data_4JU5
# 
_entry.id   4JU5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4JU5         
RCSB  RCSB078507   
WWPDB D_1000078507 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4JU5 
_pdbx_database_status.recvd_initial_deposition_date   2013-03-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bastos-Aristizabal, S.' 1 
'Kozlov, G.'             2 
'Gehring, K.'            3 
# 
_citation.id                        primary 
_citation.title                     'Structural insight into the dimerization of human protein disulfide isomerase.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            23 
_citation.page_first                618 
_citation.page_last                 626 
_citation.year                      2014 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24549644 
_citation.pdbx_database_id_DOI      10.1002/pro.2444 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bastos-Aristizabal, S.' 1 ? 
primary 'Kozlov, G.'             2 ? 
primary 'Gehring, K.'            3 ? 
# 
_cell.entry_id           4JU5 
_cell.length_a           40.521 
_cell.length_b           45.718 
_cell.length_c           55.149 
_cell.angle_alpha        81.85 
_cell.angle_beta         92.15 
_cell.angle_gamma        80.02 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4JU5 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein disulfide-isomerase' 26835.256 2  5.3.4.1 ? 
;bb' domain
;
? 
2 water   nat water                         18.015    67 ?       ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PDI, Cellular thyroid hormone-binding protein, Prolyl 4-hydroxylase subunit beta, p55' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKF
DEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFI
FIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKF
DEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFI
FIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   PRO n 
1 7   ALA n 
1 8   ALA n 
1 9   THR n 
1 10  THR n 
1 11  LEU n 
1 12  PRO n 
1 13  ASP n 
1 14  GLY n 
1 15  ALA n 
1 16  ALA n 
1 17  ALA n 
1 18  GLU n 
1 19  SER n 
1 20  LEU n 
1 21  VAL n 
1 22  GLU n 
1 23  SER n 
1 24  SER n 
1 25  GLU n 
1 26  VAL n 
1 27  ALA n 
1 28  VAL n 
1 29  ILE n 
1 30  GLY n 
1 31  PHE n 
1 32  PHE n 
1 33  LYS n 
1 34  ASP n 
1 35  VAL n 
1 36  GLU n 
1 37  SER n 
1 38  ASP n 
1 39  SER n 
1 40  ALA n 
1 41  LYS n 
1 42  GLN n 
1 43  PHE n 
1 44  LEU n 
1 45  GLN n 
1 46  ALA n 
1 47  ALA n 
1 48  GLU n 
1 49  ALA n 
1 50  ILE n 
1 51  ASP n 
1 52  ASP n 
1 53  ILE n 
1 54  PRO n 
1 55  PHE n 
1 56  GLY n 
1 57  ILE n 
1 58  THR n 
1 59  SER n 
1 60  ASN n 
1 61  SER n 
1 62  ASP n 
1 63  VAL n 
1 64  PHE n 
1 65  SER n 
1 66  LYS n 
1 67  TYR n 
1 68  GLN n 
1 69  LEU n 
1 70  ASP n 
1 71  LYS n 
1 72  ASP n 
1 73  GLY n 
1 74  VAL n 
1 75  VAL n 
1 76  LEU n 
1 77  PHE n 
1 78  LYS n 
1 79  LYS n 
1 80  PHE n 
1 81  ASP n 
1 82  GLU n 
1 83  GLY n 
1 84  ARG n 
1 85  ASN n 
1 86  ASN n 
1 87  PHE n 
1 88  GLU n 
1 89  GLY n 
1 90  GLU n 
1 91  VAL n 
1 92  THR n 
1 93  LYS n 
1 94  GLU n 
1 95  ASN n 
1 96  LEU n 
1 97  LEU n 
1 98  ASP n 
1 99  PHE n 
1 100 ILE n 
1 101 LYS n 
1 102 HIS n 
1 103 ASN n 
1 104 GLN n 
1 105 LEU n 
1 106 PRO n 
1 107 LEU n 
1 108 VAL n 
1 109 ILE n 
1 110 GLU n 
1 111 PHE n 
1 112 THR n 
1 113 GLU n 
1 114 GLN n 
1 115 THR n 
1 116 ALA n 
1 117 PRO n 
1 118 LYS n 
1 119 ILE n 
1 120 PHE n 
1 121 GLY n 
1 122 GLY n 
1 123 GLU n 
1 124 ILE n 
1 125 LYS n 
1 126 THR n 
1 127 HIS n 
1 128 ILE n 
1 129 LEU n 
1 130 LEU n 
1 131 PHE n 
1 132 LEU n 
1 133 PRO n 
1 134 LYS n 
1 135 SER n 
1 136 VAL n 
1 137 SER n 
1 138 ASP n 
1 139 TYR n 
1 140 ASP n 
1 141 GLY n 
1 142 LYS n 
1 143 LEU n 
1 144 SER n 
1 145 ASN n 
1 146 PHE n 
1 147 LYS n 
1 148 THR n 
1 149 ALA n 
1 150 ALA n 
1 151 GLU n 
1 152 SER n 
1 153 PHE n 
1 154 LYS n 
1 155 GLY n 
1 156 LYS n 
1 157 ILE n 
1 158 LEU n 
1 159 PHE n 
1 160 ILE n 
1 161 PHE n 
1 162 ILE n 
1 163 ASP n 
1 164 SER n 
1 165 ASP n 
1 166 HIS n 
1 167 THR n 
1 168 ASP n 
1 169 ASN n 
1 170 GLN n 
1 171 ARG n 
1 172 ILE n 
1 173 LEU n 
1 174 GLU n 
1 175 PHE n 
1 176 PHE n 
1 177 GLY n 
1 178 LEU n 
1 179 LYS n 
1 180 LYS n 
1 181 GLU n 
1 182 GLU n 
1 183 CYS n 
1 184 PRO n 
1 185 ALA n 
1 186 VAL n 
1 187 ARG n 
1 188 LEU n 
1 189 ILE n 
1 190 THR n 
1 191 LEU n 
1 192 GLU n 
1 193 GLU n 
1 194 GLU n 
1 195 MET n 
1 196 THR n 
1 197 LYS n 
1 198 TYR n 
1 199 LYS n 
1 200 PRO n 
1 201 GLU n 
1 202 SER n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 THR n 
1 207 ALA n 
1 208 GLU n 
1 209 ARG n 
1 210 ILE n 
1 211 THR n 
1 212 GLU n 
1 213 PHE n 
1 214 CYS n 
1 215 HIS n 
1 216 ARG n 
1 217 PHE n 
1 218 LEU n 
1 219 GLU n 
1 220 GLY n 
1 221 LYS n 
1 222 ILE n 
1 223 LYS n 
1 224 PRO n 
1 225 HIS n 
1 226 LEU n 
1 227 MET n 
1 228 SER n 
1 229 GLN n 
1 230 GLU n 
1 231 LEU n 
1 232 PRO n 
1 233 GLU n 
1 234 ASP n 
1 235 TRP n 
1 236 ASP n 
1 237 LYS n 
1 238 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'P4HB, ERBA2L, PDI, PDIA1, PO4DB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDIA1_HUMAN 
_struct_ref.pdbx_db_accession          P07237 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRN
NFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSD
HTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQ
;
_struct_ref.pdbx_align_begin           135 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4JU5 A 6 ? 238 ? P07237 135 ? 367 ? 135 367 
2 1 4JU5 B 6 ? 238 ? P07237 135 ? 367 ? 135 367 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4JU5 GLY A 1 ? UNP P07237 ? ? 'EXPRESSION TAG' 130 1  
1 4JU5 PRO A 2 ? UNP P07237 ? ? 'EXPRESSION TAG' 131 2  
1 4JU5 LEU A 3 ? UNP P07237 ? ? 'EXPRESSION TAG' 132 3  
1 4JU5 GLY A 4 ? UNP P07237 ? ? 'EXPRESSION TAG' 133 4  
1 4JU5 SER A 5 ? UNP P07237 ? ? 'EXPRESSION TAG' 134 5  
2 4JU5 GLY B 1 ? UNP P07237 ? ? 'EXPRESSION TAG' 130 6  
2 4JU5 PRO B 2 ? UNP P07237 ? ? 'EXPRESSION TAG' 131 7  
2 4JU5 LEU B 3 ? UNP P07237 ? ? 'EXPRESSION TAG' 132 8  
2 4JU5 GLY B 4 ? UNP P07237 ? ? 'EXPRESSION TAG' 133 9  
2 4JU5 SER B 5 ? UNP P07237 ? ? 'EXPRESSION TAG' 134 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4JU5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.85 
_exptl_crystal.density_percent_sol   33.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;25% (w/v) polyethylene glycol 1500, 25 mM sodium malonate, 37.5 mM imidazole, 37.5 mM boric acid, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-11-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.7433 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.7433 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4JU5 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             500 
_reflns.d_resolution_high            2.28 
_reflns.number_obs                   15880 
_reflns.number_all                   17110 
_reflns.percent_possible_obs         92.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        23.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.28 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   92.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.403 
_reflns_shell.meanI_over_sigI_obs    5.4 
_reflns_shell.pdbx_redundancy        7.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4JU5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     15714 
_refine.ls_number_reflns_all                     17110 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.55 
_refine.ls_d_res_high                            2.28 
_refine.ls_percent_reflns_obs                    94.60 
_refine.ls_R_factor_obs                          0.24533 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24297 
_refine.ls_R_factor_R_free                       0.28982 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  836 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.930 
_refine.correlation_coeff_Fo_to_Fc_free          0.903 
_refine.B_iso_mean                               41.020 
_refine.aniso_B[1][1]                            2.03 
_refine.aniso_B[2][2]                            -1.97 
_refine.aniso_B[3][3]                            0.20 
_refine.aniso_B[1][2]                            1.88 
_refine.aniso_B[1][3]                            0.17 
_refine.aniso_B[2][3]                            -1.05 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entries 3bj5, 3ec3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.556 
_refine.pdbx_overall_ESU_R_Free                  0.305 
_refine.overall_SU_ML                            0.216 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.950 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3034 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             67 
_refine_hist.number_atoms_total               3101 
_refine_hist.d_res_high                       2.28 
_refine_hist.d_res_low                        44.55 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.019  ? 3090 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.070  1.957  ? 4180 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.758  5.000  ? 393  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.844 25.683 ? 139  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.328 15.000 ? 512  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.433 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 486  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 2322 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 202 0.18 0.05 'interatomic distance' 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 202 0.18 0.05 'interatomic distance' 1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.28 
_refine_ls_shell.d_res_low                        2.342 
_refine_ls_shell.number_reflns_R_work             995 
_refine_ls_shell.R_factor_R_work                  0.390 
_refine_ls_shell.percent_reflns_obs               81.99 
_refine_ls_shell.R_factor_R_free                  0.468 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 136 A 347 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 136 B 347 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4JU5 
_struct.title                     
;Crystal structure of the dimeric form of the bb' domains of human protein disulfide isomerase
;
_struct.pdbx_descriptor           'Protein disulfide-isomerase (E.C.5.3.4.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4JU5 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'thioredoxin-like fold, disulfide isomerase, chaperone, Isomerase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 13  ? SER A 23  ? ASP A 142 SER A 152 1 ? 11 
HELX_P HELX_P2  2  SER A 37  ? ILE A 50  ? SER A 166 ILE A 179 1 ? 14 
HELX_P HELX_P3  3  ASN A 60  ? TYR A 67  ? ASN A 189 TYR A 196 1 ? 8  
HELX_P HELX_P4  4  THR A 92  ? GLN A 104 ? THR A 221 GLN A 233 1 ? 13 
HELX_P HELX_P5  5  THR A 115 ? GLY A 122 ? THR A 244 GLY A 251 1 ? 8  
HELX_P HELX_P6  6  ASP A 138 ? PHE A 153 ? ASP A 267 PHE A 282 1 ? 16 
HELX_P HELX_P7  7  HIS A 166 ? ASP A 168 ? HIS A 295 ASP A 297 5 ? 3  
HELX_P HELX_P8  8  ASN A 169 ? PHE A 176 ? ASN A 298 PHE A 305 1 ? 8  
HELX_P HELX_P9  9  LYS A 179 ? CYS A 183 ? LYS A 308 CYS A 312 5 ? 5  
HELX_P HELX_P10 10 ALA A 207 ? HIS A 215 ? ALA A 336 HIS A 344 1 ? 9  
HELX_P HELX_P11 11 ASP B 13  ? SER B 23  ? ASP B 142 SER B 152 1 ? 11 
HELX_P HELX_P12 12 SER B 37  ? ALA B 49  ? SER B 166 ALA B 178 1 ? 13 
HELX_P HELX_P13 13 ASN B 60  ? TYR B 67  ? ASN B 189 TYR B 196 1 ? 8  
HELX_P HELX_P14 14 THR B 92  ? GLN B 104 ? THR B 221 GLN B 233 1 ? 13 
HELX_P HELX_P15 15 THR B 115 ? GLY B 121 ? THR B 244 GLY B 250 1 ? 7  
HELX_P HELX_P16 16 ASP B 138 ? SER B 152 ? ASP B 267 SER B 281 1 ? 15 
HELX_P HELX_P17 17 HIS B 166 ? ASP B 168 ? HIS B 295 ASP B 297 5 ? 3  
HELX_P HELX_P18 18 ASN B 169 ? PHE B 176 ? ASN B 298 PHE B 305 1 ? 8  
HELX_P HELX_P19 19 LYS B 179 ? CYS B 183 ? LYS B 308 CYS B 312 5 ? 5  
HELX_P HELX_P20 20 ARG B 209 ? LEU B 218 ? ARG B 338 LEU B 347 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 CYS 183 A . ? CYS 312 A PRO 184 A ? PRO 313 A 1 1.26 
2 CYS 183 B . ? CYS 312 B PRO 184 B ? PRO 313 B 1 1.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 8 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? parallel      
B 7 8 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 9   ? THR A 10  ? THR A 138 THR A 139 
A 2 PHE A 55  ? THR A 58  ? PHE A 184 THR A 187 
A 3 VAL A 26  ? PHE A 31  ? VAL A 155 PHE A 160 
A 4 GLY A 73  ? LYS A 78  ? GLY A 202 LYS A 207 
A 5 ARG A 84  ? ASN A 86  ? ARG A 213 ASN A 215 
B 1 VAL A 108 ? GLU A 110 ? VAL A 237 GLU A 239 
B 2 LEU A 158 ? ILE A 162 ? LEU A 287 ILE A 291 
B 3 THR A 126 ? PHE A 131 ? THR A 255 PHE A 260 
B 4 ALA A 185 ? GLU A 192 ? ALA A 314 GLU A 321 
B 5 ALA B 185 ? LEU B 191 ? ALA B 314 LEU B 320 
B 6 THR B 126 ? PHE B 131 ? THR B 255 PHE B 260 
B 7 ILE B 157 ? ILE B 162 ? ILE B 286 ILE B 291 
B 8 VAL B 108 ? GLU B 110 ? VAL B 237 GLU B 239 
C 1 THR B 9   ? THR B 10  ? THR B 138 THR B 139 
C 2 PHE B 55  ? THR B 58  ? PHE B 184 THR B 187 
C 3 VAL B 26  ? PHE B 31  ? VAL B 155 PHE B 160 
C 4 GLY B 73  ? LYS B 78  ? GLY B 202 LYS B 207 
C 5 ARG B 84  ? ASN B 86  ? ARG B 213 ASN B 215 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 9   ? N THR A 138 O PHE A 55  ? O PHE A 184 
A 2 3 O GLY A 56  ? O GLY A 185 N GLY A 30  ? N GLY A 159 
A 3 4 N ALA A 27  ? N ALA A 156 O PHE A 77  ? O PHE A 206 
A 4 5 N LEU A 76  ? N LEU A 205 O ASN A 85  ? O ASN A 214 
B 1 2 N ILE A 109 ? N ILE A 238 O PHE A 161 ? O PHE A 290 
B 2 3 O ILE A 160 ? O ILE A 289 N LEU A 130 ? N LEU A 259 
B 3 4 N LEU A 129 ? N LEU A 258 O ARG A 187 ? O ARG A 316 
B 4 5 N THR A 190 ? N THR A 319 O THR B 190 ? O THR B 319 
B 5 6 O ILE B 189 ? O ILE B 318 N HIS B 127 ? N HIS B 256 
B 6 7 N LEU B 130 ? N LEU B 259 O ILE B 162 ? O ILE B 291 
B 7 8 O PHE B 159 ? O PHE B 288 N ILE B 109 ? N ILE B 238 
C 1 2 N THR B 9   ? N THR B 138 O PHE B 55  ? O PHE B 184 
C 2 3 O GLY B 56  ? O GLY B 185 N GLY B 30  ? N GLY B 159 
C 3 4 N ALA B 27  ? N ALA B 156 O PHE B 77  ? O PHE B 206 
C 4 5 N LEU B 76  ? N LEU B 205 O ASN B 85  ? O ASN B 214 
# 
_database_PDB_matrix.entry_id          4JU5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4JU5 
_atom_sites.fract_transf_matrix[1][1]   0.024679 
_atom_sites.fract_transf_matrix[1][2]   -0.004343 
_atom_sites.fract_transf_matrix[1][3]   0.001599 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022209 
_atom_sites.fract_transf_matrix[2][3]   -0.003384 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018355 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 7   ? -18.548 16.170  -14.213 1.00 39.19 ? 136 ALA A N   1 
ATOM   2    C CA  . ALA A 1 7   ? -18.858 15.595  -12.870 1.00 41.46 ? 136 ALA A CA  1 
ATOM   3    C C   . ALA A 1 7   ? -17.996 14.359  -12.614 1.00 41.30 ? 136 ALA A C   1 
ATOM   4    O O   . ALA A 1 7   ? -17.293 14.274  -11.610 1.00 39.53 ? 136 ALA A O   1 
ATOM   5    C CB  . ALA A 1 7   ? -20.339 15.251  -12.769 1.00 42.36 ? 136 ALA A CB  1 
ATOM   6    N N   . ALA A 1 8   ? -18.069 13.408  -13.540 1.00 42.33 ? 137 ALA A N   1 
ATOM   7    C CA  . ALA A 1 8   ? -17.220 12.227  -13.543 1.00 43.79 ? 137 ALA A CA  1 
ATOM   8    C C   . ALA A 1 8   ? -17.068 11.765  -14.984 1.00 44.86 ? 137 ALA A C   1 
ATOM   9    O O   . ALA A 1 8   ? -18.057 11.675  -15.718 1.00 46.16 ? 137 ALA A O   1 
ATOM   10   C CB  . ALA A 1 8   ? -17.823 11.123  -12.687 1.00 43.35 ? 137 ALA A CB  1 
ATOM   11   N N   . THR A 1 9   ? -15.829 11.477  -15.381 1.00 44.93 ? 138 THR A N   1 
ATOM   12   C CA  . THR A 1 9   ? -15.522 11.058  -16.748 1.00 44.30 ? 138 THR A CA  1 
ATOM   13   C C   . THR A 1 9   ? -15.986 9.619   -16.991 1.00 43.96 ? 138 THR A C   1 
ATOM   14   O O   . THR A 1 9   ? -15.729 8.726   -16.177 1.00 43.73 ? 138 THR A O   1 
ATOM   15   C CB  . THR A 1 9   ? -14.010 11.202  -17.078 1.00 45.01 ? 138 THR A CB  1 
ATOM   16   O OG1 . THR A 1 9   ? -13.324 9.976   -16.799 1.00 46.57 ? 138 THR A OG1 1 
ATOM   17   C CG2 . THR A 1 9   ? -13.364 12.336  -16.274 1.00 42.67 ? 138 THR A CG2 1 
ATOM   18   N N   . THR A 1 10  ? -16.678 9.403   -18.107 1.00 45.16 ? 139 THR A N   1 
ATOM   19   C CA  . THR A 1 10  ? -17.133 8.066   -18.482 1.00 46.45 ? 139 THR A CA  1 
ATOM   20   C C   . THR A 1 10  ? -15.944 7.194   -18.898 1.00 47.53 ? 139 THR A C   1 
ATOM   21   O O   . THR A 1 10  ? -15.028 7.662   -19.581 1.00 49.48 ? 139 THR A O   1 
ATOM   22   C CB  . THR A 1 10  ? -18.230 8.106   -19.576 1.00 47.00 ? 139 THR A CB  1 
ATOM   23   O OG1 . THR A 1 10  ? -18.809 6.806   -19.730 1.00 45.95 ? 139 THR A OG1 1 
ATOM   24   C CG2 . THR A 1 10  ? -17.679 8.577   -20.927 1.00 48.67 ? 139 THR A CG2 1 
ATOM   25   N N   . LEU A 1 11  ? -15.949 5.939   -18.453 1.00 47.10 ? 140 LEU A N   1 
ATOM   26   C CA  . LEU A 1 11  ? -14.868 5.000   -18.765 1.00 45.45 ? 140 LEU A CA  1 
ATOM   27   C C   . LEU A 1 11  ? -15.422 3.773   -19.494 1.00 44.87 ? 140 LEU A C   1 
ATOM   28   O O   . LEU A 1 11  ? -16.025 2.906   -18.862 1.00 46.44 ? 140 LEU A O   1 
ATOM   29   C CB  . LEU A 1 11  ? -14.127 4.571   -17.488 1.00 44.28 ? 140 LEU A CB  1 
ATOM   30   C CG  . LEU A 1 11  ? -13.713 5.613   -16.441 1.00 43.67 ? 140 LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 11  ? -13.313 4.930   -15.145 1.00 42.61 ? 140 LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 11  ? -12.592 6.513   -16.940 1.00 42.56 ? 140 LEU A CD2 1 
ATOM   33   N N   . PRO A 1 12  ? -15.231 3.701   -20.829 1.00 45.15 ? 141 PRO A N   1 
ATOM   34   C CA  . PRO A 1 12  ? -15.744 2.570   -21.624 1.00 43.65 ? 141 PRO A CA  1 
ATOM   35   C C   . PRO A 1 12  ? -14.885 1.300   -21.579 1.00 43.48 ? 141 PRO A C   1 
ATOM   36   O O   . PRO A 1 12  ? -15.401 0.201   -21.800 1.00 43.33 ? 141 PRO A O   1 
ATOM   37   C CB  . PRO A 1 12  ? -15.773 3.130   -23.047 1.00 43.74 ? 141 PRO A CB  1 
ATOM   38   C CG  . PRO A 1 12  ? -14.700 4.166   -23.065 1.00 44.03 ? 141 PRO A CG  1 
ATOM   39   C CD  . PRO A 1 12  ? -14.653 4.759   -21.681 1.00 44.36 ? 141 PRO A CD  1 
ATOM   40   N N   . ASP A 1 13  ? -13.590 1.451   -21.309 1.00 43.10 ? 142 ASP A N   1 
ATOM   41   C CA  . ASP A 1 13  ? -12.664 0.313   -21.325 1.00 42.39 ? 142 ASP A CA  1 
ATOM   42   C C   . ASP A 1 13  ? -11.675 0.321   -20.157 1.00 40.43 ? 142 ASP A C   1 
ATOM   43   O O   . ASP A 1 13  ? -11.583 1.306   -19.413 1.00 38.06 ? 142 ASP A O   1 
ATOM   44   C CB  . ASP A 1 13  ? -11.920 0.221   -22.675 1.00 43.27 ? 142 ASP A CB  1 
ATOM   45   C CG  . ASP A 1 13  ? -11.230 1.527   -23.073 1.00 45.00 ? 142 ASP A CG  1 
ATOM   46   O OD1 . ASP A 1 13  ? -10.768 2.279   -22.189 1.00 44.81 ? 142 ASP A OD1 1 
ATOM   47   O OD2 . ASP A 1 13  ? -11.137 1.797   -24.292 1.00 47.89 ? 142 ASP A OD2 1 
ATOM   48   N N   . GLY A 1 14  ? -10.940 -0.786  -20.017 1.00 39.83 ? 143 GLY A N   1 
ATOM   49   C CA  . GLY A 1 14  ? -9.907  -0.931  -18.990 1.00 39.97 ? 143 GLY A CA  1 
ATOM   50   C C   . GLY A 1 14  ? -8.804  0.111   -19.074 1.00 40.39 ? 143 GLY A C   1 
ATOM   51   O O   . GLY A 1 14  ? -8.253  0.522   -18.050 1.00 40.13 ? 143 GLY A O   1 
ATOM   52   N N   . ALA A 1 15  ? -8.502  0.549   -20.295 1.00 41.36 ? 144 ALA A N   1 
ATOM   53   C CA  . ALA A 1 15  ? -7.412  1.491   -20.550 1.00 41.90 ? 144 ALA A CA  1 
ATOM   54   C C   . ALA A 1 15  ? -7.701  2.889   -20.007 1.00 43.02 ? 144 ALA A C   1 
ATOM   55   O O   . ALA A 1 15  ? -6.827  3.521   -19.413 1.00 45.31 ? 144 ALA A O   1 
ATOM   56   C CB  . ALA A 1 15  ? -7.107  1.549   -22.039 1.00 43.33 ? 144 ALA A CB  1 
ATOM   57   N N   . ALA A 1 16  ? -8.926  3.369   -20.217 1.00 44.32 ? 145 ALA A N   1 
ATOM   58   C CA  . ALA A 1 16  ? -9.357  4.664   -19.685 1.00 44.74 ? 145 ALA A CA  1 
ATOM   59   C C   . ALA A 1 16  ? -9.363  4.644   -18.160 1.00 44.78 ? 145 ALA A C   1 
ATOM   60   O O   . ALA A 1 16  ? -8.980  5.629   -17.517 1.00 47.50 ? 145 ALA A O   1 
ATOM   61   C CB  . ALA A 1 16  ? -10.735 5.028   -20.215 1.00 44.75 ? 145 ALA A CB  1 
ATOM   62   N N   . ALA A 1 17  ? -9.796  3.517   -17.591 1.00 41.91 ? 146 ALA A N   1 
ATOM   63   C CA  . ALA A 1 17  ? -9.836  3.335   -16.143 1.00 40.28 ? 146 ALA A CA  1 
ATOM   64   C C   . ALA A 1 17  ? -8.445  3.491   -15.543 1.00 39.50 ? 146 ALA A C   1 
ATOM   65   O O   . ALA A 1 17  ? -8.252  4.309   -14.644 1.00 39.04 ? 146 ALA A O   1 
ATOM   66   C CB  . ALA A 1 17  ? -10.438 1.983   -15.785 1.00 39.04 ? 146 ALA A CB  1 
ATOM   67   N N   . GLU A 1 18  ? -7.473  2.740   -16.063 1.00 40.84 ? 147 GLU A N   1 
ATOM   68   C CA  . GLU A 1 18  ? -6.096  2.806   -15.548 1.00 41.79 ? 147 GLU A CA  1 
ATOM   69   C C   . GLU A 1 18  ? -5.505  4.202   -15.675 1.00 40.93 ? 147 GLU A C   1 
ATOM   70   O O   . GLU A 1 18  ? -4.865  4.683   -14.743 1.00 41.91 ? 147 GLU A O   1 
ATOM   71   C CB  . GLU A 1 18  ? -5.181  1.779   -16.217 1.00 43.52 ? 147 GLU A CB  1 
ATOM   72   C CG  . GLU A 1 18  ? -5.701  0.357   -16.163 1.00 46.51 ? 147 GLU A CG  1 
ATOM   73   C CD  . GLU A 1 18  ? -4.607  -0.679  -16.325 1.00 49.82 ? 147 GLU A CD  1 
ATOM   74   O OE1 . GLU A 1 18  ? -3.966  -1.026  -15.310 1.00 49.68 ? 147 GLU A OE1 1 
ATOM   75   O OE2 . GLU A 1 18  ? -4.407  -1.164  -17.462 1.00 51.58 ? 147 GLU A OE2 1 
ATOM   76   N N   . SER A 1 19  ? -5.740  4.850   -16.818 1.00 42.33 ? 148 SER A N   1 
ATOM   77   C CA  . SER A 1 19  ? -5.319  6.238   -17.041 1.00 42.64 ? 148 SER A CA  1 
ATOM   78   C C   . SER A 1 19  ? -5.828  7.161   -15.938 1.00 43.41 ? 148 SER A C   1 
ATOM   79   O O   . SER A 1 19  ? -5.073  7.978   -15.401 1.00 45.08 ? 148 SER A O   1 
ATOM   80   C CB  . SER A 1 19  ? -5.811  6.743   -18.400 1.00 43.51 ? 148 SER A CB  1 
ATOM   81   O OG  . SER A 1 19  ? -5.135  6.106   -19.468 1.00 44.10 ? 148 SER A OG  1 
ATOM   82   N N   . LEU A 1 20  ? -7.111  7.011   -15.604 1.00 42.66 ? 149 LEU A N   1 
ATOM   83   C CA  . LEU A 1 20  ? -7.763  7.807   -14.569 1.00 41.26 ? 149 LEU A CA  1 
ATOM   84   C C   . LEU A 1 20  ? -7.161  7.542   -13.192 1.00 40.95 ? 149 LEU A C   1 
ATOM   85   O O   . LEU A 1 20  ? -6.902  8.477   -12.438 1.00 41.64 ? 149 LEU A O   1 
ATOM   86   C CB  . LEU A 1 20  ? -9.279  7.541   -14.566 1.00 41.00 ? 149 LEU A CB  1 
ATOM   87   C CG  . LEU A 1 20  ? -10.224 8.300   -13.619 1.00 41.05 ? 149 LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 20  ? -10.318 7.647   -12.241 1.00 39.64 ? 149 LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 20  ? -9.858  9.776   -13.506 1.00 41.00 ? 149 LEU A CD2 1 
ATOM   90   N N   . VAL A 1 21  ? -6.954  6.267   -12.872 1.00 41.43 ? 150 VAL A N   1 
ATOM   91   C CA  . VAL A 1 21  ? -6.362  5.860   -11.595 1.00 41.54 ? 150 VAL A CA  1 
ATOM   92   C C   . VAL A 1 21  ? -4.946  6.418   -11.472 1.00 43.01 ? 150 VAL A C   1 
ATOM   93   O O   . VAL A 1 21  ? -4.544  6.908   -10.410 1.00 43.64 ? 150 VAL A O   1 
ATOM   94   C CB  . VAL A 1 21  ? -6.356  4.319   -11.441 1.00 38.93 ? 150 VAL A CB  1 
ATOM   95   C CG1 . VAL A 1 21  ? -5.562  3.891   -10.216 1.00 37.67 ? 150 VAL A CG1 1 
ATOM   96   C CG2 . VAL A 1 21  ? -7.779  3.783   -11.365 1.00 39.30 ? 150 VAL A CG2 1 
ATOM   97   N N   . GLU A 1 22  ? -4.206  6.352   -12.575 1.00 47.23 ? 151 GLU A N   1 
ATOM   98   C CA  . GLU A 1 22  ? -2.821  6.821   -12.614 1.00 52.39 ? 151 GLU A CA  1 
ATOM   99   C C   . GLU A 1 22  ? -2.682  8.341   -12.676 1.00 52.22 ? 151 GLU A C   1 
ATOM   100  O O   . GLU A 1 22  ? -1.594  8.875   -12.462 1.00 51.48 ? 151 GLU A O   1 
ATOM   101  C CB  . GLU A 1 22  ? -2.073  6.171   -13.780 1.00 54.08 ? 151 GLU A CB  1 
ATOM   102  C CG  . GLU A 1 22  ? -1.549  4.784   -13.454 1.00 58.02 ? 151 GLU A CG  1 
ATOM   103  C CD  . GLU A 1 22  ? -0.476  4.816   -12.384 1.00 60.48 ? 151 GLU A CD  1 
ATOM   104  O OE1 . GLU A 1 22  ? 0.637   5.303   -12.678 1.00 63.11 ? 151 GLU A OE1 1 
ATOM   105  O OE2 . GLU A 1 22  ? -0.747  4.357   -11.252 1.00 62.46 ? 151 GLU A OE2 1 
ATOM   106  N N   . SER A 1 23  ? -3.789  9.028   -12.949 1.00 52.64 ? 152 SER A N   1 
ATOM   107  C CA  . SER A 1 23  ? -3.781  10.475  -13.145 1.00 52.47 ? 152 SER A CA  1 
ATOM   108  C C   . SER A 1 23  ? -3.675  11.290  -11.855 1.00 51.15 ? 152 SER A C   1 
ATOM   109  O O   . SER A 1 23  ? -3.373  12.487  -11.899 1.00 52.80 ? 152 SER A O   1 
ATOM   110  C CB  . SER A 1 23  ? -5.022  10.909  -13.926 1.00 53.92 ? 152 SER A CB  1 
ATOM   111  O OG  . SER A 1 23  ? -5.079  12.321  -14.032 1.00 55.42 ? 152 SER A OG  1 
ATOM   112  N N   . SER A 1 24  ? -3.928  10.659  -10.712 1.00 50.01 ? 153 SER A N   1 
ATOM   113  C CA  . SER A 1 24  ? -3.934  11.383  -9.444  1.00 46.69 ? 153 SER A CA  1 
ATOM   114  C C   . SER A 1 24  ? -3.390  10.555  -8.285  1.00 47.17 ? 153 SER A C   1 
ATOM   115  O O   . SER A 1 24  ? -3.258  9.326   -8.382  1.00 46.97 ? 153 SER A O   1 
ATOM   116  C CB  . SER A 1 24  ? -5.354  11.877  -9.132  1.00 48.21 ? 153 SER A CB  1 
ATOM   117  O OG  . SER A 1 24  ? -5.417  12.615  -7.915  1.00 48.15 ? 153 SER A OG  1 
ATOM   118  N N   . GLU A 1 25  ? -3.068  11.248  -7.194  1.00 46.41 ? 154 GLU A N   1 
ATOM   119  C CA  . GLU A 1 25  ? -2.717  10.611  -5.931  1.00 46.55 ? 154 GLU A CA  1 
ATOM   120  C C   . GLU A 1 25  ? -3.871  9.748   -5.434  1.00 47.16 ? 154 GLU A C   1 
ATOM   121  O O   . GLU A 1 25  ? -3.655  8.630   -4.960  1.00 47.94 ? 154 GLU A O   1 
ATOM   122  C CB  . GLU A 1 25  ? -2.364  11.665  -4.874  1.00 46.78 ? 154 GLU A CB  1 
ATOM   123  C CG  . GLU A 1 25  ? -1.049  12.386  -5.131  1.00 47.18 ? 154 GLU A CG  1 
ATOM   124  C CD  . GLU A 1 25  ? 0.122   11.429  -5.238  1.00 46.23 ? 154 GLU A CD  1 
ATOM   125  O OE1 . GLU A 1 25  ? 0.637   11.242  -6.358  1.00 45.78 ? 154 GLU A OE1 1 
ATOM   126  O OE2 . GLU A 1 25  ? 0.511   10.847  -4.205  1.00 47.40 ? 154 GLU A OE2 1 
ATOM   127  N N   . VAL A 1 26  ? -5.086  10.290  -5.546  1.00 45.18 ? 155 VAL A N   1 
ATOM   128  C CA  . VAL A 1 26  ? -6.321  9.614   -5.157  1.00 42.46 ? 155 VAL A CA  1 
ATOM   129  C C   . VAL A 1 26  ? -7.345  9.739   -6.286  1.00 41.70 ? 155 VAL A C   1 
ATOM   130  O O   . VAL A 1 26  ? -7.636  10.845  -6.743  1.00 41.26 ? 155 VAL A O   1 
ATOM   131  C CB  . VAL A 1 26  ? -6.914  10.198  -3.856  1.00 42.52 ? 155 VAL A CB  1 
ATOM   132  C CG1 . VAL A 1 26  ? -8.217  9.496   -3.491  1.00 42.93 ? 155 VAL A CG1 1 
ATOM   133  C CG2 . VAL A 1 26  ? -5.923  10.086  -2.708  1.00 41.63 ? 155 VAL A CG2 1 
ATOM   134  N N   . ALA A 1 27  ? -7.864  8.598   -6.739  1.00 38.50 ? 156 ALA A N   1 
ATOM   135  C CA  . ALA A 1 27  ? -8.937  8.554   -7.727  1.00 35.63 ? 156 ALA A CA  1 
ATOM   136  C C   . ALA A 1 27  ? -10.105 7.689   -7.226  1.00 35.15 ? 156 ALA A C   1 
ATOM   137  O O   . ALA A 1 27  ? -9.922  6.786   -6.406  1.00 34.59 ? 156 ALA A O   1 
ATOM   138  C CB  . ALA A 1 27  ? -8.413  8.028   -9.053  1.00 35.08 ? 156 ALA A CB  1 
ATOM   139  N N   . VAL A 1 28  ? -11.303 7.979   -7.720  1.00 33.32 ? 157 VAL A N   1 
ATOM   140  C CA  . VAL A 1 28  ? -12.509 7.246   -7.326  1.00 31.88 ? 157 VAL A CA  1 
ATOM   141  C C   . VAL A 1 28  ? -13.248 6.782   -8.579  1.00 30.15 ? 157 VAL A C   1 
ATOM   142  O O   . VAL A 1 28  ? -13.440 7.564   -9.508  1.00 29.72 ? 157 VAL A O   1 
ATOM   143  C CB  . VAL A 1 28  ? -13.426 8.113   -6.433  1.00 31.46 ? 157 VAL A CB  1 
ATOM   144  C CG1 . VAL A 1 28  ? -14.773 7.446   -6.199  1.00 31.12 ? 157 VAL A CG1 1 
ATOM   145  C CG2 . VAL A 1 28  ? -12.746 8.398   -5.102  1.00 31.58 ? 157 VAL A CG2 1 
ATOM   146  N N   . ILE A 1 29  ? -13.624 5.504   -8.616  1.00 28.88 ? 158 ILE A N   1 
ATOM   147  C CA  . ILE A 1 29  ? -14.412 4.968   -9.729  1.00 27.58 ? 158 ILE A CA  1 
ATOM   148  C C   . ILE A 1 29  ? -15.757 4.442   -9.238  1.00 26.45 ? 158 ILE A C   1 
ATOM   149  O O   . ILE A 1 29  ? -15.816 3.645   -8.303  1.00 24.85 ? 158 ILE A O   1 
ATOM   150  C CB  . ILE A 1 29  ? -13.676 3.853   -10.508 1.00 27.94 ? 158 ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 29  ? -12.330 4.354   -11.055 1.00 28.92 ? 158 ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 29  ? -14.546 3.341   -11.652 1.00 29.22 ? 158 ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 29  ? -11.579 3.345   -11.906 1.00 27.66 ? 158 ILE A CD1 1 
ATOM   154  N N   . GLY A 1 30  ? -16.830 4.897   -9.880  1.00 25.96 ? 159 GLY A N   1 
ATOM   155  C CA  . GLY A 1 30  ? -18.165 4.370   -9.630  1.00 25.46 ? 159 GLY A CA  1 
ATOM   156  C C   . GLY A 1 30  ? -18.523 3.325   -10.672 1.00 26.17 ? 159 GLY A C   1 
ATOM   157  O O   . GLY A 1 30  ? -18.466 3.590   -11.877 1.00 25.37 ? 159 GLY A O   1 
ATOM   158  N N   . PHE A 1 31  ? -18.884 2.134   -10.204 1.00 25.79 ? 160 PHE A N   1 
ATOM   159  C CA  . PHE A 1 31  ? -19.203 1.013   -11.078 1.00 26.15 ? 160 PHE A CA  1 
ATOM   160  C C   . PHE A 1 31  ? -20.705 0.796   -11.068 1.00 27.66 ? 160 PHE A C   1 
ATOM   161  O O   . PHE A 1 31  ? -21.237 0.217   -10.119 1.00 27.51 ? 160 PHE A O   1 
ATOM   162  C CB  . PHE A 1 31  ? -18.524 -0.269  -10.584 1.00 25.46 ? 160 PHE A CB  1 
ATOM   163  C CG  . PHE A 1 31  ? -17.022 -0.215  -10.576 1.00 25.61 ? 160 PHE A CG  1 
ATOM   164  C CD1 . PHE A 1 31  ? -16.335 0.414   -9.538  1.00 25.58 ? 160 PHE A CD1 1 
ATOM   165  C CD2 . PHE A 1 31  ? -16.292 -0.832  -11.583 1.00 25.22 ? 160 PHE A CD2 1 
ATOM   166  C CE1 . PHE A 1 31  ? -14.954 0.446   -9.527  1.00 25.61 ? 160 PHE A CE1 1 
ATOM   167  C CE2 . PHE A 1 31  ? -14.905 -0.806  -11.574 1.00 25.68 ? 160 PHE A CE2 1 
ATOM   168  C CZ  . PHE A 1 31  ? -14.237 -0.163  -10.548 1.00 25.50 ? 160 PHE A CZ  1 
ATOM   169  N N   . PHE A 1 32  ? -21.384 1.263   -12.115 1.00 29.07 ? 161 PHE A N   1 
ATOM   170  C CA  . PHE A 1 32  ? -22.843 1.174   -12.192 1.00 31.39 ? 161 PHE A CA  1 
ATOM   171  C C   . PHE A 1 32  ? -23.297 0.758   -13.585 1.00 32.88 ? 161 PHE A C   1 
ATOM   172  O O   . PHE A 1 32  ? -23.015 1.457   -14.563 1.00 33.02 ? 161 PHE A O   1 
ATOM   173  C CB  . PHE A 1 32  ? -23.498 2.515   -11.797 1.00 31.40 ? 161 PHE A CB  1 
ATOM   174  C CG  . PHE A 1 32  ? -23.186 2.953   -10.390 1.00 30.72 ? 161 PHE A CG  1 
ATOM   175  C CD1 . PHE A 1 32  ? -22.167 3.868   -10.144 1.00 30.58 ? 161 PHE A CD1 1 
ATOM   176  C CD2 . PHE A 1 32  ? -23.895 2.436   -9.313  1.00 30.35 ? 161 PHE A CD2 1 
ATOM   177  C CE1 . PHE A 1 32  ? -21.863 4.260   -8.849  1.00 30.71 ? 161 PHE A CE1 1 
ATOM   178  C CE2 . PHE A 1 32  ? -23.598 2.827   -8.017  1.00 30.40 ? 161 PHE A CE2 1 
ATOM   179  C CZ  . PHE A 1 32  ? -22.581 3.738   -7.784  1.00 30.71 ? 161 PHE A CZ  1 
ATOM   180  N N   . LYS A 1 33  ? -23.990 -0.379  -13.669 1.00 33.17 ? 162 LYS A N   1 
ATOM   181  C CA  . LYS A 1 33  ? -24.587 -0.842  -14.927 1.00 36.20 ? 162 LYS A CA  1 
ATOM   182  C C   . LYS A 1 33  ? -25.433 0.239   -15.598 1.00 36.10 ? 162 LYS A C   1 
ATOM   183  O O   . LYS A 1 33  ? -25.279 0.501   -16.790 1.00 37.78 ? 162 LYS A O   1 
ATOM   184  C CB  . LYS A 1 33  ? -25.438 -2.102  -14.705 1.00 37.14 ? 162 LYS A CB  1 
ATOM   185  C CG  . LYS A 1 33  ? -24.815 -3.401  -15.201 1.00 39.20 ? 162 LYS A CG  1 
ATOM   186  C CD  . LYS A 1 33  ? -23.584 -3.818  -14.409 1.00 41.01 ? 162 LYS A CD  1 
ATOM   187  C CE  . LYS A 1 33  ? -22.862 -4.972  -15.097 1.00 42.97 ? 162 LYS A CE  1 
ATOM   188  N NZ  . LYS A 1 33  ? -21.627 -5.390  -14.375 1.00 43.80 ? 162 LYS A NZ  1 
ATOM   189  N N   . ASP A 1 34  ? -26.316 0.860   -14.818 1.00 36.62 ? 163 ASP A N   1 
ATOM   190  C CA  . ASP A 1 34  ? -27.196 1.917   -15.301 1.00 36.14 ? 163 ASP A CA  1 
ATOM   191  C C   . ASP A 1 34  ? -26.751 3.267   -14.740 1.00 37.23 ? 163 ASP A C   1 
ATOM   192  O O   . ASP A 1 34  ? -26.801 3.499   -13.528 1.00 35.83 ? 163 ASP A O   1 
ATOM   193  C CB  . ASP A 1 34  ? -28.648 1.609   -14.921 1.00 36.28 ? 163 ASP A CB  1 
ATOM   194  C CG  . ASP A 1 34  ? -29.638 2.655   -15.436 1.00 36.84 ? 163 ASP A CG  1 
ATOM   195  O OD1 . ASP A 1 34  ? -30.854 2.448   -15.236 1.00 37.55 ? 163 ASP A OD1 1 
ATOM   196  O OD2 . ASP A 1 34  ? -29.220 3.676   -16.029 1.00 36.85 ? 163 ASP A OD2 1 
ATOM   197  N N   . VAL A 1 35  ? -26.335 4.144   -15.653 1.00 39.23 ? 164 VAL A N   1 
ATOM   198  C CA  . VAL A 1 35  ? -25.785 5.475   -15.361 1.00 41.23 ? 164 VAL A CA  1 
ATOM   199  C C   . VAL A 1 35  ? -26.767 6.427   -14.652 1.00 42.04 ? 164 VAL A C   1 
ATOM   200  O O   . VAL A 1 35  ? -26.349 7.311   -13.904 1.00 43.29 ? 164 VAL A O   1 
ATOM   201  C CB  . VAL A 1 35  ? -25.204 6.106   -16.664 1.00 42.83 ? 164 VAL A CB  1 
ATOM   202  C CG1 . VAL A 1 35  ? -25.199 7.634   -16.633 1.00 42.56 ? 164 VAL A CG1 1 
ATOM   203  C CG2 . VAL A 1 35  ? -23.804 5.561   -16.940 1.00 42.34 ? 164 VAL A CG2 1 
ATOM   204  N N   . GLU A 1 36  ? -28.065 6.253   -14.882 1.00 42.72 ? 165 GLU A N   1 
ATOM   205  C CA  . GLU A 1 36  ? -29.061 7.093   -14.209 1.00 42.36 ? 165 GLU A CA  1 
ATOM   206  C C   . GLU A 1 36  ? -29.949 6.350   -13.209 1.00 40.52 ? 165 GLU A C   1 
ATOM   207  O O   . GLU A 1 36  ? -31.100 6.732   -12.999 1.00 42.79 ? 165 GLU A O   1 
ATOM   208  C CB  . GLU A 1 36  ? -29.910 7.908   -15.201 1.00 44.88 ? 165 GLU A CB  1 
ATOM   209  C CG  . GLU A 1 36  ? -30.393 7.161   -16.433 1.00 47.55 ? 165 GLU A CG  1 
ATOM   210  C CD  . GLU A 1 36  ? -29.671 7.594   -17.692 1.00 49.28 ? 165 GLU A CD  1 
ATOM   211  O OE1 . GLU A 1 36  ? -30.292 7.546   -18.772 1.00 52.35 ? 165 GLU A OE1 1 
ATOM   212  O OE2 . GLU A 1 36  ? -28.490 7.997   -17.607 1.00 50.76 ? 165 GLU A OE2 1 
ATOM   213  N N   . SER A 1 37  ? -29.411 5.296   -12.594 1.00 37.19 ? 166 SER A N   1 
ATOM   214  C CA  . SER A 1 37  ? -30.052 4.684   -11.429 1.00 34.56 ? 166 SER A CA  1 
ATOM   215  C C   . SER A 1 37  ? -29.857 5.598   -10.217 1.00 33.84 ? 166 SER A C   1 
ATOM   216  O O   . SER A 1 37  ? -28.993 6.489   -10.237 1.00 32.91 ? 166 SER A O   1 
ATOM   217  C CB  . SER A 1 37  ? -29.493 3.282   -11.151 1.00 33.91 ? 166 SER A CB  1 
ATOM   218  O OG  . SER A 1 37  ? -28.189 3.315   -10.581 1.00 32.39 ? 166 SER A OG  1 
ATOM   219  N N   . ASP A 1 38  ? -30.656 5.373   -9.174  1.00 32.50 ? 167 ASP A N   1 
ATOM   220  C CA  . ASP A 1 38  ? -30.593 6.162   -7.938  1.00 32.78 ? 167 ASP A CA  1 
ATOM   221  C C   . ASP A 1 38  ? -29.178 6.228   -7.352  1.00 32.09 ? 167 ASP A C   1 
ATOM   222  O O   . ASP A 1 38  ? -28.694 7.305   -6.974  1.00 29.82 ? 167 ASP A O   1 
ATOM   223  C CB  . ASP A 1 38  ? -31.569 5.606   -6.887  1.00 33.16 ? 167 ASP A CB  1 
ATOM   224  C CG  . ASP A 1 38  ? -33.034 5.960   -7.178  1.00 33.70 ? 167 ASP A CG  1 
ATOM   225  O OD1 . ASP A 1 38  ? -33.877 5.736   -6.283  1.00 33.23 ? 167 ASP A OD1 1 
ATOM   226  O OD2 . ASP A 1 38  ? -33.351 6.461   -8.283  1.00 33.65 ? 167 ASP A OD2 1 
ATOM   227  N N   . SER A 1 39  ? -28.529 5.066   -7.285  1.00 32.32 ? 168 SER A N   1 
ATOM   228  C CA  . SER A 1 39  ? -27.179 4.944   -6.750  1.00 31.41 ? 168 SER A CA  1 
ATOM   229  C C   . SER A 1 39  ? -26.172 5.707   -7.610  1.00 30.99 ? 168 SER A C   1 
ATOM   230  O O   . SER A 1 39  ? -25.350 6.459   -7.091  1.00 29.70 ? 168 SER A O   1 
ATOM   231  C CB  . SER A 1 39  ? -26.788 3.468   -6.631  1.00 32.01 ? 168 SER A CB  1 
ATOM   232  O OG  . SER A 1 39  ? -27.591 2.800   -5.670  1.00 32.67 ? 168 SER A OG  1 
ATOM   233  N N   . ALA A 1 40  ? -26.255 5.522   -8.924  1.00 31.67 ? 169 ALA A N   1 
ATOM   234  C CA  . ALA A 1 40  ? -25.396 6.244   -9.863  1.00 32.38 ? 169 ALA A CA  1 
ATOM   235  C C   . ALA A 1 40  ? -25.603 7.755   -9.751  1.00 33.26 ? 169 ALA A C   1 
ATOM   236  O O   . ALA A 1 40  ? -24.640 8.525   -9.807  1.00 33.24 ? 169 ALA A O   1 
ATOM   237  C CB  . ALA A 1 40  ? -25.645 5.769   -11.283 1.00 32.17 ? 169 ALA A CB  1 
ATOM   238  N N   . LYS A 1 41  ? -26.860 8.165   -9.575  1.00 34.13 ? 170 LYS A N   1 
ATOM   239  C CA  . LYS A 1 41  ? -27.201 9.573   -9.371  1.00 35.25 ? 170 LYS A CA  1 
ATOM   240  C C   . LYS A 1 41  ? -26.592 10.140  -8.083  1.00 35.03 ? 170 LYS A C   1 
ATOM   241  O O   . LYS A 1 41  ? -26.019 11.227  -8.103  1.00 34.47 ? 170 LYS A O   1 
ATOM   242  C CB  . LYS A 1 41  ? -28.718 9.778   -9.401  1.00 36.21 ? 170 LYS A CB  1 
ATOM   243  C CG  . LYS A 1 41  ? -29.261 10.061  -10.795 1.00 38.50 ? 170 LYS A CG  1 
ATOM   244  C CD  . LYS A 1 41  ? -30.785 10.113  -10.807 1.00 39.39 ? 170 LYS A CD  1 
ATOM   245  C CE  . LYS A 1 41  ? -31.319 10.932  -11.976 1.00 41.96 ? 170 LYS A CE  1 
ATOM   246  N NZ  . LYS A 1 41  ? -30.685 10.594  -13.289 1.00 42.37 ? 170 LYS A NZ  1 
ATOM   247  N N   . GLN A 1 42  ? -26.705 9.393   -6.981  1.00 34.52 ? 171 GLN A N   1 
ATOM   248  C CA  . GLN A 1 42  ? -26.085 9.771   -5.701  1.00 33.97 ? 171 GLN A CA  1 
ATOM   249  C C   . GLN A 1 42  ? -24.574 9.958   -5.831  1.00 33.98 ? 171 GLN A C   1 
ATOM   250  O O   . GLN A 1 42  ? -24.016 10.934  -5.315  1.00 33.75 ? 171 GLN A O   1 
ATOM   251  C CB  . GLN A 1 42  ? -26.388 8.731   -4.611  1.00 33.92 ? 171 GLN A CB  1 
ATOM   252  C CG  . GLN A 1 42  ? -27.830 8.726   -4.118  1.00 33.82 ? 171 GLN A CG  1 
ATOM   253  C CD  . GLN A 1 42  ? -28.316 10.107  -3.720  1.00 34.99 ? 171 GLN A CD  1 
ATOM   254  O OE1 . GLN A 1 42  ? -27.797 10.723  -2.782  1.00 35.75 ? 171 GLN A OE1 1 
ATOM   255  N NE2 . GLN A 1 42  ? -29.312 10.607  -4.440  1.00 34.47 ? 171 GLN A NE2 1 
ATOM   256  N N   . PHE A 1 43  ? -23.931 9.017   -6.526  1.00 33.51 ? 172 PHE A N   1 
ATOM   257  C CA  . PHE A 1 43  ? -22.485 9.016   -6.744  1.00 33.26 ? 172 PHE A CA  1 
ATOM   258  C C   . PHE A 1 43  ? -22.024 10.257  -7.506  1.00 34.42 ? 172 PHE A C   1 
ATOM   259  O O   . PHE A 1 43  ? -21.086 10.934  -7.084  1.00 35.73 ? 172 PHE A O   1 
ATOM   260  C CB  . PHE A 1 43  ? -22.054 7.717   -7.451  1.00 32.61 ? 172 PHE A CB  1 
ATOM   261  C CG  . PHE A 1 43  ? -20.692 7.785   -8.096  1.00 32.05 ? 172 PHE A CG  1 
ATOM   262  C CD1 . PHE A 1 43  ? -19.535 7.614   -7.340  1.00 30.91 ? 172 PHE A CD1 1 
ATOM   263  C CD2 . PHE A 1 43  ? -20.569 8.006   -9.471  1.00 31.41 ? 172 PHE A CD2 1 
ATOM   264  C CE1 . PHE A 1 43  ? -18.285 7.675   -7.940  1.00 30.69 ? 172 PHE A CE1 1 
ATOM   265  C CE2 . PHE A 1 43  ? -19.320 8.069   -10.074 1.00 30.71 ? 172 PHE A CE2 1 
ATOM   266  C CZ  . PHE A 1 43  ? -18.177 7.902   -9.305  1.00 30.76 ? 172 PHE A CZ  1 
ATOM   267  N N   . LEU A 1 44  ? -22.694 10.557  -8.616  1.00 35.86 ? 173 LEU A N   1 
ATOM   268  C CA  . LEU A 1 44  ? -22.391 11.757  -9.402  1.00 38.36 ? 173 LEU A CA  1 
ATOM   269  C C   . LEU A 1 44  ? -22.520 13.051  -8.589  1.00 39.53 ? 173 LEU A C   1 
ATOM   270  O O   . LEU A 1 44  ? -21.749 13.989  -8.791  1.00 40.53 ? 173 LEU A O   1 
ATOM   271  C CB  . LEU A 1 44  ? -23.253 11.809  -10.666 1.00 38.22 ? 173 LEU A CB  1 
ATOM   272  C CG  . LEU A 1 44  ? -22.944 10.692  -11.670 1.00 37.62 ? 173 LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 44  ? -24.028 10.573  -12.729 1.00 37.12 ? 173 LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 44  ? -21.577 10.900  -12.304 1.00 37.82 ? 173 LEU A CD2 1 
ATOM   275  N N   . GLN A 1 45  ? -23.478 13.079  -7.662  1.00 40.08 ? 174 GLN A N   1 
ATOM   276  C CA  . GLN A 1 45  ? -23.636 14.194  -6.728  1.00 40.92 ? 174 GLN A CA  1 
ATOM   277  C C   . GLN A 1 45  ? -22.488 14.287  -5.709  1.00 41.41 ? 174 GLN A C   1 
ATOM   278  O O   . GLN A 1 45  ? -22.056 15.390  -5.359  1.00 40.48 ? 174 GLN A O   1 
ATOM   279  C CB  . GLN A 1 45  ? -24.990 14.119  -6.013  1.00 41.64 ? 174 GLN A CB  1 
ATOM   280  C CG  . GLN A 1 45  ? -26.183 14.434  -6.904  1.00 42.95 ? 174 GLN A CG  1 
ATOM   281  C CD  . GLN A 1 45  ? -27.495 14.531  -6.140  1.00 45.63 ? 174 GLN A CD  1 
ATOM   282  O OE1 . GLN A 1 45  ? -28.560 14.197  -6.670  1.00 44.62 ? 174 GLN A OE1 1 
ATOM   283  N NE2 . GLN A 1 45  ? -27.428 14.991  -4.887  1.00 46.24 ? 174 GLN A NE2 1 
ATOM   284  N N   . ALA A 1 46  ? -22.004 13.137  -5.234  1.00 40.77 ? 175 ALA A N   1 
