data_4JUO
# 
_entry.id   4JUO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4JUO         
NDB   NA2327       
RCSB  RCSB078526   
WWPDB D_1000078526 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4I3H 'A three-gate structure of topoisomerase IV from Streptococcus pneumoniae (high resolution, space group P42212)' 
unspecified 
PDB 3RAD 'Quinolone(Clinafloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'                      
unspecified 
PDB 3RAE 'Quinolone(Levofloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'                       
unspecified 
PDB 3RAF 'Quinazolinedione-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'                              
unspecified 
PDB 3KSA 'Detailed structural insight into the DNA cleavage complex of type IIA topoisomerases (cleaved form)'            
unspecified 
PDB 3KSB 'Detailed structural insight into the DNA cleavage complex of type IIA topoisomerases (re-sealed form)'          
unspecified 
PDB 3LTN 'Inhibitor-stabilized topoisomerase IV-DNA cleavage complex (S. pneumoniae)'                                     
unspecified 
PDB 3K9F 'Detailed structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases'                 
unspecified 
PDB 3FOE 'Structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases'                          
unspecified 
PDB 3FOF 'Structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases'                          
unspecified 
PDB 2NOV 'Breakage-reunion domain of S.pneumoniae topo IV: crystal structure of a gram-positive quinolone target'         
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4JUO 
_pdbx_database_status.recvd_initial_deposition_date   2013-03-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Laponogov, I.'   1 
'Veselkov, D.A.'  2 
'Pan, X.-S.'      3 
'Crevel, I.'      4 
'Fisher, L.M.'    5 
'Sanderson, M.R.' 6 
# 
_citation.id                        primary 
_citation.title                     
;Structure of an 'open' clamp type II topoisomerase-DNA complex provides a mechanism for DNA capture and transport.
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            41 
_citation.page_first                9911 
_citation.page_last                 9923 
_citation.year                      2013 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23965305 
_citation.pdbx_database_id_DOI      10.1093/nar/gkt749 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Laponogov, I.'   1 
primary 'Veselkov, D.A.'  2 
primary 'Crevel, I.M.'    3 
primary 'Pan, X.S.'       4 
primary 'Fisher, L.M.'    5 
primary 'Sanderson, M.R.' 6 
# 
_cell.entry_id           4JUO 
_cell.length_a           213.580 
_cell.length_b           213.580 
_cell.length_c           211.830 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4JUO 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA topoisomerase 4 subunit A' 56455.434 1 5.99.1.3 ? ParC55 ? 
2 polymer     man 'DNA topoisomerase 4 subunit B' 74528.180 1 5.99.1.3 ? ParE   ? 
3 polymer     syn 'E-site DNA' 3397.247  1 ?        ? ?      ? 
4 polymer     syn 'E-site DNA' 4543.972  1 ?        ? ?      ? 
5 polymer     syn 'E-site DNA' 3339.195  1 ?        ? ?      ? 
6 polymer     syn 'E-site DNA' 4602.025  1 ?        ? ?      ? 
7 non-polymer syn 'MAGNESIUM ION' 24.305    2 ?        ? ?      ? 
8 non-polymer syn 
'(3S)-9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid' 
361.368   1 ?        ? ?      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Topoisomerase IV subunit A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
A ? 
2 'polypeptide(L)'        no no 
;MGHHHHHHHHHHSSGHIDDDDKHMSKKEININNYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEAL
SGFGDRIDVTINKDGSLTVQDHGRGMPTGMHAMGIPTVEVIFTILHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVE
ITRDGAVYKQRFENGGKPVTTLKKIGTAPKSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTD
EAIEFHYENGVQDFVSYLNEDKEILTPVLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTKDGGTHETGLKSAITKV
MNDYARKTGLLKEKDKNLEGSDYREGLAAVLSILVPEEHLQFEGQTKDKLGSPLARPVVDGIVADKLTFFLMENGELASN
LIRKAIKARDAREAARKARDESRNGKKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRG
KVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYI
ALPPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERR
VNVLMGDKVEPRRKWIEDNVKFTLEEATVF
;
;MGHHHHHHHHHHSSGHIDDDDKHMSKKEININNYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEAL
SGFGDRIDVTINKDGSLTVQDHGRGMPTGMHAMGIPTVEVIFTILHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVE
ITRDGAVYKQRFENGGKPVTTLKKIGTAPKSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTD
EAIEFHYENGVQDFVSYLNEDKEILTPVLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTKDGGTHETGLKSAITKV
MNDYARKTGLLKEKDKNLEGSDYREGLAAVLSILVPEEHLQFEGQTKDKLGSPLARPVVDGIVADKLTFFLMENGELASN
LIRKAIKARDAREAARKARDESRNGKKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRG
KVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYI
ALPPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERR
VNVLMGDKVEPRRKWIEDNVKFTLEEATVF
;
C ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DG)(DT)(DC)(DA)(DT)(DG)(DA)(DA)(DT)' AGGTCATGAAT E ? 
4 polydeoxyribonucleotide no no '(DA)(DG)(DT)(DC)(DA)(DT)(DT)(DC)(DA)(DT)(DG)(DA)(DC)(DC)(DT)' AGTCATTCATGACCT F ? 
5 polydeoxyribonucleotide no no '(DT)(DT)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DA)(DT)' TTTACGTGCAT G ? 
6 polydeoxyribonucleotide no no '(DG)(DA)(DC)(DT)(DA)(DT)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DA)(DA)' GACTATGCACGTAAA H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   GLN n 
1 6   ASN n 
1 7   MET n 
1 8   SER n 
1 9   LEU n 
1 10  GLU n 
1 11  ASP n 
1 12  ILE n 
1 13  MET n 
1 14  GLY n 
1 15  GLU n 
1 16  ARG n 
1 17  PHE n 
1 18  GLY n 
1 19  ARG n 
1 20  TYR n 
1 21  SER n 
1 22  LYS n 
1 23  TYR n 
1 24  ILE n 
1 25  ILE n 
1 26  GLN n 
1 27  ASP n 
1 28  ARG n 
1 29  ALA n 
1 30  LEU n 
1 31  PRO n 
1 32  ASP n 
1 33  ILE n 
1 34  ARG n 
1 35  ASP n 
1 36  GLY n 
1 37  LEU n 
1 38  LYS n 
1 39  PRO n 
1 40  VAL n 
1 41  GLN n 
1 42  ARG n 
1 43  ARG n 
1 44  ILE n 
1 45  LEU n 
1 46  TYR n 
1 47  SER n 
1 48  MET n 
1 49  ASN n 
1 50  LYS n 
1 51  ASP n 
1 52  SER n 
1 53  ASN n 
1 54  THR n 
1 55  PHE n 
1 56  ASP n 
1 57  LYS n 
1 58  SER n 
1 59  TYR n 
1 60  ARG n 
1 61  LYS n 
1 62  SER n 
1 63  ALA n 
1 64  LYS n 
1 65  SER n 
1 66  VAL n 
1 67  GLY n 
1 68  ASN n 
1 69  ILE n 
1 70  MET n 
1 71  GLY n 
1 72  ASN n 
1 73  PHE n 
1 74  HIS n 
1 75  PRO n 
1 76  HIS n 
1 77  GLY n 
1 78  ASP n 
1 79  SER n 
1 80  SER n 
1 81  ILE n 
1 82  TYR n 
1 83  ASP n 
1 84  ALA n 
1 85  MET n 
1 86  VAL n 
1 87  ARG n 
1 88  MET n 
1 89  SER n 
1 90  GLN n 
1 91  ASN n 
1 92  TRP n 
1 93  LYS n 
1 94  ASN n 
1 95  ARG n 
1 96  GLU n 
1 97  ILE n 
1 98  LEU n 
1 99  VAL n 
1 100 GLU n 
1 101 MET n 
1 102 HIS n 
1 103 GLY n 
1 104 ASN n 
1 105 ASN n 
1 106 GLY n 
1 107 SER n 
1 108 MET n 
1 109 ASP n 
1 110 GLY n 
1 111 ASP n 
1 112 PRO n 
1 113 PRO n 
1 114 ALA n 
1 115 ALA n 
1 116 MET n 
1 117 ARG n 
1 118 TYR n 
1 119 THR n 
1 120 GLU n 
1 121 ALA n 
1 122 ARG n 
1 123 LEU n 
1 124 SER n 
1 125 GLU n 
1 126 ILE n 
1 127 ALA n 
1 128 GLY n 
1 129 TYR n 
1 130 LEU n 
1 131 LEU n 
1 132 GLN n 
1 133 ASP n 
1 134 ILE n 
1 135 GLU n 
1 136 LYS n 
1 137 LYS n 
1 138 THR n 
1 139 VAL n 
1 140 PRO n 
1 141 PHE n 
1 142 ALA n 
1 143 TRP n 
1 144 ASN n 
1 145 PHE n 
1 146 ASP n 
1 147 ASP n 
1 148 THR n 
1 149 GLU n 
1 150 LYS n 
1 151 GLU n 
1 152 PRO n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 PRO n 
1 157 ALA n 
1 158 ALA n 
1 159 PHE n 
1 160 PRO n 
1 161 ASN n 
1 162 LEU n 
1 163 LEU n 
1 164 VAL n 
1 165 ASN n 
1 166 GLY n 
1 167 SER n 
1 168 THR n 
1 169 GLY n 
1 170 ILE n 
1 171 SER n 
1 172 ALA n 
1 173 GLY n 
1 174 TYR n 
1 175 ALA n 
1 176 THR n 
1 177 ASP n 
1 178 ILE n 
1 179 PRO n 
1 180 PRO n 
1 181 HIS n 
1 182 ASN n 
1 183 LEU n 
1 184 ALA n 
1 185 GLU n 
1 186 VAL n 
1 187 ILE n 
1 188 ASP n 
1 189 ALA n 
1 190 ALA n 
1 191 VAL n 
1 192 TYR n 
1 193 MET n 
1 194 ILE n 
1 195 ASP n 
1 196 HIS n 
1 197 PRO n 
1 198 THR n 
1 199 ALA n 
1 200 LYS n 
1 201 ILE n 
1 202 ASP n 
1 203 LYS n 
1 204 LEU n 
1 205 MET n 
1 206 GLU n 
1 207 PHE n 
1 208 LEU n 
1 209 PRO n 
1 210 GLY n 
1 211 PRO n 
1 212 ASP n 
1 213 PHE n 
1 214 PRO n 
1 215 THR n 
1 216 GLY n 
1 217 ALA n 
1 218 ILE n 
1 219 ILE n 
1 220 GLN n 
1 221 GLY n 
1 222 ARG n 
1 223 ASP n 
1 224 GLU n 
1 225 ILE n 
1 226 LYS n 
1 227 LYS n 
1 228 ALA n 
1 229 TYR n 
1 230 GLU n 
1 231 THR n 
1 232 GLY n 
1 233 LYS n 
1 234 GLY n 
1 235 ARG n 
1 236 VAL n 
1 237 VAL n 
1 238 VAL n 
1 239 ARG n 
1 240 SER n 
1 241 LYS n 
1 242 THR n 
1 243 GLU n 
1 244 ILE n 
1 245 GLU n 
1 246 LYS n 
1 247 LEU n 
1 248 LYS n 
1 249 GLY n 
1 250 GLY n 
1 251 LYS n 
1 252 GLU n 
1 253 GLN n 
1 254 ILE n 
1 255 VAL n 
1 256 ILE n 
1 257 THR n 
1 258 GLU n 
1 259 ILE n 
1 260 PRO n 
1 261 TYR n 
1 262 GLU n 
1 263 ILE n 
1 264 ASN n 
1 265 LYS n 
1 266 ALA n 
1 267 ASN n 
1 268 LEU n 
1 269 VAL n 
1 270 LYS n 
1 271 LYS n 
1 272 ILE n 
1 273 ASP n 
1 274 ASP n 
1 275 VAL n 
1 276 ARG n 
1 277 VAL n 
1 278 ASN n 
1 279 ASN n 
1 280 LYS n 
1 281 VAL n 
1 282 ALA n 
1 283 GLY n 
1 284 ILE n 
1 285 ALA n 
1 286 GLU n 
1 287 VAL n 
1 288 ARG n 
1 289 ASP n 
1 290 GLU n 
1 291 SER n 
1 292 ASP n 
1 293 ARG n 
1 294 ASP n 
1 295 GLY n 
1 296 LEU n 
1 297 ARG n 
1 298 ILE n 
1 299 ALA n 
1 300 ILE n 
1 301 GLU n 
1 302 LEU n 
1 303 LYS n 
1 304 LYS n 
1 305 ASP n 
1 306 ALA n 
1 307 ASN n 
1 308 THR n 
1 309 GLU n 
1 310 LEU n 
1 311 VAL n 
1 312 LEU n 
1 313 ASN n 
1 314 TYR n 
1 315 LEU n 
1 316 PHE n 
1 317 LYS n 
1 318 TYR n 
1 319 THR n 
1 320 ASP n 
1 321 LEU n 
1 322 GLN n 
1 323 ILE n 
1 324 ASN n 
1 325 TYR n 
1 326 ASN n 
1 327 PHE n 
1 328 ASN n 
1 329 MET n 
1 330 VAL n 
1 331 ALA n 
1 332 ILE n 
1 333 ASP n 
1 334 ASN n 
1 335 PHE n 
1 336 THR n 
1 337 PRO n 
1 338 ARG n 
1 339 GLN n 
1 340 VAL n 
1 341 GLY n 
1 342 ILE n 
1 343 VAL n 
1 344 PRO n 
1 345 ILE n 
1 346 LEU n 
1 347 SER n 
1 348 SER n 
1 349 TYR n 
1 350 ILE n 
1 351 ALA n 
1 352 HIS n 
1 353 ARG n 
1 354 ARG n 
1 355 GLU n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ALA n 
1 360 ARG n 
1 361 SER n 
1 362 ARG n 
1 363 PHE n 
1 364 ASP n 
1 365 LYS n 
1 366 GLU n 
1 367 LYS n 
1 368 ALA n 
1 369 GLU n 
1 370 LYS n 
1 371 ARG n 
1 372 LEU n 
1 373 HIS n 
1 374 ILE n 
1 375 VAL n 
1 376 GLU n 
1 377 GLY n 
1 378 LEU n 
1 379 ILE n 
1 380 ARG n 
1 381 VAL n 
1 382 ILE n 
1 383 SER n 
1 384 ILE n 
1 385 LEU n 
1 386 ASP n 
1 387 GLU n 
1 388 VAL n 
1 389 ILE n 
1 390 ALA n 
1 391 LEU n 
1 392 ILE n 
1 393 ARG n 
1 394 ALA n 
1 395 SER n 
1 396 GLU n 
1 397 ASN n 
1 398 LYS n 
1 399 ALA n 
1 400 ASP n 
1 401 ALA n 
1 402 LYS n 
1 403 GLU n 
1 404 ASN n 
1 405 LEU n 
1 406 LYS n 
1 407 VAL n 
1 408 SER n 
1 409 TYR n 
1 410 ASP n 
1 411 PHE n 
1 412 THR n 
1 413 GLU n 
1 414 GLU n 
1 415 GLN n 
1 416 ALA n 
1 417 GLU n 
1 418 ALA n 
1 419 ILE n 
1 420 VAL n 
1 421 THR n 
1 422 LEU n 
1 423 GLN n 
1 424 LEU n 
1 425 TYR n 
1 426 ARG n 
1 427 LEU n 
1 428 THR n 
1 429 ASN n 
1 430 THR n 
1 431 ASP n 
1 432 VAL n 
1 433 VAL n 
1 434 VAL n 
1 435 LEU n 
1 436 GLN n 
1 437 GLU n 
1 438 GLU n 
1 439 GLU n 
1 440 ALA n 
1 441 GLU n 
1 442 LEU n 
1 443 ARG n 
1 444 GLU n 
1 445 LYS n 
1 446 ILE n 
1 447 ALA n 
1 448 MET n 
1 449 LEU n 
1 450 ALA n 
1 451 ALA n 
1 452 ILE n 
1 453 ILE n 
1 454 GLY n 
1 455 ASP n 
1 456 GLU n 
1 457 ARG n 
1 458 THR n 
1 459 MET n 
1 460 TYR n 
1 461 ASN n 
1 462 LEU n 
1 463 MET n 
1 464 LYS n 
1 465 LYS n 
1 466 GLU n 
1 467 LEU n 
1 468 ARG n 
1 469 GLU n 
1 470 VAL n 
1 471 LYS n 
1 472 LYS n 
1 473 LYS n 
1 474 PHE n 
1 475 ALA n 
1 476 THR n 
1 477 PRO n 
1 478 ARG n 
1 479 LEU n 
1 480 SER n 
1 481 SER n 
1 482 LEU n 
1 483 GLU n 
1 484 ASP n 
1 485 THR n 
1 486 ALA n 
1 487 LYS n 
1 488 ALA n 
1 489 LEU n 
1 490 GLU n 
1 491 HIS n 
1 492 HIS n 
1 493 HIS n 
1 494 HIS n 
1 495 HIS n 
1 496 HIS n 
2 1   MET n 
2 2   GLY n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  HIS n 
2 12  HIS n 
2 13  SER n 
2 14  SER n 
2 15  GLY n 
2 16  HIS n 
2 17  ILE n 
2 18  ASP n 
2 19  ASP n 
2 20  ASP n 
2 21  ASP n 
2 22  LYS n 
2 23  HIS n 
2 24  MET n 
2 25  SER n 
2 26  LYS n 
2 27  LYS n 
2 28  GLU n 
2 29  ILE n 
2 30  ASN n 
2 31  ILE n 
2 32  ASN n 
2 33  ASN n 
2 34  TYR n 
2 35  ASN n 
2 36  ASP n 
2 37  ASP n 
2 38  ALA n 
2 39  ILE n 
2 40  GLN n 
2 41  VAL n 
2 42  LEU n 
2 43  GLU n 
2 44  GLY n 
2 45  LEU n 
2 46  ASP n 
2 47  ALA n 
2 48  VAL n 
2 49  ARG n 
2 50  LYS n 
2 51  ARG n 
2 52  PRO n 
2 53  GLY n 
2 54  MET n 
2 55  TYR n 
2 56  ILE n 
2 57  GLY n 
2 58  SER n 
2 59  THR n 
2 60  ASP n 
2 61  GLY n 
2 62  ALA n 
2 63  GLY n 
2 64  LEU n 
2 65  HIS n 
2 66  HIS n 
2 67  LEU n 
2 68  VAL n 
2 69  TRP n 
2 70  GLU n 
2 71  ILE n 
2 72  VAL n 
2 73  ASP n 
2 74  ASN n 
2 75  ALA n 
2 76  VAL n 
2 77  ASP n 
2 78  GLU n 
2 79  ALA n 
2 80  LEU n 
2 81  SER n 
2 82  GLY n 
2 83  PHE n 
2 84  GLY n 
2 85  ASP n 
2 86  ARG n 
2 87  ILE n 
2 88  ASP n 
2 89  VAL n 
2 90  THR n 
2 91  ILE n 
2 92  ASN n 
2 93  LYS n 
2 94  ASP n 
2 95  GLY n 
2 96  SER n 
2 97  LEU n 
2 98  THR n 
2 99  VAL n 
2 100 GLN n 
2 101 ASP n 
2 102 HIS n 
2 103 GLY n 
2 104 ARG n 
2 105 GLY n 
2 106 MET n 
2 107 PRO n 
2 108 THR n 
2 109 GLY n 
2 110 MET n 
2 111 HIS n 
2 112 ALA n 
2 113 MET n 
2 114 GLY n 
2 115 ILE n 
2 116 PRO n 
2 117 THR n 
2 118 VAL n 
2 119 GLU n 
2 120 VAL n 
2 121 ILE n 
2 122 PHE n 
2 123 THR n 
2 124 ILE n 
2 125 LEU n 
2 126 HIS n 
2 127 ALA n 
2 128 GLY n 
2 129 GLY n 
2 130 LYS n 
2 131 PHE n 
2 132 GLY n 
2 133 GLN n 
2 134 GLY n 
2 135 GLY n 
2 136 TYR n 
2 137 LYS n 
2 138 THR n 
2 139 SER n 
2 140 GLY n 
2 141 GLY n 
2 142 LEU n 
2 143 HIS n 
2 144 GLY n 
2 145 VAL n 
2 146 GLY n 
2 147 SER n 
2 148 SER n 
2 149 VAL n 
2 150 VAL n 
2 151 ASN n 
2 152 ALA n 
2 153 LEU n 
2 154 SER n 
2 155 SER n 
2 156 TRP n 
2 157 LEU n 
2 158 GLU n 
2 159 VAL n 
2 160 GLU n 
2 161 ILE n 
2 162 THR n 
2 163 ARG n 
2 164 ASP n 
2 165 GLY n 
2 166 ALA n 
2 167 VAL n 
2 168 TYR n 
2 169 LYS n 
2 170 GLN n 
2 171 ARG n 
2 172 PHE n 
2 173 GLU n 
2 174 ASN n 
2 175 GLY n 
2 176 GLY n 
2 177 LYS n 
2 178 PRO n 
2 179 VAL n 
2 180 THR n 
2 181 THR n 
2 182 LEU n 
2 183 LYS n 
2 184 LYS n 
2 185 ILE n 
2 186 GLY n 
2 187 THR n 
2 188 ALA n 
2 189 PRO n 
2 190 LYS n 
2 191 SER n 
2 192 LYS n 
2 193 THR n 
2 194 GLY n 
2 195 THR n 
2 196 LYS n 
2 197 VAL n 
2 198 THR n 
2 199 PHE n 
2 200 MET n 
2 201 PRO n 
2 202 ASP n 
2 203 ALA n 
2 204 THR n 
2 205 ILE n 
2 206 PHE n 
2 207 SER n 
2 208 THR n 
2 209 THR n 
2 210 ASP n 
2 211 PHE n 
2 212 LYS n 
2 213 TYR n 
2 214 ASN n 
2 215 THR n 
2 216 ILE n 
2 217 SER n 
2 218 GLU n 
2 219 ARG n 
2 220 LEU n 
2 221 ASN n 
2 222 GLU n 
2 223 SER n 
2 224 ALA n 
2 225 PHE n 
2 226 LEU n 
2 227 LEU n 
2 228 LYS n 
2 229 ASN n 
2 230 VAL n 
2 231 THR n 
2 232 LEU n 
2 233 SER n 
2 234 LEU n 
2 235 THR n 
2 236 ASP n 
2 237 LYS n 
2 238 ARG n 
2 239 THR n 
2 240 ASP n 
2 241 GLU n 
2 242 ALA n 
2 243 ILE n 
2 244 GLU n 
2 245 PHE n 
2 246 HIS n 
2 247 TYR n 
2 248 GLU n 
2 249 ASN n 
2 250 GLY n 
2 251 VAL n 
2 252 GLN n 
2 253 ASP n 
2 254 PHE n 
2 255 VAL n 
2 256 SER n 
2 257 TYR n 
2 258 LEU n 
2 259 ASN n 
2 260 GLU n 
2 261 ASP n 
2 262 LYS n 
2 263 GLU n 
2 264 ILE n 
2 265 LEU n 
2 266 THR n 
2 267 PRO n 
2 268 VAL n 
2 269 LEU n 
2 270 TYR n 
2 271 PHE n 
2 272 GLU n 
2 273 GLY n 
2 274 GLU n 
2 275 ASP n 
2 276 ASN n 
2 277 GLY n 
2 278 PHE n 
2 279 GLN n 
2 280 VAL n 
2 281 GLU n 
2 282 VAL n 
2 283 ALA n 
2 284 LEU n 
2 285 GLN n 
2 286 TYR n 
2 287 ASN n 
2 288 ASP n 
2 289 GLY n 
2 290 PHE n 
2 291 SER n 
2 292 ASP n 
2 293 ASN n 
2 294 ILE n 
2 295 LEU n 
2 296 SER n 
2 297 PHE n 
2 298 VAL n 
2 299 ASN n 
2 300 ASN n 
2 301 VAL n 
2 302 ARG n 
2 303 THR n 
2 304 LYS n 
2 305 ASP n 
2 306 GLY n 
2 307 GLY n 
2 308 THR n 
2 309 HIS n 
2 310 GLU n 
2 311 THR n 
2 312 GLY n 
2 313 LEU n 
2 314 LYS n 
2 315 SER n 
2 316 ALA n 
2 317 ILE n 
2 318 THR n 
2 319 LYS n 
2 320 VAL n 
2 321 MET n 
2 322 ASN n 
2 323 ASP n 
2 324 TYR n 
2 325 ALA n 
2 326 ARG n 
2 327 LYS n 
2 328 THR n 
2 329 GLY n 
2 330 LEU n 
2 331 LEU n 
2 332 LYS n 
2 333 GLU n 
2 334 LYS n 
2 335 ASP n 
2 336 LYS n 
2 337 ASN n 
2 338 LEU n 
2 339 GLU n 
2 340 GLY n 
2 341 SER n 
2 342 ASP n 
2 343 TYR n 
2 344 ARG n 
2 345 GLU n 
2 346 GLY n 
2 347 LEU n 
2 348 ALA n 
2 349 ALA n 
2 350 VAL n 
2 351 LEU n 
2 352 SER n 
2 353 ILE n 
2 354 LEU n 
2 355 VAL n 
2 356 PRO n 
2 357 GLU n 
2 358 GLU n 
2 359 HIS n 
2 360 LEU n 
2 361 GLN n 
2 362 PHE n 
2 363 GLU n 
2 364 GLY n 
2 365 GLN n 
2 366 THR n 
2 367 LYS n 
2 368 ASP n 
2 369 LYS n 
2 370 LEU n 
2 371 GLY n 
2 372 SER n 
2 373 PRO n 
2 374 LEU n 
2 375 ALA n 
2 376 ARG n 
2 377 PRO n 
2 378 VAL n 
2 379 VAL n 
2 380 ASP n 
2 381 GLY n 
2 382 ILE n 
2 383 VAL n 
2 384 ALA n 
2 385 ASP n 
2 386 LYS n 
2 387 LEU n 
2 388 THR n 
2 389 PHE n 
2 390 PHE n 
2 391 LEU n 
2 392 MET n 
2 393 GLU n 
2 394 ASN n 
2 395 GLY n 
2 396 GLU n 
2 397 LEU n 
2 398 ALA n 
2 399 SER n 
2 400 ASN n 
2 401 LEU n 
2 402 ILE n 
2 403 ARG n 
2 404 LYS n 
2 405 ALA n 
2 406 ILE n 
2 407 LYS n 
2 408 ALA n 
2 409 ARG n 
2 410 ASP n 
2 411 ALA n 
2 412 ARG n 
2 413 GLU n 
2 414 ALA n 
2 415 ALA n 
2 416 ARG n 
2 417 LYS n 
2 418 ALA n 
2 419 ARG n 
2 420 ASP n 
2 421 GLU n 
2 422 SER n 
2 423 ARG n 
2 424 ASN n 
2 425 GLY n 
2 426 LYS n 
2 427 LYS n 
2 428 ASN n 
2 429 LYS n 
2 430 LYS n 
2 431 ASP n 
2 432 LYS n 
2 433 GLY n 
2 434 LEU n 
2 435 LEU n 
2 436 SER n 
2 437 GLY n 
2 438 LYS n 
2 439 LEU n 
2 440 THR n 
2 441 PRO n 
2 442 ALA n 
2 443 GLN n 
2 444 SER n 
2 445 LYS n 
2 446 ASN n 
2 447 PRO n 
2 448 ALA n 
2 449 LYS n 
2 450 ASN n 
2 451 GLU n 
2 452 LEU n 
2 453 TYR n 
2 454 LEU n 
2 455 VAL n 
2 456 GLU n 
2 457 GLY n 
2 458 ASP n 
2 459 SER n 
2 460 ALA n 
2 461 GLY n 
2 462 GLY n 
2 463 SER n 
2 464 ALA n 
2 465 LYS n 
2 466 GLN n 
2 467 GLY n 
2 468 ARG n 
2 469 ASP n 
2 470 ARG n 
2 471 LYS n 
2 472 PHE n 
2 473 GLN n 
2 474 ALA n 
2 475 ILE n 
2 476 LEU n 
2 477 PRO n 
2 478 LEU n 
2 479 ARG n 
2 480 GLY n 
2 481 LYS n 
2 482 VAL n 
2 483 ILE n 
2 484 ASN n 
2 485 THR n 
2 486 ALA n 
2 487 LYS n 
2 488 ALA n 
2 489 LYS n 
2 490 MET n 
2 491 ALA n 
2 492 ASP n 
2 493 ILE n 
2 494 LEU n 
2 495 LYS n 
2 496 ASN n 
2 497 GLU n 
2 498 GLU n 
2 499 ILE n 
2 500 ASN n 
2 501 THR n 
2 502 MET n 
2 503 ILE n 
2 504 TYR n 
2 505 THR n 
2 506 ILE n 
2 507 GLY n 
2 508 ALA n 
2 509 GLY n 
2 510 VAL n 
2 511 GLY n 
2 512 ALA n 
2 513 ASP n 
2 514 PHE n 
2 515 SER n 
2 516 ILE n 
2 517 GLU n 
2 518 ASP n 
2 519 ALA n 
2 520 ASN n 
2 521 TYR n 
2 522 ASP n 
2 523 LYS n 
2 524 ILE n 
2 525 ILE n 
2 526 ILE n 
2 527 MET n 
2 528 THR n 
2 529 ASP n 
2 530 ALA n 
2 531 ASP n 
2 532 THR n 
2 533 ASP n 
2 534 GLY n 
2 535 ALA n 
2 536 HIS n 
2 537 ILE n 
2 538 GLN n 
2 539 THR n 
2 540 LEU n 
2 541 LEU n 
2 542 LEU n 
2 543 THR n 
2 544 PHE n 
2 545 PHE n 
2 546 TYR n 
2 547 ARG n 
2 548 TYR n 
2 549 MET n 
2 550 ARG n 
2 551 PRO n 
2 552 LEU n 
2 553 VAL n 
2 554 GLU n 
2 555 ALA n 
2 556 GLY n 
2 557 HIS n 
2 558 VAL n 
2 559 TYR n 
2 560 ILE n 
2 561 ALA n 
2 562 LEU n 
2 563 PRO n 
2 564 PRO n 
2 565 LEU n 
2 566 TYR n 
2 567 LYS n 
2 568 MET n 
2 569 SER n 
2 570 LYS n 
2 571 GLY n 
2 572 LYS n 
2 573 GLY n 
2 574 LYS n 
2 575 LYS n 
2 576 GLU n 
2 577 GLU n 
2 578 VAL n 
2 579 ALA n 
2 580 TYR n 
2 581 ALA n 
2 582 TRP n 
2 583 THR n 
2 584 ASP n 
2 585 GLY n 
2 586 GLU n 
2 587 LEU n 
2 588 GLU n 
2 589 GLU n 
2 590 LEU n 
2 591 ARG n 
2 592 LYS n 
2 593 GLN n 
2 594 PHE n 
2 595 GLY n 
2 596 LYS n 
2 597 GLY n 
2 598 ALA n 
2 599 THR n 
2 600 LEU n 
2 601 GLN n 
2 602 ARG n 
2 603 TYR n 
2 604 LYS n 
2 605 GLY n 
2 606 LEU n 
2 607 GLY n 
2 608 GLU n 
2 609 MET n 
2 610 ASN n 
2 611 ALA n 
2 612 ASP n 
2 613 GLN n 
2 614 LEU n 
2 615 TRP n 
2 616 GLU n 
2 617 THR n 
2 618 THR n 
2 619 MET n 
2 620 ASN n 
2 621 PRO n 
2 622 GLU n 
2 623 THR n 
2 624 ARG n 
2 625 THR n 
2 626 LEU n 
2 627 ILE n 
2 628 ARG n 
2 629 VAL n 
2 630 THR n 
2 631 ILE n 
2 632 GLU n 
2 633 ASP n 
2 634 LEU n 
2 635 ALA n 
2 636 ARG n 
2 637 ALA n 
2 638 GLU n 
2 639 ARG n 
2 640 ARG n 
2 641 VAL n 
2 642 ASN n 
2 643 VAL n 
2 644 LEU n 
2 645 MET n 
2 646 GLY n 
2 647 ASP n 
2 648 LYS n 
2 649 VAL n 
2 650 GLU n 
2 651 PRO n 
2 652 ARG n 
2 653 ARG n 
2 654 LYS n 
2 655 TRP n 
2 656 ILE n 
2 657 GLU n 
2 658 ASP n 
2 659 ASN n 
2 660 VAL n 
2 661 LYS n 
2 662 PHE n 
2 663 THR n 
2 664 LEU n 
2 665 GLU n 
2 666 GLU n 
2 667 ALA n 
2 668 THR n 
2 669 VAL n 
2 670 PHE n 
3 1   DA  n 
3 2   DG  n 
3 3   DG  n 
3 4   DT  n 
3 5   DC  n 
3 6   DA  n 
3 7   DT  n 
3 8   DG  n 
3 9   DA  n 
3 10  DA  n 
3 11  DT  n 
4 1   DA  n 
4 2   DG  n 
4 3   DT  n 
4 4   DC  n 
4 5   DA  n 
4 6   DT  n 
4 7   DT  n 
4 8   DC  n 
4 9   DA  n 
4 10  DT  n 
4 11  DG  n 
4 12  DA  n 
4 13  DC  n 
4 14  DC  n 
4 15  DT  n 
5 1   DT  n 
5 2   DT  n 
5 3   DT  n 
5 4   DA  n 
5 5   DC  n 
5 6   DG  n 
5 7   DT  n 
5 8   DG  n 
5 9   DC  n 
5 10  DA  n 
5 11  DT  n 
6 1   DG  n 
6 2   DA  n 
6 3   DC  n 
6 4   DT  n 
6 5   DA  n 
6 6   DT  n 
6 7   DG  n 
6 8   DC  n 
6 9   DA  n 
6 10  DC  n 
6 11  DG  n 
6 12  DT  n 
6 13  DA  n 
6 14  DA  n 
6 15  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? 'parC, SP_0855' ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 'Streptococcus pneumoniae'            170187 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? ? parE            ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 'Streptococcus pneumoniae serotype 4' 170187 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PARC_STRPN P72525 1 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVIIEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKA
;
1 ? 
2 UNP PARE_STRPN Q59961 2 
;MSKKEININNYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEALSGFGDRIDVTINKDGSLTVQDHG
RGMPTGMHAMGIPTVEVIFTILHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVEITRDGAVYKQRFENGGKPVTTLK
KIGTAPKSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTNEAIEFHYENGVQDFVSYLNEDKE
ILTPVLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTKDGGTHETGLKSAITKVMNDYARKTGLLKEKDKNLEGSDY
REGLAAVLSILVPEEHLQFEGQTKDKLGSPLARPVVDGIVADKLTFFLMENGELASNLIRKAIKARDAREAARKARDESR
NGKKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVVNTAKAKMADILKNEEINTMI
YTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWT
DGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
LEETTVF
;
1 ? 
3 PDB 4JUO       4JUO   3 AGGTCATGAAT ? ? 
4 PDB 4JUO       4JUO   4 AGTCATTCATGACCT ? ? 
5 PDB 4JUO       4JUO   5 TTTACGTGCAT ? ? 
6 PDB 4JUO       4JUO   6 GACTATGCACGTAAA ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4JUO A 1  ? 488 ? P72525 1 ? 488 ? 1 488 
2 2 4JUO C 24 ? 670 ? Q59961 1 ? 647 ? 1 647 
3 3 4JUO E 1  ? 11  ? 4JUO   5 ? 15  ? 5 15  
4 4 4JUO F 1  ? 15  ? 4JUO   1 ? 15  ? 1 15  
5 5 4JUO G 1  ? 11  ? 4JUO   5 ? 15  ? 5 15  
6 6 4JUO H 1  ? 15  ? 4JUO   1 ? 15  ? 1 15  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4JUO THR A 257 ? UNP P72525 ILE 257 CONFLICT         257 1  
1 4JUO LEU A 489 ? UNP P72525 ?   ?   'EXPRESSION TAG' 489 2  
1 4JUO GLU A 490 ? UNP P72525 ?   ?   'EXPRESSION TAG' 490 3  
1 4JUO HIS A 491 ? UNP P72525 ?   ?   'EXPRESSION TAG' 491 4  
1 4JUO HIS A 492 ? UNP P72525 ?   ?   'EXPRESSION TAG' 492 5  
1 4JUO HIS A 493 ? UNP P72525 ?   ?   'EXPRESSION TAG' 493 6  
1 4JUO HIS A 494 ? UNP P72525 ?   ?   'EXPRESSION TAG' 494 7  
1 4JUO HIS A 495 ? UNP P72525 ?   ?   'EXPRESSION TAG' 495 8  
1 4JUO HIS A 496 ? UNP P72525 ?   ?   'EXPRESSION TAG' 496 9  
2 4JUO MET C 1   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -22 10 
2 4JUO GLY C 2   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -21 11 
2 4JUO HIS C 3   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -20 12 
2 4JUO HIS C 4   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -19 13 
2 4JUO HIS C 5   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -18 14 
2 4JUO HIS C 6   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -17 15 
2 4JUO HIS C 7   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -16 16 
2 4JUO HIS C 8   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -15 17 
2 4JUO HIS C 9   ? UNP Q59961 ?   ?   'EXPRESSION TAG' -14 18 
2 4JUO HIS C 10  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -13 19 
2 4JUO HIS C 11  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -12 20 
2 4JUO HIS C 12  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -11 21 
2 4JUO SER C 13  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -10 22 
2 4JUO SER C 14  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -9  23 
2 4JUO GLY C 15  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -8  24 
2 4JUO HIS C 16  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -7  25 
2 4JUO ILE C 17  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -6  26 
2 4JUO ASP C 18  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -5  27 
2 4JUO ASP C 19  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -4  28 
2 4JUO ASP C 20  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -3  29 
2 4JUO ASP C 21  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -2  30 
2 4JUO LYS C 22  ? UNP Q59961 ?   ?   'EXPRESSION TAG' -1  31 
2 4JUO HIS C 23  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 0   32 
2 4JUO ASP C 240 ? UNP Q59961 ASN 217 CONFLICT         217 33 
2 4JUO ILE C 483 ? UNP Q59961 VAL 460 CONFLICT         460 34 
2 4JUO ALA C 667 ? UNP Q59961 THR 644 CONFLICT         644 35 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?            'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?            'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?            'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?            'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?            'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?            'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?            'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?            'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ?            'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?            'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?            'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?            'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE ?            'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?            'C6 H13 N O2'     131.173 
LFX non-polymer         . 
