 74.08  ? 517 GLY B C   1 
ATOM   3026 O O   . GLY B 1 168 ? -11.812 41.452 37.146  1.00 65.19  ? 517 GLY B O   1 
ATOM   3027 N N   . LEU B 1 169 ? -9.686  40.976 37.629  1.00 76.15  ? 518 LEU B N   1 
ATOM   3028 C CA  . LEU B 1 169 ? -9.930  40.965 39.078  1.00 84.36  ? 518 LEU B CA  1 
ATOM   3029 C C   . LEU B 1 169 ? -10.401 42.314 39.586  1.00 80.51  ? 518 LEU B C   1 
ATOM   3030 O O   . LEU B 1 169 ? -9.872  43.342 39.187  1.00 76.09  ? 518 LEU B O   1 
ATOM   3031 C CB  . LEU B 1 169 ? -8.666  40.585 39.861  1.00 78.48  ? 518 LEU B CB  1 
ATOM   3032 C CG  . LEU B 1 169 ? -8.287  39.109 39.911  1.00 71.98  ? 518 LEU B CG  1 
ATOM   3033 C CD1 . LEU B 1 169 ? -7.012  39.002 40.719  1.00 71.58  ? 518 LEU B CD1 1 
ATOM   3034 C CD2 . LEU B 1 169 ? -9.397  38.261 40.528  1.00 69.77  ? 518 LEU B CD2 1 
ATOM   3035 N N   . GLN B 1 170 ? -11.417 42.285 40.445  1.00 79.76  ? 519 GLN B N   1 
ATOM   3036 C CA  . GLN B 1 170 ? -11.903 43.477 41.116  1.00 75.73  ? 519 GLN B CA  1 
ATOM   3037 C C   . GLN B 1 170 ? -10.976 43.921 42.221  1.00 79.38  ? 519 GLN B C   1 
ATOM   3038 O O   . GLN B 1 170 ? -10.781 45.103 42.401  1.00 86.48  ? 519 GLN B O   1 
ATOM   3039 C CB  . GLN B 1 170 ? -13.281 43.242 41.707  1.00 69.01  ? 519 GLN B CB  1 
ATOM   3040 C CG  . GLN B 1 170 ? -14.351 43.106 40.650  1.00 69.13  ? 519 GLN B CG  1 
ATOM   3041 C CD  . GLN B 1 170 ? -15.668 42.667 41.233  1.00 72.12  ? 519 GLN B CD  1 
ATOM   3042 O OE1 . GLN B 1 170 ? -15.773 42.422 42.428  1.00 75.52  ? 519 GLN B OE1 1 
ATOM   3043 N NE2 . GLN B 1 170 ? -16.684 42.558 40.389  1.00 77.32  ? 519 GLN B NE2 1 
ATOM   3044 N N   . GLU B 1 171 ? -10.405 42.999 42.974  1.00 80.43  ? 520 GLU B N   1 
ATOM   3045 C CA  . GLU B 1 171 ? -9.561  43.414 44.079  1.00 79.80  ? 520 GLU B CA  1 
ATOM   3046 C C   . GLU B 1 171 ? -8.200  42.747 43.986  1.00 80.56  ? 520 GLU B C   1 
ATOM   3047 O O   . GLU B 1 171 ? -7.806  41.985 44.870  1.00 81.40  ? 520 GLU B O   1 
ATOM   3048 C CB  . GLU B 1 171 ? -10.267 43.113 45.390  1.00 86.14  ? 520 GLU B CB  1 
ATOM   3049 C CG  . GLU B 1 171 ? -11.624 43.782 45.520  1.00 94.43  ? 520 GLU B CG  1 
ATOM   3050 C CD  . GLU B 1 171 ? -12.155 43.645 46.938  1.00 102.76 ? 520 GLU B CD  1 
ATOM   3051 O OE1 . GLU B 1 171 ? -12.732 42.592 47.243  1.00 113.46 ? 520 GLU B OE1 1 
ATOM   3052 O OE2 . GLU B 1 171 ? -11.975 44.565 47.759  1.00 102.40 ? 520 GLU B OE2 1 
ATOM   3053 N N   . PRO B 1 172 ? -7.464  43.031 42.900  1.00 79.05  ? 521 PRO B N   1 
ATOM   3054 C CA  . PRO B 1 172 ? -6.170  42.399 42.644  1.00 81.06  ? 521 PRO B CA  1 
ATOM   3055 C C   . PRO B 1 172 ? -5.238  42.347 43.854  1.00 89.56  ? 521 PRO B C   1 
ATOM   3056 O O   . PRO B 1 172 ? -4.517  41.369 44.014  1.00 102.94 ? 521 PRO B O   1 
ATOM   3057 C CB  . PRO B 1 172 ? -5.544  43.293 41.580  1.00 79.40  ? 521 PRO B CB  1 
ATOM   3058 C CG  . PRO B 1 172 ? -6.682  43.939 40.890  1.00 77.10  ? 521 PRO B CG  1 
ATOM   3059 C CD  . PRO B 1 172 ? -7.841  43.970 41.836  1.00 77.03  ? 521 PRO B CD  1 
ATOM   3060 N N   . ARG B 1 173 ? -5.268  43.374 44.700  1.00 92.11  ? 522 ARG B N   1 
ATOM   3061 C CA  . ARG B 1 173 ? -4.318  43.489 45.805  1.00 94.33  ? 522 ARG B CA  1 
ATOM   3062 C C   . ARG B 1 173 ? -4.627  42.520 46.962  1.00 96.11  ? 522 ARG B C   1 
ATOM   3063 O O   . ARG B 1 173 ? -3.701  42.022 47.623  1.00 97.57  ? 522 ARG B O   1 
ATOM   3064 C CB  . ARG B 1 173 ? -4.278  44.922 46.342  1.00 107.06 ? 522 ARG B CB  1 
ATOM   3065 C CG  . ARG B 1 173 ? -3.936  46.013 45.325  1.00 116.50 ? 522 ARG B CG  1 
ATOM   3066 C CD  . ARG B 1 173 ? -3.451  47.288 46.003  1.00 120.58 ? 522 ARG B CD  1 
ATOM   3067 N NE  . ARG B 1 173 ? -2.196  47.050 46.731  1.00 122.80 ? 522 ARG B NE  1 
ATOM   3068 C CZ  . ARG B 1 173 ? -1.044  47.708 46.568  1.00 115.12 ? 522 ARG B CZ  1 
ATOM   3069 N NH1 . ARG B 1 173 ? 0.015   47.354 47.296  1.00 109.75 ? 522 ARG B NH1 1 
ATOM   3070 N NH2 . ARG B 1 173 ? -0.940  48.716 45.708  1.00 106.46 ? 522 ARG B NH2 1 
ATOM   3071 N N   . ARG B 1 174 ? -5.916  42.277 47.234  1.00 90.07  ? 523 ARG B N   1 
ATOM   3072 C CA  . ARG B 1 174 ? -6.324  41.305 48.273  1.00 90.05  ? 523 ARG B CA  1 
ATOM   3073 C C   . ARG B 1 174 ? -5.911  39.888 47.903  1.00 89.89  ? 523 ARG B C   1 
ATOM   3074 O O   . ARG B 1 174 ? -5.534  39.074 48.758  1.00 75.01  ? 523 ARG B O   1 
ATOM   3075 C CB  . ARG B 1 174 ? -7.830  41.313 48.472  1.00 87.67  ? 523 ARG B CB  1 
ATOM   3076 C CG  . ARG B 1 174 ? -8.332  42.655 48.956  1.00 82.43  ? 523 ARG B CG  1 
ATOM   3077 C CD  . ARG B 1 174 ? -9.609  42.482 49.745  1.00 81.62  ? 523 ARG B CD  1 
ATOM   3078 N NE  . ARG B 1 174 ? -9.266  41.819 51.009  1.00 83.61  ? 523 ARG B NE  1 
ATOM   3079 C CZ  . ARG B 1 174 ? -9.818  40.705 51.502  1.00 88.57  ? 523 ARG B CZ  1 
ATOM   3080 N NH1 . ARG B 1 174 ? -9.364  40.208 52.661  1.00 84.72  ? 523 ARG B NH1 1 
ATOM   3081 N NH2 . ARG B 1 174 ? -10.832 40.093 50.893  1.00 88.55  ? 523 ARG B NH2 1 
ATOM   3082 N N   . VAL B 1 175 ? -6.013  39.625 46.607  1.00 85.42  ? 524 VAL B N   1 
ATOM   3083 C CA  . VAL B 1 175 ? -5.591  38.383 46.032  1.00 83.76  ? 524 VAL B CA  1 
ATOM   3084 C C   . VAL B 1 175 ? -4.075  38.260 46.170  1.00 87.80  ? 524 VAL B C   1 
ATOM   3085 O O   . VAL B 1 175 ? -3.588  37.226 46.621  1.00 101.35 ? 524 VAL B O   1 
ATOM   3086 C CB  . VAL B 1 175 ? -6.044  38.298 44.559  1.00 80.59  ? 524 VAL B CB  1 
ATOM   3087 C CG1 . VAL B 1 175 ? -5.384  37.139 43.844  1.00 82.86  ? 524 VAL B CG1 1 
ATOM   3088 C CG2 . VAL B 1 175 ? -7.547  38.147 44.495  1.00 79.12  ? 524 VAL B CG2 1 
ATOM   3089 N N   . GLU B 1 176 ? -3.336  39.312 45.811  1.00 85.07  ? 525 GLU B N   1 
ATOM   3090 C CA  . GLU B 1 176 ? -1.878  39.302 45.950  1.00 87.54  ? 525 GLU B CA  1 
ATOM   3091 C C   . GLU B 1 176 ? -1.462  39.167 47.422  1.00 91.52  ? 525 GLU B C   1 
ATOM   3092 O O   . GLU B 1 176 ? -0.432  38.562 47.721  1.00 96.85  ? 525 GLU B O   1 
ATOM   3093 C CB  . GLU B 1 176 ? -1.262  40.583 45.388  1.00 92.74  ? 525 GLU B CB  1 
ATOM   3094 C CG  . GLU B 1 176 ? -1.294  40.753 43.874  1.00 97.16  ? 525 GLU B CG  1 
ATOM   3095 C CD  . GLU B 1 176 ? -1.128  42.227 43.465  1.00 103.38 ? 525 GLU B CD  1 
ATOM   3096 O OE1 . GLU B 1 176 ? -0.889  43.063 44.366  1.00 99.23  ? 525 GLU B OE1 1 
ATOM   3097 O OE2 . GLU B 1 176 ? -1.218  42.569 42.261  1.00 94.88  ? 525 GLU B OE2 1 
ATOM   3098 N N   . GLU B 1 177 ? -2.246  39.744 48.334  1.00 89.23  ? 526 GLU B N   1 
ATOM   3099 C CA  . GLU B 1 177 ? -1.935  39.662 49.763  1.00 84.03  ? 526 GLU B CA  1 
ATOM   3100 C C   . GLU B 1 177 ? -2.117  38.233 50.226  1.00 74.37  ? 526 GLU B C   1 
ATOM   3101 O O   . GLU B 1 177 ? -1.245  37.671 50.886  1.00 79.91  ? 526 GLU B O   1 
ATOM   3102 C CB  . GLU B 1 177 ? -2.735  40.684 50.618  1.00 95.66  ? 526 GLU B CB  1 
ATOM   3103 C CG  . GLU B 1 177 ? -1.987  42.049 50.756  1.00 102.80 ? 526 GLU B CG  1 
ATOM   3104 C CD  . GLU B 1 177 ? -2.858  43.312 50.686  1.00 107.00 ? 526 GLU B CD  1 
ATOM   3105 O OE1 . GLU B 1 177 ? -4.073  43.246 50.961  1.00 106.31 ? 526 GLU B OE1 1 
ATOM   3106 O OE2 . GLU B 1 177 ? -2.311  44.401 50.368  1.00 106.11 ? 526 GLU B OE2 1 
ATOM   3107 N N   . LEU B 1 178 ? -3.217  37.622 49.807  1.00 72.39  ? 527 LEU B N   1 
ATOM   3108 C CA  . LEU B 1 178 ? -3.508  36.234 50.125  1.00 66.57  ? 527 LEU B CA  1 
ATOM   3109 C C   . LEU B 1 178 ? -2.452  35.303 49.531  1.00 70.03  ? 527 LEU B C   1 
ATOM   3110 O O   . LEU B 1 178 ? -2.013  34.365 50.178  1.00 72.54  ? 527 LEU B O   1 
ATOM   3111 C CB  . LEU B 1 178 ? -4.891  35.879 49.600  1.00 64.99  ? 527 LEU B CB  1 
ATOM   3112 C CG  . LEU B 1 178 ? -5.449  34.522 50.028  1.00 68.48  ? 527 LEU B CG  1 
ATOM   3113 C CD1 . LEU B 1 178 ? -5.282  34.270 51.521  1.00 70.75  ? 527 LEU B CD1 1 
ATOM   3114 C CD2 . LEU B 1 178 ? -6.910  34.416 49.636  1.00 66.42  ? 527 LEU B CD2 1 
ATOM   3115 N N   . GLN B 1 179 ? -2.054  35.562 48.290  1.00 74.09  ? 528 GLN B N   1 
ATOM   3116 C CA  . GLN B 1 179 ? -0.854  34.946 47.726  1.00 77.61  ? 528 GLN B CA  1 
ATOM   3117 C C   . GLN B 1 179 ? 0.338   35.012 48.652  1.00 76.97  ? 528 GLN B C   1 
ATOM   3118 O O   . GLN B 1 179 ? 0.958   34.006 48.927  1.00 78.59  ? 528 GLN B O   1 
ATOM   3119 C CB  . GLN B 1 179 ? -0.426  35.633 46.433  1.00 85.58  ? 528 GLN B CB  1 
ATOM   3120 C CG  . GLN B 1 179 ? -0.753  34.835 45.182  1.00 82.74  ? 528 GLN B CG  1 
ATOM   3121 C CD  . GLN B 1 179 ? 0.381   34.744 44.191  1.00 78.57  ? 528 GLN B CD  1 
ATOM   3122 O OE1 . GLN B 1 179 ? 1.189   35.658 44.073  1.00 72.37  ? 528 GLN B OE1 1 
ATOM   3123 N NE2 . GLN B 1 179 ? 0.454   33.625 43.472  1.00 83.33  ? 528 GLN B NE2 1 
ATOM   3124 N N   . ASN B 1 180 ? 0.671   36.222 49.097  1.00 79.43  ? 529 ASN B N   1 
ATOM   3125 C CA  . ASN B 1 180 ? 1.861   36.429 49.920  1.00 77.63  ? 529 ASN B CA  1 
ATOM   3126 C C   . ASN B 1 180 ? 1.753   35.594 51.168  1.00 74.32  ? 529 ASN B C   1 
ATOM   3127 O O   . ASN B 1 180 ? 2.711   34.960 51.556  1.00 73.52  ? 529 ASN B O   1 
ATOM   3128 C CB  . ASN B 1 180 ? 2.066   37.894 50.318  1.00 80.78  ? 529 ASN B CB  1 
ATOM   3129 C CG  . ASN B 1 180 ? 2.468   38.790 49.143  1.00 89.57  ? 529 ASN B CG  1 
ATOM   3130 O OD1 . ASN B 1 180 ? 3.109   38.362 48.170  1.00 91.65  ? 529 ASN B OD1 1 
ATOM   3131 N ND2 . ASN B 1 180 ? 2.097   40.068 49.246  1.00 92.14  ? 529 ASN B ND2 1 
ATOM   3132 N N   . ARG B 1 181 ? 0.582   35.601 51.800  1.00 75.70  ? 530 ARG B N   1 
ATOM   3133 C CA  . ARG B 1 181 ? 0.371   34.810 53.005  1.00 78.02  ? 530 ARG B CA  1 
ATOM   3134 C C   . ARG B 1 181 ? 0.695   33.345 52.765  1.00 74.93  ? 530 ARG B C   1 
ATOM   3135 O O   . ARG B 1 181 ? 1.382   32.703 53.572  1.00 69.98  ? 530 ARG B O   1 
ATOM   3136 C CB  . ARG B 1 181 ? -1.068  34.938 53.516  1.00 87.61  ? 530 ARG B CB  1 
ATOM   3137 C CG  . ARG B 1 181 ? -1.225  35.971 54.626  1.00 94.89  ? 530 ARG B CG  1 
ATOM   3138 C CD  . ARG B 1 181 ? -2.693  36.285 54.898  1.00 99.12  ? 530 ARG B CD  1 
ATOM   3139 N NE  . ARG B 1 181 ? -3.185  37.402 54.087  1.00 107.81 ? 530 ARG B NE  1 
ATOM   3140 C CZ  . ARG B 1 181 ? -4.460  37.611 53.759  1.00 113.08 ? 530 ARG B CZ  1 
ATOM   3141 N NH1 . ARG B 1 181 ? -4.780  38.659 53.005  1.00 115.06 ? 530 ARG B NH1 1 
ATOM   3142 N NH2 . ARG B 1 181 ? -5.421  36.782 54.166  1.00 116.49 ? 530 ARG B NH2 1 
ATOM   3143 N N   . ILE B 1 182 ? 0.182   32.823 51.658  1.00 69.47  ? 531 ILE B N   1 
ATOM   3144 C CA  . ILE B 1 182 ? 0.326   31.413 51.355  1.00 69.75  ? 531 ILE B CA  1 
ATOM   3145 C C   . ILE B 1 182 ? 1.759   31.104 50.972  1.00 69.45  ? 531 ILE B C   1 
ATOM   3146 O O   . ILE B 1 182 ? 2.265   30.028 51.273  1.00 72.63  ? 531 ILE B O   1 
ATOM   3147 C CB  . ILE B 1 182 ? -0.642  30.972 50.247  1.00 66.50  ? 531 ILE B CB  1 
ATOM   3148 C CG1 . ILE B 1 182 ? -2.073  31.098 50.746  1.00 65.33  ? 531 ILE B CG1 1 
ATOM   3149 C CG2 . ILE B 1 182 ? -0.390  29.522 49.852  1.00 68.51  ? 531 ILE B CG2 1 
ATOM   3150 C CD1 . ILE B 1 182 ? -3.094  31.062 49.633  1.00 69.16  ? 531 ILE B CD1 1 
ATOM   3151 N N   . ALA B 1 183 ? 2.410   32.039 50.297  1.00 72.30  ? 532 ALA B N   1 
ATOM   3152 C CA  . ALA B 1 183 ? 3.813   31.865 49.949  1.00 72.90  ? 532 ALA B CA  1 
ATOM   3153 C C   . ALA B 1 183 ? 4.701   31.845 51.197  1.00 73.22  ? 532 ALA B C   1 
ATOM   3154 O O   . ALA B 1 183 ? 5.647   31.085 51.247  1.00 74.33  ? 532 ALA B O   1 
ATOM   3155 C CB  . ALA B 1 183 ? 4.268   32.940 48.980  1.00 73.65  ? 532 ALA B CB  1 
ATOM   3156 N N   . SER B 1 184 ? 4.390   32.666 52.201  1.00 75.70  ? 533 SER B N   1 
ATOM   3157 C CA  . SER B 1 184 ? 5.131   32.662 53.465  1.00 75.42  ? 533 SER B CA  1 
ATOM   3158 C C   . SER B 1 184 ? 4.996   31.311 54.097  1.00 76.77  ? 533 SER B C   1 
ATOM   3159 O O   . SER B 1 184 ? 5.966   30.721 54.541  1.00 85.01  ? 533 SER B O   1 
ATOM   3160 C CB  . SER B 1 184 ? 4.564   33.668 54.469  1.00 71.68  ? 533 SER B CB  1 
ATOM   3161 O OG  . SER B 1 184 ? 4.512   34.965 53.941  1.00 76.29  ? 533 SER B OG  1 
ATOM   3162 N N   . CYS B 1 185 ? 3.755   30.853 54.154  1.00 81.79  ? 534 CYS B N   1 
ATOM   3163 C CA  . CYS B 1 185 ? 3.416   29.575 54.741  1.00 81.28  ? 534 CYS B CA  1 
ATOM   3164 C C   . CYS B 1 185 ? 4.289   28.476 54.145  1.00 76.37  ? 534 CYS B C   1 
ATOM   3165 O O   . CYS B 1 185 ? 4.883   27.665 54.864  1.00 70.86  ? 534 CYS B O   1 
ATOM   3166 C CB  . CYS B 1 185 ? 1.944   29.292 54.461  1.00 82.47  ? 534 CYS B CB  1 
ATOM   3167 S SG  . CYS B 1 185 ? 1.289   27.878 55.348  1.00 81.52  ? 534 CYS B SG  1 
ATOM   3168 N N   . LEU B 1 186 ? 4.375   28.486 52.819  1.00 73.71  ? 535 LEU B N   1 
ATOM   3169 C CA  . LEU B 1 186 ? 5.134   27.493 52.088  1.00 77.60  ? 535 LEU B CA  1 
ATOM   3170 C C   . LEU B 1 186 ? 6.618   27.588 52.415  1.00 83.05  ? 535 LEU B C   1 
ATOM   3171 O O   . LEU B 1 186 ? 7.245   26.591 52.777  1.00 86.97  ? 535 LEU B O   1 
ATOM   3172 C CB  . LEU B 1 186 ? 4.915   27.660 50.580  1.00 72.46  ? 535 LEU B CB  1 
ATOM   3173 C CG  . LEU B 1 186 ? 5.722   26.736 49.655  1.00 70.47  ? 535 LEU B CG  1 
ATOM   3174 C CD1 . LEU B 1 186 ? 5.508   25.274 50.002  1.00 66.29  ? 535 LEU B CD1 1 
ATOM   3175 C CD2 . LEU B 1 186 ? 5.368   26.980 48.198  1.00 69.85  ? 535 LEU B CD2 1 
ATOM   3176 N N   . LYS B 1 187 ? 7.157   28.799 52.317  1.00 85.69  ? 536 LYS B N   1 
ATOM   3177 C CA  . LYS B 1 187 ? 8.577   29.040 52.561  1.00 90.16  ? 536 LYS B CA  1 
ATOM   3178 C C   . LYS B 1 187 ? 8.992   28.552 53.958  1.00 93.43  ? 536 LYS B C   1 
ATOM   3179 O O   . LYS B 1 187 ? 10.016  27.882 54.117  1.00 88.95  ? 536 LYS B O   1 
ATOM   3180 C CB  . LYS B 1 187 ? 8.905   30.529 52.415  1.00 93.28  ? 536 LYS B CB  1 