ATOM   285  C CA  . ALA A 1 46  ? -20.818 13.099  -4.375  1.00 40.00 ? 175 ALA A CA  1 
ATOM   286  C C   . ALA A 1 46  ? -19.582 13.553  -5.157  1.00 41.64 ? 175 ALA A C   1 
ATOM   287  O O   . ALA A 1 46  ? -18.709 14.235  -4.613  1.00 40.47 ? 175 ALA A O   1 
ATOM   288  C CB  . ALA A 1 46  ? -20.605 11.710  -3.788  1.00 39.15 ? 175 ALA A CB  1 
ATOM   289  N N   . ALA A 1 47  ? -19.533 13.181  -6.437  1.00 43.36 ? 176 ALA A N   1 
ATOM   290  C CA  . ALA A 1 47  ? -18.447 13.562  -7.343  1.00 44.97 ? 176 ALA A CA  1 
ATOM   291  C C   . ALA A 1 47  ? -18.375 15.078  -7.537  1.00 46.99 ? 176 ALA A C   1 
ATOM   292  O O   . ALA A 1 47  ? -17.288 15.648  -7.640  1.00 49.45 ? 176 ALA A O   1 
ATOM   293  C CB  . ALA A 1 47  ? -18.609 12.859  -8.683  1.00 43.26 ? 176 ALA A CB  1 
ATOM   294  N N   . GLU A 1 48  ? -19.536 15.724  -7.574  1.00 49.64 ? 177 GLU A N   1 
ATOM   295  C CA  . GLU A 1 48  ? -19.610 17.177  -7.733  1.00 52.34 ? 177 GLU A CA  1 
ATOM   296  C C   . GLU A 1 48  ? -19.229 17.933  -6.449  1.00 52.35 ? 177 GLU A C   1 
ATOM   297  O O   . GLU A 1 48  ? -18.827 19.096  -6.509  1.00 53.45 ? 177 GLU A O   1 
ATOM   298  C CB  . GLU A 1 48  ? -20.997 17.590  -8.251  1.00 54.35 ? 177 GLU A CB  1 
ATOM   299  C CG  . GLU A 1 48  ? -21.195 17.315  -9.742  1.00 56.96 ? 177 GLU A CG  1 
ATOM   300  C CD  . GLU A 1 48  ? -22.656 17.151  -10.159 1.00 58.49 ? 177 GLU A CD  1 
ATOM   301  O OE1 . GLU A 1 48  ? -23.374 16.314  -9.567  1.00 58.76 ? 177 GLU A OE1 1 
ATOM   302  O OE2 . GLU A 1 48  ? -23.086 17.844  -11.105 1.00 57.64 ? 177 GLU A OE2 1 
ATOM   303  N N   . ALA A 1 49  ? -19.319 17.255  -5.305  1.00 51.84 ? 178 ALA A N   1 
ATOM   304  C CA  . ALA A 1 49  ? -19.078 17.866  -3.994  1.00 52.14 ? 178 ALA A CA  1 
ATOM   305  C C   . ALA A 1 49  ? -17.614 17.853  -3.535  1.00 54.45 ? 178 ALA A C   1 
ATOM   306  O O   . ALA A 1 49  ? -17.271 18.488  -2.532  1.00 54.61 ? 178 ALA A O   1 
ATOM   307  C CB  . ALA A 1 49  ? -19.964 17.211  -2.942  1.00 50.98 ? 178 ALA A CB  1 
ATOM   308  N N   . ILE A 1 50  ? -16.758 17.127  -4.252  1.00 55.41 ? 179 ILE A N   1 
ATOM   309  C CA  . ILE A 1 50  ? -15.334 17.052  -3.902  1.00 56.79 ? 179 ILE A CA  1 
ATOM   310  C C   . ILE A 1 50  ? -14.450 17.526  -5.059  1.00 58.97 ? 179 ILE A C   1 
ATOM   311  O O   . ILE A 1 50  ? -14.443 16.936  -6.140  1.00 59.12 ? 179 ILE A O   1 
ATOM   312  C CB  . ILE A 1 50  ? -14.942 15.648  -3.377  1.00 55.41 ? 179 ILE A CB  1 
ATOM   313  C CG1 . ILE A 1 50  ? -15.364 15.519  -1.908  1.00 54.18 ? 179 ILE A CG1 1 
ATOM   314  C CG2 . ILE A 1 50  ? -13.445 15.400  -3.519  1.00 55.00 ? 179 ILE A CG2 1 
ATOM   315  C CD1 . ILE A 1 50  ? -15.195 14.139  -1.310  1.00 54.32 ? 179 ILE A CD1 1 
ATOM   316  N N   . ASP A 1 51  ? -13.724 18.614  -4.820  1.00 63.10 ? 180 ASP A N   1 
ATOM   317  C CA  . ASP A 1 51  ? -12.920 19.263  -5.857  1.00 66.15 ? 180 ASP A CA  1 
ATOM   318  C C   . ASP A 1 51  ? -11.526 18.654  -5.979  1.00 65.26 ? 180 ASP A C   1 
ATOM   319  O O   . ASP A 1 51  ? -10.875 18.781  -7.017  1.00 64.69 ? 180 ASP A O   1 
ATOM   320  C CB  . ASP A 1 51  ? -12.815 20.768  -5.580  1.00 68.31 ? 180 ASP A CB  1 
ATOM   321  C CG  . ASP A 1 51  ? -14.164 21.475  -5.647  1.00 70.33 ? 180 ASP A CG  1 
ATOM   322  O OD1 . ASP A 1 51  ? -14.794 21.471  -6.728  1.00 71.02 ? 180 ASP A OD1 1 
ATOM   323  O OD2 . ASP A 1 51  ? -14.590 22.044  -4.618  1.00 70.59 ? 180 ASP A OD2 1 
ATOM   324  N N   . ASP A 1 52  ? -11.095 17.973  -4.919  1.00 65.83 ? 181 ASP A N   1 
ATOM   325  C CA  . ASP A 1 52  ? -9.714  17.517  -4.764  1.00 65.52 ? 181 ASP A CA  1 
ATOM   326  C C   . ASP A 1 52  ? -9.319  16.303  -5.610  1.00 63.08 ? 181 ASP A C   1 
ATOM   327  O O   . ASP A 1 52  ? -8.147  16.159  -5.975  1.00 63.08 ? 181 ASP A O   1 
ATOM   328  C CB  . ASP A 1 52  ? -9.429  17.224  -3.287  1.00 68.18 ? 181 ASP A CB  1 
ATOM   329  C CG  . ASP A 1 52  ? -9.610  18.445  -2.402  1.00 71.64 ? 181 ASP A CG  1 
ATOM   330  O OD1 . ASP A 1 52  ? -8.979  19.490  -2.681  1.00 73.67 ? 181 ASP A OD1 1 
ATOM   331  O OD2 . ASP A 1 52  ? -10.374 18.356  -1.419  1.00 71.81 ? 181 ASP A OD2 1 
ATOM   332  N N   . ILE A 1 53  ? -10.281 15.430  -5.907  1.00 57.73 ? 182 ILE A N   1 
ATOM   333  C CA  . ILE A 1 53  ? -9.978  14.157  -6.573  1.00 52.44 ? 182 ILE A CA  1 
ATOM   334  C C   . ILE A 1 53  ? -10.837 13.910  -7.824  1.00 48.86 ? 182 ILE A C   1 
ATOM   335  O O   . ILE A 1 53  ? -12.006 14.294  -7.855  1.00 48.67 ? 182 ILE A O   1 
ATOM   336  C CB  . ILE A 1 53  ? -10.053 12.959  -5.587  1.00 53.07 ? 182 ILE A CB  1 
ATOM   337  C CG1 . ILE A 1 53  ? -11.496 12.638  -5.196  1.00 53.44 ? 182 ILE A CG1 1 
ATOM   338  C CG2 . ILE A 1 53  ? -9.212  13.222  -4.340  1.00 55.16 ? 182 ILE A CG2 1 
ATOM   339  C CD1 . ILE A 1 53  ? -11.615 11.541  -4.164  1.00 54.56 ? 182 ILE A CD1 1 
ATOM   340  N N   . PRO A 1 54  ? -10.250 13.285  -8.868  1.00 46.10 ? 183 PRO A N   1 
ATOM   341  C CA  . PRO A 1 54  ? -11.005 12.938  -10.083 1.00 44.92 ? 183 PRO A CA  1 
ATOM   342  C C   . PRO A 1 54  ? -11.890 11.692  -9.941  1.00 43.73 ? 183 PRO A C   1 
ATOM   343  O O   . PRO A 1 54  ? -11.541 10.743  -9.226  1.00 42.97 ? 183 PRO A O   1 
ATOM   344  C CB  . PRO A 1 54  ? -9.910  12.694  -11.121 1.00 43.91 ? 183 PRO A CB  1 
ATOM   345  C CG  . PRO A 1 54  ? -8.734  12.256  -10.321 1.00 45.16 ? 183 PRO A CG  1 
ATOM   346  C CD  . PRO A 1 54  ? -8.811  13.002  -9.019  1.00 44.74 ? 183 PRO A CD  1 
ATOM   347  N N   . PHE A 1 55  ? -13.019 11.709  -10.643 1.00 40.86 ? 184 PHE A N   1 
ATOM   348  C CA  . PHE A 1 55  ? -14.022 10.657  -10.551 1.00 38.00 ? 184 PHE A CA  1 
ATOM   349  C C   . PHE A 1 55  ? -14.269 10.025  -11.908 1.00 36.71 ? 184 PHE A C   1 
ATOM   350  O O   . PHE A 1 55  ? -14.344 10.721  -12.928 1.00 37.68 ? 184 PHE A O   1 
ATOM   351  C CB  . PHE A 1 55  ? -15.341 11.222  -10.024 1.00 36.96 ? 184 PHE A CB  1 
ATOM   352  C CG  . PHE A 1 55  ? -15.346 11.502  -8.552  1.00 35.96 ? 184 PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 55  ? -14.797 12.677  -8.048  1.00 36.75 ? 184 PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 55  ? -15.936 10.611  -7.670  1.00 35.75 ? 184 PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 55  ? -14.813 12.941  -6.689  1.00 36.53 ? 184 PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 55  ? -15.960 10.871  -6.310  1.00 35.93 ? 184 PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 55  ? -15.391 12.034  -5.817  1.00 36.01 ? 184 PHE A CZ  1 
ATOM   358  N N   . GLY A 1 56  ? -14.384 8.703   -11.915 1.00 34.36 ? 185 GLY A N   1 
ATOM   359  C CA  . GLY A 1 56  ? -14.738 7.964   -13.121 1.00 32.27 ? 185 GLY A CA  1 
ATOM   360  C C   . GLY A 1 56  ? -16.013 7.179   -12.896 1.00 31.58 ? 185 GLY A C   1 
ATOM   361  O O   . GLY A 1 56  ? -16.340 6.812   -11.765 1.00 31.17 ? 185 GLY A O   1 
ATOM   362  N N   . ILE A 1 57  ? -16.745 6.930   -13.972 1.00 31.57 ? 186 ILE A N   1 
ATOM   363  C CA  . ILE A 1 57  ? -17.956 6.125   -13.899 1.00 31.49 ? 186 ILE A CA  1 
ATOM   364  C C   . ILE A 1 57  ? -17.924 5.111   -15.033 1.00 31.31 ? 186 ILE A C   1 
ATOM   365  O O   . ILE A 1 57  ? -17.620 5.456   -16.172 1.00 33.20 ? 186 ILE A O   1 
ATOM   366  C CB  . ILE A 1 57  ? -19.240 7.000   -13.918 1.00 31.71 ? 186 ILE A CB  1 
ATOM   367  C CG1 . ILE A 1 57  ? -20.501 6.129   -13.809 1.00 31.47 ? 186 ILE A CG1 1 
ATOM   368  C CG2 . ILE A 1 57  ? -19.287 7.899   -15.156 1.00 31.37 ? 186 ILE A CG2 1 
ATOM   369  C CD1 . ILE A 1 57  ? -21.673 6.811   -13.134 1.00 30.53 ? 186 ILE A CD1 1 
ATOM   370  N N   . THR A 1 58  ? -18.210 3.856   -14.718 1.00 31.56 ? 187 THR A N   1 
ATOM   371  C CA  . THR A 1 58  ? -18.200 2.811   -15.738 1.00 31.25 ? 187 THR A CA  1 
ATOM   372  C C   . THR A 1 58  ? -19.428 1.900   -15.678 1.00 31.76 ? 187 THR A C   1 
ATOM   373  O O   . THR A 1 58  ? -19.984 1.642   -14.609 1.00 29.56 ? 187 THR A O   1 
ATOM   374  C CB  . THR A 1 58  ? -16.885 1.990   -15.718 1.00 30.75 ? 187 THR A CB  1 
ATOM   375  O OG1 . THR A 1 58  ? -16.767 1.245   -16.938 1.00 29.53 ? 187 THR A OG1 1 
ATOM   376  C CG2 . THR A 1 58  ? -16.834 1.035   -14.517 1.00 29.41 ? 187 THR A CG2 1 
ATOM   377  N N   . SER A 1 59  ? -19.836 1.417   -16.848 1.00 33.26 ? 188 SER A N   1 
ATOM   378  C CA  . SER A 1 59  ? -20.978 0.518   -16.969 1.00 34.81 ? 188 SER A CA  1 
ATOM   379  C C   . SER A 1 59  ? -20.537 -0.796  -17.588 1.00 35.09 ? 188 SER A C   1 
ATOM   380  O O   . SER A 1 59  ? -21.312 -1.752  -17.663 1.00 35.50 ? 188 SER A O   1 
ATOM   381  C CB  . SER A 1 59  ? -22.060 1.174   -17.834 1.00 35.75 ? 188 SER A CB  1 
ATOM   382  O OG  . SER A 1 59  ? -22.490 2.394   -17.254 1.00 35.59 ? 188 SER A OG  1 
ATOM   383  N N   . ASN A 1 60  ? -19.276 -0.822  -18.019 1.00 36.23 ? 189 ASN A N   1 
ATOM   384  C CA  . ASN A 1 60  ? -18.690 -1.935  -18.764 1.00 36.59 ? 189 ASN A CA  1 
ATOM   385  C C   . ASN A 1 60  ? -18.239 -3.064  -17.846 1.00 36.49 ? 189 ASN A C   1 
ATOM   386  O O   . ASN A 1 60  ? -17.304 -2.890  -17.061 1.00 37.06 ? 189 ASN A O   1 
ATOM   387  C CB  . ASN A 1 60  ? -17.511 -1.412  -19.600 1.00 37.16 ? 189 ASN A CB  1 
ATOM   388  C CG  . ASN A 1 60  ? -16.817 -2.497  -20.399 1.00 36.99 ? 189 ASN A CG  1 
ATOM   389  O OD1 . ASN A 1 60  ? -17.273 -3.638  -20.462 1.00 38.36 ? 189 ASN A OD1 1 
ATOM   390  N ND2 . ASN A 1 60  ? -15.699 -2.142  -21.016 1.00 36.61 ? 189 ASN A ND2 1 
ATOM   391  N N   . SER A 1 61  ? -18.880 -4.226  -17.973 1.00 36.77 ? 190 SER A N   1 
ATOM   392  C CA  . SER A 1 61  ? -18.629 -5.369  -17.076 1.00 37.23 ? 190 SER A CA  1 
ATOM   393  C C   . SER A 1 61  ? -17.195 -5.931  -17.123 1.00 36.95 ? 190 SER A C   1 
ATOM   394  O O   . SER A 1 61  ? -16.784 -6.676  -16.231 1.00 37.03 ? 190 SER A O   1 
ATOM   395  C CB  . SER A 1 61  ? -19.650 -6.485  -17.319 1.00 38.33 ? 190 SER A CB  1 
ATOM   396  O OG  . SER A 1 61  ? -19.457 -7.097  -18.583 1.00 41.65 ? 190 SER A OG  1 
ATOM   397  N N   . ASP A 1 62  ? -16.452 -5.584  -18.169 1.00 36.99 ? 191 ASP A N   1 
ATOM   398  C CA  . ASP A 1 62  ? -15.028 -5.899  -18.256 1.00 36.08 ? 191 ASP A CA  1 
ATOM   399  C C   . ASP A 1 62  ? -14.232 -5.096  -17.221 1.00 34.48 ? 191 ASP A C   1 
ATOM   400  O O   . ASP A 1 62  ? -13.325 -5.626  -16.575 1.00 34.62 ? 191 ASP A O   1 
ATOM   401  C CB  . ASP A 1 62  ? -14.503 -5.623  -19.671 1.00 36.10 ? 191 ASP A CB  1 
ATOM   402  C CG  . ASP A 1 62  ? -14.854 -6.731  -20.662 1.00 36.64 ? 191 ASP A CG  1 
ATOM   403  O OD1 . ASP A 1 62  ? -15.069 -7.893  -20.242 1.00 35.65 ? 191 ASP A OD1 1 
ATOM   404  O OD2 . ASP A 1 62  ? -14.897 -6.432  -21.875 1.00 36.82 ? 191 ASP A OD2 1 
ATOM   405  N N   . VAL A 1 63  ? -14.586 -3.819  -17.072 1.00 33.27 ? 192 VAL A N   1 
ATOM   406  C CA  . VAL A 1 63  ? -13.966 -2.941  -16.078 1.00 32.09 ? 192 VAL A CA  1 
ATOM   407  C C   . VAL A 1 63  ? -14.318 -3.403  -14.658 1.00 31.84 ? 192 VAL A C   1 
ATOM   408  O O   . VAL A 1 63  ? -13.452 -3.415  -13.784 1.00 32.48 ? 192 VAL A O   1 
ATOM   409  C CB  . VAL A 1 63  ? -14.323 -1.450  -16.311 1.00 31.28 ? 192 VAL A CB  1 
ATOM   410  C CG1 . VAL A 1 63  ? -13.576 -0.553  -15.338 1.00 31.70 ? 192 VAL A CG1 1 
ATOM   411  C CG2 . VAL A 1 63  ? -13.967 -1.037  -17.730 1.00 31.26 ? 192 VAL A CG2 1 
ATOM   412  N N   . PHE A 1 64  ? -15.574 -3.799  -14.443 1.00 30.30 ? 193 PHE A N   1 
ATOM   413  C CA  . PHE A 1 64  ? -15.999 -4.432  -13.189 1.00 30.07 ? 193 PHE A CA  1 
ATOM   414  C C   . PHE A 1 64  ? -15.039 -5.555  -12.774 1.00 30.22 ? 193 PHE A C   1 
ATOM   415  O O   . PHE A 1 64  ? -14.484 -5.542  -11.671 1.00 30.20 ? 193 PHE A O   1 
ATOM   416  C CB  . PHE A 1 64  ? -17.404 -5.033  -13.338 1.00 29.58 ? 193 PHE A CB  1 
ATOM   417  C CG  . PHE A 1 64  ? -18.539 -4.069  -13.092 1.00 29.23 ? 193 PHE A CG  1 
ATOM   418  C CD1 . PHE A 1 64  ? -18.702 -2.925  -13.875 1.00 29.41 ? 193 PHE A CD1 1 
ATOM   419  C CD2 . PHE A 1 64  ? -19.491 -4.348  -12.111 1.00 28.36 ? 193 PHE A CD2 1 
ATOM   420  C CE1 . PHE A 1 64  ? -19.765 -2.059  -13.654 1.00 29.17 ? 193 PHE A CE1 1 
ATOM   421  C CE2 . PHE A 1 64  ? -20.557 -3.494  -11.889 1.00 28.28 ? 193 PHE A CE2 1 
ATOM   422  C CZ  . PHE A 1 64  ? -20.699 -2.349  -12.666 1.00 29.28 ? 193 PHE A CZ  1 
ATOM   423  N N   . SER A 1 65  ? -14.849 -6.521  -13.673 1.00 30.41 ? 194 SER A N   1 
ATOM   424  C CA  . SER A 1 65  ? -14.064 -7.722  -13.397 1.00 29.35 ? 194 SER A CA  1 
ATOM   425  C C   . SER A 1 65  ? -12.584 -7.414  -13.269 1.00 27.87 ? 194 SER A C   1 
ATOM   426  O O   . SER A 1 65  ? -11.870 -8.103  -12.545 1.00 27.93 ? 194 SER A O   1 
ATOM   427  C CB  . SER A 1 65  ? -14.280 -8.763  -14.498 1.00 30.61 ? 194 SER A CB  1 
ATOM   428  O OG  . SER A 1 65  ? -15.657 -9.078  -14.626 1.00 32.00 ? 194 SER A OG  1 
ATOM   429  N N   . LYS A 1 66  ? -12.139 -6.380  -13.980 1.00 26.58 ? 195 LYS A N   1 
ATOM   430  C CA  . LYS A 1 66  ? -10.759 -5.912  -13.917 1.00 26.44 ? 195 LYS A CA  1 
ATOM   431  C C   . LYS A 1 66  ? -10.395 -5.553  -12.483 1.00 25.45 ? 195 LYS A C   1 
ATOM   432  O O   . LYS A 1 66  ? -9.293  -5.837  -12.030 1.00 24.73 ? 195 LYS A O   1 
ATOM   433  C CB  . LYS A 1 66  ? -10.565 -4.701  -14.837 1.00 26.84 ? 195 LYS A CB  1 
ATOM   434  C CG  . LYS A 1 66  ? -9.151  -4.143  -14.843 1.00 27.00 ? 195 LYS A CG  1 
ATOM   435  C CD  . LYS A 1 66  ? -8.972  -3.094  -15.922 1.00 27.62 ? 195 LYS A CD  1 
ATOM   436  C CE  . LYS A 1 66  ? -7.511  -2.926  -16.309 1.00 27.32 ? 195 LYS A CE  1 
ATOM   437  N NZ  . LYS A 1 66  ? -6.650  -2.756  -15.114 1.00 28.27 ? 195 LYS A NZ  1 
ATOM   438  N N   . TYR A 1 67  ? -11.352 -4.948  -11.781 1.00 25.05 ? 196 TYR A N   1 
ATOM   439  C CA  . TYR A 1 67  ? -11.162 -4.476  -10.421 1.00 24.72 ? 196 TYR A CA  1 
ATOM   440  C C   . TYR A 1 67  ? -11.914 -5.362  -9.437  1.00 25.53 ? 196 TYR A C   1 
ATOM   441  O O   . TYR A 1 67  ? -12.098 -5.004  -8.272  1.00 25.43 ? 196 TYR A O   1 
ATOM   442  C CB  . TYR A 1 67  ? -11.597 -3.011  -10.316 1.00 24.23 ? 196 TYR A CB  1 
ATOM   443  C CG  . TYR A 1 67  ? -10.753 -2.101  -11.176 1.00 24.86 ? 196 TYR A CG  1 
ATOM   444  C CD1 . TYR A 1 67  ? -9.480  -1.686  -10.754 1.00 24.72 ? 196 TYR A CD1 1 
ATOM   445  C CD2 . TYR A 1 67  ? -11.203 -1.677  -12.429 1.00 24.15 ? 196 TYR A CD2 1 
ATOM   446  C CE1 . TYR A 1 67  ? -8.697  -0.863  -11.549 1.00 24.28 ? 196 TYR A CE1 1 
ATOM   447  C CE2 . TYR A 1 67  ? -10.424 -0.854  -13.229 1.00 23.94 ? 196 TYR A CE2 1 
ATOM   448  C CZ  . TYR A 1 67  ? -9.176  -0.452  -12.787 1.00 24.41 ? 196 TYR A CZ  1 
ATOM   449  O OH  . TYR A 1 67  ? -8.409  0.363   -13.584 1.00 25.06 ? 196 TYR A OH  1 
ATOM   450  N N   . GLN A 1 68  ? -12.353 -6.517  -9.933  1.00 26.58 ? 197 GLN A N   1 
ATOM   451  C CA  . GLN A 1 68  ? -12.938 -7.582  -9.115  1.00 28.76 ? 197 GLN A CA  1 
ATOM   452  C C   . GLN A 1 68  ? -14.239 -7.191  -8.398  1.00 30.78 ? 197 GLN A C   1 
ATOM   453  O O   . GLN A 1 68  ? -14.459 -7.524  -7.233  1.00 31.11 ? 197 GLN A O   1 
ATOM   454  C CB  . GLN A 1 68  ? -11.894 -8.156  -8.150  1.00 28.40 ? 197 GLN A CB  1 
ATOM   455  C CG  . GLN A 1 68  ? -10.614 -8.608  -8.852  1.00 27.48 ? 197 GLN A CG  1 
ATOM   456  C CD  . GLN A 1 68  ? -9.752  -9.494  -7.984  1.00 27.44 ? 197 GLN A CD  1 
ATOM   457  O OE1 . GLN A 1 68  ? -9.459  -10.629 -8.350  1.00 27.60 ? 197 GLN A OE1 1 
ATOM   458  N NE2 . GLN A 1 68  ? -9.346  -8.987  -6.821  1.00 26.99 ? 197 GLN A NE2 1 
ATOM   459  N N   . LEU A 1 69  ? -15.083 -6.463  -9.122  1.00 33.11 ? 198 LEU A N   1 
ATOM   460  C CA  . LEU A 1 69  ? -16.448 -6.168  -8.707  1.00 35.58 ? 198 LEU A CA  1 
ATOM   461  C C   . LEU A 1 69  ? -17.366 -7.062  -9.536  1.00 36.80 ? 198 LEU A C   1 
ATOM   462  O O   . LEU A 1 69  ? -17.281 -7.064  -10.763 1.00 36.50 ? 198 LEU A O   1 
ATOM   463  C CB  . LEU A 1 69  ? -16.793 -4.703  -9.011  1.00 35.21 ? 198 LEU A CB  1 
ATOM   464  C CG  . LEU A 1 69  ? -16.341 -3.482  -8.196  1.00 35.03 ? 198 LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 69  ? -17.376 -3.097  -7.152  1.00 35.14 ? 198 LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 69  ? -14.960 -3.634  -7.570  1.00 36.28 ? 198 LEU A CD2 1 
ATOM   467  N N   . ASP A 1 70  ? -18.225 -7.828  -8.875  1.00 39.49 ? 199 ASP A N   1 
ATOM   468  C CA  . ASP A 1 70  ? -19.287 -8.544  -9.579  1.00 41.55 ? 199 ASP A CA  1 
ATOM   469  C C   . ASP A 1 70  ? -20.577 -7.712  -9.635  1.00 41.46 ? 199 ASP A C   1 
ATOM   470  O O   . ASP A 1 70  ? -21.290 -7.728  -10.636 1.00 43.54 ? 199 ASP A O   1 
ATOM   471  C CB  . ASP A 1 70  ? -19.535 -9.929  -8.965  1.00 44.55 ? 199 ASP A CB  1 
ATOM   472  C CG  . ASP A 1 70  ? -19.618 -9.903  -7.445  1.00 47.34 ? 199 ASP A CG  1 
ATOM   473  O OD1 . ASP A 1 70  ? -19.090 -10.841 -6.805  1.00 49.59 ? 199 ASP A OD1 1 
ATOM   474  O OD2 . ASP A 1 70  ? -20.212 -8.957  -6.885  1.00 50.17 ? 199 ASP A OD2 1 
ATOM   475  N N   . LYS A 1 71  ? -20.859 -6.987  -8.556  1.00 40.90 ? 200 LYS A N   1 
ATOM   476  C CA  . LYS A 1 71  ? -22.015 -6.093  -8.476  1.00 40.01 ? 200 LYS A CA  1 
ATOM   477  C C   . LYS A 1 71  ? -21.600 -4.620  -8.601  1.00 37.57 ? 200 LYS A C   1 
ATOM   478  O O   . LYS A 1 71  ? -20.405 -4.300  -8.644  1.00 37.36 ? 200 LYS A O   1 
ATOM   479  C CB  . LYS A 1 71  ? -22.771 -6.326  -7.161  1.00 42.75 ? 200 LYS A CB  1 
ATOM   480  C CG  . LYS A 1 71  ? -21.925 -6.157  -5.904  1.00 45.29 ? 200 LYS A CG  1 
ATOM   481  C CD  . LYS A 1 71  ? -22.704 -6.478  -4.636  1.00 48.32 ? 200 LYS A CD  1 
ATOM   482  C CE  . LYS A 1 71  ? -22.525 -7.927  -4.204  1.00 49.34 ? 200 LYS A CE  1 
ATOM   483  N NZ  . LYS A 1 71  ? -21.179 -8.168  -3.607  1.00 50.88 ? 200 LYS A NZ  1 
ATOM   484  N N   . ASP A 1 72  ? -22.589 -3.729  -8.663  1.00 34.44 ? 201 ASP A N   1 
ATOM   485  C CA  . ASP A 1 72  ? -22.345 -2.287  -8.620  1.00 32.15 ? 201 ASP A CA  1 
ATOM   486  C C   . ASP A 1 72  ? -21.540 -1.916  -7.372  1.00 30.30 ? 201 ASP A C   1 
ATOM   487  O O   . ASP A 1 72  ? -21.582 -2.626  -6.367  1.00 30.21 ? 201 ASP A O   1 
ATOM   488  C CB  . ASP A 1 72  ? -23.671 -1.508  -8.639  1.00 31.98 ? 201 ASP A CB  1 
ATOM   489  C CG  . ASP A 1 72  ? -24.298 -1.421  -10.034 1.00 32.15 ? 201 ASP A CG  1 
ATOM   490  O OD1 . ASP A 1 72  ? -25.330 -0.732  -10.162 1.00 32.69 ? 201 ASP A OD1 1 
ATOM   491  O OD2 . ASP A 1 72  ? -23.787 -2.033  -11.001 1.00 31.26 ? 201 ASP A OD2 1 
ATOM   492  N N   . GLY A 1 73  ? -20.814 -0.805  -7.427  1.00 28.58 ? 202 GLY A N   1 
ATOM   493  C CA  . GLY A 1 73  ? -20.011 -0.384  -6.279  1.00 27.26 ? 202 GLY A CA  1 
ATOM   494  C C   . GLY A 1 73  ? -19.134 0.820   -6.549  1.00 26.30 ? 202 GLY A C   1 
ATOM   495  O O   . GLY A 1 73  ? -19.142 1.371   -7.653  1.00 26.11 ? 202 GLY A O   1 
ATOM   496  N N   . VAL A 1 74  ? -18.388 1.231   -5.525  1.00 25.05 ? 203 VAL A N   1 
ATOM   497  C CA  . VAL A 1 74  ? -17.489 2.385   -5.602  1.00 24.42 ? 203 VAL A CA  1 
ATOM   498  C C   . VAL A 1 74  ? -16.145 2.002   -4.975  1.00 24.28 ? 203 VAL A C   1 
ATOM   499  O O   . VAL A 1 74  ? -16.094 1.486   -3.855  1.00 23.52 ? 203 VAL A O   1 
ATOM   500  C CB  . VAL A 1 74  ? -18.087 3.628   -4.886  1.00 23.72 ? 203 VAL A CB  1 
ATOM   501  C CG1 . VAL A 1 74  ? -17.089 4.777   -4.842  1.00 23.95 ? 203 VAL A CG1 1 
ATOM   502  C CG2 . VAL A 1 74  ? -19.372 4.081   -5.557  1.00 23.74 ? 203 VAL A CG2 1 
ATOM   503  N N   . VAL A 1 75  ? -15.066 2.245   -5.710  1.00 24.60 ? 204 VAL A N   1 
ATOM   504  C CA  . VAL A 1 75  ? -13.715 1.998   -5.215  1.00 25.11 ? 204 VAL A CA  1 
ATOM   505  C C   . VAL A 1 75  ? -12.892 3.287   -5.197  1.00 25.11 ? 204 VAL A C   1 
ATOM   506  O O   . VAL A 1 75  ? -12.829 3.992   -6.203  1.00 25.44 ? 204 VAL A O   1 
ATOM   507  C CB  . VAL A 1 75  ? -12.980 0.945   -6.071  1.00 24.69 ? 204 VAL A CB  1 
ATOM   508  C CG1 . VAL A 1 75  ? -11.587 0.675   -5.517  1.00 24.27 ? 204 VAL A CG1 1 
ATOM   509  C CG2 . VAL A 1 75  ? -13.778 -0.349  -6.136  1.00 25.18 ? 204 VAL A CG2 1 
ATOM   510  N N   . LEU A 1 76  ? -12.265 3.587   -4.059  1.00 25.10 ? 205 LEU A N   1 
ATOM   511  C CA  . LEU A 1 76  ? -11.269 4.665   -3.988  1.00 25.43 ? 205 LEU A CA  1 
ATOM   512  C C   . LEU A 1 76  ? -9.876  4.068   -4.204  1.00 26.33 ? 205 LEU A C   1 
ATOM   513  O O   . LEU A 1 76  ? -9.504  3.100   -3.533  1.00 25.52 ? 205 LEU A O   1 
ATOM   514  C CB  . LEU A 1 76  ? -11.344 5.398   -2.640  1.00 24.91 ? 205 LEU A CB  1 
ATOM   515  C CG  . LEU A 1 76  ? -10.411 6.577   -2.292  1.00 25.15 ? 205 LEU A CG  1 
ATOM   516  C CD1 . LEU A 1 76  ? -11.067 7.479   -1.255  1.00 24.83 ? 205 LEU A CD1 1 
ATOM   517  C CD2 . LEU A 1 76  ? -9.035  6.130   -1.791  1.00 24.26 ? 205 LEU A CD2 1 
ATOM   518  N N   . PHE A 1 77  ? -9.126  4.649   -5.146  1.00 27.31 ? 206 PHE A N   1 
ATOM   519  C CA  . PHE A 1 77  ? -7.731  4.275   -5.432  1.00 28.07 ? 206 PHE A CA  1 
ATOM   520  C C   . PHE A 1 77  ? -6.785  5.345   -4.911  1.00 29.91 ? 206 PHE A C   1 
ATOM   521  O O   . PHE A 1 77  ? -7.100  6.533   -4.976  1.00 30.99 ? 206 PHE A O   1 
ATOM   522  C CB  . PHE A 1 77  ? -7.498  4.124   -6.944  1.00 27.23 ? 206 PHE A CB  1 
ATOM   523  C CG  . PHE A 1 77  ? -8.365  3.084   -7.595  1.00 26.06 ? 206 PHE A CG  1 
ATOM   524  C CD1 . PHE A 1 77  ? -9.649  3.403   -8.034  1.00 25.73 ? 206 PHE A CD1 1 
ATOM   525  C CD2 . PHE A 1 77  ? -7.898  1.789   -7.777  1.00 25.30 ? 206 PHE A CD2 1 
ATOM   526  C CE1 . PHE A 1 77  ? -10.452 2.449   -8.631  1.00 25.52 ? 206 PHE A CE1 1 
ATOM   527  C CE2 . PHE A 1 77  ? -8.695  0.831   -8.376  1.00 24.62 ? 206 PHE A CE2 1 
ATOM   528  C CZ  . PHE A 1 77  ? -9.975  1.162   -8.802  1.00 25.35 ? 206 PHE A CZ  1 
ATOM   529  N N   . LYS A 1 78  ? -5.625  4.926   -4.408  1.00 31.16 ? 207 LYS A N   1 
ATOM   530  C CA  . LYS A 1 78  ? -4.611  5.856   -3.909  1.00 31.76 ? 207 LYS A CA  1 
ATOM   531  C C   . LYS A 1 78  ? -3.185  5.333   -4.109  1.00 34.43 ? 207 LYS A C   1 
ATOM   532  O O   . LYS A 1 78  ? -2.955  4.120   -4.128  1.00 35.47 ? 207 LYS A O   1 
ATOM   533  C CB  . LYS A 1 78  ? -4.870  6.227   -2.444  1.00 30.50 ? 207 LYS A CB  1 
ATOM   534  C CG  . LYS A 1 78  ? -4.948  5.048   -1.491  1.00 29.66 ? 207 LYS A CG  1 
ATOM   535  C CD  . LYS A 1 78  ? -5.664  5.425   -0.208  1.00 28.34 ? 207 LYS A CD  1 
ATOM   536  C CE  . LYS A 1 78  ? -5.541  4.330   0.833   1.00 27.87 ? 207 LYS A CE  1 
ATOM   537  N NZ  . LYS A 1 78  ? -6.422  4.615   1.995   1.00 28.34 ? 207 LYS A NZ  1 
ATOM   538  N N   . LYS A 1 79  ? -2.236  6.258   -4.251  1.00 35.60 ? 208 LYS A N   1 
ATOM   539  C CA  . LYS A 1 79  ? -0.837  5.916   -4.531  1.00 36.73 ? 208 LYS A CA  1 
ATOM   540  C C   . LYS A 1 79  ? 0.025   5.810   -3.265  1.00 38.78 ? 208 LYS A C   1 
ATOM   541  O O   . LYS A 1 79  ? 1.223   6.106   -3.289  1.00 41.30 ? 208 LYS A O   1 
ATOM   542  C CB  . LYS A 1 79  ? -0.232  6.919   -5.523  1.00 36.04 ? 208 LYS A CB  1 
ATOM   543  C CG  . LYS A 1 79  ? -0.703  6.732   -6.960  1.00 35.33 ? 208 LYS A CG  1 
ATOM   544  C CD  . LYS A 1 79  ? -0.221  7.862   -7.853  1.00 35.10 ? 208 LYS A CD  1 
ATOM   545  C CE  . LYS A 1 79  ? -0.559  7.598   -9.312  1.00 35.87 ? 208 LYS A CE  1 
ATOM   546  N NZ  . LYS A 1 79  ? -0.150  8.735   -10.183 1.00 35.15 ? 208 LYS A NZ  1 
ATOM   547  N N   . PHE A 1 80  ? -0.598  5.377   -2.170  1.00 38.98 ? 209 PHE A N   1 
ATOM   548  C CA  . PHE A 1 80  ? 0.058   5.235   -0.869  1.00 39.74 ? 209 PHE A CA  1 
ATOM   549  C C   . PHE A 1 80  ? -0.711  4.236   -0.011  1.00 40.75 ? 209 PHE A C   1 
ATOM   550  O O   . PHE A 1 80  ? -1.814  3.824   -0.378  1.00 42.47 ? 209 PHE A O   1 
ATOM   551  C CB  . PHE A 1 80  ? 0.174   6.591   -0.147  1.00 39.34 ? 209 PHE A CB  1 
ATOM   552  C CG  . PHE A 1 80  ? -1.121  7.370   -0.076  1.00 38.97 ? 209 PHE A CG  1 
ATOM   553  C CD1 . PHE A 1 80  ? -1.363  8.425   -0.954  1.00 38.57 ? 209 PHE A CD1 1 
ATOM   554  C CD2 . PHE A 1 80  ? -2.095  7.056   0.873   1.00 38.64 ? 209 PHE A CD2 1 
ATOM   555  C CE1 . PHE A 1 80  ? -2.546  9.145   -0.892  1.00 37.76 ? 209 PHE A CE1 1 
ATOM   556  C CE2 . PHE A 1 80  ? -3.282  7.772   0.935   1.00 37.89 ? 209 PHE A CE2 1 
ATOM   557  C CZ  . PHE A 1 80  ? -3.505  8.820   0.055   1.00 37.48 ? 209 PHE A CZ  1 
ATOM   558  N N   . ASP A 1 81  ? -0.131  3.864   1.129   1.00 42.28 ? 210 ASP A N   1 
ATOM   559  C CA  . ASP A 1 81  ? -0.729  2.902   2.065   1.00 42.84 ? 210 ASP A CA  1 
ATOM   560  C C   . ASP A 1 81  ? -1.297  1.658   1.353   1.00 43.07 ? 210 ASP A C   1 
ATOM   561  O O   . ASP A 1 81  ? -0.619  1.066   0.509   1.00 44.12 ? 210 ASP A O   1 
ATOM   562  C CB  . ASP A 1 81  ? -1.781  3.582   2.958   1.00 45.71 ? 210 ASP A CB  1 
ATOM   563  C CG  . ASP A 1 81  ? -1.188  4.649   3.880   1.00 48.16 ? 210 ASP A CG  1 
ATOM   564  O OD1 . ASP A 1 81  ? -1.952  5.543   4.302   1.00 50.30 ? 210 ASP A OD1 1 
ATOM   565  O OD2 . ASP A 1 81  ? 0.024   4.603   4.192   1.00 48.58 ? 210 ASP A OD2 1 
ATOM   566  N N   . GLU A 1 82  ? -2.535  1.277   1.678   1.00 41.34 ? 211 GLU A N   1 
ATOM   567  C CA  . GLU A 1 82  ? -3.136  0.035   1.171   1.00 39.75 ? 211 GLU A CA  1 
ATOM   568  C C   . GLU A 1 82  ? -3.531  0.037   -0.314  1.00 37.51 ? 211 GLU A C   1 
ATOM   569  O O   . GLU A 1 82  ? -3.889  -1.005  -0.860  1.00 36.56 ? 211 GLU A O   1 
ATOM   570  C CB  . GLU A 1 82  ? -4.329  -0.395  2.034   1.00 41.55 ? 211 GLU A CB  1 
ATOM   571  C CG  . GLU A 1 82  ? -5.476  0.605   2.095   1.00 43.86 ? 211 GLU A CG  1 
ATOM   572  C CD  . GLU A 1 82  ? -5.423  1.501   3.322   1.00 45.12 ? 211 GLU A CD  1 
ATOM   573  O OE1 . GLU A 1 82  ? -4.316  1.763   3.839   1.00 45.91 ? 211 GLU A OE1 1 
ATOM   574  O OE2 . GLU A 1 82  ? -6.497  1.949   3.774   1.00 45.90 ? 211 GLU A OE2 1 
ATOM   575  N N   . GLY A 1 83  ? -3.488  1.198   -0.959  1.00 34.64 ? 212 GLY A N   1 
ATOM   576  C CA  . GLY A 1 83  ? -3.707  1.265   -2.402  1.00 33.18 ? 212 GLY A CA  1 
ATOM   577  C C   . GLY A 1 83  ? -5.150  1.370   -2.860  1.00 32.22 ? 212 GLY A C   1 
ATOM   578  O O   . GLY A 1 83  ? -5.436  2.069   -3.831  1.00 31.04 ? 212 GLY A O   1 
ATOM   579  N N   . ARG A 1 84  ? -6.059  0.664   -2.185  1.00 32.52 ? 213 ARG A N   1 
ATOM   580  C CA  . ARG A 1 84  ? -7.489  0.785   -2.482  1.00 32.03 ? 213 ARG A CA  1 
ATOM   581  C C   . ARG A 1 84  ? -8.408  0.483   -1.297  1.00 33.06 ? 213 ARG A C   1 
ATOM   582  O O   . ARG A 1 84  ? -8.047  -0.256  -0.383  1.00 32.94 ? 213 ARG A O   1 
ATOM   583  C CB  . ARG A 1 84  ? -7.895  -0.044  -3.713  1.00 31.33 ? 213 ARG A CB  1 
ATOM   584  C CG  . ARG A 1 84  ? -8.042  -1.533  -3.471  1.00 30.58 ? 213 ARG A CG  1 
ATOM   585  C CD  . ARG A 1 84  ? -9.388  -2.047  -3.979  1.00 30.61 ? 213 ARG A CD  1 
ATOM   586  N NE  . ARG A 1 84  ? -9.335  -2.517  -5.361  1.00 29.84 ? 213 ARG A NE  1 
ATOM   587  C CZ  . ARG A 1 84  ? -10.341 -3.118  -5.996  1.00 29.46 ? 213 ARG A CZ  1 
ATOM   588  N NH1 . ARG A 1 84  ? -11.505 -3.336  -5.390  1.00 27.95 ? 213 ARG A NH1 1 
ATOM   589  N NH2 . ARG A 1 84  ? -10.180 -3.505  -7.250  1.00 28.79 ? 213 ARG A NH2 1 
ATOM   590  N N   . ASN A 1 85  ? -9.595  1.085   -1.335  1.00 32.98 ? 214 ASN A N   1 
ATOM   591  C CA  . ASN A 1 85  ? -10.650 0.852   -0.362  1.00 31.97 ? 214 ASN A CA  1 
ATOM   592  C C   . ASN A 1 85  ? -11.972 0.699   -1.111  1.00 32.04 ? 214 ASN A C   1 
ATOM   593  O O   . ASN A 1 85  ? -12.280 1.490   -2.013  1.00 30.94 ? 214 ASN A O   1 
ATOM   594  C CB  . ASN A 1 85  ? -10.745 2.015   0.637   1.00 31.53 ? 214 ASN A CB  1 
ATOM   595  C CG  . ASN A 1 85  ? -9.445  2.263   1.384   1.00 31.61 ? 214 ASN A CG  1 
ATOM   596  O OD1 . ASN A 1 85  ? -8.693  3.176   1.051   1.00 31.64 ? 214 ASN A OD1 1 
ATOM   597  N ND2 . ASN A 1 85  ? -9.175  1.451   2.397   1.00 31.40 ? 214 ASN A ND2 1 
ATOM   598  N N   . ASN A 1 86  ? -12.743 -0.322  -0.750  1.00 31.51 ? 215 ASN A N   1 
ATOM   599  C CA  . ASN A 1 86  ? -14.050 -0.537  -1.363  1.00 32.52 ? 215 ASN A CA  1 
ATOM   600  C C   . ASN A 1 86  ? -15.151 0.048   -0.493  1.00 32.53 ? 215 ASN A C   1 
ATOM   601  O O   . ASN A 1 86  ? -15.178 -0.176  0.717   1.00 31.57 ? 215 ASN A O   1 
ATOM   602  C CB  . ASN A 1 86  ? -14.301 -2.027  -1.609  1.00 33.46 ? 215 ASN A CB  1 
ATOM   603  C CG  . ASN A 1 86  ? -13.240 -2.661  -2.485  1.00 34.72 ? 215 ASN A CG  1 
ATOM   604  O OD1 . ASN A 1 86  ? -12.908 -2.150  -3.552  1.00 35.85 ? 215 ASN A OD1 1 
ATOM   605  N ND2 . ASN A 1 86  ? -12.702 -3.782  -2.035  1.00 35.48 ? 215 ASN A ND2 1 
ATOM   606  N N   . PHE A 1 87  ? -16.044 0.819   -1.106  1.00 33.54 ? 216 PHE A N   1 
ATOM   607  C CA  . PHE A 1 87  ? -17.186 1.365   -0.389  1.00 34.23 ? 216 PHE A CA  1 
ATOM   608  C C   . PHE A 1 87  ? -18.118 0.226   0.022   1.00 36.01 ? 216 PHE A C   1 
ATOM   609  O O   . PHE A 1 87  ? -18.439 -0.647  -0.787  1.00 34.63 ? 216 PHE A O   1 
ATOM   610  C CB  . PHE A 1 87  ? -17.918 2.399   -1.249  1.00 34.09 ? 216 PHE A CB  1 
ATOM   611  C CG  . PHE A 1 87  ? -19.153 2.960   -0.606  1.00 33.46 ? 216 PHE A CG  1 
ATOM   612  C CD1 . PHE A 1 87  ? -19.056 3.955   0.359   1.00 33.73 ? 216 PHE A CD1 1 
ATOM   613  C CD2 . PHE A 1 87  ? -20.415 2.489   -0.960  1.00 32.93 ? 216 PHE A CD2 1 
ATOM   614  C CE1 . PHE A 1 87  ? -20.195 4.475   0.959   1.00 33.46 ? 216 PHE A CE1 1 
ATOM   615  C CE2 . PHE A 1 87  ? -21.556 3.007   -0.361  1.00 33.04 ? 216 PHE A CE2 1 
ATOM   616  C CZ  . PHE A 1 87  ? -21.444 4.002   0.596   1.00 32.16 ? 216 PHE A CZ  1 
ATOM   617  N N   . GLU A 1 88  ? -18.524 0.224   1.288   1.00 39.55 ? 217 GLU A N   1 
ATOM   618  C CA  . GLU A 1 88  ? -19.420 -0.811  1.805   1.00 43.77 ? 217 GLU A CA  1 
ATOM   619  C C   . GLU A 1 88  ? -20.617 -0.166  2.507   1.00 45.34 ? 217 GLU A C   1 
ATOM   620  O O   . GLU A 1 88  ? -20.477 0.412   3.591   1.00 48.92 ? 217 GLU A O   1 
ATOM   621  C CB  . GLU A 1 88  ? -18.682 -1.762  2.766   1.00 44.98 ? 217 GLU A CB  1 
ATOM   622  C CG  . GLU A 1 88  ? -17.345 -2.314  2.266   1.00 48.52 ? 217 GLU A CG  1 
ATOM   623  C CD  . GLU A 1 88  ? -17.462 -3.569  1.406   1.00 50.73 ? 217 GLU A CD  1 
ATOM   624  O OE1 . GLU A 1 88  ? -18.536 -3.815  0.810   1.00 53.22 ? 217 GLU A OE1 1 
ATOM   625  O OE2 . GLU A 1 88  ? -16.461 -4.315  1.317   1.00 50.02 ? 217 GLU A OE2 1 
ATOM   626  N N   . GLY A 1 89  ? -21.791 -0.260  1.884   1.00 45.36 ? 218 GLY A N   1 
ATOM   627  C CA  . GLY A 1 89  ? -23.012 0.296   2.464   1.00 43.64 ? 218 GLY A CA  1 
ATOM   628  C C   . GLY A 1 89  ? -23.977 0.771   1.401   1.00 42.80 ? 218 GLY A C   1 
ATOM   629  O O   . GLY A 1 89  ? -23.791 0.484   0.218   1.00 43.33 ? 218 GLY A O   1 
ATOM   630  N N   . GLU A 1 90  ? -25.014 1.491   1.820   1.00 41.19 ? 219 GLU A N   1 
ATOM   631  C CA  . GLU A 1 90  ? -25.973 2.064   0.880   1.00 39.55 ? 219 GLU A CA  1 
ATOM   632  C C   . GLU A 1 90  ? -25.341 3.252   0.163   1.00 39.02 ? 219 GLU A C   1 
ATOM   633  O O   . GLU A 1 90  ? -24.655 4.077   0.780   1.00 37.32 ? 219 GLU A O   1 
ATOM   634  C CB  . GLU A 1 90  ? -27.255 2.480   1.591   1.00 39.65 ? 219 GLU A CB  1 
ATOM   635  N N   . VAL A 1 91  ? -25.564 3.323   -1.145  1.00 37.87 ? 220 VAL A N   1 
ATOM   636  C CA  . VAL A 1 91  ? -24.992 4.388   -1.956  1.00 37.92 ? 220 VAL A CA  1 
ATOM   637  C C   . VAL A 1 91  ? -25.807 5.672   -1.783  1.00 38.91 ? 220 VAL A C   1 
ATOM   638  O O   . VAL A 1 91  ? -26.748 5.960   -2.533  1.00 37.74 ? 220 VAL A O   1 
ATOM   639  C CB  . VAL A 1 91  ? -24.822 3.972   -3.437  1.00 37.33 ? 220 VAL A CB  1 
ATOM   640  C CG1 . VAL A 1 91  ? -24.159 5.080   -4.243  1.00 36.98 ? 220 VAL A CG1 1 
ATOM   641  C CG2 . VAL A 1 91  ? -23.998 2.698   -3.535  1.00 36.74 ? 220 VAL A CG2 1 
ATOM   642  N N   . THR A 1 92  ? -25.441 6.417   -0.747  1.00 40.76 ? 221 THR A N   1 
ATOM   643  C CA  . THR A 1 92  ? -25.973 7.745   -0.501  1.00 42.01 ? 221 THR A CA  1 
ATOM   644  C C   . THR A 1 92  ? -24.827 8.719   -0.769  1.00 41.96 ? 221 THR A C   1 
ATOM   645  O O   . THR A 1 92  ? -23.653 8.342   -0.667  1.00 41.40 ? 221 THR A O   1 
ATOM   646  C CB  . THR A 1 92  ? -26.489 7.877   0.952   1.00 43.06 ? 221 THR A CB  1 
ATOM   647  O OG1 . THR A 1 92  ? -27.548 6.935   1.171   1.00 45.63 ? 221 THR A OG1 1 
ATOM   648  C CG2 . THR A 1 92  ? -27.027 9.274   1.232   1.00 45.09 ? 221 THR A CG2 1 
ATOM   649  N N   . LYS A 1 93  ? -25.169 9.952   -1.136  1.00 40.71 ? 222 LYS A N   1 
ATOM   650  C CA  . LYS A 1 93  ? -24.192 11.020  -1.292  1.00 41.14 ? 222 LYS A CA  1 
ATOM   651  C C   . LYS A 1 93  ? -23.429 11.206  0.014   1.00 41.18 ? 222 LYS A C   1 
ATOM   652  O O   . LYS A 1 93  ? -22.205 11.292  0.018   1.00 43.13 ? 222 LYS A O   1 
ATOM   653  C CB  . LYS A 1 93  ? -24.891 12.321  -1.707  1.00 41.37 ? 222 LYS A CB  1 
ATOM   654  C CG  . LYS A 1 93  ? -24.002 13.557  -1.729  1.00 41.98 ? 222 LYS A CG  1 
ATOM   655  C CD  . LYS A 1 93  ? -24.737 14.743  -2.334  1.00 41.18 ? 222 LYS A CD  1 
ATOM   656  C CE  . LYS A 1 93  ? -24.139 16.063  -1.886  1.00 41.57 ? 222 LYS A CE  1 
ATOM   657  N NZ  . LYS A 1 93  ? -24.607 16.429  -0.521  1.00 41.76 ? 222 LYS A NZ  1 
ATOM   658  N N   . GLU A 1 94  ? -24.164 11.231  1.120   1.00 42.05 ? 223 GLU A N   1 
ATOM   659  C CA  . GLU A 1 94  ? -23.588 11.451  2.441   1.00 41.99 ? 223 GLU A CA  1 
ATOM   660  C C   . GLU A 1 94  ? -22.701 10.283  2.885   1.00 41.12 ? 223 GLU A C   1 
ATOM   661  O O   . GLU A 1 94  ? -21.677 10.495  3.537   1.00 39.92 ? 223 GLU A O   1 
ATOM   662  C CB  . GLU A 1 94  ? -24.694 11.716  3.475   1.00 43.90 ? 223 GLU A CB  1 
ATOM   663  C CG  . GLU A 1 94  ? -25.968 12.359  2.918   1.00 45.79 ? 223 GLU A CG  1 
ATOM   664  C CD  . GLU A 1 94  ? -25.782 13.790  2.439   1.00 47.96 ? 223 GLU A CD  1 
ATOM   665  O OE1 . GLU A 1 94  ? -24.772 14.431  2.810   1.00 50.58 ? 223 GLU A OE1 1 
ATOM   666  O OE2 . GLU A 1 94  ? -26.657 14.280  1.689   1.00 47.75 ? 223 GLU A OE2 1 
ATOM   667  N N   . ASN A 1 95  ? -23.101 9.059   2.532   1.00 39.58 ? 224 ASN A N   1 
ATOM   668  C CA  . ASN A 1 95  ? -22.319 7.861   2.843   1.00 40.81 ? 224 ASN A CA  1 
ATOM   669  C C   . ASN A 1 95  ? -21.006 7.827   2.063   1.00 39.49 ? 224 ASN A C   1 
ATOM   670  O O   . ASN A 1 95  ? -19.984 7.398   2.583   1.00 40.57 ? 224 ASN A O   1 
ATOM   671  C CB  . ASN A 1 95  ? -23.118 6.578   2.562   1.00 42.70 ? 224 ASN A CB  1 
ATOM   672  C CG  . ASN A 1 95  ? -24.194 6.303   3.606   1.00 45.02 ? 224 ASN A CG  1 
ATOM   673  O OD1 . ASN A 1 95  ? -25.027 5.413   3.426   1.00 44.62 ? 224 ASN A OD1 1 
ATOM   674  N ND2 . ASN A 1 95  ? -24.182 7.062   4.700   1.00 46.22 ? 224 ASN A ND2 1 
ATOM   675  N N   . LEU A 1 96  ? -21.055 8.292   0.821   1.00 37.02 ? 225 LEU A N   1 
ATOM   676  C CA  . LEU A 1 96  ? -19.896 8.324   -0.060  1.00 37.37 ? 225 LEU A CA  1 
ATOM   677  C C   . LEU A 1 96  ? -18.868 9.370   0.370   1.00 38.68 ? 225 LEU A C   1 
ATOM   678  O O   . LEU A 1 96  ? -17.673 9.074   0.425   1.00 38.75 ? 225 LEU A O   1 
ATOM   679  C CB  . LEU A 1 96  ? -20.333 8.554   -1.508  1.00 34.11 ? 225 LEU A CB  1 
ATOM   680  C CG  . LEU A 1 96  ? -20.973 7.359   -2.216  1.00 33.68 ? 225 LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 96  ? -21.609 7.793   -3.526  1.00 33.30 ? 225 LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 96  ? -19.963 6.242   -2.454  1.00 32.96 ? 225 LEU A CD2 1 
ATOM   683  N N   . LEU A 1 97  ? -19.341 10.579  0.677   1.00 39.42 ? 226 LEU A N   1 
ATOM   684  C CA  . LEU A 1 97  ? -18.486 11.664  1.175   1.00 41.61 ? 226 LEU A CA  1 
ATOM   685  C C   . LEU A 1 97  ? -17.797 11.284  2.491   1.00 42.65 ? 226 LEU A C   1 
ATOM   686  O O   . LEU A 1 97  ? -16.644 11.651  2.738   1.00 43.50 ? 226 LEU A O   1 
ATOM   687  C CB  . LEU A 1 97  ? -19.305 12.946  1.364   1.00 41.43 ? 226 LEU A CB  1 
ATOM   688  C CG  . LEU A 1 97  ? -20.010 13.537  0.137   1.00 42.00 ? 226 LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 97  ? -21.033 14.575  0.568   1.00 42.66 ? 226 LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 97  ? -19.022 14.125  -0.859  1.00 42.95 ? 226 LEU A CD2 1 
ATOM   691  N N   . ASP A 1 98  ? -18.525 10.554  3.330   1.00 42.15 ? 227 ASP A N   1 
ATOM   692  C CA  . ASP A 1 98  ? -17.995 9.998   4.566   1.00 44.18 ? 227 ASP A CA  1 
ATOM   693  C C   . ASP A 1 98  ? -16.873 8.997   4.270   1.00 43.39 ? 227 ASP A C   1 
ATOM   694  O O   . ASP A 1 98  ? -15.831 8.997   4.937   1.00 43.49 ? 227 ASP A O   1 
ATOM   695  C CB  . ASP A 1 98  ? -19.120 9.283   5.311   1.00 47.22 ? 227 ASP A CB  1 
ATOM   696  C CG  . ASP A 1 98  ? -19.034 9.453   6.805   1.00 50.52 ? 227 ASP A CG  1 
ATOM   697  O OD1 . ASP A 1 98  ? -19.713 8.688   7.520   1.00 51.87 ? 227 ASP A OD1 1 
ATOM   698  O OD2 . ASP A 1 98  ? -18.300 10.352  7.268   1.00 52.64 ? 227 ASP A OD2 1 
ATOM   699  N N   . PHE A 1 99  ? -17.106 8.158   3.259   1.00 40.36 ? 228 PHE A N   1 
ATOM   700  C CA  . PHE A 1 99  ? -16.196 7.088   2.856   1.00 37.32 ? 228 PHE A CA  1 
ATOM   701  C C   . PHE A 1 99  ? -14.885 7.646   2.321   1.00 37.24 ? 228 PHE A C   1 
ATOM   702  O O   . PHE A 1 99  ? -13.807 7.174   2.693   1.00 35.90 ? 228 PHE A O   1 
ATOM   703  C CB  . PHE A 1 99  ? -16.883 6.194   1.818   1.00 34.82 ? 228 PHE A CB  1 
ATOM   704  C CG  . PHE A 1 99  ? -15.945 5.336   1.014   1.00 33.78 ? 228 PHE A CG  1 
ATOM   705  C CD1 . PHE A 1 99  ? -15.703 5.621   -0.327  1.00 32.58 ? 228 PHE A CD1 1 
ATOM   706  C CD2 . PHE A 1 99  ? -15.329 4.223   1.583   1.00 33.76 ? 228 PHE A CD2 1 
ATOM   707  C CE1 . PHE A 1 99  ? -14.850 4.828   -1.083  1.00 33.16 ? 228 PHE A CE1 1 
ATOM   708  C CE2 . PHE A 1 99  ? -14.471 3.429   0.835   1.00 34.08 ? 228 PHE A CE2 1 
ATOM   709  C CZ  . PHE A 1 99  ? -14.234 3.728   -0.500  1.00 33.71 ? 228 PHE A CZ  1 
ATOM   710  N N   . ILE A 1 100 ? -14.995 8.648   1.451   1.00 37.44 ? 229 ILE A N   1 
ATOM   711  C CA  . ILE A 1 100 ? -13.836 9.308   0.866   1.00 38.68 ? 229 ILE A CA  1 
ATOM   712  C C   . ILE A 1 100 ? -12.978 9.955   1.949   1.00 41.19 ? 229 ILE A C   1 
ATOM   713  O O   . ILE A 1 100 ? -11.807 9.603   2.091   1.00 40.94 ? 229 ILE A O   1 
ATOM   714  C CB  . ILE A 1 100 ? -14.237 10.345  -0.204  1.00 37.62 ? 229 ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 100 ? -14.932 9.645   -1.378  1.00 36.54 ? 229 ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 100 ? -13.010 11.108  -0.687  1.00 37.09 ? 229 ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 100 ? -15.554 10.576  -2.396  1.00 37.80 ? 229 ILE A CD1 1 
ATOM   718  N N   . LYS A 1 101 ? -13.576 10.867  2.722   1.00 41.94 ? 230 LYS A N   1 
ATOM   719  C CA  . LYS A 1 101 ? -12.860 11.633  3.745   1.00 43.59 ? 230 LYS A CA  1 
ATOM   720  C C   . LYS A 1 101 ? -12.139 10.748  4.772   1.00 44.80 ? 230 LYS A C   1 
ATOM   721  O O   . LYS A 1 101 ? -11.089 11.126  5.292   1.00 46.25 ? 230 LYS A O   1 
ATOM   722  C CB  . LYS A 1 101 ? -13.807 12.608  4.439   1.00 42.91 ? 230 LYS A CB  1 
ATOM   723  N N   . HIS A 1 102 ? -12.710 9.575   5.048   1.00 45.62 ? 231 HIS A N   1 
ATOM   724  C CA  . HIS A 1 102 ? -12.115 8.575   5.939   1.00 45.48 ? 231 HIS A CA  1 
ATOM   725  C C   . HIS A 1 102 ? -10.912 7.836   5.316   1.00 44.52 ? 231 HIS A C   1 
ATOM   726  O O   . HIS A 1 102 ? -10.054 7.329   6.044   1.00 43.08 ? 231 HIS A O   1 
ATOM   727  C CB  . HIS A 1 102 ? -13.196 7.572   6.377   1.00 48.51 ? 231 HIS A CB  1 
ATOM   728  C CG  . HIS A 1 102 ? -12.716 6.533   7.346   1.00 52.59 ? 231 HIS A CG  1 
ATOM   729  N ND1 . HIS A 1 102 ? -12.759 6.711   8.713   1.00 54.60 ? 231 HIS A ND1 1 
ATOM   730  C CD2 . HIS A 1 102 ? -12.192 5.300   7.146   1.00 54.71 ? 231 HIS A CD2 1 
ATOM   731  C CE1 . HIS A 1 102 ? -12.277 5.637   9.313   1.00 54.74 ? 231 HIS A CE1 1 
ATOM   732  N NE2 . HIS A 1 102 ? -11.925 4.765   8.384   1.00 55.96 ? 231 HIS A NE2 1 
ATOM   733  N N   . ASN A 1 103 ? -10.855 7.782   3.983   1.00 43.17 ? 232 ASN A N   1 