'(3S)-9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid' 
Levofloxacin 'C18 H20 F N3 O4' 361.368 
LYS 'L-peptide linking' y LYSINE ?            'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?            'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?            'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?            'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?            'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?            'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?            'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?            'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?            'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?            'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4JUO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.density_percent_sol   61.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'3-4% isopropanol, 50 mM Na cacodylate, optimised mixture of salts, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-09-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97630 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97630 
# 
_reflns.entry_id                     4JUO 
_reflns.observed_criterion_sigma_I   -1 
_reflns.observed_criterion_sigma_F   -1 
_reflns.d_resolution_low             53.4 
_reflns.d_resolution_high            6.53 
_reflns.number_obs                   3701 
_reflns.number_all                   3718 
_reflns.percent_possible_obs         99.24 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.84 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.66 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             6.53 
_reflns_shell.d_res_low              6.71 
_reflns_shell.percent_possible_all   99.66 
_reflns_shell.Rmerge_I_obs           0.41 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.88 
_reflns_shell.pdbx_redundancy        10.93 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      309 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4JUO 
_refine.ls_number_reflns_obs                     3701 
_refine.ls_number_reflns_all                     3718 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.442 
_refine.ls_d_res_high                            6.53 
_refine.ls_percent_reflns_obs                    99.14 
_refine.ls_R_factor_obs                          0.2498 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2474 
_refine.ls_R_factor_R_free                       0.2982 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.57 
_refine.ls_number_reflns_R_free                  169 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'Refinement has been limited to rigid body and TLS refinement only due to the low resolution' 
_refine.pdbx_starting_model                      'PDB ENTRY 3RAE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.88 
_refine.pdbx_overall_phase_error                 40.82 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7498 
_refine_hist.pdbx_number_atoms_nucleic_acid   730 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8256 
_refine_hist.d_res_high                       6.53 
_refine_hist.d_res_low                        46.442 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.017  ? ? 8469  ? 'X-RAY DIFFRACTION' 
f_angle_d          1.491  ? ? 11661 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 18.670 ? ? 3005  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.084  ? ? 1362  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.007  ? ? 1394  ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4JUO 
_struct.title                     
'A low-resolution three-gate structure of topoisomerase IV from Streptococcus pneumoniae in space group H32' 
_struct.pdbx_descriptor           'DNA topoisomerase 4 subunit A (E.C.5.99.1.3), DNA topoisomerase 4 subunit B (E.C.5.99.1.3)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4JUO 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA 
_struct_keywords.text            'full-length ParE, ParC55, open N-gate, topoisomerase IIa, ATP binding, ISOMERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 9   ? ARG A 28  ? LEU A 9   ARG A 28  1 ? 20 
HELX_P HELX_P2  2  LYS A 38  ? ASP A 51  ? LYS A 38  ASP A 51  1 ? 14 
HELX_P HELX_P3  3  SER A 62  ? PHE A 73  ? SER A 62  PHE A 73  1 ? 12 
HELX_P HELX_P4  4  GLY A 77  ? MET A 88  ? GLY A 77  MET A 88  1 ? 12 
HELX_P HELX_P5  5  SER A 124 ? GLN A 132 ? SER A 124 GLN A 132 1 ? 9  
HELX_P HELX_P6  6  ASP A 133 ? LYS A 137 ? ASP A 133 LYS A 137 5 ? 5  
HELX_P HELX_P7  7  PRO A 160 ? GLY A 166 ? PRO A 160 GLY A 166 1 ? 7  
HELX_P HELX_P8  8  ASN A 182 ? HIS A 196 ? ASN A 182 HIS A 196 1 ? 15 
HELX_P HELX_P9  9  LYS A 200 ? MET A 205 ? LYS A 200 MET A 205 1 ? 6  
HELX_P HELX_P10 10 GLY A 221 ? GLY A 232 ? GLY A 221 GLY A 232 1 ? 12 
HELX_P HELX_P11 11 ASN A 264 ? ASN A 279 ? ASN A 264 ASN A 279 1 ? 16 
HELX_P HELX_P12 12 ASN A 307 ? THR A 319 ? ASN A 307 THR A 319 1 ? 13 
HELX_P HELX_P13 13 VAL A 343 ? ILE A 384 ? VAL A 343 ILE A 384 1 ? 42 
HELX_P HELX_P14 14 ILE A 384 ? SER A 395 ? ILE A 384 SER A 395 1 ? 12 
HELX_P HELX_P15 15 ASN A 397 ? ASP A 410 ? ASN A 397 ASP A 410 1 ? 14 
HELX_P HELX_P16 16 THR A 412 ? THR A 421 ? THR A 412 THR A 421 1 ? 10 
HELX_P HELX_P17 17 GLN A 423 ? ASN A 429 ? GLN A 423 ASN A 429 5 ? 7  
HELX_P HELX_P18 18 VAL A 432 ? ASP A 455 ? VAL A 432 ASP A 455 1 ? 24 
HELX_P HELX_P19 19 GLU A 456 ? PHE A 474 ? GLU A 456 PHE A 474 1 ? 19 
HELX_P HELX_P20 20 ARG B 51  ? ILE B 56  ? ARG C 28  ILE C 33  1 ? 6  
HELX_P HELX_P21 21 GLY B 63  ? SER B 81  ? GLY C 40  SER C 58  1 ? 19 
HELX_P HELX_P22 22 VAL B 118 ? ILE B 124 ? VAL C 95  ILE C 101 1 ? 7  
HELX_P HELX_P23 23 SER B 148 ? LEU B 153 ? SER C 125 LEU C 130 1 ? 6  
HELX_P HELX_P24 24 LYS B 212 ? PHE B 225 ? LYS C 189 PHE C 202 1 ? 14 
HELX_P HELX_P25 25 GLN B 252 ? ASN B 259 ? GLN C 229 ASN C 236 1 ? 8  
HELX_P HELX_P26 26 GLY B 307 ? LYS B 327 ? GLY C 284 LYS C 304 1 ? 21 
HELX_P HELX_P27 27 GLY B 340 ? GLU B 345 ? GLY C 317 GLU C 322 5 ? 6  
HELX_P HELX_P28 28 LEU B 374 ? ASN B 394 ? LEU C 351 ASN C 371 1 ? 21 
HELX_P HELX_P29 29 GLY B 395 ? LYS B 417 ? GLY C 372 LYS C 394 1 ? 23 
HELX_P HELX_P30 30 GLY B 457 ? ARG B 468 ? GLY C 434 ARG C 445 1 ? 12 
HELX_P HELX_P31 31 LYS B 489 ? LYS B 495 ? LYS C 466 LYS C 472 1 ? 7  
HELX_P HELX_P32 32 ASN B 496 ? GLY B 507 ? ASN C 473 GLY C 484 1 ? 12 
HELX_P HELX_P33 33 ASP B 531 ? ALA B 555 ? ASP C 508 ALA C 532 1 ? 25 
HELX_P HELX_P34 34 GLY B 585 ? ARG B 591 ? GLY C 562 ARG C 568 1 ? 7  
HELX_P HELX_P35 35 ASN B 610 ? MET B 619 ? ASN C 587 MET C 596 1 ? 10 
HELX_P HELX_P36 36 ASP B 633 ? MET B 645 ? ASP C 610 MET C 622 1 ? 13 
HELX_P HELX_P37 37 LYS B 648 ? VAL B 660 ? LYS C 625 VAL C 637 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G MG  .   MG  ? ? ? 1_555 I LFX .  O03 ? ? A MG  501 F LFX 101 1_555 ? ? ? ? ? ? ?            2.047 ? 
metalc2  metalc ? ? G MG  .   MG  ? ? ? 1_555 I LFX .  O02 ? ? A MG  501 F LFX 101 1_555 ? ? ? ? ? ? ?            2.049 ? 
metalc3  metalc ? ? B ASP 531 OD2 ? ? ? 1_555 H MG  .  MG  ? ? C ASP 508 C MG  701 1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc4  metalc ? ? B ASP 529 OD2 ? ? ? 1_555 H MG  .  MG  ? ? C ASP 506 C MG  701 1_555 ? ? ? ? ? ? ?            2.884 ? 
hydrog1  hydrog ? ? C DC  5   N3  A ? ? 1_555 D DG  11 N1  A ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DC  5   N4  A ? ? 1_555 D DG  11 O6  A ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DC  5   O2  A ? ? 1_555 D DG  11 N2  A ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DA  6   N1  A ? ? 1_555 D DT  10 N3  A ? E DA  10  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DA  6   N6  A ? ? 1_555 D DT  10 O4  A ? E DA  10  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DT  7   N3  A ? ? 1_555 D DA  9  N1  A ? E DT  11  F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DT  7   O4  A ? ? 1_555 D DA  9  N6  A ? E DT  11  F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  8   N1  A ? ? 1_555 D DC  8  N3  A ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DG  8   N2  A ? ? 1_555 D DC  8  O2  A ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DG  8   O6  A ? ? 1_555 D DC  8  N4  A ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DA  9   N1  A ? ? 1_555 D DT  7  N3  A ? E DA  13  F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DA  9   N6  A ? ? 1_555 D DT  7  O4  A ? E DA  13  F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DA  10  N1  A ? ? 1_555 D DT  6  N3  A ? E DA  14  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DA  10  N6  A ? ? 1_555 D DT  6  O4  A ? E DA  14  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DT  11  N3  A ? ? 1_555 D DA  5  N1  A ? E DT  15  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DT  11  O4  A ? ? 1_555 D DA  5  N6  A ? E DT  15  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 168 A . ? THR 168 A GLY 169 A ? GLY 169 A 1 -13.48 
2 ASP 60  B . ? ASP 37  C GLY 61  B ? GLY 38  C 1 1.13   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 8 ? 
J ? 5 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
I 6 7 ? parallel      
I 7 8 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 4   ? SER A 8   ? ILE A 4   SER A 8   
A 2 LEU B 626 ? THR B 630 ? LEU C 603 THR C 607 
A 3 VAL B 558 ? ILE B 560 ? VAL C 535 ILE C 537 
A 4 LYS B 523 ? MET B 527 ? LYS C 500 MET C 504 
A 5 GLU B 451 ? GLU B 456 ? GLU C 428 GLU C 433 
A 6 GLN B 473 ? LEU B 478 ? GLN C 450 LEU C 455 
B 1 ARG A 60  ? LYS A 61  ? ARG A 60  LYS A 61  
B 2 GLU A 120 ? LEU A 123 ? GLU A 120 LEU A 123 
B 3 VAL A 99  ? HIS A 102 ? VAL A 99  HIS A 102 
C 1 PHE A 141 ? TRP A 143 ? PHE A 141 TRP A 143 
C 2 LYS A 150 ? PRO A 152 ? LYS A 150 PRO A 152 
D 1 SER A 167 ? ILE A 170 ? SER A 167 ILE A 170 
D 2 ALA A 175 ? ILE A 178 ? ALA A 175 ILE A 178 
E 1 GLN A 322 ? ASN A 328 ? GLN A 322 ASN A 328 
E 2 LYS A 233 ? ARG A 239 ? LYS A 233 ARG A 239 
E 3 ILE A 218 ? GLN A 220 ? ILE A 218 GLN A 220 
E 4 SER A 481 ? GLU A 483 ? SER A 481 GLU A 483 
F 1 LYS A 241 ? LYS A 246 ? LYS A 241 LYS A 246 
F 2 GLU A 252 ? GLU A 258 ? GLU A 252 GLU A 258 
F 3 ILE A 298 ? LEU A 302 ? ILE A 298 LEU A 302 
F 4 ILE A 284 ? ASP A 289 ? ILE A 284 ASP A 289 
G 1 VAL A 330 ? ASP A 333 ? VAL A 330 ASP A 333 
G 2 THR A 336 ? GLN A 339 ? THR A 336 GLN A 339 
H 1 LYS B 177 ? PRO B 178 ? LYS C 154 PRO C 155 
H 2 ALA B 166 ? GLU B 173 ? ALA C 143 GLU C 150 
H 3 LYS B 183 ? THR B 187 ? LYS C 160 THR C 164 
I 1 LYS B 177 ? PRO B 178 ? LYS C 154 PRO C 155 
I 2 ALA B 166 ? GLU B 173 ? ALA C 143 GLU C 150 
I 3 SER B 154 ? ARG B 163 ? SER C 131 ARG C 140 
I 4 GLY B 194 ? PRO B 201 ? GLY C 171 PRO C 178 
I 5 LEU B 97  ? ASP B 101 ? LEU C 74  ASP C 78  
I 6 ARG B 86  ? ILE B 91  ? ARG C 63  ILE C 68  
I 7 THR B 231 ? ASP B 236 ? THR C 208 ASP C 213 
I 8 GLU B 241 ? PHE B 245 ? GLU C 218 PHE C 222 
J 1 LEU B 269 ? ASP B 275 ? LEU C 246 ASP C 252 
J 2 PHE B 278 ? TYR B 286 ? PHE C 255 TYR C 263 
J 3 LEU B 347 ? LEU B 354 ? LEU C 324 LEU C 331 
J 4 ASN B 293 ? VAL B 298 ? ASN C 270 VAL C 275 
J 5 VAL B 301 ? ARG B 302 ? VAL C 278 ARG C 279 
K 1 TYR B 566 ? LYS B 567 ? TYR C 543 LYS C 544 
K 2 GLN B 601 ? ARG B 602 ? GLN C 578 ARG C 579 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 5   ? N GLN A 5   O ARG B 628 ? O ARG C 605 
A 2 3 O ILE B 627 ? O ILE C 604 N ILE B 560 ? N ILE C 537 
A 3 4 O TYR B 559 ? O TYR C 536 N ILE B 524 ? N ILE C 501 
A 4 5 O ILE B 525 ? O ILE C 502 N LEU B 452 ? N LEU C 429 
A 5 6 N TYR B 453 ? N TYR C 430 O LEU B 476 ? O LEU C 453 
B 1 2 N ARG A 60  ? N ARG A 60  O ALA A 121 ? O ALA A 121 
B 2 3 O GLU A 120 ? O GLU A 120 N HIS A 102 ? N HIS A 102 
C 1 2 N ALA A 142 ? N ALA A 142 O GLU A 151 ? O GLU A 151 
D 1 2 N GLY A 169 ? N GLY A 169 O THR A 176 ? O THR A 176 
E 1 2 O TYR A 325 ? O TYR A 325 N VAL A 236 ? N VAL A 236 
E 2 3 O ARG A 239 ? O ARG A 239 N ILE A 218 ? N ILE A 218 
E 3 4 N ILE A 219 ? N ILE A 219 O SER A 481 ? O SER A 481 
F 1 2 N GLU A 243 ? N GLU A 243 O VAL A 255 ? O VAL A 255 
F 2 3 N GLU A 252 ? N GLU A 252 O LEU A 302 ? O LEU A 302 
F 3 4 O GLU A 301 ? O GLU A 301 N ALA A 285 ? N ALA A 285 
G 1 2 N ASP A 333 ? N ASP A 333 O THR A 336 ? O THR A 336 
H 1 2 O LYS B 177 ? O LYS C 154 N GLU B 173 ? N GLU C 150 
H 2 3 N VAL B 167 ? N VAL C 144 O ILE B 185 ? O ILE C 162 
I 1 2 O LYS B 177 ? O LYS C 154 N GLU B 173 ? N GLU C 150 
I 2 3 O TYR B 168 ? O TYR C 145 N ILE B 161 ? N ILE C 138 
I 3 4 N SER B 155 ? N SER C 132 O MET B 200 ? O MET C 177 
I 4 5 O VAL B 197 ? O VAL C 174 N VAL B 99  ? N VAL C 76  
I 5 6 O GLN B 100 ? O GLN C 77  N ASP B 88  ? N ASP C 65  
I 6 7 N ILE B 91  ? N ILE C 68  O THR B 235 ? O THR C 212 
I 7 8 N ASP B 236 ? N ASP C 213 O GLU B 241 ? O GLU C 218 
J 1 2 N PHE B 271 ? N PHE C 248 O VAL B 282 ? O VAL C 259 
J 2 3 N GLN B 285 ? N GLN C 262 O ALA B 348 ? O ALA C 325 
J 3 4 O LEU B 351 ? O LEU C 328 N PHE B 297 ? N PHE C 274 
J 4 5 N VAL B 298 ? N VAL C 275 O VAL B 301 ? O VAL C 278 
K 1 2 N LYS B 567 ? N LYS C 544 O GLN B 601 ? O GLN C 578 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG C 701'  
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE LFX F 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  DT  C 11  ? DT  E 15  . ? 1_555  ? 
2  AC1 2  LFX I .   ? LFX F 101 . ? 1_555  ? 
3  AC2 2  ASP B 529 ? ASP C 506 . ? 1_555  ? 
4  AC2 2  ASP B 531 ? ASP C 508 . ? 1_555  ? 
5  AC3 10 SER A 79  ? SER A 79  . ? 1_555  ? 
6  AC3 10 MG  G .   ? MG  A 501 . ? 1_555  ? 
7  AC3 10 DT  C 11  ? DT  E 15  . ? 1_555  ? 
8  AC3 10 DA  D 1   ? DA  F 1   . ? 16_545 ? 
9  AC3 10 DC  D 4   ? DC  F 4   . ? 1_555  ? 
10 AC3 10 DA  D 5   ? DA  F 5   . ? 1_555  ? 
11 AC3 10 DT  E 11  ? DT  G 15  . ? 1_555  ? 
12 AC3 10 DG  F 1   ? DG  H 1   . ? 16_545 ? 
13 AC3 10 DT  F 4   ? DT  H 4   . ? 1_555  ? 
14 AC3 10 DA  F 5   ? DA  H 5   . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          4JUO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4JUO 
_atom_sites.fract_transf_matrix[1][1]   0.004682 
_atom_sites.fract_transf_matrix[1][2]   0.002703 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005406 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004721 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A 1 3   ? 21.899  -5.157  75.332  1.00 149.02 ? 3   ASN A N     1 
ATOM   2    C  CA    . ASN A 1 3   ? 23.110  -4.573  74.774  1.00 138.07 ? 3   ASN A CA    1 
ATOM   3    C  C     . ASN A 1 3   ? 24.203  -4.398  75.827  1.00 130.04 ? 3   ASN A C     1 
ATOM   4    O  O     . ASN A 1 3   ? 25.305  -4.914  75.666  1.00 124.14 ? 3   ASN A O     1 
ATOM   5    C  CB    . ASN A 1 3   ? 22.807  -3.239  74.084  1.00 135.00 ? 3   ASN A CB    1 
ATOM   6    N  N     . ILE A 1 4   ? 23.897  -3.678  76.906  1.00 122.55 ? 4   ILE A N     1 
ATOM   7    C  CA    . ILE A 1 4   ? 24.871  -3.454  77.969  1.00 111.60 ? 4   ILE A CA    1 
ATOM   8    C  C     . ILE A 1 4   ? 24.253  -3.630  79.351  1.00 117.63 ? 4   ILE A C     1 
ATOM   9    O  O     . ILE A 1 4   ? 23.130  -3.199  79.593  1.00 125.80 ? 4   ILE A O     1 
ATOM   10   C  CB    . ILE A 1 4   ? 25.503  -2.054  77.880  1.00 105.05 ? 4   ILE A CB    1 
ATOM   11   N  N     . GLN A 1 5   ? 24.998  -4.274  80.246  1.00 122.16 ? 5   GLN A N     1 
ATOM   12   C  CA    . GLN A 1 5   ? 24.573  -4.490  81.634  1.00 134.80 ? 5   GLN A CA    1 
ATOM   13   C  C     . GLN A 1 5   ? 25.669  -4.069  82.618  1.00 138.87 ? 5   GLN A C     1 
ATOM   14   O  O     . GLN A 1 5   ? 26.832  -4.449  82.471  1.00 134.41 ? 5   GLN A O     1 
ATOM   15   C  CB    . GLN A 1 5   ? 24.188  -5.956  81.875  1.00 129.23 ? 5   GLN A CB    1 
ATOM   16   N  N     . ASN A 1 6   ? 25.292  -3.291  83.627  1.00 142.31 ? 6   ASN A N     1 
ATOM   17   C  CA    . ASN A 1 6   ? 26.261  -2.753  84.574  1.00 137.40 ? 6   ASN A CA    1 
ATOM   18   C  C     . ASN A 1 6   ? 26.604  -3.697  85.726  1.00 133.15 ? 6   ASN A C     1 
ATOM   19   O  O     . ASN A 1 6   ? 25.768  -4.474  86.194  1.00 136.38 ? 6   ASN A O     1 
ATOM   20   C  CB    . ASN A 1 6   ? 25.771  -1.413  85.130  1.00 136.63 ? 6   ASN A CB    1 
ATOM   21   C  CG    . ASN A 1 6   ? 25.368  -0.443  84.041  1.00 136.90 ? 6   ASN A CG    1 
ATOM   22   O  OD1   . ASN A 1 6   ? 26.068  0.532   83.772  1.00 138.29 ? 6   ASN A OD1   1 
ATOM   23   N  ND2   . ASN A 1 6   ? 24.234  -0.709  83.403  1.00 132.57 ? 6   ASN A ND2   1 
ATOM   24   N  N     . MET A 1 7   ? 27.852  -3.629  86.168  1.00 137.21 ? 7   MET A N     1 
ATOM   25   C  CA    . MET A 1 7   ? 28.272  -4.305  87.378  1.00 126.12 ? 7   MET A CA    1 
ATOM   26   C  C     . MET A 1 7   ? 29.249  -3.371  88.076  1.00 115.55 ? 7   MET A C     1 
ATOM   27   O  O     . MET A 1 7   ? 29.859  -2.514  87.435  1.00 108.84 ? 7   MET A O     1 
ATOM   28   C  CB    . MET A 1 7   ? 28.908  -5.662  87.064  1.00 145.34 ? 7   MET A CB    1 
ATOM   29   N  N     . SER A 1 8   ? 29.376  -3.515  89.389  1.00 133.98 ? 8   SER A N     1 
ATOM   30   C  CA    . SER A 1 8   ? 30.215  -2.617  90.172  1.00 134.39 ? 8   SER A CA    1 
ATOM   31   C  C     . SER A 1 8   ? 31.687  -2.982  90.030  1.00 122.81 ? 8   SER A C     1 
ATOM   32   O  O     . SER A 1 8   ? 32.016  -4.141  89.775  1.00 123.15 ? 8   SER A O     1 
ATOM   33   C  CB    . SER A 1 8   ? 29.799  -2.658  91.647  1.00 115.44 ? 8   SER A CB    1 
ATOM   34   O  OG    . SER A 1 8   ? 30.705  -1.923  92.452  1.00 114.40 ? 8   SER A OG    1 
ATOM   35   N  N     . LEU A 1 9   ? 32.575  -2.004  90.180  1.00 117.48 ? 9   LEU A N     1 
ATOM   36   C  CA    . LEU A 1 9   ? 33.991  -2.319  90.238  1.00 135.38 ? 9   LEU A CA    1 
ATOM   37   C  C     . LEU A 1 9   ? 34.200  -3.286  91.397  1.00 127.99 ? 9   LEU A C     1 
ATOM   38   O  O     . LEU A 1 9   ? 34.939  -4.262  91.273  1.00 125.99 ? 9   LEU A O     1 
ATOM   39   C  CB    . LEU A 1 9   ? 34.835  -1.068  90.450  1.00 169.86 ? 9   LEU A CB    1 
ATOM   40   C  CG    . LEU A 1 9   ? 36.275  -1.203  89.956  1.00 187.32 ? 9   LEU A CG    1 
ATOM   41   C  CD1   . LEU A 1 9   ? 37.207  -0.226  90.646  1.00 197.66 ? 9   LEU A CD1   1 
ATOM   42   C  CD2   . LEU A 1 9   ? 36.754  -2.602  90.181  1.00 186.19 ? 9   LEU A CD2   1 
ATOM   43   N  N     . GLU A 1 10  ? 33.526  -3.019  92.517  1.00 132.94 ? 10  GLU A N     1 
ATOM   44   C  CA    . GLU A 1 10  ? 33.634  -3.859  93.714  1.00 129.70 ? 10  GLU A CA    1 
ATOM   45   C  C     . GLU A 1 10  ? 33.146  -5.289  93.479  1.00 125.21 ? 10  GLU A C     1 
ATOM   46   O  O     . GLU A 1 10  ? 33.669  -6.230  94.064  1.00 136.40 ? 10  GLU A O     1 
ATOM   47   C  CB    . GLU A 1 10  ? 32.872  -3.232  94.887  1.00 130.84 ? 10  GLU A CB    1 
ATOM   48   N  N     . ASP A 1 11  ? 32.140  -5.441  92.624  1.00 122.83 ? 11  ASP A N     1 
ATOM   49   C  CA    . ASP A 1 11  ? 31.584  -6.753  92.304  1.00 121.63 ? 11  ASP A CA    1 
ATOM   50   C  C     . ASP A 1 11  ? 32.408  -7.492  91.251  1.00 126.10 ? 11  ASP A C     1 
ATOM   51   O  O     . ASP A 1 11  ? 32.636  -8.690  91.377  1.00 113.48 ? 11  ASP A O     1 
ATOM   52   C  CB    . ASP A 1 11  ? 30.137  -6.626  91.811  1.00 147.73 ? 11  ASP A CB    1 
ATOM   53   C  CG    . ASP A 1 11  ? 29.184  -6.152  92.893  1.00 148.60 ? 11  ASP A CG    1 
ATOM   54   O  OD1   . ASP A 1 11  ? 28.904  -4.935  92.957  1.00 156.06 ? 11  ASP A OD1   1 
ATOM   55   O  OD2   . ASP A 1 11  ? 28.703  -7.002  93.672  1.00 147.09 ? 11  ASP A OD2   1 
ATOM   56   N  N     . ILE A 1 12  ? 32.825  -6.786  90.200  1.00 112.35 ? 12  ILE A N     1 
ATOM   57   C  CA    . ILE A 1 12  ? 33.623  -7.405  89.147  1.00 104.55 ? 12  ILE A CA    1 
ATOM   58   C  C     . ILE A 1 12  ? 34.868  -8.036  89.773  1.00 111.56 ? 12  ILE A C     1 
ATOM   59   O  O     . ILE A 1 12  ? 35.097  -9.233  89.624  1.00 102.48 ? 12  ILE A O     1 
ATOM   60   C  CB    . ILE A 1 12  ? 34.004  -6.403  88.003  1.00 90.53  ? 12  ILE A CB    1 
ATOM   61   N  N     . MET A 1 13  ? 35.650  -7.241  90.501  1.00 116.28 ? 13  MET A N     1 
ATOM   62   C  CA    . MET A 1 13  ? 36.886  -7.731  91.110  1.00 129.08 ? 13  MET A CA    1 
ATOM   63   C  C     . MET A 1 13  ? 36.653  -8.826  92.154  1.00 122.26 ? 13  MET A C     1 
ATOM   64   O  O     . MET A 1 13  ? 37.599  -9.396  92.683  1.00 142.77 ? 13  MET A O     1 
ATOM   65   C  CB    . MET A 1 13  ? 37.673  -6.581  91.735  1.00 143.35 ? 13  MET A CB    1 
ATOM   66   C  CG    . MET A 1 13  ? 38.261  -5.612  90.725  1.00 146.84 ? 13  MET A CG    1 
ATOM   67   S  SD    . MET A 1 13  ? 40.049  -5.767  90.544  1.00 156.32 ? 13  MET A SD    1 
ATOM   68   C  CE    . MET A 1 13  ? 40.583  -5.586  92.241  1.00 256.62 ? 13  MET A CE    1 
ATOM   69   N  N     . GLY A 1 14  ? 35.392  -9.118  92.442  1.00 102.04 ? 14  GLY A N     1 
ATOM   70   C  CA    . GLY A 1 14  ? 35.047  -10.118 93.436  1.00 100.60 ? 14  GLY A CA    1 
ATOM   71   C  C     . GLY A 1 14  ? 34.745  -11.474 92.831  1.00 101.60 ? 14  GLY A C     1 
ATOM   72   O  O     . GLY A 1 14  ? 35.241  -12.485 93.316  1.00 95.76  ? 14  GLY A O     1 
ATOM   73   N  N     . GLU A 1 15  ? 33.929  -11.498 91.778  1.00 116.30 ? 15  GLU A N     1 
ATOM   74   C  CA    . GLU A 1 15  ? 33.610  -12.742 91.075  1.00 99.01  ? 15  GLU A CA    1 
ATOM   75   C  C     . GLU A 1 15  ? 34.804  -13.227 90.262  1.00 107.41 ? 15  GLU A C     1 
ATOM   76   O  O     . GLU A 1 15  ? 34.883  -14.398 89.896  1.00 103.28 ? 15  GLU A O     1 
ATOM   77   C  CB    . GLU A 1 15  ? 32.392  -12.566 90.161  1.00 85.01  ? 15  GLU A CB    1 
ATOM   78   N  N     . ARG A 1 16  ? 35.735  -12.325 89.985  1.00 88.20  ? 16  ARG A N     1 
ATOM   79   C  CA    . ARG A 1 16  ? 36.907  -12.699 89.212  1.00 83.16  ? 16  ARG A CA    1 
ATOM   80   C  C     . ARG A 1 16  ? 38.002  -13.252 90.099  1.00 112.19 ? 16  ARG A C     1 
ATOM   81   O  O     . ARG A 1 16  ? 38.471  -14.362 89.865  1.00 96.86  ? 16  ARG A O     1 
ATOM   82   C  CB    . ARG A 1 16  ? 37.434  -11.529 88.377  1.00 85.43  ? 16  ARG A CB    1 
ATOM   83   C  CG    . ARG A 1 16  ? 36.456  -11.029 87.327  1.00 96.23  ? 16  ARG A CG    1 
ATOM   84   C  CD    . ARG A 1 16  ? 35.859  -12.177 86.547  1.00 106.08 ? 16  ARG A CD    1 
ATOM   85   N  NE    . ARG A 1 16  ? 34.962  -11.730 85.489  1.00 112.59 ? 16  ARG A NE    1 
ATOM   86   C  CZ    . ARG A 1 16  ? 33.636  -11.725 85.584  1.00 126.85 ? 16  ARG A CZ    1 
ATOM   87   N  NH1   . ARG A 1 16  ? 33.045  -12.142 86.697  1.00 102.90 ? 16  ARG A NH1   1 
ATOM   88   N  NH2   . ARG A 1 16  ? 32.903  -11.311 84.561  1.00 161.24 ? 16  ARG A NH2   1 
ATOM   89   N  N     . PHE A 1 17  ? 38.411  -12.495 91.116  1.00 139.89 ? 17  PHE A N     1 
ATOM   90   C  CA    . PHE A 1 17  ? 39.537  -12.929 91.941  1.00 180.61 ? 17  PHE A CA    1 
ATOM   91   C  C     . PHE A 1 17  ? 39.201  -14.149 92.777  1.00 178.36 ? 17  PHE A C     1 
ATOM   92   O  O     . PHE A 1 17  ? 40.070  -14.955 93.113  1.00 194.25 ? 17  PHE A O     1 
ATOM   93   C  CB    . PHE A 1 17  ? 40.065  -11.824 92.837  1.00 189.50 ? 17  PHE A CB    1 
ATOM   94   C  CG    . PHE A 1 17  ? 41.457  -12.077 93.313  1.00 189.50 ? 17  PHE A CG    1 
ATOM   95   C  CD1   . PHE A 1 17  ? 41.686  -12.780 94.485  1.00 192.55 ? 17  PHE A CD1   1 
ATOM   96   C  CD2   . PHE A 1 17  ? 42.543  -11.653 92.557  1.00 168.57 ? 17  PHE A CD2   1 
ATOM   97   C  CE1   . PHE A 1 17  ? 42.974  -13.034 94.914  1.00 174.14 ? 17  PHE A CE1   1 
ATOM   98   C  CE2   . PHE A 1 17  ? 43.838  -11.903 92.973  1.00 149.59 ? 17  PHE A CE2   1 
ATOM   99   C  CZ    . PHE A 1 17  ? 44.053  -12.594 94.159  1.00 152.80 ? 17  PHE A CZ    1 
ATOM   100  N  N     . GLY A 1 18  ? 37.932  -14.285 93.109  1.00 163.48 ? 18  GLY A N     1 
ATOM   101  C  CA    . GLY A 1 18  ? 37.480  -15.472 93.797  1.00 122.82 ? 18  GLY A CA    1 
ATOM   102  C  C     . GLY A 1 18  ? 37.594  -16.651 92.861  1.00 107.03 ? 18  GLY A C     1 
ATOM   103  O  O     . GLY A 1 18  ? 38.121  -17.694 93.241  1.00 99.77  ? 18  GLY A O     1 
ATOM   104  N  N     . ARG A 1 19  ? 37.100  -16.476 91.636  1.00 91.32  ? 19  ARG A N     1 
ATOM   105  C  CA    . ARG A 1 19  ? 37.133  -17.524 90.622  1.00 93.71  ? 19  ARG A CA    1 
ATOM   106  C  C     . ARG A 1 19  ? 38.561  -18.032 90.424  1.00 91.27  ? 19  ARG A C     1 