ATOM   3181 C CG  . LYS B 1 187 ? 10.387  30.781 52.162  1.00 104.39 ? 536 LYS B CG  1 
ATOM   3182 C CD  . LYS B 1 187 ? 10.846  32.195 52.497  1.00 111.91 ? 536 LYS B CD  1 
ATOM   3183 C CE  . LYS B 1 187 ? 11.913  32.655 51.503  1.00 112.32 ? 536 LYS B CE  1 
ATOM   3184 N NZ  . LYS B 1 187 ? 12.309  34.075 51.683  1.00 112.96 ? 536 LYS B NZ  1 
ATOM   3185 N N   . GLU B 1 188 ? 8.189   28.890 54.963  1.00 92.66  ? 537 GLU B N   1 
ATOM   3186 C CA  . GLU B 1 188 ? 8.484   28.506 56.329  1.00 93.86  ? 537 GLU B CA  1 
ATOM   3187 C C   . GLU B 1 188 ? 8.406   27.012 56.450  1.00 94.10  ? 537 GLU B C   1 
ATOM   3188 O O   . GLU B 1 188 ? 9.268   26.423 57.073  1.00 103.12 ? 537 GLU B O   1 
ATOM   3189 C CB  . GLU B 1 188 ? 7.543   29.186 57.323  1.00 106.00 ? 537 GLU B CB  1 
ATOM   3190 C CG  . GLU B 1 188 ? 7.924   30.641 57.588  1.00 123.74 ? 537 GLU B CG  1 
ATOM   3191 C CD  . GLU B 1 188 ? 6.730   31.546 57.876  1.00 131.49 ? 537 GLU B CD  1 
ATOM   3192 O OE1 . GLU B 1 188 ? 5.774   31.093 58.531  1.00 135.43 ? 537 GLU B OE1 1 
ATOM   3193 O OE2 . GLU B 1 188 ? 6.757   32.724 57.463  1.00 133.14 ? 537 GLU B OE2 1 
ATOM   3194 N N   . HIS B 1 189 ? 7.396   26.391 55.842  1.00 93.73  ? 538 HIS B N   1 
ATOM   3195 C CA  . HIS B 1 189 ? 7.321   24.936 55.840  1.00 90.67  ? 538 HIS B CA  1 
ATOM   3196 C C   . HIS B 1 189 ? 8.547   24.275 55.210  1.00 96.00  ? 538 HIS B C   1 
ATOM   3197 O O   . HIS B 1 189 ? 9.040   23.283 55.749  1.00 113.28 ? 538 HIS B O   1 
ATOM   3198 C CB  . HIS B 1 189 ? 6.090   24.399 55.132  1.00 86.61  ? 538 HIS B CB  1 
ATOM   3199 C CG  . HIS B 1 189 ? 6.144   22.915 54.930  1.00 89.68  ? 538 HIS B CG  1 
ATOM   3200 N ND1 . HIS B 1 189 ? 5.823   22.015 55.926  1.00 91.51  ? 538 HIS B ND1 1 
ATOM   3201 C CD2 . HIS B 1 189 ? 6.534   22.172 53.866  1.00 88.70  ? 538 HIS B CD2 1 
ATOM   3202 C CE1 . HIS B 1 189 ? 5.984   20.783 55.474  1.00 88.77  ? 538 HIS B CE1 1 
ATOM   3203 N NE2 . HIS B 1 189 ? 6.415   20.851 54.226  1.00 86.18  ? 538 HIS B NE2 1 
ATOM   3204 N N   . VAL B 1 190 ? 9.025   24.775 54.072  1.00 98.21  ? 539 VAL B N   1 
ATOM   3205 C CA  . VAL B 1 190 ? 10.212  24.145 53.431  1.00 102.87 ? 539 VAL B CA  1 
ATOM   3206 C C   . VAL B 1 190 ? 11.463  24.288 54.304  1.00 101.76 ? 539 VAL B C   1 
ATOM   3207 O O   . VAL B 1 190 ? 12.280  23.369 54.359  1.00 93.62  ? 539 VAL B O   1 
ATOM   3208 C CB  . VAL B 1 190 ? 10.514  24.596 51.965  1.00 102.09 ? 539 VAL B CB  1 
ATOM   3209 C CG1 . VAL B 1 190 ? 9.270   24.472 51.091  1.00 100.85 ? 539 VAL B CG1 1 
ATOM   3210 C CG2 . VAL B 1 190 ? 11.125  25.994 51.890  1.00 103.61 ? 539 VAL B CG2 1 
ATOM   3211 N N   . ALA B 1 191 ? 11.586  25.425 54.994  1.00 103.22 ? 540 ALA B N   1 
ATOM   3212 C CA  . ALA B 1 191 ? 12.686  25.656 55.938  1.00 104.40 ? 540 ALA B CA  1 
ATOM   3213 C C   . ALA B 1 191 ? 12.562  24.786 57.200  1.00 107.85 ? 540 ALA B C   1 
ATOM   3214 O O   . ALA B 1 191 ? 13.553  24.218 57.660  1.00 119.36 ? 540 ALA B O   1 
ATOM   3215 C CB  . ALA B 1 191 ? 12.761  27.129 56.316  1.00 102.69 ? 540 ALA B CB  1 
ATOM   3216 N N   . ALA B 1 192 ? 11.351  24.699 57.758  1.00 109.90 ? 541 ALA B N   1 
ATOM   3217 C CA  . ALA B 1 192 ? 11.041  23.789 58.882  1.00 108.65 ? 541 ALA B CA  1 
ATOM   3218 C C   . ALA B 1 192 ? 11.544  22.358 58.638  1.00 107.63 ? 541 ALA B C   1 
ATOM   3219 O O   . ALA B 1 192 ? 12.161  21.748 59.520  1.00 100.63 ? 541 ALA B O   1 
ATOM   3220 C CB  . ALA B 1 192 ? 9.538   23.778 59.162  1.00 106.79 ? 541 ALA B CB  1 
ATOM   3221 N N   . VAL B 1 193 ? 11.273  21.834 57.444  1.00 103.76 ? 542 VAL B N   1 
ATOM   3222 C CA  . VAL B 1 193 ? 11.792  20.530 57.033  1.00 102.50 ? 542 VAL B CA  1 
ATOM   3223 C C   . VAL B 1 193 ? 13.331  20.550 56.917  1.00 103.82 ? 542 VAL B C   1 
ATOM   3224 O O   . VAL B 1 193 ? 13.909  20.871 55.872  1.00 99.82  ? 542 VAL B O   1 
ATOM   3225 C CB  . VAL B 1 193 ? 11.123  20.064 55.723  1.00 95.68  ? 542 VAL B CB  1 
ATOM   3226 C CG1 . VAL B 1 193 ? 11.859  18.876 55.111  1.00 95.19  ? 542 VAL B CG1 1 
ATOM   3227 C CG2 . VAL B 1 193 ? 9.664   19.710 55.988  1.00 90.44  ? 542 VAL B CG2 1 
ATOM   3228 N N   . CYS B 1 202 ? 15.309  24.114 45.723  1.00 109.87 ? 551 CYS B N   1 
ATOM   3229 C CA  . CYS B 1 202 ? 13.988  23.663 46.143  1.00 122.11 ? 551 CYS B CA  1 
ATOM   3230 C C   . CYS B 1 202 ? 13.083  24.844 46.478  1.00 128.30 ? 551 CYS B C   1 
ATOM   3231 O O   . CYS B 1 202 ? 11.934  24.901 46.040  1.00 127.57 ? 551 CYS B O   1 
ATOM   3232 C CB  . CYS B 1 202 ? 14.100  22.728 47.349  1.00 124.39 ? 551 CYS B CB  1 
ATOM   3233 S SG  . CYS B 1 202 ? 12.784  21.493 47.461  1.00 135.42 ? 551 CYS B SG  1 
ATOM   3234 N N   . LEU B 1 203 ? 13.609  25.784 47.257  1.00 136.93 ? 552 LEU B N   1 
ATOM   3235 C CA  . LEU B 1 203 ? 12.850  26.964 47.651  1.00 142.27 ? 552 LEU B CA  1 
ATOM   3236 C C   . LEU B 1 203 ? 12.146  27.594 46.454  1.00 136.50 ? 552 LEU B C   1 
ATOM   3237 O O   . LEU B 1 203 ? 11.146  28.294 46.607  1.00 123.11 ? 552 LEU B O   1 
ATOM   3238 C CB  . LEU B 1 203 ? 13.766  27.990 48.322  1.00 147.82 ? 552 LEU B CB  1 
ATOM   3239 C CG  . LEU B 1 203 ? 13.282  29.442 48.312  1.00 148.02 ? 552 LEU B CG  1 
ATOM   3240 C CD1 . LEU B 1 203 ? 12.960  29.911 49.722  1.00 149.76 ? 552 LEU B CD1 1 
ATOM   3241 C CD2 . LEU B 1 203 ? 14.317  30.349 47.664  1.00 135.07 ? 552 LEU B CD2 1 
ATOM   3242 N N   . SER B 1 204 ? 12.676  27.340 45.262  1.00 126.72 ? 553 SER B N   1 
ATOM   3243 C CA  . SER B 1 204 ? 12.101  27.881 44.037  1.00 112.40 ? 553 SER B CA  1 
ATOM   3244 C C   . SER B 1 204 ? 12.126  26.851 42.912  1.00 105.92 ? 553 SER B C   1 
ATOM   3245 O O   . SER B 1 204 ? 11.718  27.137 41.787  1.00 97.60  ? 553 SER B O   1 
ATOM   3246 C CB  . SER B 1 204 ? 12.847  29.146 43.607  1.00 107.51 ? 553 SER B CB  1 
ATOM   3247 O OG  . SER B 1 204 ? 14.211  28.869 43.344  1.00 104.15 ? 553 SER B OG  1 
ATOM   3248 N N   . ARG B 1 205 ? 12.545  25.644 43.200  1.00 107.35 ? 554 ARG B N   1 
ATOM   3249 C CA  . ARG B 1 205 ? 12.619  24.585 42.227  1.00 101.79 ? 554 ARG B CA  1 
ATOM   3250 C C   . ARG B 1 205 ? 11.236  24.127 41.986  1.00 94.01  ? 554 ARG B C   1 
ATOM   3251 O O   . ARG B 1 205 ? 10.884  23.810 40.879  1.00 85.87  ? 554 ARG B O   1 
ATOM   3252 C CB  . ARG B 1 205 ? 13.468  23.475 42.810  1.00 109.47 ? 554 ARG B CB  1 
ATOM   3253 C CG  . ARG B 1 205 ? 13.977  22.392 41.876  1.00 119.49 ? 554 ARG B CG  1 
ATOM   3254 C CD  . ARG B 1 205 ? 14.956  22.826 40.790  1.00 123.89 ? 554 ARG B CD  1 
ATOM   3255 N NE  . ARG B 1 205 ? 15.098  21.817 39.724  1.00 128.41 ? 554 ARG B NE  1 
ATOM   3256 C CZ  . ARG B 1 205 ? 15.675  21.995 38.546  1.00 129.30 ? 554 ARG B CZ  1 
ATOM   3257 N NH1 . ARG B 1 205 ? 16.194  23.143 38.197  1.00 128.28 ? 554 ARG B NH1 1 
ATOM   3258 N NH2 . ARG B 1 205 ? 15.723  20.985 37.722  1.00 132.30 ? 554 ARG B NH2 1 
ATOM   3259 N N   . LEU B 1 206 ? 10.435  24.130 43.034  1.00 94.86  ? 555 LEU B N   1 
ATOM   3260 C CA  . LEU B 1 206 ? 9.003   23.807 42.914  1.00 97.17  ? 555 LEU B CA  1 
ATOM   3261 C C   . LEU B 1 206 ? 8.206   24.970 42.314  1.00 92.06  ? 555 LEU B C   1 
ATOM   3262 O O   . LEU B 1 206 ? 7.350   24.757 41.466  1.00 94.38  ? 555 LEU B O   1 
ATOM   3263 C CB  . LEU B 1 206 ? 8.382   23.295 44.229  1.00 104.86 ? 555 LEU B CB  1 
ATOM   3264 C CG  . LEU B 1 206 ? 8.637   24.004 45.571  1.00 112.29 ? 555 LEU B CG  1 
ATOM   3265 C CD1 . LEU B 1 206 ? 7.326   24.384 46.247  1.00 116.13 ? 555 LEU B CD1 1 
ATOM   3266 C CD2 . LEU B 1 206 ? 9.474   23.131 46.500  1.00 115.99 ? 555 LEU B CD2 1 
ATOM   3267 N N   . LEU B 1 207 ? 8.518   26.201 42.694  1.00 83.08  ? 556 LEU B N   1 
ATOM   3268 C CA  . LEU B 1 207 ? 7.878   27.332 42.057  1.00 75.32  ? 556 LEU B CA  1 
ATOM   3269 C C   . LEU B 1 207 ? 8.181   27.365 40.565  1.00 72.39  ? 556 LEU B C   1 
ATOM   3270 O O   . LEU B 1 207 ? 7.365   27.833 39.788  1.00 69.46  ? 556 LEU B O   1 
ATOM   3271 C CB  . LEU B 1 207 ? 8.311   28.643 42.707  1.00 79.35  ? 556 LEU B CB  1 
ATOM   3272 C CG  . LEU B 1 207 ? 7.824   28.948 44.125  1.00 80.67  ? 556 LEU B CG  1 
ATOM   3273 C CD1 . LEU B 1 207 ? 8.072   30.418 44.424  1.00 81.53  ? 556 LEU B CD1 1 
ATOM   3274 C CD2 . LEU B 1 207 ? 6.347   28.619 44.313  1.00 82.60  ? 556 LEU B CD2 1 
ATOM   3275 N N   . GLY B 1 208 ? 9.348   26.864 40.166  1.00 77.64  ? 557 GLY B N   1 
ATOM   3276 C CA  . GLY B 1 208 ? 9.726   26.778 38.755  1.00 82.07  ? 557 GLY B CA  1 
ATOM   3277 C C   . GLY B 1 208 ? 8.796   25.888 37.960  1.00 81.14  ? 557 GLY B C   1 
ATOM   3278 O O   . GLY B 1 208 ? 8.687   26.033 36.742  1.00 79.13  ? 557 GLY B O   1 
ATOM   3279 N N   . LYS B 1 209 ? 8.124   24.970 38.654  1.00 81.95  ? 558 LYS B N   1 
ATOM   3280 C CA  . LYS B 1 209 ? 7.158   24.084 38.015  1.00 88.90  ? 558 LYS B CA  1 
ATOM   3281 C C   . LYS B 1 209 ? 5.990   24.806 37.402  1.00 98.08  ? 558 LYS B C   1 
ATOM   3282 O O   . LYS B 1 209 ? 5.528   24.399 36.356  1.00 108.82 ? 558 LYS B O   1 
ATOM   3283 C CB  . LYS B 1 209 ? 6.613   23.033 38.983  1.00 88.39  ? 558 LYS B CB  1 
ATOM   3284 C CG  . LYS B 1 209 ? 7.089   21.627 38.715  1.00 91.67  ? 558 LYS B CG  1 
ATOM   3285 C CD  . LYS B 1 209 ? 8.602   21.492 38.745  1.00 99.11  ? 558 LYS B CD  1 
ATOM   3286 C CE  . LYS B 1 209 ? 9.028   20.106 38.277  1.00 109.54 ? 558 LYS B CE  1 
ATOM   3287 N NZ  . LYS B 1 209 ? 8.896   19.947 36.801  1.00 110.95 ? 558 LYS B NZ  1 
ATOM   3288 N N   . LEU B 1 210 ? 5.537   25.887 38.021  1.00 96.31  ? 559 LEU B N   1 
ATOM   3289 C CA  . LEU B 1 210 ? 4.266   26.499 37.617  1.00 88.55  ? 559 LEU B CA  1 
ATOM   3290 C C   . LEU B 1 210 ? 4.286   26.970 36.124  1.00 91.10  ? 559 LEU B C   1 
ATOM   3291 O O   . LEU B 1 210 ? 3.364   26.689 35.358  1.00 89.59  ? 559 LEU B O   1 
ATOM   3292 C CB  . LEU B 1 210 ? 3.863   27.587 38.639  1.00 88.14  ? 559 LEU B CB  1 
ATOM   3293 C CG  . LEU B 1 210 ? 3.781   27.132 40.121  1.00 91.01  ? 559 LEU B CG  1 
ATOM   3294 C CD1 . LEU B 1 210 ? 3.328   28.232 41.081  1.00 83.16  ? 559 LEU B CD1 1 
ATOM   3295 C CD2 . LEU B 1 210 ? 2.872   25.922 40.272  1.00 94.80  ? 559 LEU B CD2 1 
ATOM   3296 N N   . PRO B 1 211 ? 5.368   27.626 35.681  1.00 89.62  ? 560 PRO B N   1 
ATOM   3297 C CA  . PRO B 1 211 ? 5.518   27.899 34.255  1.00 86.00  ? 560 PRO B CA  1 
ATOM   3298 C C   . PRO B 1 211 ? 5.173   26.758 33.336  1.00 78.75  ? 560 PRO B C   1 
ATOM   3299 O O   . PRO B 1 211 ? 4.514   26.984 32.345  1.00 79.36  ? 560 PRO B O   1 
ATOM   3300 C CB  . PRO B 1 211 ? 7.013   28.203 34.113  1.00 91.90  ? 560 PRO B CB  1 
ATOM   3301 C CG  . PRO B 1 211 ? 7.436   28.684 35.466  1.00 97.42  ? 560 PRO B CG  1 
ATOM   3302 C CD  . PRO B 1 211 ? 6.346   28.391 36.463  1.00 91.68  ? 560 PRO B CD  1 
ATOM   3303 N N   . GLU B 1 212 ? 5.638   25.551 33.626  1.00 78.88  ? 561 GLU B N   1 
ATOM   3304 C CA  . GLU B 1 212 ? 5.385   24.434 32.707  1.00 84.95  ? 561 GLU B CA  1 
ATOM   3305 C C   . GLU B 1 212 ? 3.969   23.917 32.823  1.00 77.50  ? 561 GLU B C   1 
ATOM   3306 O O   . GLU B 1 212 ? 3.467   23.265 31.906  1.00 78.46  ? 561 GLU B O   1 
ATOM   3307 C CB  . GLU B 1 212 ? 6.400   23.297 32.815  1.00 91.93  ? 561 GLU B CB  1 
ATOM   3308 C CG  . GLU B 1 212 ? 7.187   23.210 34.101  1.00 101.28 ? 561 GLU B CG  1 
ATOM   3309 C CD  . GLU B 1 212 ? 8.006   21.932 34.190  1.00 111.65 ? 561 GLU B CD  1 
ATOM   3310 O OE1 . GLU B 1 212 ? 7.774   20.996 33.378  1.00 113.45 ? 561 GLU B OE1 1 
ATOM   3311 O OE2 . GLU B 1 212 ? 8.876   21.862 35.091  1.00 119.95 ? 561 GLU B OE2 1 
ATOM   3312 N N   . LEU B 1 213 ? 3.326   24.219 33.944  1.00 75.16  ? 562 LEU B N   1 
ATOM   3313 C CA  . LEU B 1 213 ? 1.926   23.897 34.125  1.00 70.74  ? 562 LEU B CA  1 
ATOM   3314 C C   . LEU B 1 213 ? 1.049   24.746 33.228  1.00 66.82  ? 562 LEU B C   1 
ATOM   3315 O O   . LEU B 1 213 ? 0.046   24.280 32.745  1.00 63.66  ? 562 LEU B O   1 
ATOM   3316 C CB  . LEU B 1 213 ? 1.523   24.096 35.583  1.00 70.15  ? 562 LEU B CB  1 
ATOM   3317 C CG  . LEU B 1 213 ? 0.136   23.597 35.982  1.00 69.95  ? 562 LEU B CG  1 
ATOM   3318 C CD1 . LEU B 1 213 ? -0.053  22.097 35.767  1.00 70.19  ? 562 LEU B CD1 1 
ATOM   3319 C CD2 . LEU B 1 213 ? -0.073  23.943 37.439  1.00 70.10  ? 562 LEU B CD2 1 
ATOM   3320 N N   . ARG B 1 214 ? 1.438   25.994 33.006  1.00 73.12  ? 563 ARG B N   1 
ATOM   3321 C CA  . ARG B 1 214 ? 0.717   26.873 32.078  1.00 72.84  ? 563 ARG B CA  1 
ATOM   3322 C C   . ARG B 1 214 ? 0.754   26.280 30.695  1.00 66.32  ? 563 ARG B C   1 
ATOM   3323 O O   . ARG B 1 214 ? -0.260  26.197 30.023  1.00 68.04  ? 563 ARG B O   1 
ATOM   3324 C CB  . ARG B 1 214 ? 1.337   28.274 32.033  1.00 78.75  ? 563 ARG B CB  1 
ATOM   3325 C CG  . ARG B 1 214 ? 1.038   29.149 33.242  1.00 92.19  ? 563 ARG B CG  1 
ATOM   3326 C CD  . ARG B 1 214 ? -0.418  29.603 33.291  1.00 97.20  ? 563 ARG B CD  1 
ATOM   3327 N NE  . ARG B 1 214 ? -0.687  30.454 34.451  1.00 96.17  ? 563 ARG B NE  1 
ATOM   3328 C CZ  . ARG B 1 214 ? -0.659  31.787 34.462  1.00 99.08  ? 563 ARG B CZ  1 
ATOM   3329 N NH1 . ARG B 1 214 ? -0.377  32.487 33.360  1.00 105.84 ? 563 ARG B NH1 1 
ATOM   3330 N NH2 . ARG B 1 214 ? -0.916  32.432 35.595  1.00 96.59  ? 563 ARG B NH2 1 
ATOM   3331 N N   . THR B 1 215 ? 1.936   25.850 30.288  1.00 62.35  ? 564 THR B N   1 
ATOM   3332 C CA  . THR B 1 215 ? 2.118   25.222 29.001  1.00 63.62  ? 564 THR B CA  1 
ATOM   3333 C C   . THR B 1 215 ? 1.234   24.016 28.843  1.00 60.47  ? 564 THR B C   1 
ATOM   3334 O O   . THR B 1 215 ? 0.680   23.765 27.770  1.00 65.13  ? 564 THR B O   1 
ATOM   3335 C CB  . THR B 1 215 ? 3.550   24.747 28.852  1.00 67.72  ? 564 THR B CB  1 
ATOM   3336 O OG1 . THR B 1 215 ? 4.419   25.807 29.267  1.00 68.47  ? 564 THR B OG1 1 