ATOM   734  C CA  . ASN A 1 103 ? -9.855  6.981   3.254   1.00 42.16 ? 232 ASN A CA  1 
ATOM   735  C C   . ASN A 1 103 ? -8.915  7.791   2.356   1.00 41.40 ? 232 ASN A C   1 
ATOM   736  O O   . ASN A 1 103 ? -7.927  7.263   1.833   1.00 39.88 ? 232 ASN A O   1 
ATOM   737  C CB  . ASN A 1 103 ? -10.556 5.904   2.416   1.00 40.58 ? 232 ASN A CB  1 
ATOM   738  C CG  . ASN A 1 103 ? -11.088 4.764   3.256   1.00 40.82 ? 232 ASN A CG  1 
ATOM   739  O OD1 . ASN A 1 103 ? -10.345 4.126   4.002   1.00 41.76 ? 232 ASN A OD1 1 
ATOM   740  N ND2 . ASN A 1 103 ? -12.384 4.495   3.137   1.00 40.38 ? 232 ASN A ND2 1 
ATOM   741  N N   . GLN A 1 104 ? -9.227  9.076   2.215   1.00 41.79 ? 233 GLN A N   1 
ATOM   742  C CA  . GLN A 1 104 ? -8.617  9.979   1.233   1.00 42.06 ? 233 GLN A CA  1 
ATOM   743  C C   . GLN A 1 104 ? -7.148  10.303  1.503   1.00 41.68 ? 233 GLN A C   1 
ATOM   744  O O   . GLN A 1 104 ? -6.381  10.567  0.574   1.00 40.51 ? 233 GLN A O   1 
ATOM   745  C CB  . GLN A 1 104 ? -9.430  11.275  1.216   1.00 44.41 ? 233 GLN A CB  1 
ATOM   746  C CG  . GLN A 1 104 ? -9.076  12.290  0.144   1.00 47.51 ? 233 GLN A CG  1 
ATOM   747  C CD  . GLN A 1 104 ? -9.932  13.545  0.236   1.00 49.43 ? 233 GLN A CD  1 
ATOM   748  O OE1 . GLN A 1 104 ? -9.998  14.334  -0.713  1.00 51.15 ? 233 GLN A OE1 1 
ATOM   749  N NE2 . GLN A 1 104 ? -10.599 13.735  1.379   1.00 46.91 ? 233 GLN A NE2 1 
ATOM   750  N N   . LEU A 1 105 ? -6.764  10.278  2.775   1.00 41.49 ? 234 LEU A N   1 
ATOM   751  C CA  . LEU A 1 105 ? -5.464  10.785  3.197   1.00 42.56 ? 234 LEU A CA  1 
ATOM   752  C C   . LEU A 1 105 ? -4.523  9.686   3.684   1.00 42.70 ? 234 LEU A C   1 
ATOM   753  O O   . LEU A 1 105 ? -4.985  8.634   4.150   1.00 42.17 ? 234 LEU A O   1 
ATOM   754  C CB  . LEU A 1 105 ? -5.627  11.874  4.272   1.00 43.27 ? 234 LEU A CB  1 
ATOM   755  C CG  . LEU A 1 105 ? -6.654  11.671  5.389   1.00 44.41 ? 234 LEU A CG  1 
ATOM   756  C CD1 . LEU A 1 105 ? -6.104  12.155  6.721   1.00 43.74 ? 234 LEU A CD1 1 
ATOM   757  C CD2 . LEU A 1 105 ? -7.966  12.369  5.054   1.00 43.71 ? 234 LEU A CD2 1 
ATOM   758  N N   . PRO A 1 106 ? -3.198  9.921   3.560   1.00 41.54 ? 235 PRO A N   1 
ATOM   759  C CA  . PRO A 1 106 ? -2.186  8.981   4.041   1.00 42.51 ? 235 PRO A CA  1 
ATOM   760  C C   . PRO A 1 106 ? -2.231  8.821   5.552   1.00 43.18 ? 235 PRO A C   1 
ATOM   761  O O   . PRO A 1 106 ? -2.640  9.743   6.260   1.00 43.18 ? 235 PRO A O   1 
ATOM   762  C CB  . PRO A 1 106 ? -0.865  9.637   3.624   1.00 42.28 ? 235 PRO A CB  1 
ATOM   763  C CG  . PRO A 1 106 ? -1.224  10.547  2.498   1.00 42.11 ? 235 PRO A CG  1 
ATOM   764  C CD  . PRO A 1 106 ? -2.587  11.059  2.849   1.00 41.96 ? 235 PRO A CD  1 
ATOM   765  N N   . LEU A 1 107 ? -1.815  7.654   6.035   1.00 44.93 ? 236 LEU A N   1 
ATOM   766  C CA  . LEU A 1 107 ? -1.751  7.396   7.469   1.00 45.84 ? 236 LEU A CA  1 
ATOM   767  C C   . LEU A 1 107 ? -0.887  8.468   8.130   1.00 45.09 ? 236 LEU A C   1 
ATOM   768  O O   . LEU A 1 107 ? -1.244  9.005   9.177   1.00 45.74 ? 236 LEU A O   1 
ATOM   769  C CB  . LEU A 1 107 ? -1.167  6.008   7.746   1.00 47.38 ? 236 LEU A CB  1 
ATOM   770  C CG  . LEU A 1 107 ? -1.704  5.151   8.903   1.00 48.65 ? 236 LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 107 ? -0.577  4.284   9.448   1.00 49.66 ? 236 LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 107 ? -2.347  5.952   10.031  1.00 48.56 ? 236 LEU A CD2 1 
ATOM   773  N N   . VAL A 1 108 ? 0.249   8.766   7.505   1.00 42.91 ? 237 VAL A N   1 
ATOM   774  C CA  . VAL A 1 108 ? 1.125   9.839   7.958   1.00 42.84 ? 237 VAL A CA  1 
ATOM   775  C C   . VAL A 1 108 ? 1.236   10.894  6.857   1.00 42.55 ? 237 VAL A C   1 
ATOM   776  O O   . VAL A 1 108 ? 1.866   10.674  5.817   1.00 42.45 ? 237 VAL A O   1 
ATOM   777  C CB  . VAL A 1 108 ? 2.513   9.315   8.378   1.00 43.52 ? 237 VAL A CB  1 
ATOM   778  C CG1 . VAL A 1 108 ? 3.376   10.455  8.874   1.00 44.76 ? 237 VAL A CG1 1 
ATOM   779  C CG2 . VAL A 1 108 ? 2.381   8.264   9.473   1.00 43.99 ? 237 VAL A CG2 1 
ATOM   780  N N   . ILE A 1 109 ? 0.601   12.035  7.098   1.00 41.86 ? 238 ILE A N   1 
ATOM   781  C CA  . ILE A 1 109 ? 0.472   13.082  6.093   1.00 41.51 ? 238 ILE A CA  1 
ATOM   782  C C   . ILE A 1 109 ? 1.519   14.183  6.293   1.00 41.66 ? 238 ILE A C   1 
ATOM   783  O O   . ILE A 1 109 ? 1.737   14.649  7.414   1.00 40.44 ? 238 ILE A O   1 
ATOM   784  C CB  . ILE A 1 109 ? -0.981  13.628  6.037   1.00 40.87 ? 238 ILE A CB  1 
ATOM   785  C CG1 . ILE A 1 109 ? -1.118  14.761  5.013   1.00 41.50 ? 238 ILE A CG1 1 
ATOM   786  C CG2 . ILE A 1 109 ? -1.470  14.057  7.412   1.00 41.13 ? 238 ILE A CG2 1 
ATOM   787  C CD1 . ILE A 1 109 ? -2.519  14.914  4.459   1.00 39.90 ? 238 ILE A CD1 1 
ATOM   788  N N   . GLU A 1 110 ? 2.180   14.564  5.201   1.00 42.18 ? 239 GLU A N   1 
ATOM   789  C CA  . GLU A 1 110 ? 3.146   15.657  5.217   1.00 43.19 ? 239 GLU A CA  1 
ATOM   790  C C   . GLU A 1 110 ? 2.403   16.974  5.130   1.00 42.42 ? 239 GLU A C   1 
ATOM   791  O O   . GLU A 1 110 ? 1.643   17.188  4.187   1.00 44.64 ? 239 GLU A O   1 
ATOM   792  C CB  . GLU A 1 110 ? 4.127   15.542  4.043   1.00 44.53 ? 239 GLU A CB  1 
ATOM   793  C CG  . GLU A 1 110 ? 5.187   16.637  4.015   1.00 45.09 ? 239 GLU A CG  1 
ATOM   794  C CD  . GLU A 1 110 ? 6.158   16.503  2.858   1.00 45.30 ? 239 GLU A CD  1 
ATOM   795  O OE1 . GLU A 1 110 ? 7.376   16.432  3.111   1.00 45.40 ? 239 GLU A OE1 1 
ATOM   796  O OE2 . GLU A 1 110 ? 5.709   16.470  1.693   1.00 47.79 ? 239 GLU A OE2 1 
ATOM   797  N N   . PHE A 1 111 ? 2.618   17.855  6.103   1.00 39.96 ? 240 PHE A N   1 
ATOM   798  C CA  . PHE A 1 111 ? 2.004   19.175  6.054   1.00 39.19 ? 240 PHE A CA  1 
ATOM   799  C C   . PHE A 1 111 ? 2.604   19.995  4.911   1.00 38.99 ? 240 PHE A C   1 
ATOM   800  O O   . PHE A 1 111 ? 3.753   20.435  4.980   1.00 38.67 ? 240 PHE A O   1 
ATOM   801  C CB  . PHE A 1 111 ? 2.134   19.926  7.388   1.00 38.96 ? 240 PHE A CB  1 
ATOM   802  C CG  . PHE A 1 111 ? 1.475   21.280  7.379   1.00 39.30 ? 240 PHE A CG  1 
ATOM   803  C CD1 . PHE A 1 111 ? 0.119   21.412  7.669   1.00 39.06 ? 240 PHE A CD1 1 
ATOM   804  C CD2 . PHE A 1 111 ? 2.199   22.420  7.051   1.00 39.76 ? 240 PHE A CD2 1 
ATOM   805  C CE1 . PHE A 1 111 ? -0.498  22.653  7.644   1.00 38.95 ? 240 PHE A CE1 1 
ATOM   806  C CE2 . PHE A 1 111 ? 1.585   23.664  7.019   1.00 40.25 ? 240 PHE A CE2 1 
ATOM   807  C CZ  . PHE A 1 111 ? 0.237   23.780  7.321   1.00 39.72 ? 240 PHE A CZ  1 
ATOM   808  N N   . THR A 1 112 ? 1.825   20.162  3.848   1.00 39.02 ? 241 THR A N   1 
ATOM   809  C CA  . THR A 1 112 ? 2.199   21.035  2.740   1.00 40.60 ? 241 THR A CA  1 
ATOM   810  C C   . THR A 1 112 ? 1.051   21.985  2.411   1.00 43.20 ? 241 THR A C   1 
ATOM   811  O O   . THR A 1 112 ? 0.010   21.983  3.067   1.00 42.76 ? 241 THR A O   1 
ATOM   812  C CB  . THR A 1 112 ? 2.596   20.255  1.456   1.00 39.81 ? 241 THR A CB  1 
ATOM   813  O OG1 . THR A 1 112 ? 1.476   19.503  0.973   1.00 40.04 ? 241 THR A OG1 1 
ATOM   814  C CG2 . THR A 1 112 ? 3.777   19.321  1.702   1.00 38.37 ? 241 THR A CG2 1 
ATOM   815  N N   . GLU A 1 113 ? 1.265   22.785  1.374   1.00 47.05 ? 242 GLU A N   1 
ATOM   816  C CA  . GLU A 1 113 ? 0.312   23.773  0.881   1.00 49.83 ? 242 GLU A CA  1 
ATOM   817  C C   . GLU A 1 113 ? -0.975  23.149  0.344   1.00 50.00 ? 242 GLU A C   1 
ATOM   818  O O   . GLU A 1 113 ? -2.070  23.609  0.673   1.00 49.31 ? 242 GLU A O   1 
ATOM   819  C CB  . GLU A 1 113 ? 0.997   24.653  -0.180  1.00 52.23 ? 242 GLU A CB  1 
ATOM   820  C CG  . GLU A 1 113 ? 2.402   24.180  -0.582  1.00 53.15 ? 242 GLU A CG  1 
ATOM   821  C CD  . GLU A 1 113 ? 3.371   24.052  0.600   1.00 53.11 ? 242 GLU A CD  1 
ATOM   822  O OE1 . GLU A 1 113 ? 4.229   23.144  0.583   1.00 53.15 ? 242 GLU A OE1 1 
ATOM   823  O OE2 . GLU A 1 113 ? 3.270   24.841  1.563   1.00 53.76 ? 242 GLU A OE2 1 
ATOM   824  N N   . GLN A 1 114 ? -0.835  22.100  -0.465  1.00 50.71 ? 243 GLN A N   1 
ATOM   825  C CA  . GLN A 1 114 ? -1.984  21.364  -1.004  1.00 50.86 ? 243 GLN A CA  1 
ATOM   826  C C   . GLN A 1 114 ? -2.671  20.563  0.101   1.00 51.12 ? 243 GLN A C   1 
ATOM   827  O O   . GLN A 1 114 ? -3.896  20.406  0.108   1.00 50.69 ? 243 GLN A O   1 
ATOM   828  C CB  . GLN A 1 114 ? -1.544  20.445  -2.138  1.00 49.16 ? 243 GLN A CB  1 
ATOM   829  N N   . THR A 1 115 ? -1.859  20.076  1.033   1.00 50.64 ? 244 THR A N   1 
ATOM   830  C CA  . THR A 1 115 ? -2.308  19.236  2.138   1.00 51.21 ? 244 THR A CA  1 
ATOM   831  C C   . THR A 1 115 ? -3.036  20.015  3.245   1.00 50.24 ? 244 THR A C   1 
ATOM   832  O O   . THR A 1 115 ? -3.934  19.475  3.897   1.00 49.75 ? 244 THR A O   1 
ATOM   833  C CB  . THR A 1 115 ? -1.110  18.444  2.706   1.00 51.36 ? 244 THR A CB  1 
ATOM   834  O OG1 . THR A 1 115 ? -1.036  17.162  2.067   1.00 52.05 ? 244 THR A OG1 1 
ATOM   835  C CG2 . THR A 1 115 ? -1.225  18.251  4.195   1.00 52.67 ? 244 THR A CG2 1 
ATOM   836  N N   . ALA A 1 116 ? -2.655  21.282  3.429   1.00 50.77 ? 245 ALA A N   1 
ATOM   837  C CA  . ALA A 1 116 ? -3.158  22.132  4.527   1.00 50.83 ? 245 ALA A CA  1 
ATOM   838  C C   . ALA A 1 116 ? -4.691  22.180  4.717   1.00 50.43 ? 245 ALA A C   1 
ATOM   839  O O   . ALA A 1 116 ? -5.160  21.972  5.836   1.00 50.79 ? 245 ALA A O   1 
ATOM   840  C CB  . ALA A 1 116 ? -2.575  23.541  4.434   1.00 49.35 ? 245 ALA A CB  1 
ATOM   841  N N   . PRO A 1 117 ? -5.471  22.446  3.639   1.00 50.48 ? 246 PRO A N   1 
ATOM   842  C CA  . PRO A 1 117 ? -6.936  22.491  3.799   1.00 50.92 ? 246 PRO A CA  1 
ATOM   843  C C   . PRO A 1 117 ? -7.583  21.148  4.169   1.00 52.06 ? 246 PRO A C   1 
ATOM   844  O O   . PRO A 1 117 ? -8.624  21.129  4.834   1.00 51.85 ? 246 PRO A O   1 
ATOM   845  C CB  . PRO A 1 117 ? -7.430  22.949  2.420   1.00 50.04 ? 246 PRO A CB  1 
ATOM   846  C CG  . PRO A 1 117 ? -6.330  22.609  1.476   1.00 50.03 ? 246 PRO A CG  1 
ATOM   847  C CD  . PRO A 1 117 ? -5.070  22.810  2.265   1.00 50.68 ? 246 PRO A CD  1 
ATOM   848  N N   . LYS A 1 118 ? -6.966  20.046  3.741   1.00 52.98 ? 247 LYS A N   1 
ATOM   849  C CA  . LYS A 1 118 ? -7.489  18.700  3.986   1.00 51.88 ? 247 LYS A CA  1 
ATOM   850  C C   . LYS A 1 118 ? -7.232  18.221  5.420   1.00 52.33 ? 247 LYS A C   1 
ATOM   851  O O   . LYS A 1 118 ? -7.942  17.349  5.923   1.00 49.57 ? 247 LYS A O   1 
ATOM   852  C CB  . LYS A 1 118 ? -6.906  17.706  2.975   1.00 51.63 ? 247 LYS A CB  1 
ATOM   853  C CG  . LYS A 1 118 ? -7.266  18.006  1.527   1.00 52.47 ? 247 LYS A CG  1 
ATOM   854  C CD  . LYS A 1 118 ? -6.544  17.060  0.580   1.00 54.39 ? 247 LYS A CD  1 
ATOM   855  C CE  . LYS A 1 118 ? -6.500  17.615  -0.836  1.00 55.13 ? 247 LYS A CE  1 
ATOM   856  N NZ  . LYS A 1 118 ? -5.900  16.640  -1.790  1.00 54.68 ? 247 LYS A NZ  1 
ATOM   857  N N   . ILE A 1 119 ? -6.216  18.797  6.064   1.00 53.57 ? 248 ILE A N   1 
ATOM   858  C CA  . ILE A 1 119 ? -5.887  18.493  7.461   1.00 54.87 ? 248 ILE A CA  1 
ATOM   859  C C   . ILE A 1 119 ? -6.920  19.085  8.420   1.00 56.78 ? 248 ILE A C   1 
ATOM   860  O O   . ILE A 1 119 ? -7.438  18.381  9.290   1.00 56.38 ? 248 ILE A O   1 
ATOM   861  C CB  . ILE A 1 119 ? -4.460  18.969  7.832   1.00 55.67 ? 248 ILE A CB  1 
ATOM   862  C CG1 . ILE A 1 119 ? -3.414  18.042  7.199   1.00 56.57 ? 248 ILE A CG1 1 
ATOM   863  C CG2 . ILE A 1 119 ? -4.275  19.041  9.347   1.00 53.76 ? 248 ILE A CG2 1 
ATOM   864  C CD1 . ILE A 1 119 ? -1.974  18.432  7.467   1.00 58.97 ? 248 ILE A CD1 1 
ATOM   865  N N   . PHE A 1 120 ? -7.221  20.373  8.243   1.00 59.84 ? 249 PHE A N   1 
ATOM   866  C CA  . PHE A 1 120 ? -8.159  21.085  9.113   1.00 60.83 ? 249 PHE A CA  1 
ATOM   867  C C   . PHE A 1 120 ? -9.595  20.596  8.934   1.00 62.14 ? 249 PHE A C   1 
ATOM   868  O O   . PHE A 1 120 ? -10.374 20.578  9.890   1.00 62.04 ? 249 PHE A O   1 
ATOM   869  C CB  . PHE A 1 120 ? -8.066  22.588  8.879   1.00 60.27 ? 249 PHE A CB  1 
ATOM   870  N N   . GLY A 1 121 ? -9.928  20.189  7.709   1.00 64.14 ? 250 GLY A N   1 
ATOM   871  C CA  . GLY A 1 121 ? -11.270 19.712  7.371   1.00 67.24 ? 250 GLY A CA  1 
ATOM   872  C C   . GLY A 1 121 ? -11.616 18.318  7.867   1.00 69.53 ? 250 GLY A C   1 
ATOM   873  O O   . GLY A 1 121 ? -12.797 17.976  7.983   1.00 68.91 ? 250 GLY A O   1 
ATOM   874  N N   . GLY A 1 122 ? -10.590 17.517  8.156   1.00 71.55 ? 251 GLY A N   1 
ATOM   875  C CA  . GLY A 1 122 ? -10.765 16.139  8.632   1.00 73.50 ? 251 GLY A CA  1 
ATOM   876  C C   . GLY A 1 122 ? -11.624 16.017  9.880   1.00 73.90 ? 251 GLY A C   1 
ATOM   877  O O   . GLY A 1 122 ? -11.525 16.839  10.797  1.00 77.03 ? 251 GLY A O   1 
ATOM   878  N N   . GLU A 1 123 ? -12.459 14.979  9.913   1.00 70.83 ? 252 GLU A N   1 
ATOM   879  C CA  . GLU A 1 123 ? -13.425 14.774  10.994  1.00 68.38 ? 252 GLU A CA  1 
ATOM   880  C C   . GLU A 1 123 ? -12.819 14.130  12.245  1.00 66.97 ? 252 GLU A C   1 
ATOM   881  O O   . GLU A 1 123 ? -13.546 13.768  13.173  1.00 65.48 ? 252 GLU A O   1 
ATOM   882  C CB  . GLU A 1 123 ? -14.611 13.958  10.490  1.00 68.49 ? 252 GLU A CB  1 
ATOM   883  N N   . ILE A 1 124 ? -11.495 13.999  12.271  1.00 66.80 ? 253 ILE A N   1 
ATOM   884  C CA  . ILE A 1 124 ? -10.791 13.383  13.400  1.00 65.37 ? 253 ILE A CA  1 
ATOM   885  C C   . ILE A 1 124 ? -10.572 14.397  14.532  1.00 63.51 ? 253 ILE A C   1 
ATOM   886  O O   . ILE A 1 124 ? -10.797 14.085  15.705  1.00 65.00 ? 253 ILE A O   1 
ATOM   887  C CB  . ILE A 1 124 ? -9.464  12.713  12.956  1.00 65.64 ? 253 ILE A CB  1 
ATOM   888  C CG1 . ILE A 1 124 ? -9.734  11.595  11.940  1.00 65.72 ? 253 ILE A CG1 1 
ATOM   889  C CG2 . ILE A 1 124 ? -8.707  12.135  14.145  1.00 65.09 ? 253 ILE A CG2 1 
ATOM   890  C CD1 . ILE A 1 124 ? -9.863  12.065  10.505  1.00 66.34 ? 253 ILE A CD1 1 
ATOM   891  N N   . LYS A 1 125 ? -10.142 15.604  14.166  1.00 60.28 ? 254 LYS A N   1 
ATOM   892  C CA  . LYS A 1 125 ? -10.033 16.756  15.086  0.50 57.94 ? 254 LYS A CA  1 
ATOM   893  C C   . LYS A 1 125 ? -8.880  16.748  16.104  1.00 56.05 ? 254 LYS A C   1 
ATOM   894  O O   . LYS A 1 125 ? -8.420  17.813  16.512  1.00 56.04 ? 254 LYS A O   1 
ATOM   895  C CB  . LYS A 1 125 ? -11.371 17.073  15.777  0.50 57.22 ? 254 LYS A CB  1 
ATOM   896  C CG  . LYS A 1 125 ? -12.256 18.039  15.003  0.50 57.12 ? 254 LYS A CG  1 
ATOM   897  C CD  . LYS A 1 125 ? -12.948 17.361  13.832  0.50 56.89 ? 254 LYS A CD  1 
ATOM   898  C CE  . LYS A 1 125 ? -13.596 18.376  12.904  0.50 56.72 ? 254 LYS A CE  1 
ATOM   899  N NZ  . LYS A 1 125 ? -12.581 19.117  12.105  0.50 56.89 ? 254 LYS A NZ  1 
ATOM   900  N N   . THR A 1 126 ? -8.418  15.562  16.503  1.00 54.09 ? 255 THR A N   1 
ATOM   901  C CA  . THR A 1 126 ? -7.256  15.439  17.393  1.00 52.56 ? 255 THR A CA  1 
ATOM   902  C C   . THR A 1 126 ? -5.995  15.084  16.597  1.00 50.23 ? 255 THR A C   1 
ATOM   903  O O   . THR A 1 126 ? -5.891  14.001  16.017  1.00 50.37 ? 255 THR A O   1 
ATOM   904  C CB  . THR A 1 126 ? -7.494  14.421  18.525  1.00 53.71 ? 255 THR A CB  1 
ATOM   905  O OG1 . THR A 1 126 ? -8.753  14.694  19.151  1.00 58.25 ? 255 THR A OG1 1 
ATOM   906  C CG2 . THR A 1 126 ? -6.391  14.509  19.576  1.00 53.86 ? 255 THR A CG2 1 
ATOM   907  N N   . HIS A 1 127 ? -5.045  16.015  16.578  1.00 46.12 ? 256 HIS A N   1 
ATOM   908  C CA  . HIS A 1 127 ? -3.887  15.936  15.694  1.00 41.54 ? 256 HIS A CA  1 
ATOM   909  C C   . HIS A 1 127 ? -2.591  15.859  16.490  1.00 40.19 ? 256 HIS A C   1 
ATOM   910  O O   . HIS A 1 127 ? -2.428  16.536  17.510  1.00 39.31 ? 256 HIS A O   1 
ATOM   911  C CB  . HIS A 1 127 ? -3.844  17.160  14.763  1.00 41.46 ? 256 HIS A CB  1 
ATOM   912  C CG  . HIS A 1 127 ? -5.053  17.316  13.883  1.00 41.17 ? 256 HIS A CG  1 
ATOM   913  N ND1 . HIS A 1 127 ? -5.007  17.973  12.670  1.00 40.31 ? 256 HIS A ND1 1 
ATOM   914  C CD2 . HIS A 1 127 ? -6.336  16.910  14.038  1.00 40.96 ? 256 HIS A CD2 1 
ATOM   915  C CE1 . HIS A 1 127 ? -6.208  17.963  12.118  1.00 40.06 ? 256 HIS A CE1 1 
ATOM   916  N NE2 . HIS A 1 127 ? -7.033  17.325  12.928  1.00 41.10 ? 256 HIS A NE2 1 
ATOM   917  N N   . ILE A 1 128 ? -1.673  15.022  16.021  1.00 38.20 ? 257 ILE A N   1 
ATOM   918  C CA  . ILE A 1 128 ? -0.318  14.991  16.550  1.00 37.12 ? 257 ILE A CA  1 
ATOM   919  C C   . ILE A 1 128 ? 0.646   15.481  15.463  1.00 36.85 ? 257 ILE A C   1 
ATOM   920  O O   . ILE A 1 128 ? 0.613   15.001  14.329  1.00 37.35 ? 257 ILE A O   1 
ATOM   921  C CB  . ILE A 1 128 ? 0.063   13.588  17.095  1.00 37.06 ? 257 ILE A CB  1 
ATOM   922  C CG1 . ILE A 1 128 ? 1.390   13.649  17.854  1.00 37.43 ? 257 ILE A CG1 1 
ATOM   923  C CG2 . ILE A 1 128 ? 0.095   12.548  15.984  1.00 36.84 ? 257 ILE A CG2 1 
ATOM   924  C CD1 . ILE A 1 128 ? 1.746   12.388  18.616  1.00 37.95 ? 257 ILE A CD1 1 
ATOM   925  N N   . LEU A 1 129 ? 1.476   16.461  15.808  1.00 36.18 ? 258 LEU A N   1 
ATOM   926  C CA  . LEU A 1 129 ? 2.410   17.055  14.857  1.00 34.83 ? 258 LEU A CA  1 
ATOM   927  C C   . LEU A 1 129 ? 3.832   16.647  15.169  1.00 33.27 ? 258 LEU A C   1 
ATOM   928  O O   . LEU A 1 129 ? 4.364   16.986  16.224  1.00 34.24 ? 258 LEU A O   1 
ATOM   929  C CB  . LEU A 1 129 ? 2.334   18.583  14.888  1.00 36.40 ? 258 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 129 ? 1.265   19.379  14.147  1.00 38.21 ? 258 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 129 ? -0.119  19.167  14.742  1.00 38.26 ? 258 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 129 ? 1.644   20.851  14.214  1.00 39.18 ? 258 LEU A CD2 1 
ATOM   933  N N   . LEU A 1 130 ? 4.447   15.913  14.255  1.00 32.12 ? 259 LEU A N   1 
ATOM   934  C CA  . LEU A 1 130 ? 5.874   15.672  14.341  1.00 31.20 ? 259 LEU A CA  1 
ATOM   935  C C   . LEU A 1 130 ? 6.586   16.797  13.599  1.00 30.84 ? 259 LEU A C   1 
ATOM   936  O O   . LEU A 1 130 ? 6.293   17.074  12.433  1.00 30.25 ? 259 LEU A O   1 
ATOM   937  C CB  . LEU A 1 130 ? 6.250   14.306  13.755  1.00 29.74 ? 259 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 130 ? 7.732   13.918  13.711  1.00 29.82 ? 259 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 130 ? 8.400   14.002  15.085  1.00 30.36 ? 259 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 130 ? 7.906   12.534  13.109  1.00 28.59 ? 259 LEU A CD2 1 
ATOM   941  N N   . PHE A 1 131 ? 7.499   17.459  14.297  1.00 30.32 ? 260 PHE A N   1 
ATOM   942  C CA  . PHE A 1 131 ? 8.367   18.432  13.674  1.00 31.02 ? 260 PHE A CA  1 
ATOM   943  C C   . PHE A 1 131 ? 9.658   17.708  13.336  1.00 31.77 ? 260 PHE A C   1 
ATOM   944  O O   . PHE A 1 131 ? 10.526  17.537  14.186  1.00 31.61 ? 260 PHE A O   1 
ATOM   945  C CB  . PHE A 1 131 ? 8.603   19.624  14.607  1.00 30.47 ? 260 PHE A CB  1 
ATOM   946  C CG  . PHE A 1 131 ? 7.388   20.485  14.805  1.00 31.02 ? 260 PHE A CG  1 
ATOM   947  C CD1 . PHE A 1 131 ? 7.203   21.631  14.041  1.00 31.52 ? 260 PHE A CD1 1 
ATOM   948  C CD2 . PHE A 1 131 ? 6.421   20.150  15.746  1.00 30.39 ? 260 PHE A CD2 1 
ATOM   949  C CE1 . PHE A 1 131 ? 6.078   22.425  14.217  1.00 32.14 ? 260 PHE A CE1 1 
ATOM   950  C CE2 . PHE A 1 131 ? 5.300   20.941  15.926  1.00 30.98 ? 260 PHE A CE2 1 
ATOM   951  C CZ  . PHE A 1 131 ? 5.125   22.081  15.159  1.00 31.18 ? 260 PHE A CZ  1 
ATOM   952  N N   . LEU A 1 132 ? 9.756   17.260  12.090  1.00 32.56 ? 261 LEU A N   1 
ATOM   953  C CA  . LEU A 1 132 ? 10.885  16.464  11.629  1.00 32.30 ? 261 LEU A CA  1 
ATOM   954  C C   . LEU A 1 132 ? 11.679  17.221  10.562  1.00 32.49 ? 261 LEU A C   1 
ATOM   955  O O   . LEU A 1 132 ? 11.220  17.343  9.428   1.00 33.26 ? 261 LEU A O   1 
ATOM   956  C CB  . LEU A 1 132 ? 10.382  15.121  11.083  1.00 32.52 ? 261 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 132 ? 11.339  13.957  10.797  1.00 33.03 ? 261 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 132 ? 11.925  13.364  12.072  1.00 33.30 ? 261 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 132 ? 10.595  12.887  10.017  1.00 33.37 ? 261 LEU A CD2 1 
ATOM   960  N N   . PRO A 1 133 ? 12.866  17.744  10.928  1.00 33.02 ? 262 PRO A N   1 
ATOM   961  C CA  . PRO A 1 133 ? 13.783  18.375  9.976   1.00 32.88 ? 262 PRO A CA  1 
ATOM   962  C C   . PRO A 1 133 ? 14.263  17.406  8.897   1.00 33.89 ? 262 PRO A C   1 
ATOM   963  O O   . PRO A 1 133 ? 14.740  16.314  9.214   1.00 33.14 ? 262 PRO A O   1 
ATOM   964  C CB  . PRO A 1 133 ? 14.964  18.812  10.851  1.00 32.35 ? 262 PRO A CB  1 
ATOM   965  C CG  . PRO A 1 133 ? 14.823  18.064  12.131  1.00 33.62 ? 262 PRO A CG  1 
ATOM   966  C CD  . PRO A 1 133 ? 13.349  17.880  12.315  1.00 33.87 ? 262 PRO A CD  1 
ATOM   967  N N   . LYS A 1 134 ? 14.150  17.808  7.631   1.00 34.45 ? 263 LYS A N   1 
ATOM   968  C CA  . LYS A 1 134 ? 14.537  16.927  6.519   1.00 36.15 ? 263 LYS A CA  1 
ATOM   969  C C   . LYS A 1 134 ? 16.046  16.656  6.469   1.00 35.94 ? 263 LYS A C   1 
ATOM   970  O O   . LYS A 1 134 ? 16.506  15.777  5.744   1.00 34.98 ? 263 LYS A O   1 
ATOM   971  C CB  . LYS A 1 134 ? 14.001  17.450  5.180   1.00 35.72 ? 263 LYS A CB  1 
ATOM   972  C CG  . LYS A 1 134 ? 12.543  17.086  4.959   1.00 36.51 ? 263 LYS A CG  1 
ATOM   973  C CD  . LYS A 1 134 ? 12.091  17.314  3.528   1.00 37.09 ? 263 LYS A CD  1 
ATOM   974  C CE  . LYS A 1 134 ? 10.718  16.693  3.317   1.00 38.32 ? 263 LYS A CE  1 
ATOM   975  N NZ  . LYS A 1 134 ? 10.015  17.206  2.105   1.00 38.76 ? 263 LYS A NZ  1 
ATOM   976  N N   . SER A 1 135 ? 16.792  17.411  7.270   1.00 37.70 ? 264 SER A N   1 
ATOM   977  C CA  . SER A 1 135 ? 18.238  17.272  7.391   1.00 40.33 ? 264 SER A CA  1 
ATOM   978  C C   . SER A 1 135 ? 18.659  16.315  8.518   1.00 42.39 ? 264 SER A C   1 
ATOM   979  O O   . SER A 1 135 ? 19.820  15.905  8.575   1.00 41.83 ? 264 SER A O   1 
ATOM   980  C CB  . SER A 1 135 ? 18.862  18.648  7.620   1.00 41.08 ? 264 SER A CB  1 
ATOM   981  O OG  . SER A 1 135 ? 20.160  18.540  8.169   1.00 44.68 ? 264 SER A OG  1 
ATOM   982  N N   . VAL A 1 136 ? 17.724  15.973  9.407   1.00 44.21 ? 265 VAL A N   1 
ATOM   983  C CA  . VAL A 1 136 ? 18.004  15.084  10.544  1.00 46.46 ? 265 VAL A CA  1 
ATOM   984  C C   . VAL A 1 136 ? 18.565  13.741  10.074  1.00 48.78 ? 265 VAL A C   1 
ATOM   985  O O   . VAL A 1 136 ? 18.128  13.193  9.054   1.00 49.84 ? 265 VAL A O   1 
ATOM   986  C CB  . VAL A 1 136 ? 16.761  14.875  11.458  1.00 44.48 ? 265 VAL A CB  1 
ATOM   987  C CG1 . VAL A 1 136 ? 15.834  13.795  10.911  1.00 43.53 ? 265 VAL A CG1 1 
ATOM   988  C CG2 . VAL A 1 136 ? 17.184  14.532  12.879  1.00 44.24 ? 265 VAL A CG2 1 
ATOM   989  N N   . SER A 1 137 ? 19.554  13.239  10.811  1.00 50.57 ? 266 SER A N   1 
ATOM   990  C CA  . SER A 1 137 ? 20.133  11.925  10.556  1.00 51.83 ? 266 SER A CA  1 
ATOM   991  C C   . SER A 1 137 ? 19.099  10.871  10.905  1.00 52.10 ? 266 SER A C   1 
ATOM   992  O O   . SER A 1 137 ? 18.373  11.032  11.883  1.00 53.55 ? 266 SER A O   1 
ATOM   993  C CB  . SER A 1 137 ? 21.387  11.729  11.404  1.00 52.59 ? 266 SER A CB  1 
ATOM   994  O OG  . SER A 1 137 ? 21.925  10.435  11.222  1.00 54.95 ? 266 SER A OG  1 
ATOM   995  N N   . ASP A 1 138 ? 19.035  9.806   10.102  1.00 53.37 ? 267 ASP A N   1 
ATOM   996  C CA  . ASP A 1 138 ? 18.052  8.724   10.275  1.00 52.64 ? 267 ASP A CA  1 
ATOM   997  C C   . ASP A 1 138 ? 16.622  9.279   10.160  1.00 51.18 ? 267 ASP A C   1 
ATOM   998  O O   . ASP A 1 138 ? 15.783  9.101   11.047  1.00 50.56 ? 267 ASP A O   1 
ATOM   999  C CB  . ASP A 1 138 ? 18.294  7.981   11.605  1.00 53.72 ? 267 ASP A CB  1 
ATOM   1000 C CG  . ASP A 1 138 ? 17.414  6.753   11.776  1.00 54.24 ? 267 ASP A CG  1 
ATOM   1001 O OD1 . ASP A 1 138 ? 17.209  5.998   10.799  1.00 55.60 ? 267 ASP A OD1 1 
ATOM   1002 O OD2 . ASP A 1 138 ? 16.930  6.540   12.907  1.00 54.86 ? 267 ASP A OD2 1 
ATOM   1003 N N   . TYR A 1 139 ? 16.364  9.964   9.050   1.00 49.52 ? 268 TYR A N   1 
ATOM   1004 C CA  . TYR A 1 139 ? 15.096  10.647  8.823   1.00 46.95 ? 268 TYR A CA  1 
ATOM   1005 C C   . TYR A 1 139 ? 13.935  9.663   8.716   1.00 49.21 ? 268 TYR A C   1 
ATOM   1006 O O   . TYR A 1 139 ? 12.940  9.785   9.434   1.00 49.27 ? 268 TYR A O   1 
ATOM   1007 C CB  . TYR A 1 139 ? 15.192  11.523  7.568   1.00 43.74 ? 268 TYR A CB  1 
ATOM   1008 C CG  . TYR A 1 139 ? 13.896  12.176  7.136   1.00 41.27 ? 268 TYR A CG  1 
ATOM   1009 C CD1 . TYR A 1 139 ? 13.491  13.398  7.678   1.00 40.82 ? 268 TYR A CD1 1 
ATOM   1010 C CD2 . TYR A 1 139 ? 13.083  11.584  6.169   1.00 40.45 ? 268 TYR A CD2 1 
ATOM   1011 C CE1 . TYR A 1 139 ? 12.313  14.007  7.272   1.00 38.91 ? 268 TYR A CE1 1 
ATOM   1012 C CE2 . TYR A 1 139 ? 11.899  12.183  5.763   1.00 39.87 ? 268 TYR A CE2 1 
ATOM   1013 C CZ  . TYR A 1 139 ? 11.519  13.393  6.319   1.00 39.34 ? 268 TYR A CZ  1 
ATOM   1014 O OH  . TYR A 1 139 ? 10.345  13.991  5.917   1.00 38.66 ? 268 TYR A OH  1 
ATOM   1015 N N   . ASP A 1 140 ? 14.073  8.687   7.822   1.00 50.67 ? 269 ASP A N   1 
ATOM   1016 C CA  . ASP A 1 140 ? 13.020  7.705   7.576   1.00 50.02 ? 269 ASP A CA  1 
ATOM   1017 C C   . ASP A 1 140 ? 12.870  6.700   8.717   1.00 49.50 ? 269 ASP A C   1 
ATOM   1018 O O   . ASP A 1 140 ? 11.799  6.140   8.902   1.00 51.91 ? 269 ASP A O   1 
ATOM   1019 C CB  . ASP A 1 140 ? 13.237  7.007   6.229   1.00 49.52 ? 269 ASP A CB  1 
ATOM   1020 C CG  . ASP A 1 140 ? 12.944  7.922   5.050   1.00 48.55 ? 269 ASP A CG  1 
ATOM   1021 O OD1 . ASP A 1 140 ? 11.755  8.213   4.813   1.00 47.97 ? 269 ASP A OD1 1 
ATOM   1022 O OD2 . ASP A 1 140 ? 13.897  8.347   4.360   1.00 46.98 ? 269 ASP A OD2 1 
ATOM   1023 N N   . GLY A 1 141 ? 13.937  6.493   9.484   1.00 50.38 ? 270 GLY A N   1 
ATOM   1024 C CA  . GLY A 1 141 ? 13.879  5.685   10.704  1.00 51.65 ? 270 GLY A CA  1 
ATOM   1025 C C   . GLY A 1 141 ? 13.085  6.360   11.810  1.00 52.27 ? 270 GLY A C   1 
ATOM   1026 O O   . GLY A 1 141 ? 12.348  5.699   12.547  1.00 53.41 ? 270 GLY A O   1 
ATOM   1027 N N   . LYS A 1 142 ? 13.243  7.678   11.928  1.00 50.94 ? 271 LYS A N   1 
ATOM   1028 C CA  . LYS A 1 142 ? 12.438  8.482   12.850  1.00 49.19 ? 271 LYS A CA  1 
ATOM   1029 C C   . LYS A 1 142 ? 10.998  8.599   12.358  1.00 48.90 ? 271 LYS A C   1 
ATOM   1030 O O   . LYS A 1 142 ? 10.056  8.554   13.150  1.00 50.40 ? 271 LYS A O   1 
ATOM   1031 C CB  . LYS A 1 142 ? 13.055  9.869   13.041  1.00 46.84 ? 271 LYS A CB  1 
ATOM   1032 C CG  . LYS A 1 142 ? 14.295  9.866   13.917  1.00 45.55 ? 271 LYS A CG  1 
ATOM   1033 C CD  . LYS A 1 142 ? 14.945  11.237  13.968  1.00 43.96 ? 271 LYS A CD  1 
ATOM   1034 C CE  . LYS A 1 142 ? 16.259  11.195  14.729  1.00 43.43 ? 271 LYS A CE  1 
ATOM   1035 N NZ  . LYS A 1 142 ? 17.203  10.216  14.125  1.00 43.19 ? 271 LYS A NZ  1 
ATOM   1036 N N   . LEU A 1 143 ? 10.833  8.737   11.045  1.00 48.07 ? 272 LEU A N   1 
ATOM   1037 C CA  . LEU A 1 143 ? 9.511   8.787   10.433  1.00 47.37 ? 272 LEU A CA  1 
ATOM   1038 C C   . LEU A 1 143 ? 8.821   7.427   10.514  1.00 48.96 ? 272 LEU A C   1 
ATOM   1039 O O   . LEU A 1 143 ? 7.593   7.358   10.545  1.00 48.80 ? 272 LEU A O   1 
ATOM   1040 C CB  . LEU A 1 143 ? 9.612   9.256   8.979   1.00 46.43 ? 272 LEU A CB  1 
ATOM   1041 C CG  . LEU A 1 143 ? 8.337   9.457   8.157   1.00 45.89 ? 272 LEU A CG  1 
ATOM   1042 C CD1 . LEU A 1 143 ? 7.433   10.527  8.751   1.00 48.11 ? 272 LEU A CD1 1 
ATOM   1043 C CD2 . LEU A 1 143 ? 8.695   9.805   6.724   1.00 46.72 ? 272 LEU A CD2 1 
ATOM   1044 N N   . SER A 1 144 ? 9.620   6.359   10.553  1.00 49.83 ? 273 SER A N   1 
ATOM   1045 C CA  . SER A 1 144 ? 9.113   4.985   10.631  1.00 50.83 ? 273 SER A CA  1 
ATOM   1046 C C   . SER A 1 144 ? 8.409   4.720   11.962  1.00 50.36 ? 273 SER A C   1 
ATOM   1047 O O   . SER A 1 144 ? 7.334   4.113   11.993  1.00 49.10 ? 273 SER A O   1 
ATOM   1048 C CB  . SER A 1 144 ? 10.248  3.978   10.421  1.00 51.62 ? 273 SER A CB  1 
ATOM   1049 O OG  . SER A 1 144 ? 9.746   2.691   10.105  1.00 53.94 ? 273 SER A OG  1 
ATOM   1050 N N   . ASN A 1 145 ? 9.022   5.181   13.052  1.00 51.24 ? 274 ASN A N   1 
ATOM   1051 C CA  . ASN A 1 145 ? 8.428   5.080   14.387  1.00 53.18 ? 274 ASN A CA  1 
ATOM   1052 C C   . ASN A 1 145 ? 7.106   5.843   14.493  1.00 53.77 ? 274 ASN A C   1 
ATOM   1053 O O   . ASN A 1 145 ? 6.159   5.378   15.138  1.00 54.45 ? 274 ASN A O   1 
ATOM   1054 C CB  . ASN A 1 145 ? 9.418   5.555   15.456  1.00 55.06 ? 274 ASN A CB  1 
ATOM   1055 C CG  . ASN A 1 145 ? 10.717  4.768   15.440  1.00 55.81 ? 274 ASN A CG  1 
ATOM   1056 O OD1 . ASN A 1 145 ? 10.787  3.672   14.883  1.00 58.39 ? 274 ASN A OD1 1 
ATOM   1057 N ND2 . ASN A 1 145 ? 11.755  5.326   16.051  1.00 56.08 ? 274 ASN A ND2 1 
ATOM   1058 N N   . PHE A 1 146 ? 7.051   7.003   13.837  1.00 50.76 ? 275 PHE A N   1 
ATOM   1059 C CA  . PHE A 1 146 ? 5.846   7.824   13.759  1.00 48.79 ? 275 PHE A CA  1 
ATOM   1060 C C   . PHE A 1 146 ? 4.701   7.073   13.063  1.00 48.58 ? 275 PHE A C   1 
ATOM   1061 O O   . PHE A 1 146 ? 3.545   7.206   13.455  1.00 47.01 ? 275 PHE A O   1 
ATOM   1062 C CB  . PHE A 1 146 ? 6.171   9.143   13.037  1.00 46.73 ? 275 PHE A CB  1 
ATOM   1063 C CG  . PHE A 1 146 ? 5.134   10.224  13.213  1.00 44.20 ? 275 PHE A CG  1 
ATOM   1064 C CD1 . PHE A 1 146 ? 4.821   10.721  14.477  1.00 43.70 ? 275 PHE A CD1 1 
ATOM   1065 C CD2 . PHE A 1 146 ? 4.504   10.782  12.105  1.00 43.10 ? 275 PHE A CD2 1 
ATOM   1066 C CE1 . PHE A 1 146 ? 3.877   11.728  14.630  1.00 42.49 ? 275 PHE A CE1 1 
ATOM   1067 C CE2 . PHE A 1 146 ? 3.561   11.792  12.253  1.00 42.21 ? 275 PHE A CE2 1 
ATOM   1068 C CZ  . PHE A 1 146 ? 3.246   12.263  13.517  1.00 41.37 ? 275 PHE A CZ  1 
ATOM   1069 N N   . LYS A 1 147 ? 5.037   6.283   12.040  1.00 51.62 ? 276 LYS A N   1 
ATOM   1070 C CA  . LYS A 1 147 ? 4.069   5.433   11.328  1.00 52.51 ? 276 LYS A CA  1 
ATOM   1071 C C   . LYS A 1 147 ? 3.600   4.270   12.201  1.00 52.73 ? 276 LYS A C   1 
ATOM   1072 O O   . LYS A 1 147 ? 2.415   3.946   12.208  1.00 52.13 ? 276 LYS A O   1 
ATOM   1073 C CB  . LYS A 1 147 ? 4.664   4.876   10.026  1.00 53.96 ? 276 LYS A CB  1 
ATOM   1074 C CG  . LYS A 1 147 ? 5.032   5.909   8.970   1.00 55.57 ? 276 LYS A CG  1 
ATOM   1075 C CD  . LYS A 1 147 ? 5.967   5.308   7.926   1.00 56.09 ? 276 LYS A CD  1 
ATOM   1076 C CE  . LYS A 1 147 ? 6.540   6.363   6.991   1.00 53.72 ? 276 LYS A CE  1 
ATOM   1077 N NZ  . LYS A 1 147 ? 7.458   5.765   5.982   1.00 51.61 ? 276 LYS A NZ  1 
ATOM   1078 N N   . THR A 1 148 ? 4.539   3.649   12.920  1.00 54.15 ? 277 THR A N   1 
ATOM   1079 C CA  . THR A 1 148 ? 4.258   2.534   13.836  1.00 54.72 ? 277 THR A CA  1 
ATOM   1080 C C   . THR A 1 148 ? 3.263   2.947   14.923  1.00 56.80 ? 277 THR A C   1 
ATOM   1081 O O   . THR A 1 148 ? 2.333   2.200   15.239  1.00 59.55 ? 277 THR A O   1 
ATOM   1082 C CB  . THR A 1 148 ? 5.555   1.998   14.493  1.00 55.06 ? 277 THR A CB  1 
ATOM   1083 O OG1 . THR A 1 148 ? 6.511   1.668   13.477  1.00 54.23 ? 277 THR A OG1 1 
ATOM   1084 C CG2 . THR A 1 148 ? 5.278   0.754   15.346  1.00 54.28 ? 277 THR A CG2 1 
ATOM   1085 N N   . ALA A 1 149 ? 3.462   4.136   15.488  1.00 56.69 ? 278 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 149 ? 2.524   4.705   16.453  1.00 56.88 ? 278 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 149 ? 1.201   5.112   15.797  1.00 57.13 ? 278 ALA A C   1 
ATOM   1088 O O   . ALA A 1 149 ? 0.143   5.036   16.426  1.00 59.95 ? 278 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 149 ? 3.152   5.887   17.172  1.00 55.88 ? 278 ALA A CB  1 
ATOM   1090 N N   . ALA A 1 150 ? 1.265   5.530   14.534  1.00 56.01 ? 279 ALA A N   1 
ATOM   1091 C CA  . ALA A 1 150 ? 0.074   5.907   13.766  1.00 56.40 ? 279 ALA A CA  1 
ATOM   1092 C C   . ALA A 1 150 ? -0.884  4.734   13.556  1.00 57.56 ? 279 ALA A C   1 
ATOM   1093 O O   . ALA A 1 150 ? -2.085  4.934   13.351  1.00 57.99 ? 279 ALA A O   1 
ATOM   1094 C CB  . ALA A 1 150 ? 0.470   6.516   12.428  1.00 56.65 ? 279 ALA A CB  1 
ATOM   1095 N N   . GLU A 1 151 ? -0.341  3.518   13.602  1.00 58.71 ? 280 GLU A N   1 
ATOM   1096 C CA  . GLU A 1 151 ? -1.140  2.297   13.505  1.00 58.81 ? 280 GLU A CA  1 
ATOM   1097 C C   . GLU A 1 151 ? -2.092  2.195   14.697  1.00 57.38 ? 280 GLU A C   1 
ATOM   1098 O O   . GLU A 1 151 ? -3.283  1.923   14.528  1.00 58.07 ? 280 GLU A O   1 
ATOM   1099 C CB  . GLU A 1 151 ? -0.240  1.053   13.451  1.00 59.89 ? 280 GLU A CB  1 
ATOM   1100 C CG  . GLU A 1 151 ? 0.856   1.072   12.390  1.00 61.87 ? 280 GLU A CG  1 
ATOM   1101 C CD  . GLU A 1 151 ? 0.340   0.869   10.975  1.00 63.15 ? 280 GLU A CD  1 
ATOM   1102 O OE1 . GLU A 1 151 ? -0.738  0.254   10.805  1.00 63.31 ? 280 GLU A OE1 1 
ATOM   1103 O OE2 . GLU A 1 151 ? 1.024   1.318   10.030  1.00 61.66 ? 280 GLU A OE2 1 
ATOM   1104 N N   . SER A 1 152 ? -1.553  2.443   15.891  1.00 56.35 ? 281 SER A N   1 
ATOM   1105 C CA  . SER A 1 152 ? -2.283  2.309   17.156  1.00 55.42 ? 281 SER A CA  1 
ATOM   1106 C C   . SER A 1 152 ? -3.463  3.273   17.309  1.00 56.25 ? 281 SER A C   1 
ATOM   1107 O O   . SER A 1 152 ? -4.356  3.035   18.127  1.00 57.05 ? 281 SER A O   1 
ATOM   1108 C CB  . SER A 1 152 ? -1.329  2.498   18.343  1.00 55.85 ? 281 SER A CB  1 
ATOM   1109 O OG  . SER A 1 152 ? -0.131  1.758   18.184  1.00 54.09 ? 281 SER A OG  1 
ATOM   1110 N N   . PHE A 1 153 ? -3.467  4.356   16.531  1.00 56.04 ? 282 PHE A N   1 
ATOM   1111 C CA  . PHE A 1 153 ? -4.457  5.421   16.711  1.00 55.63 ? 282 PHE A CA  1 
ATOM   1112 C C   . PHE A 1 153 ? -5.207  5.822   15.443  1.00 53.62 ? 282 PHE A C   1 
ATOM   1113 O O   . PHE A 1 153 ? -5.824  6.884   15.401  1.00 53.85 ? 282 PHE A O   1 
ATOM   1114 C CB  . PHE A 1 153 ? -3.811  6.649   17.372  1.00 56.05 ? 282 PHE A CB  1 
ATOM   1115 C CG  . PHE A 1 153 ? -3.230  6.369   18.729  1.00 57.94 ? 282 PHE A CG  1 
ATOM   1116 C CD1 . PHE A 1 153 ? -1.866  6.136   18.881  1.00 58.25 ? 282 PHE A CD1 1 
ATOM   1117 C CD2 . PHE A 1 153 ? -4.047  6.320   19.856  1.00 57.60 ? 282 PHE A CD2 1 
ATOM   1118 C CE1 . PHE A 1 153 ? -1.327  5.867   20.131  1.00 59.43 ? 282 PHE A CE1 1 
ATOM   1119 C CE2 . PHE A 1 153 ? -3.514  6.050   21.108  1.00 59.26 ? 282 PHE A CE2 1 
ATOM   1120 C CZ  . PHE A 1 153 ? -2.152  5.824   21.246  1.00 59.49 ? 282 PHE A CZ  1 
ATOM   1121 N N   . LYS A 1 154 ? -5.167  4.970   14.422  1.00 54.61 ? 283 LYS A N   1 
ATOM   1122 C CA  . LYS A 1 154 ? -5.877  5.239   13.168  1.00 56.40 ? 283 LYS A CA  1 
ATOM   1123 C C   . LYS A 1 154 ? -7.365  5.444   13.440  1.00 56.58 ? 283 LYS A C   1 
ATOM   1124 O O   . LYS A 1 154 ? -7.995  4.633   14.120  1.00 58.66 ? 283 LYS A O   1 
ATOM   1125 C CB  . LYS A 1 154 ? -5.658  4.110   12.167  1.00 56.04 ? 283 LYS A CB  1 
ATOM   1126 N N   . GLY A 1 155 ? -7.910  6.547   12.933  1.00 55.93 ? 284 GLY A N   1 
ATOM   1127 C CA  . GLY A 1 155 ? -9.307  6.904   13.170  1.00 56.19 ? 284 GLY A CA  1 
ATOM   1128 C C   . GLY A 1 155 ? -9.547  7.566   14.517  1.00 56.09 ? 284 GLY A C   1 
ATOM   1129 O O   . GLY A 1 155 ? -10.671 7.974   14.822  1.00 56.34 ? 284 GLY A O   1 
ATOM   1130 N N   . LYS A 1 156 ? -8.492  7.667   15.326  1.00 55.35 ? 285 LYS A N   1 
ATOM   1131 C CA  . LYS A 1 156 ? -8.569  8.313   16.639  1.00 54.42 ? 285 LYS A CA  1 
ATOM   1132 C C   . LYS A 1 156 ? -7.703  9.580   16.709  1.00 53.33 ? 285 LYS A C   1 
ATOM   1133 O O   . LYS A 1 156 ? -8.131  10.597  17.263  1.00 52.84 ? 285 LYS A O   1 
ATOM   1134 C CB  . LYS A 1 156 ? -8.193  7.331   17.744  1.00 53.55 ? 285 LYS A CB  1 
ATOM   1135 N N   . ILE A 1 157 ? -6.493  9.509   16.151  1.00 50.97 ? 286 ILE A N   1 
ATOM   1136 C CA  . ILE A 1 157 ? -5.572  10.652  16.093  1.00 48.82 ? 286 ILE A CA  1 
ATOM   1137 C C   . ILE A 1 157 ? -4.917  10.762  14.714  1.00 48.56 ? 286 ILE A C   1 
ATOM   1138 O O   . ILE A 1 157 ? -4.266  9.819   14.246  1.00 48.82 ? 286 ILE A O   1 
ATOM   1139 C CB  . ILE A 1 157 ? -4.472  10.576  17.183  1.00 48.39 ? 286 ILE A CB  1 
ATOM   1140 C CG1 . ILE A 1 157 ? -5.094  10.555  18.585  1.00 46.90 ? 286 ILE A CG1 1 
ATOM   1141 C CG2 . ILE A 1 157 ? -3.494  11.742  17.043  1.00 47.17 ? 286 ILE A CG2 1 
ATOM   1142 C CD1 . ILE A 1 157 ? -4.152  10.120  19.684  1.00 48.04 ? 286 ILE A CD1 1 
ATOM   1143 N N   . LEU A 1 158 ? -5.091  11.917  14.074  1.00 47.45 ? 287 LEU A N   1 
ATOM   1144 C CA  . LEU A 1 158 ? -4.490  12.188  12.767  1.00 46.87 ? 287 LEU A CA  1 
ATOM   1145 C C   . LEU A 1 158 ? -3.003  12.556  12.893  1.00 44.35 ? 287 LEU A C   1 
ATOM   1146 O O   . LEU A 1 158 ? -2.653  13.584  13.471  1.00 44.34 ? 287 LEU A O   1 
ATOM   1147 C CB  . LEU A 1 158 ? -5.289  13.274  12.029  1.00 48.85 ? 287 LEU A CB  1 
ATOM   1148 C CG  . LEU A 1 158 ? -4.788  13.895  10.718  1.00 52.14 ? 287 LEU A CG  1 
ATOM   1149 C CD1 . LEU A 1 158 ? -4.279  12.858  9.726   1.00 54.28 ? 287 LEU A CD1 1 
ATOM   1150 C CD2 . LEU A 1 158 ? -5.885  14.742  10.085  1.00 53.19 ? 287 LEU A CD2 1 
ATOM   1151 N N   . PHE A 1 159 ? -2.141  11.699  12.347  1.00 42.02 ? 288 PHE A N   1 
ATOM   1152 C CA  . PHE A 1 159 ? -0.690  11.881  12.411  1.00 39.84 ? 288 PHE A CA  1 
ATOM   1153 C C   . PHE A 1 159 ? -0.172  12.776  11.281  1.00 39.85 ? 288 PHE A C   1 
ATOM   1154 O O   . PHE A 1 159 ? -0.393  12.500  10.099  1.00 39.92 ? 288 PHE A O   1 
ATOM   1155 C CB  . PHE A 1 159 ? 0.026   10.517  12.415  1.00 39.51 ? 288 PHE A CB  1 
ATOM   1156 C CG  . PHE A 1 159 ? 0.087   9.858   13.776  1.00 38.76 ? 288 PHE A CG  1 
ATOM   1157 C CD1 . PHE A 1 159 ? -1.078  9.525   14.470  1.00 38.12 ? 288 PHE A CD1 1 
ATOM   1158 C CD2 . PHE A 1 159 ? 1.314   9.556   14.362  1.00 38.53 ? 288 PHE A CD2 1 
ATOM   1159 C CE1 . PHE A 1 159 ? -1.015  8.926   15.722  1.00 37.83 ? 288 PHE A CE1 1 
ATOM   1160 C CE2 . PHE A 1 159 ? 1.384   8.955   15.616  1.00 37.87 ? 288 PHE A CE2 1 
ATOM   1161 C CZ  . PHE A 1 159 ? 0.217   8.639   16.297  1.00 37.56 ? 288 PHE A CZ  1 
ATOM   1162 N N   . ILE A 1 160 ? 0.513   13.854  11.661  1.00 38.58 ? 289 ILE A N   1 
ATOM   1163 C CA  . ILE A 1 160 ? 1.029   14.843  10.709  1.00 37.36 ? 289 ILE A CA  1 
ATOM   1164 C C   . ILE A 1 160 ? 2.502   15.127  10.969  1.00 37.21 ? 289 ILE A C   1 
ATOM   1165 O O   . ILE A 1 160 ? 2.911   15.286  12.122  1.00 38.77 ? 289 ILE A O   1 
ATOM   1166 C CB  . ILE A 1 160 ? 0.249   16.175  10.806  1.00 36.34 ? 289 ILE A CB  1 
ATOM   1167 C CG1 . ILE A 1 160 ? -1.245  15.945  10.573  1.00 35.45 ? 289 ILE A CG1 1 
ATOM   1168 C CG2 . ILE A 1 160 ? 0.792   17.207  9.820   1.00 35.71 ? 289 ILE A CG2 1 
ATOM   1169 C CD1 . ILE A 1 160 ? -2.129  16.867  11.374  1.00 36.14 ? 289 ILE A CD1 1 
ATOM   1170 N N   . PHE A 1 161 ? 3.300   15.181  9.905   1.00 36.85 ? 290 PHE A N   1 
ATOM   1171 C CA  . PHE A 1 161 ? 4.686   15.637  10.030  1.00 37.00 ? 290 PHE A CA  1 
ATOM   1172 C C   . PHE A 1 161 ? 4.954   16.915  9.233   1.00 36.09 ? 290 PHE A C   1 
ATOM   1173 O O   . PHE A 1 161 ? 4.303   17.176  8.220   1.00 35.68 ? 290 PHE A O   1 
ATOM   1174 C CB  . PHE A 1 161 ? 5.706   14.516  9.740   1.00 37.11 ? 290 PHE A CB  1 
ATOM   1175 C CG  . PHE A 1 161 ? 5.727   14.037  8.311   1.00 39.36 ? 290 PHE A CG  1 
ATOM   1176 C CD1 . PHE A 1 161 ? 6.778   14.377  7.468   1.00 39.62 ? 290 PHE A CD1 1 
ATOM   1177 C CD2 . PHE A 1 161 ? 4.718   13.214  7.816   1.00 40.96 ? 290 PHE A CD2 1 
ATOM   1178 C CE1 . PHE A 1 161 ? 6.814   13.925  6.154   1.00 41.21 ? 290 PHE A CE1 1 
ATOM   1179 C CE2 . PHE A 1 161 ? 4.749   12.756  6.503   1.00 41.91 ? 290 PHE A CE2 1 
ATOM   1180 C CZ  . PHE A 1 161 ? 5.800   13.111  5.672   1.00 41.27 ? 290 PHE A CZ  1 
ATOM   1181 N N   . ILE A 1 162 ? 5.887   17.722  9.736   1.00 36.29 ? 291 ILE A N   1 
ATOM   1182 C CA  . ILE A 1 162 ? 6.231   19.020  9.149   1.00 35.67 ? 291 ILE A CA  1 