ATOM   107  O  O     . ARG A 1 19  ? 38.819  -19.240 90.473  1.00 83.37  ? 19  ARG A O     1 
ATOM   108  C  CB    . ARG A 1 19  ? 36.549  -17.014 89.292  1.00 94.39  ? 19  ARG A CB    1 
ATOM   109  N  N     . TYR A 1 20  ? 39.480  -17.095 90.219  1.00 95.21  ? 20  TYR A N     1 
ATOM   110  C  CA    . TYR A 1 20  ? 40.885  -17.406 90.004  1.00 93.12  ? 20  TYR A CA    1 
ATOM   111  C  C     . TYR A 1 20  ? 41.537  -18.001 91.235  1.00 96.33  ? 20  TYR A C     1 
ATOM   112  O  O     . TYR A 1 20  ? 42.141  -19.062 91.159  1.00 98.42  ? 20  TYR A O     1 
ATOM   113  C  CB    . TYR A 1 20  ? 41.633  -16.144 89.593  1.00 91.40  ? 20  TYR A CB    1 
ATOM   114  C  CG    . TYR A 1 20  ? 43.107  -16.335 89.323  1.00 101.88 ? 20  TYR A CG    1 
ATOM   115  C  CD1   . TYR A 1 20  ? 43.545  -17.101 88.251  1.00 123.60 ? 20  TYR A CD1   1 
ATOM   116  C  CD2   . TYR A 1 20  ? 44.062  -15.716 90.120  1.00 106.16 ? 20  TYR A CD2   1 
ATOM   117  C  CE1   . TYR A 1 20  ? 44.900  -17.263 87.996  1.00 147.82 ? 20  TYR A CE1   1 
ATOM   118  C  CE2   . TYR A 1 20  ? 45.417  -15.869 89.873  1.00 129.44 ? 20  TYR A CE2   1 
ATOM   119  C  CZ    . TYR A 1 20  ? 45.833  -16.644 88.811  1.00 161.10 ? 20  TYR A CZ    1 
ATOM   120  O  OH    . TYR A 1 20  ? 47.177  -16.798 88.564  1.00 192.05 ? 20  TYR A OH    1 
ATOM   121  N  N     . SER A 1 21  ? 41.414  -17.307 92.369  1.00 98.10  ? 21  SER A N     1 
ATOM   122  C  CA    . SER A 1 21  ? 41.982  -17.761 93.643  1.00 97.74  ? 21  SER A CA    1 
ATOM   123  C  C     . SER A 1 21  ? 41.641  -19.237 93.930  1.00 77.84  ? 21  SER A C     1 
ATOM   124  O  O     . SER A 1 21  ? 42.541  -20.078 94.090  1.00 66.73  ? 21  SER A O     1 
ATOM   125  C  CB    . SER A 1 21  ? 41.519  -16.854 94.787  1.00 126.44 ? 21  SER A CB    1 
ATOM   126  N  N     . LYS A 1 22  ? 40.347  -19.547 93.978  1.00 66.97  ? 22  LYS A N     1 
ATOM   127  C  CA    . LYS A 1 22  ? 39.880  -20.915 94.217  1.00 66.42  ? 22  LYS A CA    1 
ATOM   128  C  C     . LYS A 1 22  ? 40.578  -21.961 93.332  1.00 76.96  ? 22  LYS A C     1 
ATOM   129  O  O     . LYS A 1 22  ? 40.956  -23.041 93.805  1.00 66.29  ? 22  LYS A O     1 
ATOM   130  C  CB    . LYS A 1 22  ? 38.367  -21.005 94.008  1.00 94.19  ? 22  LYS A CB    1 
ATOM   131  C  CG    . LYS A 1 22  ? 37.791  -22.356 94.369  1.00 117.69 ? 22  LYS A CG    1 
ATOM   132  C  CD    . LYS A 1 22  ? 36.331  -22.483 93.949  1.00 144.12 ? 22  LYS A CD    1 
ATOM   133  C  CE    . LYS A 1 22  ? 35.751  -23.815 94.439  1.00 159.33 ? 22  LYS A CE    1 
ATOM   134  N  NZ    . LYS A 1 22  ? 34.271  -23.954 94.279  1.00 165.12 ? 22  LYS A NZ    1 
ATOM   135  N  N     . TYR A 1 23  ? 40.750  -21.634 92.051  1.00 68.88  ? 23  TYR A N     1 
ATOM   136  C  CA    . TYR A 1 23  ? 41.247  -22.596 91.065  1.00 73.81  ? 23  TYR A CA    1 
ATOM   137  C  C     . TYR A 1 23  ? 42.750  -22.843 91.209  1.00 65.74  ? 23  TYR A C     1 
ATOM   138  O  O     . TYR A 1 23  ? 43.216  -23.994 91.087  1.00 56.12  ? 23  TYR A O     1 
ATOM   139  C  CB    . TYR A 1 23  ? 40.887  -22.141 89.642  1.00 104.98 ? 23  TYR A CB    1 
ATOM   140  C  CG    . TYR A 1 23  ? 41.431  -23.004 88.519  1.00 136.52 ? 23  TYR A CG    1 
ATOM   141  C  CD1   . TYR A 1 23  ? 42.689  -22.765 87.986  1.00 141.06 ? 23  TYR A CD1   1 
ATOM   142  C  CD2   . TYR A 1 23  ? 40.673  -24.035 87.962  1.00 162.03 ? 23  TYR A CD2   1 
ATOM   143  C  CE1   . TYR A 1 23  ? 43.185  -23.539 86.953  1.00 139.89 ? 23  TYR A CE1   1 
ATOM   144  C  CE2   . TYR A 1 23  ? 41.165  -24.816 86.916  1.00 152.49 ? 23  TYR A CE2   1 
ATOM   145  C  CZ    . TYR A 1 23  ? 42.426  -24.566 86.423  1.00 135.91 ? 23  TYR A CZ    1 
ATOM   146  O  OH    . TYR A 1 23  ? 42.947  -25.326 85.390  1.00 114.39 ? 23  TYR A OH    1 
ATOM   147  N  N     . ILE A 1 24  ? 43.490  -21.767 91.489  1.00 63.31  ? 24  ILE A N     1 
ATOM   148  C  CA    . ILE A 1 24  ? 44.950  -21.816 91.591  1.00 61.28  ? 24  ILE A CA    1 
ATOM   149  C  C     . ILE A 1 24  ? 45.343  -22.569 92.862  1.00 68.16  ? 24  ILE A C     1 
ATOM   150  O  O     . ILE A 1 24  ? 46.358  -23.273 92.893  1.00 74.65  ? 24  ILE A O     1 
ATOM   151  C  CB    . ILE A 1 24  ? 45.576  -20.383 91.503  1.00 149.73 ? 24  ILE A CB    1 
ATOM   152  C  CG1   . ILE A 1 24  ? 45.359  -19.849 90.101  1.00 163.46 ? 24  ILE A CG1   1 
ATOM   153  C  CG2   . ILE A 1 24  ? 47.062  -20.380 91.737  1.00 126.91 ? 24  ILE A CG2   1 
ATOM   154  C  CD1   . ILE A 1 24  ? 45.121  -20.956 89.121  1.00 177.79 ? 24  ILE A CD1   1 
ATOM   155  N  N     . ILE A 1 25  ? 44.503  -22.449 93.889  1.00 58.16  ? 25  ILE A N     1 
ATOM   156  C  CA    . ILE A 1 25  ? 44.709  -23.159 95.130  1.00 87.13  ? 25  ILE A CA    1 
ATOM   157  C  C     . ILE A 1 25  ? 44.335  -24.642 95.034  1.00 61.15  ? 25  ILE A C     1 
ATOM   158  O  O     . ILE A 1 25  ? 45.084  -25.519 95.493  1.00 61.34  ? 25  ILE A O     1 
ATOM   159  C  CB    . ILE A 1 25  ? 43.886  -22.515 96.240  1.00 109.96 ? 25  ILE A CB    1 
ATOM   160  C  CG1   . ILE A 1 25  ? 44.292  -21.046 96.399  1.00 131.29 ? 25  ILE A CG1   1 
ATOM   161  C  CG2   . ILE A 1 25  ? 44.058  -23.282 97.543  1.00 104.29 ? 25  ILE A CG2   1 
ATOM   162  C  CD1   . ILE A 1 25  ? 43.379  -20.224 97.298  1.00 137.07 ? 25  ILE A CD1   1 
ATOM   163  N  N     . GLN A 1 26  ? 43.176  -24.927 94.451  1.00 61.93  ? 26  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 26  ? 42.691  -26.307 94.369  1.00 63.17  ? 26  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 26  ? 43.325  -27.121 93.244  1.00 64.00  ? 26  GLN A C     1 
ATOM   166  O  O     . GLN A 1 26  ? 43.587  -28.316 93.418  1.00 71.42  ? 26  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 26  ? 41.172  -26.342 94.178  1.00 65.07  ? 26  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 26  ? 40.369  -25.541 95.186  1.00 83.05  ? 26  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 26  ? 38.923  -26.000 95.240  1.00 85.80  ? 26  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 26  ? 38.263  -26.130 94.206  1.00 99.89  ? 26  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 26  ? 38.432  -26.280 96.446  1.00 86.28  ? 26  GLN A NE2   1 
ATOM   172  N  N     . ASP A 1 27  ? 43.572  -26.460 92.106  1.00 68.32  ? 27  ASP A N     1 
ATOM   173  C  CA    . ASP A 1 27  ? 43.806  -27.120 90.818  1.00 62.73  ? 27  ASP A CA    1 
ATOM   174  C  C     . ASP A 1 27  ? 45.026  -26.639 90.054  1.00 57.60  ? 27  ASP A C     1 
ATOM   175  O  O     . ASP A 1 27  ? 45.005  -26.656 88.830  1.00 61.68  ? 27  ASP A O     1 
ATOM   176  C  CB    . ASP A 1 27  ? 42.617  -26.875 89.889  1.00 74.47  ? 27  ASP A CB    1 
ATOM   177  C  CG    . ASP A 1 27  ? 41.383  -27.632 90.298  1.00 89.28  ? 27  ASP A CG    1 
ATOM   178  O  OD1   . ASP A 1 27  ? 41.334  -28.855 90.052  1.00 100.02 ? 27  ASP A OD1   1 
ATOM   179  O  OD2   . ASP A 1 27  ? 40.454  -26.997 90.841  1.00 98.35  ? 27  ASP A OD2   1 
ATOM   180  N  N     . ARG A 1 28  ? 46.065  -26.181 90.740  1.00 72.24  ? 28  ARG A N     1 
ATOM   181  C  CA    . ARG A 1 28  ? 47.267  -25.744 90.045  1.00 98.40  ? 28  ARG A CA    1 
ATOM   182  C  C     . ARG A 1 28  ? 48.498  -25.886 90.916  1.00 97.40  ? 28  ARG A C     1 
ATOM   183  O  O     . ARG A 1 28  ? 49.197  -26.879 90.829  1.00 90.36  ? 28  ARG A O     1 
ATOM   184  C  CB    . ARG A 1 28  ? 47.138  -24.297 89.539  1.00 103.69 ? 28  ARG A CB    1 
ATOM   185  C  CG    . ARG A 1 28  ? 48.025  -23.998 88.322  1.00 104.61 ? 28  ARG A CG    1 
ATOM   186  C  CD    . ARG A 1 28  ? 48.379  -22.520 88.130  1.00 103.26 ? 28  ARG A CD    1 
ATOM   187  N  NE    . ARG A 1 28  ? 47.523  -21.742 87.220  1.00 98.03  ? 28  ARG A NE    1 
ATOM   188  C  CZ    . ARG A 1 28  ? 46.625  -22.241 86.377  1.00 89.79  ? 28  ARG A CZ    1 
ATOM   189  N  NH1   . ARG A 1 28  ? 46.433  -23.557 86.267  1.00 71.50  ? 28  ARG A NH1   1 
ATOM   190  N  NH2   . ARG A 1 28  ? 45.917  -21.411 85.632  1.00 100.20 ? 28  ARG A NH2   1 
ATOM   191  N  N     . ALA A 1 29  ? 48.736  -24.904 91.785  1.00 106.76 ? 29  ALA A N     1 
ATOM   192  C  CA    . ALA A 1 29  ? 50.016  -24.767 92.484  1.00 105.44 ? 29  ALA A CA    1 
ATOM   193  C  C     . ALA A 1 29  ? 50.256  -25.679 93.685  1.00 94.75  ? 29  ALA A C     1 
ATOM   194  O  O     . ALA A 1 29  ? 51.400  -25.832 94.119  1.00 103.31 ? 29  ALA A O     1 
ATOM   195  C  CB    . ALA A 1 29  ? 50.215  -23.310 92.910  1.00 109.10 ? 29  ALA A CB    1 
ATOM   196  N  N     . LEU A 1 30  ? 49.190  -26.246 94.246  1.00 72.51  ? 30  LEU A N     1 
ATOM   197  C  CA    . LEU A 1 30  ? 49.301  -26.970 95.520  1.00 60.17  ? 30  LEU A CA    1 
ATOM   198  C  C     . LEU A 1 30  ? 49.037  -28.460 95.405  1.00 58.54  ? 30  LEU A C     1 
ATOM   199  O  O     . LEU A 1 30  ? 48.069  -28.894 94.785  1.00 58.62  ? 30  LEU A O     1 
ATOM   200  C  CB    . LEU A 1 30  ? 48.396  -26.347 96.582  1.00 59.73  ? 30  LEU A CB    1 
ATOM   201  C  CG    . LEU A 1 30  ? 48.708  -24.872 96.887  1.00 69.92  ? 30  LEU A CG    1 
ATOM   202  C  CD1   . LEU A 1 30  ? 47.680  -24.241 97.832  1.00 91.09  ? 30  LEU A CD1   1 
ATOM   203  C  CD2   . LEU A 1 30  ? 50.117  -24.716 97.441  1.00 66.24  ? 30  LEU A CD2   1 
ATOM   204  N  N     . PRO A 1 31  ? 49.915  -29.254 96.012  1.00 60.23  ? 31  PRO A N     1 
ATOM   205  C  CA    . PRO A 1 31  ? 49.855  -30.718 95.968  1.00 65.58  ? 31  PRO A CA    1 
ATOM   206  C  C     . PRO A 1 31  ? 48.689  -31.212 96.782  1.00 79.92  ? 31  PRO A C     1 
ATOM   207  O  O     . PRO A 1 31  ? 48.373  -30.605 97.812  1.00 85.31  ? 31  PRO A O     1 
ATOM   208  C  CB    . PRO A 1 31  ? 51.123  -31.126 96.710  1.00 63.09  ? 31  PRO A CB    1 
ATOM   209  C  CG    . PRO A 1 31  ? 51.304  -30.029 97.722  1.00 63.74  ? 31  PRO A CG    1 
ATOM   210  C  CD    . PRO A 1 31  ? 50.962  -28.773 96.930  1.00 61.83  ? 31  PRO A CD    1 
ATOM   211  N  N     . ASP A 1 32  ? 48.068  -32.298 96.334  1.00 102.02 ? 32  ASP A N     1 
ATOM   212  C  CA    . ASP A 1 32  ? 47.119  -33.036 97.152  1.00 112.41 ? 32  ASP A CA    1 
ATOM   213  C  C     . ASP A 1 32  ? 47.897  -33.710 98.293  1.00 118.21 ? 32  ASP A C     1 
ATOM   214  O  O     . ASP A 1 32  ? 48.950  -34.311 98.063  1.00 115.55 ? 32  ASP A O     1 
ATOM   215  C  CB    . ASP A 1 32  ? 46.411  -34.081 96.304  1.00 127.38 ? 32  ASP A CB    1 
ATOM   216  C  CG    . ASP A 1 32  ? 45.404  -34.894 97.097  1.00 130.99 ? 32  ASP A CG    1 
ATOM   217  O  OD1   . ASP A 1 32  ? 44.209  -34.518 97.080  1.00 127.79 ? 32  ASP A OD1   1 
ATOM   218  O  OD2   . ASP A 1 32  ? 45.806  -35.908 97.732  1.00 114.99 ? 32  ASP A OD2   1 
ATOM   219  N  N     . ILE A 1 33  ? 47.394  -33.592 99.517  1.00 119.40 ? 33  ILE A N     1 
ATOM   220  C  CA    . ILE A 1 33  ? 48.094  -34.123 100.696 1.00 119.18 ? 33  ILE A CA    1 
ATOM   221  C  C     . ILE A 1 33  ? 48.271  -35.660 100.700 1.00 92.71  ? 33  ILE A C     1 
ATOM   222  O  O     . ILE A 1 33  ? 49.220  -36.185 101.291 1.00 80.49  ? 33  ILE A O     1 
ATOM   223  C  CB    . ILE A 1 33  ? 47.361  -33.725 101.977 1.00 126.16 ? 33  ILE A CB    1 
ATOM   224  C  CG1   . ILE A 1 33  ? 48.239  -33.978 103.196 1.00 134.58 ? 33  ILE A CG1   1 
ATOM   225  C  CG2   . ILE A 1 33  ? 46.038  -34.489 102.086 1.00 117.82 ? 33  ILE A CG2   1 
ATOM   226  C  CD1   . ILE A 1 33  ? 47.629  -33.466 104.480 1.00 148.64 ? 33  ILE A CD1   1 
ATOM   227  N  N     . ARG A 1 34  ? 47.365  -36.373 100.041 1.00 88.41  ? 34  ARG A N     1 
ATOM   228  C  CA    . ARG A 1 34  ? 47.432  -37.833 99.962  1.00 90.68  ? 34  ARG A CA    1 
ATOM   229  C  C     . ARG A 1 34  ? 48.461  -38.415 98.991  1.00 76.10  ? 34  ARG A C     1 
ATOM   230  O  O     . ARG A 1 34  ? 49.261  -39.270 99.372  1.00 72.63  ? 34  ARG A O     1 
ATOM   231  C  CB    . ARG A 1 34  ? 46.073  -38.365 99.581  1.00 79.18  ? 34  ARG A CB    1 
ATOM   232  C  CG    . ARG A 1 34  ? 45.055  -38.091 100.627 1.00 81.61  ? 34  ARG A CG    1 
ATOM   233  C  CD    . ARG A 1 34  ? 43.693  -38.378 100.085 1.00 94.20  ? 34  ARG A CD    1 
ATOM   234  N  NE    . ARG A 1 34  ? 43.348  -37.431 99.051  1.00 123.56 ? 34  ARG A NE    1 
ATOM   235  C  CZ    . ARG A 1 34  ? 42.216  -37.507 98.368  1.00 141.05 ? 34  ARG A CZ    1 
ATOM   236  N  NH1   . ARG A 1 34  ? 41.365  -38.486 98.666  1.00 163.17 ? 34  ARG A NH1   1 
ATOM   237  N  NH2   . ARG A 1 34  ? 41.938  -36.617 97.397  1.00 148.47 ? 34  ARG A NH2   1 
ATOM   238  N  N     . ASP A 1 35  ? 48.426  -37.990 97.732  1.00 81.77  ? 35  ASP A N     1 
ATOM   239  C  CA    . ASP A 1 35  ? 49.362  -38.552 96.752  1.00 69.72  ? 35  ASP A CA    1 
ATOM   240  C  C     . ASP A 1 35  ? 50.538  -37.621 96.453  1.00 68.48  ? 35  ASP A C     1 
ATOM   241  O  O     . ASP A 1 35  ? 51.478  -38.006 95.762  1.00 69.07  ? 35  ASP A O     1 
ATOM   242  C  CB    . ASP A 1 35  ? 48.650  -38.960 95.460  1.00 68.26  ? 35  ASP A CB    1 
ATOM   243  C  CG    . ASP A 1 35  ? 48.148  -37.763 94.665  1.00 68.94  ? 35  ASP A CG    1 
ATOM   244  O  OD1   . ASP A 1 35  ? 48.626  -36.643 94.973  1.00 77.95  ? 35  ASP A OD1   1 
ATOM   245  O  OD2   . ASP A 1 35  ? 47.286  -37.941 93.748  1.00 76.96  ? 35  ASP A OD2   1 
ATOM   246  N  N     . GLY A 1 36  ? 50.472  -36.399 96.974  1.00 67.62  ? 36  GLY A N     1 
ATOM   247  C  CA    . GLY A 1 36  ? 51.539  -35.425 96.826  1.00 67.39  ? 36  GLY A CA    1 
ATOM   248  C  C     . GLY A 1 36  ? 51.727  -34.804 95.447  1.00 65.27  ? 36  GLY A C     1 
ATOM   249  O  O     . GLY A 1 36  ? 52.785  -34.214 95.188  1.00 65.29  ? 36  GLY A O     1 
ATOM   250  N  N     . LEU A 1 37  ? 50.720  -34.917 94.576  1.00 63.43  ? 37  LEU A N     1 
ATOM   251  C  CA    . LEU A 1 37  ? 50.794  -34.380 93.194  1.00 61.32  ? 37  LEU A CA    1 
ATOM   252  C  C     . LEU A 1 37  ? 49.932  -33.144 92.940  1.00 59.13  ? 37  LEU A C     1 
ATOM   253  O  O     . LEU A 1 37  ? 48.793  -33.051 93.395  1.00 58.67  ? 37  LEU A O     1 
ATOM   254  C  CB    . LEU A 1 37  ? 50.407  -35.454 92.167  1.00 110.30 ? 37  LEU A CB    1 
ATOM   255  C  CG    . LEU A 1 37  ? 51.222  -36.748 92.295  1.00 116.51 ? 37  LEU A CG    1 
ATOM   256  C  CD1   . LEU A 1 37  ? 50.496  -37.915 91.632  1.00 121.86 ? 37  LEU A CD1   1 
ATOM   257  C  CD2   . LEU A 1 37  ? 52.670  -36.587 91.749  1.00 207.01 ? 37  LEU A CD2   1 
ATOM   258  N  N     . LYS A 1 38  ? 50.482  -32.195 92.197  1.00 57.90  ? 38  LYS A N     1 
ATOM   259  C  CA    . LYS A 1 38  ? 49.667  -31.140 91.604  1.00 57.50  ? 38  LYS A CA    1 
ATOM   260  C  C     . LYS A 1 38  ? 48.888  -31.741 90.431  1.00 54.16  ? 38  LYS A C     1 
ATOM   261  O  O     . LYS A 1 38  ? 49.310  -32.734 89.837  1.00 54.54  ? 38  LYS A O     1 
ATOM   262  C  CB    . LYS A 1 38  ? 50.549  -30.004 91.106  1.00 76.42  ? 38  LYS A CB    1 
ATOM   263  C  CG    . LYS A 1 38  ? 51.389  -29.351 92.167  1.00 97.15  ? 38  LYS A CG    1 
ATOM   264  C  CD    . LYS A 1 38  ? 52.644  -28.728 91.564  1.00 108.34 ? 38  LYS A CD    1 
ATOM   265  C  CE    . LYS A 1 38  ? 53.308  -27.790 92.562  1.00 117.31 ? 38  LYS A CE    1 
ATOM   266  N  NZ    . LYS A 1 38  ? 54.353  -26.926 91.945  1.00 121.59 ? 38  LYS A NZ    1 
ATOM   267  N  N     . PRO A 1 39  ? 47.742  -31.148 90.084  1.00 60.28  ? 39  PRO A N     1 
ATOM   268  C  CA    . PRO A 1 39  ? 46.954  -31.683 88.957  1.00 52.57  ? 39  PRO A CA    1 
ATOM   269  C  C     . PRO A 1 39  ? 47.765  -31.980 87.660  1.00 50.10  ? 39  PRO A C     1 
ATOM   270  O  O     . PRO A 1 39  ? 47.614  -33.062 87.086  1.00 50.11  ? 39  PRO A O     1 
ATOM   271  C  CB    . PRO A 1 39  ? 45.899  -30.601 88.731  1.00 52.71  ? 39  PRO A CB    1 
ATOM   272  C  CG    . PRO A 1 39  ? 45.709  -29.999 90.102  1.00 54.68  ? 39  PRO A CG    1 
ATOM   273  C  CD    . PRO A 1 39  ? 47.082  -30.009 90.745  1.00 61.46  ? 39  PRO A CD    1 
ATOM   274  N  N     . VAL A 1 40  ? 48.627  -31.065 87.225  1.00 49.59  ? 40  VAL A N     1 
ATOM   275  C  CA    . VAL A 1 40  ? 49.396  -31.295 86.007  1.00 48.86  ? 40  VAL A CA    1 
ATOM   276  C  C     . VAL A 1 40  ? 50.244  -32.553 86.076  1.00 50.63  ? 40  VAL A C     1 
ATOM   277  O  O     . VAL A 1 40  ? 50.394  -33.258 85.065  1.00 50.20  ? 40  VAL A O     1 
ATOM   278  C  CB    . VAL A 1 40  ? 50.308  -30.098 85.628  1.00 77.60  ? 40  VAL A CB    1 
ATOM   279  C  CG1   . VAL A 1 40  ? 51.483  -29.943 86.611  1.00 56.60  ? 40  VAL A CG1   1 
ATOM   280  C  CG2   . VAL A 1 40  ? 50.817  -30.267 84.220  1.00 108.66 ? 40  VAL A CG2   1 
ATOM   281  N  N     . GLN A 1 41  ? 50.813  -32.834 87.251  1.00 52.76  ? 41  GLN A N     1 
ATOM   282  C  CA    . GLN A 1 41  ? 51.655  -34.027 87.379  1.00 81.54  ? 41  GLN A CA    1 
ATOM   283  C  C     . GLN A 1 41  ? 50.825  -35.316 87.381  1.00 55.44  ? 41  GLN A C     1 
ATOM   284  O  O     . GLN A 1 41  ? 51.178  -36.287 86.711  1.00 56.12  ? 41  GLN A O     1 
ATOM   285  C  CB    . GLN A 1 41  ? 52.545  -33.953 88.616  1.00 106.45 ? 41  GLN A CB    1 
ATOM   286  C  CG    . GLN A 1 41  ? 53.220  -32.619 88.813  1.00 120.41 ? 41  GLN A CG    1 
ATOM   287  C  CD    . GLN A 1 41  ? 53.754  -32.440 90.236  1.00 118.11 ? 41  GLN A CD    1 
ATOM   288  O  OE1   . GLN A 1 41  ? 54.919  -32.115 90.420  1.00 127.85 ? 41  GLN A OE1   1 
ATOM   289  N  NE2   . GLN A 1 41  ? 52.898  -32.649 91.245  1.00 100.26 ? 41  GLN A NE2   1 
ATOM   290  N  N     . ARG A 1 42  ? 49.729  -35.324 88.142  1.00 55.33  ? 42  ARG A N     1 
ATOM   291  C  CA    . ARG A 1 42  ? 48.810  -36.464 88.133  1.00 55.71  ? 42  ARG A CA    1 
ATOM   292  C  C     . ARG A 1 42  ? 48.349  -36.791 86.699  1.00 53.97  ? 42  ARG A C     1 
ATOM   293  O  O     . ARG A 1 42  ? 48.322  -37.953 86.294  1.00 54.86  ? 42  ARG A O     1 
ATOM   294  C  CB    . ARG A 1 42  ? 47.593  -36.194 89.022  1.00 62.18  ? 42  ARG A CB    1 
ATOM   295  C  CG    . ARG A 1 42  ? 46.723  -37.424 89.235  1.00 58.01  ? 42  ARG A CG    1 
ATOM   296  C  CD    . ARG A 1 42  ? 45.554  -37.219 90.231  1.00 60.83  ? 42  ARG A CD    1 
ATOM   297  N  NE    . ARG A 1 42  ? 45.959  -36.765 91.558  1.00 61.92  ? 42  ARG A NE    1 
ATOM   298  C  CZ    . ARG A 1 42  ? 46.044  -35.483 91.888  1.00 61.18  ? 42  ARG A CZ    1 
ATOM   299  N  NH1   . ARG A 1 42  ? 45.756  -34.557 90.982  1.00 59.37  ? 42  ARG A NH1   1 
ATOM   300  N  NH2   . ARG A 1 42  ? 46.414  -35.123 93.107  1.00 70.49  ? 42  ARG A NH2   1 
ATOM   301  N  N     . ARG A 1 43  ? 47.977  -35.763 85.938  1.00 51.59  ? 43  ARG A N     1 
ATOM   302  C  CA    . ARG A 1 43  ? 47.541  -35.973 84.554  1.00 49.79  ? 43  ARG A CA    1 
ATOM   303  C  C     . ARG A 1 43  ? 48.673  -36.531 83.707  1.00 50.51  ? 43  ARG A C     1 
ATOM   304  O  O     . ARG A 1 43  ? 48.476  -37.511 83.000  1.00 50.69  ? 43  ARG A O     1 
ATOM   305  C  CB    . ARG A 1 43  ? 46.990  -34.689 83.948  1.00 47.27  ? 43  ARG A CB    1 
ATOM   306  C  CG    . ARG A 1 43  ? 45.554  -34.466 84.349  1.00 49.33  ? 43  ARG A CG    1 
ATOM   307  C  CD    . ARG A 1 43  ? 45.261  -32.994 84.480  1.00 48.68  ? 43  ARG A CD    1 
ATOM   308  N  NE    . ARG A 1 43  ? 43.855  -32.786 84.795  1.00 50.83  ? 43  ARG A NE    1 
ATOM   309  C  CZ    . ARG A 1 43  ? 43.276  -31.594 84.869  1.00 50.79  ? 43  ARG A CZ    1 
ATOM   310  N  NH1   . ARG A 1 43  ? 43.982  -30.484 84.649  1.00 56.01  ? 43  ARG A NH1   1 
ATOM   311  N  NH2   . ARG A 1 43  ? 41.985  -31.522 85.163  1.00 52.99  ? 43  ARG A NH2   1 
ATOM   312  N  N     . ILE A 1 44  ? 49.857  -35.930 83.804  1.00 51.06  ? 44  ILE A N     1 
ATOM   313  C  CA    . ILE A 1 44  ? 51.044  -36.516 83.196  1.00 106.70 ? 44  ILE A CA    1 
ATOM   314  C  C     . ILE A 1 44  ? 51.183  -38.023 83.459  1.00 54.62  ? 44  ILE A C     1 
ATOM   315  O  O     . ILE A 1 44  ? 51.282  -38.830 82.518  1.00 54.79  ? 44  ILE A O     1 
ATOM   316  C  CB    . ILE A 1 44  ? 52.319  -35.827 83.664  1.00 121.69 ? 44  ILE A CB    1 
ATOM   317  C  CG1   . ILE A 1 44  ? 52.306  -34.367 83.219  1.00 154.45 ? 44  ILE A CG1   1 
ATOM   318  C  CG2   . ILE A 1 44  ? 53.547  -36.558 83.114  1.00 111.92 ? 44  ILE A CG2   1 
ATOM   319  C  CD1   . ILE A 1 44  ? 53.665  -33.748 83.156  1.00 174.26 ? 44  ILE A CD1   1 
ATOM   320  N  N     . LEU A 1 45  ? 51.195  -38.403 84.732  1.00 56.59  ? 45  LEU A N     1 
ATOM   321  C  CA    . LEU A 1 45  ? 51.360  -39.805 85.091  1.00 61.23  ? 45  LEU A CA    1 
ATOM   322  C  C     . LEU A 1 45  ? 50.190  -40.661 84.623  1.00 58.66  ? 45  LEU A C     1 
ATOM   323  O  O     . LEU A 1 45  ? 50.382  -41.785 84.155  1.00 60.09  ? 45  LEU A O     1 
ATOM   324  C  CB    . LEU A 1 45  ? 51.505  -39.959 86.593  1.00 67.79  ? 45  LEU A CB    1 
ATOM   325  C  CG    . LEU A 1 45  ? 52.779  -39.410 87.210  1.00 79.80  ? 45  LEU A CG    1 
ATOM   326  C  CD1   . LEU A 1 45  ? 52.795  -39.743 88.705  1.00 100.67 ? 45  LEU A CD1   1 
ATOM   327  C  CD2   . LEU A 1 45  ? 53.945  -40.032 86.505  1.00 70.27  ? 45  LEU A CD2   1 
ATOM   328  N  N     . TYR A 1 46  ? 48.975  -40.136 84.775  1.00 81.24  ? 46  TYR A N     1 
ATOM   329  C  CA    . TYR A 1 46  ? 47.793  -40.912 84.423  1.00 101.96 ? 46  TYR A CA    1 
ATOM   330  C  C     . TYR A 1 46  ? 47.773  -41.190 82.920  1.00 54.91  ? 46  TYR A C     1 
ATOM   331  O  O     . TYR A 1 46  ? 47.534  -42.306 82.484  1.00 55.94  ? 46  TYR A O     1 
ATOM   332  C  CB    . TYR A 1 46  ? 46.494  -40.200 84.844  1.00 126.16 ? 46  TYR A CB    1 
ATOM   333  C  CG    . TYR A 1 46  ? 45.287  -41.001 84.431  1.00 150.88 ? 46  TYR A CG    1 
ATOM   334  C  CD1   . TYR A 1 46  ? 44.416  -40.545 83.439  1.00 146.56 ? 46  TYR A CD1   1 
ATOM   335  C  CD2   . TYR A 1 46  ? 45.055  -42.254 84.979  1.00 165.92 ? 46  TYR A CD2   1 
ATOM   336  C  CE1   . TYR A 1 46  ? 43.324  -41.315 83.024  1.00 143.53 ? 46  TYR A CE1   1 
ATOM   337  C  CE2   . TYR A 1 46  ? 43.970  -43.027 84.581  1.00 162.73 ? 46  TYR A CE2   1 
ATOM   338  C  CZ    . TYR A 1 46  ? 43.107  -42.558 83.607  1.00 152.29 ? 46  TYR A CZ    1 
ATOM   339  O  OH    . TYR A 1 46  ? 42.029  -43.337 83.222  1.00 136.25 ? 46  TYR A OH    1 
ATOM   340  N  N     . SER A 1 47  ? 48.037  -40.150 82.139  1.00 52.81  ? 47  SER A N     1 
ATOM   341  C  CA    . SER A 1 47  ? 47.989  -40.243 80.701  1.00 52.15  ? 47  SER A CA    1 
ATOM   342  C  C     . SER A 1 47  ? 49.084  -41.165 80.170  1.00 54.31  ? 47  SER A C     1 
ATOM   343  O  O     . SER A 1 47  ? 48.822  -41.985 79.281  1.00 55.00  ? 47  SER A O     1 
ATOM   344  C  CB    . SER A 1 47  ? 48.072  -38.848 80.052  1.00 49.78  ? 47  SER A CB    1 
ATOM   345  O  OG    . SER A 1 47  ? 47.876  -38.921 78.642  1.00 49.02  ? 47  SER A OG    1 
ATOM   346  N  N     . MET A 1 48  ? 50.302  -41.060 80.697  1.00 55.50  ? 48  MET A N     1 
ATOM   347  C  CA    . MET A 1 48  ? 51.343  -41.927 80.168  1.00 57.65  ? 48  MET A CA    1 
ATOM   348  C  C     . MET A 1 48  ? 51.053  -43.379 80.526  1.00 60.09  ? 48  MET A C     1 
ATOM   349  O  O     . MET A 1 48  ? 51.387  -44.298 79.770  1.00 61.70  ? 48  MET A O     1 
ATOM   350  C  CB    . MET A 1 48  ? 52.720  -41.500 80.633  1.00 58.43  ? 48  MET A CB    1 
ATOM   351  C  CG    . MET A 1 48  ? 53.102  -40.145 80.118  1.00 56.21  ? 48  MET A CG    1 
ATOM   352  S  SD    . MET A 1 48  ? 54.635  -39.477 80.811  1.00 305.16 ? 48  MET A SD    1 
ATOM   353  C  CE    . MET A 1 48  ? 55.866  -40.566 80.110  1.00 121.31 ? 48  MET A CE    1 
ATOM   354  N  N     . ASN A 1 49  ? 50.387  -43.583 81.658  1.00 60.37  ? 49  ASN A N     1 
ATOM   355  C  CA    . ASN A 1 49  ? 50.109  -44.934 82.120  1.00 82.79  ? 49  ASN A CA    1 
ATOM   356  C  C     . ASN A 1 49  ? 48.948  -45.510 81.326  1.00 62.31  ? 49  ASN A C     1 
ATOM   357  O  O     . ASN A 1 49  ? 48.959  -46.682 80.945  1.00 64.32  ? 49  ASN A O     1 
ATOM   358  C  CB    . ASN A 1 49  ? 49.846  -44.952 83.637  1.00 101.37 ? 49  ASN A CB    1 
ATOM   359  C  CG    . ASN A 1 49  ? 49.645  -46.366 84.194  1.00 135.05 ? 49  ASN A CG    1 
ATOM   360  O  OD1   . ASN A 1 49  ? 48.511  -46.791 84.388  1.00 138.69 ? 49  ASN A OD1   1 
ATOM   361  N  ND2   . ASN A 1 49  ? 50.746  -47.091 84.464  1.00 157.39 ? 49  ASN A ND2   1 
ATOM   362  N  N     . LYS A 1 50  ? 47.951  -44.674 81.054  1.00 59.70  ? 50  LYS A N     1 
ATOM   363  C  CA    . LYS A 1 50  ? 46.844  -45.096 80.196  1.00 41.03  ? 50  LYS A CA    1 