ATOM   3337 C CG2 . THR B 1 215 ? 3.832   24.356 27.407  1.00 67.58  ? 564 THR B CG2 1 
ATOM   3338 N N   . LEU B 1 216 ? 1.110   23.251 29.913  1.00 57.07  ? 565 LEU B N   1 
ATOM   3339 C CA  . LEU B 1 216 ? 0.247   22.070 29.883  1.00 58.94  ? 565 LEU B CA  1 
ATOM   3340 C C   . LEU B 1 216 ? -1.257  22.425 29.784  1.00 57.41  ? 565 LEU B C   1 
ATOM   3341 O O   . LEU B 1 216 ? -2.055  21.712 29.161  1.00 56.36  ? 565 LEU B O   1 
ATOM   3342 C CB  . LEU B 1 216 ? 0.529   21.243 31.121  1.00 58.56  ? 565 LEU B CB  1 
ATOM   3343 C CG  . LEU B 1 216 ? 0.697   19.746 30.996  1.00 60.21  ? 565 LEU B CG  1 
ATOM   3344 C CD1 . LEU B 1 216 ? 1.163   19.261 29.640  1.00 61.45  ? 565 LEU B CD1 1 
ATOM   3345 C CD2 . LEU B 1 216 ? 1.647   19.297 32.097  1.00 62.26  ? 565 LEU B CD2 1 
ATOM   3346 N N   . CYS B 1 217 ? -1.634  23.531 30.416  1.00 58.69  ? 566 CYS B N   1 
ATOM   3347 C CA  . CYS B 1 217 ? -2.962  24.108 30.246  1.00 61.36  ? 566 CYS B CA  1 
ATOM   3348 C C   . CYS B 1 217 ? -3.223  24.409 28.761  1.00 56.85  ? 566 CYS B C   1 
ATOM   3349 O O   . CYS B 1 217 ? -4.319  24.214 28.248  1.00 50.78  ? 566 CYS B O   1 
ATOM   3350 C CB  . CYS B 1 217 ? -3.116  25.393 31.098  1.00 68.67  ? 566 CYS B CB  1 
ATOM   3351 S SG  . CYS B 1 217 ? -4.775  26.163 31.114  1.00 83.75  ? 566 CYS B SG  1 
ATOM   3352 N N   . THR B 1 218 ? -2.219  24.935 28.078  1.00 55.25  ? 567 THR B N   1 
ATOM   3353 C CA  . THR B 1 218 ? -2.392  25.287 26.688  1.00 55.57  ? 567 THR B CA  1 
ATOM   3354 C C   . THR B 1 218 ? -2.774  24.086 25.868  1.00 55.75  ? 567 THR B C   1 
ATOM   3355 O O   . THR B 1 218 ? -3.741  24.121 25.137  1.00 57.05  ? 567 THR B O   1 
ATOM   3356 C CB  . THR B 1 218 ? -1.127  25.889 26.131  1.00 55.73  ? 567 THR B CB  1 
ATOM   3357 O OG1 . THR B 1 218 ? -0.891  27.114 26.812  1.00 55.77  ? 567 THR B OG1 1 
ATOM   3358 C CG2 . THR B 1 218 ? -1.271  26.155 24.654  1.00 58.32  ? 567 THR B CG2 1 
ATOM   3359 N N   . GLN B 1 219 ? -2.017  23.019 26.012  1.00 56.69  ? 568 GLN B N   1 
ATOM   3360 C CA  . GLN B 1 219 ? -2.367  21.751 25.385  1.00 59.98  ? 568 GLN B CA  1 
ATOM   3361 C C   . GLN B 1 219 ? -3.822  21.344 25.651  1.00 60.12  ? 568 GLN B C   1 
ATOM   3362 O O   . GLN B 1 219 ? -4.517  20.832 24.758  1.00 58.82  ? 568 GLN B O   1 
ATOM   3363 C CB  . GLN B 1 219 ? -1.463  20.659 25.931  1.00 65.95  ? 568 GLN B CB  1 
ATOM   3364 C CG  . GLN B 1 219 ? 0.016   20.916 25.707  1.00 68.80  ? 568 GLN B CG  1 
ATOM   3365 C CD  . GLN B 1 219 ? 0.865   19.673 25.685  1.00 75.34  ? 568 GLN B CD  1 
ATOM   3366 O OE1 . GLN B 1 219 ? 0.488   18.623 25.130  1.00 80.34  ? 568 GLN B OE1 1 
ATOM   3367 N NE2 . GLN B 1 219 ? 2.053   19.794 26.265  1.00 78.16  ? 568 GLN B NE2 1 
ATOM   3368 N N   . GLY B 1 220 ? -4.262  21.530 26.898  1.00 58.98  ? 569 GLY B N   1 
ATOM   3369 C CA  . GLY B 1 220 ? -5.640  21.232 27.278  1.00 54.79  ? 569 GLY B CA  1 
ATOM   3370 C C   . GLY B 1 220 ? -6.591  22.025 26.412  1.00 51.87  ? 569 GLY B C   1 
ATOM   3371 O O   . GLY B 1 220 ? -7.540  21.486 25.830  1.00 44.24  ? 569 GLY B O   1 
ATOM   3372 N N   . LEU B 1 221 ? -6.307  23.317 26.303  1.00 51.84  ? 570 LEU B N   1 
ATOM   3373 C CA  . LEU B 1 221 ? -7.151  24.193 25.514  1.00 52.83  ? 570 LEU B CA  1 
ATOM   3374 C C   . LEU B 1 221 ? -7.161  23.766 24.056  1.00 52.36  ? 570 LEU B C   1 
ATOM   3375 O O   . LEU B 1 221 ? -8.205  23.769 23.402  1.00 54.27  ? 570 LEU B O   1 
ATOM   3376 C CB  . LEU B 1 221 ? -6.693  25.641 25.649  1.00 53.93  ? 570 LEU B CB  1 
ATOM   3377 C CG  . LEU B 1 221 ? -6.948  26.282 27.014  1.00 52.90  ? 570 LEU B CG  1 
ATOM   3378 C CD1 . LEU B 1 221 ? -6.270  27.625 27.090  1.00 52.65  ? 570 LEU B CD1 1 
ATOM   3379 C CD2 . LEU B 1 221 ? -8.431  26.476 27.263  1.00 54.85  ? 570 LEU B CD2 1 
ATOM   3380 N N   . GLN B 1 222 ? -5.990  23.380 23.560  1.00 50.46  ? 571 GLN B N   1 
ATOM   3381 C CA  . GLN B 1 222 ? -5.832  22.995 22.169  1.00 48.79  ? 571 GLN B CA  1 
ATOM   3382 C C   . GLN B 1 222 ? -6.612  21.748 21.872  1.00 50.47  ? 571 GLN B C   1 
ATOM   3383 O O   . GLN B 1 222 ? -7.126  21.573 20.767  1.00 52.50  ? 571 GLN B O   1 
ATOM   3384 C CB  . GLN B 1 222 ? -4.378  22.718 21.869  1.00 50.42  ? 571 GLN B CB  1 
ATOM   3385 C CG  . GLN B 1 222 ? -3.456  23.898 22.121  1.00 53.74  ? 571 GLN B CG  1 
ATOM   3386 C CD  . GLN B 1 222 ? -2.121  23.715 21.444  1.00 53.84  ? 571 GLN B CD  1 
ATOM   3387 O OE1 . GLN B 1 222 ? -1.079  23.590 22.096  1.00 48.77  ? 571 GLN B OE1 1 
ATOM   3388 N NE2 . GLN B 1 222 ? -2.153  23.673 20.122  1.00 56.94  ? 571 GLN B NE2 1 
ATOM   3389 N N   . ARG B 1 223 ? -6.648  20.856 22.851  1.00 52.61  ? 572 ARG B N   1 
ATOM   3390 C CA  . ARG B 1 223 ? -7.364  19.604 22.713  1.00 56.55  ? 572 ARG B CA  1 
ATOM   3391 C C   . ARG B 1 223 ? -8.848  19.855 22.640  1.00 56.36  ? 572 ARG B C   1 
ATOM   3392 O O   . ARG B 1 223 ? -9.552  19.224 21.865  1.00 55.01  ? 572 ARG B O   1 
ATOM   3393 C CB  . ARG B 1 223 ? -7.077  18.673 23.895  1.00 58.40  ? 572 ARG B CB  1 
ATOM   3394 C CG  . ARG B 1 223 ? -7.761  17.310 23.816  1.00 57.28  ? 572 ARG B CG  1 
ATOM   3395 C CD  . ARG B 1 223 ? -7.233  16.500 22.653  1.00 59.33  ? 572 ARG B CD  1 
ATOM   3396 N NE  . ARG B 1 223 ? -7.904  15.209 22.511  1.00 60.47  ? 572 ARG B NE  1 
ATOM   3397 C CZ  . ARG B 1 223 ? -7.976  14.525 21.375  1.00 67.51  ? 572 ARG B CZ  1 
ATOM   3398 N NH1 . ARG B 1 223 ? -7.425  15.003 20.248  1.00 70.38  ? 572 ARG B NH1 1 
ATOM   3399 N NH2 . ARG B 1 223 ? -8.612  13.363 21.342  1.00 69.05  ? 572 ARG B NH2 1 
ATOM   3400 N N   . ILE B 1 224 ? -9.327  20.760 23.475  1.00 57.01  ? 573 ILE B N   1 
ATOM   3401 C CA  . ILE B 1 224 ? -10.744 21.030 23.516  1.00 57.23  ? 573 ILE B CA  1 
ATOM   3402 C C   . ILE B 1 224 ? -11.156 21.733 22.238  1.00 58.51  ? 573 ILE B C   1 
ATOM   3403 O O   . ILE B 1 224 ? -12.216 21.445 21.687  1.00 51.86  ? 573 ILE B O   1 
ATOM   3404 C CB  . ILE B 1 224 ? -11.092 21.904 24.714  1.00 57.46  ? 573 ILE B CB  1 
ATOM   3405 C CG1 . ILE B 1 224 ? -10.881 21.087 25.982  1.00 51.36  ? 573 ILE B CG1 1 
ATOM   3406 C CG2 . ILE B 1 224 ? -12.525 22.422 24.591  1.00 55.57  ? 573 ILE B CG2 1 
ATOM   3407 C CD1 . ILE B 1 224 ? -11.028 21.884 27.240  1.00 51.78  ? 573 ILE B CD1 1 
ATOM   3408 N N   . PHE B 1 225 ? -10.306 22.648 21.777  1.00 54.56  ? 574 PHE B N   1 
ATOM   3409 C CA  . PHE B 1 225 ? -10.515 23.278 20.490  1.00 57.93  ? 574 PHE B CA  1 
ATOM   3410 C C   . PHE B 1 225 ? -10.686 22.252 19.401  1.00 57.86  ? 574 PHE B C   1 
ATOM   3411 O O   . PHE B 1 225 ? -11.567 22.360 18.569  1.00 59.98  ? 574 PHE B O   1 
ATOM   3412 C CB  . PHE B 1 225 ? -9.326  24.147 20.118  1.00 62.59  ? 574 PHE B CB  1 
ATOM   3413 C CG  . PHE B 1 225 ? -9.402  24.709 18.717  1.00 61.83  ? 574 PHE B CG  1 
ATOM   3414 C CD1 . PHE B 1 225 ? -10.254 25.751 18.427  1.00 65.65  ? 574 PHE B CD1 1 
ATOM   3415 C CD2 . PHE B 1 225 ? -8.625  24.201 17.706  1.00 61.61  ? 574 PHE B CD2 1 
ATOM   3416 C CE1 . PHE B 1 225 ? -10.337 26.276 17.149  1.00 61.57  ? 574 PHE B CE1 1 
ATOM   3417 C CE2 . PHE B 1 225 ? -8.693  24.727 16.431  1.00 62.60  ? 574 PHE B CE2 1 
ATOM   3418 C CZ  . PHE B 1 225 ? -9.558  25.761 16.151  1.00 61.59  ? 574 PHE B CZ  1 
ATOM   3419 N N   . TYR B 1 226 ? -9.826  21.249 19.421  1.00 60.92  ? 575 TYR B N   1 
ATOM   3420 C CA  . TYR B 1 226 ? -9.835  20.227 18.399  1.00 60.93  ? 575 TYR B CA  1 
ATOM   3421 C C   . TYR B 1 226 ? -11.085 19.374 18.454  1.00 61.19  ? 575 TYR B C   1 
ATOM   3422 O O   . TYR B 1 226 ? -11.622 18.958 17.426  1.00 61.49  ? 575 TYR B O   1 
ATOM   3423 C CB  . TYR B 1 226 ? -8.615  19.330 18.555  1.00 62.26  ? 575 TYR B CB  1 
ATOM   3424 C CG  . TYR B 1 226 ? -8.707  18.141 17.681  1.00 67.42  ? 575 TYR B CG  1 
ATOM   3425 C CD1 . TYR B 1 226 ? -8.315  18.208 16.358  1.00 68.78  ? 575 TYR B CD1 1 
ATOM   3426 C CD2 . TYR B 1 226 ? -9.261  16.958 18.153  1.00 72.16  ? 575 TYR B CD2 1 
ATOM   3427 C CE1 . TYR B 1 226 ? -8.430  17.110 15.541  1.00 75.32  ? 575 TYR B CE1 1 
ATOM   3428 C CE2 . TYR B 1 226 ? -9.380  15.855 17.340  1.00 74.39  ? 575 TYR B CE2 1 
ATOM   3429 C CZ  . TYR B 1 226 ? -8.955  15.945 16.041  1.00 74.97  ? 575 TYR B CZ  1 
ATOM   3430 O OH  . TYR B 1 226 ? -9.055  14.866 15.237  1.00 84.85  ? 575 TYR B OH  1 
ATOM   3431 N N   . LEU B 1 227 ? -11.508 19.058 19.671  1.00 65.46  ? 576 LEU B N   1 
ATOM   3432 C CA  . LEU B 1 227 ? -12.676 18.216 19.862  1.00 66.00  ? 576 LEU B CA  1 
ATOM   3433 C C   . LEU B 1 227 ? -13.895 19.015 19.517  1.00 64.01  ? 576 LEU B C   1 
ATOM   3434 O O   . LEU B 1 227 ? -14.889 18.472 19.042  1.00 65.14  ? 576 LEU B O   1 
ATOM   3435 C CB  . LEU B 1 227 ? -12.770 17.707 21.302  1.00 63.74  ? 576 LEU B CB  1 
ATOM   3436 C CG  . LEU B 1 227 ? -11.637 16.807 21.783  1.00 60.95  ? 576 LEU B CG  1 
ATOM   3437 C CD1 . LEU B 1 227 ? -11.822 16.545 23.264  1.00 62.32  ? 576 LEU B CD1 1 
ATOM   3438 C CD2 . LEU B 1 227 ? -11.586 15.510 20.997  1.00 59.98  ? 576 LEU B CD2 1 
ATOM   3439 N N   . LYS B 1 228 ? -13.817 20.310 19.778  1.00 65.01  ? 577 LYS B N   1 
ATOM   3440 C CA  . LYS B 1 228 ? -14.926 21.198 19.475  1.00 69.63  ? 577 LYS B CA  1 
ATOM   3441 C C   . LYS B 1 228 ? -15.088 21.355 17.961  1.00 65.52  ? 577 LYS B C   1 
ATOM   3442 O O   . LYS B 1 228 ? -16.203 21.411 17.457  1.00 64.31  ? 577 LYS B O   1 
ATOM   3443 C CB  . LYS B 1 228 ? -14.731 22.550 20.157  1.00 74.11  ? 577 LYS B CB  1 
ATOM   3444 C CG  . LYS B 1 228 ? -15.181 22.580 21.613  1.00 73.83  ? 577 LYS B CG  1 
ATOM   3445 C CD  . LYS B 1 228 ? -15.307 23.999 22.160  1.00 77.46  ? 577 LYS B CD  1 
ATOM   3446 C CE  . LYS B 1 228 ? -16.217 24.855 21.290  1.00 80.51  ? 577 LYS B CE  1 
ATOM   3447 N NZ  . LYS B 1 228 ? -17.173 25.671 22.067  1.00 83.20  ? 577 LYS B NZ  1 
ATOM   3448 N N   . LEU B 1 229 ? -13.970 21.406 17.245  1.00 66.54  ? 578 LEU B N   1 
ATOM   3449 C CA  . LEU B 1 229 ? -13.983 21.287 15.785  1.00 68.62  ? 578 LEU B CA  1 
ATOM   3450 C C   . LEU B 1 229 ? -14.697 20.015 15.330  1.00 69.98  ? 578 LEU B C   1 
ATOM   3451 O O   . LEU B 1 229 ? -15.707 20.092 14.663  1.00 70.85  ? 578 LEU B O   1 
ATOM   3452 C CB  . LEU B 1 229 ? -12.559 21.269 15.215  1.00 64.61  ? 578 LEU B CB  1 
ATOM   3453 C CG  . LEU B 1 229 ? -11.930 22.619 14.933  1.00 64.01  ? 578 LEU B CG  1 
ATOM   3454 C CD1 . LEU B 1 229 ? -10.459 22.473 14.605  1.00 61.21  ? 578 LEU B CD1 1 
ATOM   3455 C CD2 . LEU B 1 229 ? -12.661 23.286 13.784  1.00 69.60  ? 578 LEU B CD2 1 
ATOM   3456 N N   . GLU B 1 230 ? -14.178 18.854 15.710  1.00 71.87  ? 579 GLU B N   1 
ATOM   3457 C CA  . GLU B 1 230 ? -14.723 17.594 15.206  1.00 82.32  ? 579 GLU B CA  1 
ATOM   3458 C C   . GLU B 1 230 ? -16.121 17.309 15.743  1.00 84.83  ? 579 GLU B C   1 
ATOM   3459 O O   . GLU B 1 230 ? -16.891 16.628 15.106  1.00 78.91  ? 579 GLU B O   1 
ATOM   3460 C CB  . GLU B 1 230 ? -13.814 16.406 15.494  1.00 94.35  ? 579 GLU B CB  1 
ATOM   3461 C CG  . GLU B 1 230 ? -13.392 16.283 16.944  1.00 111.24 ? 579 GLU B CG  1 
ATOM   3462 C CD  . GLU B 1 230 ? -13.436 14.852 17.426  1.00 118.40 ? 579 GLU B CD  1 
ATOM   3463 O OE1 . GLU B 1 230 ? -12.821 14.001 16.745  1.00 111.76 ? 579 GLU B OE1 1 
ATOM   3464 O OE2 . GLU B 1 230 ? -14.092 14.592 18.468  1.00 110.55 ? 579 GLU B OE2 1 
ATOM   3465 N N   . ASP B 1 231 ? -16.429 17.792 16.939  1.00 93.75  ? 580 ASP B N   1 
ATOM   3466 C CA  . ASP B 1 231 ? -17.784 17.733 17.465  1.00 90.03  ? 580 ASP B CA  1 
ATOM   3467 C C   . ASP B 1 231 ? -18.478 16.371 17.447  1.00 90.82  ? 580 ASP B C   1 
ATOM   3468 O O   . ASP B 1 231 ? -19.627 16.296 17.033  1.00 86.93  ? 580 ASP B O   1 
ATOM   3469 C CB  . ASP B 1 231 ? -18.655 18.725 16.688  1.00 83.75  ? 580 ASP B CB  1 
ATOM   3470 C CG  . ASP B 1 231 ? -20.047 18.869 17.288  1.00 90.30  ? 580 ASP B CG  1 
ATOM   3471 O OD1 . ASP B 1 231 ? -20.199 18.641 18.507  1.00 94.77  ? 580 ASP B OD1 1 
ATOM   3472 O OD2 . ASP B 1 231 ? -21.006 19.174 16.545  1.00 95.90  ? 580 ASP B OD2 1 
ATOM   3473 N N   . LEU B 1 232 ? -17.830 15.303 17.911  1.00 90.94  ? 581 LEU B N   1 
ATOM   3474 C CA  . LEU B 1 232 ? -18.546 14.021 18.062  1.00 88.51  ? 581 LEU B CA  1 
ATOM   3475 C C   . LEU B 1 232 ? -19.587 14.150 19.148  1.00 87.16  ? 581 LEU B C   1 
ATOM   3476 O O   . LEU B 1 232 ? -20.715 13.683 18.999  1.00 84.83  ? 581 LEU B O   1 
ATOM   3477 C CB  . LEU B 1 232 ? -17.625 12.887 18.451  1.00 85.93  ? 581 LEU B CB  1 
ATOM   3478 C CG  . LEU B 1 232 ? -16.425 12.686 17.558  1.00 86.82  ? 581 LEU B CG  1 
ATOM   3479 C CD1 . LEU B 1 232 ? -15.774 11.354 17.905  1.00 91.85  ? 581 LEU B CD1 1 
ATOM   3480 C CD2 . LEU B 1 232 ? -16.821 12.766 16.097  1.00 84.14  ? 581 LEU B CD2 1 
ATOM   3481 N N   . VAL B 1 233 ? -19.177 14.764 20.257  1.00 84.72  ? 582 VAL B N   1 
ATOM   3482 C CA  . VAL B 1 233 ? -20.101 15.201 21.283  1.00 82.12  ? 582 VAL B CA  1 
ATOM   3483 C C   . VAL B 1 233 ? -19.675 16.601 21.706  1.00 73.61  ? 582 VAL B C   1 
ATOM   3484 O O   . VAL B 1 233 ? -18.493 16.908 21.762  1.00 68.06  ? 582 VAL B O   1 
ATOM   3485 C CB  . VAL B 1 233 ? -20.162 14.223 22.488  1.00 87.24  ? 582 VAL B CB  1 
ATOM   3486 C CG1 . VAL B 1 233 ? -20.132 12.779 22.012  1.00 88.58  ? 582 VAL B CG1 1 
ATOM   3487 C CG2 . VAL B 1 233 ? -19.025 14.449 23.463  1.00 89.55  ? 582 VAL B CG2 1 
ATOM   3488 N N   . PRO B 1 234 ? -20.644 17.460 21.988  1.00 71.55  ? 583 PRO B N   1 
ATOM   3489 C CA  . PRO B 1 234 ? -20.328 18.806 22.437  1.00 75.77  ? 583 PRO B CA  1 
ATOM   3490 C C   . PRO B 1 234 ? -19.818 18.882 23.881  1.00 76.14  ? 583 PRO B C   1 
ATOM   3491 O O   . PRO B 1 234 ? -20.187 18.063 24.730  1.00 79.86  ? 583 PRO B O   1 
ATOM   3492 C CB  . PRO B 1 234 ? -21.681 19.509 22.349  1.00 77.87  ? 583 PRO B CB  1 