ATOM   1183 C C   . ILE A 1 162 ? 7.745   19.186  9.125   1.00 35.34 ? 291 ILE A C   1 
ATOM   1184 O O   . ILE A 1 162 ? 8.432   18.794  10.072  1.00 36.03 ? 291 ILE A O   1 
ATOM   1185 C CB  . ILE A 1 162 ? 5.645   20.201  9.960   1.00 37.05 ? 291 ILE A CB  1 
ATOM   1186 C CG1 . ILE A 1 162 ? 4.343   19.804  10.667  1.00 38.09 ? 291 ILE A CG1 1 
ATOM   1187 C CG2 . ILE A 1 162 ? 5.437   21.423  9.066   1.00 36.98 ? 291 ILE A CG2 1 
ATOM   1188 C CD1 . ILE A 1 162 ? 3.815   20.858  11.617  1.00 40.13 ? 291 ILE A CD1 1 
ATOM   1189 N N   . ASP A 1 163 ? 8.261   19.771  8.049   1.00 34.92 ? 292 ASP A N   1 
ATOM   1190 C CA  . ASP A 1 163 ? 9.698   20.002  7.919   1.00 34.92 ? 292 ASP A CA  1 
ATOM   1191 C C   . ASP A 1 163 ? 10.132  21.251  8.693   1.00 35.18 ? 292 ASP A C   1 
ATOM   1192 O O   . ASP A 1 163 ? 9.861   22.389  8.290   1.00 35.95 ? 292 ASP A O   1 
ATOM   1193 C CB  . ASP A 1 163 ? 10.109  20.077  6.447   1.00 34.65 ? 292 ASP A CB  1 
ATOM   1194 C CG  . ASP A 1 163 ? 11.606  20.303  6.254   1.00 35.48 ? 292 ASP A CG  1 
ATOM   1195 O OD1 . ASP A 1 163 ? 12.409  20.053  7.186   1.00 36.61 ? 292 ASP A OD1 1 
ATOM   1196 O OD2 . ASP A 1 163 ? 11.982  20.728  5.144   1.00 34.18 ? 292 ASP A OD2 1 
ATOM   1197 N N   . SER A 1 164 ? 10.807  21.006  9.811   1.00 33.77 ? 293 SER A N   1 
ATOM   1198 C CA  . SER A 1 164 ? 11.324  22.047  10.697  1.00 33.12 ? 293 SER A CA  1 
ATOM   1199 C C   . SER A 1 164 ? 12.397  22.933  10.080  1.00 31.55 ? 293 SER A C   1 
ATOM   1200 O O   . SER A 1 164 ? 12.579  24.063  10.521  1.00 30.70 ? 293 SER A O   1 
ATOM   1201 C CB  . SER A 1 164 ? 11.888  21.412  11.971  1.00 33.27 ? 293 SER A CB  1 
ATOM   1202 O OG  . SER A 1 164 ? 10.872  21.282  12.936  1.00 35.50 ? 293 SER A OG  1 
ATOM   1203 N N   . ASP A 1 165 ? 13.115  22.407  9.089   1.00 31.28 ? 294 ASP A N   1 
ATOM   1204 C CA  . ASP A 1 165 ? 14.191  23.138  8.418   1.00 32.36 ? 294 ASP A CA  1 
ATOM   1205 C C   . ASP A 1 165 ? 13.668  24.244  7.503   1.00 32.95 ? 294 ASP A C   1 
ATOM   1206 O O   . ASP A 1 165 ? 14.335  25.270  7.311   1.00 31.67 ? 294 ASP A O   1 
ATOM   1207 C CB  . ASP A 1 165 ? 15.041  22.180  7.575   1.00 32.65 ? 294 ASP A CB  1 
ATOM   1208 C CG  . ASP A 1 165 ? 15.903  21.249  8.414   1.00 33.35 ? 294 ASP A CG  1 
ATOM   1209 O OD1 . ASP A 1 165 ? 16.138  21.523  9.613   1.00 32.22 ? 294 ASP A OD1 1 
ATOM   1210 O OD2 . ASP A 1 165 ? 16.365  20.236  7.851   1.00 34.29 ? 294 ASP A OD2 1 
ATOM   1211 N N   . HIS A 1 166 ? 12.482  24.030  6.935   1.00 33.44 ? 295 HIS A N   1 
ATOM   1212 C CA  . HIS A 1 166 ? 11.994  24.902  5.868   1.00 33.73 ? 295 HIS A CA  1 
ATOM   1213 C C   . HIS A 1 166 ? 11.491  26.245  6.370   1.00 34.01 ? 295 HIS A C   1 
ATOM   1214 O O   . HIS A 1 166 ? 10.640  26.320  7.253   1.00 35.71 ? 295 HIS A O   1 
ATOM   1215 C CB  . HIS A 1 166 ? 10.930  24.226  5.004   1.00 32.29 ? 295 HIS A CB  1 
ATOM   1216 C CG  . HIS A 1 166 ? 10.785  24.859  3.657   1.00 33.28 ? 295 HIS A CG  1 
ATOM   1217 N ND1 . HIS A 1 166 ? 11.242  24.265  2.500   1.00 33.76 ? 295 HIS A ND1 1 
ATOM   1218 C CD2 . HIS A 1 166 ? 10.281  26.060  3.287   1.00 32.71 ? 295 HIS A CD2 1 
ATOM   1219 C CE1 . HIS A 1 166 ? 11.002  25.061  1.473   1.00 33.64 ? 295 HIS A CE1 1 
ATOM   1220 N NE2 . HIS A 1 166 ? 10.419  26.157  1.923   1.00 32.98 ? 295 HIS A NE2 1 
ATOM   1221 N N   . THR A 1 167 ? 12.035  27.299  5.772   1.00 33.98 ? 296 THR A N   1 
ATOM   1222 C CA  . THR A 1 167 ? 11.713  28.684  6.103   1.00 31.96 ? 296 THR A CA  1 
ATOM   1223 C C   . THR A 1 167 ? 10.218  29.005  6.108   1.00 32.94 ? 296 THR A C   1 
ATOM   1224 O O   . THR A 1 167 ? 9.763   29.792  6.936   1.00 33.81 ? 296 THR A O   1 
ATOM   1225 C CB  . THR A 1 167 ? 12.431  29.661  5.144   1.00 31.47 ? 296 THR A CB  1 
ATOM   1226 O OG1 . THR A 1 167 ? 12.007  29.416  3.794   1.00 29.06 ? 296 THR A OG1 1 
ATOM   1227 C CG2 . THR A 1 167 ? 13.962  29.499  5.240   1.00 30.16 ? 296 THR A CG2 1 
ATOM   1228 N N   . ASP A 1 168 ? 9.439   28.420  5.201   1.00 32.41 ? 297 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 168 ? 8.019   28.774  5.182   1.00 33.97 ? 297 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 168 ? 7.199   28.102  6.300   1.00 32.89 ? 297 ASP A C   1 
ATOM   1231 O O   . ASP A 1 168 ? 5.991   28.301  6.401   1.00 31.25 ? 297 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 168 ? 7.385   28.681  3.771   1.00 36.69 ? 297 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 168 ? 7.376   27.278  3.208   1.00 36.72 ? 297 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 168 ? 7.563   27.135  1.979   1.00 33.54 ? 297 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 168 ? 7.177   26.325  3.990   1.00 39.49 ? 297 ASP A OD2 1 
ATOM   1236 N N   . ASN A 1 169 ? 7.886   27.356  7.164   1.00 32.27 ? 298 ASN A N   1 
ATOM   1237 C CA  . ASN A 1 169 ? 7.268   26.745  8.339   1.00 33.37 ? 298 ASN A CA  1 
ATOM   1238 C C   . ASN A 1 169 ? 7.604   27.437  9.664   1.00 34.04 ? 298 ASN A C   1 
ATOM   1239 O O   . ASN A 1 169 ? 7.230   26.946  10.729  1.00 33.60 ? 298 ASN A O   1 
ATOM   1240 C CB  . ASN A 1 169 ? 7.646   25.262  8.425   1.00 32.76 ? 298 ASN A CB  1 
ATOM   1241 C CG  . ASN A 1 169 ? 6.852   24.401  7.466   1.00 31.61 ? 298 ASN A CG  1 
ATOM   1242 O OD1 . ASN A 1 169 ? 5.651   24.593  7.279   1.00 31.42 ? 298 ASN A OD1 1 
ATOM   1243 N ND2 . ASN A 1 169 ? 7.520   23.436  6.864   1.00 31.37 ? 298 ASN A ND2 1 
ATOM   1244 N N   . GLN A 1 170 ? 8.301   28.572  9.591   1.00 35.56 ? 299 GLN A N   1 
ATOM   1245 C CA  . GLN A 1 170 ? 8.777   29.280  10.784  1.00 37.73 ? 299 GLN A CA  1 
ATOM   1246 C C   . GLN A 1 170 ? 7.658   29.737  11.712  1.00 36.40 ? 299 GLN A C   1 
ATOM   1247 O O   . GLN A 1 170 ? 7.787   29.647  12.935  1.00 35.80 ? 299 GLN A O   1 
ATOM   1248 C CB  . GLN A 1 170 ? 9.653   30.486  10.409  1.00 40.60 ? 299 GLN A CB  1 
ATOM   1249 C CG  . GLN A 1 170 ? 10.945  30.147  9.672   1.00 44.13 ? 299 GLN A CG  1 
ATOM   1250 C CD  . GLN A 1 170 ? 12.048  29.556  10.545  1.00 46.94 ? 299 GLN A CD  1 
ATOM   1251 O OE1 . GLN A 1 170 ? 13.175  29.363  10.077  1.00 48.61 ? 299 GLN A OE1 1 
ATOM   1252 N NE2 . GLN A 1 170 ? 11.736  29.264  11.808  1.00 47.08 ? 299 GLN A NE2 1 
ATOM   1253 N N   . ARG A 1 171 ? 6.566   30.224  11.131  1.00 34.78 ? 300 ARG A N   1 
ATOM   1254 C CA  . ARG A 1 171 ? 5.454   30.742  11.919  1.00 34.98 ? 300 ARG A CA  1 
ATOM   1255 C C   . ARG A 1 171 ? 4.732   29.643  12.700  1.00 34.11 ? 300 ARG A C   1 
ATOM   1256 O O   . ARG A 1 171 ? 4.252   29.877  13.810  1.00 33.53 ? 300 ARG A O   1 
ATOM   1257 C CB  . ARG A 1 171 ? 4.475   31.509  11.035  1.00 35.28 ? 300 ARG A CB  1 
ATOM   1258 C CG  . ARG A 1 171 ? 3.569   32.463  11.793  1.00 36.29 ? 300 ARG A CG  1 
ATOM   1259 C CD  . ARG A 1 171 ? 4.345   33.634  12.381  1.00 37.18 ? 300 ARG A CD  1 
ATOM   1260 N NE  . ARG A 1 171 ? 3.465   34.737  12.778  1.00 37.09 ? 300 ARG A NE  1 
ATOM   1261 C CZ  . ARG A 1 171 ? 3.892   35.897  13.274  1.00 36.93 ? 300 ARG A CZ  1 
ATOM   1262 N NH1 . ARG A 1 171 ? 5.194   36.117  13.441  1.00 36.22 ? 300 ARG A NH1 1 
ATOM   1263 N NH2 . ARG A 1 171 ? 3.017   36.837  13.608  1.00 36.50 ? 300 ARG A NH2 1 
ATOM   1264 N N   . ILE A 1 172 ? 4.670   28.448  12.119  1.00 32.93 ? 301 ILE A N   1 
ATOM   1265 C CA  . ILE A 1 172 ? 4.068   27.292  12.781  1.00 32.23 ? 301 ILE A CA  1 
ATOM   1266 C C   . ILE A 1 172 ? 4.940   26.817  13.949  1.00 32.25 ? 301 ILE A C   1 
ATOM   1267 O O   . ILE A 1 172 ? 4.420   26.446  14.998  1.00 31.27 ? 301 ILE A O   1 
ATOM   1268 C CB  . ILE A 1 172 ? 3.771   26.160  11.773  1.00 31.48 ? 301 ILE A CB  1 
ATOM   1269 C CG1 . ILE A 1 172 ? 2.647   26.609  10.835  1.00 32.13 ? 301 ILE A CG1 1 
ATOM   1270 C CG2 . ILE A 1 172 ? 3.381   24.864  12.482  1.00 30.39 ? 301 ILE A CG2 1 
ATOM   1271 C CD1 . ILE A 1 172 ? 2.431   25.693  9.652   1.00 33.61 ? 301 ILE A CD1 1 
ATOM   1272 N N   . LEU A 1 173 ? 6.260   26.850  13.764  1.00 33.06 ? 302 LEU A N   1 
ATOM   1273 C CA  . LEU A 1 173 ? 7.198   26.562  14.846  1.00 34.05 ? 302 LEU A CA  1 
ATOM   1274 C C   . LEU A 1 173 ? 6.959   27.494  16.037  1.00 35.39 ? 302 LEU A C   1 
ATOM   1275 O O   . LEU A 1 173 ? 6.839   27.031  17.171  1.00 37.31 ? 302 LEU A O   1 
ATOM   1276 C CB  . LEU A 1 173 ? 8.645   26.669  14.355  1.00 33.67 ? 302 LEU A CB  1 
ATOM   1277 C CG  . LEU A 1 173 ? 9.383   25.406  13.897  1.00 33.60 ? 302 LEU A CG  1 
ATOM   1278 C CD1 . LEU A 1 173 ? 8.727   24.752  12.688  1.00 33.80 ? 302 LEU A CD1 1 
ATOM   1279 C CD2 . LEU A 1 173 ? 10.832  25.749  13.590  1.00 33.30 ? 302 LEU A CD2 1 
ATOM   1280 N N   . GLU A 1 174 ? 6.858   28.794  15.760  1.00 35.74 ? 303 GLU A N   1 
ATOM   1281 C CA  . GLU A 1 174 ? 6.623   29.822  16.780  1.00 36.16 ? 303 GLU A CA  1 
ATOM   1282 C C   . GLU A 1 174 ? 5.274   29.668  17.472  1.00 37.55 ? 303 GLU A C   1 
ATOM   1283 O O   . GLU A 1 174 ? 5.181   29.790  18.697  1.00 38.37 ? 303 GLU A O   1 
ATOM   1284 C CB  . GLU A 1 174 ? 6.725   31.214  16.163  1.00 37.16 ? 303 GLU A CB  1 
ATOM   1285 C CG  . GLU A 1 174 ? 8.102   31.537  15.607  1.00 37.98 ? 303 GLU A CG  1 
ATOM   1286 C CD  . GLU A 1 174 ? 8.145   32.862  14.875  1.00 38.61 ? 303 GLU A CD  1 
ATOM   1287 O OE1 . GLU A 1 174 ? 7.107   33.557  14.811  1.00 39.49 ? 303 GLU A OE1 1 
ATOM   1288 O OE2 . GLU A 1 174 ? 9.226   33.206  14.359  1.00 39.75 ? 303 GLU A OE2 1 
ATOM   1289 N N   . PHE A 1 175 ? 4.237   29.389  16.686  1.00 37.14 ? 304 PHE A N   1 
ATOM   1290 C CA  . PHE A 1 175 ? 2.909   29.094  17.221  1.00 38.95 ? 304 PHE A CA  1 
ATOM   1291 C C   . PHE A 1 175 ? 2.956   27.993  18.288  1.00 40.43 ? 304 PHE A C   1 
ATOM   1292 O O   . PHE A 1 175 ? 2.214   28.031  19.266  1.00 42.04 ? 304 PHE A O   1 
ATOM   1293 C CB  . PHE A 1 175 ? 1.948   28.698  16.092  1.00 37.62 ? 304 PHE A CB  1 
ATOM   1294 C CG  . PHE A 1 175 ? 0.515   28.595  16.524  1.00 36.79 ? 304 PHE A CG  1 
ATOM   1295 C CD1 . PHE A 1 175 ? -0.319  29.704  16.471  1.00 36.65 ? 304 PHE A CD1 1 
ATOM   1296 C CD2 . PHE A 1 175 ? -0.003  27.389  16.990  1.00 36.99 ? 304 PHE A CD2 1 
ATOM   1297 C CE1 . PHE A 1 175 ? -1.642  29.611  16.879  1.00 36.91 ? 304 PHE A CE1 1 
ATOM   1298 C CE2 . PHE A 1 175 ? -1.324  27.289  17.397  1.00 35.61 ? 304 PHE A CE2 1 
ATOM   1299 C CZ  . PHE A 1 175 ? -2.144  28.402  17.341  1.00 36.32 ? 304 PHE A CZ  1 
ATOM   1300 N N   . PHE A 1 176 ? 3.832   27.016  18.091  1.00 42.16 ? 305 PHE A N   1 
ATOM   1301 C CA  . PHE A 1 176 ? 3.957   25.905  19.020  1.00 43.17 ? 305 PHE A CA  1 
ATOM   1302 C C   . PHE A 1 176 ? 5.192   26.039  19.919  1.00 44.33 ? 305 PHE A C   1 
ATOM   1303 O O   . PHE A 1 176 ? 5.728   25.038  20.403  1.00 44.36 ? 305 PHE A O   1 
ATOM   1304 C CB  . PHE A 1 176 ? 3.963   24.580  18.250  1.00 42.64 ? 305 PHE A CB  1 
ATOM   1305 C CG  . PHE A 1 176 ? 2.633   24.226  17.643  1.00 42.73 ? 305 PHE A CG  1 
ATOM   1306 C CD1 . PHE A 1 176 ? 1.673   23.541  18.387  1.00 42.46 ? 305 PHE A CD1 1 
ATOM   1307 C CD2 . PHE A 1 176 ? 2.335   24.574  16.329  1.00 41.57 ? 305 PHE A CD2 1 
ATOM   1308 C CE1 . PHE A 1 176 ? 0.444   23.211  17.832  1.00 42.47 ? 305 PHE A CE1 1 
ATOM   1309 C CE2 . PHE A 1 176 ? 1.111   24.247  15.770  1.00 41.34 ? 305 PHE A CE2 1 
ATOM   1310 C CZ  . PHE A 1 176 ? 0.163   23.567  16.521  1.00 42.48 ? 305 PHE A CZ  1 
ATOM   1311 N N   . GLY A 1 177 ? 5.628   27.280  20.136  1.00 45.23 ? 306 GLY A N   1 
ATOM   1312 C CA  . GLY A 1 177 ? 6.788   27.587  20.982  1.00 46.66 ? 306 GLY A CA  1 
ATOM   1313 C C   . GLY A 1 177 ? 8.011   26.724  20.721  1.00 47.58 ? 306 GLY A C   1 
ATOM   1314 O O   . GLY A 1 177 ? 8.572   26.134  21.643  1.00 48.99 ? 306 GLY A O   1 
ATOM   1315 N N   . LEU A 1 178 ? 8.423   26.649  19.460  1.00 47.50 ? 307 LEU A N   1 
ATOM   1316 C CA  . LEU A 1 178 ? 9.544   25.804  19.066  1.00 47.23 ? 307 LEU A CA  1 
ATOM   1317 C C   . LEU A 1 178 ? 10.588  26.557  18.254  1.00 48.04 ? 307 LEU A C   1 
ATOM   1318 O O   . LEU A 1 178 ? 10.250  27.398  17.417  1.00 47.89 ? 307 LEU A O   1 
ATOM   1319 C CB  . LEU A 1 178 ? 9.046   24.588  18.278  1.00 46.70 ? 307 LEU A CB  1 
ATOM   1320 C CG  . LEU A 1 178 ? 8.580   23.372  19.084  1.00 48.13 ? 307 LEU A CG  1 
ATOM   1321 C CD1 . LEU A 1 178 ? 7.733   22.456  18.214  1.00 46.86 ? 307 LEU A CD1 1 
ATOM   1322 C CD2 . LEU A 1 178 ? 9.762   22.608  19.677  1.00 46.59 ? 307 LEU A CD2 1 
ATOM   1323 N N   . LYS A 1 179 ? 11.854  26.245  18.521  1.00 49.06 ? 308 LYS A N   1 
ATOM   1324 C CA  . LYS A 1 179 ? 12.987  26.769  17.760  1.00 51.97 ? 308 LYS A CA  1 
ATOM   1325 C C   . LYS A 1 179 ? 13.625  25.646  16.935  1.00 54.07 ? 308 LYS A C   1 
ATOM   1326 O O   . LYS A 1 179 ? 13.576  24.477  17.332  1.00 54.38 ? 308 LYS A O   1 
ATOM   1327 C CB  . LYS A 1 179 ? 14.009  27.397  18.699  1.00 50.23 ? 308 LYS A CB  1 
ATOM   1328 N N   . LYS A 1 180 ? 14.211  26.008  15.792  1.00 56.75 ? 309 LYS A N   1 
ATOM   1329 C CA  . LYS A 1 180 ? 14.861  25.054  14.876  1.00 59.35 ? 309 LYS A CA  1 
ATOM   1330 C C   . LYS A 1 180 ? 15.657  23.948  15.582  1.00 61.23 ? 309 LYS A C   1 
ATOM   1331 O O   . LYS A 1 180 ? 15.492  22.760  15.274  1.00 59.60 ? 309 LYS A O   1 
ATOM   1332 C CB  . LYS A 1 180 ? 15.781  25.788  13.891  1.00 59.22 ? 309 LYS A CB  1 
ATOM   1333 C CG  . LYS A 1 180 ? 15.092  26.354  12.658  1.00 59.05 ? 309 LYS A CG  1 
ATOM   1334 C CD  . LYS A 1 180 ? 16.076  26.575  11.513  1.00 60.47 ? 309 LYS A CD  1 
ATOM   1335 C CE  . LYS A 1 180 ? 17.046  27.722  11.784  1.00 61.23 ? 309 LYS A CE  1 
ATOM   1336 N NZ  . LYS A 1 180 ? 18.087  27.855  10.723  1.00 59.06 ? 309 LYS A NZ  1 
ATOM   1337 N N   . GLU A 1 181 ? 16.510  24.356  16.525  1.00 61.41 ? 310 GLU A N   1 
ATOM   1338 C CA  . GLU A 1 181 ? 17.392  23.445  17.261  1.00 61.42 ? 310 GLU A CA  1 
ATOM   1339 C C   . GLU A 1 181 ? 16.640  22.475  18.178  1.00 60.16 ? 310 GLU A C   1 
ATOM   1340 O O   . GLU A 1 181 ? 17.064  21.330  18.351  1.00 62.38 ? 310 GLU A O   1 
ATOM   1341 C CB  . GLU A 1 181 ? 18.428  24.236  18.053  1.00 61.90 ? 310 GLU A CB  1 
ATOM   1342 N N   . GLU A 1 182 ? 15.525  22.933  18.750  1.00 56.90 ? 311 GLU A N   1 
ATOM   1343 C CA  . GLU A 1 182 ? 14.707  22.124  19.664  0.50 54.14 ? 311 GLU A CA  1 
ATOM   1344 C C   . GLU A 1 182 ? 13.991  20.954  18.973  1.00 53.71 ? 311 GLU A C   1 
ATOM   1345 O O   . GLU A 1 182 ? 13.230  20.220  19.613  1.00 54.28 ? 311 GLU A O   1 
ATOM   1346 C CB  . GLU A 1 182 ? 13.682  23.008  20.386  0.50 53.53 ? 311 GLU A CB  1 
ATOM   1347 C CG  . GLU A 1 182 ? 14.277  24.013  21.360  0.50 53.08 ? 311 GLU A CG  1 
ATOM   1348 C CD  . GLU A 1 182 ? 13.249  25.003  21.873  0.50 52.72 ? 311 GLU A CD  1 
ATOM   1349 O OE1 . GLU A 1 182 ? 13.398  25.478  23.019  0.50 52.62 ? 311 GLU A OE1 1 
ATOM   1350 O OE2 . GLU A 1 182 ? 12.289  25.305  21.133  0.50 51.97 ? 311 GLU A OE2 1 
ATOM   1351 N N   . CYS A 1 183 ? 14.239  20.789  17.672  1.00 50.39 ? 312 CYS A N   1 
ATOM   1352 C CA  . CYS A 1 183 ? 13.608  19.741  16.868  1.00 46.39 ? 312 CYS A CA  1 
ATOM   1353 C C   . CYS A 1 183 ? 14.602  18.624  16.536  1.00 45.66 ? 312 CYS A C   1 
ATOM   1354 O O   . CYS A 1 183 ? 15.809  18.875  16.453  1.00 44.39 ? 312 CYS A O   1 
ATOM   1355 C CB  . CYS A 1 183 ? 13.013  20.337  15.584  1.00 45.07 ? 312 CYS A CB  1 
ATOM   1356 S SG  . CYS A 1 183 ? 11.607  21.447  15.851  1.00 40.93 ? 312 CYS A SG  1 
ATOM   1357 N N   . PRO A 1 184 ? 14.109  17.382  16.339  1.00 44.30 ? 313 PRO A N   1 
ATOM   1358 C CA  . PRO A 1 184 ? 12.721  16.884  16.363  1.00 42.88 ? 313 PRO A CA  1 
ATOM   1359 C C   . PRO A 1 184 ? 11.953  17.046  17.683  1.00 42.00 ? 313 PRO A C   1 
ATOM   1360 O O   . PRO A 1 184 ? 12.532  16.957  18.765  1.00 41.60 ? 313 PRO A O   1 
ATOM   1361 C CB  . PRO A 1 184 ? 12.863  15.392  16.006  1.00 43.31 ? 313 PRO A CB  1 
ATOM   1362 C CG  . PRO A 1 184 ? 14.313  15.072  16.145  1.00 43.56 ? 313 PRO A CG  1 
ATOM   1363 C CD  . PRO A 1 184 ? 15.048  16.347  15.867  1.00 43.76 ? 313 PRO A CD  1 
ATOM   1364 N N   . ALA A 1 185 ? 10.648  17.284  17.563  1.00 39.37 ? 314 ALA A N   1 
ATOM   1365 C CA  . ALA A 1 185 ? 9.756   17.467  18.703  1.00 39.26 ? 314 ALA A CA  1 
ATOM   1366 C C   . ALA A 1 185 ? 8.313   17.211  18.282  1.00 39.39 ? 314 ALA A C   1 
ATOM   1367 O O   . ALA A 1 185 ? 7.975   17.298  17.095  1.00 39.65 ? 314 ALA A O   1 
ATOM   1368 C CB  . ALA A 1 185 ? 9.904   18.866  19.284  1.00 39.05 ? 314 ALA A CB  1 
ATOM   1369 N N   . VAL A 1 186 ? 7.467   16.907  19.262  1.00 39.38 ? 315 VAL A N   1 
ATOM   1370 C CA  . VAL A 1 186 ? 6.088   16.508  19.008  1.00 39.78 ? 315 VAL A CA  1 
ATOM   1371 C C   . VAL A 1 186 ? 5.088   17.379  19.783  1.00 40.78 ? 315 VAL A C   1 
ATOM   1372 O O   . VAL A 1 186 ? 5.318   17.701  20.948  1.00 42.58 ? 315 VAL A O   1 
ATOM   1373 C CB  . VAL A 1 186 ? 5.891   15.013  19.352  1.00 39.69 ? 315 VAL A CB  1 
ATOM   1374 C CG1 . VAL A 1 186 ? 4.423   14.625  19.301  1.00 40.12 ? 315 VAL A CG1 1 
ATOM   1375 C CG2 . VAL A 1 186 ? 6.693   14.134  18.405  1.00 38.71 ? 315 VAL A CG2 1 
ATOM   1376 N N   . ARG A 1 187 ? 4.000   17.783  19.122  1.00 40.81 ? 316 ARG A N   1 
ATOM   1377 C CA  . ARG A 1 187 ? 2.868   18.432  19.802  1.00 41.04 ? 316 ARG A CA  1 
ATOM   1378 C C   . ARG A 1 187 ? 1.555   17.747  19.460  1.00 40.57 ? 316 ARG A C   1 
ATOM   1379 O O   . ARG A 1 187 ? 1.327   17.336  18.314  1.00 41.43 ? 316 ARG A O   1 
ATOM   1380 C CB  . ARG A 1 187 ? 2.707   19.928  19.458  1.00 41.56 ? 316 ARG A CB  1 
ATOM   1381 C CG  . ARG A 1 187 ? 3.934   20.732  19.061  1.00 42.89 ? 316 ARG A CG  1 
ATOM   1382 C CD  . ARG A 1 187 ? 4.995   20.882  20.137  1.00 47.08 ? 316 ARG A CD  1 
ATOM   1383 N NE  . ARG A 1 187 ? 4.492   20.840  21.505  1.00 48.56 ? 316 ARG A NE  1 
ATOM   1384 C CZ  . ARG A 1 187 ? 5.268   20.638  22.567  1.00 51.53 ? 316 ARG A CZ  1 
ATOM   1385 N NH1 . ARG A 1 187 ? 6.580   20.469  22.408  1.00 50.11 ? 316 ARG A NH1 1 
ATOM   1386 N NH2 . ARG A 1 187 ? 4.737   20.603  23.786  1.00 51.64 ? 316 ARG A NH2 1 
ATOM   1387 N N   . LEU A 1 188 ? 0.685   17.654  20.458  1.00 40.62 ? 317 LEU A N   1 
ATOM   1388 C CA  . LEU A 1 188 ? -0.689  17.231  20.249  1.00 40.95 ? 317 LEU A CA  1 
ATOM   1389 C C   . LEU A 1 188 ? -1.619  18.446  20.303  1.00 42.81 ? 317 LEU A C   1 
ATOM   1390 O O   . LEU A 1 188 ? -1.374  19.397  21.049  1.00 44.55 ? 317 LEU A O   1 
ATOM   1391 C CB  . LEU A 1 188 ? -1.084  16.186  21.292  1.00 41.14 ? 317 LEU A CB  1 
ATOM   1392 C CG  . LEU A 1 188 ? -0.630  14.750  21.011  1.00 40.85 ? 317 LEU A CG  1 
ATOM   1393 C CD1 . LEU A 1 188 ? -0.203  14.041  22.287  1.00 40.16 ? 317 LEU A CD1 1 
ATOM   1394 C CD2 . LEU A 1 188 ? -1.723  13.971  20.289  1.00 40.52 ? 317 LEU A CD2 1 
ATOM   1395 N N   . ILE A 1 189 ? -2.678  18.415  19.499  1.00 43.53 ? 318 ILE A N   1 
ATOM   1396 C CA  . ILE A 1 189 ? -3.647  19.508  19.440  1.00 44.66 ? 318 ILE A CA  1 
ATOM   1397 C C   . ILE A 1 189 ? -5.036  18.958  19.135  1.00 47.56 ? 318 ILE A C   1 
ATOM   1398 O O   . ILE A 1 189 ? -5.193  18.090  18.273  1.00 48.86 ? 318 ILE A O   1 
ATOM   1399 C CB  . ILE A 1 189 ? -3.245  20.600  18.404  1.00 44.08 ? 318 ILE A CB  1 
ATOM   1400 C CG1 . ILE A 1 189 ? -4.321  21.691  18.293  1.00 43.79 ? 318 ILE A CG1 1 
ATOM   1401 C CG2 . ILE A 1 189 ? -2.950  19.992  17.038  1.00 43.04 ? 318 ILE A CG2 1 
ATOM   1402 C CD1 . ILE A 1 189 ? -3.916  22.890  17.460  1.00 43.63 ? 318 ILE A CD1 1 
ATOM   1403 N N   . THR A 1 190 ? -6.033  19.460  19.856  1.00 48.95 ? 319 THR A N   1 
ATOM   1404 C CA  . THR A 1 190 ? -7.426  19.134  19.578  1.00 51.16 ? 319 THR A CA  1 
ATOM   1405 C C   . THR A 1 190 ? -8.153  20.368  19.038  1.00 51.52 ? 319 THR A C   1 
ATOM   1406 O O   . THR A 1 190 ? -8.161  21.422  19.675  1.00 48.95 ? 319 THR A O   1 
ATOM   1407 C CB  . THR A 1 190 ? -8.134  18.576  20.836  1.00 51.32 ? 319 THR A CB  1 
ATOM   1408 O OG1 . THR A 1 190 ? -7.390  17.462  21.348  1.00 51.57 ? 319 THR A OG1 1 
ATOM   1409 C CG2 . THR A 1 190 ? -9.553  18.119  20.511  1.00 51.88 ? 319 THR A CG2 1 
ATOM   1410 N N   . LEU A 1 191 ? -8.735  20.224  17.848  1.00 55.13 ? 320 LEU A N   1 
ATOM   1411 C CA  . LEU A 1 191 ? -9.566  21.261  17.233  1.00 58.46 ? 320 LEU A CA  1 
ATOM   1412 C C   . LEU A 1 191 ? -11.001 21.124  17.731  1.00 61.13 ? 320 LEU A C   1 
ATOM   1413 O O   . LEU A 1 191 ? -11.545 20.018  17.777  1.00 64.47 ? 320 LEU A O   1 
ATOM   1414 C CB  . LEU A 1 191 ? -9.540  21.141  15.703  1.00 59.33 ? 320 LEU A CB  1 
ATOM   1415 C CG  . LEU A 1 191 ? -8.235  21.382  14.930  1.00 58.84 ? 320 LEU A CG  1 
ATOM   1416 C CD1 . LEU A 1 191 ? -8.215  20.569  13.644  1.00 58.23 ? 320 LEU A CD1 1 
ATOM   1417 C CD2 . LEU A 1 191 ? -8.028  22.862  14.636  1.00 59.66 ? 320 LEU A CD2 1 
ATOM   1418 N N   . GLU A 1 192 ? -11.615 22.246  18.097  1.00 63.43 ? 321 GLU A N   1 
ATOM   1419 C CA  . GLU A 1 192 ? -12.976 22.245  18.639  1.00 66.24 ? 321 GLU A CA  1 
ATOM   1420 C C   . GLU A 1 192 ? -13.798 23.435  18.150  1.00 69.41 ? 321 GLU A C   1 
ATOM   1421 O O   . GLU A 1 192 ? -13.243 24.426  17.669  1.00 72.38 ? 321 GLU A O   1 
ATOM   1422 C CB  . GLU A 1 192 ? -12.931 22.237  20.172  1.00 64.60 ? 321 GLU A CB  1 
ATOM   1423 C CG  . GLU A 1 192 ? -12.635 20.874  20.785  1.00 64.72 ? 321 GLU A CG  1 
ATOM   1424 C CD  . GLU A 1 192 ? -11.751 20.953  22.016  1.00 63.95 ? 321 GLU A CD  1 
ATOM   1425 O OE1 . GLU A 1 192 ? -11.294 22.064  22.361  1.00 64.11 ? 321 GLU A OE1 1 
ATOM   1426 O OE2 . GLU A 1 192 ? -11.502 19.896  22.636  1.00 63.83 ? 321 GLU A OE2 1 
ATOM   1427 N N   . GLU A 1 193 ? -15.122 23.314  18.263  1.00 70.77 ? 322 GLU A N   1 
ATOM   1428 C CA  . GLU A 1 193 ? -16.066 24.419  18.052  1.00 71.75 ? 322 GLU A CA  1 
ATOM   1429 C C   . GLU A 1 193 ? -17.461 24.043  18.542  1.00 74.82 ? 322 GLU A C   1 
ATOM   1430 O O   . GLU A 1 193 ? -17.747 24.105  19.740  1.00 75.52 ? 322 GLU A O   1 
ATOM   1431 C CB  . GLU A 1 193 ? -16.125 24.855  16.585  1.00 72.75 ? 322 GLU A CB  1 
ATOM   1432 C CG  . GLU A 1 193 ? -15.347 26.130  16.302  1.00 73.89 ? 322 GLU A CG  1 
ATOM   1433 C CD  . GLU A 1 193 ? -15.372 26.528  14.842  1.00 75.21 ? 322 GLU A CD  1 
ATOM   1434 O OE1 . GLU A 1 193 ? -14.808 25.783  14.010  1.00 73.58 ? 322 GLU A OE1 1 
ATOM   1435 O OE2 . GLU A 1 193 ? -15.945 27.596  14.533  1.00 76.60 ? 322 GLU A OE2 1 
ATOM   1436 N N   . THR A 1 206 ? -20.284 39.177  18.167  1.00 56.33 ? 335 THR A N   1 
ATOM   1437 C CA  . THR A 1 206 ? -20.728 39.824  19.402  1.00 58.47 ? 335 THR A CA  1 
ATOM   1438 C C   . THR A 1 206 ? -20.011 39.263  20.630  1.00 60.36 ? 335 THR A C   1 
ATOM   1439 O O   . THR A 1 206 ? -19.554 38.117  20.619  1.00 61.98 ? 335 THR A O   1 
ATOM   1440 C CB  . THR A 1 206 ? -22.239 39.696  19.561  1.00 56.48 ? 335 THR A CB  1 
ATOM   1441 N N   . ALA A 1 207 ? -19.923 40.077  21.684  1.00 60.63 ? 336 ALA A N   1 
ATOM   1442 C CA  . ALA A 1 207 ? -19.291 39.680  22.948  1.00 59.01 ? 336 ALA A CA  1 
ATOM   1443 C C   . ALA A 1 207 ? -20.051 38.561  23.655  1.00 58.96 ? 336 ALA A C   1 
ATOM   1444 O O   . ALA A 1 207 ? -19.439 37.689  24.279  1.00 57.99 ? 336 ALA A O   1 
ATOM   1445 C CB  . ALA A 1 207 ? -19.152 40.882  23.873  1.00 58.09 ? 336 ALA A CB  1 
ATOM   1446 N N   . GLU A 1 208 ? -21.380 38.601  23.557  1.00 58.40 ? 337 GLU A N   1 
ATOM   1447 C CA  . GLU A 1 208 ? -22.251 37.612  24.192  1.00 58.20 ? 337 GLU A CA  1 
ATOM   1448 C C   . GLU A 1 208 ? -22.254 36.278  23.441  1.00 58.31 ? 337 GLU A C   1 
ATOM   1449 O O   . GLU A 1 208 ? -22.354 35.211  24.056  1.00 58.00 ? 337 GLU A O   1 
ATOM   1450 C CB  . GLU A 1 208 ? -23.665 38.157  24.329  1.00 59.02 ? 337 GLU A CB  1 
ATOM   1451 N N   . ARG A 1 209 ? -22.142 36.346  22.115  1.00 55.71 ? 338 ARG A N   1 
ATOM   1452 C CA  . ARG A 1 209 ? -22.053 35.151  21.282  1.00 56.34 ? 338 ARG A CA  1 
ATOM   1453 C C   . ARG A 1 209 ? -20.790 34.351  21.605  1.00 56.05 ? 338 ARG A C   1 
ATOM   1454 O O   . ARG A 1 209 ? -20.828 33.119  21.657  1.00 56.84 ? 338 ARG A O   1 
ATOM   1455 C CB  . ARG A 1 209 ? -22.097 35.519  19.803  1.00 55.00 ? 338 ARG A CB  1 
ATOM   1456 N N   . ILE A 1 210 ? -19.683 35.063  21.830  1.00 54.70 ? 339 ILE A N   1 
ATOM   1457 C CA  . ILE A 1 210 ? -18.403 34.445  22.200  1.00 52.22 ? 339 ILE A CA  1 
ATOM   1458 C C   . ILE A 1 210 ? -18.496 33.734  23.557  1.00 51.43 ? 339 ILE A C   1 
ATOM   1459 O O   . ILE A 1 210 ? -18.066 32.584  23.686  1.00 50.19 ? 339 ILE A O   1 
ATOM   1460 C CB  . ILE A 1 210 ? -17.239 35.470  22.206  1.00 50.55 ? 339 ILE A CB  1 
ATOM   1461 C CG1 . ILE A 1 210 ? -17.036 36.065  20.806  1.00 50.60 ? 339 ILE A CG1 1 
ATOM   1462 C CG2 . ILE A 1 210 ? -15.946 34.818  22.688  1.00 50.21 ? 339 ILE A CG2 1 
ATOM   1463 C CD1 . ILE A 1 210 ? -16.141 37.288  20.760  1.00 49.03 ? 339 ILE A CD1 1 
ATOM   1464 N N   . THR A 1 211 ? -19.069 34.421  24.546  1.00 50.94 ? 340 THR A N   1 
ATOM   1465 C CA  . THR A 1 211 ? -19.235 33.889  25.905  1.00 52.62 ? 340 THR A CA  1 
ATOM   1466 C C   . THR A 1 211 ? -20.090 32.614  25.934  1.00 54.72 ? 340 THR A C   1 
ATOM   1467 O O   . THR A 1 211 ? -19.750 31.649  26.633  1.00 53.91 ? 340 THR A O   1 
ATOM   1468 C CB  . THR A 1 211 ? -19.804 34.969  26.861  1.00 51.61 ? 340 THR A CB  1 
ATOM   1469 O OG1 . THR A 1 211 ? -18.880 36.063  26.949  1.00 51.05 ? 340 THR A OG1 1 
ATOM   1470 C CG2 . THR A 1 211 ? -20.031 34.415  28.262  1.00 51.92 ? 340 THR A CG2 1 
ATOM   1471 N N   . GLU A 1 212 ? -21.184 32.615  25.169  1.00 56.00 ? 341 GLU A N   1 
ATOM   1472 C CA  . GLU A 1 212 ? -22.063 31.446  25.042  1.00 57.83 ? 341 GLU A CA  1 
ATOM   1473 C C   . GLU A 1 212 ? -21.376 30.297  24.302  1.00 58.17 ? 341 GLU A C   1 
ATOM   1474 O O   . GLU A 1 212 ? -21.556 29.131  24.661  1.00 57.42 ? 341 GLU A O   1 
ATOM   1475 C CB  . GLU A 1 212 ? -23.371 31.822  24.354  1.00 57.76 ? 341 GLU A CB  1 
ATOM   1476 N N   . PHE A 1 213 ? -20.598 30.636  23.274  1.00 58.88 ? 342 PHE A N   1 
ATOM   1477 C CA  . PHE A 1 213 ? -19.790 29.657  22.534  1.00 61.53 ? 342 PHE A CA  1 
ATOM   1478 C C   . PHE A 1 213 ? -18.676 29.065  23.401  1.00 61.34 ? 342 PHE A C   1 
ATOM   1479 O O   . PHE A 1 213 ? -18.374 27.872  23.307  1.00 61.34 ? 342 PHE A O   1 
ATOM   1480 C CB  . PHE A 1 213 ? -19.202 30.283  21.256  1.00 63.09 ? 342 PHE A CB  1 
ATOM   1481 C CG  . PHE A 1 213 ? -18.017 29.538  20.697  1.00 64.58 ? 342 PHE A CG  1 
ATOM   1482 C CD1 . PHE A 1 213 ? -16.728 30.043  20.845  1.00 64.62 ? 342 PHE A CD1 1 
ATOM   1483 C CD2 . PHE A 1 213 ? -18.185 28.325  20.032  1.00 65.74 ? 342 PHE A CD2 1 
ATOM   1484 C CE1 . PHE A 1 213 ? -15.632 29.357  20.340  1.00 65.59 ? 342 PHE A CE1 1 
ATOM   1485 C CE2 . PHE A 1 213 ? -17.092 27.634  19.525  1.00 66.12 ? 342 PHE A CE2 1 
ATOM   1486 C CZ  . PHE A 1 213 ? -15.814 28.151  19.678  1.00 66.38 ? 342 PHE A CZ  1 
ATOM   1487 N N   . CYS A 1 214 ? -18.072 29.911  24.235  1.00 61.39 ? 343 CYS A N   1 
ATOM   1488 C CA  . CYS A 1 214 ? -16.981 29.502  25.116  1.00 61.08 ? 343 CYS A CA  1 
ATOM   1489 C C   . CYS A 1 214 ? -17.446 28.571  26.229  1.00 63.06 ? 343 CYS A C   1 
ATOM   1490 O O   . CYS A 1 214 ? -16.697 27.687  26.650  1.00 61.96 ? 343 CYS A O   1 
ATOM   1491 C CB  . CYS A 1 214 ? -16.279 30.719  25.713  1.00 59.15 ? 343 CYS A CB  1 
ATOM   1492 S SG  . CYS A 1 214 ? -15.083 31.504  24.616  1.00 58.77 ? 343 CYS A SG  1 
ATOM   1493 N N   . HIS A 1 215 ? -18.676 28.765  26.702  1.00 64.33 ? 344 HIS A N   1 
ATOM   1494 C CA  . HIS A 1 215 ? -19.256 27.853  27.685  1.00 68.13 ? 344 HIS A CA  1 
ATOM   1495 C C   . HIS A 1 215 ? -19.616 26.513  27.038  1.00 69.87 ? 344 HIS A C   1 
ATOM   1496 O O   . HIS A 1 215 ? -20.774 26.091  27.021  1.00 67.10 ? 344 HIS A O   1 
ATOM   1497 C CB  . HIS A 1 215 ? -20.437 28.492  28.422  1.00 68.51 ? 344 HIS A CB  1 
ATOM   1498 C CG  . HIS A 1 215 ? -20.026 29.389  29.551  1.00 69.34 ? 344 HIS A CG  1 
ATOM   1499 N ND1 . HIS A 1 215 ? -20.201 30.756  29.521  1.00 68.78 ? 344 HIS A ND1 1 
ATOM   1500 C CD2 . HIS A 1 215 ? -19.436 29.112  30.739  1.00 70.27 ? 344 HIS A CD2 1 
ATOM   1501 C CE1 . HIS A 1 215 ? -19.746 31.281  30.645  1.00 69.13 ? 344 HIS A CE1 1 
ATOM   1502 N NE2 . HIS A 1 215 ? -19.273 30.306  31.399  1.00 70.20 ? 344 HIS A NE2 1 
ATOM   1503 N N   . ARG A 1 216 ? -18.584 25.877  26.482  1.00 74.18 ? 345 ARG A N   1 
ATOM   1504 C CA  . ARG A 1 216 ? -18.635 24.514  25.979  1.00 76.66 ? 345 ARG A CA  1 
ATOM   1505 C C   . ARG A 1 216 ? -17.754 23.643  26.880  1.00 78.87 ? 345 ARG A C   1 
ATOM   1506 O O   . ARG A 1 216 ? -17.075 22.722  26.417  1.00 76.18 ? 345 ARG A O   1 
ATOM   1507 C CB  . ARG A 1 216 ? -18.163 24.461  24.533  1.00 75.71 ? 345 ARG A CB  1 
ATOM   1508 N N   . PHE A 1 217 ? -17.764 23.968  28.172  1.00 82.24 ? 346 PHE A N   1 
ATOM   1509 C CA  . PHE A 1 217 ? -17.126 23.148  29.197  1.00 85.43 ? 346 PHE A CA  1 
ATOM   1510 C C   . PHE A 1 217 ? -18.038 21.977  29.561  1.00 87.98 ? 346 PHE A C   1 
ATOM   1511 O O   . PHE A 1 217 ? -17.598 20.824  29.595  1.00 91.20 ? 346 PHE A O   1 
ATOM   1512 C CB  . PHE A 1 217 ? -16.831 23.975  30.454  1.00 85.22 ? 346 PHE A CB  1 
ATOM   1513 C CG  . PHE A 1 217 ? -15.831 25.082  30.246  1.00 83.91 ? 346 PHE A CG  1 
ATOM   1514 C CD1 . PHE A 1 217 ? -14.467 24.807  30.172  1.00 83.50 ? 346 PHE A CD1 1 
ATOM   1515 C CD2 . PHE A 1 217 ? -16.251 26.406  30.158  1.00 82.37 ? 346 PHE A CD2 1 
ATOM   1516 C CE1 . PHE A 1 217 ? -13.546 25.828  29.993  1.00 81.30 ? 346 PHE A CE1 1 
ATOM   1517 C CE2 . PHE A 1 217 ? -15.334 27.431  29.983  1.00 80.23 ? 346 PHE A CE2 1 
ATOM   1518 C CZ  . PHE A 1 217 ? -13.981 27.142  29.900  1.00 81.36 ? 346 PHE A CZ  1 
ATOM   1519 N N   . LEU A 1 218 ? -19.308 22.286  29.826  1.00 87.19 ? 347 LEU A N   1 
ATOM   1520 C CA  . LEU A 1 218 ? -20.297 21.289  30.229  1.00 86.26 ? 347 LEU A CA  1 
ATOM   1521 C C   . LEU A 1 218 ? -20.807 20.479  29.039  1.00 85.86 ? 347 LEU A C   1 
ATOM   1522 O O   . LEU A 1 218 ? -21.459 21.012  28.139  1.00 86.54 ? 347 LEU A O   1 
ATOM   1523 C CB  . LEU A 1 218 ? -21.452 21.956  30.964  1.00 84.08 ? 347 LEU A CB  1 
ATOM   1524 N N   . ALA B 1 7   ? 20.717  40.092  40.872  1.00 38.48 ? 136 ALA B N   1 
ATOM   1525 C CA  . ALA B 1 7   ? 19.474  39.371  40.443  1.00 40.79 ? 136 ALA B CA  1 
ATOM   1526 C C   . ALA B 1 7   ? 18.248  40.287  40.514  1.00 41.44 ? 136 ALA B C   1 
ATOM   1527 O O   . ALA B 1 7   ? 17.553  40.497  39.516  1.00 42.04 ? 136 ALA B O   1 
ATOM   1528 C CB  . ALA B 1 7   ? 19.256  38.128  41.295  1.00 40.59 ? 136 ALA B CB  1 
ATOM   1529 N N   . ALA B 1 8   ? 17.993  40.821  41.706  1.00 40.12 ? 137 ALA B N   1 
ATOM   1530 C CA  . ALA B 1 8   ? 16.903  41.759  41.922  1.00 38.35 ? 137 ALA B CA  1 
ATOM   1531 C C   . ALA B 1 8   ? 17.443  43.019  42.579  1.00 37.69 ? 137 ALA B C   1 
ATOM   1532 O O   . ALA B 1 8   ? 18.289  42.948  43.476  1.00 38.98 ? 137 ALA B O   1 
ATOM   1533 C CB  . ALA B 1 8   ? 15.819  41.128  42.779  1.00 37.48 ? 137 ALA B CB  1 
ATOM   1534 N N   . THR B 1 9   ? 16.958  44.170  42.128  1.00 35.08 ? 138 THR B N   1 
ATOM   1535 C CA  . THR B 1 9   ? 17.384  45.446  42.684  1.00 34.34 ? 138 THR B CA  1 
ATOM   1536 C C   . THR B 1 9   ? 16.760  45.628  44.066  1.00 32.83 ? 138 THR B C   1 
ATOM   1537 O O   . THR B 1 9   ? 15.554  45.484  44.224  1.00 32.53 ? 138 THR B O   1 
ATOM   1538 C CB  . THR B 1 9   ? 16.978  46.623  41.772  1.00 34.92 ? 138 THR B CB  1 
ATOM   1539 O OG1 . THR B 1 9   ? 15.547  46.686  41.687  1.00 37.46 ? 138 THR B OG1 1 
ATOM   1540 C CG2 . THR B 1 9   ? 17.552  46.447  40.369  1.00 34.27 ? 138 THR B CG2 1 
ATOM   1541 N N   . THR B 1 10  ? 17.584  45.928  45.065  1.00 32.57 ? 139 THR B N   1 
ATOM   1542 C CA  . THR B 1 10  ? 17.084  46.257  46.398  1.00 31.94 ? 139 THR B CA  1 
ATOM   1543 C C   . THR B 1 10  ? 16.325  47.581  46.364  1.00 32.70 ? 139 THR B C   1 
ATOM   1544 O O   . THR B 1 10  ? 16.782  48.549  45.750  1.00 33.95 ? 139 THR B O   1 
ATOM   1545 C CB  . THR B 1 10  ? 18.222  46.341  47.428  1.00 30.94 ? 139 THR B CB  1 
ATOM   1546 O OG1 . THR B 1 10  ? 18.964  45.118  47.406  1.00 30.28 ? 139 THR B OG1 1 
ATOM   1547 C CG2 . THR B 1 10  ? 17.671  46.566  48.834  1.00 29.56 ? 139 THR B CG2 1 
ATOM   1548 N N   . LEU B 1 11  ? 15.166  47.615  47.015  1.00 31.35 ? 140 LEU B N   1 
ATOM   1549 C CA  . LEU B 1 11  ? 14.380  48.839  47.094  1.00 32.41 ? 140 LEU B CA  1 
ATOM   1550 C C   . LEU B 1 11  ? 14.311  49.337  48.543  1.00 32.66 ? 140 LEU B C   1 
ATOM   1551 O O   . LEU B 1 11  ? 13.655  48.724  49.377  1.00 32.80 ? 140 LEU B O   1 
ATOM   1552 C CB  . LEU B 1 11  ? 12.979  48.627  46.503  1.00 30.64 ? 140 LEU B CB  1 
ATOM   1553 C CG  . LEU B 1 11  ? 12.856  47.873  45.176  1.00 29.88 ? 140 LEU B CG  1 
ATOM   1554 C CD1 . LEU B 1 11  ? 11.423  47.400  44.974  1.00 29.36 ? 140 LEU B CD1 1 
ATOM   1555 C CD2 . LEU B 1 11  ? 13.330  48.699  43.985  1.00 29.07 ? 140 LEU B CD2 1 
ATOM   1556 N N   . PRO B 1 12  ? 15.011  50.447  48.853  1.00 33.10 ? 141 PRO B N   1 
ATOM   1557 C CA  . PRO B 1 12  ? 15.018  50.928  50.243  1.00 33.09 ? 141 PRO B CA  1 
ATOM   1558 C C   . PRO B 1 12  ? 13.810  51.789  50.630  1.00 33.29 ? 141 PRO B C   1 
ATOM   1559 O O   . PRO B 1 12  ? 13.556  51.982  51.818  1.00 33.04 ? 141 PRO B O   1 
ATOM   1560 C CB  . PRO B 1 12  ? 16.308  51.750  50.320  1.00 32.86 ? 141 PRO B CB  1 
ATOM   1561 C CG  . PRO B 1 12  ? 16.546  52.222  48.921  1.00 32.14 ? 141 PRO B CG  1 
ATOM   1562 C CD  . PRO B 1 12  ? 15.949  51.198  47.995  1.00 32.70 ? 141 PRO B CD  1 
ATOM   1563 N N   . ASP B 1 13  ? 13.080  52.296  49.638  1.00 32.24 ? 142 ASP B N   1 
ATOM   1564 C CA  . ASP B 1 13  ? 11.996  53.254  49.875  1.00 30.81 ? 142 ASP B CA  1 
ATOM   1565 C C   . ASP B 1 13  ? 10.874  53.126  48.839  1.00 30.62 ? 142 ASP B C   1 
ATOM   1566 O O   . ASP B 1 13  ? 11.008  52.394  47.850  1.00 31.60 ? 142 ASP B O   1 
ATOM   1567 C CB  . ASP B 1 13  ? 12.546  54.692  49.890  1.00 29.77 ? 142 ASP B CB  1 
ATOM   1568 C CG  . ASP B 1 13  ? 13.261  55.064  48.594  1.00 30.03 ? 142 ASP B CG  1 
ATOM   1569 O OD1 . ASP B 1 13  ? 12.650  54.960  47.507  1.00 28.43 ? 142 ASP B OD1 1 
ATOM   1570 O OD2 . ASP B 1 13  ? 14.445  55.465  48.665  1.00 31.84 ? 142 ASP B OD2 1 
ATOM   1571 N N   . GLY B 1 14  ? 9.787   53.861  49.062  1.00 29.93 ? 143 GLY B N   1 
ATOM   1572 C CA  . GLY B 1 14  ? 8.606   53.820  48.198  1.00 30.65 ? 143 GLY B CA  1 
ATOM   1573 C C   . GLY B 1 14  ? 8.824   54.305  46.773  1.00 30.73 ? 143 GLY B C   1 
ATOM   1574 O O   . GLY B 1 14  ? 8.245   53.752  45.834  1.00 30.82 ? 143 GLY B O   1 
ATOM   1575 N N   . ALA B 1 15  ? 9.651   55.340  46.611  1.00 30.59 ? 144 ALA B N   1 
ATOM   1576 C CA  . ALA B 1 15  ? 9.938   55.920  45.290  1.00 30.22 ? 144 ALA B CA  1 
ATOM   1577 C C   . ALA B 1 15  ? 10.658  54.933  44.375  1.00 29.89 ? 144 ALA B C   1 
ATOM   1578 O O   . ALA B 1 15  ? 10.385  54.887  43.175  1.00 30.14 ? 144 ALA B O   1 
ATOM   1579 C CB  . ALA B 1 15  ? 10.743  57.209  45.425  1.00 30.05 ? 144 ALA B CB  1 
ATOM   1580 N N   . ALA B 1 16  ? 11.564  54.140  44.950  1.00 29.58 ? 145 ALA B N   1 
ATOM   1581 C CA  . ALA B 1 16  ? 12.326  53.147  44.189  1.00 29.80 ? 145 ALA B CA  1 
ATOM   1582 C C   . ALA B 1 16  ? 11.417  52.009  43.712  1.00 30.35 ? 145 ALA B C   1 
ATOM   1583 O O   . ALA B 1 16  ? 11.516  51.561  42.559  1.00 29.92 ? 145 ALA B O   1 
ATOM   1584 C CB  . ALA B 1 16  ? 13.492  52.607  45.012  1.00 29.22 ? 145 ALA B CB  1 
ATOM   1585 N N   . ALA B 1 17  ? 10.533  51.553  44.600  1.00 31.53 ? 146 ALA B N   1 
ATOM   1586 C CA  . ALA B 1 17  ? 9.507   50.574  44.245  1.00 32.35 ? 146 ALA B CA  1 
ATOM   1587 C C   . ALA B 1 17  ? 8.683   51.061  43.046  1.00 32.98 ? 146 ALA B C   1 
ATOM   1588 O O   . ALA B 1 17  ? 8.566   50.348  42.038  1.00 33.72 ? 146 ALA B O   1 
ATOM   1589 C CB  . ALA B 1 17  ? 8.612   50.276  45.442  1.00 30.36 ? 146 ALA B CB  1 
ATOM   1590 N N   . GLU B 1 18  ? 8.147   52.280  43.151  1.00 34.62 ? 147 GLU B N   1 
ATOM   1591 C CA  . GLU B 1 18  ? 7.374   52.906  42.062  1.00 36.57 ? 147 GLU B CA  1 
ATOM   1592 C C   . GLU B 1 18  ? 8.164   53.033  40.771  1.00 35.36 ? 147 GLU B C   1 
ATOM   1593 O O   . GLU B 1 18  ? 7.663   52.663  39.706  1.00 35.26 ? 147 GLU B O   1 
ATOM   1594 C CB  . GLU B 1 18  ? 6.833   54.277  42.472  1.00 39.54 ? 147 GLU B CB  1 
ATOM   1595 C CG  . GLU B 1 18  ? 5.696   54.233  43.477  1.00 43.48 ? 147 GLU B CG  1 
ATOM   1596 C CD  . GLU B 1 18  ? 4.395   53.702  42.894  1.00 47.92 ? 147 GLU B CD  1 
ATOM   1597 O OE1 . GLU B 1 18  ? 4.310   52.490  42.592  1.00 50.67 ? 147 GLU B OE1 1 
ATOM   1598 O OE2 . GLU B 1 18  ? 3.440   54.499  42.757  1.00 50.65 ? 147 GLU B OE2 1 
ATOM   1599 N N   . SER B 1 19  ? 9.397   53.544  40.869  1.00 34.73 ? 148 SER B N   1 
ATOM   1600 C CA  . SER B 1 19  ? 10.287  53.673  39.706  1.00 34.45 ? 148 SER B CA  1 
ATOM   1601 C C   . SER B 1 19  ? 10.457  52.348  38.974  1.00 34.29 ? 148 SER B C   1 
ATOM   1602 O O   . SER B 1 19  ? 10.394  52.298  37.743  1.00 34.90 ? 148 SER B O   1 
ATOM   1603 C CB  . SER B 1 19  ? 11.662  54.217  40.114  1.00 34.66 ? 148 SER B CB  1 
ATOM   1604 O OG  . SER B 1 19  ? 11.600  55.599  40.430  1.00 35.79 ? 148 SER B OG  1 
ATOM   1605 N N   . LEU B 1 20  ? 10.664  51.279  39.744  1.00 33.96 ? 149 LEU B N   1 
ATOM   1606 C CA  . LEU B 1 20  ? 10.868  49.949  39.190  1.00 34.03 ? 149 LEU B CA  1 
ATOM   1607 C C   . LEU B 1 20  ? 9.598   49.454  38.504  1.00 33.99 ? 149 LEU B C   1 
ATOM   1608 O O   . LEU B 1 20  ? 9.659   48.867  37.424  1.00 34.57 ? 149 LEU B O   1 
ATOM   1609 C CB  . LEU B 1 20  ? 11.333  48.984  40.287  1.00 34.12 ? 149 LEU B CB  1 
ATOM   1610 C CG  . LEU B 1 20  ? 11.720  47.526  39.996  1.00 35.42 ? 149 LEU B CG  1 
ATOM   1611 C CD1 . LEU B 1 20  ? 10.507  46.606  39.954  1.00 35.90 ? 149 LEU B CD1 1 
ATOM   1612 C CD2 . LEU B 1 20  ? 12.552  47.385  38.733  1.00 35.93 ? 149 LEU B CD2 1 
ATOM   1613 N N   . VAL B 1 21  ? 8.450   49.705  39.127  1.00 34.24 ? 150 VAL B N   1 
ATOM   1614 C CA  . VAL B 1 21  ? 7.165   49.315  38.548  1.00 34.46 ? 150 VAL B CA  1 
ATOM   1615 C C   . VAL B 1 21  ? 6.921   50.046  37.217  1.00 36.45 ? 150 VAL B C   1 
ATOM   1616 O O   . VAL B 1 21  ? 6.390   49.455  36.283  1.00 37.03 ? 150 VAL B O   1 
ATOM   1617 C CB  . VAL B 1 21  ? 6.005   49.500  39.560  1.00 32.62 ? 150 VAL B CB  1 
ATOM   1618 C CG1 . VAL B 1 21  ? 4.647   49.339  38.899  1.00 31.80 ? 150 VAL B CG1 1 
ATOM   1619 C CG2 . VAL B 1 21  ? 6.143   48.500  40.702  1.00 32.81 ? 150 VAL B CG2 1 
ATOM   1620 N N   . GLU B 1 22  ? 7.351   51.306  37.129  1.00 37.90 ? 151 GLU B N   1 
ATOM   1621 C CA  . GLU B 1 22  ? 7.192   52.124  35.908  1.00 40.09 ? 151 GLU B CA  1 
ATOM   1622 C C   . GLU B 1 22  ? 8.190   51.824  34.782  1.00 39.58 ? 151 GLU B C   1 
ATOM   1623 O O   . GLU B 1 22  ? 7.929   52.124  33.614  1.00 39.43 ? 151 GLU B O   1 
ATOM   1624 C CB  . GLU B 1 22  ? 7.240   53.617  36.256  1.00 40.95 ? 151 GLU B CB  1 
ATOM   1625 C CG  . GLU B 1 22  ? 6.094   54.083  37.139  1.00 41.69 ? 151 GLU B CG  1 
ATOM   1626 C CD  . GLU B 1 22  ? 4.760   53.522  36.694  1.00 44.16 ? 151 GLU B CD  1 
ATOM   1627 O OE1 . GLU B 1 22  ? 4.230   53.978  35.656  1.00 44.77 ? 151 GLU B OE1 1 
ATOM   1628 O OE2 . GLU B 1 22  ? 4.249   52.611  37.382  1.00 47.19 ? 151 GLU B OE2 1 
ATOM   1629 N N   . SER B 1 23  ? 9.324   51.232  35.140  1.00 39.77 ? 152 SER B N   1 
ATOM   1630 C CA  . SER B 1 23  ? 10.407  50.960  34.197  1.00 40.51 ? 152 SER B CA  1 
ATOM   1631 C C   . SER B 1 23  ? 10.096  49.895  33.148  1.00 40.51 ? 152 SER B C   1 
ATOM   1632 O O   . SER B 1 23  ? 10.889  49.689  32.229  1.00 42.44 ? 152 SER B O   1 