ATOM   364  C  C     . LYS A 1 50  ? 47.415  -45.591 78.866  1.00 46.30  ? 50  LYS A C     1 
ATOM   365  O  O     . LYS A 1 50  ? 46.920  -46.565 78.301  1.00 42.17  ? 50  LYS A O     1 
ATOM   366  C  CB    . LYS A 1 50  ? 45.862  -43.942 79.946  1.00 38.67  ? 50  LYS A CB    1 
ATOM   367  C  CG    . LYS A 1 50  ? 44.445  -44.373 79.546  1.00 46.33  ? 50  LYS A CG    1 
ATOM   368  C  CD    . LYS A 1 50  ? 43.803  -43.336 78.610  1.00 60.50  ? 50  LYS A CD    1 
ATOM   369  N  N     . ASP A 1 51  ? 48.464  -44.925 78.384  1.00 119.18 ? 51  ASP A N     1 
ATOM   370  C  CA    . ASP A 1 51  ? 49.057  -45.257 77.085  1.00 137.64 ? 51  ASP A CA    1 
ATOM   371  C  C     . ASP A 1 51  ? 50.132  -46.360 77.111  1.00 131.08 ? 51  ASP A C     1 
ATOM   372  O  O     . ASP A 1 51  ? 50.785  -46.603 76.090  1.00 130.16 ? 51  ASP A O     1 
ATOM   373  C  CB    . ASP A 1 51  ? 49.626  -44.010 76.400  1.00 158.37 ? 51  ASP A CB    1 
ATOM   374  C  CG    . ASP A 1 51  ? 48.561  -42.946 76.121  1.00 167.55 ? 51  ASP A CG    1 
ATOM   375  O  OD1   . ASP A 1 51  ? 47.358  -43.312 76.049  1.00 162.70 ? 51  ASP A OD1   1 
ATOM   376  O  OD2   . ASP A 1 51  ? 48.940  -41.750 75.964  1.00 173.90 ? 51  ASP A OD2   1 
ATOM   377  N  N     . SER A 1 52  ? 50.329  -47.004 78.261  1.00 122.09 ? 52  SER A N     1 
ATOM   378  C  CA    . SER A 1 52  ? 51.248  -48.148 78.351  1.00 113.56 ? 52  SER A CA    1 
ATOM   379  C  C     . SER A 1 52  ? 52.691  -47.724 78.208  1.00 106.63 ? 52  SER A C     1 
ATOM   380  O  O     . SER A 1 52  ? 53.563  -48.544 77.919  1.00 107.88 ? 52  SER A O     1 
ATOM   381  C  CB    . SER A 1 52  ? 50.957  -49.190 77.271  1.00 106.99 ? 52  SER A CB    1 
ATOM   382  O  OG    . SER A 1 52  ? 49.645  -49.705 77.377  1.00 107.14 ? 52  SER A OG    1 
ATOM   383  N  N     . ASN A 1 53  ? 52.929  -46.438 78.397  1.00 107.88 ? 53  ASN A N     1 
ATOM   384  C  CA    . ASN A 1 53  ? 54.258  -45.859 78.261  1.00 111.84 ? 53  ASN A CA    1 
ATOM   385  C  C     . ASN A 1 53  ? 54.967  -46.000 79.637  1.00 121.23 ? 53  ASN A C     1 
ATOM   386  O  O     . ASN A 1 53  ? 55.307  -45.022 80.313  1.00 128.15 ? 53  ASN A O     1 
ATOM   387  C  CB    . ASN A 1 53  ? 54.105  -44.406 77.770  1.00 109.62 ? 53  ASN A CB    1 
ATOM   388  C  CG    . ASN A 1 53  ? 55.428  -43.713 77.482  1.00 102.21 ? 53  ASN A CG    1 
ATOM   389  O  OD1   . ASN A 1 53  ? 56.495  -44.323 77.477  1.00 103.37 ? 53  ASN A OD1   1 
ATOM   390  N  ND2   . ASN A 1 53  ? 55.354  -42.410 77.243  1.00 100.48 ? 53  ASN A ND2   1 
ATOM   391  N  N     . THR A 1 54  ? 55.183  -47.257 80.022  1.00 116.31 ? 54  THR A N     1 
ATOM   392  C  CA    . THR A 1 54  ? 55.725  -47.626 81.321  1.00 115.07 ? 54  THR A CA    1 
ATOM   393  C  C     . THR A 1 54  ? 57.208  -48.020 81.306  1.00 111.63 ? 54  THR A C     1 
ATOM   394  O  O     . THR A 1 54  ? 57.819  -48.128 80.249  1.00 111.20 ? 54  THR A O     1 
ATOM   395  C  CB    . THR A 1 54  ? 54.886  -48.747 81.957  1.00 123.95 ? 54  THR A CB    1 
ATOM   396  O  OG1   . THR A 1 54  ? 54.738  -49.833 81.036  1.00 113.26 ? 54  THR A OG1   1 
ATOM   397  C  CG2   . THR A 1 54  ? 53.520  -48.222 82.280  1.00 142.69 ? 54  THR A CG2   1 
ATOM   398  N  N     . PHE A 1 55  ? 57.761  -48.251 82.495  1.00 113.16 ? 55  PHE A N     1 
ATOM   399  C  CA    . PHE A 1 55  ? 59.205  -48.403 82.686  1.00 114.21 ? 55  PHE A CA    1 
ATOM   400  C  C     . PHE A 1 55  ? 59.741  -49.600 81.917  1.00 115.55 ? 55  PHE A C     1 
ATOM   401  O  O     . PHE A 1 55  ? 60.907  -49.634 81.537  1.00 115.87 ? 55  PHE A O     1 
ATOM   402  C  CB    . PHE A 1 55  ? 59.552  -48.549 84.189  1.00 115.78 ? 55  PHE A CB    1 
ATOM   403  C  CG    . PHE A 1 55  ? 59.428  -49.962 84.705  1.00 118.13 ? 55  PHE A CG    1 
ATOM   404  C  CD1   . PHE A 1 55  ? 58.181  -50.492 85.031  1.00 118.54 ? 55  PHE A CD1   1 
ATOM   405  C  CD2   . PHE A 1 55  ? 60.552  -50.768 84.837  1.00 119.97 ? 55  PHE A CD2   1 
ATOM   406  C  CE1   . PHE A 1 55  ? 58.059  -51.796 85.477  1.00 120.73 ? 55  PHE A CE1   1 
ATOM   407  C  CE2   . PHE A 1 55  ? 60.443  -52.072 85.282  1.00 122.21 ? 55  PHE A CE2   1 
ATOM   408  C  CZ    . PHE A 1 55  ? 59.194  -52.591 85.606  1.00 124.12 ? 55  PHE A CZ    1 
ATOM   409  N  N     . ASP A 1 56  ? 58.875  -50.579 81.701  1.00 130.53 ? 56  ASP A N     1 
ATOM   410  C  CA    . ASP A 1 56  ? 59.266  -51.849 81.102  1.00 147.80 ? 56  ASP A CA    1 
ATOM   411  C  C     . ASP A 1 56  ? 59.111  -51.857 79.578  1.00 163.83 ? 56  ASP A C     1 
ATOM   412  O  O     . ASP A 1 56  ? 59.337  -52.875 78.938  1.00 183.60 ? 56  ASP A O     1 
ATOM   413  C  CB    . ASP A 1 56  ? 58.429  -52.986 81.703  1.00 141.69 ? 56  ASP A CB    1 
ATOM   414  C  CG    . ASP A 1 56  ? 56.937  -52.710 81.612  1.00 124.45 ? 56  ASP A CG    1 
ATOM   415  O  OD1   . ASP A 1 56  ? 56.536  -51.550 81.887  1.00 121.98 ? 56  ASP A OD1   1 
ATOM   416  O  OD2   . ASP A 1 56  ? 56.170  -53.635 81.258  1.00 119.15 ? 56  ASP A OD2   1 
ATOM   417  N  N     . LYS A 1 57  ? 58.709  -50.735 79.001  1.00 150.54 ? 57  LYS A N     1 
ATOM   418  C  CA    . LYS A 1 57  ? 58.552  -50.664 77.549  1.00 137.50 ? 57  LYS A CA    1 
ATOM   419  C  C     . LYS A 1 57  ? 59.372  -49.528 76.941  1.00 132.00 ? 57  LYS A C     1 
ATOM   420  O  O     . LYS A 1 57  ? 59.961  -48.720 77.664  1.00 122.84 ? 57  LYS A O     1 
ATOM   421  C  CB    . LYS A 1 57  ? 57.071  -50.587 77.179  1.00 126.55 ? 57  LYS A CB    1 
ATOM   422  C  CG    . LYS A 1 57  ? 56.260  -51.661 77.923  1.00 119.13 ? 57  LYS A CG    1 
ATOM   423  C  CD    . LYS A 1 57  ? 54.833  -51.811 77.420  1.00 112.67 ? 57  LYS A CD    1 
ATOM   424  C  CE    . LYS A 1 57  ? 54.103  -52.860 78.263  1.00 121.05 ? 57  LYS A CE    1 
ATOM   425  N  NZ    . LYS A 1 57  ? 52.619  -52.807 78.135  1.00 127.50 ? 57  LYS A NZ    1 
ATOM   426  N  N     . SER A 1 58  ? 59.432  -49.484 75.619  1.00 137.11 ? 58  SER A N     1 
ATOM   427  C  CA    . SER A 1 58  ? 60.327  -48.552 74.926  1.00 140.62 ? 58  SER A CA    1 
ATOM   428  C  C     . SER A 1 58  ? 59.990  -47.110 75.239  1.00 106.72 ? 58  SER A C     1 
ATOM   429  O  O     . SER A 1 58  ? 58.830  -46.767 75.445  1.00 105.88 ? 58  SER A O     1 
ATOM   430  C  CB    . SER A 1 58  ? 60.262  -48.752 73.412  1.00 159.62 ? 58  SER A CB    1 
ATOM   431  O  OG    . SER A 1 58  ? 59.771  -50.040 73.100  1.00 175.11 ? 58  SER A OG    1 
ATOM   432  N  N     . TYR A 1 59  ? 61.007  -46.262 75.255  1.00 106.03 ? 59  TYR A N     1 
ATOM   433  C  CA    . TYR A 1 59  ? 60.760  -44.850 75.431  1.00 104.14 ? 59  TYR A CA    1 
ATOM   434  C  C     . TYR A 1 59  ? 59.831  -44.396 74.312  1.00 102.21 ? 59  TYR A C     1 
ATOM   435  O  O     . TYR A 1 59  ? 59.835  -44.958 73.231  1.00 102.05 ? 59  TYR A O     1 
ATOM   436  C  CB    . TYR A 1 59  ? 62.068  -44.067 75.432  1.00 107.41 ? 59  TYR A CB    1 
ATOM   437  C  CG    . TYR A 1 59  ? 62.935  -44.275 76.676  1.00 122.74 ? 59  TYR A CG    1 
ATOM   438  C  CD1   . TYR A 1 59  ? 63.838  -45.328 76.748  1.00 137.16 ? 59  TYR A CD1   1 
ATOM   439  C  CD2   . TYR A 1 59  ? 62.868  -43.399 77.764  1.00 121.09 ? 59  TYR A CD2   1 
ATOM   440  C  CE1   . TYR A 1 59  ? 64.642  -45.521 77.861  1.00 137.73 ? 59  TYR A CE1   1 
ATOM   441  C  CE2   . TYR A 1 59  ? 63.680  -43.580 78.887  1.00 121.89 ? 59  TYR A CE2   1 
ATOM   442  C  CZ    . TYR A 1 59  ? 64.563  -44.648 78.928  1.00 124.59 ? 59  TYR A CZ    1 
ATOM   443  O  OH    . TYR A 1 59  ? 65.375  -44.858 80.018  1.00 117.76 ? 59  TYR A OH    1 
ATOM   444  N  N     . ARG A 1 60  ? 59.010  -43.396 74.590  1.00 100.83 ? 60  ARG A N     1 
ATOM   445  C  CA    . ARG A 1 60  ? 58.052  -42.889 73.617  1.00 101.33 ? 60  ARG A CA    1 
ATOM   446  C  C     . ARG A 1 60  ? 58.354  -41.408 73.467  1.00 106.58 ? 60  ARG A C     1 
ATOM   447  O  O     . ARG A 1 60  ? 58.744  -40.749 74.418  1.00 97.41  ? 60  ARG A O     1 
ATOM   448  C  CB    . ARG A 1 60  ? 56.625  -43.157 74.107  1.00 99.18  ? 60  ARG A CB    1 
ATOM   449  C  CG    . ARG A 1 60  ? 55.489  -42.580 73.281  1.00 97.37  ? 60  ARG A CG    1 
ATOM   450  C  CD    . ARG A 1 60  ? 54.150  -42.482 74.082  1.00 150.62 ? 60  ARG A CD    1 
ATOM   451  N  NE    . ARG A 1 60  ? 53.333  -43.706 74.229  1.00 152.06 ? 60  ARG A NE    1 
ATOM   452  C  CZ    . ARG A 1 60  ? 53.765  -44.970 74.155  1.00 155.75 ? 60  ARG A CZ    1 
ATOM   453  N  NH1   . ARG A 1 60  ? 55.045  -45.252 73.924  1.00 141.20 ? 60  ARG A NH1   1 
ATOM   454  N  NH2   . ARG A 1 60  ? 52.904  -45.973 74.330  1.00 172.86 ? 60  ARG A NH2   1 
ATOM   455  N  N     . LYS A 1 61  ? 58.235  -40.892 72.258  1.00 106.19 ? 61  LYS A N     1 
ATOM   456  C  CA    . LYS A 1 61  ? 58.581  -39.504 71.990  1.00 115.64 ? 61  LYS A CA    1 
ATOM   457  C  C     . LYS A 1 61  ? 57.875  -38.542 72.957  1.00 93.50  ? 61  LYS A C     1 
ATOM   458  O  O     . LYS A 1 61  ? 56.660  -38.589 73.111  1.00 93.32  ? 61  LYS A O     1 
ATOM   459  C  CB    . LYS A 1 61  ? 58.234  -39.178 70.537  1.00 128.30 ? 61  LYS A CB    1 
ATOM   460  C  CG    . LYS A 1 61  ? 58.383  -37.722 70.163  1.00 139.41 ? 61  LYS A CG    1 
ATOM   461  C  CD    . LYS A 1 61  ? 59.812  -37.238 70.309  1.00 152.54 ? 61  LYS A CD    1 
ATOM   462  C  CE    . LYS A 1 61  ? 60.724  -37.830 69.254  1.00 169.84 ? 61  LYS A CE    1 
ATOM   463  N  NZ    . LYS A 1 61  ? 62.091  -37.233 69.346  1.00 183.76 ? 61  LYS A NZ    1 
ATOM   464  N  N     . SER A 1 62  ? 58.632  -37.677 73.619  1.00 93.42  ? 62  SER A N     1 
ATOM   465  C  CA    . SER A 1 62  ? 58.013  -36.688 74.505  1.00 93.08  ? 62  SER A CA    1 
ATOM   466  C  C     . SER A 1 62  ? 56.788  -35.988 73.898  1.00 91.65  ? 62  SER A C     1 
ATOM   467  O  O     . SER A 1 62  ? 55.738  -35.905 74.540  1.00 91.92  ? 62  SER A O     1 
ATOM   468  C  CB    . SER A 1 62  ? 59.023  -35.643 74.966  1.00 92.78  ? 62  SER A CB    1 
ATOM   469  O  OG    . SER A 1 62  ? 59.974  -36.241 75.830  1.00 94.30  ? 62  SER A OG    1 
ATOM   470  N  N     . ALA A 1 63  ? 56.919  -35.491 72.668  1.00 102.78 ? 63  ALA A N     1 
ATOM   471  C  CA    . ALA A 1 63  ? 55.837  -34.725 72.059  1.00 129.46 ? 63  ALA A CA    1 
ATOM   472  C  C     . ALA A 1 63  ? 54.551  -35.547 71.887  1.00 132.46 ? 63  ALA A C     1 
ATOM   473  O  O     . ALA A 1 63  ? 53.449  -35.037 72.043  1.00 120.67 ? 63  ALA A O     1 
ATOM   474  C  CB    . ALA A 1 63  ? 56.277  -34.131 70.752  1.00 151.74 ? 63  ALA A CB    1 
ATOM   475  N  N     . LYS A 1 64  ? 54.674  -36.826 71.571  1.00 142.48 ? 64  LYS A N     1 
ATOM   476  C  CA    . LYS A 1 64  ? 53.479  -37.646 71.534  1.00 139.08 ? 64  LYS A CA    1 
ATOM   477  C  C     . LYS A 1 64  ? 52.810  -37.625 72.919  1.00 112.81 ? 64  LYS A C     1 
ATOM   478  O  O     . LYS A 1 64  ? 51.609  -37.406 73.039  1.00 94.55  ? 64  LYS A O     1 
ATOM   479  C  CB    . LYS A 1 64  ? 53.828  -39.070 71.098  1.00 152.93 ? 64  LYS A CB    1 
ATOM   480  C  CG    . LYS A 1 64  ? 52.657  -40.064 71.037  1.00 144.02 ? 64  LYS A CG    1 
ATOM   481  C  CD    . LYS A 1 64  ? 53.143  -41.409 70.446  1.00 122.15 ? 64  LYS A CD    1 
ATOM   482  C  CE    . LYS A 1 64  ? 52.012  -42.397 70.186  1.00 93.25  ? 64  LYS A CE    1 
ATOM   483  N  NZ    . LYS A 1 64  ? 52.519  -43.806 70.234  1.00 95.06  ? 64  LYS A NZ    1 
ATOM   484  N  N     . SER A 1 65  ? 53.581  -37.854 73.975  1.00 92.56  ? 65  SER A N     1 
ATOM   485  C  CA    . SER A 1 65  ? 52.979  -37.919 75.310  1.00 93.62  ? 65  SER A CA    1 
ATOM   486  C  C     . SER A 1 65  ? 52.287  -36.611 75.674  1.00 102.22 ? 65  SER A C     1 
ATOM   487  O  O     . SER A 1 65  ? 51.123  -36.609 76.072  1.00 96.61  ? 65  SER A O     1 
ATOM   488  C  CB    . SER A 1 65  ? 54.022  -38.282 76.360  1.00 95.12  ? 65  SER A CB    1 
ATOM   489  O  OG    . SER A 1 65  ? 54.294  -39.670 76.295  1.00 96.81  ? 65  SER A OG    1 
ATOM   490  N  N     . VAL A 1 66  ? 53.012  -35.507 75.521  1.00 118.31 ? 66  VAL A N     1 
ATOM   491  C  CA    . VAL A 1 66  ? 52.517  -34.181 75.856  1.00 136.00 ? 66  VAL A CA    1 
ATOM   492  C  C     . VAL A 1 66  ? 51.225  -33.841 75.139  1.00 128.47 ? 66  VAL A C     1 
ATOM   493  O  O     . VAL A 1 66  ? 50.283  -33.314 75.733  1.00 136.53 ? 66  VAL A O     1 
ATOM   494  C  CB    . VAL A 1 66  ? 53.537  -33.117 75.495  1.00 155.53 ? 66  VAL A CB    1 
ATOM   495  C  CG1   . VAL A 1 66  ? 52.892  -31.745 75.510  1.00 175.84 ? 66  VAL A CG1   1 
ATOM   496  C  CG2   . VAL A 1 66  ? 54.716  -33.195 76.448  1.00 148.91 ? 66  VAL A CG2   1 
ATOM   497  N  N     . GLY A 1 67  ? 51.185  -34.146 73.857  1.00 116.12 ? 67  GLY A N     1 
ATOM   498  C  CA    . GLY A 1 67  ? 50.008  -33.869 73.058  1.00 88.30  ? 67  GLY A CA    1 
ATOM   499  C  C     . GLY A 1 67  ? 48.780  -34.603 73.558  1.00 88.96  ? 67  GLY A C     1 
ATOM   500  O  O     . GLY A 1 67  ? 47.696  -34.020 73.587  1.00 88.57  ? 67  GLY A O     1 
ATOM   501  N  N     . ASN A 1 68  ? 48.948  -35.867 73.956  1.00 90.06  ? 68  ASN A N     1 
ATOM   502  C  CA    . ASN A 1 68  ? 47.838  -36.641 74.475  1.00 90.79  ? 68  ASN A CA    1 
ATOM   503  C  C     . ASN A 1 68  ? 47.319  -36.100 75.798  1.00 91.52  ? 68  ASN A C     1 
ATOM   504  O  O     . ASN A 1 68  ? 46.113  -36.089 76.044  1.00 91.52  ? 68  ASN A O     1 
ATOM   505  C  CB    . ASN A 1 68  ? 48.217  -38.112 74.606  1.00 91.99  ? 68  ASN A CB    1 
ATOM   506  C  CG    . ASN A 1 68  ? 48.446  -38.770 73.260  1.00 109.49 ? 68  ASN A CG    1 
ATOM   507  O  OD1   . ASN A 1 68  ? 49.509  -39.332 73.016  1.00 107.14 ? 68  ASN A OD1   1 
ATOM   508  N  ND2   . ASN A 1 68  ? 47.451  -38.692 72.370  1.00 119.72 ? 68  ASN A ND2   1 
ATOM   509  N  N     . ILE A 1 69  ? 48.241  -35.651 76.644  1.00 106.57 ? 69  ILE A N     1 
ATOM   510  C  CA    . ILE A 1 69  ? 47.909  -35.055 77.934  1.00 139.15 ? 69  ILE A CA    1 
ATOM   511  C  C     . ILE A 1 69  ? 47.069  -33.791 77.722  1.00 142.27 ? 69  ILE A C     1 
ATOM   512  O  O     . ILE A 1 69  ? 46.004  -33.612 78.329  1.00 146.04 ? 69  ILE A O     1 
ATOM   513  C  CB    . ILE A 1 69  ? 49.190  -34.676 78.683  1.00 181.75 ? 69  ILE A CB    1 
ATOM   514  C  CG1   . ILE A 1 69  ? 49.855  -35.921 79.276  1.00 203.56 ? 69  ILE A CG1   1 
ATOM   515  C  CG2   . ILE A 1 69  ? 48.886  -33.641 79.741  1.00 198.46 ? 69  ILE A CG2   1 
ATOM   516  C  CD1   . ILE A 1 69  ? 51.358  -35.803 79.369  1.00 215.29 ? 69  ILE A CD1   1 
ATOM   517  N  N     . MET A 1 70  ? 47.561  -32.926 76.840  1.00 140.83 ? 70  MET A N     1 
ATOM   518  C  CA    . MET A 1 70  ? 46.837  -31.723 76.421  1.00 129.54 ? 70  MET A CA    1 
ATOM   519  C  C     . MET A 1 70  ? 45.437  -31.986 75.830  1.00 106.92 ? 70  MET A C     1 
ATOM   520  O  O     . MET A 1 70  ? 44.476  -31.294 76.171  1.00 95.98  ? 70  MET A O     1 
ATOM   521  C  CB    . MET A 1 70  ? 47.679  -30.932 75.423  1.00 141.71 ? 70  MET A CB    1 
ATOM   522  C  CG    . MET A 1 70  ? 47.235  -29.496 75.230  1.00 145.18 ? 70  MET A CG    1 
ATOM   523  S  SD    . MET A 1 70  ? 48.382  -28.573 74.168  1.00 231.59 ? 70  MET A SD    1 
ATOM   524  C  CE    . MET A 1 70  ? 49.959  -29.165 74.778  1.00 179.48 ? 70  MET A CE    1 
ATOM   525  N  N     . GLY A 1 71  ? 45.317  -32.977 74.952  1.00 89.76  ? 71  GLY A N     1 
ATOM   526  C  CA    . GLY A 1 71  ? 44.074  -33.162 74.224  1.00 97.24  ? 71  GLY A CA    1 
ATOM   527  C  C     . GLY A 1 71  ? 43.036  -33.905 75.035  1.00 101.15 ? 71  GLY A C     1 
ATOM   528  O  O     . GLY A 1 71  ? 41.838  -33.821 74.769  1.00 109.17 ? 71  GLY A O     1 
ATOM   529  N  N     . ASN A 1 72  ? 43.496  -34.638 76.037  1.00 95.19  ? 72  ASN A N     1 
ATOM   530  C  CA    . ASN A 1 72  ? 42.602  -35.481 76.810  1.00 130.20 ? 72  ASN A CA    1 
ATOM   531  C  C     . ASN A 1 72  ? 42.296  -34.980 78.226  1.00 170.46 ? 72  ASN A C     1 
ATOM   532  O  O     . ASN A 1 72  ? 41.173  -35.173 78.721  1.00 179.80 ? 72  ASN A O     1 
ATOM   533  C  CB    . ASN A 1 72  ? 43.143  -36.908 76.852  1.00 113.36 ? 72  ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 72  ? 43.072  -37.592 75.500  1.00 106.66 ? 72  ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 72  ? 42.170  -37.329 74.708  1.00 103.61 ? 72  ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 72  ? 44.020  -38.486 75.237  1.00 114.61 ? 72  ASN A ND2   1 
ATOM   537  N  N     . PHE A 1 73  ? 43.270  -34.325 78.865  1.00 177.88 ? 73  PHE A N     1 
ATOM   538  C  CA    . PHE A 1 73  ? 43.140  -34.001 80.288  1.00 192.55 ? 73  PHE A CA    1 
ATOM   539  C  C     . PHE A 1 73  ? 43.477  -32.574 80.700  1.00 178.31 ? 73  PHE A C     1 
ATOM   540  O  O     . PHE A 1 73  ? 42.819  -32.021 81.574  1.00 162.64 ? 73  PHE A O     1 
ATOM   541  C  CB    . PHE A 1 73  ? 43.972  -34.979 81.125  1.00 212.76 ? 73  PHE A CB    1 
ATOM   542  C  CG    . PHE A 1 73  ? 43.705  -36.416 80.795  1.00 217.23 ? 73  PHE A CG    1 
ATOM   543  C  CD1   . PHE A 1 73  ? 44.657  -37.179 80.139  1.00 211.70 ? 73  PHE A CD1   1 
ATOM   544  C  CD2   . PHE A 1 73  ? 42.484  -36.990 81.103  1.00 218.37 ? 73  PHE A CD2   1 
ATOM   545  C  CE1   . PHE A 1 73  ? 44.409  -38.497 79.818  1.00 208.36 ? 73  PHE A CE1   1 
ATOM   546  C  CE2   . PHE A 1 73  ? 42.220  -38.316 80.781  1.00 214.08 ? 73  PHE A CE2   1 
ATOM   547  C  CZ    . PHE A 1 73  ? 43.190  -39.071 80.135  1.00 209.82 ? 73  PHE A CZ    1 
ATOM   548  N  N     . HIS A 1 74  ? 44.507  -31.991 80.092  1.00 192.56 ? 74  HIS A N     1 
ATOM   549  C  CA    . HIS A 1 74  ? 45.091  -30.759 80.609  1.00 198.48 ? 74  HIS A CA    1 
ATOM   550  C  C     . HIS A 1 74  ? 45.056  -29.636 79.588  1.00 209.93 ? 74  HIS A C     1 
ATOM   551  O  O     . HIS A 1 74  ? 45.949  -29.511 78.760  1.00 199.59 ? 74  HIS A O     1 
ATOM   552  C  CB    . HIS A 1 74  ? 46.529  -31.015 81.050  1.00 198.23 ? 74  HIS A CB    1 
ATOM   553  C  CG    . HIS A 1 74  ? 47.057  -30.021 82.040  1.00 179.76 ? 74  HIS A CG    1 
ATOM   554  N  ND1   . HIS A 1 74  ? 46.526  -29.871 83.303  1.00 157.74 ? 74  HIS A ND1   1 
ATOM   555  C  CD2   . HIS A 1 74  ? 48.099  -29.160 81.967  1.00 179.38 ? 74  HIS A CD2   1 
ATOM   556  C  CE1   . HIS A 1 74  ? 47.215  -28.954 83.965  1.00 141.08 ? 74  HIS A CE1   1 
ATOM   557  N  NE2   . HIS A 1 74  ? 48.174  -28.507 83.178  1.00 159.47 ? 74  HIS A NE2   1 
ATOM   558  N  N     . PRO A 1 75  ? 44.032  -28.784 79.675  1.00 218.04 ? 75  PRO A N     1 
ATOM   559  C  CA    . PRO A 1 75  ? 43.763  -27.729 78.698  1.00 224.99 ? 75  PRO A CA    1 
ATOM   560  C  C     . PRO A 1 75  ? 44.685  -26.513 78.824  1.00 227.05 ? 75  PRO A C     1 
ATOM   561  O  O     . PRO A 1 75  ? 44.187  -25.391 78.941  1.00 220.35 ? 75  PRO A O     1 
ATOM   562  C  CB    . PRO A 1 75  ? 42.339  -27.317 79.051  1.00 240.60 ? 75  PRO A CB    1 
ATOM   563  C  CG    . PRO A 1 75  ? 42.280  -27.498 80.529  1.00 252.99 ? 75  PRO A CG    1 
ATOM   564  C  CD    . PRO A 1 75  ? 43.083  -28.744 80.803  1.00 235.01 ? 75  PRO A CD    1 
ATOM   565  N  N     . HIS A 1 76  ? 45.998  -26.727 78.782  1.00 212.46 ? 76  HIS A N     1 
ATOM   566  C  CA    . HIS A 1 76  ? 46.953  -25.623 78.853  1.00 185.04 ? 76  HIS A CA    1 
ATOM   567  C  C     . HIS A 1 76  ? 48.116  -25.791 77.884  1.00 147.95 ? 76  HIS A C     1 
ATOM   568  O  O     . HIS A 1 76  ? 48.162  -26.734 77.095  1.00 140.09 ? 76  HIS A O     1 
ATOM   569  C  CB    . HIS A 1 76  ? 47.478  -25.455 80.273  1.00 182.96 ? 76  HIS A CB    1 
ATOM   570  C  CG    . HIS A 1 76  ? 46.396  -25.257 81.290  1.00 172.02 ? 76  HIS A CG    1 
ATOM   571  N  ND1   . HIS A 1 76  ? 45.833  -24.026 81.545  1.00 166.98 ? 76  HIS A ND1   1 
ATOM   572  C  CD2   . HIS A 1 76  ? 45.763  -26.139 82.095  1.00 165.38 ? 76  HIS A CD2   1 
ATOM   573  C  CE1   . HIS A 1 76  ? 44.902  -24.157 82.473  1.00 172.12 ? 76  HIS A CE1   1 
ATOM   574  N  NE2   . HIS A 1 76  ? 44.840  -25.428 82.825  1.00 164.70 ? 76  HIS A NE2   1 
ATOM   575  N  N     . GLY A 1 77  ? 49.056  -24.860 77.941  1.00 128.08 ? 77  GLY A N     1 
ATOM   576  C  CA    . GLY A 1 77  ? 50.189  -24.891 77.039  1.00 43.82  ? 77  GLY A CA    1 
ATOM   577  C  C     . GLY A 1 77  ? 51.013  -26.153 77.173  1.00 47.08  ? 77  GLY A C     1 
ATOM   578  O  O     . GLY A 1 77  ? 51.035  -26.792 78.230  1.00 38.97  ? 77  GLY A O     1 
ATOM   579  N  N     . ASP A 1 78  ? 51.697  -26.509 76.089  1.00 134.48 ? 78  ASP A N     1 
ATOM   580  C  CA    . ASP A 1 78  ? 52.570  -27.671 76.075  1.00 139.25 ? 78  ASP A CA    1 
ATOM   581  C  C     . ASP A 1 78  ? 53.869  -27.370 76.797  1.00 107.65 ? 78  ASP A C     1 
ATOM   582  O  O     . ASP A 1 78  ? 54.381  -28.214 77.520  1.00 86.66  ? 78  ASP A O     1 
ATOM   583  C  CB    . ASP A 1 78  ? 52.825  -28.169 74.651  1.00 147.05 ? 78  ASP A CB    1 
ATOM   584  C  CG    . ASP A 1 78  ? 53.196  -27.057 73.705  1.00 130.03 ? 78  ASP A CG    1 
ATOM   585  O  OD1   . ASP A 1 78  ? 54.395  -26.717 73.617  1.00 119.87 ? 78  ASP A OD1   1 
ATOM   586  O  OD2   . ASP A 1 78  ? 52.283  -26.524 73.043  1.00 120.88 ? 78  ASP A OD2   1 
ATOM   587  N  N     . SER A 1 79  ? 54.395  -26.163 76.638  1.00 90.08  ? 79  SER A N     1 
ATOM   588  C  CA    . SER A 1 79  ? 55.551  -25.772 77.439  1.00 75.75  ? 79  SER A CA    1 
ATOM   589  C  C     . SER A 1 79  ? 55.369  -26.192 78.908  1.00 75.46  ? 79  SER A C     1 
ATOM   590  O  O     . SER A 1 79  ? 56.213  -26.884 79.478  1.00 82.44  ? 79  SER A O     1 
ATOM   591  C  CB    . SER A 1 79  ? 55.777  -24.268 77.360  1.00 79.19  ? 79  SER A CB    1 
ATOM   592  O  OG    . SER A 1 79  ? 54.607  -23.582 77.782  1.00 89.64  ? 79  SER A OG    1 
ATOM   593  N  N     . SER A 1 80  ? 54.261  -25.775 79.513  1.00 80.37  ? 80  SER A N     1 
ATOM   594  C  CA    . SER A 1 80  ? 54.039  -26.032 80.931  1.00 100.43 ? 80  SER A CA    1 
ATOM   595  C  C     . SER A 1 80  ? 53.956  -27.518 81.243  1.00 120.84 ? 80  SER A C     1 
ATOM   596  O  O     . SER A 1 80  ? 54.547  -27.984 82.213  1.00 122.68 ? 80  SER A O     1 
ATOM   597  C  CB    . SER A 1 80  ? 52.788  -25.313 81.430  1.00 103.71 ? 80  SER A CB    1 
ATOM   598  O  OG    . SER A 1 80  ? 53.070  -23.940 81.633  1.00 107.29 ? 80  SER A OG    1 
ATOM   599  N  N     . ILE A 1 81  ? 53.224  -28.260 80.422  1.00 138.32 ? 81  ILE A N     1 
ATOM   600  C  CA    . ILE A 1 81  ? 53.156  -29.700 80.599  1.00 154.20 ? 81  ILE A CA    1 
ATOM   601  C  C     . ILE A 1 81  ? 54.538  -30.316 80.451  1.00 141.03 ? 81  ILE A C     1 
ATOM   602  O  O     . ILE A 1 81  ? 54.982  -31.089 81.293  1.00 135.02 ? 81  ILE A O     1 
ATOM   603  C  CB    . ILE A 1 81  ? 52.226  -30.343 79.593  1.00 192.80 ? 81  ILE A CB    1 
ATOM   604  C  CG1   . ILE A 1 81  ? 50.797  -29.833 79.798  1.00 197.88 ? 81  ILE A CG1   1 
ATOM   605  C  CG2   . ILE A 1 81  ? 52.315  -31.845 79.717  1.00 204.13 ? 81  ILE A CG2   1 
ATOM   606  C  CD1   . ILE A 1 81  ? 49.879  -30.090 78.605  1.00 203.03 ? 81  ILE A CD1   1 
ATOM   607  N  N     . TYR A 1 82  ? 55.234  -29.951 79.387  1.00 112.04 ? 82  TYR A N     1 
ATOM   608  C  CA    . TYR A 1 82  ? 56.548  -30.515 79.135  1.00 90.39  ? 82  TYR A CA    1 
ATOM   609  C  C     . TYR A 1 82  ? 57.525  -30.195 80.274  1.00 72.83  ? 82  TYR A C     1 
ATOM   610  O  O     . TYR A 1 82  ? 58.159  -31.101 80.812  1.00 65.04  ? 82  TYR A O     1 
ATOM   611  C  CB    . TYR A 1 82  ? 57.091  -30.072 77.773  1.00 107.18 ? 82  TYR A CB    1 
ATOM   612  C  CG    . TYR A 1 82  ? 58.426  -30.684 77.422  1.00 123.95 ? 82  TYR A CG    1 
ATOM   613  C  CD1   . TYR A 1 82  ? 58.551  -32.054 77.191  1.00 140.63 ? 82  TYR A CD1   1 
ATOM   614  C  CD2   . TYR A 1 82  ? 59.578  -29.892 77.341  1.00 133.59 ? 82  TYR A CD2   1 
ATOM   615  C  CE1   . TYR A 1 82  ? 59.794  -32.616 76.870  1.00 151.78 ? 82  TYR A CE1   1 
ATOM   616  C  CE2   . TYR A 1 82  ? 60.815  -30.447 77.019  1.00 145.18 ? 82  TYR A CE2   1 
ATOM   617  C  CZ    . TYR A 1 82  ? 60.919  -31.807 76.787  1.00 158.33 ? 82  TYR A CZ    1 
ATOM   618  O  OH    . TYR A 1 82  ? 62.153  -32.339 76.475  1.00 171.66 ? 82  TYR A OH    1 
ATOM   619  N  N     . ASP A 1 83  ? 57.629  -28.926 80.656  1.00 74.79  ? 83  ASP A N     1 
ATOM   620  C  CA    . ASP A 1 83  ? 58.504  -28.539 81.769  1.00 87.87  ? 83  ASP A CA    1 