ATOM   3493 C CG  . PRO B 1 234 ? -22.655 18.427 22.671  1.00 78.53  ? 583 PRO B CG  1 
ATOM   3494 C CD  . PRO B 1 234 ? -22.088 17.181 22.042  1.00 72.85  ? 583 PRO B CD  1 
ATOM   3495 N N   . PRO B 1 235 ? -19.033 19.907 24.186  1.00 78.25  ? 584 PRO B N   1 
ATOM   3496 C CA  . PRO B 1 235 ? -18.638 20.032 25.572  1.00 82.70  ? 584 PRO B CA  1 
ATOM   3497 C C   . PRO B 1 235 ? -19.819 20.291 26.508  1.00 81.52  ? 584 PRO B C   1 
ATOM   3498 O O   . PRO B 1 235 ? -20.821 20.885 26.089  1.00 82.62  ? 584 PRO B O   1 
ATOM   3499 C CB  . PRO B 1 235 ? -17.698 21.258 25.576  1.00 85.35  ? 584 PRO B CB  1 
ATOM   3500 C CG  . PRO B 1 235 ? -17.566 21.705 24.163  1.00 84.44  ? 584 PRO B CG  1 
ATOM   3501 C CD  . PRO B 1 235 ? -18.730 21.123 23.421  1.00 87.29  ? 584 PRO B CD  1 
ATOM   3502 N N   . PRO B 1 236 ? -19.694 19.870 27.776  1.00 77.98  ? 585 PRO B N   1 
ATOM   3503 C CA  . PRO B 1 236 ? -20.681 20.278 28.750  1.00 73.87  ? 585 PRO B CA  1 
ATOM   3504 C C   . PRO B 1 236 ? -20.595 21.780 28.900  1.00 68.32  ? 585 PRO B C   1 
ATOM   3505 O O   . PRO B 1 236 ? -19.517 22.347 28.761  1.00 64.40  ? 585 PRO B O   1 
ATOM   3506 C CB  . PRO B 1 236 ? -20.238 19.591 30.039  1.00 78.21  ? 585 PRO B CB  1 
ATOM   3507 C CG  . PRO B 1 236 ? -19.078 18.730 29.689  1.00 78.12  ? 585 PRO B CG  1 
ATOM   3508 C CD  . PRO B 1 236 ? -18.532 19.226 28.402  1.00 77.85  ? 585 PRO B CD  1 
ATOM   3509 N N   . PRO B 1 237 ? -21.718 22.426 29.184  1.00 69.15  ? 586 PRO B N   1 
ATOM   3510 C CA  . PRO B 1 237 ? -21.790 23.900 29.174  1.00 68.11  ? 586 PRO B CA  1 
ATOM   3511 C C   . PRO B 1 237 ? -20.777 24.612 30.061  1.00 63.94  ? 586 PRO B C   1 
ATOM   3512 O O   . PRO B 1 237 ? -20.239 25.657 29.692  1.00 57.68  ? 586 PRO B O   1 
ATOM   3513 C CB  . PRO B 1 237 ? -23.197 24.179 29.689  1.00 65.32  ? 586 PRO B CB  1 
ATOM   3514 C CG  . PRO B 1 237 ? -23.967 22.953 29.344  1.00 69.94  ? 586 PRO B CG  1 
ATOM   3515 C CD  . PRO B 1 237 ? -23.019 21.804 29.472  1.00 69.08  ? 586 PRO B CD  1 
ATOM   3516 N N   . ILE B 1 238 ? -20.522 24.029 31.218  1.00 67.42  ? 587 ILE B N   1 
ATOM   3517 C CA  . ILE B 1 238 ? -19.665 24.650 32.223  1.00 76.65  ? 587 ILE B CA  1 
ATOM   3518 C C   . ILE B 1 238 ? -18.217 24.643 31.762  1.00 77.90  ? 587 ILE B C   1 
ATOM   3519 O O   . ILE B 1 238 ? -17.477 25.604 31.984  1.00 79.68  ? 587 ILE B O   1 
ATOM   3520 C CB  . ILE B 1 238 ? -19.745 23.938 33.593  1.00 74.26  ? 587 ILE B CB  1 
ATOM   3521 C CG1 . ILE B 1 238 ? -21.159 23.295 33.790  1.00 78.05  ? 587 ILE B CG1 1 
ATOM   3522 C CG2 . ILE B 1 238 ? -19.332 24.932 34.682  1.00 72.33  ? 587 ILE B CG2 1 
ATOM   3523 C CD1 . ILE B 1 238 ? -21.345 21.887 33.204  1.00 81.29  ? 587 ILE B CD1 1 
ATOM   3524 N N   . ILE B 1 239 ? -17.838 23.548 31.118  1.00 75.28  ? 588 ILE B N   1 
ATOM   3525 C CA  . ILE B 1 239 ? -16.493 23.370 30.582  1.00 74.89  ? 588 ILE B CA  1 
ATOM   3526 C C   . ILE B 1 239 ? -16.318 24.261 29.368  1.00 71.57  ? 588 ILE B C   1 
ATOM   3527 O O   . ILE B 1 239 ? -15.298 24.922 29.206  1.00 78.42  ? 588 ILE B O   1 
ATOM   3528 C CB  . ILE B 1 239 ? -16.257 21.901 30.152  1.00 74.67  ? 588 ILE B CB  1 
ATOM   3529 C CG1 . ILE B 1 239 ? -16.332 20.951 31.356  1.00 73.84  ? 588 ILE B CG1 1 
ATOM   3530 C CG2 . ILE B 1 239 ? -14.928 21.757 29.437  1.00 76.22  ? 588 ILE B CG2 1 
ATOM   3531 C CD1 . ILE B 1 239 ? -15.311 21.211 32.448  1.00 73.29  ? 588 ILE B CD1 1 
ATOM   3532 N N   . ASP B 1 240 ? -17.326 24.253 28.512  1.00 66.52  ? 589 ASP B N   1 
ATOM   3533 C CA  . ASP B 1 240 ? -17.365 25.114 27.347  1.00 63.63  ? 589 ASP B CA  1 
ATOM   3534 C C   . ASP B 1 240 ? -17.248 26.603 27.728  1.00 63.12  ? 589 ASP B C   1 
ATOM   3535 O O   . ASP B 1 240 ? -16.588 27.390 27.033  1.00 57.82  ? 589 ASP B O   1 
ATOM   3536 C CB  . ASP B 1 240 ? -18.671 24.852 26.601  1.00 64.74  ? 589 ASP B CB  1 
ATOM   3537 C CG  . ASP B 1 240 ? -18.607 25.256 25.165  1.00 68.80  ? 589 ASP B CG  1 
ATOM   3538 O OD1 . ASP B 1 240 ? -17.632 25.927 24.770  1.00 68.33  ? 589 ASP B OD1 1 
ATOM   3539 O OD2 . ASP B 1 240 ? -19.549 24.908 24.424  1.00 79.15  ? 589 ASP B OD2 1 
ATOM   3540 N N   . LYS B 1 241 ? -17.893 26.981 28.831  1.00 62.70  ? 590 LYS B N   1 
ATOM   3541 C CA  . LYS B 1 241 ? -17.849 28.354 29.305  1.00 66.37  ? 590 LYS B CA  1 
ATOM   3542 C C   . LYS B 1 241 ? -16.432 28.754 29.690  1.00 70.74  ? 590 LYS B C   1 
ATOM   3543 O O   . LYS B 1 241 ? -15.985 29.862 29.410  1.00 72.80  ? 590 LYS B O   1 
ATOM   3544 C CB  . LYS B 1 241 ? -18.770 28.536 30.507  1.00 73.20  ? 590 LYS B CB  1 
ATOM   3545 C CG  . LYS B 1 241 ? -19.079 29.995 30.783  1.00 85.69  ? 590 LYS B CG  1 
ATOM   3546 C CD  . LYS B 1 241 ? -19.767 30.198 32.121  1.00 92.31  ? 590 LYS B CD  1 
ATOM   3547 C CE  . LYS B 1 241 ? -20.164 31.656 32.315  1.00 97.06  ? 590 LYS B CE  1 
ATOM   3548 N NZ  . LYS B 1 241 ? -18.987 32.522 32.612  1.00 94.17  ? 590 LYS B NZ  1 
ATOM   3549 N N   . ILE B 1 242 ? -15.730 27.837 30.346  1.00 75.39  ? 591 ILE B N   1 
ATOM   3550 C CA  . ILE B 1 242 ? -14.352 28.061 30.775  1.00 68.49  ? 591 ILE B CA  1 
ATOM   3551 C C   . ILE B 1 242 ? -13.458 28.192 29.562  1.00 65.01  ? 591 ILE B C   1 
ATOM   3552 O O   . ILE B 1 242 ? -12.594 29.059 29.514  1.00 59.29  ? 591 ILE B O   1 
ATOM   3553 C CB  . ILE B 1 242 ? -13.872 26.896 31.651  1.00 69.19  ? 591 ILE B CB  1 
ATOM   3554 C CG1 . ILE B 1 242 ? -14.570 26.957 33.015  1.00 76.26  ? 591 ILE B CG1 1 
ATOM   3555 C CG2 . ILE B 1 242 ? -12.367 26.945 31.845  1.00 69.96  ? 591 ILE B CG2 1 
ATOM   3556 C CD1 . ILE B 1 242 ? -14.624 25.635 33.756  1.00 77.02  ? 591 ILE B CD1 1 
ATOM   3557 N N   . PHE B 1 243 ? -13.690 27.323 28.582  1.00 62.81  ? 592 PHE B N   1 
ATOM   3558 C CA  . PHE B 1 243 ? -12.915 27.329 27.362  1.00 60.84  ? 592 PHE B CA  1 
ATOM   3559 C C   . PHE B 1 243 ? -12.974 28.703 26.749  1.00 62.48  ? 592 PHE B C   1 
ATOM   3560 O O   . PHE B 1 243 ? -11.948 29.306 26.474  1.00 63.65  ? 592 PHE B O   1 
ATOM   3561 C CB  . PHE B 1 243 ? -13.425 26.281 26.377  1.00 59.81  ? 592 PHE B CB  1 
ATOM   3562 C CG  . PHE B 1 243 ? -12.707 26.299 25.052  1.00 62.56  ? 592 PHE B CG  1 
ATOM   3563 C CD1 . PHE B 1 243 ? -11.393 25.871 24.951  1.00 63.77  ? 592 PHE B CD1 1 
ATOM   3564 C CD2 . PHE B 1 243 ? -13.340 26.742 23.903  1.00 65.59  ? 592 PHE B CD2 1 
ATOM   3565 C CE1 . PHE B 1 243 ? -10.728 25.881 23.731  1.00 62.81  ? 592 PHE B CE1 1 
ATOM   3566 C CE2 . PHE B 1 243 ? -12.682 26.743 22.676  1.00 65.04  ? 592 PHE B CE2 1 
ATOM   3567 C CZ  . PHE B 1 243 ? -11.368 26.323 22.592  1.00 61.46  ? 592 PHE B CZ  1 
ATOM   3568 N N   . MET B 1 244 ? -14.187 29.214 26.596  1.00 63.65  ? 593 MET B N   1 
ATOM   3569 C CA  . MET B 1 244 ? -14.396 30.492 25.923  1.00 61.64  ? 593 MET B CA  1 
ATOM   3570 C C   . MET B 1 244 ? -13.891 31.657 26.767  1.00 59.86  ? 593 MET B C   1 
ATOM   3571 O O   . MET B 1 244 ? -13.193 32.509 26.263  1.00 59.21  ? 593 MET B O   1 
ATOM   3572 C CB  . MET B 1 244 ? -15.879 30.678 25.613  1.00 65.48  ? 593 MET B CB  1 
ATOM   3573 C CG  . MET B 1 244 ? -16.510 29.563 24.774  1.00 65.81  ? 593 MET B CG  1 
ATOM   3574 S SD  . MET B 1 244 ? -16.020 29.499 23.028  1.00 67.33  ? 593 MET B SD  1 
ATOM   3575 C CE  . MET B 1 244 ? -17.524 28.875 22.269  1.00 71.76  ? 593 MET B CE  1 
ATOM   3576 N N   . ASP B 1 245 ? -14.231 31.674 28.059  1.00 64.95  ? 594 ASP B N   1 
ATOM   3577 C CA  . ASP B 1 245 ? -13.909 32.805 28.948  1.00 68.51  ? 594 ASP B CA  1 
ATOM   3578 C C   . ASP B 1 245 ? -12.406 32.980 29.089  1.00 74.94  ? 594 ASP B C   1 
ATOM   3579 O O   . ASP B 1 245 ? -11.913 34.093 29.246  1.00 75.73  ? 594 ASP B O   1 
ATOM   3580 C CB  . ASP B 1 245 ? -14.507 32.620 30.353  1.00 71.74  ? 594 ASP B CB  1 
ATOM   3581 C CG  . ASP B 1 245 ? -16.045 32.667 30.377  1.00 77.86  ? 594 ASP B CG  1 
ATOM   3582 O OD1 . ASP B 1 245 ? -16.694 33.002 29.354  1.00 83.86  ? 594 ASP B OD1 1 
ATOM   3583 O OD2 . ASP B 1 245 ? -16.610 32.354 31.439  1.00 72.87  ? 594 ASP B OD2 1 
ATOM   3584 N N   . THR B 1 246 ? -11.680 31.871 29.015  1.00 83.55  ? 595 THR B N   1 
ATOM   3585 C CA  . THR B 1 246 ? -10.235 31.878 29.235  1.00 83.19  ? 595 THR B CA  1 
ATOM   3586 C C   . THR B 1 246 ? -9.452  32.113 27.946  1.00 76.11  ? 595 THR B C   1 
ATOM   3587 O O   . THR B 1 246 ? -8.227  32.085 27.940  1.00 72.07  ? 595 THR B O   1 
ATOM   3588 C CB  . THR B 1 246 ? -9.783  30.573 29.915  1.00 81.77  ? 595 THR B CB  1 
ATOM   3589 O OG1 . THR B 1 246 ? -10.275 29.445 29.178  1.00 84.87  ? 595 THR B OG1 1 
ATOM   3590 C CG2 . THR B 1 246 ? -10.326 30.525 31.332  1.00 79.68  ? 595 THR B CG2 1 
ATOM   3591 N N   . LEU B 1 247 ? -10.161 32.385 26.865  1.00 76.84  ? 596 LEU B N   1 
ATOM   3592 C CA  . LEU B 1 247 ? -9.521  32.817 25.647  1.00 83.42  ? 596 LEU B CA  1 
ATOM   3593 C C   . LEU B 1 247 ? -9.355  34.329 25.620  1.00 93.91  ? 596 LEU B C   1 
ATOM   3594 O O   . LEU B 1 247 ? -10.358 35.047 25.650  1.00 93.21  ? 596 LEU B O   1 
ATOM   3595 C CB  . LEU B 1 247 ? -10.361 32.371 24.463  1.00 78.89  ? 596 LEU B CB  1 
ATOM   3596 C CG  . LEU B 1 247 ? -10.480 30.826 24.410  1.00 77.21  ? 596 LEU B CG  1 
ATOM   3597 C CD1 . LEU B 1 247 ? -11.120 30.263 23.137  1.00 82.05  ? 596 LEU B CD1 1 
ATOM   3598 C CD2 . LEU B 1 247 ? -9.153  30.132 24.672  1.00 75.92  ? 596 LEU B CD2 1 
ATOM   3599 N N   . PRO B 1 248 ? -8.093  34.824 25.531  1.00 104.13 ? 597 PRO B N   1 
ATOM   3600 C CA  . PRO B 1 248 ? -7.870  36.277 25.410  1.00 110.05 ? 597 PRO B CA  1 
ATOM   3601 C C   . PRO B 1 248 ? -8.194  36.847 24.006  1.00 111.58 ? 597 PRO B C   1 
ATOM   3602 O O   . PRO B 1 248 ? -7.344  37.500 23.393  1.00 108.44 ? 597 PRO B O   1 
ATOM   3603 C CB  . PRO B 1 248 ? -6.375  36.434 25.762  1.00 105.47 ? 597 PRO B CB  1 
ATOM   3604 C CG  . PRO B 1 248 ? -5.754  35.139 25.367  1.00 102.18 ? 597 PRO B CG  1 
ATOM   3605 C CD  . PRO B 1 248 ? -6.820  34.074 25.479  1.00 101.26 ? 597 PRO B CD  1 
ATOM   3606 N N   . PHE B 1 249 ? -9.422  36.594 23.527  1.00 110.27 ? 598 PHE B N   1 
ATOM   3607 C CA  . PHE B 1 249 ? -9.952  37.119 22.242  1.00 102.00 ? 598 PHE B CA  1 
ATOM   3608 C C   . PHE B 1 249 ? -11.399 36.649 22.019  1.00 83.35  ? 598 PHE B C   1 
ATOM   3609 O O   . PHE B 1 249 ? -12.177 36.544 22.967  0.70 65.94  ? 598 PHE B O   1 
ATOM   3610 C CB  . PHE B 1 249 ? -9.067  36.734 21.026  1.00 100.69 ? 598 PHE B CB  1 
ATOM   3611 C CG  . PHE B 1 249 ? -8.809  35.250 20.890  1.00 96.69  ? 598 PHE B CG  1 
ATOM   3612 C CD1 . PHE B 1 249 ? -9.702  34.434 20.204  1.00 89.29  ? 598 PHE B CD1 1 
ATOM   3613 C CD2 . PHE B 1 249 ? -7.668  34.667 21.444  1.00 89.93  ? 598 PHE B CD2 1 
ATOM   3614 C CE1 . PHE B 1 249 ? -9.466  33.074 20.085  1.00 83.37  ? 598 PHE B CE1 1 
ATOM   3615 C CE2 . PHE B 1 249 ? -7.433  33.305 21.317  1.00 82.01  ? 598 PHE B CE2 1 
ATOM   3616 C CZ  . PHE B 1 249 ? -8.334  32.510 20.644  1.00 76.35  ? 598 PHE B CZ  1 
HETATM 3617 C C1  . T94 C 2 .   ? -16.289 20.217 -4.968  0.90 60.75  ? 601 T94 A C1  1 
HETATM 3618 C C2  . T94 C 2 .   ? -17.247 19.527 -4.228  0.70 68.90  ? 601 T94 A C2  1 
HETATM 3619 C C3  . T94 C 2 .   ? -16.925 18.343 -3.593  0.70 69.99  ? 601 T94 A C3  1 
HETATM 3620 C C4  . T94 C 2 .   ? -15.619 17.857 -3.724  0.70 67.50  ? 601 T94 A C4  1 
HETATM 3621 C C5  . T94 C 2 .   ? -14.696 18.572 -4.453  0.70 57.66  ? 601 T94 A C5  1 
HETATM 3622 C C6  . T94 C 2 .   ? -15.025 19.729 -5.079  0.90 58.17  ? 601 T94 A C6  1 
HETATM 3623 O O7  . T94 C 2 .   ? -17.870 17.669 -2.857  0.70 59.39  ? 601 T94 A O7  1 
HETATM 3624 O O8  . T94 C 2 .   ? -18.517 19.993 -4.094  0.70 85.37  ? 601 T94 A O8  1 
HETATM 3625 O O9  . T94 C 2 .   ? -16.539 21.379 -5.609  0.70 58.82  ? 601 T94 A O9  1 
HETATM 3626 C C10 . T94 C 2 .   ? -13.336 18.094 -4.661  0.70 58.15  ? 601 T94 A C10 1 
HETATM 3627 C C11 . T94 C 2 .   ? -12.162 18.789 -4.049  0.70 62.16  ? 601 T94 A C11 1 
HETATM 3628 C C12 . T94 C 2 .   ? -10.959 18.615 -4.976  0.70 62.99  ? 601 T94 A C12 1 
HETATM 3629 C C13 . T94 C 2 .   ? -10.269 17.261 -4.816  0.70 61.48  ? 601 T94 A C13 1 
HETATM 3630 C C14 . T94 C 2 .   ? -8.789  17.384 -5.182  0.70 60.93  ? 601 T94 A C14 1 
HETATM 3631 C C15 . T94 C 2 .   ? -7.892  17.170 -3.972  0.70 59.92  ? 601 T94 A C15 1 
HETATM 3632 C C16 . T94 C 2 .   ? -7.970  15.722 -3.485  0.70 58.82  ? 601 T94 A C16 1 
HETATM 3633 C C17 . T94 C 2 .   ? -6.611  15.200 -3.054  0.70 57.54  ? 601 T94 A C17 1 
HETATM 3634 C C18 . T94 C 2 .   ? -5.643  15.204 -4.216  0.70 56.30  ? 601 T94 A C18 1 
HETATM 3635 O O19 . T94 C 2 .   ? -13.215 17.150 -5.404  0.70 58.96  ? 601 T94 A O19 1 
HETATM 3636 C C1  . GOL D 3 .   ? 9.329   10.581 -2.471  1.00 90.27  ? 602 GOL A C1  1 
HETATM 3637 O O1  . GOL D 3 .   ? 9.604   9.764  -1.301  1.00 81.34  ? 602 GOL A O1  1 
HETATM 3638 C C2  . GOL D 3 .   ? 10.098  11.922 -2.468  1.00 96.12  ? 602 GOL A C2  1 
HETATM 3639 O O2  . GOL D 3 .   ? 9.586   12.782 -3.508  1.00 80.11  ? 602 GOL A O2  1 
HETATM 3640 C C3  . GOL D 3 .   ? 10.044  12.620 -1.095  1.00 98.34  ? 602 GOL A C3  1 
HETATM 3641 O O3  . GOL D 3 .   ? 11.207  12.520 -0.232  1.00 99.02  ? 602 GOL A O3  1 
HETATM 3642 C C1  . GOL E 3 .   ? 8.850   14.419 10.942  1.00 73.71  ? 603 GOL A C1  1 
HETATM 3643 O O1  . GOL E 3 .   ? 9.135   14.951 9.642   1.00 72.18  ? 603 GOL A O1  1 
HETATM 3644 C C2  . GOL E 3 .   ? 8.354   15.561 11.821  1.00 74.24  ? 603 GOL A C2  1 
HETATM 3645 O O2  . GOL E 3 .   ? 7.015   15.910 11.452  1.00 69.57  ? 603 GOL A O2  1 
HETATM 3646 C C3  . GOL E 3 .   ? 8.365   15.139 13.283  1.00 78.68  ? 603 GOL A C3  1 
HETATM 3647 O O3  . GOL E 3 .   ? 9.706   14.945 13.742  1.00 81.96  ? 603 GOL A O3  1 
HETATM 3648 C C1  . GOL F 3 .   ? 9.698   14.910 -6.581  1.00 71.04  ? 604 GOL A C1  1 