ATOM   1633 C CB  . SER B 1 23  ? 11.676  50.556  34.952  1.00 40.49 ? 152 SER B CB  1 
ATOM   1634 O OG  . SER B 1 23  ? 12.336  51.691  35.480  1.00 41.81 ? 152 SER B OG  1 
ATOM   1635 N N   . SER B 1 24  ? 8.966   49.210  33.282  1.00 38.86 ? 153 SER B N   1 
ATOM   1636 C CA  . SER B 1 24  ? 8.646   48.115  32.371  1.00 37.82 ? 153 SER B CA  1 
ATOM   1637 C C   . SER B 1 24  ? 7.149   47.864  32.262  1.00 35.98 ? 153 SER B C   1 
ATOM   1638 O O   . SER B 1 24  ? 6.377   48.316  33.101  1.00 35.25 ? 153 SER B O   1 
ATOM   1639 C CB  . SER B 1 24  ? 9.360   46.838  32.818  1.00 39.69 ? 153 SER B CB  1 
ATOM   1640 O OG  . SER B 1 24  ? 9.191   45.792  31.872  1.00 43.59 ? 153 SER B OG  1 
ATOM   1641 N N   . GLU B 1 25  ? 6.751   47.144  31.217  1.00 35.93 ? 154 GLU B N   1 
ATOM   1642 C CA  . GLU B 1 25  ? 5.360   46.708  31.043  1.00 36.86 ? 154 GLU B CA  1 
ATOM   1643 C C   . GLU B 1 25  ? 4.945   45.741  32.157  1.00 35.14 ? 154 GLU B C   1 
ATOM   1644 O O   . GLU B 1 25  ? 3.869   45.884  32.741  1.00 35.55 ? 154 GLU B O   1 
ATOM   1645 C CB  . GLU B 1 25  ? 5.159   46.059  29.662  1.00 37.93 ? 154 GLU B CB  1 
ATOM   1646 C CG  . GLU B 1 25  ? 5.325   47.014  28.486  1.00 39.84 ? 154 GLU B CG  1 
ATOM   1647 C CD  . GLU B 1 25  ? 4.280   48.123  28.467  1.00 41.42 ? 154 GLU B CD  1 
ATOM   1648 O OE1 . GLU B 1 25  ? 4.648   49.296  28.710  1.00 42.09 ? 154 GLU B OE1 1 
ATOM   1649 O OE2 . GLU B 1 25  ? 3.091   47.823  28.218  1.00 41.82 ? 154 GLU B OE2 1 
ATOM   1650 N N   . VAL B 1 26  ? 5.816   44.774  32.447  1.00 33.81 ? 155 VAL B N   1 
ATOM   1651 C CA  . VAL B 1 26  ? 5.645   43.840  33.562  1.00 32.55 ? 155 VAL B CA  1 
ATOM   1652 C C   . VAL B 1 26  ? 6.843   43.958  34.515  1.00 31.49 ? 155 VAL B C   1 
ATOM   1653 O O   . VAL B 1 26  ? 7.985   44.024  34.063  1.00 32.58 ? 155 VAL B O   1 
ATOM   1654 C CB  . VAL B 1 26  ? 5.521   42.384  33.060  1.00 31.88 ? 155 VAL B CB  1 
ATOM   1655 C CG1 . VAL B 1 26  ? 5.262   41.427  34.214  1.00 31.74 ? 155 VAL B CG1 1 
ATOM   1656 C CG2 . VAL B 1 26  ? 4.422   42.270  32.015  1.00 32.06 ? 155 VAL B CG2 1 
ATOM   1657 N N   . ALA B 1 27  ? 6.579   43.993  35.823  1.00 29.39 ? 156 ALA B N   1 
ATOM   1658 C CA  . ALA B 1 27  ? 7.636   44.044  36.847  1.00 27.67 ? 156 ALA B CA  1 
ATOM   1659 C C   . ALA B 1 27  ? 7.244   43.223  38.083  1.00 26.96 ? 156 ALA B C   1 
ATOM   1660 O O   . ALA B 1 27  ? 6.052   43.020  38.347  1.00 26.45 ? 156 ALA B O   1 
ATOM   1661 C CB  . ALA B 1 27  ? 7.945   45.483  37.235  1.00 27.19 ? 156 ALA B CB  1 
ATOM   1662 N N   . VAL B 1 28  ? 8.241   42.749  38.835  1.00 25.40 ? 157 VAL B N   1 
ATOM   1663 C CA  . VAL B 1 28  ? 7.988   41.890  40.006  1.00 23.91 ? 157 VAL B CA  1 
ATOM   1664 C C   . VAL B 1 28  ? 8.790   42.333  41.236  1.00 23.40 ? 157 VAL B C   1 
ATOM   1665 O O   . VAL B 1 28  ? 10.004  42.550  41.160  1.00 22.92 ? 157 VAL B O   1 
ATOM   1666 C CB  . VAL B 1 28  ? 8.278   40.397  39.688  1.00 23.95 ? 157 VAL B CB  1 
ATOM   1667 C CG1 . VAL B 1 28  ? 8.228   39.537  40.949  1.00 23.48 ? 157 VAL B CG1 1 
ATOM   1668 C CG2 . VAL B 1 28  ? 7.306   39.859  38.646  1.00 23.98 ? 157 VAL B CG2 1 
ATOM   1669 N N   . ILE B 1 29  ? 8.112   42.455  42.376  1.00 22.46 ? 158 ILE B N   1 
ATOM   1670 C CA  . ILE B 1 29  ? 8.795   42.779  43.630  1.00 21.58 ? 158 ILE B CA  1 
ATOM   1671 C C   . ILE B 1 29  ? 8.658   41.627  44.633  1.00 21.24 ? 158 ILE B C   1 
ATOM   1672 O O   . ILE B 1 29  ? 7.560   41.112  44.851  1.00 20.86 ? 158 ILE B O   1 
ATOM   1673 C CB  . ILE B 1 29  ? 8.284   44.100  44.254  1.00 20.48 ? 158 ILE B CB  1 
ATOM   1674 C CG1 . ILE B 1 29  ? 8.626   45.293  43.357  1.00 20.53 ? 158 ILE B CG1 1 
ATOM   1675 C CG2 . ILE B 1 29  ? 8.904   44.322  45.625  1.00 20.88 ? 158 ILE B CG2 1 
ATOM   1676 C CD1 . ILE B 1 29  ? 7.998   46.603  43.810  1.00 19.65 ? 158 ILE B CD1 1 
ATOM   1677 N N   . GLY B 1 30  ? 9.782   41.218  45.214  1.00 21.32 ? 159 GLY B N   1 
ATOM   1678 C CA  . GLY B 1 30  ? 9.778   40.291  46.345  1.00 21.29 ? 159 GLY B CA  1 
ATOM   1679 C C   . GLY B 1 30  ? 9.821   41.071  47.650  1.00 21.28 ? 159 GLY B C   1 
ATOM   1680 O O   . GLY B 1 30  ? 10.678  41.934  47.837  1.00 22.07 ? 159 GLY B O   1 
ATOM   1681 N N   . PHE B 1 31  ? 8.875   40.788  48.535  1.00 21.28 ? 160 PHE B N   1 
ATOM   1682 C CA  . PHE B 1 31  ? 8.805   41.430  49.838  1.00 21.38 ? 160 PHE B CA  1 
ATOM   1683 C C   . PHE B 1 31  ? 9.246   40.401  50.879  1.00 22.05 ? 160 PHE B C   1 
ATOM   1684 O O   . PHE B 1 31  ? 8.465   39.548  51.297  1.00 21.64 ? 160 PHE B O   1 
ATOM   1685 C CB  . PHE B 1 31  ? 7.381   41.911  50.137  1.00 20.95 ? 160 PHE B CB  1 
ATOM   1686 C CG  . PHE B 1 31  ? 6.850   42.929  49.161  1.00 21.28 ? 160 PHE B CG  1 
ATOM   1687 C CD1 . PHE B 1 31  ? 6.334   42.537  47.928  1.00 21.12 ? 160 PHE B CD1 1 
ATOM   1688 C CD2 . PHE B 1 31  ? 6.839   44.283  49.485  1.00 21.19 ? 160 PHE B CD2 1 
ATOM   1689 C CE1 . PHE B 1 31  ? 5.829   43.474  47.035  1.00 20.78 ? 160 PHE B CE1 1 
ATOM   1690 C CE2 . PHE B 1 31  ? 6.336   45.226  48.591  1.00 20.97 ? 160 PHE B CE2 1 
ATOM   1691 C CZ  . PHE B 1 31  ? 5.832   44.822  47.367  1.00 20.76 ? 160 PHE B CZ  1 
ATOM   1692 N N   . PHE B 1 32  ? 10.506  40.494  51.289  1.00 22.87 ? 161 PHE B N   1 
ATOM   1693 C CA  . PHE B 1 32  ? 11.099  39.542  52.215  1.00 23.19 ? 161 PHE B CA  1 
ATOM   1694 C C   . PHE B 1 32  ? 11.851  40.270  53.334  1.00 24.37 ? 161 PHE B C   1 
ATOM   1695 O O   . PHE B 1 32  ? 12.880  40.919  53.090  1.00 24.40 ? 161 PHE B O   1 
ATOM   1696 C CB  . PHE B 1 32  ? 12.035  38.596  51.458  1.00 22.86 ? 161 PHE B CB  1 
ATOM   1697 C CG  . PHE B 1 32  ? 11.331  37.713  50.467  1.00 22.07 ? 161 PHE B CG  1 
ATOM   1698 C CD1 . PHE B 1 32  ? 11.264  38.066  49.125  1.00 21.45 ? 161 PHE B CD1 1 
ATOM   1699 C CD2 . PHE B 1 32  ? 10.727  36.521  50.879  1.00 21.91 ? 161 PHE B CD2 1 
ATOM   1700 C CE1 . PHE B 1 32  ? 10.594  37.262  48.207  1.00 21.49 ? 161 PHE B CE1 1 
ATOM   1701 C CE2 . PHE B 1 32  ? 10.064  35.713  49.966  1.00 21.82 ? 161 PHE B CE2 1 
ATOM   1702 C CZ  . PHE B 1 32  ? 9.997   36.083  48.625  1.00 20.97 ? 161 PHE B CZ  1 
ATOM   1703 N N   . LYS B 1 33  ? 11.321  40.169  54.552  1.00 24.54 ? 162 LYS B N   1 
ATOM   1704 C CA  . LYS B 1 33  ? 11.926  40.798  55.730  1.00 26.72 ? 162 LYS B CA  1 
ATOM   1705 C C   . LYS B 1 33  ? 13.366  40.341  55.907  1.00 27.03 ? 162 LYS B C   1 
ATOM   1706 O O   . LYS B 1 33  ? 14.270  41.156  56.094  1.00 27.51 ? 162 LYS B O   1 
ATOM   1707 C CB  . LYS B 1 33  ? 11.121  40.480  56.997  1.00 27.04 ? 162 LYS B CB  1 
ATOM   1708 C CG  . LYS B 1 33  ? 10.464  41.682  57.657  1.00 27.79 ? 162 LYS B CG  1 
ATOM   1709 C CD  . LYS B 1 33  ? 9.282   42.181  56.857  1.00 28.49 ? 162 LYS B CD  1 
ATOM   1710 C CE  . LYS B 1 33  ? 8.826   43.551  57.321  1.00 29.13 ? 162 LYS B CE  1 
ATOM   1711 N NZ  . LYS B 1 33  ? 7.951   43.458  58.518  1.00 30.08 ? 162 LYS B NZ  1 
ATOM   1712 N N   . ASP B 1 34  ? 13.565  39.030  55.837  1.00 27.38 ? 163 ASP B N   1 
ATOM   1713 C CA  . ASP B 1 34  ? 14.892  38.449  55.852  1.00 27.14 ? 163 ASP B CA  1 
ATOM   1714 C C   . ASP B 1 34  ? 15.296  38.099  54.422  1.00 27.70 ? 163 ASP B C   1 
ATOM   1715 O O   . ASP B 1 34  ? 14.826  37.116  53.852  1.00 27.25 ? 163 ASP B O   1 
ATOM   1716 C CB  . ASP B 1 34  ? 14.920  37.213  56.755  1.00 26.06 ? 163 ASP B CB  1 
ATOM   1717 C CG  . ASP B 1 34  ? 16.332  36.695  57.005  1.00 26.13 ? 163 ASP B CG  1 
ATOM   1718 O OD1 . ASP B 1 34  ? 16.493  35.842  57.904  1.00 26.14 ? 163 ASP B OD1 1 
ATOM   1719 O OD2 . ASP B 1 34  ? 17.280  37.129  56.307  1.00 25.95 ? 163 ASP B OD2 1 
ATOM   1720 N N   . VAL B 1 35  ? 16.174  38.913  53.847  1.00 29.61 ? 164 VAL B N   1 
ATOM   1721 C CA  . VAL B 1 35  ? 16.644  38.695  52.480  1.00 32.60 ? 164 VAL B CA  1 
ATOM   1722 C C   . VAL B 1 35  ? 17.537  37.444  52.394  1.00 34.33 ? 164 VAL B C   1 
ATOM   1723 O O   . VAL B 1 35  ? 17.760  36.889  51.312  1.00 32.99 ? 164 VAL B O   1 
ATOM   1724 C CB  . VAL B 1 35  ? 17.342  39.960  51.923  1.00 34.03 ? 164 VAL B CB  1 
ATOM   1725 C CG1 . VAL B 1 35  ? 18.707  40.185  52.570  1.00 33.48 ? 164 VAL B CG1 1 
ATOM   1726 C CG2 . VAL B 1 35  ? 17.469  39.889  50.412  1.00 36.78 ? 164 VAL B CG2 1 
ATOM   1727 N N   . GLU B 1 36  ? 18.022  36.994  53.549  1.00 36.03 ? 165 GLU B N   1 
ATOM   1728 C CA  . GLU B 1 36  ? 18.884  35.818  53.615  1.00 38.77 ? 165 GLU B CA  1 
ATOM   1729 C C   . GLU B 1 36  ? 18.115  34.517  53.855  1.00 37.30 ? 165 GLU B C   1 
ATOM   1730 O O   . GLU B 1 36  ? 18.725  33.455  53.940  1.00 38.73 ? 165 GLU B O   1 
ATOM   1731 C CB  . GLU B 1 36  ? 19.985  36.008  54.670  1.00 40.79 ? 165 GLU B CB  1 
ATOM   1732 C CG  . GLU B 1 36  ? 21.036  37.053  54.301  1.00 43.25 ? 165 GLU B CG  1 
ATOM   1733 C CD  . GLU B 1 36  ? 21.794  36.709  53.029  1.00 46.08 ? 165 GLU B CD  1 
ATOM   1734 O OE1 . GLU B 1 36  ? 22.166  37.639  52.282  1.00 46.31 ? 165 GLU B OE1 1 
ATOM   1735 O OE2 . GLU B 1 36  ? 22.018  35.508  52.769  1.00 48.39 ? 165 GLU B OE2 1 
ATOM   1736 N N   . SER B 1 37  ? 16.787  34.603  53.948  1.00 35.41 ? 166 SER B N   1 
ATOM   1737 C CA  . SER B 1 37  ? 15.941  33.427  54.194  1.00 33.85 ? 166 SER B CA  1 
ATOM   1738 C C   . SER B 1 37  ? 15.801  32.536  52.956  1.00 32.50 ? 166 SER B C   1 
ATOM   1739 O O   . SER B 1 37  ? 15.983  32.997  51.828  1.00 31.70 ? 166 SER B O   1 
ATOM   1740 C CB  . SER B 1 37  ? 14.557  33.847  54.713  1.00 34.48 ? 166 SER B CB  1 
ATOM   1741 O OG  . SER B 1 37  ? 13.857  34.631  53.757  1.00 32.73 ? 166 SER B OG  1 
ATOM   1742 N N   . ASP B 1 38  ? 15.469  31.265  53.183  1.00 31.22 ? 167 ASP B N   1 
ATOM   1743 C CA  . ASP B 1 38  ? 15.329  30.271  52.110  1.00 30.73 ? 167 ASP B CA  1 
ATOM   1744 C C   . ASP B 1 38  ? 14.332  30.671  51.012  1.00 29.91 ? 167 ASP B C   1 
ATOM   1745 O O   . ASP B 1 38  ? 14.656  30.595  49.828  1.00 29.07 ? 167 ASP B O   1 
ATOM   1746 C CB  . ASP B 1 38  ? 14.969  28.896  52.681  1.00 31.40 ? 167 ASP B CB  1 
ATOM   1747 C CG  . ASP B 1 38  ? 16.164  28.189  53.314  1.00 33.90 ? 167 ASP B CG  1 
ATOM   1748 O OD1 . ASP B 1 38  ? 15.967  27.083  53.865  1.00 35.84 ? 167 ASP B OD1 1 
ATOM   1749 O OD2 . ASP B 1 38  ? 17.296  28.730  53.268  1.00 33.36 ? 167 ASP B OD2 1 
ATOM   1750 N N   . SER B 1 39  ? 13.137  31.100  51.409  1.00 28.21 ? 168 SER B N   1 
ATOM   1751 C CA  . SER B 1 39  ? 12.143  31.581  50.454  1.00 28.68 ? 168 SER B CA  1 
ATOM   1752 C C   . SER B 1 39  ? 12.663  32.765  49.623  1.00 28.64 ? 168 SER B C   1 
ATOM   1753 O O   . SER B 1 39  ? 12.436  32.820  48.411  1.00 27.79 ? 168 SER B O   1 
ATOM   1754 C CB  . SER B 1 39  ? 10.827  31.927  51.165  1.00 29.74 ? 168 SER B CB  1 
ATOM   1755 O OG  . SER B 1 39  ? 11.040  32.762  52.288  1.00 30.17 ? 168 SER B OG  1 
ATOM   1756 N N   . ALA B 1 40  ? 13.377  33.687  50.274  1.00 28.25 ? 169 ALA B N   1 
ATOM   1757 C CA  . ALA B 1 40  ? 14.004  34.826  49.594  1.00 28.69 ? 169 ALA B CA  1 
ATOM   1758 C C   . ALA B 1 40  ? 15.026  34.392  48.539  1.00 30.00 ? 169 ALA B C   1 
ATOM   1759 O O   . ALA B 1 40  ? 15.037  34.937  47.430  1.00 30.45 ? 169 ALA B O   1 
ATOM   1760 C CB  . ALA B 1 40  ? 14.629  35.789  50.598  1.00 28.32 ? 169 ALA B CB  1 
ATOM   1761 N N   . LYS B 1 41  ? 15.864  33.409  48.881  1.00 30.60 ? 170 LYS B N   1 
ATOM   1762 C CA  . LYS B 1 41  ? 16.810  32.810  47.931  1.00 30.60 ? 170 LYS B CA  1 
ATOM   1763 C C   . LYS B 1 41  ? 16.087  32.204  46.731  1.00 30.04 ? 170 LYS B C   1 
ATOM   1764 O O   . LYS B 1 41  ? 16.504  32.397  45.582  1.00 29.42 ? 170 LYS B O   1 
ATOM   1765 C CB  . LYS B 1 41  ? 17.661  31.728  48.611  1.00 32.51 ? 170 LYS B CB  1 
ATOM   1766 C CG  . LYS B 1 41  ? 18.736  32.249  49.555  1.00 35.67 ? 170 LYS B CG  1 
ATOM   1767 C CD  . LYS B 1 41  ? 19.547  31.090  50.123  1.00 38.06 ? 170 LYS B CD  1 
ATOM   1768 C CE  . LYS B 1 41  ? 20.489  31.534  51.230  1.00 38.36 ? 170 LYS B CE  1 
ATOM   1769 N NZ  . LYS B 1 41  ? 21.374  30.412  51.664  1.00 39.16 ? 170 LYS B NZ  1 
ATOM   1770 N N   . GLN B 1 42  ? 15.008  31.468  47.008  1.00 29.64 ? 171 GLN B N   1 
ATOM   1771 C CA  . GLN B 1 42  ? 14.155  30.896  45.965  1.00 29.82 ? 171 GLN B CA  1 
ATOM   1772 C C   . GLN B 1 42  ? 13.635  31.992  45.026  1.00 28.97 ? 171 GLN B C   1 
ATOM   1773 O O   . GLN B 1 42  ? 13.610  31.811  43.802  1.00 28.40 ? 171 GLN B O   1 
ATOM   1774 C CB  . GLN B 1 42  ? 12.984  30.114  46.578  1.00 31.09 ? 171 GLN B CB  1 
ATOM   1775 C CG  . GLN B 1 42  ? 13.375  28.905  47.427  1.00 32.49 ? 171 GLN B CG  1 
ATOM   1776 C CD  . GLN B 1 42  ? 13.651  27.648  46.612  1.00 35.28 ? 171 GLN B CD  1 
ATOM   1777 O OE1 . GLN B 1 42  ? 13.515  27.634  45.383  1.00 35.95 ? 171 GLN B OE1 1 
ATOM   1778 N NE2 . GLN B 1 42  ? 14.036  26.574  47.302  1.00 36.86 ? 171 GLN B NE2 1 
ATOM   1779 N N   . PHE B 1 43  ? 13.241  33.130  45.602  1.00 27.87 ? 172 PHE B N   1 
ATOM   1780 C CA  . PHE B 1 43  ? 12.807  34.280  44.810  1.00 28.07 ? 172 PHE B CA  1 
ATOM   1781 C C   . PHE B 1 43  ? 13.957  34.835  43.968  1.00 28.84 ? 172 PHE B C   1 
ATOM   1782 O O   . PHE B 1 43  ? 13.781  35.093  42.778  1.00 29.72 ? 172 PHE B O   1 
ATOM   1783 C CB  . PHE B 1 43  ? 12.184  35.385  45.692  1.00 26.60 ? 172 PHE B CB  1 
ATOM   1784 C CG  . PHE B 1 43  ? 12.012  36.702  44.977  1.00 25.77 ? 172 PHE B CG  1 
ATOM   1785 C CD1 . PHE B 1 43  ? 10.919  36.922  44.142  1.00 25.34 ? 172 PHE B CD1 1 
ATOM   1786 C CD2 . PHE B 1 43  ? 12.962  37.714  45.115  1.00 25.19 ? 172 PHE B CD2 1 
ATOM   1787 C CE1 . PHE B 1 43  ? 10.768  38.127  43.473  1.00 25.27 ? 172 PHE B CE1 1 
ATOM   1788 C CE2 . PHE B 1 43  ? 12.821  38.918  44.446  1.00 24.67 ? 172 PHE B CE2 1 
ATOM   1789 C CZ  . PHE B 1 43  ? 11.725  39.125  43.620  1.00 25.30 ? 172 PHE B CZ  1 
ATOM   1790 N N   . LEU B 1 44  ? 15.123  35.011  44.586  1.00 29.28 ? 173 LEU B N   1 
ATOM   1791 C CA  . LEU B 1 44  ? 16.302  35.515  43.878  1.00 31.09 ? 173 LEU B CA  1 
ATOM   1792 C C   . LEU B 1 44  ? 16.726  34.600  42.724  1.00 32.22 ? 173 LEU B C   1 
ATOM   1793 O O   . LEU B 1 44  ? 17.164  35.074  41.674  1.00 32.84 ? 173 LEU B O   1 
ATOM   1794 C CB  . LEU B 1 44  ? 17.460  35.772  44.852  1.00 30.66 ? 173 LEU B CB  1 
ATOM   1795 C CG  . LEU B 1 44  ? 17.278  36.982  45.788  1.00 31.57 ? 173 LEU B CG  1 
ATOM   1796 C CD1 . LEU B 1 44  ? 18.272  36.961  46.942  1.00 30.84 ? 173 LEU B CD1 1 
ATOM   1797 C CD2 . LEU B 1 44  ? 17.355  38.305  45.031  1.00 31.52 ? 173 LEU B CD2 1 
ATOM   1798 N N   . GLN B 1 45  ? 16.569  33.294  42.923  1.00 34.30 ? 174 GLN B N   1 
ATOM   1799 C CA  . GLN B 1 45  ? 16.773  32.304  41.863  1.00 35.81 ? 174 GLN B CA  1 
ATOM   1800 C C   . GLN B 1 45  ? 15.744  32.439  40.740  1.00 35.22 ? 174 GLN B C   1 
ATOM   1801 O O   . GLN B 1 45  ? 16.063  32.197  39.579  1.00 35.51 ? 174 GLN B O   1 
ATOM   1802 C CB  . GLN B 1 45  ? 16.755  30.880  42.436  1.00 37.15 ? 174 GLN B CB  1 
ATOM   1803 C CG  . GLN B 1 45  ? 18.126  30.334  42.815  1.00 38.81 ? 174 GLN B CG  1 
ATOM   1804 C CD  . GLN B 1 45  ? 18.899  29.822  41.606  1.00 42.59 ? 174 GLN B CD  1 
ATOM   1805 O OE1 . GLN B 1 45  ? 18.712  28.680  41.163  1.00 43.73 ? 174 GLN B OE1 1 
ATOM   1806 N NE2 . GLN B 1 45  ? 19.772  30.665  41.065  1.00 42.18 ? 174 GLN B NE2 1 
ATOM   1807 N N   . ALA B 1 46  ? 14.513  32.821  41.083  1.00 34.91 ? 175 ALA B N   1 
ATOM   1808 C CA  . ALA B 1 46  ? 13.485  33.050  40.067  1.00 34.99 ? 175 ALA B CA  1 
ATOM   1809 C C   . ALA B 1 46  ? 13.808  34.306  39.265  1.00 35.76 ? 175 ALA B C   1 
ATOM   1810 O O   . ALA B 1 46  ? 13.584  34.343  38.055  1.00 35.42 ? 175 ALA B O   1 
ATOM   1811 C CB  . ALA B 1 46  ? 12.101  33.144  40.696  1.00 35.46 ? 175 ALA B CB  1 
ATOM   1812 N N   . ALA B 1 47  ? 14.349  35.318  39.950  1.00 36.57 ? 176 ALA B N   1 
ATOM   1813 C CA  . ALA B 1 47  ? 14.748  36.586  39.333  1.00 37.17 ? 176 ALA B CA  1 
ATOM   1814 C C   . ALA B 1 47  ? 15.844  36.402  38.278  1.00 38.47 ? 176 ALA B C   1 
ATOM   1815 O O   . ALA B 1 47  ? 15.827  37.068  37.240  1.00 37.34 ? 176 ALA B O   1 
ATOM   1816 C CB  . ALA B 1 47  ? 15.190  37.581  40.400  1.00 35.98 ? 176 ALA B CB  1 
ATOM   1817 N N   . GLU B 1 48  ? 16.779  35.493  38.552  1.00 40.94 ? 177 GLU B N   1 
ATOM   1818 C CA  . GLU B 1 48  ? 17.891  35.187  37.652  1.00 43.35 ? 177 GLU B CA  1 
ATOM   1819 C C   . GLU B 1 48  ? 17.448  34.359  36.441  1.00 43.65 ? 177 GLU B C   1 
ATOM   1820 O O   . GLU B 1 48  ? 18.053  34.444  35.374  1.00 45.70 ? 177 GLU B O   1 
ATOM   1821 C CB  . GLU B 1 48  ? 18.987  34.433  38.412  1.00 46.22 ? 177 GLU B CB  1 
ATOM   1822 C CG  . GLU B 1 48  ? 20.389  34.590  37.831  1.00 49.85 ? 177 GLU B CG  1 
ATOM   1823 C CD  . GLU B 1 48  ? 21.155  35.771  38.414  1.00 51.61 ? 177 GLU B CD  1 
ATOM   1824 O OE1 . GLU B 1 48  ? 20.959  36.086  39.606  1.00 52.90 ? 177 GLU B OE1 1 
ATOM   1825 O OE2 . GLU B 1 48  ? 21.969  36.380  37.686  1.00 53.05 ? 177 GLU B OE2 1 
ATOM   1826 N N   . ALA B 1 49  ? 16.396  33.561  36.614  1.00 43.78 ? 178 ALA B N   1 
ATOM   1827 C CA  . ALA B 1 49  ? 15.896  32.669  35.562  1.00 43.41 ? 178 ALA B CA  1 
ATOM   1828 C C   . ALA B 1 49  ? 15.090  33.390  34.477  1.00 45.50 ? 178 ALA B C   1 
ATOM   1829 O O   . ALA B 1 49  ? 14.707  32.776  33.476  1.00 46.80 ? 178 ALA B O   1 
ATOM   1830 C CB  . ALA B 1 49  ? 15.070  31.545  36.175  1.00 42.41 ? 178 ALA B CB  1 
ATOM   1831 N N   . ILE B 1 50  ? 14.825  34.681  34.689  1.00 45.88 ? 179 ILE B N   1 
ATOM   1832 C CA  . ILE B 1 50  ? 14.055  35.510  33.753  1.00 47.02 ? 179 ILE B CA  1 
ATOM   1833 C C   . ILE B 1 50  ? 14.751  36.860  33.578  1.00 48.41 ? 179 ILE B C   1 
ATOM   1834 O O   . ILE B 1 50  ? 15.057  37.543  34.559  1.00 51.08 ? 179 ILE B O   1 
ATOM   1835 C CB  . ILE B 1 50  ? 12.585  35.711  34.220  1.00 46.03 ? 179 ILE B CB  1 
ATOM   1836 C CG1 . ILE B 1 50  ? 11.801  34.396  34.115  1.00 45.58 ? 179 ILE B CG1 1 
ATOM   1837 C CG2 . ILE B 1 50  ? 11.888  36.800  33.406  1.00 46.14 ? 179 ILE B CG2 1 
ATOM   1838 C CD1 . ILE B 1 50  ? 10.386  34.443  34.653  1.00 44.76 ? 179 ILE B CD1 1 
ATOM   1839 N N   . ASP B 1 51  ? 15.009  37.232  32.327  1.00 48.52 ? 180 ASP B N   1 
ATOM   1840 C CA  . ASP B 1 51  ? 15.638  38.516  32.023  1.00 49.57 ? 180 ASP B CA  1 
ATOM   1841 C C   . ASP B 1 51  ? 14.713  39.439  31.235  1.00 48.48 ? 180 ASP B C   1 
ATOM   1842 O O   . ASP B 1 51  ? 15.069  40.574  30.920  1.00 48.73 ? 180 ASP B O   1 
ATOM   1843 C CB  . ASP B 1 51  ? 16.966  38.303  31.292  1.00 51.57 ? 180 ASP B CB  1 
ATOM   1844 C CG  . ASP B 1 51  ? 18.093  37.906  32.231  1.00 53.53 ? 180 ASP B CG  1 
ATOM   1845 O OD1 . ASP B 1 51  ? 17.838  37.711  33.441  1.00 54.49 ? 180 ASP B OD1 1 
ATOM   1846 O OD2 . ASP B 1 51  ? 19.243  37.791  31.757  1.00 54.88 ? 180 ASP B OD2 1 
ATOM   1847 N N   . ASP B 1 52  ? 13.515  38.942  30.944  1.00 48.22 ? 181 ASP B N   1 
ATOM   1848 C CA  . ASP B 1 52  ? 12.482  39.701  30.248  1.00 48.66 ? 181 ASP B CA  1 
ATOM   1849 C C   . ASP B 1 52  ? 11.832  40.754  31.155  1.00 44.95 ? 181 ASP B C   1 
ATOM   1850 O O   . ASP B 1 52  ? 11.332  41.775  30.676  1.00 44.47 ? 181 ASP B O   1 
ATOM   1851 C CB  . ASP B 1 52  ? 11.414  38.739  29.720  1.00 52.08 ? 181 ASP B CB  1 
ATOM   1852 C CG  . ASP B 1 52  ? 10.497  39.386  28.705  1.00 57.24 ? 181 ASP B CG  1 
ATOM   1853 O OD1 . ASP B 1 52  ? 11.007  39.964  27.722  1.00 60.31 ? 181 ASP B OD1 1 
ATOM   1854 O OD2 . ASP B 1 52  ? 9.263   39.314  28.888  1.00 60.11 ? 181 ASP B OD2 1 
ATOM   1855 N N   . ILE B 1 53  ? 11.858  40.489  32.461  1.00 40.69 ? 182 ILE B N   1 
ATOM   1856 C CA  . ILE B 1 53  ? 11.167  41.286  33.476  1.00 35.63 ? 182 ILE B CA  1 
ATOM   1857 C C   . ILE B 1 53  ? 12.169  41.744  34.554  1.00 34.00 ? 182 ILE B C   1 
ATOM   1858 O O   . ILE B 1 53  ? 13.028  40.960  34.967  1.00 34.10 ? 182 ILE B O   1 
ATOM   1859 C CB  . ILE B 1 53  ? 10.040  40.452  34.131  1.00 34.82 ? 182 ILE B CB  1 
ATOM   1860 C CG1 . ILE B 1 53  ? 9.047   39.955  33.077  1.00 33.49 ? 182 ILE B CG1 1 
ATOM   1861 C CG2 . ILE B 1 53  ? 9.312   41.238  35.217  1.00 34.80 ? 182 ILE B CG2 1 
ATOM   1862 C CD1 . ILE B 1 53  ? 8.168   38.818  33.558  1.00 33.84 ? 182 ILE B CD1 1 
ATOM   1863 N N   . PRO B 1 54  ? 12.081  43.018  34.995  1.00 31.67 ? 183 PRO B N   1 
ATOM   1864 C CA  . PRO B 1 54  ? 12.922  43.461  36.112  1.00 31.42 ? 183 PRO B CA  1 
ATOM   1865 C C   . PRO B 1 54  ? 12.369  43.014  37.471  1.00 30.70 ? 183 PRO B C   1 
ATOM   1866 O O   . PRO B 1 54  ? 11.146  42.954  37.661  1.00 30.06 ? 183 PRO B O   1 
ATOM   1867 C CB  . PRO B 1 54  ? 12.892  44.989  35.992  1.00 31.27 ? 183 PRO B CB  1 
ATOM   1868 C CG  . PRO B 1 54  ? 11.577  45.279  35.351  1.00 31.15 ? 183 PRO B CG  1 
ATOM   1869 C CD  . PRO B 1 54  ? 11.314  44.134  34.409  1.00 30.92 ? 183 PRO B CD  1 
ATOM   1870 N N   . PHE B 1 55  ? 13.273  42.698  38.398  1.00 29.36 ? 184 PHE B N   1 
ATOM   1871 C CA  . PHE B 1 55  ? 12.893  42.266  39.745  1.00 27.71 ? 184 PHE B CA  1 
ATOM   1872 C C   . PHE B 1 55  ? 13.385  43.217  40.822  1.00 27.12 ? 184 PHE B C   1 
ATOM   1873 O O   . PHE B 1 55  ? 14.481  43.766  40.720  1.00 29.30 ? 184 PHE B O   1 
ATOM   1874 C CB  . PHE B 1 55  ? 13.406  40.853  40.021  1.00 27.44 ? 184 PHE B CB  1 
ATOM   1875 C CG  . PHE B 1 55  ? 12.719  39.794  39.209  1.00 28.04 ? 184 PHE B CG  1 
ATOM   1876 C CD1 . PHE B 1 55  ? 13.039  39.607  37.864  1.00 28.48 ? 184 PHE B CD1 1 
ATOM   1877 C CD2 . PHE B 1 55  ? 11.755  38.982  39.784  1.00 27.95 ? 184 PHE B CD2 1 
ATOM   1878 C CE1 . PHE B 1 55  ? 12.407  38.630  37.111  1.00 28.50 ? 184 PHE B CE1 1 
ATOM   1879 C CE2 . PHE B 1 55  ? 11.117  38.002  39.036  1.00 28.53 ? 184 PHE B CE2 1 
ATOM   1880 C CZ  . PHE B 1 55  ? 11.441  37.826  37.697  1.00 28.53 ? 184 PHE B CZ  1 
ATOM   1881 N N   . GLY B 1 56  ? 12.559  43.413  41.846  1.00 26.15 ? 185 GLY B N   1 
ATOM   1882 C CA  . GLY B 1 56  ? 12.922  44.222  43.005  1.00 25.00 ? 185 GLY B CA  1 
ATOM   1883 C C   . GLY B 1 56  ? 12.812  43.395  44.274  1.00 24.76 ? 185 GLY B C   1 
ATOM   1884 O O   . GLY B 1 56  ? 12.144  42.362  44.284  1.00 25.58 ? 185 GLY B O   1 
ATOM   1885 N N   . ILE B 1 57  ? 13.475  43.838  45.339  1.00 23.85 ? 186 ILE B N   1 
ATOM   1886 C CA  . ILE B 1 57  ? 13.389  43.171  46.637  1.00 24.02 ? 186 ILE B CA  1 
ATOM   1887 C C   . ILE B 1 57  ? 13.426  44.200  47.762  1.00 25.15 ? 186 ILE B C   1 
ATOM   1888 O O   . ILE B 1 57  ? 14.303  45.068  47.775  1.00 26.22 ? 186 ILE B O   1 
ATOM   1889 C CB  . ILE B 1 57  ? 14.482  42.064  46.815  1.00 23.49 ? 186 ILE B CB  1 
ATOM   1890 C CG1 . ILE B 1 57  ? 14.243  41.250  48.094  1.00 22.96 ? 186 ILE B CG1 1 
ATOM   1891 C CG2 . ILE B 1 57  ? 15.895  42.643  46.783  1.00 23.06 ? 186 ILE B CG2 1 
ATOM   1892 C CD1 . ILE B 1 57  ? 15.001  39.943  48.142  1.00 22.39 ? 186 ILE B CD1 1 
ATOM   1893 N N   . THR B 1 58  ? 12.458  44.113  48.680  1.00 25.49 ? 187 THR B N   1 
ATOM   1894 C CA  . THR B 1 58  ? 12.414  44.958  49.878  1.00 25.99 ? 187 THR B CA  1 
ATOM   1895 C C   . THR B 1 58  ? 12.340  44.166  51.173  1.00 25.94 ? 187 THR B C   1 
ATOM   1896 O O   . THR B 1 58  ? 11.807  43.053  51.198  1.00 27.45 ? 187 THR B O   1 
ATOM   1897 C CB  . THR B 1 58  ? 11.180  45.876  49.920  1.00 26.76 ? 187 THR B CB  1 
ATOM   1898 O OG1 . THR B 1 58  ? 10.071  45.255  49.243  1.00 27.10 ? 187 THR B OG1 1 
ATOM   1899 C CG2 . THR B 1 58  ? 11.489  47.181  49.306  1.00 27.58 ? 187 THR B CG2 1 
ATOM   1900 N N   . SER B 1 59  ? 12.847  44.791  52.235  1.00 24.95 ? 188 SER B N   1 
ATOM   1901 C CA  . SER B 1 59  ? 12.719  44.342  53.614  1.00 26.01 ? 188 SER B CA  1 
ATOM   1902 C C   . SER B 1 59  ? 12.120  45.491  54.421  1.00 26.85 ? 188 SER B C   1 
ATOM   1903 O O   . SER B 1 59  ? 12.012  45.411  55.652  1.00 27.30 ? 188 SER B O   1 
ATOM   1904 C CB  . SER B 1 59  ? 14.103  44.015  54.189  1.00 26.14 ? 188 SER B CB  1 
ATOM   1905 O OG  . SER B 1 59  ? 14.796  43.093  53.367  1.00 27.14 ? 188 SER B OG  1 
ATOM   1906 N N   . ASN B 1 60  ? 11.759  46.565  53.721  1.00 26.83 ? 189 ASN B N   1 
ATOM   1907 C CA  . ASN B 1 60  ? 11.306  47.799  54.346  1.00 28.42 ? 189 ASN B CA  1 
ATOM   1908 C C   . ASN B 1 60  ? 9.802   47.742  54.542  1.00 28.80 ? 189 ASN B C   1 
ATOM   1909 O O   . ASN B 1 60  ? 9.047   47.670  53.570  1.00 28.92 ? 189 ASN B O   1 
ATOM   1910 C CB  . ASN B 1 60  ? 11.705  48.995  53.476  1.00 29.42 ? 189 ASN B CB  1 
ATOM   1911 C CG  . ASN B 1 60  ? 11.470  50.328  54.156  1.00 31.46 ? 189 ASN B CG  1 
ATOM   1912 O OD1 . ASN B 1 60  ? 10.506  50.512  54.899  1.00 31.73 ? 189 ASN B OD1 1 
ATOM   1913 N ND2 . ASN B 1 60  ? 12.354  51.277  53.890  1.00 33.12 ? 189 ASN B ND2 1 
ATOM   1914 N N   . SER B 1 61  ? 9.371   47.769  55.800  1.00 28.98 ? 190 SER B N   1 
ATOM   1915 C CA  . SER B 1 61  ? 7.970   47.509  56.130  1.00 30.52 ? 190 SER B CA  1 
ATOM   1916 C C   . SER B 1 61  ? 7.014   48.632  55.707  1.00 29.80 ? 190 SER B C   1 
ATOM   1917 O O   . SER B 1 61  ? 5.808   48.420  55.623  1.00 30.44 ? 190 SER B O   1 
ATOM   1918 C CB  . SER B 1 61  ? 7.805   47.127  57.606  1.00 30.91 ? 190 SER B CB  1 
ATOM   1919 O OG  . SER B 1 61  ? 8.030   48.231  58.449  1.00 32.62 ? 190 SER B OG  1 
ATOM   1920 N N   . ASP B 1 62  ? 7.571   49.810  55.428  1.00 29.86 ? 191 ASP B N   1 
ATOM   1921 C CA  . ASP B 1 62  ? 6.841   50.912  54.810  1.00 28.68 ? 191 ASP B CA  1 
ATOM   1922 C C   . ASP B 1 62  ? 6.510   50.551  53.368  1.00 28.96 ? 191 ASP B C   1 
ATOM   1923 O O   . ASP B 1 62  ? 5.401   50.811  52.892  1.00 28.80 ? 191 ASP B O   1 
ATOM   1924 C CB  . ASP B 1 62  ? 7.680   52.198  54.829  1.00 29.91 ? 191 ASP B CB  1 
ATOM   1925 C CG  . ASP B 1 62  ? 7.647   52.922  56.175  1.00 30.42 ? 191 ASP B CG  1 
ATOM   1926 O OD1 . ASP B 1 62  ? 7.071   52.406  57.159  1.00 30.22 ? 191 ASP B OD1 1 
ATOM   1927 O OD2 . ASP B 1 62  ? 8.205   54.037  56.242  1.00 32.21 ? 191 ASP B OD2 1 
ATOM   1928 N N   . VAL B 1 63  ? 7.477   49.947  52.678  1.00 27.36 ? 192 VAL B N   1 
ATOM   1929 C CA  . VAL B 1 63  ? 7.252   49.455  51.317  1.00 27.12 ? 192 VAL B CA  1 
ATOM   1930 C C   . VAL B 1 63  ? 6.266   48.274  51.314  1.00 25.89 ? 192 VAL B C   1 
ATOM   1931 O O   . VAL B 1 63  ? 5.392   48.208  50.451  1.00 23.87 ? 192 VAL B O   1 
ATOM   1932 C CB  . VAL B 1 63  ? 8.566   49.104  50.587  1.00 27.04 ? 192 VAL B CB  1 
ATOM   1933 C CG1 . VAL B 1 63  ? 8.298   48.861  49.113  1.00 27.15 ? 192 VAL B CG1 1 
ATOM   1934 C CG2 . VAL B 1 63  ? 9.586   50.230  50.736  1.00 27.46 ? 192 VAL B CG2 1 
ATOM   1935 N N   . PHE B 1 64  ? 6.407   47.360  52.278  1.00 25.41 ? 193 PHE B N   1 
ATOM   1936 C CA  . PHE B 1 64  ? 5.421   46.296  52.501  1.00 25.68 ? 193 PHE B CA  1 
ATOM   1937 C C   . PHE B 1 64  ? 4.009   46.890  52.572  1.00 27.44 ? 193 PHE B C   1 
ATOM   1938 O O   . PHE B 1 64  ? 3.126   46.483  51.811  1.00 28.76 ? 193 PHE B O   1 
ATOM   1939 C CB  . PHE B 1 64  ? 5.704   45.546  53.807  1.00 25.14 ? 193 PHE B CB  1 
ATOM   1940 C CG  . PHE B 1 64  ? 6.639   44.368  53.675  1.00 23.87 ? 193 PHE B CG  1 
ATOM   1941 C CD1 . PHE B 1 64  ? 7.934   44.523  53.203  1.00 24.06 ? 193 PHE B CD1 1 
ATOM   1942 C CD2 . PHE B 1 64  ? 6.235   43.107  54.095  1.00 23.81 ? 193 PHE B CD2 1 
ATOM   1943 C CE1 . PHE B 1 64  ? 8.794   43.435  53.118  1.00 23.11 ? 193 PHE B CE1 1 
ATOM   1944 C CE2 . PHE B 1 64  ? 7.083   42.016  54.009  1.00 23.30 ? 193 PHE B CE2 1 
ATOM   1945 C CZ  . PHE B 1 64  ? 8.368   42.184  53.523  1.00 23.17 ? 193 PHE B CZ  1 
ATOM   1946 N N   . SER B 1 65  ? 3.815   47.854  53.478  1.00 27.51 ? 194 SER B N   1 
ATOM   1947 C CA  . SER B 1 65  ? 2.519   48.519  53.701  1.00 28.74 ? 194 SER B CA  1 
ATOM   1948 C C   . SER B 1 65  ? 1.990   49.308  52.502  1.00 28.14 ? 194 SER B C   1 
ATOM   1949 O O   . SER B 1 65  ? 0.776   49.361  52.276  1.00 28.45 ? 194 SER B O   1 
ATOM   1950 C CB  . SER B 1 65  ? 2.610   49.464  54.905  1.00 30.41 ? 194 SER B CB  1 
ATOM   1951 O OG  . SER B 1 65  ? 2.757   48.743  56.113  1.00 32.70 ? 194 SER B OG  1 
ATOM   1952 N N   . LYS B 1 66  ? 2.893   49.938  51.752  1.00 26.94 ? 195 LYS B N   1 
ATOM   1953 C CA  . LYS B 1 66  ? 2.510   50.701  50.564  1.00 26.84 ? 195 LYS B CA  1 
ATOM   1954 C C   . LYS B 1 66  ? 1.712   49.831  49.584  1.00 27.02 ? 195 LYS B C   1 
ATOM   1955 O O   . LYS B 1 66  ? 0.808   50.319  48.914  1.00 27.60 ? 195 LYS B O   1 
ATOM   1956 C CB  . LYS B 1 66  ? 3.743   51.292  49.871  1.00 27.11 ? 195 LYS B CB  1 
ATOM   1957 C CG  . LYS B 1 66  ? 3.432   52.335  48.798  1.00 27.18 ? 195 LYS B CG  1 
ATOM   1958 C CD  . LYS B 1 66  ? 4.666   52.673  47.978  1.00 27.71 ? 195 LYS B CD  1 
ATOM   1959 C CE  . LYS B 1 66  ? 4.370   53.674  46.865  1.00 27.67 ? 195 LYS B CE  1 
ATOM   1960 N NZ  . LYS B 1 66  ? 4.324   55.075  47.381  1.00 28.64 ? 195 LYS B NZ  1 
ATOM   1961 N N   . TYR B 1 67  ? 2.044   48.543  49.524  1.00 26.10 ? 196 TYR B N   1 
ATOM   1962 C CA  . TYR B 1 67  ? 1.366   47.609  48.628  1.00 25.12 ? 196 TYR B CA  1 
ATOM   1963 C C   . TYR B 1 67  ? 0.440   46.655  49.377  1.00 24.50 ? 196 TYR B C   1 
ATOM   1964 O O   . TYR B 1 67  ? -0.004  45.658  48.820  1.00 23.59 ? 196 TYR B O   1 
ATOM   1965 C CB  . TYR B 1 67  ? 2.398   46.852  47.787  1.00 25.17 ? 196 TYR B CB  1 
ATOM   1966 C CG  . TYR B 1 67  ? 3.176   47.785  46.893  1.00 25.21 ? 196 TYR B CG  1 
ATOM   1967 C CD1 . TYR B 1 67  ? 2.625   48.246  45.697  1.00 24.88 ? 196 TYR B CD1 1 
ATOM   1968 C CD2 . TYR B 1 67  ? 4.443   48.250  47.265  1.00 25.15 ? 196 TYR B CD2 1 
ATOM   1969 C CE1 . TYR B 1 67  ? 3.320   49.117  44.880  1.00 25.63 ? 196 TYR B CE1 1 
ATOM   1970 C CE2 . TYR B 1 67  ? 5.149   49.126  46.453  1.00 25.12 ? 196 TYR B CE2 1 
ATOM   1971 C CZ  . TYR B 1 67  ? 4.581   49.553  45.261  1.00 25.39 ? 196 TYR B CZ  1 
ATOM   1972 O OH  . TYR B 1 67  ? 5.261   50.414  44.437  1.00 25.13 ? 196 TYR B OH  1 
ATOM   1973 N N   . GLN B 1 68  ? 0.157   46.987  50.637  1.00 24.99 ? 197 GLN B N   1 
ATOM   1974 C CA  . GLN B 1 68  ? -0.715  46.200  51.525  1.00 26.25 ? 197 GLN B CA  1 
ATOM   1975 C C   . GLN B 1 68  ? -0.205  44.787  51.778  1.00 27.47 ? 197 GLN B C   1 
ATOM   1976 O O   . GLN B 1 68  ? -0.977  43.824  51.787  1.00 28.26 ? 197 GLN B O   1 
ATOM   1977 C CB  . GLN B 1 68  ? -2.159  46.159  51.024  1.00 26.12 ? 197 GLN B CB  1 
ATOM   1978 C CG  . GLN B 1 68  ? -2.775  47.526  50.771  1.00 27.66 ? 197 GLN B CG  1 
ATOM   1979 C CD  . GLN B 1 68  ? -4.281  47.460  50.614  1.00 28.26 ? 197 GLN B CD  1 
ATOM   1980 O OE1 . GLN B 1 68  ? -4.996  48.308  51.131  1.00 29.98 ? 197 GLN B OE1 1 
ATOM   1981 N NE2 . GLN B 1 68  ? -4.769  46.446  49.910  1.00 28.64 ? 197 GLN B NE2 1 
ATOM   1982 N N   . LEU B 1 69  ? 1.101   44.667  51.984  1.00 28.33 ? 198 LEU B N   1 
ATOM   1983 C CA  . LEU B 1 69  ? 1.683   43.414  52.433  1.00 29.09 ? 198 LEU B CA  1 
ATOM   1984 C C   . LEU B 1 69  ? 1.935   43.531  53.931  1.00 30.24 ? 198 LEU B C   1 
ATOM   1985 O O   . LEU B 1 69  ? 2.567   44.489  54.386  1.00 29.92 ? 198 LEU B O   1 
ATOM   1986 C CB  . LEU B 1 69  ? 2.998   43.122  51.693  1.00 28.77 ? 198 LEU B CB  1 
ATOM   1987 C CG  . LEU B 1 69  ? 3.065   42.521  50.278  1.00 29.04 ? 198 LEU B CG  1 
ATOM   1988 C CD1 . LEU B 1 69  ? 2.998   41.002  50.300  1.00 28.50 ? 198 LEU B CD1 1 
ATOM   1989 C CD2 . LEU B 1 69  ? 2.025   43.114  49.330  1.00 28.24 ? 198 LEU B CD2 1 
ATOM   1990 N N   . ASP B 1 70  ? 1.420   42.568  54.691  1.00 31.27 ? 199 ASP B N   1 
ATOM   1991 C CA  . ASP B 1 70  ? 1.695   42.482  56.127  1.00 33.94 ? 199 ASP B CA  1 
ATOM   1992 C C   . ASP B 1 70  ? 2.458   41.199  56.472  1.00 33.47 ? 199 ASP B C   1 
ATOM   1993 O O   . ASP B 1 70  ? 2.600   40.838  57.640  1.00 35.34 ? 199 ASP B O   1 
ATOM   1994 C CB  . ASP B 1 70  ? 0.400   42.588  56.937  1.00 35.14 ? 199 ASP B CB  1 
ATOM   1995 C CG  . ASP B 1 70  ? -0.681  41.641  56.444  1.00 36.62 ? 199 ASP B CG  1 
ATOM   1996 O OD1 . ASP B 1 70  ? -1.699  42.137  55.909  1.00 37.96 ? 199 ASP B OD1 1 
ATOM   1997 O OD2 . ASP B 1 70  ? -0.513  40.407  56.586  1.00 37.59 ? 199 ASP B OD2 1 
ATOM   1998 N N   . LYS B 1 71  ? 2.932   40.520  55.432  1.00 32.24 ? 200 LYS B N   1 
ATOM   1999 C CA  . LYS B 1 71  ? 3.754   39.316  55.540  1.00 29.03 ? 200 LYS B CA  1 
ATOM   2000 C C   . LYS B 1 71  ? 4.637   39.279  54.300  1.00 27.53 ? 200 LYS B C   1 
ATOM   2001 O O   . LYS B 1 71  ? 4.393   40.025  53.346  1.00 28.76 ? 200 LYS B O   1 
ATOM   2002 C CB  . LYS B 1 71  ? 2.871   38.059  55.591  1.00 28.83 ? 200 LYS B CB  1 
ATOM   2003 C CG  . LYS B 1 71  ? 2.027   37.835  54.337  1.00 29.11 ? 200 LYS B CG  1 
ATOM   2004 C CD  . LYS B 1 71  ? 1.326   36.484  54.337  1.00 29.42 ? 200 LYS B CD  1 
ATOM   2005 C CE  . LYS B 1 71  ? 0.114   36.466  55.259  1.00 29.34 ? 200 LYS B CE  1 
ATOM   2006 N NZ  . LYS B 1 71  ? -0.899  37.484  54.865  1.00 29.18 ? 200 LYS B NZ  1 
ATOM   2007 N N   . ASP B 1 72  ? 5.652   38.418  54.306  1.00 25.56 ? 201 ASP B N   1 
ATOM   2008 C CA  . ASP B 1 72  ? 6.477   38.179  53.126  1.00 24.56 ? 201 ASP B CA  1 
ATOM   2009 C C   . ASP B 1 72  ? 5.603   37.816  51.930  1.00 24.65 ? 201 ASP B C   1 
ATOM   2010 O O   . ASP B 1 72  ? 4.525   37.245  52.092  1.00 25.38 ? 201 ASP B O   1 
ATOM   2011 C CB  . ASP B 1 72  ? 7.488   37.051  53.383  1.00 23.93 ? 201 ASP B CB  1 
ATOM   2012 C CG  . ASP B 1 72  ? 8.708   37.512  54.180  1.00 23.62 ? 201 ASP B CG  1 
ATOM   2013 O OD1 . ASP B 1 72  ? 9.679   36.734  54.273  1.00 23.33 ? 201 ASP B OD1 1 
ATOM   2014 O OD2 . ASP B 1 72  ? 8.703   38.646  54.707  1.00 22.91 ? 201 ASP B OD2 1 
ATOM   2015 N N   . GLY B 1 73  ? 6.060   38.153  50.731  1.00 24.15 ? 202 GLY B N   1 
ATOM   2016 C CA  . GLY B 1 73  ? 5.301   37.826  49.535  1.00 23.58 ? 202 GLY B CA  1 
ATOM   2017 C C   . GLY B 1 73  ? 5.934   38.300  48.254  1.00 24.12 ? 202 GLY B C   1 
ATOM   2018 O O   . GLY B 1 73  ? 6.997   38.924  48.255  1.00 24.49 ? 202 GLY B O   1 
ATOM   2019 N N   . VAL B 1 74  ? 5.278   37.987  47.146  1.00 24.43 ? 203 VAL B N   1 
ATOM   2020 C CA  . VAL B 1 74  ? 5.726   38.452  45.847  1.00 24.53 ? 203 VAL B CA  1 
ATOM   2021 C C   . VAL B 1 74  ? 4.519   38.902  45.023  1.00 24.64 ? 203 VAL B C   1 
ATOM   2022 O O   . VAL B 1 74  ? 3.463   38.256  45.032  1.00 25.49 ? 203 VAL B O   1 
ATOM   2023 C CB  . VAL B 1 74  ? 6.721   37.463  45.153  1.00 24.91 ? 203 VAL B CB  1 
ATOM   2024 C CG1 . VAL B 1 74  ? 6.598   36.061  45.724  1.00 24.92 ? 203 VAL B CG1 1 
ATOM   2025 C CG2 . VAL B 1 74  ? 6.584   37.470  43.632  1.00 25.23 ? 203 VAL B CG2 1 
ATOM   2026 N N   . VAL B 1 75  ? 4.672   40.047  44.369  1.00 23.76 ? 204 VAL B N   1 
ATOM   2027 C CA  . VAL B 1 75  ? 3.610   40.648  43.580  1.00 22.83 ? 204 VAL B CA  1 
ATOM   2028 C C   . VAL B 1 75  ? 4.112   40.863  42.161  1.00 22.42 ? 204 VAL B C   1 
ATOM   2029 O O   . VAL B 1 75  ? 5.221   41.363  41.959  1.00 22.23 ? 204 VAL B O   1 
ATOM   2030 C CB  . VAL B 1 75  ? 3.164   42.014  44.174  1.00 22.53 ? 204 VAL B CB  1 
ATOM   2031 C CG1 . VAL B 1 75  ? 2.116   42.671  43.293  1.00 22.50 ? 204 VAL B CG1 1 
ATOM   2032 C CG2 . VAL B 1 75  ? 2.627   41.860  45.591  1.00 22.08 ? 204 VAL B CG2 1 
ATOM   2033 N N   . LEU B 1 76  ? 3.303   40.465  41.184  1.00 22.74 ? 205 LEU B N   1 
ATOM   2034 C CA  . LEU B 1 76  ? 3.547   40.847  39.803  1.00 22.98 ? 205 LEU B CA  1 
ATOM   2035 C C   . LEU B 1 76  ? 2.776   42.135  39.514  1.00 23.21 ? 205 LEU B C   1 
ATOM   2036 O O   . LEU B 1 76  ? 1.586   42.239  39.837  1.00 22.85 ? 205 LEU B O   1 
ATOM   2037 C CB  . LEU B 1 76  ? 3.153   39.723  38.831  1.00 23.08 ? 205 LEU B CB  1 
ATOM   2038 C CG  . LEU B 1 76  ? 3.417   39.988  37.342  1.00 23.55 ? 205 LEU B CG  1 
ATOM   2039 C CD1 . LEU B 1 76  ? 4.006   38.769  36.648  1.00 23.86 ? 205 LEU B CD1 1 
ATOM   2040 C CD2 . LEU B 1 76  ? 2.152   40.473  36.631  1.00 23.26 ? 205 LEU B CD2 1 
ATOM   2041 N N   . PHE B 1 77  ? 3.471   43.113  38.933  1.00 23.59 ? 206 PHE B N   1 
ATOM   2042 C CA  . PHE B 1 77  ? 2.866   44.361  38.479  1.00 24.25 ? 206 PHE B CA  1 
ATOM   2043 C C   . PHE B 1 77  ? 2.843   44.390  36.951  1.00 25.71 ? 206 PHE B C   1 
ATOM   2044 O O   . PHE B 1 77  ? 3.804   43.955  36.301  1.00 26.50 ? 206 PHE B O   1 
ATOM   2045 C CB  . PHE B 1 77  ? 3.642   45.573  39.001  1.00 23.51 ? 206 PHE B CB  1 
ATOM   2046 C CG  . PHE B 1 77  ? 3.693   45.668  40.502  1.00 23.98 ? 206 PHE B CG  1 
ATOM   2047 C CD1 . PHE B 1 77  ? 4.732   45.074  41.215  1.00 22.74 ? 206 PHE B CD1 1 
ATOM   2048 C CD2 . PHE B 1 77  ? 2.705   46.362  41.206  1.00 23.40 ? 206 PHE B CD2 1 
ATOM   2049 C CE1 . PHE B 1 77  ? 4.788   45.164  42.597  1.00 22.95 ? 206 PHE B CE1 1 
ATOM   2050 C CE2 . PHE B 1 77  ? 2.757   46.446  42.591  1.00 24.21 ? 206 PHE B CE2 1 
ATOM   2051 C CZ  . PHE B 1 77  ? 3.805   45.851  43.288  1.00 22.86 ? 206 PHE B CZ  1 
ATOM   2052 N N   . LYS B 1 78  ? 1.752   44.907  36.390  1.00 25.97 ? 207 LYS B N   1 
ATOM   2053 C CA  . LYS B 1 78  ? 1.564   44.983  34.939  1.00 27.01 ? 207 LYS B CA  1 
ATOM   2054 C C   . LYS B 1 78  ? 0.851   46.276  34.551  1.00 28.15 ? 207 LYS B C   1 
ATOM   2055 O O   . LYS B 1 78  ? 0.006   46.774  35.297  1.00 27.63 ? 207 LYS B O   1 
ATOM   2056 C CB  . LYS B 1 78  ? 0.769   43.772  34.443  1.00 27.70 ? 207 LYS B CB  1 
ATOM   2057 C CG  . LYS B 1 78  ? -0.380  43.389  35.365  1.00 28.62 ? 207 LYS B CG  1 
ATOM   2058 C CD  . LYS B 1 78  ? -1.426  42.529  34.689  1.00 29.07 ? 207 LYS B CD  1 
ATOM   2059 C CE  . LYS B 1 78  ? -1.100  41.058  34.808  1.00 28.07 ? 207 LYS B CE  1 
ATOM   2060 N NZ  . LYS B 1 78  ? -2.348  40.253  34.854  1.00 27.42 ? 207 LYS B NZ  1 
ATOM   2061 N N   . LYS B 1 79  ? 1.180   46.811  33.378  1.00 29.92 ? 208 LYS B N   1 
ATOM   2062 C CA  . LYS B 1 79  ? 0.597   48.078  32.927  1.00 31.22 ? 208 LYS B CA  1 
ATOM   2063 C C   . LYS B 1 79  ? -0.681  47.901  32.105  1.00 32.52 ? 208 LYS B C   1 
ATOM   2064 O O   . LYS B 1 79  ? -0.979  48.704  31.217  1.00 34.12 ? 208 LYS B O   1 
ATOM   2065 C CB  . LYS B 1 79  ? 1.635   48.899  32.157  1.00 32.19 ? 208 LYS B CB  1 
ATOM   2066 C CG  . LYS B 1 79  ? 2.652   49.566  33.065  1.00 33.74 ? 208 LYS B CG  1 
ATOM   2067 C CD  . LYS B 1 79  ? 3.493   50.582  32.316  1.00 34.82 ? 208 LYS B CD  1 
ATOM   2068 C CE  . LYS B 1 79  ? 4.428   51.309  33.269  1.00 35.90 ? 208 LYS B CE  1 
ATOM   2069 N NZ  . LYS B 1 79  ? 5.497   52.014  32.515  1.00 36.90 ? 208 LYS B NZ  1 
ATOM   2070 N N   . PHE B 1 80  ? -1.441  46.853  32.415  1.00 32.58 ? 209 PHE B N   1 
ATOM   2071 C CA  . PHE B 1 80  ? -2.650  46.502  31.663  1.00 32.09 ? 209 PHE B CA  1 
ATOM   2072 C C   . PHE B 1 80  ? -3.555  45.657  32.539  1.00 32.46 ? 209 PHE B C   1 
ATOM   2073 O O   . PHE B 1 80  ? -3.114  45.134  33.558  1.00 33.33 ? 209 PHE B O   1 
ATOM   2074 C CB  . PHE B 1 80  ? -2.312  45.755  30.349  1.00 31.29 ? 209 PHE B CB  1 
ATOM   2075 C CG  . PHE B 1 80  ? -1.228  44.704  30.487  1.00 30.69 ? 209 PHE B CG  1 
ATOM   2076 C CD1 . PHE B 1 80  ? 0.088   44.987  30.117  1.00 30.78 ? 209 PHE B CD1 1 
ATOM   2077 C CD2 . PHE B 1 80  ? -1.520  43.430  30.979  1.00 30.09 ? 209 PHE B CD2 1 
ATOM   2078 C CE1 . PHE B 1 80  ? 1.091   44.029  30.244  1.00 29.35 ? 209 PHE B CE1 1 
ATOM   2079 C CE2 . PHE B 1 80  ? -0.520  42.472  31.110  1.00 29.50 ? 209 PHE B CE2 1 
ATOM   2080 C CZ  . PHE B 1 80  ? 0.783   42.771  30.736  1.00 29.24 ? 209 PHE B CZ  1 
ATOM   2081 N N   . ASP B 1 81  ? -4.821  45.542  32.143  1.00 32.90 ? 210 ASP B N   1 
ATOM   2082 C CA  . ASP B 1 81  ? -5.787  44.689  32.824  1.00 33.32 ? 210 ASP B CA  1 
ATOM   2083 C C   . ASP B 1 81  ? -5.849  44.973  34.330  1.00 33.32 ? 210 ASP B C   1 