ATOM   621  C  C     . ASP A 1 83  ? 58.184  -29.297 83.047  1.00 66.56  ? 83  ASP A C     1 
ATOM   622  O  O     . ASP A 1 83  ? 59.079  -29.672 83.798  1.00 69.65  ? 83  ASP A O     1 
ATOM   623  C  CB    . ASP A 1 83  ? 58.435  -27.037 82.044  1.00 108.32 ? 83  ASP A CB    1 
ATOM   624  C  CG    . ASP A 1 83  ? 59.019  -26.222 80.921  1.00 119.12 ? 83  ASP A CG    1 
ATOM   625  O  OD1   . ASP A 1 83  ? 59.642  -26.825 80.002  1.00 112.03 ? 83  ASP A OD1   1 
ATOM   626  O  OD2   . ASP A 1 83  ? 58.863  -24.979 80.961  1.00 129.66 ? 83  ASP A OD2   1 
ATOM   627  N  N     . ALA A 1 84  ? 56.900  -29.505 83.295  1.00 72.85  ? 84  ALA A N     1 
ATOM   628  C  CA    . ALA A 1 84  ? 56.478  -30.290 84.442  1.00 93.43  ? 84  ALA A CA    1 
ATOM   629  C  C     . ALA A 1 84  ? 56.952  -31.747 84.319  1.00 87.95  ? 84  ALA A C     1 
ATOM   630  O  O     . ALA A 1 84  ? 57.469  -32.313 85.276  1.00 73.52  ? 84  ALA A O     1 
ATOM   631  C  CB    . ALA A 1 84  ? 54.957  -30.202 84.616  1.00 119.53 ? 84  ALA A CB    1 
ATOM   632  N  N     . MET A 1 85  ? 56.800  -32.326 83.129  1.00 106.44 ? 85  MET A N     1 
ATOM   633  C  CA    . MET A 1 85  ? 57.243  -33.693 82.832  1.00 127.29 ? 85  MET A CA    1 
ATOM   634  C  C     . MET A 1 85  ? 58.771  -33.827 82.953  1.00 110.59 ? 85  MET A C     1 
ATOM   635  O  O     . MET A 1 85  ? 59.296  -34.785 83.523  1.00 110.32 ? 85  MET A O     1 
ATOM   636  C  CB    . MET A 1 85  ? 56.767  -34.070 81.426  1.00 153.98 ? 85  MET A CB    1 
ATOM   637  C  CG    . MET A 1 85  ? 57.138  -35.459 80.924  1.00 162.15 ? 85  MET A CG    1 
ATOM   638  S  SD    . MET A 1 85  ? 56.451  -35.788 79.265  1.00 199.12 ? 85  MET A SD    1 
ATOM   639  N  N     . VAL A 1 86  ? 59.479  -32.841 82.424  1.00 99.50  ? 86  VAL A N     1 
ATOM   640  C  CA    . VAL A 1 86  ? 60.926  -32.807 82.508  1.00 90.67  ? 86  VAL A CA    1 
ATOM   641  C  C     . VAL A 1 86  ? 61.368  -32.745 83.994  1.00 64.16  ? 86  VAL A C     1 
ATOM   642  O  O     . VAL A 1 86  ? 62.265  -33.481 84.429  1.00 89.80  ? 86  VAL A O     1 
ATOM   643  C  CB    . VAL A 1 86  ? 61.486  -31.585 81.710  1.00 89.05  ? 86  VAL A CB    1 
ATOM   644  C  CG1   . VAL A 1 86  ? 62.858  -31.130 82.248  1.00 90.51  ? 86  VAL A CG1   1 
ATOM   645  C  CG2   . VAL A 1 86  ? 61.519  -31.870 80.204  1.00 93.39  ? 86  VAL A CG2   1 
ATOM   646  N  N     . ARG A 1 87  ? 60.732  -31.872 84.772  1.00 64.98  ? 87  ARG A N     1 
ATOM   647  C  CA    . ARG A 1 87  ? 61.129  -31.734 86.155  1.00 65.30  ? 87  ARG A CA    1 
ATOM   648  C  C     . ARG A 1 87  ? 61.015  -33.083 86.863  1.00 64.77  ? 87  ARG A C     1 
ATOM   649  O  O     . ARG A 1 87  ? 61.963  -33.509 87.520  1.00 64.48  ? 87  ARG A O     1 
ATOM   650  C  CB    . ARG A 1 87  ? 60.328  -30.658 86.884  1.00 66.24  ? 87  ARG A CB    1 
ATOM   651  C  CG    . ARG A 1 87  ? 60.848  -30.397 88.312  1.00 74.49  ? 87  ARG A CG    1 
ATOM   652  C  CD    . ARG A 1 87  ? 60.132  -29.235 89.004  1.00 67.57  ? 87  ARG A CD    1 
ATOM   653  N  NE    . ARG A 1 87  ? 60.756  -28.869 90.286  1.00 72.11  ? 87  ARG A NE    1 
ATOM   654  C  CZ    . ARG A 1 87  ? 60.578  -29.532 91.422  1.00 77.60  ? 87  ARG A CZ    1 
ATOM   655  N  NH1   . ARG A 1 87  ? 59.814  -30.613 91.430  1.00 84.56  ? 87  ARG A NH1   1 
ATOM   656  N  NH2   . ARG A 1 87  ? 61.172  -29.134 92.542  1.00 74.96  ? 87  ARG A NH2   1 
ATOM   657  N  N     . MET A 1 88  ? 59.878  -33.764 86.703  1.00 64.63  ? 88  MET A N     1 
ATOM   658  C  CA    . MET A 1 88  ? 59.672  -35.085 87.321  1.00 64.12  ? 88  MET A CA    1 
ATOM   659  C  C     . MET A 1 88  ? 60.713  -36.118 86.866  1.00 63.21  ? 88  MET A C     1 
ATOM   660  O  O     . MET A 1 88  ? 60.669  -37.260 87.309  1.00 71.11  ? 88  MET A O     1 
ATOM   661  C  CB    . MET A 1 88  ? 58.268  -35.651 87.029  1.00 64.08  ? 88  MET A CB    1 
ATOM   662  C  CG    . MET A 1 88  ? 57.047  -34.791 87.406  1.00 91.59  ? 88  MET A CG    1 
ATOM   663  S  SD    . MET A 1 88  ? 55.533  -35.720 87.057  1.00 199.10 ? 88  MET A SD    1 
ATOM   664  C  CE    . MET A 1 88  ? 54.895  -34.797 85.678  1.00 154.12 ? 88  MET A CE    1 
ATOM   665  N  N     . SER A 1 89  ? 61.629  -35.735 85.976  1.00 74.93  ? 89  SER A N     1 
ATOM   666  C  CA    . SER A 1 89  ? 62.641  -36.673 85.498  1.00 100.92 ? 89  SER A CA    1 
ATOM   667  C  C     . SER A 1 89  ? 64.043  -36.279 85.971  1.00 124.84 ? 89  SER A C     1 
ATOM   668  O  O     . SER A 1 89  ? 65.005  -37.041 85.845  1.00 121.07 ? 89  SER A O     1 
ATOM   669  C  CB    . SER A 1 89  ? 62.641  -36.715 83.976  1.00 119.44 ? 89  SER A CB    1 
ATOM   670  O  OG    . SER A 1 89  ? 63.549  -35.755 83.461  1.00 131.34 ? 89  SER A OG    1 
ATOM   671  N  N     . GLN A 1 90  ? 64.164  -35.068 86.489  1.00 147.37 ? 90  GLN A N     1 
ATOM   672  C  CA    . GLN A 1 90  ? 65.462  -34.589 86.949  1.00 149.03 ? 90  GLN A CA    1 
ATOM   673  C  C     . GLN A 1 90  ? 65.739  -35.118 88.353  1.00 124.69 ? 90  GLN A C     1 
ATOM   674  O  O     . GLN A 1 90  ? 64.967  -34.888 89.279  1.00 119.12 ? 90  GLN A O     1 
ATOM   675  C  CB    . GLN A 1 90  ? 65.509  -33.065 86.891  1.00 162.04 ? 90  GLN A CB    1 
ATOM   676  C  CG    . GLN A 1 90  ? 64.976  -32.546 85.587  1.00 162.66 ? 90  GLN A CG    1 
ATOM   677  C  CD    . GLN A 1 90  ? 64.931  -31.050 85.534  1.00 154.93 ? 90  GLN A CD    1 
ATOM   678  O  OE1   . GLN A 1 90  ? 64.171  -30.404 86.263  1.00 149.67 ? 90  GLN A OE1   1 
ATOM   679  N  NE2   . GLN A 1 90  ? 65.744  -30.474 84.656  1.00 150.74 ? 90  GLN A NE2   1 
ATOM   680  N  N     . ASN A 1 91  ? 66.832  -35.854 88.493  1.00 115.36 ? 91  ASN A N     1 
ATOM   681  C  CA    . ASN A 1 91  ? 67.116  -36.558 89.739  1.00 108.21 ? 91  ASN A CA    1 
ATOM   682  C  C     . ASN A 1 91  ? 67.845  -35.705 90.791  1.00 94.76  ? 91  ASN A C     1 
ATOM   683  O  O     . ASN A 1 91  ? 68.154  -36.182 91.875  1.00 76.82  ? 91  ASN A O     1 
ATOM   684  C  CB    . ASN A 1 91  ? 67.860  -37.866 89.462  1.00 112.73 ? 91  ASN A CB    1 
ATOM   685  C  CG    . ASN A 1 91  ? 69.311  -37.652 89.083  1.00 115.69 ? 91  ASN A CG    1 
ATOM   686  O  OD1   . ASN A 1 91  ? 70.106  -38.576 89.154  1.00 98.81  ? 91  ASN A OD1   1 
ATOM   687  N  ND2   . ASN A 1 91  ? 69.665  -36.437 88.687  1.00 112.21 ? 91  ASN A ND2   1 
ATOM   688  N  N     . TRP A 1 92  ? 68.101  -34.444 90.459  1.00 112.92 ? 92  TRP A N     1 
ATOM   689  C  CA    . TRP A 1 92  ? 68.622  -33.482 91.413  1.00 128.58 ? 92  TRP A CA    1 
ATOM   690  C  C     . TRP A 1 92  ? 67.511  -32.577 91.926  1.00 117.04 ? 92  TRP A C     1 
ATOM   691  O  O     . TRP A 1 92  ? 67.753  -31.701 92.770  1.00 113.83 ? 92  TRP A O     1 
ATOM   692  C  CB    . TRP A 1 92  ? 69.720  -32.636 90.774  1.00 121.58 ? 92  TRP A CB    1 
ATOM   693  C  CG    . TRP A 1 92  ? 69.252  -31.828 89.598  1.00 114.11 ? 92  TRP A CG    1 
ATOM   694  C  CD1   . TRP A 1 92  ? 68.813  -30.537 89.616  1.00 103.79 ? 92  TRP A CD1   1 
ATOM   695  C  CD2   . TRP A 1 92  ? 69.171  -32.260 88.227  1.00 115.26 ? 92  TRP A CD2   1 
ATOM   696  N  NE1   . TRP A 1 92  ? 68.479  -30.130 88.341  1.00 100.01 ? 92  TRP A NE1   1 
ATOM   697  C  CE2   . TRP A 1 92  ? 68.687  -31.169 87.473  1.00 107.06 ? 92  TRP A CE2   1 
ATOM   698  C  CE3   . TRP A 1 92  ? 69.448  -33.464 87.574  1.00 124.52 ? 92  TRP A CE3   1 
ATOM   699  C  CZ2   . TRP A 1 92  ? 68.470  -31.247 86.095  1.00 121.10 ? 92  TRP A CZ2   1 
ATOM   700  C  CZ3   . TRP A 1 92  ? 69.242  -33.536 86.213  1.00 128.45 ? 92  TRP A CZ3   1 
ATOM   701  C  CH2   . TRP A 1 92  ? 68.754  -32.433 85.486  1.00 123.47 ? 92  TRP A CH2   1 
ATOM   702  N  N     . LYS A 1 93  ? 66.303  -32.764 91.397  1.00 109.50 ? 93  LYS A N     1 
ATOM   703  C  CA    . LYS A 1 93  ? 65.129  -32.047 91.893  1.00 105.38 ? 93  LYS A CA    1 
ATOM   704  C  C     . LYS A 1 93  ? 64.192  -33.046 92.577  1.00 104.08 ? 93  LYS A C     1 
ATOM   705  O  O     . LYS A 1 93  ? 63.550  -32.708 93.576  1.00 113.10 ? 93  LYS A O     1 
ATOM   706  C  CB    . LYS A 1 93  ? 64.411  -31.258 90.781  1.00 77.88  ? 93  LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 93  ? 65.320  -30.304 89.985  1.00 68.48  ? 93  LYS A CG    1 
ATOM   708  C  CD    . LYS A 1 93  ? 64.950  -28.817 90.130  1.00 67.00  ? 93  LYS A CD    1 
ATOM   709  N  N     . ASN A 1 94  ? 64.142  -34.279 92.063  1.00 102.64 ? 94  ASN A N     1 
ATOM   710  C  CA    . ASN A 1 94  ? 63.331  -35.331 92.681  1.00 80.89  ? 94  ASN A CA    1 
ATOM   711  C  C     . ASN A 1 94  ? 64.120  -36.438 93.372  1.00 74.60  ? 94  ASN A C     1 
ATOM   712  O  O     . ASN A 1 94  ? 65.001  -37.057 92.766  1.00 70.51  ? 94  ASN A O     1 
ATOM   713  C  CB    . ASN A 1 94  ? 62.352  -35.934 91.684  1.00 84.23  ? 94  ASN A CB    1 
ATOM   714  C  CG    . ASN A 1 94  ? 61.194  -35.011 91.387  1.00 87.69  ? 94  ASN A CG    1 
ATOM   715  O  OD1   . ASN A 1 94  ? 61.112  -34.423 90.302  1.00 68.54  ? 94  ASN A OD1   1 
ATOM   716  N  ND2   . ASN A 1 94  ? 60.293  -34.867 92.359  1.00 111.38 ? 94  ASN A ND2   1 
ATOM   717  N  N     . ARG A 1 95  ? 63.787  -36.680 94.644  1.00 64.11  ? 95  ARG A N     1 
ATOM   718  C  CA    . ARG A 1 95  ? 64.486  -37.675 95.453  1.00 63.62  ? 95  ARG A CA    1 
ATOM   719  C  C     . ARG A 1 95  ? 64.244  -39.045 94.848  1.00 62.78  ? 95  ARG A C     1 
ATOM   720  O  O     . ARG A 1 95  ? 65.123  -39.911 94.843  1.00 62.13  ? 95  ARG A O     1 
ATOM   721  C  CB    . ARG A 1 95  ? 64.003  -37.633 96.920  1.00 73.40  ? 95  ARG A CB    1 
ATOM   722  C  CG    . ARG A 1 95  ? 64.622  -38.676 97.838  1.00 76.54  ? 95  ARG A CG    1 
ATOM   723  C  CD    . ARG A 1 95  ? 66.089  -38.381 98.028  1.00 74.45  ? 95  ARG A CD    1 
ATOM   724  N  NE    . ARG A 1 95  ? 66.773  -39.385 98.832  1.00 63.04  ? 95  ARG A NE    1 
ATOM   725  C  CZ    . ARG A 1 95  ? 67.165  -40.567 98.375  1.00 62.21  ? 95  ARG A CZ    1 
ATOM   726  N  NH1   . ARG A 1 95  ? 66.932  -40.888 97.120  1.00 61.78  ? 95  ARG A NH1   1 
ATOM   727  N  NH2   . ARG A 1 95  ? 67.794  -41.428 99.168  1.00 61.82  ? 95  ARG A NH2   1 
ATOM   728  N  N     . GLU A 1 96  ? 63.042  -39.226 94.326  1.00 66.50  ? 96  GLU A N     1 
ATOM   729  C  CA    . GLU A 1 96  ? 62.663  -40.468 93.657  1.00 69.45  ? 96  GLU A CA    1 
ATOM   730  C  C     . GLU A 1 96  ? 61.945  -40.169 92.318  1.00 62.08  ? 96  GLU A C     1 
ATOM   731  O  O     . GLU A 1 96  ? 60.708  -40.076 92.286  1.00 62.52  ? 96  GLU A O     1 
ATOM   732  C  CB    . GLU A 1 96  ? 61.754  -41.264 94.592  1.00 80.40  ? 96  GLU A CB    1 
ATOM   733  C  CG    . GLU A 1 96  ? 62.035  -42.735 94.616  1.00 74.39  ? 96  GLU A CG    1 
ATOM   734  C  CD    . GLU A 1 96  ? 63.321  -43.081 95.324  1.00 79.99  ? 96  GLU A CD    1 
ATOM   735  O  OE1   . GLU A 1 96  ? 63.476  -42.663 96.488  1.00 80.74  ? 96  GLU A OE1   1 
ATOM   736  O  OE2   . GLU A 1 96  ? 64.165  -43.786 94.724  1.00 82.78  ? 96  GLU A OE2   1 
ATOM   737  N  N     . ILE A 1 97  ? 62.694  -40.025 91.217  1.00 61.72  ? 97  ILE A N     1 
ATOM   738  C  CA    . ILE A 1 97  ? 62.066  -39.613 89.947  1.00 69.31  ? 97  ILE A CA    1 
ATOM   739  C  C     . ILE A 1 97  ? 60.964  -40.525 89.426  1.00 61.41  ? 97  ILE A C     1 
ATOM   740  O  O     . ILE A 1 97  ? 61.056  -41.743 89.523  1.00 60.77  ? 97  ILE A O     1 
ATOM   741  C  CB    . ILE A 1 97  ? 63.060  -39.422 88.808  1.00 61.36  ? 97  ILE A CB    1 
ATOM   742  C  CG1   . ILE A 1 97  ? 63.570  -40.774 88.298  1.00 60.39  ? 97  ILE A CG1   1 
ATOM   743  C  CG2   . ILE A 1 97  ? 64.175  -38.462 89.208  1.00 61.73  ? 97  ILE A CG2   1 
ATOM   744  C  CD1   . ILE A 1 97  ? 64.563  -40.625 87.127  1.00 79.93  ? 97  ILE A CD1   1 
ATOM   745  N  N     . LEU A 1 98  ? 59.929  -39.904 88.861  1.00 61.85  ? 98  LEU A N     1 
ATOM   746  C  CA    . LEU A 1 98  ? 58.745  -40.607 88.377  1.00 61.64  ? 98  LEU A CA    1 
ATOM   747  C  C     . LEU A 1 98  ? 58.700  -40.708 86.841  1.00 61.22  ? 98  LEU A C     1 
ATOM   748  O  O     . LEU A 1 98  ? 57.858  -41.391 86.269  1.00 67.17  ? 98  LEU A O     1 
ATOM   749  C  CB    . LEU A 1 98  ? 57.495  -39.884 88.863  1.00 80.32  ? 98  LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 98  ? 57.468  -39.599 90.354  1.00 113.12 ? 98  LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 98  ? 56.376  -38.572 90.717  1.00 161.86 ? 98  LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 98  ? 57.292  -40.916 91.097  1.00 102.51 ? 98  LEU A CD2   1 
ATOM   753  N  N     . VAL A 1 99  ? 59.592  -40.000 86.175  1.00 61.22  ? 99  VAL A N     1 
ATOM   754  C  CA    . VAL A 1 99  ? 59.653  -40.046 84.732  1.00 78.33  ? 99  VAL A CA    1 
ATOM   755  C  C     . VAL A 1 99  ? 61.108  -40.241 84.362  1.00 70.96  ? 99  VAL A C     1 
ATOM   756  O  O     . VAL A 1 99  ? 61.987  -39.563 84.914  1.00 67.72  ? 99  VAL A O     1 
ATOM   757  C  CB    . VAL A 1 99  ? 59.116  -38.741 84.123  1.00 109.72 ? 99  VAL A CB    1 
ATOM   758  C  CG1   . VAL A 1 99  ? 59.308  -38.736 82.650  1.00 135.86 ? 99  VAL A CG1   1 
ATOM   759  C  CG2   . VAL A 1 99  ? 57.650  -38.583 84.444  1.00 113.76 ? 99  VAL A CG2   1 
ATOM   760  N  N     . GLU A 1 100 ? 61.360  -41.206 83.479  1.00 59.47  ? 100 GLU A N     1 
ATOM   761  C  CA    . GLU A 1 100 ? 62.674  -41.397 82.866  1.00 65.77  ? 100 GLU A CA    1 
ATOM   762  C  C     . GLU A 1 100 ? 62.670  -40.815 81.452  1.00 65.63  ? 100 GLU A C     1 
ATOM   763  O  O     . GLU A 1 100 ? 61.804  -41.132 80.630  1.00 65.43  ? 100 GLU A O     1 
ATOM   764  C  CB    . GLU A 1 100 ? 63.046  -42.872 82.791  1.00 57.99  ? 100 GLU A CB    1 
ATOM   765  C  CG    . GLU A 1 100 ? 63.040  -43.562 84.117  1.00 63.39  ? 100 GLU A CG    1 
ATOM   766  C  CD    . GLU A 1 100 ? 63.507  -44.997 84.015  1.00 74.75  ? 100 GLU A CD    1 
ATOM   767  O  OE1   . GLU A 1 100 ? 64.254  -45.428 84.916  1.00 89.03  ? 100 GLU A OE1   1 
ATOM   768  O  OE2   . GLU A 1 100 ? 63.139  -45.689 83.039  1.00 68.61  ? 100 GLU A OE2   1 
ATOM   769  N  N     . MET A 1 101 ? 63.654  -39.969 81.180  1.00 68.96  ? 101 MET A N     1 
ATOM   770  C  CA    . MET A 1 101 ? 63.722  -39.232 79.946  1.00 95.69  ? 101 MET A CA    1 
ATOM   771  C  C     . MET A 1 101 ? 65.084  -39.469 79.323  1.00 84.49  ? 101 MET A C     1 
ATOM   772  O  O     . MET A 1 101 ? 66.116  -39.365 79.993  1.00 58.40  ? 101 MET A O     1 
ATOM   773  C  CB    . MET A 1 101 ? 63.484  -37.734 80.207  1.00 115.51 ? 101 MET A CB    1 
ATOM   774  C  CG    . MET A 1 101 ? 63.500  -36.863 78.953  1.00 127.17 ? 101 MET A CG    1 
ATOM   775  S  SD    . MET A 1 101 ? 62.792  -35.216 79.178  1.00 370.74 ? 101 MET A SD    1 
ATOM   776  C  CE    . MET A 1 101 ? 61.160  -35.637 79.769  1.00 177.50 ? 101 MET A CE    1 
ATOM   777  N  N     . HIS A 1 102 ? 65.066  -39.803 78.035  1.00 103.47 ? 102 HIS A N     1 
ATOM   778  C  CA    . HIS A 1 102 ? 66.267  -40.001 77.233  1.00 124.44 ? 102 HIS A CA    1 
ATOM   779  C  C     . HIS A 1 102 ? 66.617  -38.715 76.503  1.00 122.40 ? 102 HIS A C     1 
ATOM   780  O  O     . HIS A 1 102 ? 65.817  -38.207 75.717  1.00 125.67 ? 102 HIS A O     1 
ATOM   781  C  CB    . HIS A 1 102 ? 66.010  -41.075 76.185  1.00 145.07 ? 102 HIS A CB    1 
ATOM   782  C  CG    . HIS A 1 102 ? 66.713  -42.359 76.456  1.00 148.27 ? 102 HIS A CG    1 
ATOM   783  N  ND1   . HIS A 1 102 ? 66.827  -43.355 75.510  1.00 149.69 ? 102 HIS A ND1   1 
ATOM   784  C  CD2   . HIS A 1 102 ? 67.341  -42.815 77.564  1.00 147.04 ? 102 HIS A CD2   1 
ATOM   785  C  CE1   . HIS A 1 102 ? 67.497  -44.370 76.025  1.00 143.95 ? 102 HIS A CE1   1 
ATOM   786  N  NE2   . HIS A 1 102 ? 67.818  -44.068 77.272  1.00 144.64 ? 102 HIS A NE2   1 
ATOM   787  N  N     . GLY A 1 103 ? 67.819  -38.201 76.741  1.00 128.58 ? 103 GLY A N     1 
ATOM   788  C  CA    . GLY A 1 103 ? 68.280  -36.994 76.077  1.00 134.52 ? 103 GLY A CA    1 
ATOM   789  C  C     . GLY A 1 103 ? 68.616  -35.873 77.046  1.00 144.99 ? 103 GLY A C     1 
ATOM   790  O  O     . GLY A 1 103 ? 68.596  -36.050 78.255  1.00 136.45 ? 103 GLY A O     1 
ATOM   791  N  N     . ASN A 1 104 ? 68.920  -34.710 76.507  1.00 162.99 ? 104 ASN A N     1 
ATOM   792  C  CA    . ASN A 1 104 ? 69.170  -33.548 77.328  1.00 147.92 ? 104 ASN A CA    1 
ATOM   793  C  C     . ASN A 1 104 ? 67.897  -33.131 78.068  1.00 126.36 ? 104 ASN A C     1 
ATOM   794  O  O     . ASN A 1 104 ? 66.982  -32.558 77.483  1.00 132.53 ? 104 ASN A O     1 
ATOM   795  C  CB    . ASN A 1 104 ? 69.717  -32.392 76.468  1.00 140.57 ? 104 ASN A CB    1 
ATOM   796  C  CG    . ASN A 1 104 ? 69.999  -31.146 77.280  1.00 115.98 ? 104 ASN A CG    1 
ATOM   797  O  OD1   . ASN A 1 104 ? 69.808  -31.125 78.502  1.00 99.39  ? 104 ASN A OD1   1 
ATOM   798  N  ND2   . ASN A 1 104 ? 70.461  -30.101 76.612  1.00 99.17  ? 104 ASN A ND2   1 
ATOM   799  N  N     . ASN A 1 105 ? 67.840  -33.435 79.359  1.00 102.86 ? 105 ASN A N     1 
ATOM   800  C  CA    . ASN A 1 105 ? 66.733  -32.982 80.191  1.00 83.26  ? 105 ASN A CA    1 
ATOM   801  C  C     . ASN A 1 105 ? 67.229  -31.999 81.223  1.00 68.77  ? 105 ASN A C     1 
ATOM   802  O  O     . ASN A 1 105 ? 66.706  -31.947 82.321  1.00 67.35  ? 105 ASN A O     1 
ATOM   803  C  CB    . ASN A 1 105 ? 66.058  -34.147 80.894  1.00 72.75  ? 105 ASN A CB    1 
ATOM   804  C  CG    . ASN A 1 105 ? 67.003  -34.889 81.825  1.00 69.32  ? 105 ASN A CG    1 
ATOM   805  O  OD1   . ASN A 1 105 ? 68.206  -34.993 81.553  1.00 61.44  ? 105 ASN A OD1   1 
ATOM   806  N  ND2   . ASN A 1 105 ? 66.465  -35.403 82.938  1.00 77.90  ? 105 ASN A ND2   1 
ATOM   807  N  N     . GLY A 1 106 ? 68.246  -31.227 80.859  1.00 75.63  ? 106 GLY A N     1 
ATOM   808  C  CA    . GLY A 1 106 ? 68.820  -30.243 81.759  1.00 83.86  ? 106 GLY A CA    1 
ATOM   809  C  C     . GLY A 1 106 ? 69.981  -30.764 82.592  1.00 105.65 ? 106 GLY A C     1 
ATOM   810  O  O     . GLY A 1 106 ? 70.467  -31.884 82.386  1.00 101.24 ? 106 GLY A O     1 
ATOM   811  N  N     . SER A 1 107 ? 70.416  -29.949 83.547  1.00 120.31 ? 107 SER A N     1 
ATOM   812  C  CA    . SER A 1 107 ? 71.560  -30.282 84.396  1.00 103.62 ? 107 SER A CA    1 
ATOM   813  C  C     . SER A 1 107 ? 71.496  -29.467 85.674  1.00 88.02  ? 107 SER A C     1 
ATOM   814  O  O     . SER A 1 107 ? 70.704  -28.531 85.774  1.00 71.13  ? 107 SER A O     1 
ATOM   815  C  CB    . SER A 1 107 ? 72.862  -29.961 83.672  1.00 133.02 ? 107 SER A CB    1 
ATOM   816  O  OG    . SER A 1 107 ? 72.976  -28.555 83.469  1.00 150.56 ? 107 SER A OG    1 
ATOM   817  N  N     . MET A 1 108 ? 72.329  -29.810 86.653  1.00 79.67  ? 108 MET A N     1 
ATOM   818  C  CA    . MET A 1 108 ? 72.440  -28.985 87.854  1.00 87.00  ? 108 MET A CA    1 
ATOM   819  C  C     . MET A 1 108 ? 72.896  -27.571 87.515  1.00 91.35  ? 108 MET A C     1 
ATOM   820  O  O     . MET A 1 108 ? 72.687  -26.657 88.296  1.00 64.56  ? 108 MET A O     1 
ATOM   821  C  CB    . MET A 1 108 ? 73.399  -29.597 88.860  1.00 99.35  ? 108 MET A CB    1 
ATOM   822  C  CG    . MET A 1 108 ? 72.851  -30.827 89.563  1.00 105.24 ? 108 MET A CG    1 
ATOM   823  S  SD    . MET A 1 108 ? 73.757  -31.220 91.060  1.00 376.05 ? 108 MET A SD    1 
ATOM   824  C  CE    . MET A 1 108 ? 73.254  -29.870 92.118  1.00 183.20 ? 108 MET A CE    1 
ATOM   825  N  N     . ASP A 1 109 ? 73.515  -27.392 86.350  1.00 103.17 ? 109 ASP A N     1 
ATOM   826  C  CA    . ASP A 1 109 ? 73.941  -26.061 85.913  1.00 109.83 ? 109 ASP A CA    1 
ATOM   827  C  C     . ASP A 1 109 ? 72.757  -25.273 85.349  1.00 121.84 ? 109 ASP A C     1 
ATOM   828  O  O     . ASP A 1 109 ? 72.907  -24.144 84.889  1.00 131.16 ? 109 ASP A O     1 
ATOM   829  C  CB    . ASP A 1 109 ? 75.038  -26.155 84.845  1.00 96.45  ? 109 ASP A CB    1 
ATOM   830  C  CG    . ASP A 1 109 ? 76.390  -26.562 85.411  1.00 94.55  ? 109 ASP A CG    1 
ATOM   831  O  OD1   . ASP A 1 109 ? 76.585  -26.464 86.638  1.00 104.48 ? 109 ASP A OD1   1 
ATOM   832  O  OD2   . ASP A 1 109 ? 77.266  -26.969 84.617  1.00 68.93  ? 109 ASP A OD2   1 
ATOM   833  N  N     . GLY A 1 110 ? 71.579  -25.881 85.367  1.00 119.43 ? 110 GLY A N     1 
ATOM   834  C  CA    . GLY A 1 110 ? 70.404  -25.250 84.797  1.00 126.79 ? 110 GLY A CA    1 
ATOM   835  C  C     . GLY A 1 110 ? 70.479  -24.862 83.322  1.00 121.12 ? 110 GLY A C     1 
ATOM   836  O  O     . GLY A 1 110 ? 69.973  -23.802 82.948  1.00 112.21 ? 110 GLY A O     1 
ATOM   837  N  N     . ASP A 1 111 ? 71.088  -25.685 82.469  1.00 126.61 ? 111 ASP A N     1 
ATOM   838  C  CA    . ASP A 1 111 ? 70.936  -25.426 81.030  1.00 110.93 ? 111 ASP A CA    1 
ATOM   839  C  C     . ASP A 1 111 ? 69.629  -25.994 80.453  1.00 80.69  ? 111 ASP A C     1 
ATOM   840  O  O     . ASP A 1 111 ? 69.206  -27.101 80.798  1.00 85.76  ? 111 ASP A O     1 
ATOM   841  C  CB    . ASP A 1 111 ? 72.177  -25.786 80.170  1.00 189.81 ? 111 ASP A CB    1 
ATOM   842  C  CG    . ASP A 1 111 ? 73.024  -26.908 80.756  1.00 185.41 ? 111 ASP A CG    1 
ATOM   843  O  OD1   . ASP A 1 111 ? 74.271  -26.803 80.692  1.00 182.85 ? 111 ASP A OD1   1 
ATOM   844  O  OD2   . ASP A 1 111 ? 72.458  -27.903 81.246  1.00 190.38 ? 111 ASP A OD2   1 
ATOM   845  N  N     . PRO A 1 112 ? 68.986  -25.219 79.572  1.00 56.14  ? 112 PRO A N     1 
ATOM   846  C  CA    . PRO A 1 112 ? 67.687  -25.596 79.000  1.00 46.83  ? 112 PRO A CA    1 
ATOM   847  C  C     . PRO A 1 112 ? 67.717  -27.052 78.581  1.00 40.72  ? 112 PRO A C     1 
ATOM   848  O  O     . PRO A 1 112 ? 68.677  -27.454 77.918  1.00 45.49  ? 112 PRO A O     1 
ATOM   849  C  CB    . PRO A 1 112 ? 67.595  -24.740 77.737  1.00 47.50  ? 112 PRO A CB    1 
ATOM   850  C  CG    . PRO A 1 112 ? 68.550  -23.631 77.934  1.00 57.36  ? 112 PRO A CG    1 
ATOM   851  C  CD    . PRO A 1 112 ? 69.623  -24.099 78.861  1.00 49.29  ? 112 PRO A CD    1 
ATOM   852  N  N     . PRO A 1 113 ? 66.704  -27.834 78.982  1.00 37.16  ? 113 PRO A N     1 
ATOM   853  C  CA    . PRO A 1 113 ? 66.440  -29.167 78.414  1.00 43.77  ? 113 PRO A CA    1 
ATOM   854  C  C     . PRO A 1 113 ? 66.190  -29.062 76.906  1.00 41.36  ? 113 PRO A C     1 
ATOM   855  O  O     . PRO A 1 113 ? 65.787  -28.000 76.409  1.00 36.14  ? 113 PRO A O     1 
ATOM   856  C  CB    . PRO A 1 113 ? 65.141  -29.591 79.115  1.00 38.12  ? 113 PRO A CB    1 
ATOM   857  C  CG    . PRO A 1 113 ? 65.168  -28.848 80.424  1.00 39.10  ? 113 PRO A CG    1 
ATOM   858  C  CD    . PRO A 1 113 ? 65.795  -27.509 80.098  1.00 38.51  ? 113 PRO A CD    1 
ATOM   859  N  N     . ALA A 1 114 ? 66.442  -30.138 76.173  1.00 43.07  ? 114 ALA A N     1 
ATOM   860  C  CA    . ALA A 1 114 ? 66.081  -30.166 74.763  1.00 42.22  ? 114 ALA A CA    1 
ATOM   861  C  C     . ALA A 1 114 ? 64.565  -29.977 74.667  1.00 40.78  ? 114 ALA A C     1 
ATOM   862  O  O     . ALA A 1 114 ? 63.817  -30.373 75.587  1.00 45.74  ? 114 ALA A O     1 
ATOM   863  C  CB    . ALA A 1 114 ? 66.507  -31.497 74.127  1.00 41.96  ? 114 ALA A CB    1 
ATOM   864  N  N     . ALA A 1 115 ? 64.104  -29.360 73.579  1.00 44.93  ? 115 ALA A N     1 
ATOM   865  C  CA    . ALA A 1 115 ? 62.661  -29.209 73.375  1.00 35.24  ? 115 ALA A CA    1 
ATOM   866  C  C     . ALA A 1 115 ? 62.030  -30.568 73.174  1.00 35.45  ? 115 ALA A C     1 
ATOM   867  O  O     . ALA A 1 115 ? 62.707  -31.531 72.802  1.00 34.79  ? 115 ALA A O     1 
ATOM   868  C  CB    . ALA A 1 115 ? 62.366  -28.326 72.220  1.00 34.56  ? 115 ALA A CB    1 
ATOM   869  N  N     . MET A 1 116 ? 60.729  -30.651 73.439  1.00 43.10  ? 116 MET A N     1 
ATOM   870  C  CA    . MET A 1 116 ? 60.052  -31.936 73.419  1.00 37.34  ? 116 MET A CA    1 
ATOM   871  C  C     . MET A 1 116 ? 60.058  -32.665 72.059  1.00 42.30  ? 116 MET A C     1 
ATOM   872  O  O     . MET A 1 116 ? 59.500  -33.763 71.937  1.00 50.50  ? 116 MET A O     1 
ATOM   873  C  CB    . MET A 1 116 ? 58.623  -31.766 73.900  1.00 52.20  ? 116 MET A CB    1 
ATOM   874  C  CG    . MET A 1 116 ? 57.801  -30.944 72.978  1.00 68.71  ? 116 MET A CG    1 
ATOM   875  S  SD    . MET A 1 116 ? 56.043  -30.974 73.328  1.00 306.69 ? 116 MET A SD    1 
ATOM   876  C  CE    . MET A 1 116 ? 55.440  -30.264 71.769  1.00 167.87 ? 116 MET A CE    1 
ATOM   877  N  N     . ARG A 1 117 ? 60.652  -32.064 71.030  1.00 45.20  ? 117 ARG A N     1 