HETATM 3649 O O1  . GOL F 3 .   ? 8.527   15.286 -7.301  1.00 72.89  ? 604 GOL A O1  1 
HETATM 3650 C C2  . GOL F 3 .   ? 10.378  16.146 -6.004  1.00 69.26  ? 604 GOL A C2  1 
HETATM 3651 O O2  . GOL F 3 .   ? 10.801  15.857 -4.671  1.00 60.82  ? 604 GOL A O2  1 
HETATM 3652 C C3  . GOL F 3 .   ? 11.587  16.574 -6.838  1.00 73.77  ? 604 GOL A C3  1 
HETATM 3653 O O3  . GOL F 3 .   ? 12.799  16.576 -6.052  1.00 75.09  ? 604 GOL A O3  1 
HETATM 3654 C C1  . GOL G 3 .   ? -1.710  21.361 17.187  1.00 82.76  ? 605 GOL A C1  1 
HETATM 3655 O O1  . GOL G 3 .   ? -1.287  20.706 18.399  1.00 80.94  ? 605 GOL A O1  1 
HETATM 3656 C C2  . GOL G 3 .   ? -0.558  21.954 16.346  1.00 84.16  ? 605 GOL A C2  1 
HETATM 3657 O O2  . GOL G 3 .   ? -0.697  21.492 14.983  1.00 89.98  ? 605 GOL A O2  1 
HETATM 3658 C C3  . GOL G 3 .   ? -0.531  23.496 16.317  1.00 78.58  ? 605 GOL A C3  1 
HETATM 3659 O O3  . GOL G 3 .   ? 0.652   24.077 16.910  1.00 68.29  ? 605 GOL A O3  1 
HETATM 3660 C C1  . GOL H 3 .   ? -4.847  11.303 -12.062 1.00 85.12  ? 606 GOL A C1  1 
HETATM 3661 O O1  . GOL H 3 .   ? -5.575  10.293 -11.361 1.00 82.92  ? 606 GOL A O1  1 
HETATM 3662 C C2  . GOL H 3 .   ? -5.691  11.764 -13.262 1.00 95.52  ? 606 GOL A C2  1 
HETATM 3663 O O2  . GOL H 3 .   ? -7.094  11.450 -13.050 1.00 82.85  ? 606 GOL A O2  1 
HETATM 3664 C C3  . GOL H 3 .   ? -5.494  13.270 -13.557 1.00 95.35  ? 606 GOL A C3  1 
HETATM 3665 O O3  . GOL H 3 .   ? -4.473  13.555 -14.544 1.00 86.80  ? 606 GOL A O3  1 
HETATM 3666 C C1  . GOL I 3 .   ? 0.396   28.193 -8.877  1.00 54.63  ? 607 GOL A C1  1 
HETATM 3667 O O1  . GOL I 3 .   ? 0.286   27.247 -7.793  1.00 50.90  ? 607 GOL A O1  1 
HETATM 3668 C C2  . GOL I 3 .   ? 1.684   28.004 -9.692  1.00 56.57  ? 607 GOL A C2  1 
HETATM 3669 O O2  . GOL I 3 .   ? 2.769   27.657 -8.828  1.00 54.74  ? 607 GOL A O2  1 
HETATM 3670 C C3  . GOL I 3 .   ? 1.567   26.925 -10.755 1.00 60.52  ? 607 GOL A C3  1 
HETATM 3671 O O3  . GOL I 3 .   ? 2.347   27.318 -11.886 1.00 66.56  ? 607 GOL A O3  1 
HETATM 3672 C C1  . GOL J 3 .   ? -5.984  14.432 48.108  1.00 76.39  ? 601 GOL B C1  1 
HETATM 3673 O O1  . GOL J 3 .   ? -5.052  13.478 48.644  1.00 73.96  ? 601 GOL B O1  1 
HETATM 3674 C C2  . GOL J 3 .   ? -5.892  14.277 46.608  1.00 72.69  ? 601 GOL B C2  1 
HETATM 3675 O O2  . GOL J 3 .   ? -6.510  13.046 46.196  1.00 73.38  ? 601 GOL B O2  1 
HETATM 3676 C C3  . GOL J 3 .   ? -6.501  15.468 45.898  1.00 63.76  ? 601 GOL B C3  1 
HETATM 3677 O O3  . GOL J 3 .   ? -5.705  15.690 44.721  1.00 62.25  ? 601 GOL B O3  1 
HETATM 3678 O O   . HOH K 4 .   ? -15.385 27.248 -1.318  1.00 42.93  ? 701 HOH A O   1 
HETATM 3679 O O   . HOH K 4 .   ? 3.915   33.737 -13.477 1.00 62.53  ? 702 HOH A O   1 
HETATM 3680 O O   . HOH K 4 .   ? -4.829  23.071 18.648  1.00 47.87  ? 703 HOH A O   1 
HETATM 3681 O O   . HOH K 4 .   ? 14.449  32.390 -0.630  1.00 49.66  ? 704 HOH A O   1 
HETATM 3682 O O   . HOH K 4 .   ? 16.903  24.901 6.758   1.00 50.02  ? 705 HOH A O   1 
HETATM 3683 O O   . HOH K 4 .   ? -5.131  7.163  -0.306  1.00 61.05  ? 706 HOH A O   1 
HETATM 3684 O O   . HOH K 4 .   ? 7.857   36.526 4.332   1.00 69.46  ? 707 HOH A O   1 
HETATM 3685 O O   . HOH K 4 .   ? -23.572 34.628 -6.391  1.00 57.58  ? 708 HOH A O   1 
HETATM 3686 O O   . HOH K 4 .   ? -20.893 9.234  -17.896 1.00 49.61  ? 709 HOH A O   1 
HETATM 3687 O O   . HOH K 4 .   ? 5.502   11.096 3.454   1.00 36.65  ? 710 HOH A O   1 
HETATM 3688 O O   . HOH K 4 .   ? -13.913 17.794 0.674   1.00 53.90  ? 711 HOH A O   1 
HETATM 3689 O O   . HOH K 4 .   ? -11.570 20.474 6.456   1.00 52.27  ? 712 HOH A O   1 
HETATM 3690 O O   . HOH K 4 .   ? -3.107  34.731 -9.276  1.00 48.22  ? 713 HOH A O   1 
HETATM 3691 O O   . HOH K 4 .   ? -10.208 28.361 4.536   1.00 34.99  ? 714 HOH A O   1 
HETATM 3692 O O   . HOH K 4 .   ? -1.332  35.173 16.760  1.00 56.06  ? 715 HOH A O   1 
HETATM 3693 O O   . HOH K 4 .   ? 12.216  35.432 9.168   1.00 55.05  ? 716 HOH A O   1 
HETATM 3694 O O   . HOH K 4 .   ? 14.847  36.094 -7.749  1.00 60.62  ? 717 HOH A O   1 
HETATM 3695 O O   . HOH K 4 .   ? -19.135 21.463 -0.366  1.00 48.89  ? 718 HOH A O   1 
HETATM 3696 O O   . HOH K 4 .   ? -13.687 25.918 5.232   1.00 36.42  ? 719 HOH A O   1 
HETATM 3697 O O   . HOH K 4 .   ? 1.073   18.938 -17.093 1.00 47.56  ? 720 HOH A O   1 
HETATM 3698 O O   . HOH K 4 .   ? 6.898   25.248 16.773  1.00 51.34  ? 721 HOH A O   1 
HETATM 3699 O O   . HOH K 4 .   ? -0.131  14.174 5.336   1.00 49.34  ? 722 HOH A O   1 
HETATM 3700 O O   . HOH K 4 .   ? 17.265  21.997 18.418  1.00 60.59  ? 723 HOH A O   1 
HETATM 3701 O O   . HOH K 4 .   ? 8.050   31.339 9.205   1.00 57.30  ? 724 HOH A O   1 
HETATM 3702 O O   . HOH K 4 .   ? -22.950 34.555 0.723   1.00 50.07  ? 725 HOH A O   1 
HETATM 3703 O O   . HOH K 4 .   ? 10.228  36.376 -3.924  1.00 46.12  ? 726 HOH A O   1 
HETATM 3704 O O   . HOH K 4 .   ? 3.115   10.433 1.718   1.00 58.06  ? 727 HOH A O   1 
HETATM 3705 O O   . HOH K 4 .   ? -5.294  37.142 17.967  1.00 63.49  ? 728 HOH A O   1 
HETATM 3706 O O   . HOH K 4 .   ? 13.702  18.125 5.559   1.00 56.18  ? 729 HOH A O   1 
HETATM 3707 O O   . HOH K 4 .   ? 15.579  28.676 -9.754  1.00 64.80  ? 730 HOH A O   1 
HETATM 3708 O O   . HOH K 4 .   ? -4.325  26.516 -8.726  1.00 39.87  ? 731 HOH A O   1 
HETATM 3709 O O   . HOH K 4 .   ? 10.114  18.768 12.536  1.00 43.43  ? 732 HOH A O   1 
HETATM 3710 O O   . HOH K 4 .   ? -10.431 37.199 17.436  1.00 54.90  ? 733 HOH A O   1 
HETATM 3711 O O   . HOH K 4 .   ? -16.759 30.728 16.430  1.00 47.01  ? 734 HOH A O   1 
HETATM 3712 O O   . HOH K 4 .   ? 14.368  21.421 -8.652  1.00 64.82  ? 735 HOH A O   1 
HETATM 3713 O O   . HOH K 4 .   ? 2.496   36.009 -8.365  1.00 40.91  ? 736 HOH A O   1 
HETATM 3714 O O   . HOH K 4 .   ? -15.114 40.552 -3.328  1.00 51.81  ? 737 HOH A O   1 
HETATM 3715 O O   . HOH K 4 .   ? -12.576 37.651 1.376   1.00 47.51  ? 738 HOH A O   1 
HETATM 3716 O O   . HOH K 4 .   ? 6.187   9.850  -8.866  1.00 67.24  ? 739 HOH A O   1 
HETATM 3717 O O   . HOH K 4 .   ? -12.706 9.834  -0.044  1.00 63.52  ? 740 HOH A O   1 
HETATM 3718 O O   . HOH K 4 .   ? -18.503 6.605  -14.107 1.00 77.88  ? 741 HOH A O   1 
HETATM 3719 O O   . HOH K 4 .   ? -20.225 22.251 -19.711 1.00 58.99  ? 742 HOH A O   1 
HETATM 3720 O O   . HOH K 4 .   ? 15.953  30.859 8.183   1.00 43.38  ? 743 HOH A O   1 
HETATM 3721 O O   . HOH K 4 .   ? -0.819  7.367  -4.167  1.00 69.36  ? 744 HOH A O   1 
HETATM 3722 O O   . HOH K 4 .   ? -6.110  41.287 13.909  1.00 53.97  ? 745 HOH A O   1 
HETATM 3723 O O   . HOH K 4 .   ? 20.299  32.362 1.340   1.00 64.73  ? 746 HOH A O   1 
HETATM 3724 O O   . HOH K 4 .   ? -18.251 25.672 4.039   1.00 58.60  ? 747 HOH A O   1 
HETATM 3725 O O   . HOH K 4 .   ? 13.415  33.357 7.273   1.00 60.88  ? 748 HOH A O   1 
HETATM 3726 O O   . HOH K 4 .   ? -19.836 27.671 5.298   1.00 60.62  ? 749 HOH A O   1 
HETATM 3727 O O   . HOH K 4 .   ? -29.278 30.353 -7.091  1.00 34.40  ? 750 HOH A O   1 
HETATM 3728 O O   . HOH K 4 .   ? -27.825 38.878 -4.136  1.00 54.35  ? 751 HOH A O   1 
HETATM 3729 O O   . HOH K 4 .   ? -17.235 20.737 0.948   1.00 47.32  ? 752 HOH A O   1 
HETATM 3730 O O   . HOH K 4 .   ? -0.937  29.873 -3.284  1.00 8.16   ? 753 HOH A O   1 
HETATM 3731 O O   . HOH K 4 .   ? 0.788   24.847 -7.540  1.00 68.56  ? 754 HOH A O   1 
HETATM 3732 O O   . HOH K 4 .   ? 7.093   12.905 -4.876  1.00 66.27  ? 755 HOH A O   1 
HETATM 3733 O O   . HOH K 4 .   ? -13.646 22.983 3.561   1.00 53.77  ? 756 HOH A O   1 
HETATM 3734 O O   . HOH K 4 .   ? 0.653   28.166 -1.463  1.00 42.62  ? 757 HOH A O   1 
HETATM 3735 O O   . HOH K 4 .   ? -4.402  8.577  -10.679 1.00 58.18  ? 758 HOH A O   1 
HETATM 3736 O O   . HOH K 4 .   ? -13.148 39.122 -2.874  1.00 60.86  ? 759 HOH A O   1 
HETATM 3737 O O   . HOH K 4 .   ? -8.499  32.798 -17.631 1.00 56.75  ? 760 HOH A O   1 
HETATM 3738 O O   . HOH K 4 .   ? 16.399  31.231 -8.781  1.00 64.32  ? 761 HOH A O   1 
HETATM 3739 O O   . HOH K 4 .   ? -11.751 41.328 1.942   1.00 66.35  ? 762 HOH A O   1 
HETATM 3740 O O   . HOH K 4 .   ? 8.205   38.274 7.903   1.00 72.31  ? 763 HOH A O   1 
HETATM 3741 O O   . HOH K 4 .   ? 3.688   33.388 -0.436  1.00 71.02  ? 764 HOH A O   1 
HETATM 3742 O O   . HOH K 4 .   ? -6.843  39.665 0.486   1.00 63.20  ? 765 HOH A O   1 
HETATM 3743 O O   . HOH K 4 .   ? -19.213 22.888 2.386   1.00 44.99  ? 766 HOH A O   1 
HETATM 3744 O O   . HOH K 4 .   ? -27.751 33.447 2.572   1.00 71.66  ? 767 HOH A O   1 
HETATM 3745 O O   . HOH K 4 .   ? 4.344   34.702 -9.122  1.00 53.23  ? 768 HOH A O   1 
HETATM 3746 O O   . HOH K 4 .   ? -0.278  39.366 -4.932  1.00 75.20  ? 769 HOH A O   1 
HETATM 3747 O O   . HOH K 4 .   ? -25.336 27.036 10.313  1.00 74.90  ? 770 HOH A O   1 
HETATM 3748 O O   . HOH K 4 .   ? 1.935   33.973 18.262  1.00 62.10  ? 771 HOH A O   1 
HETATM 3749 O O   . HOH K 4 .   ? -6.804  18.555 -23.217 1.00 52.24  ? 772 HOH A O   1 
HETATM 3750 O O   . HOH K 4 .   ? -5.846  14.703 -17.277 1.00 71.03  ? 773 HOH A O   1 
HETATM 3751 O O   . HOH K 4 .   ? -20.786 24.955 4.204   1.00 48.03  ? 774 HOH A O   1 
HETATM 3752 O O   . HOH K 4 .   ? 19.355  34.947 -4.134  1.00 66.18  ? 775 HOH A O   1 
HETATM 3753 O O   . HOH K 4 .   ? -4.330  38.792 1.625   1.00 60.19  ? 776 HOH A O   1 
HETATM 3754 O O   . HOH K 4 .   ? -33.365 27.735 -6.736  1.00 55.75  ? 777 HOH A O   1 
HETATM 3755 O O   . HOH K 4 .   ? 20.784  32.205 -4.558  1.00 58.66  ? 778 HOH A O   1 
HETATM 3756 O O   . HOH K 4 .   ? 4.737   29.568 -15.859 1.00 62.20  ? 779 HOH A O   1 
HETATM 3757 O O   . HOH K 4 .   ? 2.238   30.641 -0.850  1.00 56.10  ? 780 HOH A O   1 
HETATM 3758 O O   . HOH K 4 .   ? -19.434 40.633 2.007   1.00 68.83  ? 781 HOH A O   1 
HETATM 3759 O O   . HOH K 4 .   ? -3.465  42.436 12.794  1.00 74.22  ? 782 HOH A O   1 
HETATM 3760 O O   . HOH K 4 .   ? 3.143   5.766  -7.959  1.00 64.72  ? 783 HOH A O   1 
HETATM 3761 O O   . HOH K 4 .   ? 18.440  25.531 22.662  1.00 60.44  ? 784 HOH A O   1 
HETATM 3762 O O   . HOH K 4 .   ? 8.014   22.091 -9.525  1.00 70.79  ? 785 HOH A O   1 
HETATM 3763 O O   . HOH K 4 .   ? -3.871  4.033  -2.913  1.00 80.10  ? 786 HOH A O   1 
HETATM 3764 O O   . HOH K 4 .   ? -9.799  6.649  -10.564 1.00 62.31  ? 787 HOH A O   1 
HETATM 3765 O O   . HOH K 4 .   ? 16.993  21.377 0.103   1.00 73.21  ? 788 HOH A O   1 
HETATM 3766 O O   . HOH K 4 .   ? -9.115  31.191 -23.574 1.00 69.78  ? 789 HOH A O   1 
HETATM 3767 O O   . HOH K 4 .   ? 15.016  33.413 18.585  1.00 73.15  ? 790 HOH A O   1 
HETATM 3768 O O   . HOH K 4 .   ? -7.022  26.839 -12.494 1.00 50.81  ? 791 HOH A O   1 
HETATM 3769 O O   . HOH K 4 .   ? -15.061 26.138 -23.342 1.00 68.12  ? 792 HOH A O   1 
HETATM 3770 O O   . HOH K 4 .   ? 1.154   23.442 19.588  1.00 52.98  ? 793 HOH A O   1 
HETATM 3771 O O   . HOH K 4 .   ? 5.194   27.297 -9.609  1.00 51.56  ? 794 HOH A O   1 
HETATM 3772 O O   . HOH K 4 .   ? 13.740  32.331 14.407  1.00 47.37  ? 795 HOH A O   1 
HETATM 3773 O O   . HOH K 4 .   ? 9.107   26.458 -11.706 1.00 71.14  ? 796 HOH A O   1 
HETATM 3774 O O   . HOH K 4 .   ? 5.077   25.908 18.841  1.00 56.60  ? 797 HOH A O   1 
HETATM 3775 O O   . HOH K 4 .   ? 3.628   24.101 20.468  1.00 57.45  ? 798 HOH A O   1 
HETATM 3776 O O   . HOH K 4 .   ? -5.161  23.492 -22.653 1.00 60.86  ? 799 HOH A O   1 
HETATM 3777 O O   . HOH K 4 .   ? -10.376 24.142 5.500   1.00 63.16  ? 800 HOH A O   1 
HETATM 3778 O O   . HOH K 4 .   ? -23.138 30.201 -13.577 1.00 63.91  ? 801 HOH A O   1 
HETATM 3779 O O   . HOH K 4 .   ? 3.185   43.087 8.360   1.00 48.04  ? 802 HOH A O   1 
HETATM 3780 O O   . HOH K 4 .   ? 20.946  35.603 -1.711  1.00 67.66  ? 803 HOH A O   1 
HETATM 3781 O O   . HOH K 4 .   ? 13.335  31.534 8.754   1.00 52.96  ? 804 HOH A O   1 
HETATM 3782 O O   . HOH K 4 .   ? -3.362  19.383 19.866  1.00 62.82  ? 805 HOH A O   1 
HETATM 3783 O O   . HOH K 4 .   ? 7.948   8.938  -4.424  1.00 71.78  ? 806 HOH A O   1 
HETATM 3784 O O   . HOH K 4 .   ? 8.949   23.841 16.078  1.00 56.92  ? 807 HOH A O   1 
HETATM 3785 O O   . HOH K 4 .   ? -15.893 36.212 -15.948 1.00 53.63  ? 808 HOH A O   1 
HETATM 3786 O O   . HOH K 4 .   ? -19.365 30.593 11.252  1.00 75.13  ? 809 HOH A O   1 
HETATM 3787 O O   . HOH K 4 .   ? -29.868 36.902 -3.492  1.00 58.66  ? 810 HOH A O   1 
HETATM 3788 O O   . HOH K 4 .   ? -22.425 21.313 -17.835 1.00 51.50  ? 811 HOH A O   1 
HETATM 3789 O O   . HOH K 4 .   ? -25.292 22.622 -16.321 1.00 56.70  ? 812 HOH A O   1 
HETATM 3790 O O   . HOH K 4 .   ? 3.295   29.610 -13.148 1.00 53.79  ? 813 HOH A O   1 
HETATM 3791 O O   . HOH K 4 .   ? -4.753  20.563 -22.831 1.00 57.16  ? 814 HOH A O   1 
HETATM 3792 O O   . HOH K 4 .   ? -14.452 35.632 -13.289 1.00 49.91  ? 815 HOH A O   1 
HETATM 3793 O O   . HOH K 4 .   ? -20.966 20.623 -3.617  1.00 56.72  ? 816 HOH A O   1 
HETATM 3794 O O   . HOH K 4 .   ? -11.293 8.026  -18.485 1.00 64.04  ? 817 HOH A O   1 
HETATM 3795 O O   . HOH K 4 .   ? 1.845   24.395 -12.470 1.00 56.62  ? 818 HOH A O   1 
HETATM 3796 O O   . HOH K 4 .   ? 3.603   20.902 -11.568 1.00 48.77  ? 819 HOH A O   1 
HETATM 3797 O O   . HOH K 4 .   ? 3.979   19.172 -9.708  1.00 36.75  ? 820 HOH A O   1 
HETATM 3798 O O   . HOH K 4 .   ? 3.534   16.098 -9.848  1.00 61.63  ? 821 HOH A O   1 
HETATM 3799 O O   . HOH K 4 .   ? 2.536   15.351 -13.306 1.00 59.42  ? 822 HOH A O   1 
HETATM 3800 O O   . HOH K 4 .   ? -10.671 5.014  -24.026 1.00 71.31  ? 823 HOH A O   1 
HETATM 3801 O O   . HOH L 4 .   ? -4.664  22.772 49.650  1.00 54.96  ? 701 HOH B O   1 
HETATM 3802 O O   . HOH L 4 .   ? -5.177  20.395 45.773  1.00 65.84  ? 702 HOH B O   1 
HETATM 3803 O O   . HOH L 4 .   ? -10.589 10.014 27.417  1.00 68.64  ? 703 HOH B O   1 