ATOM   2084 O O   . ASP B 1 81  ? -5.864  46.135  34.734  1.00 34.19 ? 210 ASP B O   1 
ATOM   2085 C CB  . ASP B 1 81  ? -5.486  43.214  32.534  1.00 35.03 ? 210 ASP B CB  1 
ATOM   2086 C CG  . ASP B 1 81  ? -5.661  42.866  31.076  1.00 36.06 ? 210 ASP B CG  1 
ATOM   2087 O OD1 . ASP B 1 81  ? -4.711  42.325  30.468  1.00 37.15 ? 210 ASP B OD1 1 
ATOM   2088 O OD2 . ASP B 1 81  ? -6.749  43.144  30.533  1.00 37.65 ? 210 ASP B OD2 1 
ATOM   2089 N N   . GLU B 1 82  ? -5.848  43.924  35.152  1.00 32.32 ? 211 GLU B N   1 
ATOM   2090 C CA  . GLU B 1 82  ? -6.082  44.073  36.596  1.00 31.83 ? 211 GLU B CA  1 
ATOM   2091 C C   . GLU B 1 82  ? -4.940  44.743  37.370  1.00 30.23 ? 211 GLU B C   1 
ATOM   2092 O O   . GLU B 1 82  ? -5.044  44.941  38.576  1.00 30.87 ? 211 GLU B O   1 
ATOM   2093 C CB  . GLU B 1 82  ? -6.504  42.734  37.241  1.00 32.19 ? 211 GLU B CB  1 
ATOM   2094 C CG  . GLU B 1 82  ? -5.424  41.656  37.341  1.00 32.36 ? 211 GLU B CG  1 
ATOM   2095 C CD  . GLU B 1 82  ? -5.281  40.810  36.084  1.00 32.74 ? 211 GLU B CD  1 
ATOM   2096 O OE1 . GLU B 1 82  ? -5.692  41.260  34.997  1.00 33.27 ? 211 GLU B OE1 1 
ATOM   2097 O OE2 . GLU B 1 82  ? -4.732  39.691  36.177  1.00 32.82 ? 211 GLU B OE2 1 
ATOM   2098 N N   . GLY B 1 83  ? -3.854  45.079  36.677  1.00 29.33 ? 212 GLY B N   1 
ATOM   2099 C CA  . GLY B 1 83  ? -2.798  45.912  37.252  1.00 27.60 ? 212 GLY B CA  1 
ATOM   2100 C C   . GLY B 1 83  ? -1.795  45.203  38.142  1.00 27.31 ? 212 GLY B C   1 
ATOM   2101 O O   . GLY B 1 83  ? -0.646  45.635  38.235  1.00 27.39 ? 212 GLY B O   1 
ATOM   2102 N N   . ARG B 1 84  ? -2.223  44.131  38.812  1.00 26.24 ? 213 ARG B N   1 
ATOM   2103 C CA  . ARG B 1 84  ? -1.318  43.329  39.639  1.00 26.03 ? 213 ARG B CA  1 
ATOM   2104 C C   . ARG B 1 84  ? -1.893  41.982  40.070  1.00 25.73 ? 213 ARG B C   1 
ATOM   2105 O O   . ARG B 1 84  ? -3.112  41.811  40.155  1.00 25.53 ? 213 ARG B O   1 
ATOM   2106 C CB  . ARG B 1 84  ? -0.852  44.108  40.880  1.00 26.29 ? 213 ARG B CB  1 
ATOM   2107 C CG  . ARG B 1 84  ? -1.881  44.171  41.986  1.00 26.57 ? 213 ARG B CG  1 
ATOM   2108 C CD  . ARG B 1 84  ? -1.271  43.782  43.323  1.00 26.77 ? 213 ARG B CD  1 
ATOM   2109 N NE  . ARG B 1 84  ? -0.922  44.952  44.117  1.00 25.33 ? 213 ARG B NE  1 
ATOM   2110 C CZ  . ARG B 1 84  ? -0.657  44.933  45.421  1.00 24.03 ? 213 ARG B CZ  1 
ATOM   2111 N NH1 . ARG B 1 84  ? -0.688  43.798  46.114  1.00 23.57 ? 213 ARG B NH1 1 
ATOM   2112 N NH2 . ARG B 1 84  ? -0.352  46.062  46.027  1.00 23.11 ? 213 ARG B NH2 1 
ATOM   2113 N N   . ASN B 1 85  ? -0.994  41.038  40.355  1.00 25.49 ? 214 ASN B N   1 
ATOM   2114 C CA  . ASN B 1 85  ? -1.363  39.728  40.889  1.00 24.92 ? 214 ASN B CA  1 
ATOM   2115 C C   . ASN B 1 85  ? -0.471  39.365  42.067  1.00 25.77 ? 214 ASN B C   1 
ATOM   2116 O O   . ASN B 1 85  ? 0.754   39.534  42.007  1.00 25.81 ? 214 ASN B O   1 
ATOM   2117 C CB  . ASN B 1 85  ? -1.229  38.655  39.808  1.00 25.13 ? 214 ASN B CB  1 
ATOM   2118 C CG  . ASN B 1 85  ? -1.932  39.032  38.526  1.00 24.58 ? 214 ASN B CG  1 
ATOM   2119 O OD1 . ASN B 1 85  ? -3.154  38.964  38.436  1.00 25.21 ? 214 ASN B OD1 1 
ATOM   2120 N ND2 . ASN B 1 85  ? -1.161  39.441  37.525  1.00 24.14 ? 214 ASN B ND2 1 
ATOM   2121 N N   . ASN B 1 86  ? -1.086  38.870  43.136  1.00 26.24 ? 215 ASN B N   1 
ATOM   2122 C CA  . ASN B 1 86  ? -0.353  38.453  44.323  1.00 26.39 ? 215 ASN B CA  1 
ATOM   2123 C C   . ASN B 1 86  ? -0.073  36.958  44.252  1.00 26.18 ? 215 ASN B C   1 
ATOM   2124 O O   . ASN B 1 86  ? -0.978  36.172  43.987  1.00 26.48 ? 215 ASN B O   1 
ATOM   2125 C CB  . ASN B 1 86  ? -1.152  38.760  45.599  1.00 26.89 ? 215 ASN B CB  1 
ATOM   2126 C CG  . ASN B 1 86  ? -1.426  40.246  45.795  1.00 27.30 ? 215 ASN B CG  1 
ATOM   2127 O OD1 . ASN B 1 86  ? -0.640  41.113  45.399  1.00 27.49 ? 215 ASN B OD1 1 
ATOM   2128 N ND2 . ASN B 1 86  ? -2.549  40.544  46.433  1.00 27.40 ? 215 ASN B ND2 1 
ATOM   2129 N N   . PHE B 1 87  ? 1.177   36.572  44.482  1.00 26.52 ? 216 PHE B N   1 
ATOM   2130 C CA  . PHE B 1 87  ? 1.551   35.162  44.523  1.00 27.09 ? 216 PHE B CA  1 
ATOM   2131 C C   . PHE B 1 87  ? 0.925   34.430  45.721  1.00 28.06 ? 216 PHE B C   1 
ATOM   2132 O O   . PHE B 1 87  ? 0.891   34.956  46.834  1.00 26.71 ? 216 PHE B O   1 
ATOM   2133 C CB  . PHE B 1 87  ? 3.080   34.999  44.529  1.00 26.15 ? 216 PHE B CB  1 
ATOM   2134 C CG  . PHE B 1 87  ? 3.534   33.577  44.718  1.00 25.63 ? 216 PHE B CG  1 
ATOM   2135 C CD1 . PHE B 1 87  ? 3.535   32.688  43.651  1.00 25.73 ? 216 PHE B CD1 1 
ATOM   2136 C CD2 . PHE B 1 87  ? 3.929   33.118  45.971  1.00 25.46 ? 216 PHE B CD2 1 
ATOM   2137 C CE1 . PHE B 1 87  ? 3.936   31.371  43.825  1.00 26.13 ? 216 PHE B CE1 1 
ATOM   2138 C CE2 . PHE B 1 87  ? 4.333   31.808  46.149  1.00 25.78 ? 216 PHE B CE2 1 
ATOM   2139 C CZ  . PHE B 1 87  ? 4.337   30.932  45.075  1.00 25.56 ? 216 PHE B CZ  1 
ATOM   2140 N N   . GLU B 1 88  ? 0.441   33.213  45.476  1.00 30.71 ? 217 GLU B N   1 
ATOM   2141 C CA  . GLU B 1 88  ? -0.170  32.381  46.517  1.00 33.23 ? 217 GLU B CA  1 
ATOM   2142 C C   . GLU B 1 88  ? 0.558   31.050  46.651  1.00 33.33 ? 217 GLU B C   1 
ATOM   2143 O O   . GLU B 1 88  ? 0.997   30.476  45.656  1.00 33.55 ? 217 GLU B O   1 
ATOM   2144 C CB  . GLU B 1 88  ? -1.646  32.124  46.204  1.00 34.71 ? 217 GLU B CB  1 
ATOM   2145 C CG  . GLU B 1 88  ? -2.491  33.388  46.152  1.00 38.79 ? 217 GLU B CG  1 
ATOM   2146 C CD  . GLU B 1 88  ? -3.921  33.127  45.720  1.00 41.68 ? 217 GLU B CD  1 
ATOM   2147 O OE1 . GLU B 1 88  ? -4.619  32.338  46.400  1.00 43.32 ? 217 GLU B OE1 1 
ATOM   2148 O OE2 . GLU B 1 88  ? -4.349  33.720  44.703  1.00 42.08 ? 217 GLU B OE2 1 
ATOM   2149 N N   . GLY B 1 89  ? 0.684   30.568  47.884  1.00 33.35 ? 218 GLY B N   1 
ATOM   2150 C CA  . GLY B 1 89  ? 1.270   29.252  48.137  1.00 33.95 ? 218 GLY B CA  1 
ATOM   2151 C C   . GLY B 1 89  ? 2.740   29.299  48.507  1.00 34.06 ? 218 GLY B C   1 
ATOM   2152 O O   . GLY B 1 89  ? 3.275   30.359  48.823  1.00 35.08 ? 218 GLY B O   1 
ATOM   2153 N N   . GLU B 1 90  ? 3.391   28.142  48.453  1.00 33.85 ? 219 GLU B N   1 
ATOM   2154 C CA  . GLU B 1 90  ? 4.778   28.004  48.890  1.00 34.32 ? 219 GLU B CA  1 
ATOM   2155 C C   . GLU B 1 90  ? 5.772   28.654  47.924  1.00 32.92 ? 219 GLU B C   1 
ATOM   2156 O O   . GLU B 1 90  ? 5.703   28.447  46.709  1.00 31.80 ? 219 GLU B O   1 
ATOM   2157 C CB  . GLU B 1 90  ? 5.115   26.527  49.087  1.00 35.93 ? 219 GLU B CB  1 
ATOM   2158 C CG  . GLU B 1 90  ? 6.400   26.281  49.856  1.00 37.93 ? 219 GLU B CG  1 
ATOM   2159 C CD  . GLU B 1 90  ? 6.797   24.821  49.865  1.00 39.56 ? 219 GLU B CD  1 
ATOM   2160 O OE1 . GLU B 1 90  ? 7.835   24.502  50.476  1.00 39.52 ? 219 GLU B OE1 1 
ATOM   2161 O OE2 . GLU B 1 90  ? 6.073   23.993  49.267  1.00 40.69 ? 219 GLU B OE2 1 
ATOM   2162 N N   . VAL B 1 91  ? 6.703   29.422  48.488  1.00 32.17 ? 220 VAL B N   1 
ATOM   2163 C CA  . VAL B 1 91  ? 7.695   30.170  47.714  1.00 31.49 ? 220 VAL B CA  1 
ATOM   2164 C C   . VAL B 1 91  ? 8.852   29.271  47.263  1.00 32.47 ? 220 VAL B C   1 
ATOM   2165 O O   . VAL B 1 91  ? 9.843   29.096  47.980  1.00 34.24 ? 220 VAL B O   1 
ATOM   2166 C CB  . VAL B 1 91  ? 8.242   31.398  48.494  1.00 30.78 ? 220 VAL B CB  1 
ATOM   2167 C CG1 . VAL B 1 91  ? 9.151   32.241  47.608  1.00 30.70 ? 220 VAL B CG1 1 
ATOM   2168 C CG2 . VAL B 1 91  ? 7.111   32.259  49.043  1.00 29.56 ? 220 VAL B CG2 1 
ATOM   2169 N N   . THR B 1 92  ? 8.715   28.698  46.071  1.00 32.21 ? 221 THR B N   1 
ATOM   2170 C CA  . THR B 1 92  ? 9.811   27.976  45.425  1.00 32.41 ? 221 THR B CA  1 
ATOM   2171 C C   . THR B 1 92  ? 10.009  28.537  44.026  1.00 32.43 ? 221 THR B C   1 
ATOM   2172 O O   . THR B 1 92  ? 9.080   29.122  43.450  1.00 32.27 ? 221 THR B O   1 
ATOM   2173 C CB  . THR B 1 92  ? 9.528   26.467  45.309  1.00 32.41 ? 221 THR B CB  1 
ATOM   2174 O OG1 . THR B 1 92  ? 8.382   26.269  44.479  1.00 33.28 ? 221 THR B OG1 1 
ATOM   2175 C CG2 . THR B 1 92  ? 9.271   25.840  46.675  1.00 31.92 ? 221 THR B CG2 1 
ATOM   2176 N N   . LYS B 1 93  ? 11.207  28.346  43.477  1.00 32.68 ? 222 LYS B N   1 
ATOM   2177 C CA  . LYS B 1 93  ? 11.539  28.848  42.144  1.00 34.25 ? 222 LYS B CA  1 
ATOM   2178 C C   . LYS B 1 93  ? 10.522  28.400  41.089  1.00 35.13 ? 222 LYS B C   1 
ATOM   2179 O O   . LYS B 1 93  ? 10.088  29.210  40.262  1.00 35.55 ? 222 LYS B O   1 
ATOM   2180 C CB  . LYS B 1 93  ? 12.960  28.433  41.732  1.00 34.89 ? 222 LYS B CB  1 
ATOM   2181 C CG  . LYS B 1 93  ? 13.427  29.059  40.422  1.00 35.55 ? 222 LYS B CG  1 
ATOM   2182 C CD  . LYS B 1 93  ? 14.330  28.131  39.623  1.00 36.61 ? 222 LYS B CD  1 
ATOM   2183 C CE  . LYS B 1 93  ? 15.778  28.253  40.061  1.00 37.69 ? 222 LYS B CE  1 
ATOM   2184 N NZ  . LYS B 1 93  ? 16.642  27.185  39.492  1.00 38.89 ? 222 LYS B NZ  1 
ATOM   2185 N N   . GLU B 1 94  ? 10.138  27.123  41.136  1.00 34.28 ? 223 GLU B N   1 
ATOM   2186 C CA  . GLU B 1 94  ? 9.222   26.548  40.147  1.00 33.58 ? 223 GLU B CA  1 
ATOM   2187 C C   . GLU B 1 94  ? 7.798   27.095  40.270  1.00 32.74 ? 223 GLU B C   1 
ATOM   2188 O O   . GLU B 1 94  ? 7.141   27.330  39.256  1.00 31.24 ? 223 GLU B O   1 
ATOM   2189 C CB  . GLU B 1 94  ? 9.232   25.024  40.213  1.00 32.97 ? 223 GLU B CB  1 
ATOM   2190 N N   . ASN B 1 95  ? 7.331   27.281  41.507  1.00 32.70 ? 224 ASN B N   1 
ATOM   2191 C CA  . ASN B 1 95  ? 6.035   27.907  41.769  1.00 32.65 ? 224 ASN B CA  1 
ATOM   2192 C C   . ASN B 1 95  ? 6.006   29.362  41.301  1.00 32.63 ? 224 ASN B C   1 
ATOM   2193 O O   . ASN B 1 95  ? 4.997   29.835  40.780  1.00 33.23 ? 224 ASN B O   1 
ATOM   2194 C CB  . ASN B 1 95  ? 5.677   27.831  43.261  1.00 32.84 ? 224 ASN B CB  1 
ATOM   2195 C CG  . ASN B 1 95  ? 5.352   26.416  43.724  1.00 32.62 ? 224 ASN B CG  1 
ATOM   2196 O OD1 . ASN B 1 95  ? 5.123   25.518  42.914  1.00 33.47 ? 224 ASN B OD1 1 
ATOM   2197 N ND2 . ASN B 1 95  ? 5.328   26.215  45.039  1.00 31.08 ? 224 ASN B ND2 1 
ATOM   2198 N N   . LEU B 1 96  ? 7.126   30.059  41.485  1.00 33.29 ? 225 LEU B N   1 
ATOM   2199 C CA  . LEU B 1 96  ? 7.255   31.457  41.087  1.00 32.32 ? 225 LEU B CA  1 
ATOM   2200 C C   . LEU B 1 96  ? 7.285   31.639  39.574  1.00 33.01 ? 225 LEU B C   1 
ATOM   2201 O O   . LEU B 1 96  ? 6.637   32.541  39.055  1.00 33.25 ? 225 LEU B O   1 
ATOM   2202 C CB  . LEU B 1 96  ? 8.483   32.112  41.736  1.00 30.82 ? 225 LEU B CB  1 
ATOM   2203 C CG  . LEU B 1 96  ? 8.398   32.394  43.244  1.00 30.49 ? 225 LEU B CG  1 
ATOM   2204 C CD1 . LEU B 1 96  ? 9.666   33.068  43.745  1.00 29.87 ? 225 LEU B CD1 1 
ATOM   2205 C CD2 . LEU B 1 96  ? 7.180   33.232  43.600  1.00 29.88 ? 225 LEU B CD2 1 
ATOM   2206 N N   . LEU B 1 97  ? 8.022   30.779  38.873  1.00 33.49 ? 226 LEU B N   1 
ATOM   2207 C CA  . LEU B 1 97  ? 8.085   30.835  37.417  1.00 34.08 ? 226 LEU B CA  1 
ATOM   2208 C C   . LEU B 1 97  ? 6.745   30.464  36.801  1.00 35.61 ? 226 LEU B C   1 
ATOM   2209 O O   . LEU B 1 97  ? 6.361   31.031  35.777  1.00 35.83 ? 226 LEU B O   1 
ATOM   2210 C CB  . LEU B 1 97  ? 9.200   29.943  36.871  1.00 34.77 ? 226 LEU B CB  1 
ATOM   2211 C CG  . LEU B 1 97  ? 10.632  30.220  37.350  1.00 34.77 ? 226 LEU B CG  1 
ATOM   2212 C CD1 . LEU B 1 97  ? 11.594  29.232  36.708  1.00 33.97 ? 226 LEU B CD1 1 
ATOM   2213 C CD2 . LEU B 1 97  ? 11.067  31.657  37.090  1.00 33.36 ? 226 LEU B CD2 1 
ATOM   2214 N N   . ASP B 1 98  ? 6.038   29.524  37.435  1.00 35.42 ? 227 ASP B N   1 
ATOM   2215 C CA  . ASP B 1 98  ? 4.674   29.165  37.032  1.00 36.41 ? 227 ASP B CA  1 
ATOM   2216 C C   . ASP B 1 98  ? 3.710   30.343  37.205  1.00 36.42 ? 227 ASP B C   1 
ATOM   2217 O O   . ASP B 1 98  ? 2.886   30.625  36.322  1.00 35.78 ? 227 ASP B O   1 
ATOM   2218 C CB  . ASP B 1 98  ? 4.167   27.955  37.828  1.00 38.22 ? 227 ASP B CB  1 
ATOM   2219 C CG  . ASP B 1 98  ? 4.716   26.630  37.309  1.00 39.30 ? 227 ASP B CG  1 
ATOM   2220 O OD1 . ASP B 1 98  ? 5.535   26.628  36.365  1.00 41.94 ? 227 ASP B OD1 1 
ATOM   2221 O OD2 . ASP B 1 98  ? 4.331   25.578  37.854  1.00 40.92 ? 227 ASP B OD2 1 
ATOM   2222 N N   . PHE B 1 99  ? 3.835   31.025  38.346  1.00 34.35 ? 228 PHE B N   1 
ATOM   2223 C CA  . PHE B 1 99  ? 3.019   32.186  38.678  1.00 32.14 ? 228 PHE B CA  1 
ATOM   2224 C C   . PHE B 1 99  ? 3.276   33.340  37.721  1.00 32.15 ? 228 PHE B C   1 
ATOM   2225 O O   . PHE B 1 99  ? 2.337   33.986  37.256  1.00 32.21 ? 228 PHE B O   1 
ATOM   2226 C CB  . PHE B 1 99  ? 3.280   32.610  40.130  1.00 30.69 ? 228 PHE B CB  1 
ATOM   2227 C CG  . PHE B 1 99  ? 2.882   34.035  40.446  1.00 29.38 ? 228 PHE B CG  1 
ATOM   2228 C CD1 . PHE B 1 99  ? 3.856   35.013  40.643  1.00 28.54 ? 228 PHE B CD1 1 
ATOM   2229 C CD2 . PHE B 1 99  ? 1.539   34.394  40.572  1.00 28.71 ? 228 PHE B CD2 1 
ATOM   2230 C CE1 . PHE B 1 99  ? 3.500   36.322  40.941  1.00 28.52 ? 228 PHE B CE1 1 
ATOM   2231 C CE2 . PHE B 1 99  ? 1.182   35.701  40.868  1.00 27.95 ? 228 PHE B CE2 1 
ATOM   2232 C CZ  . PHE B 1 99  ? 2.161   36.663  41.059  1.00 27.80 ? 228 PHE B CZ  1 
ATOM   2233 N N   . ILE B 1 100 ? 4.552   33.596  37.441  1.00 33.22 ? 229 ILE B N   1 
ATOM   2234 C CA  . ILE B 1 100 ? 4.947   34.674  36.540  1.00 34.50 ? 229 ILE B CA  1 
ATOM   2235 C C   . ILE B 1 100 ? 4.447   34.408  35.112  1.00 36.75 ? 229 ILE B C   1 
ATOM   2236 O O   . ILE B 1 100 ? 3.944   35.318  34.453  1.00 36.57 ? 229 ILE B O   1 
ATOM   2237 C CB  . ILE B 1 100 ? 6.473   34.934  36.587  1.00 33.25 ? 229 ILE B CB  1 
ATOM   2238 C CG1 . ILE B 1 100 ? 6.858   35.584  37.919  1.00 32.52 ? 229 ILE B CG1 1 
ATOM   2239 C CG2 . ILE B 1 100 ? 6.913   35.843  35.447  1.00 33.34 ? 229 ILE B CG2 1 
ATOM   2240 C CD1 . ILE B 1 100 ? 8.350   35.670  38.159  1.00 31.58 ? 229 ILE B CD1 1 
ATOM   2241 N N   . LYS B 1 101 ? 4.551   33.162  34.655  1.00 39.07 ? 230 LYS B N   1 
ATOM   2242 C CA  . LYS B 1 101 ? 4.055   32.789  33.325  1.00 42.91 ? 230 LYS B CA  1 
ATOM   2243 C C   . LYS B 1 101 ? 2.528   32.828  33.201  1.00 43.31 ? 230 LYS B C   1 
ATOM   2244 O O   . LYS B 1 101 ? 2.006   33.240  32.170  1.00 45.97 ? 230 LYS B O   1 
ATOM   2245 C CB  . LYS B 1 101 ? 4.600   31.426  32.886  1.00 44.47 ? 230 LYS B CB  1 
ATOM   2246 C CG  . LYS B 1 101 ? 6.052   31.464  32.422  1.00 45.59 ? 230 LYS B CG  1 
ATOM   2247 C CD  . LYS B 1 101 ? 6.500   30.132  31.831  1.00 48.53 ? 230 LYS B CD  1 
ATOM   2248 C CE  . LYS B 1 101 ? 6.647   29.042  32.889  1.00 48.44 ? 230 LYS B CE  1 
ATOM   2249 N NZ  . LYS B 1 101 ? 6.890   27.711  32.265  1.00 49.29 ? 230 LYS B NZ  1 
ATOM   2250 N N   . HIS B 1 102 ? 1.820   32.411  34.249  1.00 45.58 ? 231 HIS B N   1 
ATOM   2251 C CA  . HIS B 1 102 ? 0.351   32.380  34.232  1.00 46.21 ? 231 HIS B CA  1 
ATOM   2252 C C   . HIS B 1 102 ? -0.293  33.780  34.321  1.00 44.95 ? 231 HIS B C   1 
ATOM   2253 O O   . HIS B 1 102 ? -1.486  33.934  34.041  1.00 44.36 ? 231 HIS B O   1 
ATOM   2254 C CB  . HIS B 1 102 ? -0.182  31.447  35.334  1.00 49.24 ? 231 HIS B CB  1 
ATOM   2255 C CG  . HIS B 1 102 ? -1.678  31.417  35.442  1.00 54.57 ? 231 HIS B CG  1 
ATOM   2256 N ND1 . HIS B 1 102 ? -2.483  30.784  34.517  1.00 56.06 ? 231 HIS B ND1 1 
ATOM   2257 C CD2 . HIS B 1 102 ? -2.516  31.947  36.365  1.00 56.36 ? 231 HIS B CD2 1 
ATOM   2258 C CE1 . HIS B 1 102 ? -3.749  30.926  34.865  1.00 57.35 ? 231 HIS B CE1 1 
ATOM   2259 N NE2 . HIS B 1 102 ? -3.798  31.627  35.984  1.00 57.74 ? 231 HIS B NE2 1 
ATOM   2260 N N   . ASN B 1 103 ? 0.504   34.791  34.679  1.00 42.41 ? 232 ASN B N   1 
ATOM   2261 C CA  . ASN B 1 103 ? -0.001  36.151  34.943  1.00 38.79 ? 232 ASN B CA  1 
ATOM   2262 C C   . ASN B 1 103 ? 0.704   37.259  34.170  1.00 37.07 ? 232 ASN B C   1 
ATOM   2263 O O   . ASN B 1 103 ? 0.303   38.416  34.230  1.00 36.72 ? 232 ASN B O   1 
ATOM   2264 C CB  . ASN B 1 103 ? 0.071   36.453  36.439  1.00 37.65 ? 232 ASN B CB  1 
ATOM   2265 C CG  . ASN B 1 103 ? -0.873  35.594  37.242  1.00 36.78 ? 232 ASN B CG  1 
ATOM   2266 O OD1 . ASN B 1 103 ? -2.076  35.837  37.270  1.00 36.08 ? 232 ASN B OD1 1 
ATOM   2267 N ND2 . ASN B 1 103 ? -0.335  34.574  37.891  1.00 36.29 ? 232 ASN B ND2 1 
ATOM   2268 N N   . GLN B 1 104 ? 1.759   36.890  33.455  1.00 36.27 ? 233 GLN B N   1 
ATOM   2269 C CA  . GLN B 1 104 ? 2.570   37.818  32.664  1.00 37.68 ? 233 GLN B CA  1 
ATOM   2270 C C   . GLN B 1 104 ? 1.819   38.401  31.461  1.00 37.45 ? 233 GLN B C   1 
ATOM   2271 O O   . GLN B 1 104 ? 2.103   39.520  31.017  1.00 36.80 ? 233 GLN B O   1 
ATOM   2272 C CB  . GLN B 1 104 ? 3.788   37.052  32.157  1.00 38.02 ? 233 GLN B CB  1 
ATOM   2273 C CG  . GLN B 1 104 ? 4.905   37.883  31.572  1.00 39.39 ? 233 GLN B CG  1 
ATOM   2274 C CD  . GLN B 1 104 ? 6.056   37.026  31.088  1.00 38.72 ? 233 GLN B CD  1 
ATOM   2275 O OE1 . GLN B 1 104 ? 7.060   37.544  30.600  1.00 40.19 ? 233 GLN B OE1 1 
ATOM   2276 N NE2 . GLN B 1 104 ? 5.920   35.707  31.224  1.00 37.22 ? 233 GLN B NE2 1 
ATOM   2277 N N   . LEU B 1 105 ? 0.868   37.630  30.938  1.00 36.45 ? 234 LEU B N   1 
ATOM   2278 C CA  . LEU B 1 105 ? 0.235   37.929  29.660  1.00 35.99 ? 234 LEU B CA  1 
ATOM   2279 C C   . LEU B 1 105 ? -0.964  38.858  29.805  1.00 34.74 ? 234 LEU B C   1 
ATOM   2280 O O   . LEU B 1 105 ? -1.663  38.803  30.814  1.00 33.58 ? 234 LEU B O   1 
ATOM   2281 C CB  . LEU B 1 105 ? -0.191  36.624  28.969  1.00 37.00 ? 234 LEU B CB  1 
ATOM   2282 C CG  . LEU B 1 105 ? 0.874   35.525  28.816  1.00 38.02 ? 234 LEU B CG  1 
ATOM   2283 C CD1 . LEU B 1 105 ? 0.297   34.294  28.129  1.00 37.97 ? 234 LEU B CD1 1 
ATOM   2284 C CD2 . LEU B 1 105 ? 2.100   36.039  28.070  1.00 37.67 ? 234 LEU B CD2 1 
ATOM   2285 N N   . PRO B 1 106 ? -1.204  39.713  28.791  1.00 33.96 ? 235 PRO B N   1 
ATOM   2286 C CA  . PRO B 1 106 ? -2.436  40.495  28.753  1.00 34.36 ? 235 PRO B CA  1 
ATOM   2287 C C   . PRO B 1 106 ? -3.628  39.567  28.561  1.00 34.35 ? 235 PRO B C   1 
ATOM   2288 O O   . PRO B 1 106 ? -3.473  38.480  28.000  1.00 32.81 ? 235 PRO B O   1 
ATOM   2289 C CB  . PRO B 1 106 ? -2.255  41.385  27.516  1.00 34.59 ? 235 PRO B CB  1 
ATOM   2290 C CG  . PRO B 1 106 ? -0.785  41.419  27.274  1.00 34.77 ? 235 PRO B CG  1 
ATOM   2291 C CD  . PRO B 1 106 ? -0.314  40.050  27.667  1.00 34.70 ? 235 PRO B CD  1 
ATOM   2292 N N   . LEU B 1 107 ? -4.794  39.990  29.042  1.00 35.15 ? 236 LEU B N   1 
ATOM   2293 C CA  . LEU B 1 107 ? -6.032  39.206  28.949  1.00 36.41 ? 236 LEU B CA  1 
ATOM   2294 C C   . LEU B 1 107 ? -6.307  38.763  27.503  1.00 36.51 ? 236 LEU B C   1 
ATOM   2295 O O   . LEU B 1 107 ? -6.574  37.592  27.232  1.00 36.72 ? 236 LEU B O   1 
ATOM   2296 C CB  . LEU B 1 107 ? -7.205  40.047  29.467  1.00 36.41 ? 236 LEU B CB  1 
ATOM   2297 C CG  . LEU B 1 107 ? -8.437  39.441  30.140  1.00 36.36 ? 236 LEU B CG  1 
ATOM   2298 C CD1 . LEU B 1 107 ? -9.645  40.291  29.779  1.00 36.53 ? 236 LEU B CD1 1 
ATOM   2299 C CD2 . LEU B 1 107 ? -8.672  37.987  29.757  1.00 36.91 ? 236 LEU B CD2 1 
ATOM   2300 N N   . VAL B 1 108 ? -6.246  39.720  26.585  1.00 36.32 ? 237 VAL B N   1 
ATOM   2301 C CA  . VAL B 1 108 ? -6.328  39.438  25.161  1.00 35.97 ? 237 VAL B CA  1 
ATOM   2302 C C   . VAL B 1 108 ? -4.936  39.682  24.591  1.00 36.86 ? 237 VAL B C   1 
ATOM   2303 O O   . VAL B 1 108 ? -4.389  40.785  24.700  1.00 36.76 ? 237 VAL B O   1 
ATOM   2304 C CB  . VAL B 1 108 ? -7.402  40.309  24.481  1.00 35.22 ? 237 VAL B CB  1 
ATOM   2305 C CG1 . VAL B 1 108 ? -7.258  40.279  22.977  1.00 35.21 ? 237 VAL B CG1 1 
ATOM   2306 C CG2 . VAL B 1 108 ? -8.788  39.820  24.873  1.00 35.47 ? 237 VAL B CG2 1 
ATOM   2307 N N   . ILE B 1 109 ? -4.359  38.636  24.006  1.00 37.33 ? 238 ILE B N   1 
ATOM   2308 C CA  . ILE B 1 109 ? -2.962  38.674  23.589  1.00 37.75 ? 238 ILE B CA  1 
ATOM   2309 C C   . ILE B 1 109 ? -2.801  38.633  22.064  1.00 36.89 ? 238 ILE B C   1 
ATOM   2310 O O   . ILE B 1 109 ? -3.350  37.758  21.379  1.00 35.16 ? 238 ILE B O   1 
ATOM   2311 C CB  . ILE B 1 109 ? -2.113  37.599  24.329  1.00 39.19 ? 238 ILE B CB  1 
ATOM   2312 C CG1 . ILE B 1 109 ? -0.619  37.782  24.031  1.00 41.12 ? 238 ILE B CG1 1 
ATOM   2313 C CG2 . ILE B 1 109 ? -2.602  36.183  24.029  1.00 39.53 ? 238 ILE B CG2 1 
ATOM   2314 C CD1 . ILE B 1 109 ? 0.301   37.018  24.963  1.00 43.03 ? 238 ILE B CD1 1 
ATOM   2315 N N   . GLU B 1 110 ? -2.060  39.606  21.546  1.00 36.90 ? 239 GLU B N   1 
ATOM   2316 C CA  . GLU B 1 110 ? -1.799  39.704  20.116  1.00 37.96 ? 239 GLU B CA  1 
ATOM   2317 C C   . GLU B 1 110 ? -0.674  38.760  19.741  1.00 37.37 ? 239 GLU B C   1 
ATOM   2318 O O   . GLU B 1 110 ? 0.435   38.875  20.273  1.00 37.57 ? 239 GLU B O   1 
ATOM   2319 C CB  . GLU B 1 110 ? -1.424  41.137  19.728  1.00 39.16 ? 239 GLU B CB  1 
ATOM   2320 C CG  . GLU B 1 110 ? -1.093  41.295  18.250  1.00 41.93 ? 239 GLU B CG  1 
ATOM   2321 C CD  . GLU B 1 110 ? -0.896  42.736  17.816  1.00 43.88 ? 239 GLU B CD  1 
ATOM   2322 O OE1 . GLU B 1 110 ? -0.558  42.937  16.632  1.00 45.23 ? 239 GLU B OE1 1 
ATOM   2323 O OE2 . GLU B 1 110 ? -1.084  43.662  18.638  1.00 45.07 ? 239 GLU B OE2 1 
ATOM   2324 N N   . PHE B 1 111 ? -0.955  37.838  18.823  1.00 35.73 ? 240 PHE B N   1 
ATOM   2325 C CA  . PHE B 1 111 ? 0.059   36.900  18.373  1.00 36.34 ? 240 PHE B CA  1 
ATOM   2326 C C   . PHE B 1 111 ? 1.154   37.620  17.586  1.00 37.86 ? 240 PHE B C   1 
ATOM   2327 O O   . PHE B 1 111 ? 0.929   38.089  16.465  1.00 38.68 ? 240 PHE B O   1 
ATOM   2328 C CB  . PHE B 1 111 ? -0.542  35.744  17.556  1.00 34.84 ? 240 PHE B CB  1 
ATOM   2329 C CG  . PHE B 1 111 ? 0.450   34.654  17.248  1.00 34.30 ? 240 PHE B CG  1 
ATOM   2330 C CD1 . PHE B 1 111 ? 0.797   33.715  18.219  1.00 34.24 ? 240 PHE B CD1 1 
ATOM   2331 C CD2 . PHE B 1 111 ? 1.069   34.586  16.007  1.00 33.52 ? 240 PHE B CD2 1 
ATOM   2332 C CE1 . PHE B 1 111 ? 1.730   32.720  17.949  1.00 33.97 ? 240 PHE B CE1 1 
ATOM   2333 C CE2 . PHE B 1 111 ? 2.003   33.597  15.734  1.00 34.46 ? 240 PHE B CE2 1 
ATOM   2334 C CZ  . PHE B 1 111 ? 2.336   32.662  16.705  1.00 33.90 ? 240 PHE B CZ  1 
ATOM   2335 N N   . THR B 1 112 ? 2.332   37.713  18.199  1.00 40.23 ? 241 THR B N   1 
ATOM   2336 C CA  . THR B 1 112 ? 3.524   38.276  17.561  1.00 42.41 ? 241 THR B CA  1 
ATOM   2337 C C   . THR B 1 112 ? 4.730   37.358  17.812  1.00 44.87 ? 241 THR B C   1 
ATOM   2338 O O   . THR B 1 112 ? 4.594   36.286  18.409  1.00 42.16 ? 241 THR B O   1 
ATOM   2339 C CB  . THR B 1 112 ? 3.854   39.709  18.069  1.00 42.42 ? 241 THR B CB  1 
ATOM   2340 O OG1 . THR B 1 112 ? 4.225   39.667  19.451  1.00 41.95 ? 241 THR B OG1 1 
ATOM   2341 C CG2 . THR B 1 112 ? 2.678   40.680  17.877  1.00 40.70 ? 241 THR B CG2 1 
ATOM   2342 N N   . GLU B 1 113 ? 5.905   37.790  17.356  1.00 48.85 ? 242 GLU B N   1 
ATOM   2343 C CA  . GLU B 1 113 ? 7.144   37.034  17.525  1.00 52.65 ? 242 GLU B CA  1 
ATOM   2344 C C   . GLU B 1 113 ? 7.582   36.993  18.991  1.00 53.15 ? 242 GLU B C   1 
ATOM   2345 O O   . GLU B 1 113 ? 7.964   35.938  19.504  1.00 54.71 ? 242 GLU B O   1 
ATOM   2346 C CB  . GLU B 1 113 ? 8.244   37.650  16.663  1.00 56.28 ? 242 GLU B CB  1 
ATOM   2347 C CG  . GLU B 1 113 ? 9.273   36.669  16.130  1.00 59.27 ? 242 GLU B CG  1 
ATOM   2348 C CD  . GLU B 1 113 ? 10.191  37.310  15.104  1.00 62.50 ? 242 GLU B CD  1 
ATOM   2349 O OE1 . GLU B 1 113 ? 10.752  38.392  15.391  1.00 64.14 ? 242 GLU B OE1 1 
ATOM   2350 O OE2 . GLU B 1 113 ? 10.351  36.733  14.007  1.00 63.65 ? 242 GLU B OE2 1 
ATOM   2351 N N   . GLN B 1 114 ? 7.515   38.143  19.660  1.00 52.88 ? 243 GLN B N   1 
ATOM   2352 C CA  . GLN B 1 114 ? 7.873   38.242  21.078  1.00 51.36 ? 243 GLN B CA  1 
ATOM   2353 C C   . GLN B 1 114 ? 6.856   37.517  21.965  1.00 49.46 ? 243 GLN B C   1 
ATOM   2354 O O   . GLN B 1 114 ? 7.202   36.973  23.016  1.00 49.46 ? 243 GLN B O   1 
ATOM   2355 C CB  . GLN B 1 114 ? 7.996   39.704  21.486  1.00 51.43 ? 243 GLN B CB  1 
ATOM   2356 N N   . THR B 1 115 ? 5.607   37.502  21.506  1.00 46.96 ? 244 THR B N   1 
ATOM   2357 C CA  . THR B 1 115 ? 4.465   36.969  22.248  1.00 45.22 ? 244 THR B CA  1 
ATOM   2358 C C   . THR B 1 115 ? 4.330   35.436  22.188  1.00 44.30 ? 244 THR B C   1 
ATOM   2359 O O   . THR B 1 115 ? 3.948   34.806  23.181  1.00 43.76 ? 244 THR B O   1 
ATOM   2360 C CB  . THR B 1 115 ? 3.170   37.680  21.782  1.00 44.47 ? 244 THR B CB  1 
ATOM   2361 O OG1 . THR B 1 115 ? 2.875   38.770  22.666  1.00 44.16 ? 244 THR B OG1 1 
ATOM   2362 C CG2 . THR B 1 115 ? 1.993   36.744  21.737  1.00 44.16 ? 244 THR B CG2 1 
ATOM   2363 N N   . ALA B 1 116 ? 4.667   34.852  21.036  1.00 43.62 ? 245 ALA B N   1 
ATOM   2364 C CA  . ALA B 1 116 ? 4.502   33.413  20.774  1.00 42.82 ? 245 ALA B CA  1 
ATOM   2365 C C   . ALA B 1 116 ? 5.045   32.445  21.851  1.00 42.83 ? 245 ALA B C   1 
ATOM   2366 O O   . ALA B 1 116 ? 4.302   31.558  22.293  1.00 42.03 ? 245 ALA B O   1 
ATOM   2367 C CB  . ALA B 1 116 ? 5.053   33.055  19.397  1.00 41.72 ? 245 ALA B CB  1 
ATOM   2368 N N   . PRO B 1 117 ? 6.325   32.602  22.277  1.00 43.16 ? 246 PRO B N   1 
ATOM   2369 C CA  . PRO B 1 117 ? 6.854   31.661  23.281  1.00 44.39 ? 246 PRO B CA  1 
ATOM   2370 C C   . PRO B 1 117 ? 6.182   31.762  24.659  1.00 45.88 ? 246 PRO B C   1 
ATOM   2371 O O   . PRO B 1 117 ? 6.173   30.782  25.410  1.00 46.11 ? 246 PRO B O   1 
ATOM   2372 C CB  . PRO B 1 117 ? 8.339   32.041  23.381  1.00 44.10 ? 246 PRO B CB  1 
ATOM   2373 C CG  . PRO B 1 117 ? 8.407   33.454  22.918  1.00 43.46 ? 246 PRO B CG  1 
ATOM   2374 C CD  . PRO B 1 117 ? 7.347   33.586  21.863  1.00 43.17 ? 246 PRO B CD  1 
ATOM   2375 N N   . LYS B 1 118 ? 5.625   32.928  24.980  1.00 46.73 ? 247 LYS B N   1 
ATOM   2376 C CA  . LYS B 1 118 ? 4.943   33.133  26.262  1.00 47.22 ? 247 LYS B CA  1 
ATOM   2377 C C   . LYS B 1 118 ? 3.526   32.551  26.261  1.00 47.95 ? 247 LYS B C   1 
ATOM   2378 O O   . LYS B 1 118 ? 2.983   32.233  27.320  1.00 49.33 ? 247 LYS B O   1 
ATOM   2379 C CB  . LYS B 1 118 ? 4.902   34.617  26.625  1.00 46.78 ? 247 LYS B CB  1 
ATOM   2380 C CG  . LYS B 1 118 ? 6.264   35.272  26.786  1.00 46.25 ? 247 LYS B CG  1 
ATOM   2381 C CD  . LYS B 1 118 ? 6.108   36.738  27.156  1.00 45.70 ? 247 LYS B CD  1 
ATOM   2382 C CE  . LYS B 1 118 ? 7.404   37.502  26.941  1.00 45.99 ? 247 LYS B CE  1 
ATOM   2383 N NZ  . LYS B 1 118 ? 7.187   38.973  27.046  1.00 44.28 ? 247 LYS B NZ  1 
ATOM   2384 N N   . ILE B 1 119 ? 2.937   32.424  25.073  1.00 47.52 ? 248 ILE B N   1 
ATOM   2385 C CA  . ILE B 1 119 ? 1.634   31.776  24.900  1.00 47.64 ? 248 ILE B CA  1 
ATOM   2386 C C   . ILE B 1 119 ? 1.759   30.280  25.186  1.00 48.46 ? 248 ILE B C   1 
ATOM   2387 O O   . ILE B 1 119 ? 0.934   29.704  25.898  1.00 48.22 ? 248 ILE B O   1 
ATOM   2388 C CB  . ILE B 1 119 ? 1.067   32.002  23.475  1.00 46.37 ? 248 ILE B CB  1 
ATOM   2389 C CG1 . ILE B 1 119 ? 0.800   33.493  23.237  1.00 47.31 ? 248 ILE B CG1 1 
ATOM   2390 C CG2 . ILE B 1 119 ? -0.202  31.189  23.251  1.00 44.27 ? 248 ILE B CG2 1 
ATOM   2391 C CD1 . ILE B 1 119 ? 0.296   33.824  21.846  1.00 48.47 ? 248 ILE B CD1 1 
ATOM   2392 N N   . PHE B 1 120 ? 2.795   29.664  24.621  1.00 51.10 ? 249 PHE B N   1 
ATOM   2393 C CA  . PHE B 1 120 ? 3.134   28.270  24.908  1.00 54.58 ? 249 PHE B CA  1 
ATOM   2394 C C   . PHE B 1 120 ? 3.537   28.095  26.375  1.00 57.08 ? 249 PHE B C   1 
ATOM   2395 O O   . PHE B 1 120 ? 3.294   27.044  26.969  1.00 57.32 ? 249 PHE B O   1 
ATOM   2396 C CB  . PHE B 1 120 ? 4.248   27.790  23.987  1.00 52.88 ? 249 PHE B CB  1 
ATOM   2397 N N   . GLY B 1 121 ? 4.138   29.141  26.948  1.00 61.06 ? 250 GLY B N   1 
ATOM   2398 C CA  . GLY B 1 121 ? 4.578   29.150  28.347  1.00 63.09 ? 250 GLY B CA  1 
ATOM   2399 C C   . GLY B 1 121 ? 3.454   29.171  29.374  1.00 64.65 ? 250 GLY B C   1 
ATOM   2400 O O   . GLY B 1 121 ? 3.678   28.871  30.548  1.00 67.21 ? 250 GLY B O   1 
ATOM   2401 N N   . GLY B 1 122 ? 2.248   29.527  28.935  1.00 64.48 ? 251 GLY B N   1 
ATOM   2402 C CA  . GLY B 1 122 ? 1.069   29.518  29.801  1.00 64.13 ? 251 GLY B CA  1 
ATOM   2403 C C   . GLY B 1 122 ? 0.665   28.119  30.232  1.00 63.36 ? 251 GLY B C   1 
ATOM   2404 O O   . GLY B 1 122 ? 1.051   27.128  29.606  1.00 65.30 ? 251 GLY B O   1 
ATOM   2405 N N   . GLU B 1 123 ? -0.111  28.041  31.308  1.00 62.61 ? 252 GLU B N   1 
ATOM   2406 C CA  . GLU B 1 123 ? -0.569  26.762  31.853  1.00 60.42 ? 252 GLU B CA  1 
ATOM   2407 C C   . GLU B 1 123 ? -2.015  26.450  31.466  1.00 56.73 ? 252 GLU B C   1 
ATOM   2408 O O   . GLU B 1 123 ? -2.639  25.542  32.023  1.00 55.98 ? 252 GLU B O   1 
ATOM   2409 C CB  . GLU B 1 123 ? -0.399  26.748  33.375  1.00 62.16 ? 252 GLU B CB  1 
ATOM   2410 C CG  . GLU B 1 123 ? 1.011   26.406  33.824  1.00 63.53 ? 252 GLU B CG  1 
ATOM   2411 C CD  . GLU B 1 123 ? 1.609   27.444  34.755  1.00 64.38 ? 252 GLU B CD  1 
ATOM   2412 O OE1 . GLU B 1 123 ? 2.854   27.534  34.791  1.00 65.46 ? 252 GLU B OE1 1 
ATOM   2413 O OE2 . GLU B 1 123 ? 0.850   28.174  35.436  1.00 63.73 ? 252 GLU B OE2 1 
ATOM   2414 N N   . ILE B 1 124 ? -2.532  27.200  30.497  1.00 53.12 ? 253 ILE B N   1 
ATOM   2415 C CA  . ILE B 1 124 ? -3.904  27.027  30.024  1.00 48.69 ? 253 ILE B CA  1 
ATOM   2416 C C   . ILE B 1 124 ? -3.921  26.166  28.762  1.00 45.83 ? 253 ILE B C   1 
ATOM   2417 O O   . ILE B 1 124 ? -3.297  26.505  27.755  1.00 44.96 ? 253 ILE B O   1 
ATOM   2418 C CB  . ILE B 1 124 ? -4.589  28.392  29.757  1.00 48.57 ? 253 ILE B CB  1 
ATOM   2419 C CG1 . ILE B 1 124 ? -4.426  29.348  30.954  1.00 47.43 ? 253 ILE B CG1 1 
ATOM   2420 C CG2 . ILE B 1 124 ? -6.051  28.204  29.378  1.00 46.15 ? 253 ILE B CG2 1 
ATOM   2421 C CD1 . ILE B 1 124 ? -4.953  28.833  32.280  1.00 48.83 ? 253 ILE B CD1 1 
ATOM   2422 N N   . LYS B 1 125 ? -4.642  25.051  28.830  1.00 44.55 ? 254 LYS B N   1 
ATOM   2423 C CA  . LYS B 1 125 ? -4.731  24.106  27.716  1.00 42.58 ? 254 LYS B CA  1 
ATOM   2424 C C   . LYS B 1 125 ? -5.571  24.646  26.554  1.00 40.26 ? 254 LYS B C   1 
ATOM   2425 O O   . LYS B 1 125 ? -5.162  24.553  25.396  1.00 40.84 ? 254 LYS B O   1 
ATOM   2426 C CB  . LYS B 1 125 ? -5.285  22.770  28.202  1.00 43.33 ? 254 LYS B CB  1 
ATOM   2427 N N   . THR B 1 126 ? -6.739  25.202  26.878  1.00 37.17 ? 255 THR B N   1 
ATOM   2428 C CA  . THR B 1 126 ? -7.688  25.692  25.883  1.00 35.88 ? 255 THR B CA  1 
ATOM   2429 C C   . THR B 1 126 ? -7.360  27.116  25.444  1.00 35.13 ? 255 THR B C   1 
ATOM   2430 O O   . THR B 1 126 ? -7.203  28.013  26.272  1.00 34.53 ? 255 THR B O   1 
ATOM   2431 C CB  . THR B 1 126 ? -9.144  25.610  26.402  1.00 35.59 ? 255 THR B CB  1 
ATOM   2432 O OG1 . THR B 1 126 ? -9.454  24.252  26.728  1.00 36.59 ? 255 THR B OG1 1 
ATOM   2433 C CG2 . THR B 1 126 ? -10.135 26.084  25.356  1.00 33.20 ? 255 THR B CG2 1 
ATOM   2434 N N   . HIS B 1 127 ? -7.261  27.303  24.129  1.00 34.57 ? 256 HIS B N   1 
ATOM   2435 C CA  . HIS B 1 127 ? -6.947  28.594  23.521  1.00 33.01 ? 256 HIS B CA  1 
ATOM   2436 C C   . HIS B 1 127 ? -8.032  28.911  22.513  1.00 33.00 ? 256 HIS B C   1 
ATOM   2437 O O   . HIS B 1 127 ? -8.405  28.048  21.717  1.00 33.65 ? 256 HIS B O   1 
ATOM   2438 C CB  . HIS B 1 127 ? -5.600  28.526  22.789  1.00 32.56 ? 256 HIS B CB  1 
ATOM   2439 C CG  . HIS B 1 127 ? -4.413  28.329  23.685  1.00 33.57 ? 256 HIS B CG  1 
ATOM   2440 N ND1 . HIS B 1 127 ? -3.125  28.599  23.274  1.00 33.73 ? 256 HIS B ND1 1 
ATOM   2441 C CD2 . HIS B 1 127 ? -4.313  27.898  24.967  1.00 34.45 ? 256 HIS B CD2 1 
ATOM   2442 C CE1 . HIS B 1 127 ? -2.283  28.340  24.259  1.00 33.02 ? 256 HIS B CE1 1 
ATOM   2443 N NE2 . HIS B 1 127 ? -2.977  27.912  25.297  1.00 34.05 ? 256 HIS B NE2 1 
ATOM   2444 N N   . ILE B 1 128 ? -8.547  30.138  22.546  1.00 32.53 ? 257 ILE B N   1 
ATOM   2445 C CA  . ILE B 1 128 ? -9.478  30.597  21.508  1.00 31.63 ? 257 ILE B CA  1 
ATOM   2446 C C   . ILE B 1 128 ? -8.796  31.632  20.610  1.00 31.12 ? 257 ILE B C   1 
ATOM   2447 O O   . ILE B 1 128 ? -8.348  32.678  21.073  1.00 31.00 ? 257 ILE B O   1 
ATOM   2448 C CB  . ILE B 1 128 ? -10.838 31.105  22.071  1.00 30.49 ? 257 ILE B CB  1 
ATOM   2449 C CG1 . ILE B 1 128 ? -11.785 31.505  20.925  1.00 29.92 ? 257 ILE B CG1 1 
ATOM   2450 C CG2 . ILE B 1 128 ? -10.643 32.248  23.057  1.00 31.37 ? 257 ILE B CG2 1 
ATOM   2451 C CD1 . ILE B 1 128 ? -13.151 32.006  21.359  1.00 28.78 ? 257 ILE B CD1 1 
ATOM   2452 N N   . LEU B 1 129 ? -8.711  31.315  19.325  1.00 31.36 ? 258 LEU B N   1 
ATOM   2453 C CA  . LEU B 1 129 ? -8.059  32.180  18.356  1.00 31.85 ? 258 LEU B CA  1 
ATOM   2454 C C   . LEU B 1 129 ? -9.095  33.008  17.625  1.00 32.24 ? 258 LEU B C   1 
ATOM   2455 O O   . LEU B 1 129 ? -10.068 32.475  17.105  1.00 32.99 ? 258 LEU B O   1 
ATOM   2456 C CB  . LEU B 1 129 ? -7.271  31.347  17.348  1.00 31.36 ? 258 LEU B CB  1 
ATOM   2457 C CG  . LEU B 1 129 ? -5.872  30.829  17.691  1.00 32.52 ? 258 LEU B CG  1 
ATOM   2458 C CD1 . LEU B 1 129 ? -5.763  30.209  19.081  1.00 31.48 ? 258 LEU B CD1 1 
ATOM   2459 C CD2 . LEU B 1 129 ? -5.446  29.834  16.623  1.00 32.04 ? 258 LEU B CD2 1 
ATOM   2460 N N   . LEU B 1 130 ? -8.896  34.317  17.601  1.00 32.99 ? 259 LEU B N   1 
ATOM   2461 C CA  . LEU B 1 130 ? -9.686  35.165  16.732  1.00 33.84 ? 259 LEU B CA  1 
ATOM   2462 C C   . LEU B 1 130 ? -8.773  35.677  15.629  1.00 34.84 ? 259 LEU B C   1 
ATOM   2463 O O   . LEU B 1 130 ? -7.794  36.387  15.893  1.00 33.92 ? 259 LEU B O   1 
ATOM   2464 C CB  . LEU B 1 130 ? -10.325 36.315  17.512  1.00 33.87 ? 259 LEU B CB  1 
ATOM   2465 C CG  . LEU B 1 130 ? -11.080 37.415  16.751  1.00 34.27 ? 259 LEU B CG  1 
ATOM   2466 C CD1 . LEU B 1 130 ? -12.438 36.944  16.248  1.00 34.12 ? 259 LEU B CD1 1 
ATOM   2467 C CD2 . LEU B 1 130 ? -11.243 38.640  17.641  1.00 34.91 ? 259 LEU B CD2 1 
ATOM   2468 N N   . PHE B 1 131 ? -9.078  35.279  14.397  1.00 35.47 ? 260 PHE B N   1 
ATOM   2469 C CA  . PHE B 1 131 ? -8.377  35.791  13.225  1.00 36.57 ? 260 PHE B CA  1 
ATOM   2470 C C   . PHE B 1 131 ? -9.085  37.073  12.810  1.00 37.53 ? 260 PHE B C   1 
ATOM   2471 O O   . PHE B 1 131 ? -10.161 37.037  12.216  1.00 38.15 ? 260 PHE B O   1 
ATOM   2472 C CB  . PHE B 1 131 ? -8.377  34.756  12.093  1.00 35.97 ? 260 PHE B CB  1 
ATOM   2473 C CG  . PHE B 1 131 ? -7.642  33.481  12.430  1.00 36.36 ? 260 PHE B CG  1 
ATOM   2474 C CD1 . PHE B 1 131 ? -6.317  33.301  12.037  1.00 35.86 ? 260 PHE B CD1 1 
ATOM   2475 C CD2 . PHE B 1 131 ? -8.270  32.462  13.149  1.00 35.69 ? 260 PHE B CD2 1 
ATOM   2476 C CE1 . PHE B 1 131 ? -5.635  32.132  12.347  1.00 35.46 ? 260 PHE B CE1 1 
ATOM   2477 C CE2 . PHE B 1 131 ? -7.594  31.292  13.457  1.00 35.93 ? 260 PHE B CE2 1 
ATOM   2478 C CZ  . PHE B 1 131 ? -6.276  31.125  13.055  1.00 35.96 ? 260 PHE B CZ  1 
ATOM   2479 N N   . LEU B 1 132 ? -8.484  38.205  13.159  1.00 38.99 ? 261 LEU B N   1 
ATOM   2480 C CA  . LEU B 1 132 ? -9.113  39.508  12.979  1.00 40.30 ? 261 LEU B CA  1 
ATOM   2481 C C   . LEU B 1 132 ? -8.254  40.409  12.092  1.00 41.38 ? 261 LEU B C   1 
ATOM   2482 O O   . LEU B 1 132 ? -7.166  40.820  12.505  1.00 43.00 ? 261 LEU B O   1 
ATOM   2483 C CB  . LEU B 1 132 ? -9.343  40.167  14.347  1.00 39.80 ? 261 LEU B CB  1 
ATOM   2484 C CG  . LEU B 1 132 ? -10.039 41.530  14.457  1.00 40.33 ? 261 LEU B CG  1 
ATOM   2485 C CD1 . LEU B 1 132 ? -11.490 41.458  13.999  1.00 40.36 ? 261 LEU B CD1 1 
ATOM   2486 C CD2 . LEU B 1 132 ? -9.964  42.042  15.888  1.00 40.03 ? 261 LEU B CD2 1 
ATOM   2487 N N   . PRO B 1 133 ? -8.743  40.730  10.875  1.00 42.39 ? 262 PRO B N   1 
ATOM   2488 C CA  . PRO B 1 133 ? -8.018  41.643  9.985   1.00 42.48 ? 262 PRO B CA  1 
ATOM   2489 C C   . PRO B 1 133 ? -7.962  43.055  10.571  1.00 43.54 ? 262 PRO B C   1 
ATOM   2490 O O   . PRO B 1 133 ? -8.995  43.596  10.968  1.00 43.27 ? 262 PRO B O   1 
ATOM   2491 C CB  . PRO B 1 133 ? -8.862  41.642  8.699   1.00 42.09 ? 262 PRO B CB  1 
ATOM   2492 C CG  . PRO B 1 133 ? -9.819  40.504  8.830   1.00 42.57 ? 262 PRO B CG  1 
ATOM   2493 C CD  . PRO B 1 133 ? -10.033 40.310  10.299  1.00 41.90 ? 262 PRO B CD  1 
ATOM   2494 N N   . LYS B 1 134 ? -6.769  43.643  10.626  1.00 45.50 ? 263 LYS B N   1 
ATOM   2495 C CA  . LYS B 1 134 ? -6.608  44.999  11.168  1.00 48.34 ? 263 LYS B CA  1 
ATOM   2496 C C   . LYS B 1 134 ? -7.315  46.086  10.349  1.00 49.17 ? 263 LYS B C   1 
ATOM   2497 O O   . LYS B 1 134 ? -7.477  47.219  10.813  1.00 49.40 ? 263 LYS B O   1 
ATOM   2498 C CB  . LYS B 1 134 ? -5.130  45.342  11.386  1.00 48.69 ? 263 LYS B CB  1 
ATOM   2499 C CG  . LYS B 1 134 ? -4.631  44.940  12.765  1.00 49.37 ? 263 LYS B CG  1 
ATOM   2500 C CD  . LYS B 1 134 ? -3.184  45.343  13.014  1.00 48.39 ? 263 LYS B CD  1 
ATOM   2501 C CE  . LYS B 1 134 ? -2.727  44.825  14.370  1.00 48.11 ? 263 LYS B CE  1 
ATOM   2502 N NZ  . LYS B 1 134 ? -1.269  45.005  14.606  1.00 47.83 ? 263 LYS B NZ  1 
ATOM   2503 N N   . SER B 1 135 ? -7.751  45.729  9.145   1.00 50.18 ? 264 SER B N   1 
ATOM   2504 C CA  . SER B 1 135 ? -8.432  46.665  8.262   1.00 51.96 ? 264 SER B CA  1 
ATOM   2505 C C   . SER B 1 135 ? -9.952  46.512  8.304   1.00 51.44 ? 264 SER B C   1 
ATOM   2506 O O   . SER B 1 135 ? -10.667 47.237  7.609   1.00 51.69 ? 264 SER B O   1 
ATOM   2507 C CB  . SER B 1 135 ? -7.916  46.513  6.827   1.00 52.54 ? 264 SER B CB  1 
ATOM   2508 O OG  . SER B 1 135 ? -6.559  46.914  6.737   1.00 52.95 ? 264 SER B OG  1 
ATOM   2509 N N   . VAL B 1 136 ? -10.441 45.583  9.125   1.00 51.57 ? 265 VAL B N   1 
ATOM   2510 C CA  . VAL B 1 136 ? -11.881 45.288  9.184   1.00 52.51 ? 265 VAL B CA  1 
ATOM   2511 C C   . VAL B 1 136 ? -12.703 46.467  9.728   1.00 52.58 ? 265 VAL B C   1 
ATOM   2512 O O   . VAL B 1 136 ? -12.187 47.316  10.464  1.00 50.93 ? 265 VAL B O   1 
ATOM   2513 C CB  . VAL B 1 136 ? -12.184 43.974  9.964   1.00 52.26 ? 265 VAL B CB  1 
ATOM   2514 C CG1 . VAL B 1 136 ? -12.223 44.209  11.472  1.00 51.97 ? 265 VAL B CG1 1 
ATOM   2515 C CG2 . VAL B 1 136 ? -13.487 43.346  9.484   1.00 50.74 ? 265 VAL B CG2 1 
ATOM   2516 N N   . SER B 1 137 ? -13.972 46.511  9.325   1.00 52.73 ? 266 SER B N   1 
ATOM   2517 C CA  . SER B 1 137 ? -14.949 47.468  9.836   1.00 53.58 ? 266 SER B CA  1 
ATOM   2518 C C   . SER B 1 137 ? -15.170 47.232  11.330  1.00 53.69 ? 266 SER B C   1 
ATOM   2519 O O   . SER B 1 137 ? -15.277 46.084  11.773  1.00 53.31 ? 266 SER B O   1 
ATOM   2520 C CB  . SER B 1 137 ? -16.269 47.310  9.074   1.00 53.43 ? 266 SER B CB  1 
ATOM   2521 O OG  . SER B 1 137 ? -17.267 48.196  9.551   1.00 52.71 ? 266 SER B OG  1 
ATOM   2522 N N   . ASP B 1 138 ? -15.222 48.324  12.095  1.00 52.41 ? 267 ASP B N   1 
ATOM   2523 C CA  . ASP B 1 138 ? -15.439 48.279  13.550  1.00 50.61 ? 267 ASP B CA  1 
ATOM   2524 C C   . ASP B 1 138 ? -14.458 47.323  14.244  1.00 50.45 ? 267 ASP B C   1 
ATOM   2525 O O   . ASP B 1 138 ? -14.848 46.494  15.066  1.00 48.93 ? 267 ASP B O   1 
ATOM   2526 C CB  . ASP B 1 138 ? -16.906 47.929  13.871  1.00 49.31 ? 267 ASP B CB  1 
ATOM   2527 C CG  . ASP B 1 138 ? -17.269 48.168  15.330  1.00 47.60 ? 267 ASP B CG  1 
ATOM   2528 O OD1 . ASP B 1 138 ? -16.814 49.170  15.919  1.00 46.63 ? 267 ASP B OD1 1 
ATOM   2529 O OD2 . ASP B 1 138 ? -18.016 47.342  15.888  1.00 47.34 ? 267 ASP B OD2 1 
ATOM   2530 N N   . TYR B 1 139 ? -13.182 47.458  13.886  1.00 51.45 ? 268 TYR B N   1 
ATOM   2531 C CA  . TYR B 1 139 ? -12.104 46.618  14.402  1.00 51.52 ? 268 TYR B CA  1 
ATOM   2532 C C   . TYR B 1 139 ? -12.020 46.671  15.923  1.00 51.95 ? 268 TYR B C   1 
ATOM   2533 O O   . TYR B 1 139 ? -12.002 45.626  16.580  1.00 51.64 ? 268 TYR B O   1 
ATOM   2534 C CB  . TYR B 1 139 ? -10.766 47.037  13.775  1.00 51.38 ? 268 TYR B CB  1 