ATOM   878  C  CA    A ARG A 1 117 ? 60.763  -32.742 69.742  0.52 42.27  ? 117 ARG A CA    1 
ATOM   879  C  CA    B ARG A 1 117 ? 60.769  -32.741 69.740  0.48 42.24  ? 117 ARG A CA    1 
ATOM   880  C  C     . ARG A 1 117 ? 61.954  -33.707 69.736  1.00 42.88  ? 117 ARG A C     1 
ATOM   881  O  O     . ARG A 1 117 ? 61.968  -34.685 68.988  1.00 44.70  ? 117 ARG A O     1 
ATOM   882  C  CB    A ARG A 1 117 ? 60.827  -31.737 68.581  0.52 38.35  ? 117 ARG A CB    1 
ATOM   883  C  CB    B ARG A 1 117 ? 60.875  -31.746 68.575  0.48 38.00  ? 117 ARG A CB    1 
ATOM   884  C  CG    A ARG A 1 117 ? 62.101  -30.908 68.495  0.52 35.89  ? 117 ARG A CG    1 
ATOM   885  C  CG    B ARG A 1 117 ? 62.158  -30.929 68.538  0.48 36.33  ? 117 ARG A CG    1 
ATOM   886  C  CD    A ARG A 1 117 ? 61.994  -29.824 67.416  0.52 37.91  ? 117 ARG A CD    1 
ATOM   887  C  CD    B ARG A 1 117 ? 62.480  -30.434 67.118  0.48 33.74  ? 117 ARG A CD    1 
ATOM   888  N  NE    A ARG A 1 117 ? 61.577  -28.555 67.992  0.52 36.49  ? 117 ARG A NE    1 
ATOM   889  N  NE    B ARG A 1 117 ? 62.950  -31.508 66.233  0.48 29.92  ? 117 ARG A NE    1 
ATOM   890  C  CZ    A ARG A 1 117 ? 62.393  -27.534 68.217  0.52 40.98  ? 117 ARG A CZ    1 
ATOM   891  C  CZ    B ARG A 1 117 ? 63.307  -31.334 64.961  0.48 34.68  ? 117 ARG A CZ    1 
ATOM   892  N  NH1   A ARG A 1 117 ? 63.674  -27.609 67.881  0.52 40.73  ? 117 ARG A NH1   1 
ATOM   893  N  NH1   B ARG A 1 117 ? 63.251  -30.123 64.404  0.48 28.45  ? 117 ARG A NH1   1 
ATOM   894  N  NH2   A ARG A 1 117 ? 61.924  -26.429 68.776  0.52 48.93  ? 117 ARG A NH2   1 
ATOM   895  N  NH2   B ARG A 1 117 ? 63.725  -32.372 64.248  0.48 28.07  ? 117 ARG A NH2   1 
ATOM   896  N  N     . TYR A 1 118 ? 62.938  -33.442 70.599  1.00 45.21  ? 118 TYR A N     1 
ATOM   897  C  CA    . TYR A 1 118 ? 64.140  -34.273 70.680  1.00 66.70  ? 118 TYR A CA    1 
ATOM   898  C  C     . TYR A 1 118 ? 64.038  -35.442 71.654  1.00 92.66  ? 118 TYR A C     1 
ATOM   899  O  O     . TYR A 1 118 ? 64.390  -36.576 71.317  1.00 115.98 ? 118 TYR A O     1 
ATOM   900  C  CB    . TYR A 1 118 ? 65.366  -33.425 71.024  1.00 74.53  ? 118 TYR A CB    1 
ATOM   901  C  CG    . TYR A 1 118 ? 65.615  -32.296 70.047  1.00 57.75  ? 118 TYR A CG    1 
ATOM   902  C  CD1   . TYR A 1 118 ? 66.087  -32.539 68.752  1.00 51.47  ? 118 TYR A CD1   1 
ATOM   903  C  CD2   . TYR A 1 118 ? 65.375  -30.981 70.416  1.00 52.51  ? 118 TYR A CD2   1 
ATOM   904  C  CE1   . TYR A 1 118 ? 66.310  -31.490 67.859  1.00 36.01  ? 118 TYR A CE1   1 
ATOM   905  C  CE2   . TYR A 1 118 ? 65.593  -29.943 69.542  1.00 43.33  ? 118 TYR A CE2   1 
ATOM   906  C  CZ    . TYR A 1 118 ? 66.063  -30.194 68.274  1.00 39.28  ? 118 TYR A CZ    1 
ATOM   907  O  OH    . TYR A 1 118 ? 66.248  -29.121 67.437  1.00 49.37  ? 118 TYR A OH    1 
ATOM   908  N  N     . THR A 1 119 ? 63.537  -35.160 72.850  1.00 72.91  ? 119 THR A N     1 
ATOM   909  C  CA    . THR A 1 119 ? 63.589  -36.103 73.961  1.00 53.14  ? 119 THR A CA    1 
ATOM   910  C  C     . THR A 1 119 ? 62.544  -37.204 73.860  1.00 45.36  ? 119 THR A C     1 
ATOM   911  O  O     . THR A 1 119 ? 61.589  -37.094 73.091  1.00 35.67  ? 119 THR A O     1 
ATOM   912  C  CB    . THR A 1 119 ? 63.417  -35.348 75.279  1.00 51.27  ? 119 THR A CB    1 
ATOM   913  O  OG1   . THR A 1 119 ? 62.056  -34.934 75.432  1.00 46.60  ? 119 THR A OG1   1 
ATOM   914  C  CG2   . THR A 1 119 ? 64.304  -34.110 75.287  1.00 53.68  ? 119 THR A CG2   1 
ATOM   915  N  N     . GLU A 1 120 ? 62.738  -38.276 74.623  1.00 41.99  ? 120 GLU A N     1 
ATOM   916  C  CA    . GLU A 1 120 ? 61.713  -39.319 74.779  1.00 56.49  ? 120 GLU A CA    1 
ATOM   917  C  C     . GLU A 1 120 ? 61.604  -39.824 76.242  1.00 44.50  ? 120 GLU A C     1 
ATOM   918  O  O     . GLU A 1 120 ? 62.537  -39.712 77.037  1.00 38.08  ? 120 GLU A O     1 
ATOM   919  C  CB    . GLU A 1 120 ? 61.924  -40.462 73.790  1.00 72.09  ? 120 GLU A CB    1 
ATOM   920  C  CG    . GLU A 1 120 ? 63.386  -40.859 73.577  1.00 86.19  ? 120 GLU A CG    1 
ATOM   921  C  CD    . GLU A 1 120 ? 63.568  -42.019 72.579  1.00 94.67  ? 120 GLU A CD    1 
ATOM   922  O  OE1   . GLU A 1 120 ? 64.560  -42.774 72.716  1.00 91.28  ? 120 GLU A OE1   1 
ATOM   923  O  OE2   . GLU A 1 120 ? 62.730  -42.177 71.660  1.00 103.31 ? 120 GLU A OE2   1 
ATOM   924  N  N     . ALA A 1 121 ? 60.446  -40.362 76.599  1.00 38.98  ? 121 ALA A N     1 
ATOM   925  C  CA    . ALA A 1 121 ? 60.148  -40.578 77.994  1.00 40.21  ? 121 ALA A CA    1 
ATOM   926  C  C     . ALA A 1 121 ? 59.260  -41.787 78.266  1.00 47.63  ? 121 ALA A C     1 
ATOM   927  O  O     . ALA A 1 121 ? 58.649  -42.354 77.366  1.00 40.65  ? 121 ALA A O     1 
ATOM   928  C  CB    . ALA A 1 121 ? 59.530  -39.323 78.571  1.00 47.78  ? 121 ALA A CB    1 
ATOM   929  N  N     . ARG A 1 122 ? 59.221  -42.186 79.531  1.00 41.95  ? 122 ARG A N     1 
ATOM   930  C  CA    . ARG A 1 122 ? 58.315  -43.226 80.009  1.00 42.88  ? 122 ARG A CA    1 
ATOM   931  C  C     . ARG A 1 122 ? 58.269  -43.080 81.528  1.00 55.04  ? 122 ARG A C     1 
ATOM   932  O  O     . ARG A 1 122 ? 59.120  -42.415 82.112  1.00 44.02  ? 122 ARG A O     1 
ATOM   933  C  CB    . ARG A 1 122 ? 58.837  -44.611 79.657  1.00 42.33  ? 122 ARG A CB    1 
ATOM   934  C  CG    . ARG A 1 122 ? 60.229  -44.867 80.246  1.00 41.97  ? 122 ARG A CG    1 
ATOM   935  C  CD    . ARG A 1 122 ? 60.694  -46.293 80.028  1.00 43.28  ? 122 ARG A CD    1 
ATOM   936  N  NE    . ARG A 1 122 ? 62.086  -46.492 80.423  1.00 54.05  ? 122 ARG A NE    1 
ATOM   937  C  CZ    . ARG A 1 122 ? 62.840  -47.498 79.989  1.00 68.27  ? 122 ARG A CZ    1 
ATOM   938  N  NH1   . ARG A 1 122 ? 62.330  -48.381 79.133  1.00 92.77  ? 122 ARG A NH1   1 
ATOM   939  N  NH2   . ARG A 1 122 ? 64.104  -47.616 80.391  1.00 70.91  ? 122 ARG A NH2   1 
ATOM   940  N  N     . LEU A 1 123 ? 57.271  -43.690 82.159  1.00 72.63  ? 123 LEU A N     1 
ATOM   941  C  CA    . LEU A 1 123 ? 57.191  -43.701 83.607  1.00 84.22  ? 123 LEU A CA    1 
ATOM   942  C  C     . LEU A 1 123 ? 58.351  -44.514 84.215  1.00 75.69  ? 123 LEU A C     1 
ATOM   943  O  O     . LEU A 1 123 ? 58.837  -45.473 83.607  1.00 59.40  ? 123 LEU A O     1 
ATOM   944  C  CB    . LEU A 1 123 ? 55.838  -44.263 84.051  1.00 98.47  ? 123 LEU A CB    1 
ATOM   945  C  CG    . LEU A 1 123 ? 54.616  -43.470 83.595  1.00 104.24 ? 123 LEU A CG    1 
ATOM   946  C  CD1   . LEU A 1 123 ? 53.327  -44.178 83.963  1.00 86.91  ? 123 LEU A CD1   1 
ATOM   947  C  CD2   . LEU A 1 123 ? 54.612  -42.048 84.137  1.00 132.14 ? 123 LEU A CD2   1 
ATOM   948  N  N     . SER A 1 124 ? 58.798  -44.126 85.409  1.00 66.76  ? 124 SER A N     1 
ATOM   949  C  CA    . SER A 1 124 ? 59.802  -44.917 86.128  1.00 53.94  ? 124 SER A CA    1 
ATOM   950  C  C     . SER A 1 124 ? 59.095  -46.099 86.745  1.00 63.88  ? 124 SER A C     1 
ATOM   951  O  O     . SER A 1 124 ? 57.868  -46.101 86.824  1.00 72.34  ? 124 SER A O     1 
ATOM   952  C  CB    . SER A 1 124 ? 60.473  -44.094 87.222  1.00 47.33  ? 124 SER A CB    1 
ATOM   953  O  OG    . SER A 1 124 ? 59.548  -43.789 88.246  1.00 48.70  ? 124 SER A OG    1 
ATOM   954  N  N     . GLU A 1 125 ? 59.844  -47.105 87.183  1.00 73.10  ? 125 GLU A N     1 
ATOM   955  C  CA    . GLU A 1 125 ? 59.198  -48.202 87.894  1.00 77.87  ? 125 GLU A CA    1 
ATOM   956  C  C     . GLU A 1 125 ? 58.464  -47.703 89.158  1.00 50.90  ? 125 GLU A C     1 
ATOM   957  O  O     . GLU A 1 125 ? 57.321  -48.096 89.414  1.00 51.14  ? 125 GLU A O     1 
ATOM   958  C  CB    . GLU A 1 125 ? 60.177  -49.310 88.251  1.00 120.94 ? 125 GLU A CB    1 
ATOM   959  C  CG    . GLU A 1 125 ? 59.478  -50.600 88.602  1.00 157.21 ? 125 GLU A CG    1 
ATOM   960  C  CD    . GLU A 1 125 ? 60.444  -51.730 88.889  1.00 162.09 ? 125 GLU A CD    1 
ATOM   961  O  OE1   . GLU A 1 125 ? 61.662  -51.457 88.948  1.00 164.46 ? 125 GLU A OE1   1 
ATOM   962  O  OE2   . GLU A 1 125 ? 59.991  -52.890 89.052  1.00 171.54 ? 125 GLU A OE2   1 
ATOM   963  N  N     . ILE A 1 126 ? 59.098  -46.825 89.939  1.00 50.47  ? 126 ILE A N     1 
ATOM   964  C  CA    . ILE A 1 126 ? 58.454  -46.409 91.168  1.00 51.86  ? 126 ILE A CA    1 
ATOM   965  C  C     . ILE A 1 126 ? 57.131  -45.673 90.908  1.00 53.22  ? 126 ILE A C     1 
ATOM   966  O  O     . ILE A 1 126 ? 56.153  -45.839 91.661  1.00 53.60  ? 126 ILE A O     1 
ATOM   967  C  CB    . ILE A 1 126 ? 59.389  -45.598 92.080  1.00 52.04  ? 126 ILE A CB    1 
ATOM   968  C  CG1   . ILE A 1 126 ? 59.205  -46.055 93.536  1.00 75.65  ? 126 ILE A CG1   1 
ATOM   969  C  CG2   . ILE A 1 126 ? 59.154  -44.113 91.910  1.00 51.97  ? 126 ILE A CG2   1 
ATOM   970  C  CD1   . ILE A 1 126 ? 59.709  -45.089 94.587  1.00 83.16  ? 126 ILE A CD1   1 
ATOM   971  N  N     . ALA A 1 127 ? 57.104  -44.874 89.836  1.00 51.49  ? 127 ALA A N     1 
ATOM   972  C  CA    . ALA A 1 127 ? 55.878  -44.203 89.386  1.00 51.82  ? 127 ALA A CA    1 
ATOM   973  C  C     . ALA A 1 127 ? 54.742  -45.200 89.143  1.00 52.34  ? 127 ALA A C     1 
ATOM   974  O  O     . ALA A 1 127 ? 53.564  -44.885 89.313  1.00 53.17  ? 127 ALA A O     1 
ATOM   975  C  CB    . ALA A 1 127 ? 56.137  -43.398 88.134  1.00 58.14  ? 127 ALA A CB    1 
ATOM   976  N  N     . GLY A 1 128 ? 55.110  -46.407 88.733  1.00 59.34  ? 128 GLY A N     1 
ATOM   977  C  CA    . GLY A 1 128 ? 54.155  -47.484 88.640  1.00 52.39  ? 128 GLY A CA    1 
ATOM   978  C  C     . GLY A 1 128 ? 53.442  -47.714 89.955  1.00 53.91  ? 128 GLY A C     1 
ATOM   979  O  O     . GLY A 1 128 ? 52.255  -48.013 89.979  1.00 54.67  ? 128 GLY A O     1 
ATOM   980  N  N     . TYR A 1 129 ? 54.164  -47.547 91.058  1.00 62.06  ? 129 TYR A N     1 
ATOM   981  C  CA    . TYR A 1 129 ? 53.583  -47.765 92.366  1.00 60.28  ? 129 TYR A CA    1 
ATOM   982  C  C     . TYR A 1 129 ? 52.638  -46.643 92.783  1.00 56.69  ? 129 TYR A C     1 
ATOM   983  O  O     . TYR A 1 129 ? 51.779  -46.852 93.623  1.00 57.92  ? 129 TYR A O     1 
ATOM   984  C  CB    . TYR A 1 129 ? 54.671  -48.041 93.407  1.00 78.66  ? 129 TYR A CB    1 
ATOM   985  C  CG    . TYR A 1 129 ? 55.163  -49.460 93.319  1.00 106.47 ? 129 TYR A CG    1 
ATOM   986  C  CD1   . TYR A 1 129 ? 54.851  -50.384 94.298  1.00 154.54 ? 129 TYR A CD1   1 
ATOM   987  C  CD2   . TYR A 1 129 ? 55.881  -49.901 92.209  1.00 93.64  ? 129 TYR A CD2   1 
ATOM   988  C  CE1   . TYR A 1 129 ? 55.268  -51.695 94.203  1.00 158.86 ? 129 TYR A CE1   1 
ATOM   989  C  CE2   . TYR A 1 129 ? 56.309  -51.215 92.102  1.00 105.10 ? 129 TYR A CE2   1 
ATOM   990  C  CZ    . TYR A 1 129 ? 55.999  -52.114 93.111  1.00 136.97 ? 129 TYR A CZ    1 
ATOM   991  O  OH    . TYR A 1 129 ? 56.419  -53.432 93.038  1.00 138.12 ? 129 TYR A OH    1 
ATOM   992  N  N     . LEU A 1 130 ? 52.768  -45.461 92.190  1.00 56.05  ? 130 LEU A N     1 
ATOM   993  C  CA    . LEU A 1 130 ? 51.763  -44.419 92.433  1.00 65.10  ? 130 LEU A CA    1 
ATOM   994  C  C     . LEU A 1 130 ? 50.440  -44.753 91.758  1.00 62.89  ? 130 LEU A C     1 
ATOM   995  O  O     . LEU A 1 130 ? 49.395  -44.244 92.160  1.00 58.00  ? 130 LEU A O     1 
ATOM   996  C  CB    . LEU A 1 130 ? 52.233  -43.042 91.944  1.00 78.23  ? 130 LEU A CB    1 
ATOM   997  C  CG    . LEU A 1 130 ? 53.081  -42.226 92.918  1.00 105.55 ? 130 LEU A CG    1 
ATOM   998  C  CD1   . LEU A 1 130 ? 53.711  -41.017 92.237  1.00 127.54 ? 130 LEU A CD1   1 
ATOM   999  C  CD2   . LEU A 1 130 ? 52.266  -41.796 94.140  1.00 83.03  ? 130 LEU A CD2   1 
ATOM   1000 N  N     . LEU A 1 131 ? 50.487  -45.584 90.716  1.00 75.71  ? 131 LEU A N     1 
ATOM   1001 C  CA    . LEU A 1 131 ? 49.296  -45.885 89.918  1.00 21.81  ? 131 LEU A CA    1 
ATOM   1002 C  C     . LEU A 1 131 ? 48.768  -47.276 90.229  1.00 19.51  ? 131 LEU A C     1 
ATOM   1003 O  O     . LEU A 1 131 ? 47.726  -47.699 89.713  1.00 21.88  ? 131 LEU A O     1 
ATOM   1004 C  CB    . LEU A 1 131 ? 49.576  -45.729 88.405  1.00 50.86  ? 131 LEU A CB    1 
ATOM   1005 C  CG    . LEU A 1 131 ? 49.954  -44.328 87.878  1.00 104.66 ? 131 LEU A CG    1 
ATOM   1006 C  CD1   . LEU A 1 131 ? 51.009  -44.383 86.775  1.00 131.39 ? 131 LEU A CD1   1 
ATOM   1007 C  CD2   . LEU A 1 131 ? 48.721  -43.521 87.438  1.00 124.62 ? 131 LEU A CD2   1 
ATOM   1008 N  N     . GLN A 1 132 ? 49.477  -47.992 91.094  1.00 66.54  ? 132 GLN A N     1 
ATOM   1009 C  CA    . GLN A 1 132 ? 49.082  -49.357 91.408  1.00 69.50  ? 132 GLN A CA    1 
ATOM   1010 C  C     . GLN A 1 132 ? 47.585  -49.460 91.738  1.00 63.58  ? 132 GLN A C     1 
ATOM   1011 O  O     . GLN A 1 132 ? 47.053  -48.731 92.593  1.00 72.09  ? 132 GLN A O     1 
ATOM   1012 C  CB    . GLN A 1 132 ? 49.930  -49.885 92.545  1.00 86.48  ? 132 GLN A CB    1 
ATOM   1013 C  CG    . GLN A 1 132 ? 49.901  -51.381 92.710  1.00 113.38 ? 132 GLN A CG    1 
ATOM   1014 C  CD    . GLN A 1 132 ? 50.522  -51.785 94.045  1.00 148.93 ? 132 GLN A CD    1 
ATOM   1015 O  OE1   . GLN A 1 132 ? 51.531  -52.502 94.090  1.00 175.62 ? 132 GLN A OE1   1 
ATOM   1016 N  NE2   . GLN A 1 132 ? 49.928  -51.299 95.145  1.00 148.72 ? 132 GLN A NE2   1 
ATOM   1017 N  N     . ASP A 1 133 ? 46.912  -50.351 91.022  1.00 62.68  ? 133 ASP A N     1 
ATOM   1018 C  CA    . ASP A 1 133 ? 45.514  -50.666 91.274  1.00 90.25  ? 133 ASP A CA    1 
ATOM   1019 C  C     . ASP A 1 133 ? 44.534  -49.585 90.817  1.00 72.18  ? 133 ASP A C     1 
ATOM   1020 O  O     . ASP A 1 133 ? 43.354  -49.647 91.163  1.00 63.93  ? 133 ASP A O     1 
ATOM   1021 C  CB    . ASP A 1 133 ? 45.308  -50.997 92.757  1.00 120.51 ? 133 ASP A CB    1 
ATOM   1022 C  CG    . ASP A 1 133 ? 45.880  -52.371 93.139  1.00 143.61 ? 133 ASP A CG    1 
ATOM   1023 O  OD1   . ASP A 1 133 ? 45.779  -53.320 92.323  1.00 122.24 ? 133 ASP A OD1   1 
ATOM   1024 O  OD2   . ASP A 1 133 ? 46.428  -52.502 94.258  1.00 178.52 ? 133 ASP A OD2   1 
ATOM   1025 N  N     . ILE A 1 134 ? 45.000  -48.614 90.022  1.00 71.36  ? 134 ILE A N     1 
ATOM   1026 C  CA    . ILE A 1 134 ? 44.097  -47.572 89.504  1.00 96.68  ? 134 ILE A CA    1 
ATOM   1027 C  C     . ILE A 1 134 ? 42.942  -48.135 88.675  1.00 71.15  ? 134 ILE A C     1 
ATOM   1028 O  O     . ILE A 1 134 ? 41.920  -47.474 88.470  1.00 72.86  ? 134 ILE A O     1 
ATOM   1029 C  CB    . ILE A 1 134 ? 44.813  -46.552 88.617  1.00 131.05 ? 134 ILE A CB    1 
ATOM   1030 C  CG1   . ILE A 1 134 ? 43.893  -45.357 88.372  1.00 157.74 ? 134 ILE A CG1   1 
ATOM   1031 C  CG2   . ILE A 1 134 ? 45.205  -47.195 87.275  1.00 149.68 ? 134 ILE A CG2   1 
ATOM   1032 C  CD1   . ILE A 1 134 ? 44.568  -44.034 88.588  1.00 159.51 ? 134 ILE A CD1   1 
ATOM   1033 N  N     . GLU A 1 135 ? 43.112  -49.355 88.189  1.00 65.41  ? 135 GLU A N     1 
ATOM   1034 C  CA    . GLU A 1 135 ? 42.097  -49.970 87.334  1.00 63.64  ? 135 GLU A CA    1 
ATOM   1035 C  C     . GLU A 1 135 ? 41.045  -50.682 88.134  1.00 64.56  ? 135 GLU A C     1 
ATOM   1036 O  O     . GLU A 1 135 ? 40.120  -51.264 87.570  1.00 65.03  ? 135 GLU A O     1 
ATOM   1037 C  CB    . GLU A 1 135 ? 42.742  -50.995 86.404  1.00 62.99  ? 135 GLU A CB    1 
ATOM   1038 C  CG    . GLU A 1 135 ? 43.067  -52.327 87.090  1.00 63.94  ? 135 GLU A CG    1 
ATOM   1039 C  CD    . GLU A 1 135 ? 44.514  -52.436 87.578  1.00 74.95  ? 135 GLU A CD    1 
ATOM   1040 O  OE1   . GLU A 1 135 ? 45.196  -51.386 87.783  1.00 67.12  ? 135 GLU A OE1   1 
ATOM   1041 O  OE2   . GLU A 1 135 ? 44.960  -53.597 87.755  1.00 80.37  ? 135 GLU A OE2   1 
ATOM   1042 N  N     . LYS A 1 136 ? 41.218  -50.670 89.453  1.00 64.84  ? 136 LYS A N     1 
ATOM   1043 C  CA    . LYS A 1 136 ? 40.383  -51.478 90.327  1.00 65.71  ? 136 LYS A CA    1 
ATOM   1044 C  C     . LYS A 1 136 ? 39.333  -50.655 91.066  1.00 66.74  ? 136 LYS A C     1 
ATOM   1045 O  O     . LYS A 1 136 ? 38.788  -51.093 92.064  1.00 67.53  ? 136 LYS A O     1 
ATOM   1046 C  CB    . LYS A 1 136 ? 41.250  -52.312 91.281  1.00 66.43  ? 136 LYS A CB    1 
ATOM   1047 C  CG    . LYS A 1 136 ? 41.631  -53.681 90.702  1.00 78.04  ? 136 LYS A CG    1 
ATOM   1048 C  CD    . LYS A 1 136 ? 42.960  -54.207 91.235  1.00 86.50  ? 136 LYS A CD    1 
ATOM   1049 C  CE    . LYS A 1 136 ? 43.188  -55.662 90.820  1.00 90.59  ? 136 LYS A CE    1 
ATOM   1050 N  NZ    . LYS A 1 136 ? 43.748  -56.543 91.913  1.00 93.58  ? 136 LYS A NZ    1 
ATOM   1051 N  N     . LYS A 1 137 ? 39.031  -49.477 90.541  1.00 66.78  ? 137 LYS A N     1 
ATOM   1052 C  CA    . LYS A 1 137 ? 38.015  -48.604 91.124  1.00 76.98  ? 137 LYS A CA    1 
ATOM   1053 C  C     . LYS A 1 137 ? 38.374  -48.293 92.573  1.00 120.29 ? 137 LYS A C     1 
ATOM   1054 O  O     . LYS A 1 137 ? 37.549  -48.409 93.470  1.00 105.97 ? 137 LYS A O     1 
ATOM   1055 C  CB    . LYS A 1 137 ? 36.597  -49.193 90.959  1.00 68.76  ? 137 LYS A CB    1 
ATOM   1056 C  CG    . LYS A 1 137 ? 36.137  -49.194 89.476  1.00 83.94  ? 137 LYS A CG    1 
ATOM   1057 C  CD    . LYS A 1 137 ? 34.674  -49.573 89.257  1.00 80.18  ? 137 LYS A CD    1 
ATOM   1058 N  N     . THR A 1 138 ? 39.628  -47.889 92.761  1.00 154.87 ? 138 THR A N     1 
ATOM   1059 C  CA    . THR A 1 138 ? 40.210  -47.636 94.067  1.00 199.36 ? 138 THR A CA    1 
ATOM   1060 C  C     . THR A 1 138 ? 40.197  -46.157 94.437  1.00 216.71 ? 138 THR A C     1 
ATOM   1061 O  O     . THR A 1 138 ? 40.385  -45.796 95.596  1.00 232.75 ? 138 THR A O     1 
ATOM   1062 C  CB    . THR A 1 138 ? 41.688  -48.077 94.117  1.00 215.41 ? 138 THR A CB    1 
ATOM   1063 O  OG1   . THR A 1 138 ? 42.420  -47.460 93.042  1.00 222.54 ? 138 THR A OG1   1 
ATOM   1064 C  CG2   . THR A 1 138 ? 41.809  -49.593 94.040  1.00 214.02 ? 138 THR A CG2   1 
ATOM   1065 N  N     . VAL A 1 139 ? 39.968  -45.307 93.447  1.00 200.05 ? 139 VAL A N     1 
ATOM   1066 C  CA    . VAL A 1 139 ? 40.083  -43.870 93.617  1.00 162.96 ? 139 VAL A CA    1 
ATOM   1067 C  C     . VAL A 1 139 ? 38.922  -43.215 92.878  1.00 166.49 ? 139 VAL A C     1 
ATOM   1068 O  O     . VAL A 1 139 ? 38.437  -43.760 91.906  1.00 143.27 ? 139 VAL A O     1 
ATOM   1069 C  CB    . VAL A 1 139 ? 41.421  -43.385 93.028  1.00 120.16 ? 139 VAL A CB    1 
ATOM   1070 C  CG1   . VAL A 1 139 ? 41.274  -42.023 92.439  1.00 76.98  ? 139 VAL A CG1   1 
ATOM   1071 C  CG2   . VAL A 1 139 ? 42.518  -43.414 94.085  1.00 130.40 ? 139 VAL A CG2   1 
ATOM   1072 N  N     . PRO A 1 140 ? 38.475  -42.041 93.343  1.00 165.49 ? 140 PRO A N     1 
ATOM   1073 C  CA    . PRO A 1 140 ? 37.370  -41.266 92.756  1.00 153.40 ? 140 PRO A CA    1 
ATOM   1074 C  C     . PRO A 1 140 ? 37.747  -40.605 91.434  1.00 112.04 ? 140 PRO A C     1 
ATOM   1075 O  O     . PRO A 1 140 ? 38.768  -39.916 91.357  1.00 97.21  ? 140 PRO A O     1 
ATOM   1076 C  CB    . PRO A 1 140 ? 37.113  -40.164 93.792  1.00 177.65 ? 140 PRO A CB    1 
ATOM   1077 C  CG    . PRO A 1 140 ? 37.940  -40.532 94.985  1.00 188.16 ? 140 PRO A CG    1 
ATOM   1078 C  CD    . PRO A 1 140 ? 39.069  -41.349 94.493  1.00 181.30 ? 140 PRO A CD    1 
ATOM   1079 N  N     . PHE A 1 141 ? 36.906  -40.790 90.421  1.00 92.57  ? 141 PHE A N     1 
ATOM   1080 C  CA    . PHE A 1 141 ? 37.141  -40.240 89.087  1.00 87.57  ? 141 PHE A CA    1 
ATOM   1081 C  C     . PHE A 1 141 ? 36.148  -39.129 88.729  1.00 78.03  ? 141 PHE A C     1 
ATOM   1082 O  O     . PHE A 1 141 ? 34.989  -39.164 89.143  1.00 93.77  ? 141 PHE A O     1 
ATOM   1083 C  CB    . PHE A 1 141 ? 37.039  -41.353 88.046  1.00 77.44  ? 141 PHE A CB    1 
ATOM   1084 C  CG    . PHE A 1 141 ? 38.322  -42.104 87.828  1.00 89.69  ? 141 PHE A CG    1 
ATOM   1085 C  CD1   . PHE A 1 141 ? 38.828  -42.946 88.811  1.00 92.28  ? 141 PHE A CD1   1 
ATOM   1086 C  CD2   . PHE A 1 141 ? 39.016  -41.982 86.623  1.00 111.60 ? 141 PHE A CD2   1 
ATOM   1087 C  CE1   . PHE A 1 141 ? 40.011  -43.649 88.610  1.00 110.09 ? 141 PHE A CE1   1 
ATOM   1088 C  CE2   . PHE A 1 141 ? 40.195  -42.678 86.415  1.00 130.38 ? 141 PHE A CE2   1 
ATOM   1089 C  CZ    . PHE A 1 141 ? 40.699  -43.513 87.418  1.00 129.24 ? 141 PHE A CZ    1 
ATOM   1090 N  N     . ALA A 1 142 ? 36.609  -38.150 87.957  1.00 74.89  ? 142 ALA A N     1 
ATOM   1091 C  CA    . ALA A 1 142 ? 35.752  -37.076 87.451  1.00 92.64  ? 142 ALA A CA    1 
ATOM   1092 C  C     . ALA A 1 142 ? 35.837  -36.970 85.933  1.00 77.89  ? 142 ALA A C     1 
ATOM   1093 O  O     . ALA A 1 142 ? 36.715  -37.558 85.303  1.00 87.74  ? 142 ALA A O     1 
ATOM   1094 C  CB    . ALA A 1 142 ? 36.132  -35.745 88.080  1.00 129.23 ? 142 ALA A CB    1 
ATOM   1095 N  N     . TRP A 1 143 ? 34.927  -36.203 85.349  1.00 82.06  ? 143 TRP A N     1 
ATOM   1096 C  CA    . TRP A 1 143 ? 34.973  -35.946 83.921  1.00 89.66  ? 143 TRP A CA    1 
ATOM   1097 C  C     . TRP A 1 143 ? 36.079  -34.964 83.625  1.00 96.28  ? 143 TRP A C     1 
ATOM   1098 O  O     . TRP A 1 143 ? 36.334  -34.059 84.419  1.00 98.21  ? 143 TRP A O     1 
ATOM   1099 C  CB    . TRP A 1 143 ? 33.633  -35.420 83.424  1.00 102.44 ? 143 TRP A CB    1 
ATOM   1100 C  CG    . TRP A 1 143 ? 32.635  -36.508 83.352  1.00 109.34 ? 143 TRP A CG    1 
ATOM   1101 C  CD1   . TRP A 1 143 ? 31.568  -36.702 84.175  1.00 106.96 ? 143 TRP A CD1   1 
ATOM   1102 C  CD2   . TRP A 1 143 ? 32.628  -37.596 82.425  1.00 115.12 ? 143 TRP A CD2   1 
ATOM   1103 N  NE1   . TRP A 1 143 ? 30.885  -37.839 83.807  1.00 106.34 ? 143 TRP A NE1   1 
ATOM   1104 C  CE2   . TRP A 1 143 ? 31.517  -38.404 82.737  1.00 112.75 ? 143 TRP A CE2   1 
ATOM   1105 C  CE3   . TRP A 1 143 ? 33.450  -37.961 81.362  1.00 123.13 ? 143 TRP A CE3   1 
ATOM   1106 C  CZ2   . TRP A 1 143 ? 31.208  -39.550 82.019  1.00 121.21 ? 143 TRP A CZ2   1 
ATOM   1107 C  CZ3   . TRP A 1 143 ? 33.142  -39.102 80.650  1.00 128.45 ? 143 TRP A CZ3   1 
ATOM   1108 C  CH2   . TRP A 1 143 ? 32.029  -39.884 80.980  1.00 127.84 ? 143 TRP A CH2   1 
ATOM   1109 N  N     . ASN A 1 144 ? 36.755  -35.162 82.495  1.00 109.92 ? 144 ASN A N     1 
ATOM   1110 C  CA    . ASN A 1 144 ? 37.788  -34.225 82.071  1.00 137.72 ? 144 ASN A CA    1 
ATOM   1111 C  C     . ASN A 1 144 ? 37.139  -32.911 81.653  1.00 148.45 ? 144 ASN A C     1 
ATOM   1112 O  O     . ASN A 1 144 ? 35.923  -32.849 81.503  1.00 157.14 ? 144 ASN A O     1 
ATOM   1113 C  CB    . ASN A 1 144 ? 38.655  -34.802 80.940  1.00 162.69 ? 144 ASN A CB    1 
ATOM   1114 C  CG    . ASN A 1 144 ? 37.835  -35.296 79.763  1.00 193.13 ? 144 ASN A CG    1 
ATOM   1115 O  OD1   . ASN A 1 144 ? 36.618  -35.136 79.741  1.00 200.45 ? 144 ASN A OD1   1 
ATOM   1116 N  ND2   . ASN A 1 144 ? 38.501  -35.905 78.777  1.00 209.57 ? 144 ASN A ND2   1 
ATOM   1117 N  N     . PHE A 1 145 ? 37.950  -31.864 81.510  1.00 150.64 ? 145 PHE A N     1 
ATOM   1118 C  CA    . PHE A 1 145 ? 37.502  -30.569 80.980  1.00 155.37 ? 145 PHE A CA    1 
ATOM   1119 C  C     . PHE A 1 145 ? 36.494  -30.728 79.841  1.00 147.30 ? 145 PHE A C     1 
ATOM   1120 O  O     . PHE A 1 145 ? 35.648  -29.869 79.615  1.00 138.79 ? 145 PHE A O     1 
ATOM   1121 C  CB    . PHE A 1 145 ? 38.701  -29.756 80.461  1.00 163.81 ? 145 PHE A CB    1 
ATOM   1122 C  CG    . PHE A 1 145 ? 39.318  -30.321 79.211  1.00 163.91 ? 145 PHE A CG    1 
ATOM   1123 C  CD1   . PHE A 1 145 ? 38.824  -29.977 77.960  1.00 162.73 ? 145 PHE A CD1   1 
ATOM   1124 C  CD2   . PHE A 1 145 ? 40.392  -31.195 79.282  1.00 157.24 ? 145 PHE A CD2   1 
ATOM   1125 C  CE1   . PHE A 1 145 ? 39.387  -30.501 76.794  1.00 152.83 ? 145 PHE A CE1   1 
ATOM   1126 C  CE2   . PHE A 1 145 ? 40.960  -31.721 78.124  1.00 147.00 ? 145 PHE A CE2   1 
ATOM   1127 C  CZ    . PHE A 1 145 ? 40.456  -31.370 76.876  1.00 144.73 ? 145 PHE A CZ    1 
ATOM   1128 N  N     . ASP A 1 146 ? 36.587  -31.854 79.150  1.00 143.18 ? 146 ASP A N     1 
ATOM   1129 C  CA    . ASP A 1 146 ? 35.983  -32.031 77.846  1.00 125.66 ? 146 ASP A CA    1 
ATOM   1130 C  C     . ASP A 1 146 ? 34.647  -32.767 77.921  1.00 109.99 ? 146 ASP A C     1 
ATOM   1131 O  O     . ASP A 1 146 ? 33.905  -32.832 76.943  1.00 103.04 ? 146 ASP A O     1 
ATOM   1132 C  CB    . ASP A 1 146 ? 36.998  -32.803 76.988  1.00 118.56 ? 146 ASP A CB    1 
ATOM   1133 C  CG    . ASP A 1 146 ? 36.472  -33.175 75.628  1.00 114.36 ? 146 ASP A CG    1 
ATOM   1134 O  OD1   . ASP A 1 146 ? 37.112  -32.780 74.631  1.00 115.52 ? 146 ASP A OD1   1 
ATOM   1135 O  OD2   . ASP A 1 146 ? 35.452  -33.895 75.558  1.00 111.73 ? 146 ASP A OD2   1 