HETATM 3804 O O   . HOH L 4 .   ? -17.108 30.115 37.538  1.00 72.33  ? 704 HOH B O   1 
HETATM 3805 O O   . HOH L 4 .   ? -6.963  31.687 39.286  1.00 45.73  ? 705 HOH B O   1 
HETATM 3806 O O   . HOH L 4 .   ? -4.520  -4.810 38.422  1.00 56.61  ? 706 HOH B O   1 
HETATM 3807 O O   . HOH L 4 .   ? -18.043 29.249 42.870  1.00 62.56  ? 707 HOH B O   1 
HETATM 3808 O O   . HOH L 4 .   ? -18.567 23.118 20.589  1.00 58.97  ? 708 HOH B O   1 
HETATM 3809 O O   . HOH L 4 .   ? -9.278  23.428 55.660  1.00 57.32  ? 709 HOH B O   1 
HETATM 3810 O O   . HOH L 4 .   ? -2.372  5.176  46.327  1.00 63.32  ? 710 HOH B O   1 
HETATM 3811 O O   . HOH L 4 .   ? -19.945 27.045 21.021  1.00 70.80  ? 711 HOH B O   1 
HETATM 3812 O O   . HOH L 4 .   ? -6.548  29.075 59.346  1.00 60.83  ? 712 HOH B O   1 
HETATM 3813 O O   . HOH L 4 .   ? -6.737  12.006 50.406  1.00 55.99  ? 713 HOH B O   1 
HETATM 3814 O O   . HOH L 4 .   ? -8.283  28.049 31.055  1.00 56.04  ? 714 HOH B O   1 
HETATM 3815 O O   . HOH L 4 .   ? 8.306   18.138 32.500  1.00 64.85  ? 715 HOH B O   1 
HETATM 3816 O O   . HOH L 4 .   ? 2.417   27.455 25.380  1.00 66.97  ? 716 HOH B O   1 
HETATM 3817 O O   . HOH L 4 .   ? -8.673  37.114 51.922  1.00 55.84  ? 717 HOH B O   1 
HETATM 3818 O O   . HOH L 4 .   ? 4.443   7.241  32.175  1.00 64.70  ? 718 HOH B O   1 
HETATM 3819 O O   . HOH L 4 .   ? -0.752  34.934 37.267  1.00 69.81  ? 719 HOH B O   1 
HETATM 3820 O O   . HOH L 4 .   ? -9.171  17.361 40.695  1.00 19.43  ? 720 HOH B O   1 
HETATM 3821 O O   . HOH L 4 .   ? -16.347 18.200 21.386  1.00 53.48  ? 721 HOH B O   1 
HETATM 3822 O O   . HOH L 4 .   ? -2.273  14.016 48.235  1.00 54.53  ? 722 HOH B O   1 
HETATM 3823 O O   . HOH L 4 .   ? -12.439 30.284 52.264  1.00 44.05  ? 723 HOH B O   1 
HETATM 3824 O O   . HOH L 4 .   ? -1.036  30.095 60.340  1.00 54.86  ? 724 HOH B O   1 
HETATM 3825 O O   . HOH L 4 .   ? 1.384   2.026  27.764  1.00 67.74  ? 725 HOH B O   1 
HETATM 3826 O O   . HOH L 4 .   ? -15.100 10.677 37.859  1.00 49.66  ? 726 HOH B O   1 
HETATM 3827 O O   . HOH L 4 .   ? -13.029 19.225 47.399  1.00 58.44  ? 727 HOH B O   1 
HETATM 3828 O O   . HOH L 4 .   ? -15.814 23.661 50.682  1.00 73.83  ? 728 HOH B O   1 
HETATM 3829 O O   . HOH L 4 .   ? 3.120   14.189 53.371  1.00 53.28  ? 729 HOH B O   1 
HETATM 3830 O O   . HOH L 4 .   ? -15.670 5.827  41.683  1.00 56.62  ? 730 HOH B O   1 
HETATM 3831 O O   . HOH L 4 .   ? 8.857   20.048 50.217  1.00 60.51  ? 731 HOH B O   1 
HETATM 3832 O O   . HOH L 4 .   ? -14.569 45.648 44.130  1.00 72.60  ? 732 HOH B O   1 
HETATM 3833 O O   . HOH L 4 .   ? -17.031 36.179 37.714  1.00 62.86  ? 733 HOH B O   1 
HETATM 3834 O O   . HOH L 4 .   ? 5.408   9.605  29.797  1.00 70.27  ? 734 HOH B O   1 
HETATM 3835 O O   . HOH L 4 .   ? -14.477 24.623 39.080  1.00 67.06  ? 735 HOH B O   1 
HETATM 3836 O O   . HOH L 4 .   ? -3.569  16.961 22.902  1.00 76.10  ? 736 HOH B O   1 
HETATM 3837 O O   . HOH L 4 .   ? -18.398 34.124 49.881  1.00 52.96  ? 737 HOH B O   1 
HETATM 3838 O O   . HOH L 4 .   ? 8.841   16.343 29.939  1.00 70.28  ? 738 HOH B O   1 
HETATM 3839 O O   . HOH L 4 .   ? -9.499  14.131 38.480  1.00 64.37  ? 739 HOH B O   1 
HETATM 3840 O O   . HOH L 4 .   ? 2.941   7.656  23.632  1.00 58.69  ? 740 HOH B O   1 
HETATM 3841 O O   . HOH L 4 .   ? -9.647  38.021 54.620  1.00 67.80  ? 741 HOH B O   1 
HETATM 3842 O O   . HOH L 4 .   ? -16.392 9.335  44.621  1.00 60.74  ? 742 HOH B O   1 
HETATM 3843 O O   . HOH L 4 .   ? 4.581   8.652  25.809  1.00 58.44  ? 743 HOH B O   1 
HETATM 3844 O O   . HOH L 4 .   ? -19.582 32.095 28.652  1.00 65.53  ? 744 HOH B O   1 
HETATM 3845 O O   . HOH L 4 .   ? -12.061 14.262 37.595  1.00 56.17  ? 745 HOH B O   1 
HETATM 3846 O O   . HOH L 4 .   ? -14.822 2.649  22.511  1.00 49.31  ? 746 HOH B O   1 
HETATM 3847 O O   . HOH L 4 .   ? -6.210  29.949 31.949  1.00 50.44  ? 747 HOH B O   1 
HETATM 3848 O O   . HOH L 4 .   ? 11.822  18.227 37.750  1.00 59.56  ? 748 HOH B O   1 
HETATM 3849 O O   . HOH L 4 .   ? -13.145 1.062  23.888  1.00 56.20  ? 749 HOH B O   1 
HETATM 3850 O O   . HOH L 4 .   ? -14.745 3.484  17.509  1.00 70.70  ? 750 HOH B O   1 
HETATM 3851 O O   . HOH L 4 .   ? -5.408  17.542 19.618  1.00 52.47  ? 751 HOH B O   1 
HETATM 3852 O O   . HOH L 4 .   ? 0.739   40.578 51.741  1.00 54.90  ? 752 HOH B O   1 
HETATM 3853 O O   . HOH L 4 .   ? 6.097   14.993 44.174  1.00 68.37  ? 753 HOH B O   1 
HETATM 3854 O O   . HOH L 4 .   ? 6.992   26.235 30.734  1.00 68.04  ? 754 HOH B O   1 
HETATM 3855 O O   . HOH L 4 .   ? -13.430 12.499 38.569  1.00 64.61  ? 755 HOH B O   1 
HETATM 3856 O O   . HOH L 4 .   ? 0.919   31.346 40.315  1.00 60.83  ? 756 HOH B O   1 
HETATM 3857 O O   . HOH L 4 .   ? -22.690 21.798 14.251  1.00 69.81  ? 757 HOH B O   1 
HETATM 3858 O O   . HOH L 4 .   ? -16.425 20.821 51.138  1.00 67.05  ? 758 HOH B O   1 
HETATM 3859 O O   . HOH L 4 .   ? -17.039 33.238 35.999  1.00 65.73  ? 759 HOH B O   1 
HETATM 3860 O O   . HOH L 4 .   ? -12.026 6.192  11.966  1.00 59.80  ? 760 HOH B O   1 
HETATM 3861 O O   . HOH L 4 .   ? -11.873 36.263 27.608  1.00 84.68  ? 761 HOH B O   1 
HETATM 3862 O O   . HOH L 4 .   ? -11.430 12.090 51.140  1.00 61.10  ? 762 HOH B O   1 
HETATM 3863 O O   . HOH L 4 .   ? -12.685 34.062 22.551  1.00 58.69  ? 763 HOH B O   1 
HETATM 3864 O O   . HOH L 4 .   ? -13.658 39.963 38.554  1.00 61.58  ? 764 HOH B O   1 
HETATM 3865 O O   . HOH L 4 .   ? -22.659 15.589 17.729  1.00 60.31  ? 765 HOH B O   1 
HETATM 3866 O O   . HOH L 4 .   ? -1.132  39.783 54.052  1.00 62.18  ? 766 HOH B O   1 
HETATM 3867 O O   . HOH L 4 .   ? -14.827 6.006  32.743  1.00 74.88  ? 767 HOH B O   1 
HETATM 3868 O O   . HOH L 4 .   ? -21.515 23.422 22.098  1.00 74.77  ? 768 HOH B O   1 
HETATM 3869 O O   . HOH L 4 .   ? 16.234  27.015 46.186  1.00 73.60  ? 769 HOH B O   1 
HETATM 3870 O O   . HOH L 4 .   ? 4.684   27.182 57.530  1.00 77.25  ? 770 HOH B O   1 
HETATM 3871 O O   . HOH L 4 .   ? 6.012   23.925 58.399  1.00 69.55  ? 771 HOH B O   1 
HETATM 3872 O O   . HOH L 4 .   ? -18.344 7.086  17.500  1.00 73.31  ? 772 HOH B O   1 
HETATM 3873 O O   . HOH L 4 .   ? -7.359  15.840 38.740  1.00 44.64  ? 773 HOH B O   1 
HETATM 3874 O O   . HOH L 4 .   ? -11.083 38.163 32.438  1.00 66.70  ? 774 HOH B O   1 
HETATM 3875 O O   . HOH L 4 .   ? 2.553   29.503 58.242  1.00 81.88  ? 775 HOH B O   1 
HETATM 3876 O O   . HOH L 4 .   ? -15.073 15.708 11.865  1.00 72.22  ? 776 HOH B O   1 
HETATM 3877 O O   . HOH L 4 .   ? 10.958  13.799 34.532  1.00 57.61  ? 777 HOH B O   1 
HETATM 3878 O O   . HOH L 4 .   ? 1.261   2.807  30.231  1.00 75.87  ? 778 HOH B O   1 
HETATM 3879 O O   . HOH L 4 .   ? -13.489 44.313 50.532  1.00 55.61  ? 779 HOH B O   1 
HETATM 3880 O O   . HOH L 4 .   ? 5.865   21.524 30.716  1.00 69.52  ? 780 HOH B O   1 
HETATM 3881 O O   . HOH L 4 .   ? -5.027  35.801 33.457  1.00 57.78  ? 781 HOH B O   1 
HETATM 3882 O O   . HOH L 4 .   ? -12.410 16.483 12.980  1.00 60.83  ? 782 HOH B O   1 
HETATM 3883 O O   . HOH L 4 .   ? -16.411 8.369  33.348  1.00 53.67  ? 783 HOH B O   1 
HETATM 3884 O O   . HOH L 4 .   ? -6.392  5.794  17.058  1.00 68.39  ? 784 HOH B O   1 
HETATM 3885 O O   . HOH L 4 .   ? -18.597 5.028  19.686  1.00 71.91  ? 785 HOH B O   1 
HETATM 3886 O O   . HOH L 4 .   ? -0.054  43.740 46.913  1.00 60.78  ? 786 HOH B O   1 
HETATM 3887 O O   . HOH L 4 .   ? -0.539  6.295  47.720  1.00 51.31  ? 787 HOH B O   1 
HETATM 3888 O O   . HOH L 4 .   ? -13.335 13.254 46.451  1.00 52.65  ? 788 HOH B O   1 
HETATM 3889 O O   . HOH L 4 .   ? 4.693   5.698  39.734  1.00 66.65  ? 789 HOH B O   1 
HETATM 3890 O O   . HOH L 4 .   ? -4.152  -0.235 22.904  1.00 80.32  ? 790 HOH B O   1 
HETATM 3891 O O   . HOH L 4 .   ? -5.184  10.068 46.557  1.00 48.02  ? 791 HOH B O   1 
HETATM 3892 O O   . HOH L 4 .   ? 0.012   11.107 46.547  1.00 57.70  ? 792 HOH B O   1 
HETATM 3893 O O   . HOH L 4 .   ? -2.446  12.901 45.765  1.00 72.43  ? 793 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   350 ?   ?   ?   A . n 
A 1 2   SER 2   351 ?   ?   ?   A . n 
A 1 3   LYS 3   352 ?   ?   ?   A . n 
A 1 4   PRO 4   353 ?   ?   ?   A . n 
A 1 5   LYS 5   354 ?   ?   ?   A . n 
A 1 6   GLN 6   355 ?   ?   ?   A . n 
A 1 7   PRO 7   356 ?   ?   ?   A . n 
A 1 8   PRO 8   357 ?   ?   ?   A . n 
A 1 9   ASP 9   358 ?   ?   ?   A . n 
A 1 10  ALA 10  359 ?   ?   ?   A . n 
A 1 11  SER 11  360 ?   ?   ?   A . n 
A 1 12  PRO 12  361 ?   ?   ?   A . n 
A 1 13  ALA 13  362 362 ALA ALA A . n 
A 1 14  ASN 14  363 363 ASN ASN A . n 
A 1 15  LEU 15  364 364 LEU LEU A . n 
A 1 16  LEU 16  365 365 LEU LEU A . n 
A 1 17  THR 17  366 366 THR THR A . n 
A 1 18  SER 18  367 367 SER SER A . n 
A 1 19  LEU 19  368 368 LEU LEU A . n 
A 1 20  VAL 20  369 369 VAL VAL A . n 
A 1 21  ARG 21  370 370 ARG ARG A . n 
A 1 22  ALA 22  371 371 ALA ALA A . n 
A 1 23  HIS 23  372 372 HIS HIS A . n 
A 1 24  LEU 24  373 373 LEU LEU A . n 
A 1 25  ASP 25  374 374 ASP ASP A . n 
A 1 26  SER 26  375 375 SER SER A . n 
A 1 27  GLY 27  376 376 GLY GLY A . n 
A 1 28  PRO 28  377 377 PRO PRO A . n 
A 1 29  SER 29  378 378 SER SER A . n 
A 1 30  THR 30  379 379 THR THR A . n 
A 1 31  ALA 31  380 380 ALA ALA A . n 
A 1 32  LYS 32  381 381 LYS LYS A . n 
A 1 33  LEU 33  382 382 LEU LEU A . n 
A 1 34  ASP 34  383 383 ASP ASP A . n 
A 1 35  TYR 35  384 384 TYR TYR A . n 
A 1 36  SER 36  385 385 SER SER A . n 
A 1 37  LYS 37  386 386 LYS LYS A . n 
A 1 38  PHE 38  387 387 PHE PHE A . n 
A 1 39  GLN 39  388 388 GLN GLN A . n 
A 1 40  GLU 40  389 389 GLU GLU A . n 
A 1 41  LEU 41  390 390 LEU LEU A . n 
A 1 42  VAL 42  391 391 VAL VAL A . n 
A 1 43  LEU 43  392 392 LEU LEU A . n 
A 1 44  PRO 44  393 393 PRO PRO A . n 
A 1 45  HIS 45  394 394 HIS HIS A . n 
A 1 46  PHE 46  395 395 PHE PHE A . n 
A 1 47  GLY 47  396 396 GLY GLY A . n 
A 1 48  LYS 48  397 397 LYS LYS A . n 
A 1 49  GLU 49  398 398 GLU GLU A . n 
A 1 50  ASP 50  399 399 ASP ASP A . n 
A 1 51  ALA 51  400 400 ALA ALA A . n 
A 1 52  GLY 52  401 401 GLY GLY A . n 
A 1 53  ASP 53  402 402 ASP ASP A . n 
A 1 54  VAL 54  403 403 VAL VAL A . n 
A 1 55  GLN 55  404 404 GLN GLN A . n 
A 1 56  GLN 56  405 405 GLN GLN A . n 
A 1 57  PHE 57  406 406 PHE PHE A . n 
A 1 58  TYR 58  407 407 TYR TYR A . n 
A 1 59  ASP 59  408 408 ASP ASP A . n 
A 1 60  LEU 60  409 409 LEU LEU A . n 
A 1 61  LEU 61  410 410 LEU LEU A . n 
A 1 62  SER 62  411 411 SER SER A . n 
A 1 63  GLY 63  412 412 GLY GLY A . n 
A 1 64  SER 64  413 413 SER SER A . n 
A 1 65  LEU 65  414 414 LEU LEU A . n 
A 1 66  GLU 66  415 415 GLU GLU A . n 
A 1 67  VAL 67  416 416 VAL VAL A . n 
A 1 68  ILE 68  417 417 ILE ILE A . n 
A 1 69  ARG 69  418 418 ARG ARG A . n 
A 1 70  LYS 70  419 419 LYS LYS A . n 
A 1 71  TRP 71  420 420 TRP TRP A . n 
A 1 72  ALA 72  421 421 ALA ALA A . n 
A 1 73  GLU 73  422 422 GLU GLU A . n 
A 1 74  LYS 74  423 423 LYS LYS A . n 
A 1 75  ILE 75  424 424 ILE ILE A . n 
A 1 76  PRO 76  425 425 PRO PRO A . n 
A 1 77  GLY 77  426 426 GLY GLY A . n 
A 1 78  PHE 78  427 427 PHE PHE A . n 
A 1 79  ALA 79  428 428 ALA ALA A . n 
A 1 80  GLU 80  429 429 GLU GLU A . n 
A 1 81  LEU 81  430 430 LEU LEU A . n 
A 1 82  SER 82  431 431 SER SER A . n 
A 1 83  PRO 83  432 432 PRO PRO A . n 
A 1 84  ALA 84  433 433 ALA ALA A . n 
A 1 85  ASP 85  434 434 ASP ASP A . n 
A 1 86  GLN 86  435 435 GLN GLN A . n 
A 1 87  ASP 87  436 436 ASP ASP A . n 
A 1 88  LEU 88  437 437 LEU LEU A . n 
A 1 89  LEU 89  438 438 LEU LEU A . n 
A 1 90  LEU 90  439 439 LEU LEU A . n 
A 1 91  GLU 91  440 440 GLU GLU A . n 
A 1 92  SER 92  441 441 SER SER A . n 
A 1 93  ALA 93  442 442 ALA ALA A . n 
A 1 94  PHE 94  443 443 PHE PHE A . n 
A 1 95  LEU 95  444 444 LEU LEU A . n 
A 1 96  GLU 96  445 445 GLU GLU A . n 
A 1 97  LEU 97  446 446 LEU LEU A . n 
A 1 98  PHE 98  447 447 PHE PHE A . n 
A 1 99  ILE 99  448 448 ILE ILE A . n 
A 1 100 LEU 100 449 449 LEU LEU A . n 
A 1 101 ARG 101 450 450 ARG ARG A . n 
A 1 102 LEU 102 451 451 LEU LEU A . n 
A 1 103 ALA 103 452 452 ALA ALA A . n 
A 1 104 TYR 104 453 453 TYR TYR A . n 
A 1 105 ARG 105 454 454 ARG ARG A . n 
A 1 106 SER 106 455 455 SER SER A . n 
A 1 107 LYS 107 456 456 LYS LYS A . n 
A 1 108 PRO 108 457 457 PRO PRO A . n 
A 1 109 GLY 109 458 458 GLY GLY A . n 
A 1 110 GLU 110 459 459 GLU GLU A . n 
A 1 111 GLY 111 460 460 GLY GLY A . n 
A 1 112 LYS 112 461 461 LYS LYS A . n 
A 1 113 LEU 113 462 462 LEU LEU A . n 
A 1 114 ILE 114 463 463 ILE ILE A . n 
A 1 115 PHE 115 464 464 PHE PHE A . n 
A 1 116 CYS 116 465 465 CYS CYS A . n 
A 1 117 SER 117 466 466 SER SER A . n 
A 1 118 GLY 118 467 467 GLY GLY A . n 
A 1 119 LEU 119 468 468 LEU LEU A . n 
A 1 120 VAL 120 469 469 VAL VAL A . n 
A 1 121 LEU 121 470 470 LEU LEU A . n 
A 1 122 HIS 122 471 471 HIS HIS A . n 
A 1 123 ARG 123 472 472 ARG ARG A . n 
A 1 124 LEU 124 473 473 LEU LEU A . n 
A 1 125 GLN 125 474 474 GLN GLN A . n 
A 1 126 CYS 126 475 475 CYS CYS A . n 
A 1 127 ALA 127 476 476 ALA ALA A . n 
A 1 128 ARG 128 477 477 ARG ARG A . n 
A 1 129 GLY 129 478 478 GLY GLY A . n 
A 1 130 PHE 130 479 479 PHE PHE A . n 
A 1 131 GLY 131 480 480 GLY GLY A . n 
A 1 132 ASP 132 481 481 ASP ASP A . n 
A 1 133 TRP 133 482 482 TRP TRP A . n 
A 1 134 ILE 134 483 483 ILE ILE A . n 
A 1 135 ASP 135 484 484 ASP ASP A . n 
A 1 136 SER 136 485 485 SER SER A . n 
A 1 137 ILE 137 486 486 ILE ILE A . n 
A 1 138 LEU 138 487 487 LEU LEU A . n 
A 1 139 ALA 139 488 488 ALA ALA A . n 
A 1 140 PHE 140 489 489 PHE PHE A . n 
A 1 141 SER 141 490 490 SER SER A . n 
A 1 142 ARG 142 491 491 ARG ARG A . n 
A 1 143 SER 143 492 492 SER SER A . n 
A 1 144 LEU 144 493 493 LEU LEU A . n 
A 1 145 HIS 145 494 494 HIS HIS A . n 
A 1 146 SER 146 495 495 SER SER A . n 
A 1 147 LEU 147 496 496 LEU LEU A . n 
A 1 148 LEU 148 497 497 LEU LEU A . n 