ATOM   2535 C CG  . TYR B 1 139 ? -9.535  46.378  14.372  1.00 51.93 ? 268 TYR B CG  1 
ATOM   2536 C CD1 . TYR B 1 139 ? -9.089  45.139  13.911  1.00 51.35 ? 268 TYR B CD1 1 
ATOM   2537 C CD2 . TYR B 1 139 ? -8.805  47.005  15.386  1.00 51.64 ? 268 TYR B CD2 1 
ATOM   2538 C CE1 . TYR B 1 139 ? -7.959  44.540  14.447  1.00 51.33 ? 268 TYR B CE1 1 
ATOM   2539 C CE2 . TYR B 1 139 ? -7.676  46.410  15.931  1.00 51.70 ? 268 TYR B CE2 1 
ATOM   2540 C CZ  . TYR B 1 139 ? -7.258  45.179  15.458  1.00 51.55 ? 268 TYR B CZ  1 
ATOM   2541 O OH  . TYR B 1 139 ? -6.139  44.584  15.990  1.00 51.59 ? 268 TYR B OH  1 
ATOM   2542 N N   . ASP B 1 140 ? -11.972 47.888  16.467  1.00 51.77 ? 269 ASP B N   1 
ATOM   2543 C CA  . ASP B 1 140 ? -11.820 48.106  17.909  1.00 52.40 ? 269 ASP B CA  1 
ATOM   2544 C C   . ASP B 1 140 ? -13.047 47.672  18.702  1.00 49.78 ? 269 ASP B C   1 
ATOM   2545 O O   . ASP B 1 140 ? -12.940 47.341  19.882  1.00 49.83 ? 269 ASP B O   1 
ATOM   2546 C CB  . ASP B 1 140 ? -11.501 49.576  18.203  1.00 53.43 ? 269 ASP B CB  1 
ATOM   2547 C CG  . ASP B 1 140 ? -10.151 49.999  17.661  1.00 54.18 ? 269 ASP B CG  1 
ATOM   2548 O OD1 . ASP B 1 140 ? -9.116  49.534  18.182  1.00 55.37 ? 269 ASP B OD1 1 
ATOM   2549 O OD2 . ASP B 1 140 ? -10.126 50.809  16.713  1.00 55.97 ? 269 ASP B OD2 1 
ATOM   2550 N N   . GLY B 1 141 ? -14.205 47.688  18.047  1.00 49.46 ? 270 GLY B N   1 
ATOM   2551 C CA  . GLY B 1 141 ? -15.449 47.199  18.640  1.00 49.56 ? 270 GLY B CA  1 
ATOM   2552 C C   . GLY B 1 141 ? -15.472 45.683  18.721  1.00 48.68 ? 270 GLY B C   1 
ATOM   2553 O O   . GLY B 1 141 ? -15.894 45.113  19.729  1.00 49.11 ? 270 GLY B O   1 
ATOM   2554 N N   . LYS B 1 142 ? -15.012 45.034  17.654  1.00 48.33 ? 271 LYS B N   1 
ATOM   2555 C CA  . LYS B 1 142 ? -14.943 43.571  17.592  1.00 48.28 ? 271 LYS B CA  1 
ATOM   2556 C C   . LYS B 1 142 ? -13.891 43.005  18.555  1.00 47.00 ? 271 LYS B C   1 
ATOM   2557 O O   . LYS B 1 142 ? -14.085 41.932  19.132  1.00 47.13 ? 271 LYS B O   1 
ATOM   2558 C CB  . LYS B 1 142 ? -14.672 43.096  16.159  1.00 47.76 ? 271 LYS B CB  1 
ATOM   2559 C CG  . LYS B 1 142 ? -15.802 43.368  15.175  1.00 47.27 ? 271 LYS B CG  1 
ATOM   2560 C CD  . LYS B 1 142 ? -15.472 42.811  13.796  1.00 48.75 ? 271 LYS B CD  1 
ATOM   2561 C CE  . LYS B 1 142 ? -16.382 43.375  12.712  1.00 48.94 ? 271 LYS B CE  1 
ATOM   2562 N NZ  . LYS B 1 142 ? -17.836 43.215  12.995  1.00 49.18 ? 271 LYS B NZ  1 
ATOM   2563 N N   . LEU B 1 143 ? -12.793 43.744  18.722  1.00 45.22 ? 272 LEU B N   1 
ATOM   2564 C CA  . LEU B 1 143 ? -11.704 43.376  19.625  1.00 45.02 ? 272 LEU B CA  1 
ATOM   2565 C C   . LEU B 1 143 ? -12.098 43.548  21.094  1.00 46.17 ? 272 LEU B C   1 
ATOM   2566 O O   . LEU B 1 143 ? -11.725 42.733  21.947  1.00 44.60 ? 272 LEU B O   1 
ATOM   2567 C CB  . LEU B 1 143 ? -10.456 44.210  19.306  1.00 44.40 ? 272 LEU B CB  1 
ATOM   2568 C CG  . LEU B 1 143 ? -9.094  43.779  19.857  1.00 44.29 ? 272 LEU B CG  1 
ATOM   2569 C CD1 . LEU B 1 143 ? -8.692  42.397  19.361  1.00 43.96 ? 272 LEU B CD1 1 
ATOM   2570 C CD2 . LEU B 1 143 ? -8.036  44.800  19.475  1.00 44.71 ? 272 LEU B CD2 1 
ATOM   2571 N N   . SER B 1 144 ? -12.849 44.610  21.385  1.00 45.86 ? 273 SER B N   1 
ATOM   2572 C CA  . SER B 1 144 ? -13.344 44.844  22.738  1.00 46.64 ? 273 SER B CA  1 
ATOM   2573 C C   . SER B 1 144 ? -14.337 43.765  23.151  1.00 45.20 ? 273 SER B C   1 
ATOM   2574 O O   . SER B 1 144 ? -14.339 43.332  24.306  1.00 43.78 ? 273 SER B O   1 
ATOM   2575 C CB  . SER B 1 144 ? -13.966 46.235  22.864  1.00 48.54 ? 273 SER B CB  1 
ATOM   2576 O OG  . SER B 1 144 ? -12.961 47.234  22.813  1.00 51.11 ? 273 SER B OG  1 
ATOM   2577 N N   . ASN B 1 145 ? -15.158 43.329  22.195  1.00 44.00 ? 274 ASN B N   1 
ATOM   2578 C CA  . ASN B 1 145 ? -16.091 42.212  22.389  1.00 43.28 ? 274 ASN B CA  1 
ATOM   2579 C C   . ASN B 1 145 ? -15.391 40.916  22.788  1.00 42.16 ? 274 ASN B C   1 
ATOM   2580 O O   . ASN B 1 145 ? -15.874 40.175  23.654  1.00 41.27 ? 274 ASN B O   1 
ATOM   2581 C CB  . ASN B 1 145 ? -16.920 41.979  21.121  1.00 44.72 ? 274 ASN B CB  1 
ATOM   2582 C CG  . ASN B 1 145 ? -18.029 42.999  20.949  1.00 46.59 ? 274 ASN B CG  1 
ATOM   2583 O OD1 . ASN B 1 145 ? -17.972 44.103  21.495  1.00 47.23 ? 274 ASN B OD1 1 
ATOM   2584 N ND2 . ASN B 1 145 ? -19.046 42.635  20.181  1.00 47.06 ? 274 ASN B ND2 1 
ATOM   2585 N N   . PHE B 1 146 ? -14.258 40.655  22.137  1.00 39.69 ? 275 PHE B N   1 
ATOM   2586 C CA  . PHE B 1 146 ? -13.380 39.544  22.470  1.00 37.73 ? 275 PHE B CA  1 
ATOM   2587 C C   . PHE B 1 146 ? -12.791 39.729  23.876  1.00 36.57 ? 275 PHE B C   1 
ATOM   2588 O O   . PHE B 1 146 ? -12.705 38.772  24.643  1.00 35.34 ? 275 PHE B O   1 
ATOM   2589 C CB  . PHE B 1 146 ? -12.269 39.451  21.417  1.00 37.71 ? 275 PHE B CB  1 
ATOM   2590 C CG  . PHE B 1 146 ? -11.589 38.107  21.336  1.00 37.41 ? 275 PHE B CG  1 
ATOM   2591 C CD1 . PHE B 1 146 ? -12.308 36.953  21.038  1.00 37.44 ? 275 PHE B CD1 1 
ATOM   2592 C CD2 . PHE B 1 146 ? -10.212 38.007  21.507  1.00 37.15 ? 275 PHE B CD2 1 
ATOM   2593 C CE1 . PHE B 1 146 ? -11.667 35.726  20.940  1.00 37.56 ? 275 PHE B CE1 1 
ATOM   2594 C CE2 . PHE B 1 146 ? -9.565  36.784  21.409  1.00 36.42 ? 275 PHE B CE2 1 
ATOM   2595 C CZ  . PHE B 1 146 ? -10.294 35.642  21.125  1.00 37.15 ? 275 PHE B CZ  1 
ATOM   2596 N N   . LYS B 1 147 ? -12.405 40.964  24.209  1.00 36.62 ? 276 LYS B N   1 
ATOM   2597 C CA  . LYS B 1 147 ? -11.848 41.288  25.532  1.00 36.75 ? 276 LYS B CA  1 
ATOM   2598 C C   . LYS B 1 147 ? -12.887 41.186  26.646  1.00 36.18 ? 276 LYS B C   1 
ATOM   2599 O O   . LYS B 1 147 ? -12.590 40.707  27.738  1.00 35.70 ? 276 LYS B O   1 
ATOM   2600 C CB  . LYS B 1 147 ? -11.205 42.668  25.524  1.00 35.60 ? 276 LYS B CB  1 
ATOM   2601 N N   . THR B 1 148 ? -14.101 41.643  26.360  1.00 37.12 ? 277 THR B N   1 
ATOM   2602 C CA  . THR B 1 148 ? -15.218 41.551  27.298  1.00 37.84 ? 277 THR B CA  1 
ATOM   2603 C C   . THR B 1 148 ? -15.564 40.094  27.593  1.00 37.60 ? 277 THR B C   1 
ATOM   2604 O O   . THR B 1 148 ? -15.809 39.737  28.744  1.00 37.81 ? 277 THR B O   1 
ATOM   2605 C CB  . THR B 1 148 ? -16.455 42.291  26.756  1.00 38.60 ? 277 THR B CB  1 
ATOM   2606 O OG1 . THR B 1 148 ? -16.148 43.683  26.643  1.00 38.90 ? 277 THR B OG1 1 
ATOM   2607 C CG2 . THR B 1 148 ? -17.665 42.111  27.683  1.00 39.27 ? 277 THR B CG2 1 
ATOM   2608 N N   . ALA B 1 149 ? -15.574 39.265  26.549  1.00 37.52 ? 278 ALA B N   1 
ATOM   2609 C CA  . ALA B 1 149 ? -15.831 37.831  26.687  1.00 37.81 ? 278 ALA B CA  1 
ATOM   2610 C C   . ALA B 1 149 ? -14.680 37.129  27.393  1.00 38.22 ? 278 ALA B C   1 
ATOM   2611 O O   . ALA B 1 149 ? -14.891 36.146  28.094  1.00 39.14 ? 278 ALA B O   1 
ATOM   2612 C CB  . ALA B 1 149 ? -16.077 37.201  25.330  1.00 37.56 ? 278 ALA B CB  1 
ATOM   2613 N N   . ALA B 1 150 ? -13.466 37.642  27.205  1.00 38.65 ? 279 ALA B N   1 
ATOM   2614 C CA  . ALA B 1 150 ? -12.276 37.095  27.858  1.00 40.65 ? 279 ALA B CA  1 
ATOM   2615 C C   . ALA B 1 150 ? -12.318 37.257  29.379  1.00 41.53 ? 279 ALA B C   1 
ATOM   2616 O O   . ALA B 1 150 ? -11.714 36.466  30.116  1.00 40.96 ? 279 ALA B O   1 
ATOM   2617 C CB  . ALA B 1 150 ? -11.020 37.736  27.288  1.00 39.41 ? 279 ALA B CB  1 
ATOM   2618 N N   . GLU B 1 151 ? -13.040 38.284  29.828  1.00 43.66 ? 280 GLU B N   1 
ATOM   2619 C CA  . GLU B 1 151 ? -13.154 38.636  31.244  1.00 44.21 ? 280 GLU B CA  1 
ATOM   2620 C C   . GLU B 1 151 ? -13.664 37.493  32.105  1.00 44.47 ? 280 GLU B C   1 
ATOM   2621 O O   . GLU B 1 151 ? -13.117 37.231  33.175  1.00 45.11 ? 280 GLU B O   1 
ATOM   2622 C CB  . GLU B 1 151 ? -14.060 39.859  31.432  1.00 44.13 ? 280 GLU B CB  1 
ATOM   2623 C CG  . GLU B 1 151 ? -13.532 41.152  30.826  1.00 46.51 ? 280 GLU B CG  1 
ATOM   2624 C CD  . GLU B 1 151 ? -12.355 41.751  31.587  1.00 48.99 ? 280 GLU B CD  1 
ATOM   2625 O OE1 . GLU B 1 151 ? -11.740 41.045  32.420  1.00 49.97 ? 280 GLU B OE1 1 
ATOM   2626 O OE2 . GLU B 1 151 ? -12.039 42.940  31.346  1.00 49.10 ? 280 GLU B OE2 1 
ATOM   2627 N N   . SER B 1 152 ? -14.704 36.809  31.635  1.00 44.11 ? 281 SER B N   1 
ATOM   2628 C CA  . SER B 1 152 ? -15.326 35.756  32.426  1.00 44.81 ? 281 SER B CA  1 
ATOM   2629 C C   . SER B 1 152 ? -14.729 34.375  32.150  1.00 44.41 ? 281 SER B C   1 
ATOM   2630 O O   . SER B 1 152 ? -15.392 33.359  32.358  1.00 42.69 ? 281 SER B O   1 
ATOM   2631 C CB  . SER B 1 152 ? -16.853 35.765  32.246  1.00 46.24 ? 281 SER B CB  1 
ATOM   2632 O OG  . SER B 1 152 ? -17.224 35.476  30.914  1.00 45.95 ? 281 SER B OG  1 
ATOM   2633 N N   . PHE B 1 153 ? -13.475 34.351  31.691  1.00 44.32 ? 282 PHE B N   1 
ATOM   2634 C CA  . PHE B 1 153 ? -12.745 33.100  31.447  1.00 43.16 ? 282 PHE B CA  1 
ATOM   2635 C C   . PHE B 1 153 ? -11.279 33.156  31.875  1.00 43.16 ? 282 PHE B C   1 
ATOM   2636 O O   . PHE B 1 153 ? -10.467 32.352  31.412  1.00 42.91 ? 282 PHE B O   1 
ATOM   2637 C CB  . PHE B 1 153 ? -12.853 32.676  29.976  1.00 43.09 ? 282 PHE B CB  1 
ATOM   2638 C CG  . PHE B 1 153 ? -14.254 32.375  29.537  1.00 43.57 ? 282 PHE B CG  1 
ATOM   2639 C CD1 . PHE B 1 153 ? -14.979 33.308  28.810  1.00 42.43 ? 282 PHE B CD1 1 
ATOM   2640 C CD2 . PHE B 1 153 ? -14.860 31.166  29.870  1.00 44.09 ? 282 PHE B CD2 1 
ATOM   2641 C CE1 . PHE B 1 153 ? -16.279 33.045  28.414  1.00 43.28 ? 282 PHE B CE1 1 
ATOM   2642 C CE2 . PHE B 1 153 ? -16.164 30.894  29.473  1.00 43.74 ? 282 PHE B CE2 1 
ATOM   2643 C CZ  . PHE B 1 153 ? -16.873 31.836  28.745  1.00 44.00 ? 282 PHE B CZ  1 
ATOM   2644 N N   . LYS B 1 154 ? -10.949 34.100  32.759  1.00 44.79 ? 283 LYS B N   1 
ATOM   2645 C CA  . LYS B 1 154 ? -9.592  34.239  33.304  1.00 44.73 ? 283 LYS B CA  1 
ATOM   2646 C C   . LYS B 1 154 ? -9.121  32.922  33.912  1.00 44.89 ? 283 LYS B C   1 
ATOM   2647 O O   . LYS B 1 154 ? -9.833  32.317  34.721  1.00 44.66 ? 283 LYS B O   1 
ATOM   2648 C CB  . LYS B 1 154 ? -9.532  35.341  34.369  1.00 46.93 ? 283 LYS B CB  1 
ATOM   2649 C CG  . LYS B 1 154 ? -9.864  36.735  33.862  1.00 49.62 ? 283 LYS B CG  1 
ATOM   2650 C CD  . LYS B 1 154 ? -9.573  37.799  34.910  1.00 50.87 ? 283 LYS B CD  1 
ATOM   2651 C CE  . LYS B 1 154 ? -9.625  39.190  34.297  1.00 52.24 ? 283 LYS B CE  1 
ATOM   2652 N NZ  . LYS B 1 154 ? -9.468  40.264  35.316  1.00 52.55 ? 283 LYS B NZ  1 
ATOM   2653 N N   . GLY B 1 155 ? -7.928  32.487  33.513  1.00 43.62 ? 284 GLY B N   1 
ATOM   2654 C CA  . GLY B 1 155 ? -7.359  31.216  33.963  1.00 42.23 ? 284 GLY B CA  1 
ATOM   2655 C C   . GLY B 1 155 ? -8.150  29.985  33.550  1.00 41.27 ? 284 GLY B C   1 
ATOM   2656 O O   . GLY B 1 155 ? -8.120  28.971  34.241  1.00 42.86 ? 284 GLY B O   1 
ATOM   2657 N N   . LYS B 1 156 ? -8.871  30.073  32.435  1.00 40.29 ? 285 LYS B N   1 
ATOM   2658 C CA  . LYS B 1 156 ? -9.636  28.934  31.915  1.00 39.60 ? 285 LYS B CA  1 
ATOM   2659 C C   . LYS B 1 156 ? -9.452  28.781  30.406  1.00 38.08 ? 285 LYS B C   1 
ATOM   2660 O O   . LYS B 1 156 ? -9.216  27.677  29.912  1.00 37.67 ? 285 LYS B O   1 
ATOM   2661 C CB  . LYS B 1 156 ? -11.121 29.062  32.261  1.00 40.70 ? 285 LYS B CB  1 
ATOM   2662 C CG  . LYS B 1 156 ? -11.474 28.679  33.687  1.00 42.65 ? 285 LYS B CG  1 
ATOM   2663 C CD  . LYS B 1 156 ? -12.957 28.884  33.945  1.00 45.36 ? 285 LYS B CD  1 
ATOM   2664 C CE  . LYS B 1 156 ? -13.255 28.968  35.434  1.00 47.41 ? 285 LYS B CE  1 
ATOM   2665 N NZ  . LYS B 1 156 ? -14.673 29.368  35.659  1.00 48.71 ? 285 LYS B NZ  1 
ATOM   2666 N N   . ILE B 1 157 ? -9.571  29.893  29.685  1.00 35.88 ? 286 ILE B N   1 
ATOM   2667 C CA  . ILE B 1 157 ? -9.294  29.934  28.255  1.00 33.64 ? 286 ILE B CA  1 
ATOM   2668 C C   . ILE B 1 157 ? -8.334  31.080  27.975  1.00 32.72 ? 286 ILE B C   1 
ATOM   2669 O O   . ILE B 1 157 ? -8.515  32.185  28.480  1.00 31.99 ? 286 ILE B O   1 
ATOM   2670 C CB  . ILE B 1 157 ? -10.572 30.146  27.413  1.00 33.84 ? 286 ILE B CB  1 
ATOM   2671 C CG1 . ILE B 1 157 ? -11.643 29.110  27.760  1.00 33.82 ? 286 ILE B CG1 1 
ATOM   2672 C CG2 . ILE B 1 157 ? -10.248 30.077  25.924  1.00 34.33 ? 286 ILE B CG2 1 
ATOM   2673 C CD1 . ILE B 1 157 ? -12.994 29.399  27.143  1.00 34.40 ? 286 ILE B CD1 1 
ATOM   2674 N N   . LEU B 1 158 ? -7.308  30.815  27.174  1.00 32.67 ? 287 LEU B N   1 
ATOM   2675 C CA  . LEU B 1 158 ? -6.430  31.880  26.703  1.00 32.05 ? 287 LEU B CA  1 
ATOM   2676 C C   . LEU B 1 158 ? -7.002  32.463  25.409  1.00 31.78 ? 287 LEU B C   1 
ATOM   2677 O O   . LEU B 1 158 ? -7.262  31.731  24.451  1.00 30.93 ? 287 LEU B O   1 
ATOM   2678 C CB  . LEU B 1 158 ? -5.000  31.364  26.509  1.00 33.52 ? 287 LEU B CB  1 
ATOM   2679 C CG  . LEU B 1 158 ? -3.856  32.389  26.529  1.00 35.53 ? 287 LEU B CG  1 
ATOM   2680 C CD1 . LEU B 1 158 ? -3.757  33.117  27.867  1.00 35.96 ? 287 LEU B CD1 1 
ATOM   2681 C CD2 . LEU B 1 158 ? -2.537  31.697  26.219  1.00 36.47 ? 287 LEU B CD2 1 
ATOM   2682 N N   . PHE B 1 159 ? -7.228  33.777  25.415  1.00 30.92 ? 288 PHE B N   1 
ATOM   2683 C CA  . PHE B 1 159 ? -7.796  34.502  24.278  1.00 30.91 ? 288 PHE B CA  1 
ATOM   2684 C C   . PHE B 1 159 ? -6.672  35.110  23.445  1.00 30.31 ? 288 PHE B C   1 
ATOM   2685 O O   . PHE B 1 159 ? -5.922  35.966  23.930  1.00 29.62 ? 288 PHE B O   1 
ATOM   2686 C CB  . PHE B 1 159 ? -8.749  35.611  24.762  1.00 30.96 ? 288 PHE B CB  1 
ATOM   2687 C CG  . PHE B 1 159 ? -10.137 35.133  25.103  1.00 30.77 ? 288 PHE B CG  1 
ATOM   2688 C CD1 . PHE B 1 159 ? -10.351 34.228  26.139  1.00 31.33 ? 288 PHE B CD1 1 
ATOM   2689 C CD2 . PHE B 1 159 ? -11.236 35.611  24.402  1.00 30.84 ? 288 PHE B CD2 1 
ATOM   2690 C CE1 . PHE B 1 159 ? -11.631 33.788  26.447  1.00 30.92 ? 288 PHE B CE1 1 
ATOM   2691 C CE2 . PHE B 1 159 ? -12.519 35.180  24.704  1.00 30.48 ? 288 PHE B CE2 1 
ATOM   2692 C CZ  . PHE B 1 159 ? -12.716 34.268  25.730  1.00 30.93 ? 288 PHE B CZ  1 
ATOM   2693 N N   . ILE B 1 160 ? -6.561  34.652  22.198  1.00 29.36 ? 289 ILE B N   1 
ATOM   2694 C CA  . ILE B 1 160 ? -5.514  35.092  21.278  1.00 30.18 ? 289 ILE B CA  1 
ATOM   2695 C C   . ILE B 1 160 ? -6.139  35.689  20.020  1.00 31.22 ? 289 ILE B C   1 
ATOM   2696 O O   . ILE B 1 160 ? -7.052  35.098  19.436  1.00 31.20 ? 289 ILE B O   1 
ATOM   2697 C CB  . ILE B 1 160 ? -4.597  33.913  20.861  1.00 29.44 ? 289 ILE B CB  1 
ATOM   2698 C CG1 . ILE B 1 160 ? -3.969  33.246  22.091  1.00 29.95 ? 289 ILE B CG1 1 
ATOM   2699 C CG2 . ILE B 1 160 ? -3.507  34.382  19.906  1.00 29.15 ? 289 ILE B CG2 1 
ATOM   2700 C CD1 . ILE B 1 160 ? -3.743  31.757  21.934  1.00 29.66 ? 289 ILE B CD1 1 
ATOM   2701 N N   . PHE B 1 161 ? -5.654  36.859  19.607  1.00 32.56 ? 290 PHE B N   1 
ATOM   2702 C CA  . PHE B 1 161 ? -6.065  37.426  18.325  1.00 33.67 ? 290 PHE B CA  1 
ATOM   2703 C C   . PHE B 1 161 ? -4.906  37.515  17.332  1.00 33.28 ? 290 PHE B C   1 
ATOM   2704 O O   . PHE B 1 161 ? -3.791  37.908  17.695  1.00 31.81 ? 290 PHE B O   1 
ATOM   2705 C CB  . PHE B 1 161 ? -6.853  38.742  18.478  1.00 35.20 ? 290 PHE B CB  1 
ATOM   2706 C CG  . PHE B 1 161 ? -6.022  39.936  18.882  1.00 37.65 ? 290 PHE B CG  1 
ATOM   2707 C CD1 . PHE B 1 161 ? -5.589  40.855  17.927  1.00 38.45 ? 290 PHE B CD1 1 
ATOM   2708 C CD2 . PHE B 1 161 ? -5.712  40.174  20.224  1.00 38.88 ? 290 PHE B CD2 1 
ATOM   2709 C CE1 . PHE B 1 161 ? -4.844  41.971  18.297  1.00 39.63 ? 290 PHE B CE1 1 
ATOM   2710 C CE2 . PHE B 1 161 ? -4.968  41.291  20.601  1.00 39.30 ? 290 PHE B CE2 1 
ATOM   2711 C CZ  . PHE B 1 161 ? -4.535  42.191  19.638  1.00 39.83 ? 290 PHE B CZ  1 
ATOM   2712 N N   . ILE B 1 162 ? -5.189  37.121  16.089  1.00 33.15 ? 291 ILE B N   1 
ATOM   2713 C CA  . ILE B 1 162 ? -4.208  37.095  15.001  1.00 34.33 ? 291 ILE B CA  1 
ATOM   2714 C C   . ILE B 1 162 ? -4.605  38.103  13.927  1.00 35.03 ? 291 ILE B C   1 
ATOM   2715 O O   . ILE B 1 162 ? -5.756  38.117  13.469  1.00 33.64 ? 291 ILE B O   1 
ATOM   2716 C CB  . ILE B 1 162 ? -4.136  35.710  14.304  1.00 35.09 ? 291 ILE B CB  1 
ATOM   2717 C CG1 . ILE B 1 162 ? -4.532  34.552  15.247  1.00 35.13 ? 291 ILE B CG1 1 
ATOM   2718 C CG2 . ILE B 1 162 ? -2.775  35.508  13.639  1.00 35.27 ? 291 ILE B CG2 1 
ATOM   2719 C CD1 . ILE B 1 162 ? -3.400  33.914  16.019  1.00 35.11 ? 291 ILE B CD1 1 
ATOM   2720 N N   . ASP B 1 163 ? -3.655  38.942  13.524  1.00 36.52 ? 292 ASP B N   1 
ATOM   2721 C CA  . ASP B 1 163 ? -3.883  39.897  12.434  1.00 38.99 ? 292 ASP B CA  1 
ATOM   2722 C C   . ASP B 1 163 ? -3.822  39.167  11.087  1.00 39.12 ? 292 ASP B C   1 
ATOM   2723 O O   . ASP B 1 163 ? -2.742  38.814  10.616  1.00 37.40 ? 292 ASP B O   1 
ATOM   2724 C CB  . ASP B 1 163 ? -2.865  41.051  12.501  1.00 40.55 ? 292 ASP B CB  1 
ATOM   2725 C CG  . ASP B 1 163 ? -3.071  42.100  11.405  1.00 41.53 ? 292 ASP B CG  1 
ATOM   2726 O OD1 . ASP B 1 163 ? -4.163  42.164  10.798  1.00 42.88 ? 292 ASP B OD1 1 
ATOM   2727 O OD2 . ASP B 1 163 ? -2.128  42.877  11.156  1.00 42.22 ? 292 ASP B OD2 1 
ATOM   2728 N N   . SER B 1 164 ? -4.994  38.935  10.497  1.00 40.74 ? 293 SER B N   1 
ATOM   2729 C CA  . SER B 1 164 ? -5.139  38.230  9.213   1.00 43.20 ? 293 SER B CA  1 
ATOM   2730 C C   . SER B 1 164 ? -4.468  38.908  8.013   1.00 45.09 ? 293 SER B C   1 
ATOM   2731 O O   . SER B 1 164 ? -4.092  38.241  7.037   1.00 46.48 ? 293 SER B O   1 
ATOM   2732 C CB  . SER B 1 164 ? -6.619  38.027  8.892   1.00 43.26 ? 293 SER B CB  1 
ATOM   2733 O OG  . SER B 1 164 ? -7.153  36.965  9.648   1.00 44.57 ? 293 SER B OG  1 
ATOM   2734 N N   . ASP B 1 165 ? -4.335  40.230  8.071   1.00 44.56 ? 294 ASP B N   1 
ATOM   2735 C CA  . ASP B 1 165 ? -3.770  40.974  6.948   1.00 44.88 ? 294 ASP B CA  1 
ATOM   2736 C C   . ASP B 1 165 ? -2.250  40.840  6.857   1.00 45.65 ? 294 ASP B C   1 
ATOM   2737 O O   . ASP B 1 165 ? -1.679  41.036  5.784   1.00 46.52 ? 294 ASP B O   1 
ATOM   2738 C CB  . ASP B 1 165 ? -4.197  42.447  7.000   1.00 44.50 ? 294 ASP B CB  1 
ATOM   2739 C CG  . ASP B 1 165 ? -5.683  42.632  6.743   1.00 45.30 ? 294 ASP B CG  1 
ATOM   2740 O OD1 . ASP B 1 165 ? -6.288  41.787  6.042   1.00 45.40 ? 294 ASP B OD1 1 
ATOM   2741 O OD2 . ASP B 1 165 ? -6.250  43.627  7.243   1.00 46.55 ? 294 ASP B OD2 1 
ATOM   2742 N N   . HIS B 1 166 ? -1.605  40.493  7.970   1.00 44.99 ? 295 HIS B N   1 
ATOM   2743 C CA  . HIS B 1 166 ? -0.145  40.402  8.016   1.00 47.12 ? 295 HIS B CA  1 
ATOM   2744 C C   . HIS B 1 166 ? 0.374   39.162  7.291   1.00 47.03 ? 295 HIS B C   1 
ATOM   2745 O O   . HIS B 1 166 ? -0.089  38.041  7.533   1.00 47.85 ? 295 HIS B O   1 
ATOM   2746 C CB  . HIS B 1 166 ? 0.369   40.436  9.457   1.00 46.88 ? 295 HIS B CB  1 
ATOM   2747 C CG  . HIS B 1 166 ? 1.810   40.827  9.571   1.00 48.62 ? 295 HIS B CG  1 
ATOM   2748 N ND1 . HIS B 1 166 ? 2.214   42.033  10.102  1.00 48.74 ? 295 HIS B ND1 1 
ATOM   2749 C CD2 . HIS B 1 166 ? 2.943   40.176  9.214   1.00 49.28 ? 295 HIS B CD2 1 
ATOM   2750 C CE1 . HIS B 1 166 ? 3.533   42.106  10.073  1.00 49.98 ? 295 HIS B CE1 1 
ATOM   2751 N NE2 . HIS B 1 166 ? 4.000   40.993  9.536   1.00 49.87 ? 295 HIS B NE2 1 
ATOM   2752 N N   . THR B 1 167 ? 1.349   39.383  6.411   1.00 47.53 ? 296 THR B N   1 
ATOM   2753 C CA  . THR B 1 167 ? 1.912   38.330  5.555   1.00 46.80 ? 296 THR B CA  1 
ATOM   2754 C C   . THR B 1 167 ? 2.453   37.129  6.342   1.00 46.21 ? 296 THR B C   1 
ATOM   2755 O O   . THR B 1 167 ? 2.355   35.989  5.888   1.00 47.71 ? 296 THR B O   1 
ATOM   2756 C CB  . THR B 1 167 ? 3.001   38.887  4.598   1.00 45.82 ? 296 THR B CB  1 
ATOM   2757 O OG1 . THR B 1 167 ? 3.474   37.844  3.734   1.00 44.10 ? 296 THR B OG1 1 
ATOM   2758 C CG2 . THR B 1 167 ? 4.187   39.487  5.373   1.00 45.93 ? 296 THR B CG2 1 
ATOM   2759 N N   . ASP B 1 168 ? 2.999   37.391  7.524   1.00 45.70 ? 297 ASP B N   1 
ATOM   2760 C CA  . ASP B 1 168 ? 3.636   36.353  8.327   1.00 45.76 ? 297 ASP B CA  1 
ATOM   2761 C C   . ASP B 1 168 ? 2.649   35.431  9.046   1.00 43.45 ? 297 ASP B C   1 
ATOM   2762 O O   . ASP B 1 168 ? 3.052   34.402  9.584   1.00 44.33 ? 297 ASP B O   1 
ATOM   2763 C CB  . ASP B 1 168 ? 4.622   36.975  9.326   1.00 47.27 ? 297 ASP B CB  1 
ATOM   2764 C CG  . ASP B 1 168 ? 5.820   37.620  8.645   1.00 48.71 ? 297 ASP B CG  1 
ATOM   2765 O OD1 . ASP B 1 168 ? 6.182   37.196  7.526   1.00 49.13 ? 297 ASP B OD1 1 
ATOM   2766 O OD2 . ASP B 1 168 ? 6.406   38.554  9.236   1.00 49.91 ? 297 ASP B OD2 1 
ATOM   2767 N N   . ASN B 1 169 ? 1.368   35.798  9.046   1.00 40.77 ? 298 ASN B N   1 
ATOM   2768 C CA  . ASN B 1 169 ? 0.327   35.002  9.700   1.00 38.50 ? 298 ASN B CA  1 
ATOM   2769 C C   . ASN B 1 169 ? -0.409  34.069  8.750   1.00 37.76 ? 298 ASN B C   1 
ATOM   2770 O O   . ASN B 1 169 ? -1.246  33.261  9.182   1.00 34.98 ? 298 ASN B O   1 
ATOM   2771 C CB  . ASN B 1 169 ? -0.673  35.909  10.434  1.00 38.51 ? 298 ASN B CB  1 
ATOM   2772 C CG  . ASN B 1 169 ? -0.068  36.572  11.660  1.00 38.15 ? 298 ASN B CG  1 
ATOM   2773 O OD1 . ASN B 1 169 ? 0.885   36.059  12.253  1.00 37.81 ? 298 ASN B OD1 1 
ATOM   2774 N ND2 . ASN B 1 169 ? -0.622  37.716  12.051  1.00 35.85 ? 298 ASN B ND2 1 
ATOM   2775 N N   . GLN B 1 170 ? -0.082  34.171  7.460   1.00 36.97 ? 299 GLN B N   1 
ATOM   2776 C CA  . GLN B 1 170 ? -0.783  33.426  6.413   1.00 35.88 ? 299 GLN B CA  1 
ATOM   2777 C C   . GLN B 1 170 ? -0.680  31.905  6.566   1.00 34.88 ? 299 GLN B C   1 
ATOM   2778 O O   . GLN B 1 170 ? -1.660  31.191  6.345   1.00 34.70 ? 299 GLN B O   1 
ATOM   2779 C CB  . GLN B 1 170 ? -0.329  33.881  5.017   1.00 37.88 ? 299 GLN B CB  1 
ATOM   2780 C CG  . GLN B 1 170 ? -0.588  35.355  4.709   1.00 38.08 ? 299 GLN B CG  1 
ATOM   2781 C CD  . GLN B 1 170 ? -1.959  35.836  5.167   1.00 38.91 ? 299 GLN B CD  1 
ATOM   2782 O OE1 . GLN B 1 170 ? -2.995  35.372  4.678   1.00 39.80 ? 299 GLN B OE1 1 
ATOM   2783 N NE2 . GLN B 1 170 ? -1.969  36.768  6.116   1.00 38.21 ? 299 GLN B NE2 1 
ATOM   2784 N N   . ARG B 1 171 ? 0.494   31.422  6.969   1.00 34.54 ? 300 ARG B N   1 
ATOM   2785 C CA  . ARG B 1 171 ? 0.718   29.991  7.222   1.00 35.43 ? 300 ARG B CA  1 
ATOM   2786 C C   . ARG B 1 171 ? -0.169  29.455  8.357   1.00 34.56 ? 300 ARG B C   1 
ATOM   2787 O O   . ARG B 1 171 ? -0.631  28.311  8.301   1.00 33.91 ? 300 ARG B O   1 
ATOM   2788 C CB  . ARG B 1 171 ? 2.201   29.715  7.517   1.00 36.68 ? 300 ARG B CB  1 
ATOM   2789 C CG  . ARG B 1 171 ? 2.656   28.281  7.265   1.00 39.03 ? 300 ARG B CG  1 
ATOM   2790 C CD  . ARG B 1 171 ? 2.768   27.949  5.782   1.00 40.81 ? 300 ARG B CD  1 
ATOM   2791 N NE  . ARG B 1 171 ? 3.352   26.626  5.561   1.00 44.27 ? 300 ARG B NE  1 
ATOM   2792 C CZ  . ARG B 1 171 ? 3.043   25.815  4.546   1.00 46.91 ? 300 ARG B CZ  1 
ATOM   2793 N NH1 . ARG B 1 171 ? 2.136   26.174  3.644   1.00 47.70 ? 300 ARG B NH1 1 
ATOM   2794 N NH2 . ARG B 1 171 ? 3.634   24.630  4.436   1.00 47.49 ? 300 ARG B NH2 1 
ATOM   2795 N N   . ILE B 1 172 ? -0.400  30.282  9.376   1.00 33.34 ? 301 ILE B N   1 
ATOM   2796 C CA  . ILE B 1 172 ? -1.336  29.937  10.447  1.00 33.61 ? 301 ILE B CA  1 
ATOM   2797 C C   . ILE B 1 172 ? -2.780  29.902  9.930   1.00 32.99 ? 301 ILE B C   1 
ATOM   2798 O O   . ILE B 1 172 ? -3.557  29.017  10.311  1.00 33.01 ? 301 ILE B O   1 
ATOM   2799 C CB  . ILE B 1 172 ? -1.210  30.880  11.668  1.00 33.20 ? 301 ILE B CB  1 
ATOM   2800 C CG1 . ILE B 1 172 ? 0.184   30.759  12.285  1.00 33.73 ? 301 ILE B CG1 1 
ATOM   2801 C CG2 . ILE B 1 172 ? -2.263  30.543  12.716  1.00 32.87 ? 301 ILE B CG2 1 
ATOM   2802 C CD1 . ILE B 1 172 ? 0.528   31.894  13.224  1.00 34.35 ? 301 ILE B CD1 1 
ATOM   2803 N N   . LEU B 1 173 ? -3.134  30.851  9.062   1.00 32.76 ? 302 LEU B N   1 
ATOM   2804 C CA  . LEU B 1 173 ? -4.429  30.797  8.373   1.00 34.01 ? 302 LEU B CA  1 
ATOM   2805 C C   . LEU B 1 173 ? -4.591  29.481  7.609   1.00 33.46 ? 302 LEU B C   1 
ATOM   2806 O O   . LEU B 1 173 ? -5.629  28.832  7.725   1.00 35.51 ? 302 LEU B O   1 
ATOM   2807 C CB  . LEU B 1 173 ? -4.642  32.004  7.445   1.00 33.53 ? 302 LEU B CB  1 
ATOM   2808 C CG  . LEU B 1 173 ? -5.411  33.231  7.954   1.00 33.44 ? 302 LEU B CG  1 
ATOM   2809 C CD1 . LEU B 1 173 ? -4.626  34.009  9.000   1.00 33.88 ? 302 LEU B CD1 1 
ATOM   2810 C CD2 . LEU B 1 173 ? -5.764  34.141  6.785   1.00 33.91 ? 302 LEU B CD2 1 
ATOM   2811 N N   . GLU B 1 174 ? -3.556  29.089  6.858   1.00 33.86 ? 303 GLU B N   1 
ATOM   2812 C CA  . GLU B 1 174 ? -3.532  27.811  6.120   1.00 35.03 ? 303 GLU B CA  1 
ATOM   2813 C C   . GLU B 1 174 ? -3.648  26.606  7.051   1.00 34.66 ? 303 GLU B C   1 
ATOM   2814 O O   . GLU B 1 174 ? -4.374  25.662  6.752   1.00 34.63 ? 303 GLU B O   1 
ATOM   2815 C CB  . GLU B 1 174 ? -2.244  27.656  5.301   1.00 36.24 ? 303 GLU B CB  1 
ATOM   2816 C CG  . GLU B 1 174 ? -2.073  28.580  4.107   1.00 38.95 ? 303 GLU B CG  1 
ATOM   2817 C CD  . GLU B 1 174 ? -0.733  28.371  3.413   1.00 42.29 ? 303 GLU B CD  1 
ATOM   2818 O OE1 . GLU B 1 174 ? -0.316  27.203  3.237   1.00 42.80 ? 303 GLU B OE1 1 
ATOM   2819 O OE2 . GLU B 1 174 ? -0.087  29.373  3.041   1.00 44.02 ? 303 GLU B OE2 1 
ATOM   2820 N N   . PHE B 1 175 ? -2.910  26.642  8.163   1.00 33.91 ? 304 PHE B N   1 
ATOM   2821 C CA  . PHE B 1 175 ? -2.908  25.562  9.150   1.00 34.19 ? 304 PHE B CA  1 
ATOM   2822 C C   . PHE B 1 175 ? -4.320  25.262  9.659   1.00 34.79 ? 304 PHE B C   1 
ATOM   2823 O O   . PHE B 1 175 ? -4.673  24.104  9.868   1.00 34.30 ? 304 PHE B O   1 
ATOM   2824 C CB  . PHE B 1 175 ? -1.979  25.911  10.322  1.00 34.69 ? 304 PHE B CB  1 
ATOM   2825 C CG  . PHE B 1 175 ? -1.718  24.763  11.265  1.00 35.56 ? 304 PHE B CG  1 
ATOM   2826 C CD1 . PHE B 1 175 ? -0.662  23.879  11.037  1.00 36.07 ? 304 PHE B CD1 1 
ATOM   2827 C CD2 . PHE B 1 175 ? -2.515  24.573  12.394  1.00 35.88 ? 304 PHE B CD2 1 
ATOM   2828 C CE1 . PHE B 1 175 ? -0.419  22.821  11.907  1.00 35.67 ? 304 PHE B CE1 1 
ATOM   2829 C CE2 . PHE B 1 175 ? -2.275  23.518  13.266  1.00 35.87 ? 304 PHE B CE2 1 
ATOM   2830 C CZ  . PHE B 1 175 ? -1.227  22.640  13.020  1.00 35.53 ? 304 PHE B CZ  1 
ATOM   2831 N N   . PHE B 1 176 ? -5.122  26.310  9.841   1.00 36.12 ? 305 PHE B N   1 
ATOM   2832 C CA  . PHE B 1 176 ? -6.493  26.162  10.332  1.00 36.90 ? 305 PHE B CA  1 
ATOM   2833 C C   . PHE B 1 176 ? -7.529  26.252  9.207   1.00 38.67 ? 305 PHE B C   1 
ATOM   2834 O O   . PHE B 1 176 ? -8.720  26.474  9.457   1.00 39.31 ? 305 PHE B O   1 
ATOM   2835 C CB  . PHE B 1 176 ? -6.773  27.178  11.450  1.00 36.18 ? 305 PHE B CB  1 
ATOM   2836 C CG  . PHE B 1 176 ? -5.938  26.960  12.686  1.00 36.08 ? 305 PHE B CG  1 
ATOM   2837 C CD1 . PHE B 1 176 ? -6.333  26.046  13.659  1.00 35.70 ? 305 PHE B CD1 1 
ATOM   2838 C CD2 . PHE B 1 176 ? -4.743  27.653  12.869  1.00 35.44 ? 305 PHE B CD2 1 
ATOM   2839 C CE1 . PHE B 1 176 ? -5.558  25.836  14.790  1.00 35.77 ? 305 PHE B CE1 1 
ATOM   2840 C CE2 . PHE B 1 176 ? -3.965  27.447  14.001  1.00 35.48 ? 305 PHE B CE2 1 
ATOM   2841 C CZ  . PHE B 1 176 ? -4.373  26.538  14.963  1.00 35.36 ? 305 PHE B CZ  1 
ATOM   2842 N N   . GLY B 1 177 ? -7.061  26.062  7.973   1.00 40.06 ? 306 GLY B N   1 
ATOM   2843 C CA  . GLY B 1 177 ? -7.918  26.060  6.785   1.00 40.58 ? 306 GLY B CA  1 
ATOM   2844 C C   . GLY B 1 177 ? -8.712  27.340  6.615   1.00 40.68 ? 306 GLY B C   1 
ATOM   2845 O O   . GLY B 1 177 ? -9.934  27.309  6.505   1.00 40.67 ? 306 GLY B O   1 
ATOM   2846 N N   . LEU B 1 178 ? -8.015  28.470  6.610   1.00 41.75 ? 307 LEU B N   1 
ATOM   2847 C CA  . LEU B 1 178 ? -8.669  29.765  6.455   1.00 42.88 ? 307 LEU B CA  1 
ATOM   2848 C C   . LEU B 1 178 ? -8.097  30.576  5.305   1.00 43.82 ? 307 LEU B C   1 
ATOM   2849 O O   . LEU B 1 178 ? -6.886  30.589  5.074   1.00 43.50 ? 307 LEU B O   1 
ATOM   2850 C CB  . LEU B 1 178 ? -8.594  30.581  7.752   1.00 43.27 ? 307 LEU B CB  1 
ATOM   2851 C CG  . LEU B 1 178 ? -9.635  30.335  8.853   1.00 42.43 ? 307 LEU B CG  1 
ATOM   2852 C CD1 . LEU B 1 178 ? -9.192  31.022  10.133  1.00 41.36 ? 307 LEU B CD1 1 
ATOM   2853 C CD2 . LEU B 1 178 ? -11.023 30.816  8.445   1.00 41.78 ? 307 LEU B CD2 1 
ATOM   2854 N N   . LYS B 1 179 ? -8.991  31.242  4.583   1.00 46.63 ? 308 LYS B N   1 
ATOM   2855 C CA  . LYS B 1 179 ? -8.610  32.225  3.580   1.00 49.77 ? 308 LYS B CA  1 
ATOM   2856 C C   . LYS B 1 179 ? -8.805  33.609  4.186   1.00 49.91 ? 308 LYS B C   1 
ATOM   2857 O O   . LYS B 1 179 ? -9.664  33.784  5.052   1.00 51.99 ? 308 LYS B O   1 
ATOM   2858 C CB  . LYS B 1 179 ? -9.457  32.061  2.310   1.00 51.34 ? 308 LYS B CB  1 
ATOM   2859 C CG  . LYS B 1 179 ? -9.072  30.880  1.422   1.00 52.38 ? 308 LYS B CG  1 
ATOM   2860 C CD  . LYS B 1 179 ? -7.686  31.069  0.811   1.00 54.74 ? 308 LYS B CD  1 
ATOM   2861 C CE  . LYS B 1 179 ? -7.433  30.128  -0.357  1.00 55.40 ? 308 LYS B CE  1 
ATOM   2862 N NZ  . LYS B 1 179 ? -8.166  30.559  -1.582  1.00 55.88 ? 308 LYS B NZ  1 
ATOM   2863 N N   . LYS B 1 180 ? -8.013  34.583  3.738   1.00 49.75 ? 309 LYS B N   1 
ATOM   2864 C CA  . LYS B 1 180 ? -8.104  35.958  4.250   1.00 50.07 ? 309 LYS B CA  1 
ATOM   2865 C C   . LYS B 1 180 ? -9.517  36.562  4.235   1.00 52.63 ? 309 LYS B C   1 
ATOM   2866 O O   . LYS B 1 180 ? -9.840  37.399  5.082   1.00 53.99 ? 309 LYS B O   1 
ATOM   2867 C CB  . LYS B 1 180 ? -7.138  36.886  3.510   1.00 49.22 ? 309 LYS B CB  1 
ATOM   2868 C CG  . LYS B 1 180 ? -5.838  37.141  4.253   1.00 48.51 ? 309 LYS B CG  1 
ATOM   2869 C CD  . LYS B 1 180 ? -5.340  38.562  4.035   1.00 48.27 ? 309 LYS B CD  1 
ATOM   2870 C CE  . LYS B 1 180 ? -4.382  38.667  2.860   1.00 48.85 ? 309 LYS B CE  1 
ATOM   2871 N NZ  . LYS B 1 180 ? -3.962  40.077  2.629   1.00 47.58 ? 309 LYS B NZ  1 
ATOM   2872 N N   . GLU B 1 181 ? -10.348 36.128  3.285   1.00 53.29 ? 310 GLU B N   1 
ATOM   2873 C CA  . GLU B 1 181 ? -11.709 36.658  3.120   1.00 53.02 ? 310 GLU B CA  1 
ATOM   2874 C C   . GLU B 1 181 ? -12.730 35.967  4.028   1.00 53.50 ? 310 GLU B C   1 
ATOM   2875 O O   . GLU B 1 181 ? -13.881 36.402  4.114   1.00 53.11 ? 310 GLU B O   1 
ATOM   2876 C CB  . GLU B 1 181 ? -12.167 36.578  1.655   1.00 52.91 ? 310 GLU B CB  1 
ATOM   2877 C CG  . GLU B 1 181 ? -11.154 37.080  0.632   1.00 53.27 ? 310 GLU B CG  1 
ATOM   2878 C CD  . GLU B 1 181 ? -10.115 36.031  0.274   1.00 54.17 ? 310 GLU B CD  1 
ATOM   2879 O OE1 . GLU B 1 181 ? -10.464 34.831  0.243   1.00 55.69 ? 310 GLU B OE1 1 
ATOM   2880 O OE2 . GLU B 1 181 ? -8.947  36.401  0.028   1.00 54.23 ? 310 GLU B OE2 1 
ATOM   2881 N N   . GLU B 1 182 ? -12.308 34.896  4.699   1.00 52.82 ? 311 GLU B N   1 
ATOM   2882 C CA  . GLU B 1 182 ? -13.163 34.191  5.657   1.00 53.23 ? 311 GLU B CA  1 
ATOM   2883 C C   . GLU B 1 182 ? -13.084 34.804  7.054   1.00 51.37 ? 311 GLU B C   1 
ATOM   2884 O O   . GLU B 1 182 ? -13.781 34.367  7.970   1.00 53.25 ? 311 GLU B O   1 
ATOM   2885 C CB  . GLU B 1 182 ? -12.791 32.711  5.727   1.00 55.52 ? 311 GLU B CB  1 
ATOM   2886 C CG  . GLU B 1 182 ? -13.164 31.899  4.501   1.00 59.47 ? 311 GLU B CG  1 
ATOM   2887 C CD  . GLU B 1 182 ? -12.658 30.471  4.586   1.00 62.69 ? 311 GLU B CD  1 
ATOM   2888 O OE1 . GLU B 1 182 ? -11.424 30.277  4.644   1.00 63.63 ? 311 GLU B OE1 1 
ATOM   2889 O OE2 . GLU B 1 182 ? -13.496 29.541  4.594   1.00 64.07 ? 311 GLU B OE2 1 
ATOM   2890 N N   . CYS B 1 183 ? -12.230 35.812  7.205   1.00 50.76 ? 312 CYS B N   1 
ATOM   2891 C CA  . CYS B 1 183 ? -11.994 36.475  8.491   1.00 49.98 ? 312 CYS B CA  1 
ATOM   2892 C C   . CYS B 1 183 ? -12.827 37.764  8.642   1.00 50.19 ? 312 CYS B C   1 
ATOM   2893 O O   . CYS B 1 183 ? -13.125 38.421  7.641   1.00 48.14 ? 312 CYS B O   1 
ATOM   2894 C CB  . CYS B 1 183 ? -10.498 36.774  8.654   1.00 48.69 ? 312 CYS B CB  1 
ATOM   2895 S SG  . CYS B 1 183 ? -9.445  35.302  8.626   1.00 46.73 ? 312 CYS B SG  1 
ATOM   2896 N N   . PRO B 1 184 ? -13.204 38.136  9.889   1.00 50.21 ? 313 PRO B N   1 
ATOM   2897 C CA  . PRO B 1 184 ? -12.923 37.507  11.192  1.00 48.84 ? 313 PRO B CA  1 
ATOM   2898 C C   . PRO B 1 184 ? -13.491 36.100  11.361  1.00 47.39 ? 313 PRO B C   1 
ATOM   2899 O O   . PRO B 1 184 ? -14.631 35.831  10.968  1.00 47.79 ? 313 PRO B O   1 
ATOM   2900 C CB  . PRO B 1 184 ? -13.575 38.466  12.200  1.00 49.59 ? 313 PRO B CB  1 
ATOM   2901 C CG  . PRO B 1 184 ? -14.579 39.237  11.409  1.00 49.94 ? 313 PRO B CG  1 
ATOM   2902 C CD  . PRO B 1 184 ? -13.950 39.397  10.058  1.00 50.04 ? 313 PRO B CD  1 
ATOM   2903 N N   . ALA B 1 185 ? -12.677 35.219  11.941  1.00 45.36 ? 314 ALA B N   1 
ATOM   2904 C CA  . ALA B 1 185 ? -13.054 33.831  12.210  1.00 44.24 ? 314 ALA B CA  1 
ATOM   2905 C C   . ALA B 1 185 ? -12.554 33.413  13.591  1.00 43.51 ? 314 ALA B C   1 
ATOM   2906 O O   . ALA B 1 185 ? -11.644 34.032  14.140  1.00 41.82 ? 314 ALA B O   1 
ATOM   2907 C CB  . ALA B 1 185 ? -12.492 32.908  11.136  1.00 43.87 ? 314 ALA B CB  1 
ATOM   2908 N N   . VAL B 1 186 ? -13.155 32.358  14.136  1.00 43.53 ? 315 VAL B N   1 
ATOM   2909 C CA  . VAL B 1 186 ? -12.872 31.894  15.493  1.00 43.04 ? 315 VAL B CA  1 
ATOM   2910 C C   . VAL B 1 186 ? -12.532 30.400  15.489  1.00 42.39 ? 315 VAL B C   1 
ATOM   2911 O O   . VAL B 1 186 ? -13.300 29.580  14.984  1.00 43.59 ? 315 VAL B O   1 
ATOM   2912 C CB  . VAL B 1 186 ? -14.076 32.158  16.434  1.00 42.95 ? 315 VAL B CB  1 
ATOM   2913 C CG1 . VAL B 1 186 ? -13.903 31.448  17.768  1.00 42.85 ? 315 VAL B CG1 1 
ATOM   2914 C CG2 . VAL B 1 186 ? -14.278 33.649  16.654  1.00 41.81 ? 315 VAL B CG2 1 
ATOM   2915 N N   . ARG B 1 187 ? -11.376 30.057  16.046  1.00 41.56 ? 316 ARG B N   1 
ATOM   2916 C CA  . ARG B 1 187 ? -10.966 28.661  16.183  1.00 40.58 ? 316 ARG B CA  1 
ATOM   2917 C C   . ARG B 1 187 ? -10.622 28.376  17.634  1.00 39.20 ? 316 ARG B C   1 
ATOM   2918 O O   . ARG B 1 187 ? -9.707  28.984  18.175  1.00 37.51 ? 316 ARG B O   1 
ATOM   2919 C CB  . ARG B 1 187 ? -9.748  28.354  15.303  1.00 40.73 ? 316 ARG B CB  1 
ATOM   2920 C CG  . ARG B 1 187 ? -9.993  28.440  13.804  1.00 42.77 ? 316 ARG B CG  1 
ATOM   2921 C CD  . ARG B 1 187 ? -10.747 27.228  13.272  1.00 43.28 ? 316 ARG B CD  1 
ATOM   2922 N NE  . ARG B 1 187 ? -10.963 27.322  11.826  1.00 44.89 ? 316 ARG B NE  1 
ATOM   2923 C CZ  . ARG B 1 187 ? -12.026 27.878  11.247  1.00 43.83 ? 316 ARG B CZ  1 
ATOM   2924 N NH1 . ARG B 1 187 ? -13.005 28.407  11.977  1.00 42.11 ? 316 ARG B NH1 1 
ATOM   2925 N NH2 . ARG B 1 187 ? -12.104 27.909  9.925   1.00 43.35 ? 316 ARG B NH2 1 
ATOM   2926 N N   . LEU B 1 188 ? -11.356 27.458  18.257  1.00 39.38 ? 317 LEU B N   1 
ATOM   2927 C CA  . LEU B 1 188 ? -11.088 27.048  19.638  1.00 40.76 ? 317 LEU B CA  1 
ATOM   2928 C C   . LEU B 1 188 ? -10.249 25.764  19.653  1.00 40.35 ? 317 LEU B C   1 
ATOM   2929 O O   . LEU B 1 188 ? -10.619 24.782  19.013  1.00 41.91 ? 317 LEU B O   1 
ATOM   2930 C CB  . LEU B 1 188 ? -12.408 26.817  20.379  1.00 41.13 ? 317 LEU B CB  1 
ATOM   2931 C CG  . LEU B 1 188 ? -12.670 27.437  21.759  1.00 42.16 ? 317 LEU B CG  1 
ATOM   2932 C CD1 . LEU B 1 188 ? -13.778 26.665  22.466  1.00 41.68 ? 317 LEU B CD1 1 
ATOM   2933 C CD2 . LEU B 1 188 ? -11.427 27.477  22.630  1.00 41.20 ? 317 LEU B CD2 1 
ATOM   2934 N N   . ILE B 1 189 ? -9.123  25.775  20.370  1.00 40.04 ? 318 ILE B N   1 
ATOM   2935 C CA  . ILE B 1 189 ? -8.204  24.622  20.394  1.00 39.97 ? 318 ILE B CA  1 
ATOM   2936 C C   . ILE B 1 189 ? -7.748  24.204  21.802  1.00 41.82 ? 318 ILE B C   1 
ATOM   2937 O O   . ILE B 1 189 ? -7.659  25.030  22.710  1.00 42.36 ? 318 ILE B O   1 
ATOM   2938 C CB  . ILE B 1 189 ? -6.949  24.832  19.497  1.00 38.67 ? 318 ILE B CB  1 
ATOM   2939 C CG1 . ILE B 1 189 ? -6.010  25.890  20.088  1.00 38.28 ? 318 ILE B CG1 1 
ATOM   2940 C CG2 . ILE B 1 189 ? -7.338  25.177  18.060  1.00 38.92 ? 318 ILE B CG2 1 
ATOM   2941 C CD1 . ILE B 1 189 ? -4.587  25.824  19.575  1.00 36.31 ? 318 ILE B CD1 1 
ATOM   2942 N N   . THR B 1 190 ? -7.461  22.916  21.970  1.00 42.94 ? 319 THR B N   1 
ATOM   2943 C CA  . THR B 1 190 ? -6.849  22.413  23.197  1.00 43.88 ? 319 THR B CA  1 
ATOM   2944 C C   . THR B 1 190 ? -5.431  21.954  22.890  1.00 45.90 ? 319 THR B C   1 
ATOM   2945 O O   . THR B 1 190 ? -5.224  21.109  22.021  1.00 45.47 ? 319 THR B O   1 
ATOM   2946 C CB  . THR B 1 190 ? -7.660  21.257  23.816  1.00 42.99 ? 319 THR B CB  1 
ATOM   2947 O OG1 . THR B 1 190 ? -9.018  21.670  23.995  1.00 42.03 ? 319 THR B OG1 1 
ATOM   2948 C CG2 . THR B 1 190 ? -7.087  20.852  25.172  1.00 43.47 ? 319 THR B CG2 1 
ATOM   2949 N N   . LEU B 1 191 ? -4.462  22.525  23.601  1.00 49.42 ? 320 LEU B N   1 
ATOM   2950 C CA  . LEU B 1 191 ? -3.058  22.177  23.420  1.00 52.74 ? 320 LEU B CA  1 
ATOM   2951 C C   . LEU B 1 191 ? -2.563  21.172  24.453  1.00 55.74 ? 320 LEU B C   1 
ATOM   2952 O O   . LEU B 1 191 ? -3.094  21.089  25.561  1.00 56.59 ? 320 LEU B O   1 
ATOM   2953 C CB  . LEU B 1 191 ? -2.178  23.429  23.432  1.00 55.08 ? 320 LEU B CB  1 
ATOM   2954 C CG  . LEU B 1 191 ? -2.121  24.226  22.124  1.00 55.56 ? 320 LEU B CG  1 
ATOM   2955 C CD1 . LEU B 1 191 ? -1.339  25.517  22.318  1.00 57.19 ? 320 LEU B CD1 1 
ATOM   2956 C CD2 . LEU B 1 191 ? -1.514  23.399  20.999  1.00 55.27 ? 320 LEU B CD2 1 
ATOM   2957 N N   . GLU B 1 192 ? -1.542  20.412  24.063  1.00 58.44 ? 321 GLU B N   1 
ATOM   2958 C CA  . GLU B 1 192 ? -0.969  19.342  24.875  1.00 61.37 ? 321 GLU B CA  1 
ATOM   2959 C C   . GLU B 1 192 ? 0.526   19.254  24.572  1.00 60.39 ? 321 GLU B C   1 
ATOM   2960 O O   . GLU B 1 192 ? 1.300   18.693  25.344  1.00 59.33 ? 321 GLU B O   1 
ATOM   2961 C CB  . GLU B 1 192 ? -1.651  18.001  24.555  1.00 64.45 ? 321 GLU B CB  1 
ATOM   2962 C CG  . GLU B 1 192 ? -3.109  17.888  24.999  1.00 66.58 ? 321 GLU B CG  1 
ATOM   2963 C CD  . GLU B 1 192 ? -4.012  17.266  23.943  1.00 68.13 ? 321 GLU B CD  1 
ATOM   2964 O OE1 . GLU B 1 192 ? -5.060  17.870  23.625  1.00 67.34 ? 321 GLU B OE1 1 
ATOM   2965 O OE2 . GLU B 1 192 ? -3.680  16.182  23.420  1.00 69.43 ? 321 GLU B OE2 1 
ATOM   2966 N N   . GLU B 1 208 ? 9.360   5.319   19.265  1.00 63.36 ? 337 GLU B N   1 
ATOM   2967 C CA  . GLU B 1 208 ? 7.905   5.362   19.336  1.00 64.77 ? 337 GLU B CA  1 
ATOM   2968 C C   . GLU B 1 208 ? 7.393   5.441   20.785  1.00 69.60 ? 337 GLU B C   1 
ATOM   2969 O O   . GLU B 1 208 ? 6.426   4.761   21.156  1.00 70.80 ? 337 GLU B O   1 
ATOM   2970 C CB  . GLU B 1 208 ? 7.302   4.172   18.601  1.00 62.34 ? 337 GLU B CB  1 
ATOM   2971 N N   . ARG B 1 209 ? 8.051   6.279   21.591  1.00 69.86 ? 338 ARG B N   1 
ATOM   2972 C CA  . ARG B 1 209 ? 7.588   6.619   22.944  1.00 67.45 ? 338 ARG B CA  1 
ATOM   2973 C C   . ARG B 1 209 ? 6.477   7.670   22.869  1.00 67.16 ? 338 ARG B C   1 
ATOM   2974 O O   . ARG B 1 209 ? 6.064   8.238   23.885  1.00 66.03 ? 338 ARG B O   1 
ATOM   2975 C CB  . ARG B 1 209 ? 8.747   7.123   23.794  1.00 64.80 ? 338 ARG B CB  1 
ATOM   2976 N N   . ILE B 1 210 ? 6.010   7.918   21.646  1.00 66.30 ? 339 ILE B N   1 
ATOM   2977 C CA  . ILE B 1 210 ? 4.919   8.849   21.367  1.00 65.61 ? 339 ILE B CA  1 
ATOM   2978 C C   . ILE B 1 210 ? 3.547   8.193   21.547  1.00 65.13 ? 339 ILE B C   1 
ATOM   2979 O O   . ILE B 1 210 ? 2.535   8.887   21.681  1.00 64.69 ? 339 ILE B O   1 
ATOM   2980 C CB  . ILE B 1 210 ? 5.040   9.465   19.950  1.00 65.77 ? 339 ILE B CB  1 
ATOM   2981 C CG1 . ILE B 1 210 ? 5.255   8.375   18.891  1.00 64.30 ? 339 ILE B CG1 1 
ATOM   2982 C CG2 . ILE B 1 210 ? 6.166   10.493  19.914  1.00 66.76 ? 339 ILE B CG2 1 
ATOM   2983 C CD1 . ILE B 1 210 ? 5.210   8.865   17.459  1.00 62.74 ? 339 ILE B CD1 1 
ATOM   2984 N N   . THR B 1 211 ? 3.521   6.861   21.552  1.00 64.06 ? 340 THR B N   1 
ATOM   2985 C CA  . THR B 1 211 ? 2.304   6.100   21.850  1.00 63.89 ? 340 THR B CA  1 