ATOM   1136 N  N     . ASP A 1 147 ? 34.337  -33.314 79.090  1.00 106.40 ? 147 ASP A N     1 
ATOM   1137 C  CA    . ASP A 1 147 ? 33.186  -34.214 79.251  1.00 97.85  ? 147 ASP A CA    1 
ATOM   1138 C  C     . ASP A 1 147 ? 33.205  -35.425 78.314  1.00 88.96  ? 147 ASP A C     1 
ATOM   1139 O  O     . ASP A 1 147 ? 32.176  -36.058 78.078  1.00 80.27  ? 147 ASP A O     1 
ATOM   1140 C  CB    . ASP A 1 147 ? 31.860  -33.462 79.157  1.00 102.75 ? 147 ASP A CB    1 
ATOM   1141 C  CG    . ASP A 1 147 ? 31.387  -32.970 80.507  1.00 111.34 ? 147 ASP A CG    1 
ATOM   1142 O  OD1   . ASP A 1 147 ? 31.672  -31.806 80.875  1.00 118.13 ? 147 ASP A OD1   1 
ATOM   1143 O  OD2   . ASP A 1 147 ? 30.744  -33.768 81.216  1.00 119.66 ? 147 ASP A OD2   1 
ATOM   1144 N  N     . THR A 1 148 ? 34.395  -35.747 77.814  1.00 89.63  ? 148 THR A N     1 
ATOM   1145 C  CA    . THR A 1 148 ? 34.609  -36.902 76.952  1.00 86.74  ? 148 THR A CA    1 
ATOM   1146 C  C     . THR A 1 148 ? 35.157  -38.123 77.690  1.00 87.54  ? 148 THR A C     1 
ATOM   1147 O  O     . THR A 1 148 ? 34.890  -39.266 77.291  1.00 79.21  ? 148 THR A O     1 
ATOM   1148 C  CB    . THR A 1 148 ? 35.615  -36.581 75.845  1.00 82.49  ? 148 THR A CB    1 
ATOM   1149 O  OG1   . THR A 1 148 ? 36.096  -37.810 75.292  1.00 86.01  ? 148 THR A OG1   1 
ATOM   1150 C  CG2   . THR A 1 148 ? 36.805  -35.818 76.410  1.00 90.25  ? 148 THR A CG2   1 
ATOM   1151 N  N     . GLU A 1 149 ? 35.933  -37.882 78.751  1.00 108.22 ? 149 GLU A N     1 
ATOM   1152 C  CA    . GLU A 1 149 ? 36.669  -38.954 79.431  1.00 132.70 ? 149 GLU A CA    1 
ATOM   1153 C  C     . GLU A 1 149 ? 36.836  -38.753 80.941  1.00 129.12 ? 149 GLU A C     1 
ATOM   1154 O  O     . GLU A 1 149 ? 36.931  -37.622 81.434  1.00 157.02 ? 149 GLU A O     1 
ATOM   1155 C  CB    . GLU A 1 149 ? 38.049  -39.098 78.800  1.00 152.31 ? 149 GLU A CB    1 
ATOM   1156 C  CG    . GLU A 1 149 ? 38.700  -40.436 79.038  1.00 163.05 ? 149 GLU A CG    1 
ATOM   1157 C  CD    . GLU A 1 149 ? 40.076  -40.515 78.410  1.00 169.64 ? 149 GLU A CD    1 
ATOM   1158 O  OE1   . GLU A 1 149 ? 40.338  -39.755 77.449  1.00 183.43 ? 149 GLU A OE1   1 
ATOM   1159 O  OE2   . GLU A 1 149 ? 40.899  -41.328 78.889  1.00 160.94 ? 149 GLU A OE2   1 
ATOM   1160 N  N     . LYS A 1 150 ? 36.892  -39.857 81.671  1.00 88.79  ? 150 LYS A N     1 
ATOM   1161 C  CA    . LYS A 1 150 ? 37.110  -39.793 83.113  1.00 70.83  ? 150 LYS A CA    1 
ATOM   1162 C  C     . LYS A 1 150 ? 38.617  -39.729 83.454  1.00 67.54  ? 150 LYS A C     1 
ATOM   1163 O  O     . LYS A 1 150 ? 39.436  -40.372 82.790  1.00 69.23  ? 150 LYS A O     1 
ATOM   1164 C  CB    . LYS A 1 150 ? 36.421  -40.977 83.817  1.00 69.73  ? 150 LYS A CB    1 
ATOM   1165 C  CG    . LYS A 1 150 ? 34.886  -40.871 83.941  1.00 68.51  ? 150 LYS A CG    1 
ATOM   1166 N  N     . GLU A 1 151 ? 38.973  -38.928 84.463  1.00 65.22  ? 151 GLU A N     1 
ATOM   1167 C  CA    . GLU A 1 151 ? 40.328  -38.911 85.023  1.00 64.45  ? 151 GLU A CA    1 
ATOM   1168 C  C     . GLU A 1 151 ? 40.306  -39.077 86.554  1.00 64.86  ? 151 GLU A C     1 
ATOM   1169 O  O     . GLU A 1 151 ? 39.317  -38.760 87.207  1.00 65.75  ? 151 GLU A O     1 
ATOM   1170 C  CB    . GLU A 1 151 ? 41.066  -37.621 84.659  1.00 82.76  ? 151 GLU A CB    1 
ATOM   1171 C  CG    . GLU A 1 151 ? 40.311  -36.364 85.030  1.00 87.27  ? 151 GLU A CG    1 
ATOM   1172 C  CD    . GLU A 1 151 ? 41.115  -35.081 84.807  1.00 104.76 ? 151 GLU A CD    1 
ATOM   1173 O  OE1   . GLU A 1 151 ? 40.473  -34.008 84.717  1.00 83.80  ? 151 GLU A OE1   1 
ATOM   1174 O  OE2   . GLU A 1 151 ? 42.371  -35.132 84.740  1.00 118.41 ? 151 GLU A OE2   1 
ATOM   1175 N  N     . PRO A 1 152 ? 41.407  -39.574 87.138  1.00 82.98  ? 152 PRO A N     1 
ATOM   1176 C  CA    . PRO A 1 152 ? 41.411  -39.747 88.587  1.00 64.67  ? 152 PRO A CA    1 
ATOM   1177 C  C     . PRO A 1 152 ? 41.631  -38.400 89.277  1.00 64.79  ? 152 PRO A C     1 
ATOM   1178 O  O     . PRO A 1 152 ? 42.409  -37.601 88.759  1.00 65.41  ? 152 PRO A O     1 
ATOM   1179 C  CB    . PRO A 1 152 ? 42.611  -40.676 88.801  1.00 110.76 ? 152 PRO A CB    1 
ATOM   1180 C  CG    . PRO A 1 152 ? 43.556  -40.272 87.724  1.00 116.78 ? 152 PRO A CG    1 
ATOM   1181 C  CD    . PRO A 1 152 ? 42.689  -39.984 86.535  1.00 105.58 ? 152 PRO A CD    1 
ATOM   1182 N  N     . THR A 1 153 ? 40.963  -38.154 90.407  1.00 65.66  ? 153 THR A N     1 
ATOM   1183 C  CA    . THR A 1 153 ? 41.179  -36.932 91.194  1.00 65.85  ? 153 THR A CA    1 
ATOM   1184 C  C     . THR A 1 153 ? 42.363  -37.044 92.159  1.00 65.35  ? 153 THR A C     1 
ATOM   1185 O  O     . THR A 1 153 ? 42.886  -36.026 92.625  1.00 65.20  ? 153 THR A O     1 
ATOM   1186 C  CB    . THR A 1 153 ? 39.948  -36.586 92.021  1.00 67.10  ? 153 THR A CB    1 
ATOM   1187 O  OG1   . THR A 1 153 ? 39.580  -37.721 92.820  1.00 76.74  ? 153 THR A OG1   1 
ATOM   1188 C  CG2   . THR A 1 153 ? 38.798  -36.214 91.119  1.00 76.65  ? 153 THR A CG2   1 
ATOM   1189 N  N     . VAL A 1 154 ? 42.752  -38.283 92.467  1.00 72.85  ? 154 VAL A N     1 
ATOM   1190 C  CA    . VAL A 1 154 ? 43.946  -38.587 93.258  1.00 83.03  ? 154 VAL A CA    1 
ATOM   1191 C  C     . VAL A 1 154 ? 44.446  -39.991 92.882  1.00 63.99  ? 154 VAL A C     1 
ATOM   1192 O  O     . VAL A 1 154 ? 43.652  -40.867 92.542  1.00 64.40  ? 154 VAL A O     1 
ATOM   1193 C  CB    . VAL A 1 154 ? 43.645  -38.557 94.796  1.00 114.67 ? 154 VAL A CB    1 
ATOM   1194 C  CG1   . VAL A 1 154 ? 42.363  -39.322 95.114  1.00 123.00 ? 154 VAL A CG1   1 
ATOM   1195 C  CG2   . VAL A 1 154 ? 44.797  -39.152 95.584  1.00 106.76 ? 154 VAL A CG2   1 
ATOM   1196 N  N     . LEU A 1 155 ? 45.750  -40.224 92.952  1.00 63.84  ? 155 LEU A N     1 
ATOM   1197 C  CA    . LEU A 1 155 ? 46.257  -41.570 92.666  1.00 63.56  ? 155 LEU A CA    1 
ATOM   1198 C  C     . LEU A 1 155 ? 46.294  -42.499 93.899  1.00 65.75  ? 155 LEU A C     1 
ATOM   1199 O  O     . LEU A 1 155 ? 46.304  -42.029 95.046  1.00 67.55  ? 155 LEU A O     1 
ATOM   1200 C  CB    . LEU A 1 155 ? 47.632  -41.478 91.991  1.00 62.33  ? 155 LEU A CB    1 
ATOM   1201 C  CG    . LEU A 1 155 ? 47.659  -40.658 90.695  1.00 120.14 ? 155 LEU A CG    1 
ATOM   1202 C  CD1   . LEU A 1 155 ? 49.018  -40.755 90.032  1.00 128.44 ? 155 LEU A CD1   1 
ATOM   1203 C  CD2   . LEU A 1 155 ? 46.582  -41.144 89.738  1.00 119.39 ? 155 LEU A CD2   1 
ATOM   1204 N  N     . PRO A 1 156 ? 46.289  -43.823 93.666  1.00 65.62  ? 156 PRO A N     1 
ATOM   1205 C  CA    . PRO A 1 156 ? 46.354  -44.813 94.757  1.00 67.62  ? 156 PRO A CA    1 
ATOM   1206 C  C     . PRO A 1 156 ? 47.558  -44.666 95.695  1.00 69.01  ? 156 PRO A C     1 
ATOM   1207 O  O     . PRO A 1 156 ? 47.473  -45.081 96.855  1.00 71.03  ? 156 PRO A O     1 
ATOM   1208 C  CB    . PRO A 1 156 ? 46.398  -46.160 94.005  1.00 66.66  ? 156 PRO A CB    1 
ATOM   1209 C  CG    . PRO A 1 156 ? 45.571  -45.900 92.789  1.00 64.69  ? 156 PRO A CG    1 
ATOM   1210 C  CD    . PRO A 1 156 ? 45.912  -44.454 92.386  1.00 63.70  ? 156 PRO A CD    1 
ATOM   1211 N  N     . ALA A 1 157 ? 48.656  -44.098 95.202  1.00 67.97  ? 157 ALA A N     1 
ATOM   1212 C  CA    . ALA A 1 157 ? 49.842  -43.826 96.027  1.00 69.17  ? 157 ALA A CA    1 
ATOM   1213 C  C     . ALA A 1 157 ? 50.282  -44.962 96.969  1.00 70.92  ? 157 ALA A C     1 
ATOM   1214 O  O     . ALA A 1 157 ? 50.162  -44.847 98.166  1.00 72.89  ? 157 ALA A O     1 
ATOM   1215 C  CB    . ALA A 1 157 ? 49.648  -42.533 96.829  1.00 70.25  ? 157 ALA A CB    1 
ATOM   1216 N  N     . ALA A 1 158 ? 50.829  -46.035 96.421  1.00 70.20  ? 158 ALA A N     1 
ATOM   1217 C  CA    . ALA A 1 158 ? 51.387  -47.110 97.221  1.00 77.45  ? 158 ALA A CA    1 
ATOM   1218 C  C     . ALA A 1 158 ? 52.709  -46.748 97.907  1.00 72.68  ? 158 ALA A C     1 
ATOM   1219 O  O     . ALA A 1 158 ? 53.297  -47.576 98.585  1.00 73.96  ? 158 ALA A O     1 
ATOM   1220 C  CB    . ALA A 1 158 ? 51.572  -48.335 96.368  1.00 87.06  ? 158 ALA A CB    1 
ATOM   1221 N  N     . PHE A 1 159 ? 53.199  -45.532 97.708  1.00 72.05  ? 159 PHE A N     1 
ATOM   1222 C  CA    . PHE A 1 159 ? 54.197  -44.980 98.624  1.00 89.01  ? 159 PHE A CA    1 
ATOM   1223 C  C     . PHE A 1 159 ? 53.827  -43.513 98.862  1.00 80.52  ? 159 PHE A C     1 
ATOM   1224 O  O     . PHE A 1 159 ? 53.159  -42.910 98.007  1.00 76.39  ? 159 PHE A O     1 
ATOM   1225 C  CB    . PHE A 1 159 ? 55.633  -45.162 98.108  1.00 125.33 ? 159 PHE A CB    1 
ATOM   1226 C  CG    . PHE A 1 159 ? 56.004  -44.228 96.995  1.00 162.41 ? 159 PHE A CG    1 
ATOM   1227 C  CD1   . PHE A 1 159 ? 55.872  -44.617 95.673  1.00 170.15 ? 159 PHE A CD1   1 
ATOM   1228 C  CD2   . PHE A 1 159 ? 56.487  -42.954 97.272  1.00 184.58 ? 159 PHE A CD2   1 
ATOM   1229 C  CE1   . PHE A 1 159 ? 56.215  -43.742 94.642  1.00 176.84 ? 159 PHE A CE1   1 
ATOM   1230 C  CE2   . PHE A 1 159 ? 56.829  -42.069 96.250  1.00 189.75 ? 159 PHE A CE2   1 
ATOM   1231 C  CZ    . PHE A 1 159 ? 56.695  -42.462 94.937  1.00 184.18 ? 159 PHE A CZ    1 
ATOM   1232 N  N     . PRO A 1 160 ? 54.216  -42.958 100.035 1.00 106.55 ? 160 PRO A N     1 
ATOM   1233 C  CA    . PRO A 1 160 ? 53.898  -41.603 100.533 1.00 115.96 ? 160 PRO A CA    1 
ATOM   1234 C  C     . PRO A 1 160 ? 54.690  -40.484 99.833  1.00 74.43  ? 160 PRO A C     1 
ATOM   1235 O  O     . PRO A 1 160 ? 55.575  -39.840 100.409 1.00 75.21  ? 160 PRO A O     1 
ATOM   1236 C  CB    . PRO A 1 160 ? 54.258  -41.662 102.031 1.00 138.44 ? 160 PRO A CB    1 
ATOM   1237 C  CG    . PRO A 1 160 ? 54.588  -43.093 102.322 1.00 150.08 ? 160 PRO A CG    1 
ATOM   1238 C  CD    . PRO A 1 160 ? 54.987  -43.729 101.022 1.00 136.16 ? 160 PRO A CD    1 
ATOM   1239 N  N     . ASN A 1 161 ? 54.314  -40.241 98.583  1.00 72.36  ? 161 ASN A N     1 
ATOM   1240 C  CA    . ASN A 1 161 ? 55.020  -39.341 97.688  1.00 70.71  ? 161 ASN A CA    1 
ATOM   1241 C  C     . ASN A 1 161 ? 55.130  -37.871 98.166  1.00 71.23  ? 161 ASN A C     1 
ATOM   1242 O  O     . ASN A 1 161 ? 56.092  -37.189 97.829  1.00 70.54  ? 161 ASN A O     1 
ATOM   1243 C  CB    . ASN A 1 161 ? 54.401  -39.484 96.282  1.00 141.50 ? 161 ASN A CB    1 
ATOM   1244 C  CG    . ASN A 1 161 ? 55.039  -38.586 95.256  1.00 178.24 ? 161 ASN A CG    1 
ATOM   1245 O  OD1   . ASN A 1 161 ? 56.176  -38.796 94.826  1.00 206.62 ? 161 ASN A OD1   1 
ATOM   1246 N  ND2   . ASN A 1 161 ? 54.296  -37.586 94.836  1.00 185.91 ? 161 ASN A ND2   1 
ATOM   1247 N  N     . LEU A 1 162 ? 54.180  -37.397 98.976  1.00 72.51  ? 162 LEU A N     1 
ATOM   1248 C  CA    . LEU A 1 162 ? 54.176  -35.997 99.437  1.00 73.04  ? 162 LEU A CA    1 
ATOM   1249 C  C     . LEU A 1 162 ? 55.468  -35.654 100.165 1.00 74.10  ? 162 LEU A C     1 
ATOM   1250 O  O     . LEU A 1 162 ? 56.076  -34.620 99.912  1.00 73.51  ? 162 LEU A O     1 
ATOM   1251 C  CB    . LEU A 1 162 ? 52.990  -35.724 100.370 1.00 74.61  ? 162 LEU A CB    1 
ATOM   1252 C  CG    . LEU A 1 162 ? 52.375  -34.317 100.433 1.00 74.56  ? 162 LEU A CG    1 
ATOM   1253 C  CD1   . LEU A 1 162 ? 52.160  -33.920 101.859 1.00 90.91  ? 162 LEU A CD1   1 
ATOM   1254 C  CD2   . LEU A 1 162 ? 53.217  -33.285 99.735  1.00 73.20  ? 162 LEU A CD2   1 
ATOM   1255 N  N     . LEU A 1 163 ? 55.887  -36.544 101.055 1.00 111.32 ? 163 LEU A N     1 
ATOM   1256 C  CA    . LEU A 1 163 ? 57.088  -36.325 101.845 1.00 125.91 ? 163 LEU A CA    1 
ATOM   1257 C  C     . LEU A 1 163 ? 58.303  -36.846 101.107 1.00 106.79 ? 163 LEU A C     1 
ATOM   1258 O  O     . LEU A 1 163 ? 59.385  -36.272 101.228 1.00 94.55  ? 163 LEU A O     1 
ATOM   1259 C  CB    . LEU A 1 163 ? 56.995  -37.006 103.231 1.00 174.12 ? 163 LEU A CB    1 
ATOM   1260 C  CG    . LEU A 1 163 ? 55.993  -36.463 104.255 1.00 226.41 ? 163 LEU A CG    1 
ATOM   1261 C  CD1   . LEU A 1 163 ? 55.877  -37.408 105.416 1.00 249.81 ? 163 LEU A CD1   1 
ATOM   1262 C  CD2   . LEU A 1 163 ? 56.378  -35.077 104.728 1.00 246.39 ? 163 LEU A CD2   1 
ATOM   1263 N  N     . VAL A 1 164 ? 58.134  -37.942 100.364 1.00 109.38 ? 164 VAL A N     1 
ATOM   1264 C  CA    . VAL A 1 164 ? 59.260  -38.538 99.654  1.00 116.48 ? 164 VAL A CA    1 
ATOM   1265 C  C     . VAL A 1 164 ? 59.846  -37.578 98.603  1.00 113.53 ? 164 VAL A C     1 
ATOM   1266 O  O     . VAL A 1 164 ? 61.050  -37.277 98.643  1.00 107.90 ? 164 VAL A O     1 
ATOM   1267 C  CB    . VAL A 1 164 ? 58.914  -39.889 98.992  1.00 125.27 ? 164 VAL A CB    1 
ATOM   1268 C  CG1   . VAL A 1 164 ? 60.021  -40.284 98.059  1.00 131.42 ? 164 VAL A CG1   1 
ATOM   1269 C  CG2   . VAL A 1 164 ? 58.694  -40.993 100.056 1.00 126.61 ? 164 VAL A CG2   1 
ATOM   1270 N  N     . ASN A 1 165 ? 59.003  -37.082 97.694  1.00 114.28 ? 165 ASN A N     1 
ATOM   1271 C  CA    . ASN A 1 165 ? 59.462  -36.137 96.634  1.00 106.19 ? 165 ASN A CA    1 
ATOM   1272 C  C     . ASN A 1 165 ? 59.350  -34.647 96.897  1.00 86.75  ? 165 ASN A C     1 
ATOM   1273 O  O     . ASN A 1 165 ? 60.132  -33.858 96.359  1.00 78.80  ? 165 ASN A O     1 
ATOM   1274 C  CB    . ASN A 1 165 ? 58.858  -36.455 95.258  1.00 117.25 ? 165 ASN A CB    1 
ATOM   1275 C  CG    . ASN A 1 165 ? 59.583  -37.582 94.584  1.00 128.75 ? 165 ASN A CG    1 
ATOM   1276 O  OD1   . ASN A 1 165 ? 60.815  -37.666 94.665  1.00 117.20 ? 165 ASN A OD1   1 
ATOM   1277 N  ND2   . ASN A 1 165 ? 58.832  -38.496 93.969  1.00 148.87 ? 165 ASN A ND2   1 
ATOM   1278 N  N     . GLY A 1 166 ? 58.395  -34.265 97.731  1.00 69.92  ? 166 GLY A N     1 
ATOM   1279 C  CA    . GLY A 1 166 ? 58.248  -32.872 98.093  1.00 70.31  ? 166 GLY A CA    1 
ATOM   1280 C  C     . GLY A 1 166 ? 57.335  -32.136 97.136  1.00 86.62  ? 166 GLY A C     1 
ATOM   1281 O  O     . GLY A 1 166 ? 56.596  -32.748 96.377  1.00 84.16  ? 166 GLY A O     1 
ATOM   1282 N  N     . SER A 1 167 ? 57.380  -30.813 97.192  1.00 93.47  ? 167 SER A N     1 
ATOM   1283 C  CA    . SER A 1 167 ? 56.479  -29.980 96.419  1.00 79.83  ? 167 SER A CA    1 
ATOM   1284 C  C     . SER A 1 167 ? 56.779  -28.520 96.722  1.00 69.78  ? 167 SER A C     1 
ATOM   1285 O  O     . SER A 1 167 ? 57.162  -28.184 97.835  1.00 76.66  ? 167 SER A O     1 
ATOM   1286 C  CB    . SER A 1 167 ? 55.018  -30.318 96.758  1.00 74.02  ? 167 SER A CB    1 
ATOM   1287 O  OG    . SER A 1 167 ? 54.122  -29.672 95.868  1.00 66.79  ? 167 SER A OG    1 
ATOM   1288 N  N     . THR A 1 168 ? 56.592  -27.669 95.717  1.00 74.95  ? 168 THR A N     1 
ATOM   1289 C  CA    . THR A 1 168 ? 56.757  -26.218 95.802  1.00 66.40  ? 168 THR A CA    1 
ATOM   1290 C  C     . THR A 1 168 ? 56.121  -25.703 94.522  1.00 73.85  ? 168 THR A C     1 
ATOM   1291 O  O     . THR A 1 168 ? 56.424  -26.261 93.474  1.00 70.21  ? 168 THR A O     1 
ATOM   1292 C  CB    . THR A 1 168 ? 58.263  -25.832 95.752  1.00 66.00  ? 168 THR A CB    1 
ATOM   1293 O  OG1   . THR A 1 168 ? 58.439  -24.703 94.896  1.00 67.84  ? 168 THR A OG1   1 
ATOM   1294 C  CG2   . THR A 1 168 ? 59.110  -26.955 95.173  1.00 65.21  ? 168 THR A CG2   1 
ATOM   1295 N  N     . GLY A 1 169 ? 55.212  -24.724 94.538  1.00 101.83 ? 169 GLY A N     1 
ATOM   1296 C  CA    . GLY A 1 169 ? 54.520  -24.224 95.684  1.00 121.89 ? 169 GLY A CA    1 
ATOM   1297 C  C     . GLY A 1 169 ? 54.271  -22.723 95.723  1.00 124.34 ? 169 GLY A C     1 
ATOM   1298 O  O     . GLY A 1 169 ? 54.669  -22.099 96.713  1.00 102.41 ? 169 GLY A O     1 
ATOM   1299 N  N     . ILE A 1 170 ? 53.623  -22.128 94.713  1.00 143.15 ? 170 ILE A N     1 
ATOM   1300 C  CA    . ILE A 1 170 ? 53.109  -20.731 94.889  1.00 144.51 ? 170 ILE A CA    1 
ATOM   1301 C  C     . ILE A 1 170 ? 51.714  -20.432 94.323  1.00 153.80 ? 170 ILE A C     1 
ATOM   1302 O  O     . ILE A 1 170 ? 51.556  -20.352 93.113  1.00 135.96 ? 170 ILE A O     1 
ATOM   1303 C  CB    . ILE A 1 170 ? 53.996  -19.668 94.225  1.00 123.15 ? 170 ILE A CB    1 
ATOM   1304 C  CG1   . ILE A 1 170 ? 55.476  -19.873 94.548  1.00 103.55 ? 170 ILE A CG1   1 
ATOM   1305 C  CG2   . ILE A 1 170 ? 53.486  -18.248 94.581  1.00 109.90 ? 170 ILE A CG2   1 
ATOM   1306 C  CD1   . ILE A 1 170 ? 56.382  -18.970 93.731  1.00 92.74  ? 170 ILE A CD1   1 
ATOM   1307 N  N     . SER A 1 171 ? 50.708  -20.210 95.164  1.00 179.91 ? 171 SER A N     1 
ATOM   1308 C  CA    . SER A 1 171 ? 49.390  -19.857 94.608  1.00 189.79 ? 171 SER A CA    1 
ATOM   1309 C  C     . SER A 1 171 ? 48.918  -18.437 94.923  1.00 179.87 ? 171 SER A C     1 
ATOM   1310 O  O     . SER A 1 171 ? 49.664  -17.458 94.728  1.00 163.21 ? 171 SER A O     1 
ATOM   1311 C  CB    . SER A 1 171 ? 48.300  -20.895 94.934  1.00 195.42 ? 171 SER A CB    1 
ATOM   1312 O  OG    . SER A 1 171 ? 47.766  -20.727 96.230  1.00 193.43 ? 171 SER A OG    1 
ATOM   1313 N  N     . ALA A 1 172 ? 47.659  -18.324 95.339  1.00 180.25 ? 172 ALA A N     1 
ATOM   1314 C  CA    . ALA A 1 172 ? 47.096  -17.045 95.791  1.00 170.10 ? 172 ALA A CA    1 
ATOM   1315 C  C     . ALA A 1 172 ? 46.752  -17.170 97.281  1.00 150.47 ? 172 ALA A C     1 
ATOM   1316 O  O     . ALA A 1 172 ? 46.068  -18.112 97.680  1.00 165.99 ? 172 ALA A O     1 
ATOM   1317 C  CB    . ALA A 1 172 ? 45.856  -16.678 94.970  1.00 183.38 ? 172 ALA A CB    1 
ATOM   1318 N  N     . GLY A 1 173 ? 47.242  -16.248 98.105  1.00 115.38 ? 173 GLY A N     1 
ATOM   1319 C  CA    . GLY A 1 173 ? 47.012  -16.331 99.541  1.00 98.95  ? 173 GLY A CA    1 
ATOM   1320 C  C     . GLY A 1 173 ? 47.769  -17.477 100.206 1.00 94.65  ? 173 GLY A C     1 
ATOM   1321 O  O     . GLY A 1 173 ? 47.791  -17.580 101.420 1.00 94.59  ? 173 GLY A O     1 
ATOM   1322 N  N     . TYR A 1 174 ? 48.389  -18.349 99.413  1.00 96.60  ? 174 TYR A N     1 
ATOM   1323 C  CA    . TYR A 1 174 ? 49.162  -19.458 99.973  1.00 107.61 ? 174 TYR A CA    1 
ATOM   1324 C  C     . TYR A 1 174 ? 50.314  -19.871 99.059  1.00 104.78 ? 174 TYR A C     1 
ATOM   1325 O  O     . TYR A 1 174 ? 50.197  -19.813 97.845  1.00 104.57 ? 174 TYR A O     1 
ATOM   1326 C  CB    . TYR A 1 174 ? 48.280  -20.690 100.215 1.00 130.26 ? 174 TYR A CB    1 
ATOM   1327 C  CG    . TYR A 1 174 ? 47.046  -20.491 101.072 1.00 160.92 ? 174 TYR A CG    1 
ATOM   1328 C  CD1   . TYR A 1 174 ? 47.026  -20.877 102.404 1.00 176.64 ? 174 TYR A CD1   1 
ATOM   1329 C  CD2   . TYR A 1 174 ? 45.889  -19.953 100.534 1.00 171.50 ? 174 TYR A CD2   1 
ATOM   1330 C  CE1   . TYR A 1 174 ? 45.898  -20.712 103.175 1.00 181.00 ? 174 TYR A CE1   1 
ATOM   1331 C  CE2   . TYR A 1 174 ? 44.758  -19.784 101.294 1.00 175.45 ? 174 TYR A CE2   1 
ATOM   1332 C  CZ    . TYR A 1 174 ? 44.763  -20.164 102.614 1.00 172.15 ? 174 TYR A CZ    1 
ATOM   1333 O  OH    . TYR A 1 174 ? 43.623  -19.988 103.366 1.00 158.00 ? 174 TYR A OH    1 
ATOM   1334 N  N     . ALA A 1 175 ? 51.416  -20.302 99.668  1.00 108.26 ? 175 ALA A N     1 
ATOM   1335 C  CA    . ALA A 1 175 ? 52.548  -20.924 98.983  1.00 111.00 ? 175 ALA A CA    1 
ATOM   1336 C  C     . ALA A 1 175 ? 52.828  -22.267 99.662  1.00 98.24  ? 175 ALA A C     1 
ATOM   1337 O  O     . ALA A 1 175 ? 52.248  -22.564 100.701 1.00 85.27  ? 175 ALA A O     1 
ATOM   1338 C  CB    . ALA A 1 175 ? 53.784  -20.018 99.043  1.00 123.99 ? 175 ALA A CB    1 
ATOM   1339 N  N     . THR A 1 176 ? 53.689  -23.097 99.083  1.00 98.16  ? 176 THR A N     1 
ATOM   1340 C  CA    . THR A 1 176 ? 54.063  -24.338 99.757  1.00 87.41  ? 176 THR A CA    1 
ATOM   1341 C  C     . THR A 1 176 ? 55.518  -24.699 99.516  1.00 78.27  ? 176 THR A C     1 
ATOM   1342 O  O     . THR A 1 176 ? 56.008  -24.599 98.412  1.00 77.79  ? 176 THR A O     1 
ATOM   1343 C  CB    . THR A 1 176 ? 53.189  -25.542 99.333  1.00 78.58  ? 176 THR A CB    1 
ATOM   1344 O  OG1   . THR A 1 176 ? 53.513  -26.687 100.141 1.00 74.26  ? 176 THR A OG1   1 
ATOM   1345 C  CG2   . THR A 1 176 ? 53.436  -25.894 97.864  1.00 81.52  ? 176 THR A CG2   1 
ATOM   1346 N  N     . ASP A 1 177 ? 56.194  -25.143 100.564 1.00 73.83  ? 177 ASP A N     1 
ATOM   1347 C  CA    . ASP A 1 177 ? 57.519  -25.705 100.431 1.00 73.29  ? 177 ASP A CA    1 
ATOM   1348 C  C     . ASP A 1 177 ? 57.653  -26.880 101.367 1.00 77.02  ? 177 ASP A C     1 
ATOM   1349 O  O     . ASP A 1 177 ? 57.664  -26.716 102.592 1.00 91.72  ? 177 ASP A O     1 
ATOM   1350 C  CB    . ASP A 1 177 ? 58.585  -24.657 100.719 1.00 73.64  ? 177 ASP A CB    1 
ATOM   1351 C  CG    . ASP A 1 177 ? 59.056  -23.975 99.467  1.00 80.99  ? 177 ASP A CG    1 
ATOM   1352 O  OD1   . ASP A 1 177 ? 59.740  -24.650 98.655  1.00 82.78  ? 177 ASP A OD1   1 
ATOM   1353 O  OD2   . ASP A 1 177 ? 58.728  -22.781 99.284  1.00 81.60  ? 177 ASP A OD2   1 
ATOM   1354 N  N     . ILE A 1 178 ? 57.725  -28.065 100.778 1.00 74.05  ? 178 ILE A N     1 
ATOM   1355 C  CA    . ILE A 1 178 ? 57.856  -29.318 101.519 1.00 75.37  ? 178 ILE A CA    1 
ATOM   1356 C  C     . ILE A 1 178 ? 59.065  -30.026 100.939 1.00 74.48  ? 178 ILE A C     1 
ATOM   1357 O  O     . ILE A 1 178 ? 59.099  -30.309 99.747  1.00 72.61  ? 178 ILE A O     1 
ATOM   1358 C  CB    . ILE A 1 178 ? 56.631  -30.214 101.286 1.00 81.31  ? 178 ILE A CB    1 
ATOM   1359 C  CG1   . ILE A 1 178 ? 55.355  -29.542 101.794 1.00 100.31 ? 178 ILE A CG1   1 
ATOM   1360 C  CG2   . ILE A 1 178 ? 56.835  -31.609 101.884 1.00 81.55  ? 178 ILE A CG2   1 
ATOM   1361 C  CD1   . ILE A 1 178 ? 54.096  -30.389 101.529 1.00 109.50 ? 178 ILE A CD1   1 
ATOM   1362 N  N     . PRO A 1 179 ? 60.081  -30.298 101.757 1.00 75.81  ? 179 PRO A N     1 
ATOM   1363 C  CA    . PRO A 1 179 ? 61.254  -30.897 101.119 1.00 74.86  ? 179 PRO A CA    1 
ATOM   1364 C  C     . PRO A 1 179 ? 61.095  -32.408 101.019 1.00 74.88  ? 179 PRO A C     1 
ATOM   1365 O  O     . PRO A 1 179 ? 60.176  -32.964 101.606 1.00 75.90  ? 179 PRO A O     1 
ATOM   1366 C  CB    . PRO A 1 179 ? 62.378  -30.547 102.094 1.00 76.37  ? 179 PRO A CB    1 
ATOM   1367 C  CG    . PRO A 1 179 ? 61.688  -30.600 103.428 1.00 78.51  ? 179 PRO A CG    1 
ATOM   1368 C  CD    . PRO A 1 179 ? 60.306  -30.017 103.185 1.00 78.07  ? 179 PRO A CD    1 
ATOM   1369 N  N     . PRO A 1 180 ? 61.997  -33.064 100.288 1.00 73.82  ? 180 PRO A N     1 
ATOM   1370 C  CA    . PRO A 1 180 ? 62.007  -34.506 100.053 1.00 108.18 ? 180 PRO A CA    1 
ATOM   1371 C  C     . PRO A 1 180 ? 62.567  -35.246 101.248 1.00 106.47 ? 180 PRO A C     1 
ATOM   1372 O  O     . PRO A 1 180 ? 63.368  -34.710 101.996 1.00 103.35 ? 180 PRO A O     1 
ATOM   1373 C  CB    . PRO A 1 180 ? 62.992  -34.673 98.891  1.00 114.26 ? 180 PRO A CB    1 
ATOM   1374 C  CG    . PRO A 1 180 ? 63.502  -33.305 98.566  1.00 111.29 ? 180 PRO A CG    1 
ATOM   1375 C  CD    . PRO A 1 180 ? 63.168  -32.408 99.694  1.00 72.84  ? 180 PRO A CD    1 
ATOM   1376 N  N     . HIS A 1 181 ? 62.169  -36.498 101.390 1.00 109.32 ? 181 HIS A N     1 
ATOM   1377 C  CA    . HIS A 1 181 ? 62.658  -37.335 102.454 1.00 103.10 ? 181 HIS A CA    1 
ATOM   1378 C  C     . HIS A 1 181 ? 63.001  -38.700 101.894 1.00 104.33 ? 181 HIS A C     1 
ATOM   1379 O  O     . HIS A 1 181 ? 62.564  -39.062 100.808 1.00 111.72 ? 181 HIS A O     1 
ATOM   1380 C  CB    . HIS A 1 181 ? 61.579  -37.493 103.518 1.00 90.54  ? 181 HIS A CB    1 
ATOM   1381 C  CG    . HIS A 1 181 ? 61.184  -36.203 104.176 1.00 84.67  ? 181 HIS A CG    1 
ATOM   1382 N  ND1   . HIS A 1 181 ? 60.377  -35.271 103.563 1.00 87.68  ? 181 HIS A ND1   1 
ATOM   1383 C  CD2   . HIS A 1 181 ? 61.478  -35.701 105.402 1.00 85.90  ? 181 HIS A CD2   1 
ATOM   1384 C  CE1   . HIS A 1 181 ? 60.190  -34.248 104.383 1.00 95.32  ? 181 HIS A CE1   1 
ATOM   1385 N  NE2   . HIS A 1 181 ? 60.845  -34.486 105.502 1.00 95.05  ? 181 HIS A NE2   1 
ATOM   1386 N  N     . ASN A 1 182 ? 63.773  -39.447 102.665 1.00 95.52  ? 182 ASN A N     1 
ATOM   1387 C  CA    . ASN A 1 182 ? 64.147  -40.820 102.371 1.00 59.72  ? 182 ASN A CA    1 
ATOM   1388 C  C     . ASN A 1 182 ? 62.950  -41.773 102.469 1.00 59.85  ? 182 ASN A C     1 
ATOM   1389 O  O     . ASN A 1 182 ? 62.220  -41.774 103.461 1.00 65.94  ? 182 ASN A O     1 
ATOM   1390 C  CB    . ASN A 1 182 ? 65.228  -41.239 103.361 1.00 61.43  ? 182 ASN A CB    1 
ATOM   1391 C  CG    . ASN A 1 182 ? 65.845  -42.559 103.022 1.00 63.24  ? 182 ASN A CG    1 
ATOM   1392 O  OD1   . ASN A 1 182 ? 65.366  -43.606 103.447 1.00 72.27  ? 182 ASN A OD1   1 