A 1 149 VAL 149 498 498 VAL VAL A . n 
A 1 150 ASP 150 499 499 ASP ASP A . n 
A 1 151 VAL 151 500 500 VAL VAL A . n 
A 1 152 PRO 152 501 501 PRO PRO A . n 
A 1 153 ALA 153 502 502 ALA ALA A . n 
A 1 154 PHE 154 503 503 PHE PHE A . n 
A 1 155 ALA 155 504 504 ALA ALA A . n 
A 1 156 CYS 156 505 505 CYS CYS A . n 
A 1 157 LEU 157 506 506 LEU LEU A . n 
A 1 158 SER 158 507 507 SER SER A . n 
A 1 159 ALA 159 508 508 ALA ALA A . n 
A 1 160 LEU 160 509 509 LEU LEU A . n 
A 1 161 VAL 161 510 510 VAL VAL A . n 
A 1 162 LEU 162 511 511 LEU LEU A . n 
A 1 163 ILE 163 512 512 ILE ILE A . n 
A 1 164 THR 164 513 513 THR THR A . n 
A 1 165 ASP 165 514 514 ASP ASP A . n 
A 1 166 ARG 166 515 515 ARG ARG A . n 
A 1 167 HIS 167 516 516 HIS HIS A . n 
A 1 168 GLY 168 517 517 GLY GLY A . n 
A 1 169 LEU 169 518 518 LEU LEU A . n 
A 1 170 GLN 170 519 519 GLN GLN A . n 
A 1 171 GLU 171 520 520 GLU GLU A . n 
A 1 172 PRO 172 521 521 PRO PRO A . n 
A 1 173 ARG 173 522 522 ARG ARG A . n 
A 1 174 ARG 174 523 523 ARG ARG A . n 
A 1 175 VAL 175 524 524 VAL VAL A . n 
A 1 176 GLU 176 525 525 GLU GLU A . n 
A 1 177 GLU 177 526 526 GLU GLU A . n 
A 1 178 LEU 178 527 527 LEU LEU A . n 
A 1 179 GLN 179 528 528 GLN GLN A . n 
A 1 180 ASN 180 529 529 ASN ASN A . n 
A 1 181 ARG 181 530 530 ARG ARG A . n 
A 1 182 ILE 182 531 531 ILE ILE A . n 
A 1 183 ALA 183 532 532 ALA ALA A . n 
A 1 184 SER 184 533 533 SER SER A . n 
A 1 185 CYS 185 534 534 CYS CYS A . n 
A 1 186 LEU 186 535 535 LEU LEU A . n 
A 1 187 LYS 187 536 536 LYS LYS A . n 
A 1 188 GLU 188 537 537 GLU GLU A . n 
A 1 189 HIS 189 538 538 HIS HIS A . n 
A 1 190 VAL 190 539 539 VAL VAL A . n 
A 1 191 ALA 191 540 540 ALA ALA A . n 
A 1 192 ALA 192 541 541 ALA ALA A . n 
A 1 193 VAL 193 542 542 VAL VAL A . n 
A 1 194 ALA 194 543 543 ALA ALA A . n 
A 1 195 GLY 195 544 ?   ?   ?   A . n 
A 1 196 GLU 196 545 545 GLU GLU A . n 
A 1 197 PRO 197 546 546 PRO PRO A . n 
A 1 198 GLN 198 547 ?   ?   ?   A . n 
A 1 199 PRO 199 548 548 PRO PRO A . n 
A 1 200 ALA 200 549 549 ALA ALA A . n 
A 1 201 SER 201 550 ?   ?   ?   A . n 
A 1 202 CYS 202 551 ?   ?   ?   A . n 
A 1 203 LEU 203 552 552 LEU LEU A . n 
A 1 204 SER 204 553 553 SER SER A . n 
A 1 205 ARG 205 554 554 ARG ARG A . n 
A 1 206 LEU 206 555 555 LEU LEU A . n 
A 1 207 LEU 207 556 556 LEU LEU A . n 
A 1 208 GLY 208 557 557 GLY GLY A . n 
A 1 209 LYS 209 558 558 LYS LYS A . n 
A 1 210 LEU 210 559 559 LEU LEU A . n 
A 1 211 PRO 211 560 560 PRO PRO A . n 
A 1 212 GLU 212 561 561 GLU GLU A . n 
A 1 213 LEU 213 562 562 LEU LEU A . n 
A 1 214 ARG 214 563 563 ARG ARG A . n 
A 1 215 THR 215 564 564 THR THR A . n 
A 1 216 LEU 216 565 565 LEU LEU A . n 
A 1 217 CYS 217 566 566 CYS CYS A . n 
A 1 218 THR 218 567 567 THR THR A . n 
A 1 219 GLN 219 568 568 GLN GLN A . n 
A 1 220 GLY 220 569 569 GLY GLY A . n 
A 1 221 LEU 221 570 570 LEU LEU A . n 
A 1 222 GLN 222 571 571 GLN GLN A . n 
A 1 223 ARG 223 572 572 ARG ARG A . n 
A 1 224 ILE 224 573 573 ILE ILE A . n 
A 1 225 PHE 225 574 574 PHE PHE A . n 
A 1 226 TYR 226 575 575 TYR TYR A . n 
A 1 227 LEU 227 576 576 LEU LEU A . n 
A 1 228 LYS 228 577 577 LYS LYS A . n 
A 1 229 LEU 229 578 578 LEU LEU A . n 
A 1 230 GLU 230 579 579 GLU GLU A . n 
A 1 231 ASP 231 580 580 ASP ASP A . n 
A 1 232 LEU 232 581 581 LEU LEU A . n 
A 1 233 VAL 233 582 582 VAL VAL A . n 
A 1 234 PRO 234 583 583 PRO PRO A . n 
A 1 235 PRO 235 584 584 PRO PRO A . n 
A 1 236 PRO 236 585 585 PRO PRO A . n 
A 1 237 PRO 237 586 586 PRO PRO A . n 
A 1 238 ILE 238 587 587 ILE ILE A . n 
A 1 239 ILE 239 588 588 ILE ILE A . n 
A 1 240 ASP 240 589 589 ASP ASP A . n 
A 1 241 LYS 241 590 590 LYS LYS A . n 
A 1 242 ILE 242 591 591 ILE ILE A . n 
A 1 243 PHE 243 592 592 PHE PHE A . n 
A 1 244 MET 244 593 593 MET MET A . n 
A 1 245 ASP 245 594 594 ASP ASP A . n 
A 1 246 THR 246 595 595 THR THR A . n 
A 1 247 LEU 247 596 596 LEU LEU A . n 
A 1 248 PRO 248 597 597 PRO PRO A . n 
A 1 249 PHE 249 598 598 PHE PHE A . n 
B 1 1   SER 1   350 ?   ?   ?   B . n 
B 1 2   SER 2   351 ?   ?   ?   B . n 
B 1 3   LYS 3   352 ?   ?   ?   B . n 
B 1 4   PRO 4   353 ?   ?   ?   B . n 
B 1 5   LYS 5   354 ?   ?   ?   B . n 
B 1 6   GLN 6   355 ?   ?   ?   B . n 
B 1 7   PRO 7   356 ?   ?   ?   B . n 
B 1 8   PRO 8   357 ?   ?   ?   B . n 
B 1 9   ASP 9   358 ?   ?   ?   B . n 
B 1 10  ALA 10  359 ?   ?   ?   B . n 
B 1 11  SER 11  360 ?   ?   ?   B . n 
B 1 12  PRO 12  361 ?   ?   ?   B . n 
B 1 13  ALA 13  362 362 ALA ALA B . n 
B 1 14  ASN 14  363 363 ASN ASN B . n 
B 1 15  LEU 15  364 364 LEU LEU B . n 
B 1 16  LEU 16  365 365 LEU LEU B . n 
B 1 17  THR 17  366 366 THR THR B . n 
B 1 18  SER 18  367 367 SER SER B . n 
B 1 19  LEU 19  368 368 LEU LEU B . n 
B 1 20  VAL 20  369 369 VAL VAL B . n 
B 1 21  ARG 21  370 370 ARG ARG B . n 
B 1 22  ALA 22  371 371 ALA ALA B . n 
B 1 23  HIS 23  372 372 HIS HIS B . n 
B 1 24  LEU 24  373 373 LEU LEU B . n 
B 1 25  ASP 25  374 374 ASP ASP B . n 
B 1 26  SER 26  375 375 SER SER B . n 
B 1 27  GLY 27  376 376 GLY GLY B . n 
B 1 28  PRO 28  377 377 PRO PRO B . n 
B 1 29  SER 29  378 378 SER SER B . n 
B 1 30  THR 30  379 379 THR THR B . n 
B 1 31  ALA 31  380 380 ALA ALA B . n 
B 1 32  LYS 32  381 381 LYS LYS B . n 
B 1 33  LEU 33  382 382 LEU LEU B . n 
B 1 34  ASP 34  383 383 ASP ASP B . n 
B 1 35  TYR 35  384 384 TYR TYR B . n 
B 1 36  SER 36  385 385 SER SER B . n 
B 1 37  LYS 37  386 386 LYS LYS B . n 
B 1 38  PHE 38  387 387 PHE PHE B . n 
B 1 39  GLN 39  388 388 GLN GLN B . n 
B 1 40  GLU 40  389 389 GLU GLU B . n 
B 1 41  LEU 41  390 390 LEU LEU B . n 
B 1 42  VAL 42  391 391 VAL VAL B . n 
B 1 43  LEU 43  392 392 LEU LEU B . n 
B 1 44  PRO 44  393 393 PRO PRO B . n 
B 1 45  HIS 45  394 ?   ?   ?   B . n 
B 1 46  PHE 46  395 ?   ?   ?   B . n 
B 1 47  GLY 47  396 ?   ?   ?   B . n 
B 1 48  LYS 48  397 397 LYS LYS B . n 
B 1 49  GLU 49  398 398 GLU GLU B . n 
B 1 50  ASP 50  399 399 ASP ASP B . n 
B 1 51  ALA 51  400 400 ALA ALA B . n 
B 1 52  GLY 52  401 401 GLY GLY B . n 
B 1 53  ASP 53  402 402 ASP ASP B . n 
B 1 54  VAL 54  403 403 VAL VAL B . n 
B 1 55  GLN 55  404 404 GLN GLN B . n 
B 1 56  GLN 56  405 405 GLN GLN B . n 
B 1 57  PHE 57  406 406 PHE PHE B . n 
B 1 58  TYR 58  407 407 TYR TYR B . n 
B 1 59  ASP 59  408 408 ASP ASP B . n 
B 1 60  LEU 60  409 409 LEU LEU B . n 
B 1 61  LEU 61  410 410 LEU LEU B . n 
B 1 62  SER 62  411 411 SER SER B . n 
B 1 63  GLY 63  412 412 GLY GLY B . n 
B 1 64  SER 64  413 413 SER SER B . n 
B 1 65  LEU 65  414 414 LEU LEU B . n 
B 1 66  GLU 66  415 415 GLU GLU B . n 
B 1 67  VAL 67  416 416 VAL VAL B . n 
B 1 68  ILE 68  417 417 ILE ILE B . n 
B 1 69  ARG 69  418 418 ARG ARG B . n 
B 1 70  LYS 70  419 419 LYS LYS B . n 
B 1 71  TRP 71  420 420 TRP TRP B . n 
B 1 72  ALA 72  421 421 ALA ALA B . n 
B 1 73  GLU 73  422 422 GLU GLU B . n 
B 1 74  LYS 74  423 423 LYS LYS B . n 
B 1 75  ILE 75  424 424 ILE ILE B . n 
B 1 76  PRO 76  425 425 PRO PRO B . n 
B 1 77  GLY 77  426 426 GLY GLY B . n 
B 1 78  PHE 78  427 427 PHE PHE B . n 
B 1 79  ALA 79  428 428 ALA ALA B . n 
B 1 80  GLU 80  429 429 GLU GLU B . n 
B 1 81  LEU 81  430 430 LEU LEU B . n 
B 1 82  SER 82  431 431 SER SER B . n 
B 1 83  PRO 83  432 432 PRO PRO B . n 
B 1 84  ALA 84  433 433 ALA ALA B . n 
B 1 85  ASP 85  434 434 ASP ASP B . n 
B 1 86  GLN 86  435 435 GLN GLN B . n 
B 1 87  ASP 87  436 436 ASP ASP B . n 
B 1 88  LEU 88  437 437 LEU LEU B . n 
B 1 89  LEU 89  438 438 LEU LEU B . n 
B 1 90  LEU 90  439 439 LEU LEU B . n 
B 1 91  GLU 91  440 440 GLU GLU B . n 
B 1 92  SER 92  441 441 SER SER B . n 
B 1 93  ALA 93  442 442 ALA ALA B . n 
B 1 94  PHE 94  443 443 PHE PHE B . n 
B 1 95  LEU 95  444 444 LEU LEU B . n 
B 1 96  GLU 96  445 445 GLU GLU B . n 
B 1 97  LEU 97  446 446 LEU LEU B . n 
B 1 98  PHE 98  447 447 PHE PHE B . n 
B 1 99  ILE 99  448 448 ILE ILE B . n 
B 1 100 LEU 100 449 449 LEU LEU B . n 
B 1 101 ARG 101 450 450 ARG ARG B . n 
B 1 102 LEU 102 451 451 LEU LEU B . n 
B 1 103 ALA 103 452 452 ALA ALA B . n 
B 1 104 TYR 104 453 453 TYR TYR B . n 
B 1 105 ARG 105 454 454 ARG ARG B . n 
B 1 106 SER 106 455 455 SER SER B . n 
B 1 107 LYS 107 456 456 LYS LYS B . n 
B 1 108 PRO 108 457 457 PRO PRO B . n 
B 1 109 GLY 109 458 458 GLY GLY B . n 
B 1 110 GLU 110 459 459 GLU GLU B . n 
B 1 111 GLY 111 460 460 GLY GLY B . n 
B 1 112 LYS 112 461 461 LYS LYS B . n 
B 1 113 LEU 113 462 462 LEU LEU B . n 
B 1 114 ILE 114 463 463 ILE ILE B . n 
B 1 115 PHE 115 464 464 PHE PHE B . n 
B 1 116 CYS 116 465 465 CYS CYS B . n 
B 1 117 SER 117 466 466 SER SER B . n 
B 1 118 GLY 118 467 467 GLY GLY B . n 
B 1 119 LEU 119 468 468 LEU LEU B . n 
B 1 120 VAL 120 469 469 VAL VAL B . n 
B 1 121 LEU 121 470 470 LEU LEU B . n 
B 1 122 HIS 122 471 471 HIS HIS B . n 
B 1 123 ARG 123 472 472 ARG ARG B . n 
B 1 124 LEU 124 473 473 LEU LEU B . n 
B 1 125 GLN 125 474 474 GLN GLN B . n 
B 1 126 CYS 126 475 475 CYS CYS B . n 
B 1 127 ALA 127 476 476 ALA ALA B . n 
B 1 128 ARG 128 477 477 ARG ARG B . n 
B 1 129 GLY 129 478 478 GLY GLY B . n 
B 1 130 PHE 130 479 479 PHE PHE B . n 
B 1 131 GLY 131 480 480 GLY GLY B . n 
B 1 132 ASP 132 481 481 ASP ASP B . n 
B 1 133 TRP 133 482 482 TRP TRP B . n 
B 1 134 ILE 134 483 483 ILE ILE B . n 
B 1 135 ASP 135 484 484 ASP ASP B . n 
B 1 136 SER 136 485 485 SER SER B . n 
B 1 137 ILE 137 486 486 ILE ILE B . n 
B 1 138 LEU 138 487 487 LEU LEU B . n 
B 1 139 ALA 139 488 488 ALA ALA B . n 
B 1 140 PHE 140 489 489 PHE PHE B . n 
B 1 141 SER 141 490 490 SER SER B . n 
B 1 142 ARG 142 491 491 ARG ARG B . n 
B 1 143 SER 143 492 492 SER SER B . n 
B 1 144 LEU 144 493 493 LEU LEU B . n 
B 1 145 HIS 145 494 494 HIS HIS B . n 
B 1 146 SER 146 495 495 SER SER B . n 
B 1 147 LEU 147 496 496 LEU LEU B . n 
B 1 148 LEU 148 497 497 LEU LEU B . n 
B 1 149 VAL 149 498 498 VAL VAL B . n 
B 1 150 ASP 150 499 499 ASP ASP B . n 
B 1 151 VAL 151 500 500 VAL VAL B . n 
B 1 152 PRO 152 501 501 PRO PRO B . n 
B 1 153 ALA 153 502 502 ALA ALA B . n 
B 1 154 PHE 154 503 503 PHE PHE B . n 
B 1 155 ALA 155 504 504 ALA ALA B . n 
B 1 156 CYS 156 505 505 CYS CYS B . n 
B 1 157 LEU 157 506 506 LEU LEU B . n 
B 1 158 SER 158 507 507 SER SER B . n 
B 1 159 ALA 159 508 508 ALA ALA B . n 
B 1 160 LEU 160 509 509 LEU LEU B . n 
B 1 161 VAL 161 510 510 VAL VAL B . n 
B 1 162 LEU 162 511 511 LEU LEU B . n 
B 1 163 ILE 163 512 512 ILE ILE B . n 
B 1 164 THR 164 513 513 THR THR B . n 
B 1 165 ASP 165 514 514 ASP ASP B . n 
B 1 166 ARG 166 515 515 ARG ARG B . n 
B 1 167 HIS 167 516 516 HIS HIS B . n 
B 1 168 GLY 168 517 517 GLY GLY B . n 
B 1 169 LEU 169 518 518 LEU LEU B . n 
B 1 170 GLN 170 519 519 GLN GLN B . n 
B 1 171 GLU 171 520 520 GLU GLU B . n 
B 1 172 PRO 172 521 521 PRO PRO B . n 
B 1 173 ARG 173 522 522 ARG ARG B . n 
B 1 174 ARG 174 523 523 ARG ARG B . n 
B 1 175 VAL 175 524 524 VAL VAL B . n 
B 1 176 GLU 176 525 525 GLU GLU B . n 
B 1 177 GLU 177 526 526 GLU GLU B . n 
B 1 178 LEU 178 527 527 LEU LEU B . n 
B 1 179 GLN 179 528 528 GLN GLN B . n 
B 1 180 ASN 180 529 529 ASN ASN B . n 
B 1 181 ARG 181 530 530 ARG ARG B . n 
B 1 182 ILE 182 531 531 ILE ILE B . n 
B 1 183 ALA 183 532 532 ALA ALA B . n 
B 1 184 SER 184 533 533 SER SER B . n 
B 1 185 CYS 185 534 534 CYS CYS B . n 
B 1 186 LEU 186 535 535 LEU LEU B . n 
B 1 187 LYS 187 536 536 LYS LYS B . n 
B 1 188 GLU 188 537 537 GLU GLU B . n 
B 1 189 HIS 189 538 538 HIS HIS B . n 
B 1 190 VAL 190 539 539 VAL VAL B . n 
B 1 191 ALA 191 540 540 ALA ALA B . n 
B 1 192 ALA 192 541 541 ALA ALA B . n 
B 1 193 VAL 193 542 542 VAL VAL B . n 
B 1 194 ALA 194 543 ?   ?   ?   B . n 
B 1 195 GLY 195 544 ?   ?   ?   B . n 
B 1 196 GLU 196 545 ?   ?   ?   B . n 
B 1 197 PRO 197 546 ?   ?   ?   B . n 
B 1 198 GLN 198 547 ?   ?   ?   B . n 
B 1 199 PRO 199 548 ?   ?   ?   B . n 
B 1 200 ALA 200 549 ?   ?   ?   B . n 
B 1 201 SER 201 550 ?   ?   ?   B . n 
B 1 202 CYS 202 551 551 CYS CYS B . n 
B 1 203 LEU 203 552 552 LEU LEU B . n 
B 1 204 SER 204 553 553 SER SER B . n 
B 1 205 ARG 205 554 554 ARG ARG B . n 
B 1 206 LEU 206 555 555 LEU LEU B . n 
B 1 207 LEU 207 556 556 LEU LEU B . n 
B 1 208 GLY 208 557 557 GLY GLY B . n 
B 1 209 LYS 209 558 558 LYS LYS B . n 
B 1 210 LEU 210 559 559 LEU LEU B . n 
B 1 211 PRO 211 560 560 PRO PRO B . n 
B 1 212 GLU 212 561 561 GLU GLU B . n 
B 1 213 LEU 213 562 562 LEU LEU B . n 
B 1 214 ARG 214 563 563 ARG ARG B . n 
B 1 215 THR 215 564 564 THR THR B . n 
B 1 216 LEU 216 565 565 LEU LEU B . n 
B 1 217 CYS 217 566 566 CYS CYS B . n 
B 1 218 THR 218 567 567 THR THR B . n 
B 1 219 GLN 219 568 568 GLN GLN B . n 
B 1 220 GLY 220 569 569 GLY GLY B . n 
B 1 221 LEU 221 570 570 LEU LEU B . n 
B 1 222 GLN 222 571 571 GLN GLN B . n 
B 1 223 ARG 223 572 572 ARG ARG B . n 
B 1 224 ILE 224 573 573 ILE ILE B . n 
B 1 225 PHE 225 574 574 PHE PHE B . n 
B 1 226 TYR 226 575 575 TYR TYR B . n 
B 1 227 LEU 227 576 576 LEU LEU B . n 
B 1 228 LYS 228 577 577 LYS LYS B . n 
B 1 229 LEU 229 578 578 LEU LEU B . n 
B 1 230 GLU 230 579 579 GLU GLU B . n 
B 1 231 ASP 231 580 580 ASP ASP B . n 
B 1 232 LEU 232 581 581 LEU LEU B . n 
B 1 233 VAL 233 582 582 VAL VAL B . n 
B 1 234 PRO 234 583 583 PRO PRO B . n 
B 1 235 PRO 235 584 584 PRO PRO B . n 
B 1 236 PRO 236 585 585 PRO PRO B . n 
B 1 237 PRO 237 586 586 PRO PRO B . n 
B 1 238 ILE 238 587 587 ILE ILE B . n 
B 1 239 ILE 239 588 588 ILE ILE B . n 
B 1 240 ASP 240 589 589 ASP ASP B . n 
B 1 241 LYS 241 590 590 LYS LYS B . n 
B 1 242 ILE 242 591 591 ILE ILE B . n 
B 1 243 PHE 243 592 592 PHE PHE B . n 
B 1 244 MET 244 593 593 MET MET B . n 
B 1 245 ASP 245 594 594 ASP ASP B . n 
B 1 246 THR 246 595 595 THR THR B . n 
B 1 247 LEU 247 596 596 LEU LEU B . n 
B 1 248 PRO 248 597 597 PRO PRO B . n 
B 1 249 PHE 249 598 598 PHE PHE B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2880  ? 