ATOM   2986 C C   . THR B 1 211 ? 1.831   6.407   23.276  1.00 63.87 ? 340 THR B C   1 
ATOM   2987 O O   . THR B 1 211 ? 0.628   6.546   23.522  1.00 62.65 ? 340 THR B O   1 
ATOM   2988 C CB  . THR B 1 211 ? 2.518   4.579   21.670  1.00 63.52 ? 340 THR B CB  1 
ATOM   2989 O OG1 . THR B 1 211 ? 3.134   4.324   20.401  1.00 63.47 ? 340 THR B OG1 1 
ATOM   2990 C CG2 . THR B 1 211 ? 1.192   3.827   21.736  1.00 63.50 ? 340 THR B CG2 1 
ATOM   2991 N N   . GLU B 1 212 ? 2.788   6.527   24.199  1.00 62.33 ? 341 GLU B N   1 
ATOM   2992 C CA  . GLU B 1 212 ? 2.512   6.918   25.584  1.00 61.69 ? 341 GLU B CA  1 
ATOM   2993 C C   . GLU B 1 212 ? 2.029   8.366   25.675  1.00 60.84 ? 341 GLU B C   1 
ATOM   2994 O O   . GLU B 1 212 ? 1.148   8.684   26.477  1.00 59.51 ? 341 GLU B O   1 
ATOM   2995 C CB  . GLU B 1 212 ? 3.746   6.709   26.454  1.00 61.68 ? 341 GLU B CB  1 
ATOM   2996 N N   . PHE B 1 213 ? 2.608   9.233   24.844  1.00 60.37 ? 342 PHE B N   1 
ATOM   2997 C CA  . PHE B 1 213 ? 2.234   10.647  24.795  1.00 59.98 ? 342 PHE B CA  1 
ATOM   2998 C C   . PHE B 1 213 ? 0.791   10.849  24.325  1.00 58.31 ? 342 PHE B C   1 
ATOM   2999 O O   . PHE B 1 213 ? 0.118   11.780  24.769  1.00 57.42 ? 342 PHE B O   1 
ATOM   3000 C CB  . PHE B 1 213 ? 3.199   11.426  23.913  1.00 59.01 ? 342 PHE B CB  1 
ATOM   3001 N N   . CYS B 1 214 ? 0.328   9.968   23.437  1.00 56.62 ? 343 CYS B N   1 
ATOM   3002 C CA  . CYS B 1 214 ? -1.026  10.032  22.885  1.00 55.35 ? 343 CYS B CA  1 
ATOM   3003 C C   . CYS B 1 214 ? -2.107  9.635   23.896  1.00 56.00 ? 343 CYS B C   1 
ATOM   3004 O O   . CYS B 1 214 ? -3.181  10.241  23.921  1.00 57.08 ? 343 CYS B O   1 
ATOM   3005 C CB  . CYS B 1 214 ? -1.141  9.149   21.640  1.00 55.58 ? 343 CYS B CB  1 
ATOM   3006 S SG  . CYS B 1 214 ? -0.273  9.739   20.165  1.00 55.13 ? 343 CYS B SG  1 
ATOM   3007 N N   . HIS B 1 215 ? -1.822  8.614   24.710  1.00 55.36 ? 344 HIS B N   1 
ATOM   3008 C CA  . HIS B 1 215 ? -2.757  8.128   25.738  1.00 54.80 ? 344 HIS B CA  1 
ATOM   3009 C C   . HIS B 1 215 ? -2.975  9.140   26.856  1.00 54.03 ? 344 HIS B C   1 
ATOM   3010 O O   . HIS B 1 215 ? -4.113  9.379   27.257  1.00 52.94 ? 344 HIS B O   1 
ATOM   3011 C CB  . HIS B 1 215 ? -2.283  6.801   26.348  1.00 53.60 ? 344 HIS B CB  1 
ATOM   3012 C CG  . HIS B 1 215 ? -2.539  5.606   25.484  1.00 52.57 ? 344 HIS B CG  1 
ATOM   3013 N ND1 . HIS B 1 215 ? -1.543  4.724   25.123  1.00 52.51 ? 344 HIS B ND1 1 
ATOM   3014 C CD2 . HIS B 1 215 ? -3.677  5.142   24.914  1.00 52.74 ? 344 HIS B CD2 1 
ATOM   3015 C CE1 . HIS B 1 215 ? -2.056  3.770   24.366  1.00 52.49 ? 344 HIS B CE1 1 
ATOM   3016 N NE2 . HIS B 1 215 ? -3.349  3.999   24.225  1.00 52.25 ? 344 HIS B NE2 1 
ATOM   3017 N N   . ARG B 1 216 ? -1.882  9.719   27.356  1.00 54.21 ? 345 ARG B N   1 
ATOM   3018 C CA  . ARG B 1 216 ? -1.939  10.709  28.438  1.00 55.82 ? 345 ARG B CA  1 
ATOM   3019 C C   . ARG B 1 216 ? -2.731  11.950  28.035  1.00 56.90 ? 345 ARG B C   1 
ATOM   3020 O O   . ARG B 1 216 ? -3.416  12.555  28.865  1.00 57.95 ? 345 ARG B O   1 
ATOM   3021 C CB  . ARG B 1 216 ? -0.538  11.093  28.890  1.00 54.88 ? 345 ARG B CB  1 
ATOM   3022 N N   . PHE B 1 217 ? -2.630  12.314  26.756  1.00 56.53 ? 346 PHE B N   1 
ATOM   3023 C CA  . PHE B 1 217 ? -3.369  13.441  26.187  1.00 55.52 ? 346 PHE B CA  1 
ATOM   3024 C C   . PHE B 1 217 ? -4.861  13.126  26.051  1.00 54.90 ? 346 PHE B C   1 
ATOM   3025 O O   . PHE B 1 217 ? -5.710  13.992  26.289  1.00 53.25 ? 346 PHE B O   1 
ATOM   3026 C CB  . PHE B 1 217 ? -2.776  13.830  24.844  1.00 54.74 ? 346 PHE B CB  1 
ATOM   3027 N N   . LEU B 1 218 ? -5.166  11.888  25.663  1.00 54.58 ? 347 LEU B N   1 
ATOM   3028 C CA  . LEU B 1 218 ? -6.537  11.382  25.654  1.00 54.83 ? 347 LEU B CA  1 
ATOM   3029 C C   . LEU B 1 218 ? -6.977  11.033  27.079  1.00 54.49 ? 347 LEU B C   1 
ATOM   3030 O O   . LEU B 1 218 ? -8.162  10.838  27.348  1.00 54.22 ? 347 LEU B O   1 
ATOM   3031 C CB  . LEU B 1 218 ? -6.661  10.151  24.744  1.00 54.58 ? 347 LEU B CB  1 
ATOM   3032 C CG  . LEU B 1 218 ? -6.628  10.299  23.217  1.00 53.48 ? 347 LEU B CG  1 
ATOM   3033 C CD1 . LEU B 1 218 ? -6.538  8.926   22.569  1.00 53.71 ? 347 LEU B CD1 1 
ATOM   3034 C CD2 . LEU B 1 218 ? -7.836  11.054  22.677  1.00 52.44 ? 347 LEU B CD2 1 
HETATM 3035 O O   . HOH C 2 .   ? -13.908 16.233  -9.005  1.00 43.73 ? 401 HOH A O   1 
HETATM 3036 O O   . HOH C 2 .   ? -20.654 -5.376  -0.605  1.00 40.75 ? 402 HOH A O   1 
HETATM 3037 O O   . HOH C 2 .   ? 6.557   19.965  5.562   1.00 20.89 ? 403 HOH A O   1 
HETATM 3038 O O   . HOH C 2 .   ? 9.976   30.498  2.767   1.00 21.43 ? 404 HOH A O   1 
HETATM 3039 O O   . HOH C 2 .   ? -7.349  7.325   5.593   1.00 26.77 ? 405 HOH A O   1 
HETATM 3040 O O   . HOH C 2 .   ? -14.435 23.723  24.738  1.00 40.16 ? 406 HOH A O   1 
HETATM 3041 O O   . HOH C 2 .   ? -18.406 -6.859  -5.849  1.00 46.37 ? 407 HOH A O   1 
HETATM 3042 O O   . HOH C 2 .   ? 7.687   30.736  19.939  1.00 40.72 ? 408 HOH A O   1 
HETATM 3043 O O   . HOH C 2 .   ? 2.800   3.535   1.377   1.00 38.90 ? 409 HOH A O   1 
HETATM 3044 O O   . HOH C 2 .   ? -18.049 21.992  -8.162  1.00 34.91 ? 410 HOH A O   1 
HETATM 3045 O O   . HOH C 2 .   ? -15.777 26.184  11.355  1.00 45.09 ? 411 HOH A O   1 
HETATM 3046 O O   . HOH C 2 .   ? 5.974   30.533  8.359   1.00 34.31 ? 412 HOH A O   1 
HETATM 3047 O O   . HOH C 2 .   ? -26.234 0.114   -6.240  1.00 40.59 ? 413 HOH A O   1 
HETATM 3048 O O   . HOH C 2 .   ? -12.258 0.926   7.954   1.00 43.02 ? 414 HOH A O   1 
HETATM 3049 O O   . HOH C 2 .   ? -18.441 29.969  15.888  1.00 58.07 ? 415 HOH A O   1 
HETATM 3050 O O   . HOH C 2 .   ? 6.513   26.613  -1.054  1.00 21.86 ? 416 HOH A O   1 
HETATM 3051 O O   . HOH C 2 .   ? 14.012  26.334  3.461   1.00 32.21 ? 417 HOH A O   1 
HETATM 3052 O O   . HOH C 2 .   ? -20.820 12.359  -15.156 1.00 45.43 ? 418 HOH A O   1 
HETATM 3053 O O   . HOH C 2 .   ? -4.472  9.853   8.472   1.00 41.45 ? 419 HOH A O   1 
HETATM 3054 O O   . HOH C 2 .   ? -20.445 5.125   4.490   1.00 45.85 ? 420 HOH A O   1 
HETATM 3055 O O   . HOH C 2 .   ? 0.585   10.327  -13.890 1.00 54.92 ? 421 HOH A O   1 
HETATM 3056 O O   . HOH C 2 .   ? 0.046   11.384  -1.474  1.00 44.51 ? 422 HOH A O   1 
HETATM 3057 O O   . HOH C 2 .   ? 1.241   7.315   4.832   1.00 38.78 ? 423 HOH A O   1 
HETATM 3058 O O   . HOH C 2 .   ? -3.416  4.395   -7.341  1.00 32.41 ? 424 HOH A O   1 
HETATM 3059 O O   . HOH C 2 .   ? -29.506 5.393   -3.654  1.00 46.10 ? 425 HOH A O   1 
HETATM 3060 O O   . HOH C 2 .   ? -11.998 16.343  -0.136  1.00 50.78 ? 426 HOH A O   1 
HETATM 3061 O O   . HOH C 2 .   ? -27.263 1.213   -2.915  1.00 43.37 ? 427 HOH A O   1 
HETATM 3062 O O   . HOH C 2 .   ? -4.057  2.748   -19.399 1.00 59.13 ? 428 HOH A O   1 
HETATM 3063 O O   . HOH C 2 .   ? -26.883 0.443   -12.096 1.00 44.05 ? 429 HOH A O   1 
HETATM 3064 O O   . HOH C 2 .   ? 1.418   13.875  2.550   1.00 28.47 ? 430 HOH A O   1 
HETATM 3065 O O   . HOH C 2 .   ? -33.076 6.212   -11.039 1.00 37.42 ? 431 HOH A O   1 
HETATM 3066 O O   . HOH C 2 .   ? -24.100 2.922   5.311   1.00 36.21 ? 432 HOH A O   1 
HETATM 3067 O O   . HOH C 2 .   ? -23.915 -9.275  -7.408  1.00 62.81 ? 433 HOH A O   1 
HETATM 3068 O O   . HOH C 2 .   ? -17.894 1.780   3.457   1.00 28.07 ? 434 HOH A O   1 
HETATM 3069 O O   . HOH C 2 .   ? -2.049  3.046   -16.125 1.00 73.83 ? 435 HOH A O   1 
HETATM 3070 O O   . HOH C 2 .   ? -29.238 0.316   -8.745  1.00 22.49 ? 436 HOH A O   1 
HETATM 3071 O O   . HOH C 2 .   ? -13.846 14.392  -12.123 1.00 48.40 ? 437 HOH A O   1 
HETATM 3072 O O   . HOH C 2 .   ? -10.458 13.929  -18.038 1.00 46.64 ? 438 HOH A O   1 
HETATM 3073 O O   . HOH C 2 .   ? 14.289  21.389  4.319   1.00 21.21 ? 439 HOH A O   1 
HETATM 3074 O O   . HOH D 2 .   ? -3.241  37.442  35.071  1.00 27.54 ? 401 HOH B O   1 
HETATM 3075 O O   . HOH D 2 .   ? 14.934  47.173  51.552  1.00 18.08 ? 402 HOH B O   1 
HETATM 3076 O O   . HOH D 2 .   ? 15.569  41.481  27.684  1.00 42.69 ? 403 HOH B O   1 
HETATM 3077 O O   . HOH D 2 .   ? 9.411   26.053  51.830  1.00 40.82 ? 404 HOH B O   1 
HETATM 3078 O O   . HOH D 2 .   ? -8.396  27.957  36.972  1.00 48.25 ? 405 HOH B O   1 
HETATM 3079 O O   . HOH D 2 .   ? 14.363  51.280  41.428  1.00 30.80 ? 406 HOH B O   1 
HETATM 3080 O O   . HOH D 2 .   ? -13.512 45.658  26.288  1.00 33.11 ? 407 HOH B O   1 
HETATM 3081 O O   . HOH D 2 .   ? 18.477  30.863  54.870  1.00 46.44 ? 408 HOH B O   1 
HETATM 3082 O O   . HOH D 2 .   ? 6.051   39.318  14.794  1.00 54.90 ? 409 HOH B O   1 
HETATM 3083 O O   . HOH D 2 .   ? 4.596   47.384  35.554  1.00 27.26 ? 410 HOH B O   1 
HETATM 3084 O O   . HOH D 2 .   ? -0.010  40.460  53.181  1.00 32.19 ? 411 HOH B O   1 
HETATM 3085 O O   . HOH D 2 .   ? 3.778   33.700  49.337  1.00 44.94 ? 412 HOH B O   1 
HETATM 3086 O O   . HOH D 2 .   ? -2.031  44.647  8.935   1.00 37.44 ? 413 HOH B O   1 
HETATM 3087 O O   . HOH D 2 .   ? 3.841   40.595  29.045  1.00 38.50 ? 414 HOH B O   1 
HETATM 3088 O O   . HOH D 2 .   ? 11.857  31.427  54.463  1.00 22.77 ? 415 HOH B O   1 
HETATM 3089 O O   . HOH D 2 .   ? -3.910  38.559  43.149  1.00 41.40 ? 416 HOH B O   1 
HETATM 3090 O O   . HOH D 2 .   ? 16.149  42.491  37.402  1.00 34.98 ? 417 HOH B O   1 
HETATM 3091 O O   . HOH D 2 .   ? 2.676   28.995  41.489  1.00 34.63 ? 418 HOH B O   1 
HETATM 3092 O O   . HOH D 2 .   ? 9.110   46.643  29.345  1.00 39.29 ? 419 HOH B O   1 
HETATM 3093 O O   . HOH D 2 .   ? 2.003   36.926  50.709  1.00 28.22 ? 420 HOH B O   1 
HETATM 3094 O O   . HOH D 2 .   ? 2.669   36.571  48.057  1.00 27.46 ? 421 HOH B O   1 
HETATM 3095 O O   . HOH D 2 .   ? 0.153   32.373  42.810  1.00 24.72 ? 422 HOH B O   1 
HETATM 3096 O O   . HOH D 2 .   ? 17.141  38.917  36.070  1.00 53.70 ? 423 HOH B O   1 
HETATM 3097 O O   . HOH D 2 .   ? 18.055  30.865  38.084  1.00 44.49 ? 424 HOH B O   1 
HETATM 3098 O O   . HOH D 2 .   ? 4.389   28.132  52.716  1.00 42.18 ? 425 HOH B O   1 
HETATM 3099 O O   . HOH D 2 .   ? 3.228   32.771  7.271   1.00 41.57 ? 426 HOH B O   1 
HETATM 3100 O O   . HOH D 2 .   ? -1.446  35.876  52.358  1.00 47.80 ? 427 HOH B O   1 
HETATM 3101 O O   . HOH D 2 .   ? 14.320  43.816  31.855  1.00 51.86 ? 428 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   130 ?   ?   ?   A . n 
A 1 2   PRO 2   131 ?   ?   ?   A . n 
A 1 3   LEU 3   132 ?   ?   ?   A . n 
A 1 4   GLY 4   133 ?   ?   ?   A . n 
A 1 5   SER 5   134 ?   ?   ?   A . n 
A 1 6   PRO 6   135 ?   ?   ?   A . n 
A 1 7   ALA 7   136 136 ALA ALA A . n 
A 1 8   ALA 8   137 137 ALA ALA A . n 
A 1 9   THR 9   138 138 THR THR A . n 
A 1 10  THR 10  139 139 THR THR A . n 
A 1 11  LEU 11  140 140 LEU LEU A . n 
A 1 12  PRO 12  141 141 PRO PRO A . n 
A 1 13  ASP 13  142 142 ASP ASP A . n 
A 1 14  GLY 14  143 143 GLY GLY A . n 
A 1 15  ALA 15  144 144 ALA ALA A . n 
A 1 16  ALA 16  145 145 ALA ALA A . n 
A 1 17  ALA 17  146 146 ALA ALA A . n 
A 1 18  GLU 18  147 147 GLU GLU A . n 
A 1 19  SER 19  148 148 SER SER A . n 
A 1 20  LEU 20  149 149 LEU LEU A . n 
A 1 21  VAL 21  150 150 VAL VAL A . n 
A 1 22  GLU 22  151 151 GLU GLU A . n 
A 1 23  SER 23  152 152 SER SER A . n 
A 1 24  SER 24  153 153 SER SER A . n 
A 1 25  GLU 25  154 154 GLU GLU A . n 
A 1 26  VAL 26  155 155 VAL VAL A . n 
A 1 27  ALA 27  156 156 ALA ALA A . n 
A 1 28  VAL 28  157 157 VAL VAL A . n 
A 1 29  ILE 29  158 158 ILE ILE A . n 
A 1 30  GLY 30  159 159 GLY GLY A . n 
A 1 31  PHE 31  160 160 PHE PHE A . n 
A 1 32  PHE 32  161 161 PHE PHE A . n 
A 1 33  LYS 33  162 162 LYS LYS A . n 
A 1 34  ASP 34  163 163 ASP ASP A . n 
A 1 35  VAL 35  164 164 VAL VAL A . n 
A 1 36  GLU 36  165 165 GLU GLU A . n 
A 1 37  SER 37  166 166 SER SER A . n 
A 1 38  ASP 38  167 167 ASP ASP A . n 
A 1 39  SER 39  168 168 SER SER A . n 
A 1 40  ALA 40  169 169 ALA ALA A . n 
A 1 41  LYS 41  170 170 LYS LYS A . n 
A 1 42  GLN 42  171 171 GLN GLN A . n 
A 1 43  PHE 43  172 172 PHE PHE A . n 
A 1 44  LEU 44  173 173 LEU LEU A . n 
A 1 45  GLN 45  174 174 GLN GLN A . n 
A 1 46  ALA 46  175 175 ALA ALA A . n 
A 1 47  ALA 47  176 176 ALA ALA A . n 
A 1 48  GLU 48  177 177 GLU GLU A . n 
A 1 49  ALA 49  178 178 ALA ALA A . n 
A 1 50  ILE 50  179 179 ILE ILE A . n 
A 1 51  ASP 51  180 180 ASP ASP A . n 
A 1 52  ASP 52  181 181 ASP ASP A . n 
A 1 53  ILE 53  182 182 ILE ILE A . n 
A 1 54  PRO 54  183 183 PRO PRO A . n 
A 1 55  PHE 55  184 184 PHE PHE A . n 
A 1 56  GLY 56  185 185 GLY GLY A . n 
A 1 57  ILE 57  186 186 ILE ILE A . n 
A 1 58  THR 58  187 187 THR THR A . n 
A 1 59  SER 59  188 188 SER SER A . n 
A 1 60  ASN 60  189 189 ASN ASN A . n 
A 1 61  SER 61  190 190 SER SER A . n 
A 1 62  ASP 62  191 191 ASP ASP A . n 
A 1 63  VAL 63  192 192 VAL VAL A . n 
A 1 64  PHE 64  193 193 PHE PHE A . n 
A 1 65  SER 65  194 194 SER SER A . n 
A 1 66  LYS 66  195 195 LYS LYS A . n 
A 1 67  TYR 67  196 196 TYR TYR A . n 
A 1 68  GLN 68  197 197 GLN GLN A . n 
A 1 69  LEU 69  198 198 LEU LEU A . n 
A 1 70  ASP 70  199 199 ASP ASP A . n 
A 1 71  LYS 71  200 200 LYS LYS A . n 
A 1 72  ASP 72  201 201 ASP ASP A . n 
A 1 73  GLY 73  202 202 GLY GLY A . n 
A 1 74  VAL 74  203 203 VAL VAL A . n 
A 1 75  VAL 75  204 204 VAL VAL A . n 
A 1 76  LEU 76  205 205 LEU LEU A . n 
A 1 77  PHE 77  206 206 PHE PHE A . n 
A 1 78  LYS 78  207 207 LYS LYS A . n 
A 1 79  LYS 79  208 208 LYS LYS A . n 
A 1 80  PHE 80  209 209 PHE PHE A . n 
A 1 81  ASP 81  210 210 ASP ASP A . n 
A 1 82  GLU 82  211 211 GLU GLU A . n 
A 1 83  GLY 83  212 212 GLY GLY A . n 
A 1 84  ARG 84  213 213 ARG ARG A . n 
A 1 85  ASN 85  214 214 ASN ASN A . n 
A 1 86  ASN 86  215 215 ASN ASN A . n 
A 1 87  PHE 87  216 216 PHE PHE A . n 
A 1 88  GLU 88  217 217 GLU GLU A . n 
A 1 89  GLY 89  218 218 GLY GLY A . n 
A 1 90  GLU 90  219 219 GLU ALA A . n 
A 1 91  VAL 91  220 220 VAL VAL A . n 
A 1 92  THR 92  221 221 THR THR A . n 
A 1 93  LYS 93  222 222 LYS LYS A . n 
A 1 94  GLU 94  223 223 GLU GLU A . n 
A 1 95  ASN 95  224 224 ASN ASN A . n 
A 1 96  LEU 96  225 225 LEU LEU A . n 
A 1 97  LEU 97  226 226 LEU LEU A . n 
A 1 98  ASP 98  227 227 ASP ASP A . n 
A 1 99  PHE 99  228 228 PHE PHE A . n 
A 1 100 ILE 100 229 229 ILE ILE A . n 
A 1 101 LYS 101 230 230 LYS ALA A . n 
A 1 102 HIS 102 231 231 HIS HIS A . n 
A 1 103 ASN 103 232 232 ASN ASN A . n 
A 1 104 GLN 104 233 233 GLN GLN A . n 
A 1 105 LEU 105 234 234 LEU LEU A . n 
A 1 106 PRO 106 235 235 PRO PRO A . n 
A 1 107 LEU 107 236 236 LEU LEU A . n 
A 1 108 VAL 108 237 237 VAL VAL A . n 
A 1 109 ILE 109 238 238 ILE ILE A . n 
A 1 110 GLU 110 239 239 GLU GLU A . n 
A 1 111 PHE 111 240 240 PHE PHE A . n 
A 1 112 THR 112 241 241 THR THR A . n 
A 1 113 GLU 113 242 242 GLU GLU A . n 
A 1 114 GLN 114 243 243 GLN ALA A . n 
A 1 115 THR 115 244 244 THR THR A . n 
A 1 116 ALA 116 245 245 ALA ALA A . n 
A 1 117 PRO 117 246 246 PRO PRO A . n 
A 1 118 LYS 118 247 247 LYS LYS A . n 
A 1 119 ILE 119 248 248 ILE ILE A . n 
A 1 120 PHE 120 249 249 PHE ALA A . n 
A 1 121 GLY 121 250 250 GLY GLY A . n 
A 1 122 GLY 122 251 251 GLY GLY A . n 
A 1 123 GLU 123 252 252 GLU ALA A . n 
A 1 124 ILE 124 253 253 ILE ILE A . n 
A 1 125 LYS 125 254 254 LYS LYS A . n 
A 1 126 THR 126 255 255 THR THR A . n 
A 1 127 HIS 127 256 256 HIS HIS A . n 
A 1 128 ILE 128 257 257 ILE ILE A . n 
A 1 129 LEU 129 258 258 LEU LEU A . n 
A 1 130 LEU 130 259 259 LEU LEU A . n 
A 1 131 PHE 131 260 260 PHE PHE A . n 
A 1 132 LEU 132 261 261 LEU LEU A . n 
A 1 133 PRO 133 262 262 PRO PRO A . n 
A 1 134 LYS 134 263 263 LYS LYS A . n 
A 1 135 SER 135 264 264 SER SER A . n 
A 1 136 VAL 136 265 265 VAL VAL A . n 
A 1 137 SER 137 266 266 SER SER A . n 
A 1 138 ASP 138 267 267 ASP ASP A . n 
A 1 139 TYR 139 268 268 TYR TYR A . n 
A 1 140 ASP 140 269 269 ASP ASP A . n 
A 1 141 GLY 141 270 270 GLY GLY A . n 
A 1 142 LYS 142 271 271 LYS LYS A . n 
A 1 143 LEU 143 272 272 LEU LEU A . n 
A 1 144 SER 144 273 273 SER SER A . n 
A 1 145 ASN 145 274 274 ASN ASN A . n 
A 1 146 PHE 146 275 275 PHE PHE A . n 
A 1 147 LYS 147 276 276 LYS LYS A . n 
A 1 148 THR 148 277 277 THR THR A . n 
A 1 149 ALA 149 278 278 ALA ALA A . n 
A 1 150 ALA 150 279 279 ALA ALA A . n 
A 1 151 GLU 151 280 280 GLU GLU A . n 
A 1 152 SER 152 281 281 SER SER A . n 
A 1 153 PHE 153 282 282 PHE PHE A . n 
A 1 154 LYS 154 283 283 LYS ALA A . n 
A 1 155 GLY 155 284 284 GLY GLY A . n 
A 1 156 LYS 156 285 285 LYS ALA A . n 
A 1 157 ILE 157 286 286 ILE ILE A . n 
A 1 158 LEU 158 287 287 LEU LEU A . n 
A 1 159 PHE 159 288 288 PHE PHE A . n 
A 1 160 ILE 160 289 289 ILE ILE A . n 
A 1 161 PHE 161 290 290 PHE PHE A . n 
A 1 162 ILE 162 291 291 ILE ILE A . n 
A 1 163 ASP 163 292 292 ASP ASP A . n 
A 1 164 SER 164 293 293 SER SER A . n 
A 1 165 ASP 165 294 294 ASP ASP A . n 
A 1 166 HIS 166 295 295 HIS HIS A . n 
A 1 167 THR 167 296 296 THR THR A . n 
A 1 168 ASP 168 297 297 ASP ASP A . n 
A 1 169 ASN 169 298 298 ASN ASN A . n 
A 1 170 GLN 170 299 299 GLN GLN A . n 
A 1 171 ARG 171 300 300 ARG ARG A . n 
A 1 172 ILE 172 301 301 ILE ILE A . n 
A 1 173 LEU 173 302 302 LEU LEU A . n 
A 1 174 GLU 174 303 303 GLU GLU A . n 
A 1 175 PHE 175 304 304 PHE PHE A . n 
A 1 176 PHE 176 305 305 PHE PHE A . n 
A 1 177 GLY 177 306 306 GLY GLY A . n 
A 1 178 LEU 178 307 307 LEU LEU A . n 
A 1 179 LYS 179 308 308 LYS ALA A . n 
A 1 180 LYS 180 309 309 LYS LYS A . n 
A 1 181 GLU 181 310 310 GLU ALA A . n 
A 1 182 GLU 182 311 311 GLU GLU A . n 
A 1 183 CYS 183 312 312 CYS CYS A . n 
A 1 184 PRO 184 313 313 PRO PRO A . n 
A 1 185 ALA 185 314 314 ALA ALA A . n 
A 1 186 VAL 186 315 315 VAL VAL A . n 
A 1 187 ARG 187 316 316 ARG ARG A . n 
A 1 188 LEU 188 317 317 LEU LEU A . n 
A 1 189 ILE 189 318 318 ILE ILE A . n 
A 1 190 THR 190 319 319 THR THR A . n 
A 1 191 LEU 191 320 320 LEU LEU A . n 
A 1 192 GLU 192 321 321 GLU GLU A . n 
A 1 193 GLU 193 322 322 GLU GLU A . n 
A 1 194 GLU 194 323 ?   ?   ?   A . n 
A 1 195 MET 195 324 ?   ?   ?   A . n 
A 1 196 THR 196 325 ?   ?   ?   A . n 
A 1 197 LYS 197 326 ?   ?   ?   A . n 
A 1 198 TYR 198 327 ?   ?   ?   A . n 
A 1 199 LYS 199 328 ?   ?   ?   A . n 
A 1 200 PRO 200 329 ?   ?   ?   A . n 
A 1 201 GLU 201 330 ?   ?   ?   A . n 
A 1 202 SER 202 331 ?   ?   ?   A . n 
A 1 203 GLU 203 332 ?   ?   ?   A . n 
A 1 204 GLU 204 333 ?   ?   ?   A . n 
A 1 205 LEU 205 334 ?   ?   ?   A . n 
A 1 206 THR 206 335 335 THR ALA A . n 
A 1 207 ALA 207 336 336 ALA ALA A . n 
A 1 208 GLU 208 337 337 GLU ALA A . n 
A 1 209 ARG 209 338 338 ARG ALA A . n 
A 1 210 ILE 210 339 339 ILE ILE A . n 
A 1 211 THR 211 340 340 THR THR A . n 
A 1 212 GLU 212 341 341 GLU ALA A . n 
A 1 213 PHE 213 342 342 PHE PHE A . n 
A 1 214 CYS 214 343 343 CYS CYS A . n 
A 1 215 HIS 215 344 344 HIS HIS A . n 
A 1 216 ARG 216 345 345 ARG ALA A . n 
A 1 217 PHE 217 346 346 PHE PHE A . n 
A 1 218 LEU 218 347 347 LEU ALA A . n 
A 1 219 GLU 219 348 ?   ?   ?   A . n 
A 1 220 GLY 220 349 ?   ?   ?   A . n 
A 1 221 LYS 221 350 ?   ?   ?   A . n 
A 1 222 ILE 222 351 ?   ?   ?   A . n 
A 1 223 LYS 223 352 ?   ?   ?   A . n 
A 1 224 PRO 224 353 ?   ?   ?   A . n 
A 1 225 HIS 225 354 ?   ?   ?   A . n 
A 1 226 LEU 226 355 ?   ?   ?   A . n 
A 1 227 MET 227 356 ?   ?   ?   A . n 
A 1 228 SER 228 357 ?   ?   ?   A . n 
A 1 229 GLN 229 358 ?   ?   ?   A . n 
A 1 230 GLU 230 359 ?   ?   ?   A . n 
A 1 231 LEU 231 360 ?   ?   ?   A . n 
A 1 232 PRO 232 361 ?   ?   ?   A . n 
A 1 233 GLU 233 362 ?   ?   ?   A . n 
A 1 234 ASP 234 363 ?   ?   ?   A . n 
A 1 235 TRP 235 364 ?   ?   ?   A . n 
A 1 236 ASP 236 365 ?   ?   ?   A . n 
A 1 237 LYS 237 366 ?   ?   ?   A . n 
A 1 238 GLN 238 367 ?   ?   ?   A . n 
B 1 1   GLY 1   130 ?   ?   ?   B . n 
B 1 2   PRO 2   131 ?   ?   ?   B . n 
B 1 3   LEU 3   132 ?   ?   ?   B . n 
B 1 4   GLY 4   133 ?   ?   ?   B . n 
B 1 5   SER 5   134 ?   ?   ?   B . n 
B 1 6   PRO 6   135 ?   ?   ?   B . n 
B 1 7   ALA 7   136 136 ALA ALA B . n 
B 1 8   ALA 8   137 137 ALA ALA B . n 
B 1 9   THR 9   138 138 THR THR B . n 
B 1 10  THR 10  139 139 THR THR B . n 
B 1 11  LEU 11  140 140 LEU LEU B . n 
B 1 12  PRO 12  141 141 PRO PRO B . n 
B 1 13  ASP 13  142 142 ASP ASP B . n 
B 1 14  GLY 14  143 143 GLY GLY B . n 
B 1 15  ALA 15  144 144 ALA ALA B . n 
B 1 16  ALA 16  145 145 ALA ALA B . n 
B 1 17  ALA 17  146 146 ALA ALA B . n 
B 1 18  GLU 18  147 147 GLU GLU B . n 
B 1 19  SER 19  148 148 SER SER B . n 
B 1 20  LEU 20  149 149 LEU LEU B . n 
B 1 21  VAL 21  150 150 VAL VAL B . n 
B 1 22  GLU 22  151 151 GLU GLU B . n 
B 1 23  SER 23  152 152 SER SER B . n 
B 1 24  SER 24  153 153 SER SER B . n 
B 1 25  GLU 25  154 154 GLU GLU B . n 
B 1 26  VAL 26  155 155 VAL VAL B . n 
B 1 27  ALA 27  156 156 ALA ALA B . n 
B 1 28  VAL 28  157 157 VAL VAL B . n 
B 1 29  ILE 29  158 158 ILE ILE B . n 
B 1 30  GLY 30  159 159 GLY GLY B . n 
B 1 31  PHE 31  160 160 PHE PHE B . n 
B 1 32  PHE 32  161 161 PHE PHE B . n 
B 1 33  LYS 33  162 162 LYS LYS B . n 
B 1 34  ASP 34  163 163 ASP ASP B . n 
B 1 35  VAL 35  164 164 VAL VAL B . n 
B 1 36  GLU 36  165 165 GLU GLU B . n 
B 1 37  SER 37  166 166 SER SER B . n 
B 1 38  ASP 38  167 167 ASP ASP B . n 
B 1 39  SER 39  168 168 SER SER B . n 
B 1 40  ALA 40  169 169 ALA ALA B . n 
B 1 41  LYS 41  170 170 LYS LYS B . n 
B 1 42  GLN 42  171 171 GLN GLN B . n 
B 1 43  PHE 43  172 172 PHE PHE B . n 
B 1 44  LEU 44  173 173 LEU LEU B . n 
B 1 45  GLN 45  174 174 GLN GLN B . n 
B 1 46  ALA 46  175 175 ALA ALA B . n 
B 1 47  ALA 47  176 176 ALA ALA B . n 
B 1 48  GLU 48  177 177 GLU GLU B . n 
B 1 49  ALA 49  178 178 ALA ALA B . n 
B 1 50  ILE 50  179 179 ILE ILE B . n 
B 1 51  ASP 51  180 180 ASP ASP B . n 
B 1 52  ASP 52  181 181 ASP ASP B . n 
B 1 53  ILE 53  182 182 ILE ILE B . n 
B 1 54  PRO 54  183 183 PRO PRO B . n 
B 1 55  PHE 55  184 184 PHE PHE B . n 
B 1 56  GLY 56  185 185 GLY GLY B . n 
B 1 57  ILE 57  186 186 ILE ILE B . n 
B 1 58  THR 58  187 187 THR THR B . n 
B 1 59  SER 59  188 188 SER SER B . n 
B 1 60  ASN 60  189 189 ASN ASN B . n 
B 1 61  SER 61  190 190 SER SER B . n 
B 1 62  ASP 62  191 191 ASP ASP B . n 
B 1 63  VAL 63  192 192 VAL VAL B . n 
B 1 64  PHE 64  193 193 PHE PHE B . n 
B 1 65  SER 65  194 194 SER SER B . n 
B 1 66  LYS 66  195 195 LYS LYS B . n 
B 1 67  TYR 67  196 196 TYR TYR B . n 
B 1 68  GLN 68  197 197 GLN GLN B . n 
B 1 69  LEU 69  198 198 LEU LEU B . n 
B 1 70  ASP 70  199 199 ASP ASP B . n 
B 1 71  LYS 71  200 200 LYS LYS B . n 
B 1 72  ASP 72  201 201 ASP ASP B . n 
B 1 73  GLY 73  202 202 GLY GLY B . n 
B 1 74  VAL 74  203 203 VAL VAL B . n 
B 1 75  VAL 75  204 204 VAL VAL B . n 
B 1 76  LEU 76  205 205 LEU LEU B . n 
B 1 77  PHE 77  206 206 PHE PHE B . n 
B 1 78  LYS 78  207 207 LYS LYS B . n 
B 1 79  LYS 79  208 208 LYS LYS B . n 
B 1 80  PHE 80  209 209 PHE PHE B . n 
B 1 81  ASP 81  210 210 ASP ASP B . n 
B 1 82  GLU 82  211 211 GLU GLU B . n 
B 1 83  GLY 83  212 212 GLY GLY B . n 
B 1 84  ARG 84  213 213 ARG ARG B . n 
B 1 85  ASN 85  214 214 ASN ASN B . n 
B 1 86  ASN 86  215 215 ASN ASN B . n 
B 1 87  PHE 87  216 216 PHE PHE B . n 
B 1 88  GLU 88  217 217 GLU GLU B . n 
B 1 89  GLY 89  218 218 GLY GLY B . n 
B 1 90  GLU 90  219 219 GLU GLU B . n 
B 1 91  VAL 91  220 220 VAL VAL B . n 
B 1 92  THR 92  221 221 THR THR B . n 
B 1 93  LYS 93  222 222 LYS LYS B . n 
B 1 94  GLU 94  223 223 GLU ALA B . n 
B 1 95  ASN 95  224 224 ASN ASN B . n 
B 1 96  LEU 96  225 225 LEU LEU B . n 
B 1 97  LEU 97  226 226 LEU LEU B . n 
B 1 98  ASP 98  227 227 ASP ASP B . n 
B 1 99  PHE 99  228 228 PHE PHE B . n 
B 1 100 ILE 100 229 229 ILE ILE B . n 
B 1 101 LYS 101 230 230 LYS LYS B . n 
B 1 102 HIS 102 231 231 HIS HIS B . n 
B 1 103 ASN 103 232 232 ASN ASN B . n 
B 1 104 GLN 104 233 233 GLN GLN B . n 
B 1 105 LEU 105 234 234 LEU LEU B . n 
B 1 106 PRO 106 235 235 PRO PRO B . n 
B 1 107 LEU 107 236 236 LEU LEU B . n 
B 1 108 VAL 108 237 237 VAL VAL B . n 
B 1 109 ILE 109 238 238 ILE ILE B . n 
B 1 110 GLU 110 239 239 GLU GLU B . n 
B 1 111 PHE 111 240 240 PHE PHE B . n 
B 1 112 THR 112 241 241 THR THR B . n 
B 1 113 GLU 113 242 242 GLU GLU B . n 
B 1 114 GLN 114 243 243 GLN ALA B . n 
B 1 115 THR 115 244 244 THR THR B . n 
B 1 116 ALA 116 245 245 ALA ALA B . n 
B 1 117 PRO 117 246 246 PRO PRO B . n 
B 1 118 LYS 118 247 247 LYS LYS B . n 
B 1 119 ILE 119 248 248 ILE ILE B . n 
B 1 120 PHE 120 249 249 PHE ALA B . n 
B 1 121 GLY 121 250 250 GLY GLY B . n 
B 1 122 GLY 122 251 251 GLY GLY B . n 
B 1 123 GLU 123 252 252 GLU GLU B . n 
B 1 124 ILE 124 253 253 ILE ILE B . n 
B 1 125 LYS 125 254 254 LYS ALA B . n 
B 1 126 THR 126 255 255 THR THR B . n 
B 1 127 HIS 127 256 256 HIS HIS B . n 
B 1 128 ILE 128 257 257 ILE ILE B . n 
B 1 129 LEU 129 258 258 LEU LEU B . n 
B 1 130 LEU 130 259 259 LEU LEU B . n 
B 1 131 PHE 131 260 260 PHE PHE B . n 
B 1 132 LEU 132 261 261 LEU LEU B . n 
B 1 133 PRO 133 262 262 PRO PRO B . n 
B 1 134 LYS 134 263 263 LYS LYS B . n 
B 1 135 SER 135 264 264 SER SER B . n 
B 1 136 VAL 136 265 265 VAL VAL B . n 
B 1 137 SER 137 266 266 SER SER B . n 
B 1 138 ASP 138 267 267 ASP ASP B . n 
B 1 139 TYR 139 268 268 TYR TYR B . n 
B 1 140 ASP 140 269 269 ASP ASP B . n 
B 1 141 GLY 141 270 270 GLY GLY B . n 
B 1 142 LYS 142 271 271 LYS LYS B . n 
B 1 143 LEU 143 272 272 LEU LEU B . n 
B 1 144 SER 144 273 273 SER SER B . n 
B 1 145 ASN 145 274 274 ASN ASN B . n 
B 1 146 PHE 146 275 275 PHE PHE B . n 
B 1 147 LYS 147 276 276 LYS ALA B . n 
B 1 148 THR 148 277 277 THR THR B . n 
B 1 149 ALA 149 278 278 ALA ALA B . n 
B 1 150 ALA 150 279 279 ALA ALA B . n 
B 1 151 GLU 151 280 280 GLU GLU B . n 
B 1 152 SER 152 281 281 SER SER B . n 
B 1 153 PHE 153 282 282 PHE PHE B . n 
B 1 154 LYS 154 283 283 LYS LYS B . n 
B 1 155 GLY 155 284 284 GLY GLY B . n 
B 1 156 LYS 156 285 285 LYS LYS B . n 
B 1 157 ILE 157 286 286 ILE ILE B . n 
B 1 158 LEU 158 287 287 LEU LEU B . n 
B 1 159 PHE 159 288 288 PHE PHE B . n 
B 1 160 ILE 160 289 289 ILE ILE B . n 
B 1 161 PHE 161 290 290 PHE PHE B . n 
B 1 162 ILE 162 291 291 ILE ILE B . n 
B 1 163 ASP 163 292 292 ASP ASP B . n 
B 1 164 SER 164 293 293 SER SER B . n 
B 1 165 ASP 165 294 294 ASP ASP B . n 
B 1 166 HIS 166 295 295 HIS HIS B . n 
B 1 167 THR 167 296 296 THR THR B . n 
B 1 168 ASP 168 297 297 ASP ASP B . n 
B 1 169 ASN 169 298 298 ASN ASN B . n 
B 1 170 GLN 170 299 299 GLN GLN B . n 
B 1 171 ARG 171 300 300 ARG ARG B . n 
B 1 172 ILE 172 301 301 ILE ILE B . n 
B 1 173 LEU 173 302 302 LEU LEU B . n 
B 1 174 GLU 174 303 303 GLU GLU B . n 
B 1 175 PHE 175 304 304 PHE PHE B . n 
B 1 176 PHE 176 305 305 PHE PHE B . n 
B 1 177 GLY 177 306 306 GLY GLY B . n 
B 1 178 LEU 178 307 307 LEU LEU B . n 
B 1 179 LYS 179 308 308 LYS LYS B . n 
B 1 180 LYS 180 309 309 LYS LYS B . n 
B 1 181 GLU 181 310 310 GLU GLU B . n 
B 1 182 GLU 182 311 311 GLU GLU B . n 
B 1 183 CYS 183 312 312 CYS CYS B . n 
B 1 184 PRO 184 313 313 PRO PRO B . n 
B 1 185 ALA 185 314 314 ALA ALA B . n 
B 1 186 VAL 186 315 315 VAL VAL B . n 
B 1 187 ARG 187 316 316 ARG ARG B . n 
B 1 188 LEU 188 317 317 LEU LEU B . n 
B 1 189 ILE 189 318 318 ILE ILE B . n 
B 1 190 THR 190 319 319 THR THR B . n 
B 1 191 LEU 191 320 320 LEU LEU B . n 
B 1 192 GLU 192 321 321 GLU GLU B . n 
B 1 193 GLU 193 322 ?   ?   ?   B . n 
B 1 194 GLU 194 323 ?   ?   ?   B . n 
B 1 195 MET 195 324 ?   ?   ?   B . n 
B 1 196 THR 196 325 ?   ?   ?   B . n 
B 1 197 LYS 197 326 ?   ?   ?   B . n 
B 1 198 TYR 198 327 ?   ?   ?   B . n 
B 1 199 LYS 199 328 ?   ?   ?   B . n 
B 1 200 PRO 200 329 ?   ?   ?   B . n 
B 1 201 GLU 201 330 ?   ?   ?   B . n 
B 1 202 SER 202 331 ?   ?   ?   B . n 
B 1 203 GLU 203 332 ?   ?   ?   B . n 
B 1 204 GLU 204 333 ?   ?   ?   B . n 
B 1 205 LEU 205 334 ?   ?   ?   B . n 
B 1 206 THR 206 335 ?   ?   ?   B . n 
B 1 207 ALA 207 336 ?   ?   ?   B . n 
B 1 208 GLU 208 337 337 GLU ALA B . n 
B 1 209 ARG 209 338 338 ARG ALA B . n 
B 1 210 ILE 210 339 339 ILE ILE B . n 
B 1 211 THR 211 340 340 THR THR B . n 
B 1 212 GLU 212 341 341 GLU ALA B . n 
B 1 213 PHE 213 342 342 PHE ALA B . n 
B 1 214 CYS 214 343 343 CYS CYS B . n 
B 1 215 HIS 215 344 344 HIS HIS B . n 
B 1 216 ARG 216 345 345 ARG ALA B . n 
B 1 217 PHE 217 346 346 PHE ALA B . n 
B 1 218 LEU 218 347 347 LEU LEU B . n 
B 1 219 GLU 219 348 ?   ?   ?   B . n 
B 1 220 GLY 220 349 ?   ?   ?   B . n 
B 1 221 LYS 221 350 ?   ?   ?   B . n 
B 1 222 ILE 222 351 ?   ?   ?   B . n 
B 1 223 LYS 223 352 ?   ?   ?   B . n 
B 1 224 PRO 224 353 ?   ?   ?   B . n 
B 1 225 HIS 225 354 ?   ?   ?   B . n 
B 1 226 LEU 226 355 ?   ?   ?   B . n 
B 1 227 MET 227 356 ?   ?   ?   B . n 
B 1 228 SER 228 357 ?   ?   ?   B . n 
B 1 229 GLN 229 358 ?   ?   ?   B . n 
B 1 230 GLU 230 359 ?   ?   ?   B . n 
B 1 231 LEU 231 360 ?   ?   ?   B . n 
B 1 232 PRO 232 361 ?   ?   ?   B . n 
B 1 233 GLU 233 362 ?   ?   ?   B . n 
B 1 234 ASP 234 363 ?   ?   ?   B . n 
B 1 235 TRP 235 364 ?   ?   ?   B . n 
B 1 236 ASP 236 365 ?   ?   ?   B . n 
B 1 237 LYS 237 366 ?   ?   ?   B . n 
B 1 238 GLN 238 367 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  401 5  HOH HOH A . 
C 2 HOH 2  402 6  HOH HOH A . 
C 2 HOH 3  403 7  HOH HOH A . 
C 2 HOH 4  404 8  HOH HOH A . 
C 2 HOH 5  405 10 HOH HOH A . 
C 2 HOH 6  406 12 HOH HOH A . 
C 2 HOH 7  407 13 HOH HOH A . 
C 2 HOH 8  408 16 HOH HOH A . 
C 2 HOH 9  409 17 HOH HOH A . 
C 2 HOH 10 410 19 HOH HOH A . 
C 2 HOH 11 411 21 HOH HOH A . 
C 2 HOH 12 412 27 HOH HOH A . 
C 2 HOH 13 413 29 HOH HOH A . 
C 2 HOH 14 414 30 HOH HOH A . 
C 2 HOH 15 415 31 HOH HOH A . 
C 2 HOH 16 416 32 HOH HOH A . 
C 2 HOH 17 417 33 HOH HOH A . 
C 2 HOH 18 418 34 HOH HOH A . 
C 2 HOH 19 419 39 HOH HOH A . 
C 2 HOH 20 420 40 HOH HOH A . 
C 2 HOH 21 421 41 HOH HOH A . 
C 2 HOH 22 422 43 HOH HOH A . 
C 2 HOH 23 423 46 HOH HOH A . 
C 2 HOH 24 424 47 HOH HOH A . 
C 2 HOH 25 425 48 HOH HOH A . 
C 2 HOH 26 426 49 HOH HOH A . 
C 2 HOH 27 427 50 HOH HOH A . 
C 2 HOH 28 428 51 HOH HOH A . 
C 2 HOH 29 429 52 HOH HOH A . 
C 2 HOH 30 430 56 HOH HOH A . 
C 2 HOH 31 431 57 HOH HOH A . 
C 2 HOH 32 432 59 HOH HOH A . 
C 2 HOH 33 433 62 HOH HOH A . 
C 2 HOH 34 434 63 HOH HOH A . 
C 2 HOH 35 435 65 HOH HOH A . 
C 2 HOH 36 436 66 HOH HOH A . 
C 2 HOH 37 437 67 HOH HOH A . 
C 2 HOH 38 438 68 HOH HOH A . 
C 2 HOH 39 439 69 HOH HOH A . 
D 2 HOH 1  401 1  HOH HOH B . 
D 2 HOH 2  402 2  HOH HOH B . 
D 2 HOH 3  403 4  HOH HOH B . 
D 2 HOH 4  404 9  HOH HOH B . 
D 2 HOH 5  405 11 HOH HOH B . 
D 2 HOH 6  406 14 HOH HOH B . 
D 2 HOH 7  407 15 HOH HOH B . 
D 2 HOH 8  408 18 HOH HOH B . 
D 2 HOH 9  409 20 HOH HOH B . 
D 2 HOH 10 410 22 HOH HOH B . 
D 2 HOH 11 411 24 HOH HOH B . 
D 2 HOH 12 412 25 HOH HOH B . 
D 2 HOH 13 413 26 HOH HOH B . 
D 2 HOH 14 414 28 HOH HOH B . 
D 2 HOH 15 415 35 HOH HOH B . 
D 2 HOH 16 416 36 HOH HOH B . 
D 2 HOH 17 417 37 HOH HOH B . 
D 2 HOH 18 418 38 HOH HOH B . 
D 2 HOH 19 419 44 HOH HOH B . 
D 2 HOH 20 420 45 HOH HOH B . 
D 2 HOH 21 421 53 HOH HOH B . 
D 2 HOH 22 422 54 HOH HOH B . 
D 2 HOH 23 423 55 HOH HOH B . 
D 2 HOH 24 424 58 HOH HOH B . 
D 2 HOH 25 425 60 HOH HOH B . 
D 2 HOH 26 426 61 HOH HOH B . 
D 2 HOH 27 427 64 HOH HOH B . 
D 2 HOH 28 428 70 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3620  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  19070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-02-19 
2 'Structure model' 1 1 2014-03-05 
3 'Structure model' 1 2 2014-03-19 
4 'Structure model' 1 3 2014-05-07 
5 'Structure model' 1 4 2019-07-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Database references'    
4 5 'Structure model' 'Data collection'        
5 5 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_software.classification' 
2 5 'Structure model' '_software.name'           
3 5 'Structure model' '_software.version'        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.7.0029 ? 1 
PHASER   phasing           .        ? 2 
CNS      refinement        1.1      ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
ADSC     'data collection' Quantum  ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 208 ? ? -93.86  32.17   
2 1 ASP A 210 ? ? 45.33   -131.43 
3 1 LYS A 254 ? ? 73.94   -27.80  
4 1 GLU A 311 ? ? -68.56  2.63    
5 1 LYS B 208 ? ? -91.00  31.53   
6 1 ASP B 210 ? ? 52.50   -134.35 
7 1 LYS B 285 ? ? -135.40 -46.91  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 219 ? CG  ? A GLU 90  CG  
2   1 Y 1 A GLU 219 ? CD  ? A GLU 90  CD  
3   1 Y 1 A GLU 219 ? OE1 ? A GLU 90  OE1 
4   1 Y 1 A GLU 219 ? OE2 ? A GLU 90  OE2 
5   1 Y 1 A LYS 230 ? CG  ? A LYS 101 CG  
6   1 Y 1 A LYS 230 ? CD  ? A LYS 101 CD  
7   1 Y 1 A LYS 230 ? CE  ? A LYS 101 CE  
8   1 Y 1 A LYS 230 ? NZ  ? A LYS 101 NZ  
9   1 Y 1 A GLN 243 ? CG  ? A GLN 114 CG  
10  1 Y 1 A GLN 243 ? CD  ? A GLN 114 CD  
11  1 Y 1 A GLN 243 ? OE1 ? A GLN 114 OE1 
12  1 Y 1 A GLN 243 ? NE2 ? A GLN 114 NE2 
13  1 Y 1 A PHE 249 ? CG  ? A PHE 120 CG  
14  1 Y 1 A PHE 249 ? CD1 ? A PHE 120 CD1 
15  1 Y 1 A PHE 249 ? CD2 ? A PHE 120 CD2 
16  1 Y 1 A PHE 249 ? CE1 ? A PHE 120 CE1 
17  1 Y 1 A PHE 249 ? CE2 ? A PHE 120 CE2 
18  1 Y 1 A PHE 249 ? CZ  ? A PHE 120 CZ  
19  1 Y 1 A GLU 252 ? CG  ? A GLU 123 CG  
20  1 Y 1 A GLU 252 ? CD  ? A GLU 123 CD  
21  1 Y 1 A GLU 252 ? OE1 ? A GLU 123 OE1 
22  1 Y 1 A GLU 252 ? OE2 ? A GLU 123 OE2 
23  1 Y 1 A LYS 283 ? CG  ? A LYS 154 CG  
24  1 Y 1 A LYS 283 ? CD  ? A LYS 154 CD  
25  1 Y 1 A LYS 283 ? CE  ? A LYS 154 CE  
26  1 Y 1 A LYS 283 ? NZ  ? A LYS 154 NZ  
27  1 Y 1 A LYS 285 ? CG  ? A LYS 156 CG  
28  1 Y 1 A LYS 285 ? CD  ? A LYS 156 CD  
29  1 Y 1 A LYS 285 ? CE  ? A LYS 156 CE  
30  1 Y 1 A LYS 285 ? NZ  ? A LYS 156 NZ  
31  1 Y 1 A LYS 308 ? CG  ? A LYS 179 CG  
32  1 Y 1 A LYS 308 ? CD  ? A LYS 179 CD  
33  1 Y 1 A LYS 308 ? CE  ? A LYS 179 CE  
34  1 Y 1 A LYS 308 ? NZ  ? A LYS 179 NZ  
35  1 Y 1 A GLU 310 ? CG  ? A GLU 181 CG  
36  1 Y 1 A GLU 310 ? CD  ? A GLU 181 CD  
37  1 Y 1 A GLU 310 ? OE1 ? A GLU 181 OE1 
38  1 Y 1 A GLU 310 ? OE2 ? A GLU 181 OE2 
39  1 Y 1 A THR 335 ? OG1 ? A THR 206 OG1 
40  1 Y 1 A THR 335 ? CG2 ? A THR 206 CG2 
41  1 Y 1 A GLU 337 ? CG  ? A GLU 208 CG  
42  1 Y 1 A GLU 337 ? CD  ? A GLU 208 CD  
43  1 Y 1 A GLU 337 ? OE1 ? A GLU 208 OE1 
44  1 Y 1 A GLU 337 ? OE2 ? A GLU 208 OE2 
45  1 Y 1 A ARG 338 ? CG  ? A ARG 209 CG  
46  1 Y 1 A ARG 338 ? CD  ? A ARG 209 CD  
47  1 Y 1 A ARG 338 ? NE  ? A ARG 209 NE  
48  1 Y 1 A ARG 338 ? CZ  ? A ARG 209 CZ  
49  1 Y 1 A ARG 338 ? NH1 ? A ARG 209 NH1 
50  1 Y 1 A ARG 338 ? NH2 ? A ARG 209 NH2 
51  1 Y 1 A GLU 341 ? CG  ? A GLU 212 CG  
52  1 Y 1 A GLU 341 ? CD  ? A GLU 212 CD  
53  1 Y 1 A GLU 341 ? OE1 ? A GLU 212 OE1 
54  1 Y 1 A GLU 341 ? OE2 ? A GLU 212 OE2 
55  1 Y 1 A ARG 345 ? CG  ? A ARG 216 CG  
56  1 Y 1 A ARG 345 ? CD  ? A ARG 216 CD  
57  1 Y 1 A ARG 345 ? NE  ? A ARG 216 NE  
58  1 Y 1 A ARG 345 ? CZ  ? A ARG 216 CZ  
59  1 Y 1 A ARG 345 ? NH1 ? A ARG 216 NH1 
60  1 Y 1 A ARG 345 ? NH2 ? A ARG 216 NH2 
61  1 Y 1 A LEU 347 ? CG  ? A LEU 218 CG  
62  1 Y 1 A LEU 347 ? CD1 ? A LEU 218 CD1 
63  1 Y 1 A LEU 347 ? CD2 ? A LEU 218 CD2 
64  1 Y 1 B GLU 223 ? CG  ? B GLU 94  CG  
65  1 Y 1 B GLU 223 ? CD  ? B GLU 94  CD  
66  1 Y 1 B GLU 223 ? OE1 ? B GLU 94  OE1 
67  1 Y 1 B GLU 223 ? OE2 ? B GLU 94  OE2 
68  1 Y 1 B GLN 243 ? CG  ? B GLN 114 CG  
69  1 Y 1 B GLN 243 ? CD  ? B GLN 114 CD  
70  1 Y 1 B GLN 243 ? OE1 ? B GLN 114 OE1 
71  1 Y 1 B GLN 243 ? NE2 ? B GLN 114 NE2 
72  1 Y 1 B PHE 249 ? CG  ? B PHE 120 CG  
73  1 Y 1 B PHE 249 ? CD1 ? B PHE 120 CD1 
74  1 Y 1 B PHE 249 ? CD2 ? B PHE 120 CD2 
75  1 Y 1 B PHE 249 ? CE1 ? B PHE 120 CE1 
76  1 Y 1 B PHE 249 ? CE2 ? B PHE 120 CE2 
77  1 Y 1 B PHE 249 ? CZ  ? B PHE 120 CZ  
78  1 Y 1 B LYS 254 ? CG  ? B LYS 125 CG  
79  1 Y 1 B LYS 254 ? CD  ? B LYS 125 CD  
80  1 Y 1 B LYS 254 ? CE  ? B LYS 125 CE  
81  1 Y 1 B LYS 254 ? NZ  ? B LYS 125 NZ  
82  1 Y 1 B LYS 276 ? CG  ? B LYS 147 CG  
83  1 Y 1 B LYS 276 ? CD  ? B LYS 147 CD  
84  1 Y 1 B LYS 276 ? CE  ? B LYS 147 CE  
85  1 Y 1 B LYS 276 ? NZ  ? B LYS 147 NZ  
86  1 Y 1 B GLU 337 ? CG  ? B GLU 208 CG  
87  1 Y 1 B GLU 337 ? CD  ? B GLU 208 CD  
88  1 Y 1 B GLU 337 ? OE1 ? B GLU 208 OE1 
89  1 Y 1 B GLU 337 ? OE2 ? B GLU 208 OE2 
90  1 Y 1 B ARG 338 ? CG  ? B ARG 209 CG  
91  1 Y 1 B ARG 338 ? CD  ? B ARG 209 CD  
92  1 Y 1 B ARG 338 ? NE  ? B ARG 209 NE  
93  1 Y 1 B ARG 338 ? CZ  ? B ARG 209 CZ  
94  1 Y 1 B ARG 338 ? NH1 ? B ARG 209 NH1 
95  1 Y 1 B ARG 338 ? NH2 ? B ARG 209 NH2 
96  1 Y 1 B GLU 341 ? CG  ? B GLU 212 CG  
97  1 Y 1 B GLU 341 ? CD  ? B GLU 212 CD  
98  1 Y 1 B GLU 341 ? OE1 ? B GLU 212 OE1 
99  1 Y 1 B GLU 341 ? OE2 ? B GLU 212 OE2 
100 1 Y 1 B PHE 342 ? CG  ? B PHE 213 CG  
101 1 Y 1 B PHE 342 ? CD1 ? B PHE 213 CD1 
102 1 Y 1 B PHE 342 ? CD2 ? B PHE 213 CD2 
103 1 Y 1 B PHE 342 ? CE1 ? B PHE 213 CE1 
104 1 Y 1 B PHE 342 ? CE2 ? B PHE 213 CE2 
105 1 Y 1 B PHE 342 ? CZ  ? B PHE 213 CZ  
106 1 Y 1 B ARG 345 ? CG  ? B ARG 216 CG  
107 1 Y 1 B ARG 345 ? CD  ? B ARG 216 CD  
108 1 Y 1 B ARG 345 ? NE  ? B ARG 216 NE  
109 1 Y 1 B ARG 345 ? CZ  ? B ARG 216 CZ  
110 1 Y 1 B ARG 345 ? NH1 ? B ARG 216 NH1 
111 1 Y 1 B ARG 345 ? NH2 ? B ARG 216 NH2 
112 1 Y 1 B PHE 346 ? CG  ? B PHE 217 CG  
113 1 Y 1 B PHE 346 ? CD1 ? B PHE 217 CD1 
114 1 Y 1 B PHE 346 ? CD2 ? B PHE 217 CD2 
115 1 Y 1 B PHE 346 ? CE1 ? B PHE 217 CE1 
116 1 Y 1 B PHE 346 ? CE2 ? B PHE 217 CE2 
117 1 Y 1 B PHE 346 ? CZ  ? B PHE 217 CZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 130 ? A GLY 1   
2  1 Y 1 A PRO 131 ? A PRO 2   
3  1 Y 1 A LEU 132 ? A LEU 3   
4  1 Y 1 A GLY 133 ? A GLY 4   
5  1 Y 1 A SER 134 ? A SER 5   
6  1 Y 1 A PRO 135 ? A PRO 6   
7  1 Y 1 A GLU 323 ? A GLU 194 
8  1 Y 1 A MET 324 ? A MET 195 
9  1 Y 1 A THR 325 ? A THR 196 
10 1 Y 1 A LYS 326 ? A LYS 197 
11 1 Y 1 A TYR 327 ? A TYR 198 
12 1 Y 1 A LYS 328 ? A LYS 199 
13 1 Y 1 A PRO 329 ? A PRO 200 
14 1 Y 1 A GLU 330 ? A GLU 201 
15 1 Y 1 A SER 331 ? A SER 202 
16 1 Y 1 A GLU 332 ? A GLU 203 
17 1 Y 1 A GLU 333 ? A GLU 204 
18 1 Y 1 A LEU 334 ? A LEU 205 
19 1 Y 1 A GLU 348 ? A GLU 219 
20 1 Y 1 A GLY 349 ? A GLY 220 
21 1 Y 1 A LYS 350 ? A LYS 221 
22 1 Y 1 A ILE 351 ? A ILE 222 
23 1 Y 1 A LYS 352 ? A LYS 223 
24 1 Y 1 A PRO 353 ? A PRO 224 
25 1 Y 1 A HIS 354 ? A HIS 225 
26 1 Y 1 A LEU 355 ? A LEU 226 
27 1 Y 1 A MET 356 ? A MET 227 
28 1 Y 1 A SER 357 ? A SER 228 
29 1 Y 1 A GLN 358 ? A GLN 229 
30 1 Y 1 A GLU 359 ? A GLU 230 
31 1 Y 1 A LEU 360 ? A LEU 231 
32 1 Y 1 A PRO 361 ? A PRO 232 
33 1 Y 1 A GLU 362 ? A GLU 233 
34 1 Y 1 A ASP 363 ? A ASP 234 
35 1 Y 1 A TRP 364 ? A TRP 235 
36 1 Y 1 A ASP 365 ? A ASP 236 
37 1 Y 1 A LYS 366 ? A LYS 237 
38 1 Y 1 A GLN 367 ? A GLN 238 
39 1 Y 1 B GLY 130 ? B GLY 1   
40 1 Y 1 B PRO 131 ? B PRO 2   
41 1 Y 1 B LEU 132 ? B LEU 3   
42 1 Y 1 B GLY 133 ? B GLY 4   
43 1 Y 1 B SER 134 ? B SER 5   
44 1 Y 1 B PRO 135 ? B PRO 6   
45 1 Y 1 B GLU 322 ? B GLU 193 
46 1 Y 1 B GLU 323 ? B GLU 194 
47 1 Y 1 B MET 324 ? B MET 195 
48 1 Y 1 B THR 325 ? B THR 196 
49 1 Y 1 B LYS 326 ? B LYS 197 
50 1 Y 1 B TYR 327 ? B TYR 198 
51 1 Y 1 B LYS 328 ? B LYS 199 
52 1 Y 1 B PRO 329 ? B PRO 200 
53 1 Y 1 B GLU 330 ? B GLU 201 
54 1 Y 1 B SER 331 ? B SER 202 
55 1 Y 1 B GLU 332 ? B GLU 203 
56 1 Y 1 B GLU 333 ? B GLU 204 
57 1 Y 1 B LEU 334 ? B LEU 205 
58 1 Y 1 B THR 335 ? B THR 206 
59 1 Y 1 B ALA 336 ? B ALA 207 
60 1 Y 1 B GLU 348 ? B GLU 219 
61 1 Y 1 B GLY 349 ? B GLY 220 
62 1 Y 1 B LYS 350 ? B LYS 221 
63 1 Y 1 B ILE 351 ? B ILE 222 
64 1 Y 1 B LYS 352 ? B LYS 223 
65 1 Y 1 B PRO 353 ? B PRO 224 
66 1 Y 1 B HIS 354 ? B HIS 225 
67 1 Y 1 B LEU 355 ? B LEU 226 
68 1 Y 1 B MET 356 ? B MET 227 
69 1 Y 1 B SER 357 ? B SER 228 
70 1 Y 1 B GLN 358 ? B GLN 229 
71 1 Y 1 B GLU 359 ? B GLU 230 
72 1 Y 1 B LEU 360 ? B LEU 231 
73 1 Y 1 B PRO 361 ? B PRO 232 
74 1 Y 1 B GLU 362 ? B GLU 233 
75 1 Y 1 B ASP 363 ? B ASP 234 
76 1 Y 1 B TRP 364 ? B TRP 235 
77 1 Y 1 B ASP 365 ? B ASP 236 
78 1 Y 1 B LYS 366 ? B LYS 237 
79 1 Y 1 B GLN 367 ? B GLN 238 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#