1 MORE         -14   ? 
1 'SSA (A^2)'  21440 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-18 
2 'Structure model' 1 1 2014-03-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.7.0029 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GOL 
_pdbx_validate_close_contact.auth_seq_id_1    606 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    758 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              450 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              450 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              450 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.13 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.17 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 431 ? ? -38.82 131.45 
2 1 SER B 431 ? ? -39.02 129.93 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 350 ? A SER 1   
2  1 Y 1 A SER 351 ? A SER 2   
3  1 Y 1 A LYS 352 ? A LYS 3   
4  1 Y 1 A PRO 353 ? A PRO 4   
5  1 Y 1 A LYS 354 ? A LYS 5   
6  1 Y 1 A GLN 355 ? A GLN 6   
7  1 Y 1 A PRO 356 ? A PRO 7   
8  1 Y 1 A PRO 357 ? A PRO 8   
9  1 Y 1 A ASP 358 ? A ASP 9   
10 1 Y 1 A ALA 359 ? A ALA 10  
11 1 Y 1 A SER 360 ? A SER 11  
12 1 Y 1 A PRO 361 ? A PRO 12  
13 1 Y 1 A GLY 544 ? A GLY 195 
14 1 Y 1 A GLN 547 ? A GLN 198 
15 1 Y 1 A SER 550 ? A SER 201 
16 1 Y 1 A CYS 551 ? A CYS 202 
17 1 Y 1 B SER 350 ? B SER 1   
18 1 Y 1 B SER 351 ? B SER 2   
19 1 Y 1 B LYS 352 ? B LYS 3   
20 1 Y 1 B PRO 353 ? B PRO 4   
21 1 Y 1 B LYS 354 ? B LYS 5   
22 1 Y 1 B GLN 355 ? B GLN 6   
23 1 Y 1 B PRO 356 ? B PRO 7   
24 1 Y 1 B PRO 357 ? B PRO 8   
25 1 Y 1 B ASP 358 ? B ASP 9   
26 1 Y 1 B ALA 359 ? B ALA 10  
27 1 Y 1 B SER 360 ? B SER 11  
28 1 Y 1 B PRO 361 ? B PRO 12  
29 1 Y 1 B HIS 394 ? B HIS 45  
30 1 Y 1 B PHE 395 ? B PHE 46  
31 1 Y 1 B GLY 396 ? B GLY 47  
32 1 Y 1 B ALA 543 ? B ALA 194 
33 1 Y 1 B GLY 544 ? B GLY 195 
34 1 Y 1 B GLU 545 ? B GLU 196 
35 1 Y 1 B PRO 546 ? B PRO 197 
36 1 Y 1 B GLN 547 ? B GLN 198 
37 1 Y 1 B PRO 548 ? B PRO 199 
38 1 Y 1 B ALA 549 ? B ALA 200 
39 1 Y 1 B SER 550 ? B SER 201 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1-(3,4,5-trihydroxyphenyl)nonan-1-one' T94 
3 GLYCEROL                                GOL 
4 water                                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 T94 1   601 1   T94 T94 A . 
D 3 GOL 1   602 1   GOL GOL A . 
E 3 GOL 1   603 2   GOL GOL A . 
F 3 GOL 1   604 3   GOL GOL A . 
G 3 GOL 1   605 4   GOL GOL A . 
H 3 GOL 1   606 5   GOL GOL A . 
I 3 GOL 1   607 6   GOL GOL A . 
J 3 GOL 1   601 7   GOL GOL B . 
K 4 HOH 1   701 1   HOH HOH A . 
K 4 HOH 2   702 2   HOH HOH A . 
K 4 HOH 3   703 3   HOH HOH A . 
K 4 HOH 4   704 4   HOH HOH A . 
K 4 HOH 5   705 5   HOH HOH A . 
K 4 HOH 6   706 6   HOH HOH A . 
K 4 HOH 7   707 7   HOH HOH A . 
K 4 HOH 8   708 10  HOH HOH A . 
K 4 HOH 9   709 11  HOH HOH A . 
K 4 HOH 10  710 12  HOH HOH A . 
K 4 HOH 11  711 13  HOH HOH A . 
K 4 HOH 12  712 16  HOH HOH A . 
K 4 HOH 13  713 17  HOH HOH A . 
K 4 HOH 14  714 19  HOH HOH A . 
K 4 HOH 15  715 21  HOH HOH A . 
K 4 HOH 16  716 24  HOH HOH A . 
K 4 HOH 17  717 25  HOH HOH A . 
K 4 HOH 18  718 26  HOH HOH A . 
K 4 HOH 19  719 27  HOH HOH A . 
K 4 HOH 20  720 28  HOH HOH A . 
K 4 HOH 21  721 29  HOH HOH A . 
K 4 HOH 22  722 31  HOH HOH A . 
K 4 HOH 23  723 37  HOH HOH A . 
K 4 HOH 24  724 38  HOH HOH A . 
K 4 HOH 25  725 39  HOH HOH A . 
K 4 HOH 26  726 41  HOH HOH A . 
K 4 HOH 27  727 42  HOH HOH A . 
K 4 HOH 28  728 46  HOH HOH A . 
K 4 HOH 29  729 47  HOH HOH A . 
K 4 HOH 30  730 48  HOH HOH A . 
K 4 HOH 31  731 51  HOH HOH A . 
K 4 HOH 32  732 54  HOH HOH A . 
K 4 HOH 33  733 58  HOH HOH A . 
K 4 HOH 34  734 59  HOH HOH A . 
K 4 HOH 35  735 63  HOH HOH A . 
K 4 HOH 36  736 67  HOH HOH A . 
K 4 HOH 37  737 68  HOH HOH A . 
K 4 HOH 38  738 69  HOH HOH A . 
K 4 HOH 39  739 70  HOH HOH A . 
K 4 HOH 40  740 72  HOH HOH A . 
K 4 HOH 41  741 73  HOH HOH A . 
K 4 HOH 42  742 75  HOH HOH A . 
K 4 HOH 43  743 76  HOH HOH A . 
K 4 HOH 44  744 78  HOH HOH A . 
K 4 HOH 45  745 79  HOH HOH A . 
K 4 HOH 46  746 80  HOH HOH A . 
K 4 HOH 47  747 81  HOH HOH A . 
K 4 HOH 48  748 85  HOH HOH A . 
K 4 HOH 49  749 88  HOH HOH A . 
K 4 HOH 50  750 89  HOH HOH A . 
K 4 HOH 51  751 95  HOH HOH A . 
K 4 HOH 52  752 96  HOH HOH A . 
K 4 HOH 53  753 97  HOH HOH A . 
K 4 HOH 54  754 98  HOH HOH A . 
K 4 HOH 55  755 99  HOH HOH A . 
K 4 HOH 56  756 100 HOH HOH A . 
K 4 HOH 57  757 101 HOH HOH A . 
K 4 HOH 58  758 102 HOH HOH A . 
K 4 HOH 59  759 103 HOH HOH A . 
K 4 HOH 60  760 106 HOH HOH A . 
K 4 HOH 61  761 107 HOH HOH A . 
K 4 HOH 62  762 109 HOH HOH A . 
K 4 HOH 63  763 110 HOH HOH A . 
K 4 HOH 64  764 112 HOH HOH A . 
K 4 HOH 65  765 114 HOH HOH A . 
K 4 HOH 66  766 115 HOH HOH A . 
K 4 HOH 67  767 117 HOH HOH A . 
K 4 HOH 68  768 119 HOH HOH A . 
K 4 HOH 69  769 122 HOH HOH A . 
K 4 HOH 70  770 124 HOH HOH A . 
K 4 HOH 71  771 126 HOH HOH A . 
K 4 HOH 72  772 127 HOH HOH A . 
K 4 HOH 73  773 128 HOH HOH A . 
K 4 HOH 74  774 129 HOH HOH A . 
K 4 HOH 75  775 130 HOH HOH A . 
K 4 HOH 76  776 131 HOH HOH A . 
K 4 HOH 77  777 132 HOH HOH A . 
K 4 HOH 78  778 133 HOH HOH A . 
K 4 HOH 79  779 135 HOH HOH A . 
K 4 HOH 80  780 136 HOH HOH A . 
K 4 HOH 81  781 140 HOH HOH A . 
K 4 HOH 82  782 142 HOH HOH A . 
K 4 HOH 83  783 143 HOH HOH A . 
K 4 HOH 84  784 144 HOH HOH A . 
K 4 HOH 85  785 151 HOH HOH A . 
K 4 HOH 86  786 154 HOH HOH A . 
K 4 HOH 87  787 155 HOH HOH A . 
K 4 HOH 88  788 157 HOH HOH A . 
K 4 HOH 89  789 162 HOH HOH A . 
K 4 HOH 90  790 166 HOH HOH A . 
K 4 HOH 91  791 168 HOH HOH A . 
K 4 HOH 92  792 169 HOH HOH A . 
K 4 HOH 93  793 171 HOH HOH A . 
K 4 HOH 94  794 172 HOH HOH A . 
K 4 HOH 95  795 175 HOH HOH A . 
K 4 HOH 96  796 176 HOH HOH A . 
K 4 HOH 97  797 178 HOH HOH A . 
K 4 HOH 98  798 179 HOH HOH A . 
K 4 HOH 99  799 180 HOH HOH A . 
K 4 HOH 100 800 182 HOH HOH A . 
K 4 HOH 101 801 183 HOH HOH A . 
K 4 HOH 102 802 186 HOH HOH A . 
K 4 HOH 103 803 187 HOH HOH A . 
K 4 HOH 104 804 189 HOH HOH A . 
K 4 HOH 105 805 190 HOH HOH A . 
K 4 HOH 106 806 193 HOH HOH A . 
K 4 HOH 107 807 195 HOH HOH A . 
K 4 HOH 108 808 197 HOH HOH A . 
K 4 HOH 109 809 198 HOH HOH A . 
K 4 HOH 110 810 199 HOH HOH A . 
K 4 HOH 111 811 200 HOH HOH A . 
K 4 HOH 112 812 201 HOH HOH A . 
K 4 HOH 113 813 204 HOH HOH A . 
K 4 HOH 114 814 205 HOH HOH A . 
K 4 HOH 115 815 206 HOH HOH A . 
K 4 HOH 116 816 207 HOH HOH A . 
K 4 HOH 117 817 208 HOH HOH A . 
K 4 HOH 118 818 210 HOH HOH A . 
K 4 HOH 119 819 211 HOH HOH A . 
K 4 HOH 120 820 212 HOH HOH A . 
K 4 HOH 121 821 213 HOH HOH A . 
K 4 HOH 122 822 214 HOH HOH A . 
K 4 HOH 123 823 215 HOH HOH A . 
L 4 HOH 1   701 8   HOH HOH B . 
L 4 HOH 2   702 9   HOH HOH B . 
L 4 HOH 3   703 14  HOH HOH B . 
L 4 HOH 4   704 15  HOH HOH B . 
L 4 HOH 5   705 18  HOH HOH B . 
L 4 HOH 6   706 20  HOH HOH B . 
L 4 HOH 7   707 22  HOH HOH B . 
L 4 HOH 8   708 23  HOH HOH B . 
L 4 HOH 9   709 30  HOH HOH B . 
L 4 HOH 10  710 32  HOH HOH B . 
L 4 HOH 11  711 33  HOH HOH B . 
L 4 HOH 12  712 34  HOH HOH B . 
L 4 HOH 13  713 35  HOH HOH B . 
L 4 HOH 14  714 36  HOH HOH B . 
L 4 HOH 15  715 40  HOH HOH B . 
L 4 HOH 16  716 43  HOH HOH B . 
L 4 HOH 17  717 44  HOH HOH B . 
L 4 HOH 18  718 45  HOH HOH B . 
L 4 HOH 19  719 49  HOH HOH B . 
L 4 HOH 20  720 50  HOH HOH B . 
L 4 HOH 21  721 52  HOH HOH B . 
L 4 HOH 22  722 55  HOH HOH B . 
L 4 HOH 23  723 56  HOH HOH B . 
L 4 HOH 24  724 57  HOH HOH B . 
L 4 HOH 25  725 60  HOH HOH B . 
L 4 HOH 26  726 61  HOH HOH B . 
L 4 HOH 27  727 62  HOH HOH B . 
L 4 HOH 28  728 64  HOH HOH B . 
L 4 HOH 29  729 65  HOH HOH B . 
L 4 HOH 30  730 66  HOH HOH B . 
L 4 HOH 31  731 71  HOH HOH B . 
L 4 HOH 32  732 74  HOH HOH B . 
L 4 HOH 33  733 77  HOH HOH B . 
L 4 HOH 34  734 82  HOH HOH B . 
L 4 HOH 35  735 83  HOH HOH B . 
L 4 HOH 36  736 84  HOH HOH B . 
L 4 HOH 37  737 86  HOH HOH B . 
L 4 HOH 38  738 87  HOH HOH B . 
L 4 HOH 39  739 90  HOH HOH B . 
L 4 HOH 40  740 91  HOH HOH B . 
L 4 HOH 41  741 92  HOH HOH B . 
L 4 HOH 42  742 93  HOH HOH B . 
L 4 HOH 43  743 94  HOH HOH B . 
L 4 HOH 44  744 104 HOH HOH B . 
L 4 HOH 45  745 105 HOH HOH B . 
L 4 HOH 46  746 108 HOH HOH B . 
L 4 HOH 47  747 111 HOH HOH B . 
L 4 HOH 48  748 113 HOH HOH B . 
L 4 HOH 49  749 116 HOH HOH B . 
L 4 HOH 50  750 118 HOH HOH B . 
L 4 HOH 51  751 120 HOH HOH B . 
L 4 HOH 52  752 121 HOH HOH B . 
L 4 HOH 53  753 123 HOH HOH B . 
L 4 HOH 54  754 125 HOH HOH B . 
L 4 HOH 55  755 134 HOH HOH B . 
L 4 HOH 56  756 137 HOH HOH B . 
L 4 HOH 57  757 138 HOH HOH B . 
L 4 HOH 58  758 139 HOH HOH B . 
L 4 HOH 59  759 141 HOH HOH B . 
L 4 HOH 60  760 145 HOH HOH B . 
L 4 HOH 61  761 146 HOH HOH B . 
L 4 HOH 62  762 147 HOH HOH B . 
L 4 HOH 63  763 148 HOH HOH B . 
L 4 HOH 64  764 149 HOH HOH B . 
L 4 HOH 65  765 150 HOH HOH B . 
L 4 HOH 66  766 152 HOH HOH B . 
L 4 HOH 67  767 153 HOH HOH B . 
L 4 HOH 68  768 156 HOH HOH B . 
L 4 HOH 69  769 158 HOH HOH B . 
L 4 HOH 70  770 159 HOH HOH B . 
L 4 HOH 71  771 160 HOH HOH B . 
L 4 HOH 72  772 161 HOH HOH B . 
L 4 HOH 73  773 163 HOH HOH B . 
L 4 HOH 74  774 164 HOH HOH B . 
L 4 HOH 75  775 165 HOH HOH B . 
L 4 HOH 76  776 167 HOH HOH B . 
L 4 HOH 77  777 170 HOH HOH B . 
L 4 HOH 78  778 173 HOH HOH B . 
L 4 HOH 79  779 174 HOH HOH B . 
L 4 HOH 80  780 177 HOH HOH B . 
L 4 HOH 81  781 181 HOH HOH B . 
L 4 HOH 82  782 184 HOH HOH B . 
L 4 HOH 83  783 185 HOH HOH B . 
L 4 HOH 84  784 188 HOH HOH B . 
L 4 HOH 85  785 191 HOH HOH B . 
L 4 HOH 86  786 192 HOH HOH B . 
L 4 HOH 87  787 196 HOH HOH B . 
L 4 HOH 88  788 202 HOH HOH B . 
L 4 HOH 89  789 203 HOH HOH B . 
L 4 HOH 90  790 209 HOH HOH B . 
L 4 HOH 91  791 216 HOH HOH B . 
L 4 HOH 92  792 217 HOH HOH B . 
L 4 HOH 93  793 218 HOH HOH B . 
#