ATOM   1393 N  ND2   . ASN A 1 182 ? 66.928  -42.523 102.264 1.00 62.79  ? 182 ASN A ND2   1 
ATOM   1394 N  N     . LEU A 1 183 ? 62.770  -42.592 101.440 1.00 140.12 ? 183 LEU A N     1 
ATOM   1395 C  CA    . LEU A 1 183 ? 61.621  -43.483 101.301 1.00 139.77 ? 183 LEU A CA    1 
ATOM   1396 C  C     . LEU A 1 183 ? 61.515  -44.469 102.478 1.00 141.81 ? 183 LEU A C     1 
ATOM   1397 O  O     . LEU A 1 183 ? 60.463  -44.608 103.108 1.00 146.72 ? 183 LEU A O     1 
ATOM   1398 C  CB    . LEU A 1 183 ? 61.741  -44.214 99.951  1.00 137.75 ? 183 LEU A CB    1 
ATOM   1399 C  CG    . LEU A 1 183 ? 60.699  -45.079 99.226  1.00 148.67 ? 183 LEU A CG    1 
ATOM   1400 C  CD1   . LEU A 1 183 ? 60.842  -46.528 99.626  1.00 142.31 ? 183 LEU A CD1   1 
ATOM   1401 C  CD2   . LEU A 1 183 ? 59.271  -44.582 99.396  1.00 166.69 ? 183 LEU A CD2   1 
ATOM   1402 N  N     . ALA A 1 184 ? 62.608  -45.152 102.784 1.00 142.64 ? 184 ALA A N     1 
ATOM   1403 C  CA    . ALA A 1 184 ? 62.598  -46.105 103.882 1.00 147.39 ? 184 ALA A CA    1 
ATOM   1404 C  C     . ALA A 1 184 ? 62.219  -45.409 105.200 1.00 153.53 ? 184 ALA A C     1 
ATOM   1405 O  O     . ALA A 1 184 ? 61.410  -45.910 105.980 1.00 155.81 ? 184 ALA A O     1 
ATOM   1406 C  CB    . ALA A 1 184 ? 63.952  -46.793 103.996 1.00 153.88 ? 184 ALA A CB    1 
ATOM   1407 N  N     . GLU A 1 185 ? 62.795  -44.238 105.434 1.00 148.34 ? 185 GLU A N     1 
ATOM   1408 C  CA    . GLU A 1 185 ? 62.491  -43.482 106.637 1.00 157.13 ? 185 GLU A CA    1 
ATOM   1409 C  C     . GLU A 1 185 ? 61.014  -43.091 106.734 1.00 148.51 ? 185 GLU A C     1 
ATOM   1410 O  O     . GLU A 1 185 ? 60.377  -43.331 107.756 1.00 150.82 ? 185 GLU A O     1 
ATOM   1411 C  CB    . GLU A 1 185 ? 63.414  -42.260 106.762 1.00 177.12 ? 185 GLU A CB    1 
ATOM   1412 C  CG    . GLU A 1 185 ? 64.848  -42.640 107.053 1.00 183.46 ? 185 GLU A CG    1 
ATOM   1413 C  CD    . GLU A 1 185 ? 65.787  -41.448 107.088 1.00 171.64 ? 185 GLU A CD    1 
ATOM   1414 O  OE1   . GLU A 1 185 ? 65.302  -40.297 107.134 1.00 162.31 ? 185 GLU A OE1   1 
ATOM   1415 O  OE2   . GLU A 1 185 ? 67.017  -41.671 107.061 1.00 165.62 ? 185 GLU A OE2   1 
ATOM   1416 N  N     . VAL A 1 186 ? 60.469  -42.488 105.684 1.00 152.53 ? 186 VAL A N     1 
ATOM   1417 C  CA    . VAL A 1 186 ? 59.066  -42.085 105.715 1.00 169.36 ? 186 VAL A CA    1 
ATOM   1418 C  C     . VAL A 1 186 ? 58.138  -43.277 105.935 1.00 157.70 ? 186 VAL A C     1 
ATOM   1419 O  O     . VAL A 1 186 ? 57.099  -43.150 106.586 1.00 156.96 ? 186 VAL A O     1 
ATOM   1420 C  CB    . VAL A 1 186 ? 58.641  -41.371 104.424 1.00 201.56 ? 186 VAL A CB    1 
ATOM   1421 C  CG1   . VAL A 1 186 ? 57.135  -41.132 104.438 1.00 226.62 ? 186 VAL A CG1   1 
ATOM   1422 C  CG2   . VAL A 1 186 ? 59.390  -40.057 104.274 1.00 203.17 ? 186 VAL A CG2   1 
ATOM   1423 N  N     . ILE A 1 187 ? 58.512  -44.426 105.379 1.00 146.06 ? 187 ILE A N     1 
ATOM   1424 C  CA    . ILE A 1 187 ? 57.708  -45.635 105.492 1.00 146.34 ? 187 ILE A CA    1 
ATOM   1425 C  C     . ILE A 1 187 ? 57.801  -46.243 106.908 1.00 148.84 ? 187 ILE A C     1 
ATOM   1426 O  O     . ILE A 1 187 ? 56.811  -46.743 107.457 1.00 149.74 ? 187 ILE A O     1 
ATOM   1427 C  CB    . ILE A 1 187 ? 58.081  -46.652 104.386 1.00 150.92 ? 187 ILE A CB    1 
ATOM   1428 C  CG1   . ILE A 1 187 ? 57.414  -46.262 103.073 1.00 173.37 ? 187 ILE A CG1   1 
ATOM   1429 C  CG2   . ILE A 1 187 ? 57.628  -48.057 104.722 1.00 145.45 ? 187 ILE A CG2   1 
ATOM   1430 C  CD1   . ILE A 1 187 ? 57.799  -47.175 101.930 1.00 193.63 ? 187 ILE A CD1   1 
ATOM   1431 N  N     . ASP A 1 188 ? 58.984  -46.175 107.504 1.00 150.00 ? 188 ASP A N     1 
ATOM   1432 C  CA    . ASP A 1 188 ? 59.140  -46.588 108.892 1.00 152.46 ? 188 ASP A CA    1 
ATOM   1433 C  C     . ASP A 1 188 ? 58.201  -45.785 109.803 1.00 153.76 ? 188 ASP A C     1 
ATOM   1434 O  O     . ASP A 1 188 ? 57.503  -46.353 110.642 1.00 155.23 ? 188 ASP A O     1 
ATOM   1435 C  CB    . ASP A 1 188 ? 60.603  -46.480 109.327 1.00 164.82 ? 188 ASP A CB    1 
ATOM   1436 C  CG    . ASP A 1 188 ? 61.495  -47.528 108.644 1.00 171.68 ? 188 ASP A CG    1 
ATOM   1437 O  OD1   . ASP A 1 188 ? 60.938  -48.555 108.180 1.00 163.53 ? 188 ASP A OD1   1 
ATOM   1438 O  OD2   . ASP A 1 188 ? 62.738  -47.326 108.573 1.00 184.67 ? 188 ASP A OD2   1 
ATOM   1439 N  N     . ALA A 1 189 ? 58.155  -44.471 109.600 1.00 153.19 ? 189 ALA A N     1 
ATOM   1440 C  CA    . ALA A 1 189 ? 57.243  -43.610 110.338 1.00 154.22 ? 189 ALA A CA    1 
ATOM   1441 C  C     . ALA A 1 189 ? 55.779  -43.994 110.112 1.00 153.75 ? 189 ALA A C     1 
ATOM   1442 O  O     . ALA A 1 189 ? 54.999  -44.074 111.059 1.00 155.34 ? 189 ALA A O     1 
ATOM   1443 C  CB    . ALA A 1 189 ? 57.487  -42.111 109.989 1.00 240.21 ? 189 ALA A CB    1 
ATOM   1444 N  N     . ALA A 1 190 ? 55.400  -44.229 108.862 1.00 151.59 ? 190 ALA A N     1 
ATOM   1445 C  CA    . ALA A 1 190 ? 54.006  -44.548 108.570 1.00 151.01 ? 190 ALA A CA    1 
ATOM   1446 C  C     . ALA A 1 190 ? 53.635  -45.853 109.234 1.00 152.36 ? 190 ALA A C     1 
ATOM   1447 O  O     . ALA A 1 190 ? 52.543  -46.004 109.770 1.00 153.25 ? 190 ALA A O     1 
ATOM   1448 C  CB    . ALA A 1 190 ? 53.755  -44.633 107.060 1.00 171.06 ? 190 ALA A CB    1 
ATOM   1449 N  N     . VAL A 1 191 ? 54.545  -46.809 109.177 1.00 152.49 ? 191 VAL A N     1 
ATOM   1450 C  CA    . VAL A 1 191 ? 54.273  -48.092 109.777 1.00 153.75 ? 191 VAL A CA    1 
ATOM   1451 C  C     . VAL A 1 191 ? 54.125  -47.983 111.287 1.00 158.61 ? 191 VAL A C     1 
ATOM   1452 O  O     . VAL A 1 191 ? 53.265  -48.648 111.881 1.00 163.07 ? 191 VAL A O     1 
ATOM   1453 C  CB    . VAL A 1 191 ? 55.349  -49.109 109.424 1.00 153.42 ? 191 VAL A CB    1 
ATOM   1454 C  CG1   . VAL A 1 191 ? 55.269  -50.339 110.352 1.00 155.27 ? 191 VAL A CG1   1 
ATOM   1455 C  CG2   . VAL A 1 191 ? 55.166  -49.507 108.009 1.00 187.05 ? 191 VAL A CG2   1 
ATOM   1456 N  N     . TYR A 1 192 ? 54.945  -47.147 111.920 1.00 169.84 ? 192 TYR A N     1 
ATOM   1457 C  CA    . TYR A 1 192 ? 54.823  -46.998 113.364 1.00 213.31 ? 192 TYR A CA    1 
ATOM   1458 C  C     . TYR A 1 192 ? 53.470  -46.393 113.687 1.00 213.92 ? 192 TYR A C     1 
ATOM   1459 O  O     . TYR A 1 192 ? 52.748  -46.879 114.549 1.00 221.67 ? 192 TYR A O     1 
ATOM   1460 C  CB    . TYR A 1 192 ? 55.933  -46.138 113.946 1.00 255.35 ? 192 TYR A CB    1 
ATOM   1461 C  CG    . TYR A 1 192 ? 55.887  -46.049 115.458 1.00 277.05 ? 192 TYR A CG    1 
ATOM   1462 C  CD1   . TYR A 1 192 ? 55.311  -44.958 116.096 1.00 274.24 ? 192 TYR A CD1   1 
ATOM   1463 C  CD2   . TYR A 1 192 ? 56.413  -47.062 116.247 1.00 276.44 ? 192 TYR A CD2   1 
ATOM   1464 C  CE1   . TYR A 1 192 ? 55.281  -44.874 117.477 1.00 255.56 ? 192 TYR A CE1   1 
ATOM   1465 C  CE2   . TYR A 1 192 ? 56.372  -46.995 117.624 1.00 258.11 ? 192 TYR A CE2   1 
ATOM   1466 C  CZ    . TYR A 1 192 ? 55.814  -45.896 118.237 1.00 236.11 ? 192 TYR A CZ    1 
ATOM   1467 O  OH    . TYR A 1 192 ? 55.786  -45.827 119.617 1.00 206.92 ? 192 TYR A OH    1 
ATOM   1468 N  N     . MET A 1 193 ? 53.120  -45.341 112.966 1.00 200.17 ? 193 MET A N     1 
ATOM   1469 C  CA    . MET A 1 193 ? 51.853  -44.663 113.183 1.00 186.08 ? 193 MET A CA    1 
ATOM   1470 C  C     . MET A 1 193 ? 50.620  -45.542 112.904 1.00 158.64 ? 193 MET A C     1 
ATOM   1471 O  O     . MET A 1 193 ? 49.559  -45.346 113.483 1.00 165.76 ? 193 MET A O     1 
ATOM   1472 C  CB    . MET A 1 193 ? 51.822  -43.389 112.347 1.00 176.73 ? 193 MET A CB    1 
ATOM   1473 C  CG    . MET A 1 193 ? 50.567  -42.580 112.490 1.00 174.10 ? 193 MET A CG    1 
ATOM   1474 S  SD    . MET A 1 193 ? 50.966  -40.853 112.311 1.00 166.40 ? 193 MET A SD    1 
ATOM   1475 C  CE    . MET A 1 193 ? 49.348  -40.272 111.802 1.00 159.60 ? 193 MET A CE    1 
ATOM   1476 N  N     . ILE A 1 194 ? 50.747  -46.500 112.001 1.00 157.20 ? 194 ILE A N     1 
ATOM   1477 C  CA    . ILE A 1 194 ? 49.640  -47.391 111.753 1.00 156.89 ? 194 ILE A CA    1 
ATOM   1478 C  C     . ILE A 1 194 ? 49.373  -48.196 113.024 1.00 159.31 ? 194 ILE A C     1 
ATOM   1479 O  O     . ILE A 1 194 ? 48.222  -48.468 113.346 1.00 159.93 ? 194 ILE A O     1 
ATOM   1480 C  CB    . ILE A 1 194 ? 49.913  -48.329 110.538 1.00 215.35 ? 194 ILE A CB    1 
ATOM   1481 C  CG1   . ILE A 1 194 ? 49.928  -47.519 109.242 1.00 230.24 ? 194 ILE A CG1   1 
ATOM   1482 C  CG2   . ILE A 1 194 ? 48.884  -49.496 110.461 1.00 259.38 ? 194 ILE A CG2   1 
ATOM   1483 C  CD1   . ILE A 1 194 ? 50.398  -48.297 108.054 1.00 246.95 ? 194 ILE A CD1   1 
ATOM   1484 N  N     . ASP A 1 195 ? 50.441  -48.559 113.740 1.00 160.68 ? 195 ASP A N     1 
ATOM   1485 C  CA    . ASP A 1 195 ? 50.345  -49.386 114.952 1.00 166.91 ? 195 ASP A CA    1 
ATOM   1486 C  C     . ASP A 1 195 ? 50.035  -48.520 116.167 1.00 177.10 ? 195 ASP A C     1 
ATOM   1487 O  O     . ASP A 1 195 ? 49.318  -48.921 117.071 1.00 181.92 ? 195 ASP A O     1 
ATOM   1488 C  CB    . ASP A 1 195 ? 51.666  -50.135 115.206 1.00 175.65 ? 195 ASP A CB    1 
ATOM   1489 C  CG    . ASP A 1 195 ? 51.797  -51.412 114.383 1.00 180.38 ? 195 ASP A CG    1 
ATOM   1490 O  OD1   . ASP A 1 195 ? 50.753  -52.013 114.053 1.00 170.32 ? 195 ASP A OD1   1 
ATOM   1491 O  OD2   . ASP A 1 195 ? 52.946  -51.820 114.076 1.00 183.39 ? 195 ASP A OD2   1 
ATOM   1492 N  N     . HIS A 1 196 ? 50.586  -47.317 116.156 1.00 176.73 ? 196 HIS A N     1 
ATOM   1493 C  CA    . HIS A 1 196 ? 50.451  -46.371 117.238 1.00 199.43 ? 196 HIS A CA    1 
ATOM   1494 C  C     . HIS A 1 196 ? 49.928  -45.015 116.714 1.00 201.94 ? 196 HIS A C     1 
ATOM   1495 O  O     . HIS A 1 196 ? 50.699  -44.062 116.569 1.00 217.03 ? 196 HIS A O     1 
ATOM   1496 C  CB    . HIS A 1 196 ? 51.827  -46.180 117.880 1.00 212.15 ? 196 HIS A CB    1 
ATOM   1497 C  CG    . HIS A 1 196 ? 52.449  -47.457 118.365 1.00 199.22 ? 196 HIS A CG    1 
ATOM   1498 N  ND1   . HIS A 1 196 ? 53.288  -48.223 117.582 1.00 187.85 ? 196 HIS A ND1   1 
ATOM   1499 C  CD2   . HIS A 1 196 ? 52.348  -48.107 119.550 1.00 186.72 ? 196 HIS A CD2   1 
ATOM   1500 C  CE1   . HIS A 1 196 ? 53.681  -49.283 118.264 1.00 181.26 ? 196 HIS A CE1   1 
ATOM   1501 N  NE2   . HIS A 1 196 ? 53.118  -49.241 119.459 1.00 178.92 ? 196 HIS A NE2   1 
ATOM   1502 N  N     . PRO A 1 197 ? 48.610  -44.922 116.454 1.00 183.94 ? 197 PRO A N     1 
ATOM   1503 C  CA    . PRO A 1 197 ? 47.949  -43.780 115.795 1.00 176.40 ? 197 PRO A CA    1 
ATOM   1504 C  C     . PRO A 1 197 ? 48.154  -42.450 116.516 1.00 180.83 ? 197 PRO A C     1 
ATOM   1505 O  O     . PRO A 1 197 ? 48.269  -41.393 115.893 1.00 184.18 ? 197 PRO A O     1 
ATOM   1506 C  CB    . PRO A 1 197 ? 46.461  -44.163 115.818 1.00 163.69 ? 197 PRO A CB    1 
ATOM   1507 C  CG    . PRO A 1 197 ? 46.443  -45.651 116.017 1.00 164.30 ? 197 PRO A CG    1 
ATOM   1508 C  CD    . PRO A 1 197 ? 47.655  -45.980 116.831 1.00 165.81 ? 197 PRO A CD    1 
ATOM   1509 N  N     . THR A 1 198 ? 48.209  -42.503 117.832 1.00 186.11 ? 198 THR A N     1 
ATOM   1510 C  CA    . THR A 1 198 ? 48.377  -41.303 118.644 1.00 183.88 ? 198 THR A CA    1 
ATOM   1511 C  C     . THR A 1 198 ? 49.842  -40.917 118.852 1.00 181.86 ? 198 THR A C     1 
ATOM   1512 O  O     . THR A 1 198 ? 50.162  -40.202 119.799 1.00 187.03 ? 198 THR A O     1 
ATOM   1513 C  CB    . THR A 1 198 ? 47.794  -41.549 120.020 1.00 187.95 ? 198 THR A CB    1 
ATOM   1514 O  OG1   . THR A 1 198 ? 48.441  -42.697 120.579 1.00 206.14 ? 198 THR A OG1   1 
ATOM   1515 C  CG2   . THR A 1 198 ? 46.301  -41.834 119.911 1.00 177.76 ? 198 THR A CG2   1 
ATOM   1516 N  N     . ALA A 1 199 ? 50.731  -41.377 117.974 1.00 183.67 ? 199 ALA A N     1 
ATOM   1517 C  CA    . ALA A 1 199 ? 52.165  -41.154 118.171 1.00 180.30 ? 199 ALA A CA    1 
ATOM   1518 C  C     . ALA A 1 199 ? 52.565  -39.678 118.176 1.00 177.27 ? 199 ALA A C     1 
ATOM   1519 O  O     . ALA A 1 199 ? 51.997  -38.851 117.455 1.00 170.58 ? 199 ALA A O     1 
ATOM   1520 C  CB    . ALA A 1 199 ? 52.971  -41.924 117.145 1.00 193.22 ? 199 ALA A CB    1 
ATOM   1521 N  N     . LYS A 1 200 ? 53.554  -39.357 119.002 1.00 183.24 ? 200 LYS A N     1 
ATOM   1522 C  CA    . LYS A 1 200 ? 54.021  -37.985 119.146 1.00 178.17 ? 200 LYS A CA    1 
ATOM   1523 C  C     . LYS A 1 200 ? 55.221  -37.751 118.231 1.00 168.97 ? 200 LYS A C     1 
ATOM   1524 O  O     . LYS A 1 200 ? 55.946  -38.697 117.922 1.00 168.72 ? 200 LYS A O     1 
ATOM   1525 C  CB    . LYS A 1 200 ? 54.390  -37.720 120.613 1.00 175.28 ? 200 LYS A CB    1 
ATOM   1526 N  N     . ILE A 1 201 ? 55.439  -36.504 117.807 1.00 188.09 ? 201 ILE A N     1 
ATOM   1527 C  CA    . ILE A 1 201 ? 56.573  -36.177 116.934 1.00 209.76 ? 201 ILE A CA    1 
ATOM   1528 C  C     . ILE A 1 201 ? 57.921  -36.716 117.417 1.00 198.90 ? 201 ILE A C     1 
ATOM   1529 O  O     . ILE A 1 201 ? 58.642  -37.342 116.645 1.00 187.90 ? 201 ILE A O     1 
ATOM   1530 C  CB    . ILE A 1 201 ? 56.720  -34.660 116.651 1.00 234.05 ? 201 ILE A CB    1 
ATOM   1531 C  CG1   . ILE A 1 201 ? 55.659  -34.198 115.655 1.00 215.58 ? 201 ILE A CG1   1 
ATOM   1532 C  CG2   . ILE A 1 201 ? 58.069  -34.373 116.025 1.00 258.75 ? 201 ILE A CG2   1 
ATOM   1533 C  CD1   . ILE A 1 201 ? 54.272  -34.090 116.245 1.00 201.29 ? 201 ILE A CD1   1 
ATOM   1534 N  N     . ASP A 1 202 ? 58.262  -36.465 118.677 1.00 203.93 ? 202 ASP A N     1 
ATOM   1535 C  CA    . ASP A 1 202 ? 59.537  -36.931 119.237 1.00 215.60 ? 202 ASP A CA    1 
ATOM   1536 C  C     . ASP A 1 202 ? 59.812  -38.380 118.865 1.00 198.01 ? 202 ASP A C     1 
ATOM   1537 O  O     . ASP A 1 202 ? 60.939  -38.749 118.508 1.00 192.30 ? 202 ASP A O     1 
ATOM   1538 C  CB    . ASP A 1 202 ? 59.566  -36.792 120.768 1.00 244.50 ? 202 ASP A CB    1 
ATOM   1539 C  CG    . ASP A 1 202 ? 59.818  -35.362 121.228 1.00 253.36 ? 202 ASP A CG    1 
ATOM   1540 O  OD1   . ASP A 1 202 ? 60.203  -34.527 120.382 1.00 254.99 ? 202 ASP A OD1   1 
ATOM   1541 O  OD2   . ASP A 1 202 ? 59.646  -35.075 122.441 1.00 252.41 ? 202 ASP A OD2   1 
ATOM   1542 N  N     . LYS A 1 203 ? 58.774  -39.199 118.966 1.00 168.83 ? 203 LYS A N     1 
ATOM   1543 C  CA    . LYS A 1 203 ? 58.886  -40.619 118.700 1.00 168.57 ? 203 LYS A CA    1 
ATOM   1544 C  C     . LYS A 1 203 ? 58.956  -40.879 117.177 1.00 168.53 ? 203 LYS A C     1 
ATOM   1545 O  O     . LYS A 1 203 ? 59.765  -41.691 116.712 1.00 165.27 ? 203 LYS A O     1 
ATOM   1546 C  CB    . LYS A 1 203 ? 57.709  -41.357 119.347 1.00 169.76 ? 203 LYS A CB    1 
ATOM   1547 C  CG    . LYS A 1 203 ? 57.639  -42.834 119.021 1.00 169.40 ? 203 LYS A CG    1 
ATOM   1548 C  CD    . LYS A 1 203 ? 58.789  -43.581 119.665 1.00 172.55 ? 203 LYS A CD    1 
ATOM   1549 C  CE    . LYS A 1 203 ? 58.726  -45.051 119.284 1.00 189.78 ? 203 LYS A CE    1 
ATOM   1550 N  NZ    . LYS A 1 203 ? 59.676  -45.878 120.076 1.00 198.36 ? 203 LYS A NZ    1 
ATOM   1551 N  N     . LEU A 1 204 ? 58.119  -40.182 116.407 1.00 164.38 ? 204 LEU A N     1 
ATOM   1552 C  CA    . LEU A 1 204 ? 58.175  -40.279 114.951 1.00 167.53 ? 204 LEU A CA    1 
ATOM   1553 C  C     . LEU A 1 204 ? 59.574  -39.931 114.436 1.00 161.01 ? 204 LEU A C     1 
ATOM   1554 O  O     . LEU A 1 204 ? 60.060  -40.557 113.502 1.00 159.53 ? 204 LEU A O     1 
ATOM   1555 C  CB    . LEU A 1 204 ? 57.092  -39.420 114.280 1.00 200.15 ? 204 LEU A CB    1 
ATOM   1556 C  CG    . LEU A 1 204 ? 55.664  -39.871 114.629 1.00 240.06 ? 204 LEU A CG    1 
ATOM   1557 C  CD1   . LEU A 1 204 ? 54.619  -38.828 114.292 1.00 251.39 ? 204 LEU A CD1   1 
ATOM   1558 C  CD2   . LEU A 1 204 ? 55.340  -41.177 113.961 1.00 255.93 ? 204 LEU A CD2   1 
ATOM   1559 N  N     . MET A 1 205 ? 60.245  -38.977 115.075 1.00 162.06 ? 205 MET A N     1 
ATOM   1560 C  CA    . MET A 1 205 ? 61.566  -38.572 114.598 1.00 161.32 ? 205 MET A CA    1 
ATOM   1561 C  C     . MET A 1 205 ? 62.671  -39.594 114.869 1.00 162.06 ? 205 MET A C     1 
ATOM   1562 O  O     . MET A 1 205 ? 63.810  -39.409 114.453 1.00 164.34 ? 205 MET A O     1 
ATOM   1563 C  CB    . MET A 1 205 ? 61.946  -37.166 115.095 1.00 172.03 ? 205 MET A CB    1 
ATOM   1564 C  CG    . MET A 1 205 ? 61.076  -36.063 114.484 1.00 179.53 ? 205 MET A CG    1 
ATOM   1565 S  SD    . MET A 1 205 ? 61.437  -34.399 115.053 1.00 310.24 ? 205 MET A SD    1 
ATOM   1566 C  CE    . MET A 1 205 ? 63.197  -34.365 114.731 1.00 181.69 ? 205 MET A CE    1 
ATOM   1567 N  N     . GLU A 1 206 ? 62.342  -40.675 115.560 1.00 163.37 ? 206 GLU A N     1 
ATOM   1568 C  CA    . GLU A 1 206 ? 63.316  -41.742 115.741 1.00 170.06 ? 206 GLU A CA    1 
ATOM   1569 C  C     . GLU A 1 206 ? 63.365  -42.537 114.437 1.00 169.88 ? 206 GLU A C     1 
ATOM   1570 O  O     . GLU A 1 206 ? 64.302  -43.288 114.179 1.00 173.95 ? 206 GLU A O     1 
ATOM   1571 C  CB    . GLU A 1 206 ? 62.942  -42.636 116.926 1.00 198.96 ? 206 GLU A CB    1 
ATOM   1572 C  CG    . GLU A 1 206 ? 62.844  -41.898 118.271 1.00 234.72 ? 206 GLU A CG    1 
ATOM   1573 C  CD    . GLU A 1 206 ? 62.664  -42.841 119.476 1.00 260.41 ? 206 GLU A CD    1 
ATOM   1574 O  OE1   . GLU A 1 206 ? 62.140  -43.960 119.282 1.00 271.77 ? 206 GLU A OE1   1 
ATOM   1575 O  OE2   . GLU A 1 206 ? 63.045  -42.461 120.617 1.00 264.96 ? 206 GLU A OE2   1 
ATOM   1576 N  N     . PHE A 1 207 ? 62.349  -42.338 113.608 1.00 160.25 ? 207 PHE A N     1 
ATOM   1577 C  CA    . PHE A 1 207 ? 62.212  -43.061 112.351 1.00 159.29 ? 207 PHE A CA    1 
ATOM   1578 C  C     . PHE A 1 207 ? 62.472  -42.152 111.152 1.00 159.14 ? 207 PHE A C     1 
ATOM   1579 O  O     . PHE A 1 207 ? 63.055  -42.577 110.160 1.00 154.52 ? 207 PHE A O     1 
ATOM   1580 C  CB    . PHE A 1 207 ? 60.806  -43.638 112.242 1.00 165.29 ? 207 PHE A CB    1 
ATOM   1581 C  CG    . PHE A 1 207 ? 60.459  -44.609 113.338 1.00 188.29 ? 207 PHE A CG    1 
ATOM   1582 C  CD1   . PHE A 1 207 ? 59.642  -44.226 114.384 1.00 193.56 ? 207 PHE A CD1   1 
ATOM   1583 C  CD2   . PHE A 1 207 ? 60.940  -45.913 113.309 1.00 209.17 ? 207 PHE A CD2   1 
ATOM   1584 C  CE1   . PHE A 1 207 ? 59.316  -45.123 115.379 1.00 207.84 ? 207 PHE A CE1   1 
ATOM   1585 C  CE2   . PHE A 1 207 ? 60.616  -46.797 114.298 1.00 222.90 ? 207 PHE A CE2   1 
ATOM   1586 C  CZ    . PHE A 1 207 ? 59.799  -46.403 115.334 1.00 221.28 ? 207 PHE A CZ    1 
ATOM   1587 N  N     . LEU A 1 208 ? 62.040  -40.899 111.289 1.00 162.40 ? 208 LEU A N     1 
ATOM   1588 C  CA    . LEU A 1 208 ? 62.086  -39.876 110.265 1.00 183.58 ? 208 LEU A CA    1 
ATOM   1589 C  C     . LEU A 1 208 ? 62.814  -38.656 110.841 1.00 165.55 ? 208 LEU A C     1 
ATOM   1590 O  O     . LEU A 1 208 ? 62.181  -37.700 111.258 1.00 161.78 ? 208 LEU A O     1 
ATOM   1591 C  CB    . LEU A 1 208 ? 60.649  -39.479 109.912 1.00 228.63 ? 208 LEU A CB    1 
ATOM   1592 C  CG    . LEU A 1 208 ? 60.164  -39.069 108.504 1.00 257.96 ? 208 LEU A CG    1 
ATOM   1593 C  CD1   . LEU A 1 208 ? 59.276  -37.831 108.610 1.00 286.09 ? 208 LEU A CD1   1 
ATOM   1594 C  CD2   . LEU A 1 208 ? 61.288  -38.856 107.498 1.00 245.07 ? 208 LEU A CD2   1 
ATOM   1595 N  N     . PRO A 1 209 ? 64.153  -38.686 110.857 1.00 155.32 ? 209 PRO A N     1 
ATOM   1596 C  CA    . PRO A 1 209 ? 64.919  -37.634 111.533 1.00 156.45 ? 209 PRO A CA    1 
ATOM   1597 C  C     . PRO A 1 209 ? 64.889  -36.288 110.801 1.00 155.85 ? 209 PRO A C     1 
ATOM   1598 O  O     . PRO A 1 209 ? 65.197  -35.250 111.396 1.00 158.95 ? 209 PRO A O     1 
ATOM   1599 C  CB    . PRO A 1 209 ? 66.347  -38.182 111.542 1.00 156.79 ? 209 PRO A CB    1 
ATOM   1600 C  CG    . PRO A 1 209 ? 66.264  -39.591 111.009 1.00 156.07 ? 209 PRO A CG    1 
ATOM   1601 C  CD    . PRO A 1 209 ? 65.015  -39.700 110.233 1.00 154.56 ? 209 PRO A CD    1 
ATOM   1602 N  N     . GLY A 1 210 ? 64.529  -36.289 109.526 1.00 171.83 ? 210 GLY A N     1 
ATOM   1603 C  CA    . GLY A 1 210 ? 64.514  -35.043 108.783 1.00 184.20 ? 210 GLY A CA    1 
ATOM   1604 C  C     . GLY A 1 210 ? 64.623  -35.285 107.298 1.00 187.28 ? 210 GLY A C     1 
ATOM   1605 O  O     . GLY A 1 210 ? 64.773  -36.434 106.855 1.00 167.21 ? 210 GLY A O     1 
ATOM   1606 N  N     . PRO A 1 211 ? 64.565  -34.200 106.519 1.00 211.15 ? 211 PRO A N     1 
ATOM   1607 C  CA    . PRO A 1 211 ? 64.561  -34.252 105.060 1.00 203.47 ? 211 PRO A CA    1 
ATOM   1608 C  C     . PRO A 1 211 ? 65.777  -35.023 104.558 1.00 185.87 ? 211 PRO A C     1 
ATOM   1609 O  O     . PRO A 1 211 ? 66.750  -35.203 105.297 1.00 186.19 ? 211 PRO A O     1 
ATOM   1610 C  CB    . PRO A 1 211 ? 64.677  -32.775 104.664 1.00 222.00 ? 211 PRO A CB    1 
ATOM   1611 C  CG    . PRO A 1 211 ? 64.190  -32.014 105.859 1.00 238.22 ? 211 PRO A CG    1 
ATOM   1612 C  CD    . PRO A 1 211 ? 64.648  -32.821 107.024 1.00 235.50 ? 211 PRO A CD    1 
ATOM   1613 N  N     . ASP A 1 212 ? 65.707  -35.482 103.311 1.00 177.83 ? 212 ASP A N     1 
ATOM   1614 C  CA    . ASP A 1 212 ? 66.822  -36.167 102.673 1.00 182.84 ? 212 ASP A CA    1 
ATOM   1615 C  C     . ASP A 1 212 ? 66.916  -35.672 101.224 1.00 206.07 ? 212 ASP A C     1 
ATOM   1616 O  O     . ASP A 1 212 ? 66.261  -36.174 100.324 1.00 227.37 ? 212 ASP A O     1 
ATOM   1617 C  CB    . ASP A 1 212 ? 66.633  -37.681 102.755 1.00 170.46 ? 212 ASP A CB    1 
ATOM   1618 C  CG    . ASP A 1 212 ? 67.839  -38.448 102.252 1.00 142.14 ? 212 ASP A CG    1 
ATOM   1619 O  OD1   . ASP A 1 212 ? 68.964  -37.906 102.372 1.00 142.58 ? 212 ASP A OD1   1 
ATOM   1620 O  OD2   . ASP A 1 212 ? 67.660  -39.590 101.735 1.00 141.42 ? 212 ASP A OD2   1 
ATOM   1621 N  N     . PHE A 1 213 ? 67.709  -34.645 101.010 1.00 203.18 ? 213 PHE A N     1 
ATOM   1622 C  CA    . PHE A 1 213 ? 67.831  -34.068 99.685  1.00 203.76 ? 213 PHE A CA    1 
ATOM   1623 C  C     . PHE A 1 213 ? 68.581  -35.000 98.759  1.00 209.31 ? 213 PHE A C     1 
ATOM   1624 O  O     . PHE A 1 213 ? 69.553  -35.639 99.185  1.00 219.65 ? 213 PHE A O     1 
ATOM   1625 C  CB    . PHE A 1 213 ? 68.570  -32.754 99.776  1.00 206.32 ? 213 PHE A CB    1 
ATOM   1626 C  CG    . PHE A 1 213 ? 67.842  -31.712 100.552 1.00 220.83 ? 213 PHE A CG    1 
ATOM   1627 C  CD1   . PHE A 1 213 ? 66.599  -31.270 100.143 1.00 226.24 ? 213 PHE A CD1   1 
ATOM   1628 C  CD2   . PHE A 1 213 ? 68.403  -31.156 101.685 1.00 239.78 ? 213 PHE A CD2   1 
ATOM   1629 C  CE1   . PHE A 1 213 ? 65.922  -30.288 100.854 1.00 242.54 ? 213 PHE A CE1   1 
ATOM   1630 C  CE2   . PHE A 1 213 ? 67.733  -30.176 102.393 1.00 256.29 ? 213 PHE A CE2   1 
ATOM   1631 C  CZ    . PHE A 1 213 ? 66.494  -29.734 101.970 1.00 256.82 ? 213 PHE A CZ    1 
ATOM   1632 N  N     . PRO A 1 214 ? 68.113  -35.098 97.495  1.00 201.10 ? 214 PRO A N     1 
ATOM   1633 C  CA    . PRO A 1 214 ? 68.772  -35.825 96.400  1.00 195.96 ? 214 PRO A CA    1 
ATOM   1634 C  C     . PRO A 1 214 ? 70.173  -35.285 96.180  1.00 204.53 ? 214 PRO A C     1 
ATOM   1635 O  O     . PRO A 1 214 ? 71.098  -36.048 95.928  1.00 195.90 ? 214 PRO A O     1 
ATOM   1636 C  CB    . PRO A 1 214 ? 67.885  -35.516 95.177  1.00 183.29 ? 214 PRO A CB    1 
ATOM   1637 C  CG    . PRO A 1 214 ? 67.003  -34.373 95.591  1.00 183.81 ? 214 PRO A CG    1 
ATOM   1638 C  CD    . PRO A 1 214 ? 66.820  -34.534 97.072  1.00 193.62 ? 214 PRO A CD    1 
ATOM   1639 N  N     . THR A 1 215 ? 70.311  -33.971 96.322  1.00 219.78 ? 215 THR A N     1 
ATOM   1640 C  CA    . THR A 1 215 ? 71.602  -33.284 96.272  1.00 219.14 ? 215 THR A CA    1 
ATOM   1641 C  C     . THR A 1 215 ? 72.477  -33.423 97.531  1.00 207.60 ? 215 THR A C     1 
ATOM   1642 O  O     . THR A 1 215 ? 73.597  -32.926 97.570  1.00 205.65 ? 215 THR A O     1 
ATOM   1643 C  CB    . THR A 1 215 ? 71.412  -31.781 95.925  1.00 200.91 ? 215 THR A CB    1 
ATOM   1644 O  OG1   . THR A 1 215 ? 70.306  -31.251 96.662  1.00 189.82 ? 215 THR A OG1   1 
ATOM   1645 C  CG2   . THR A 1 215 ? 71.141  -31.606 94.418  1.00 208.52 ? 215 THR A CG2   1 
ATOM   1646 N  N     . GLY A 1 216 ? 71.960  -34.104 98.548  1.00 195.91 ? 216 GLY A N     1 
ATOM   1647 C  CA    . GLY A 1 216 ? 72.712  -34.406 99.761  1.00 186.36 ? 216 GLY A CA    1 
ATOM   1648 C  C     . GLY A 1 216 ? 72.991  -33.209 100.655 1.00 171.52 ? 216 GLY A C     1 
ATOM   1649 O  O     . GLY A 1 216 ? 72.079  -32.473 101.029 1.00 155.50 ? 216 GLY A O     1 
ATOM   1650 N  N     . ALA A 1 217 ? 74.263  -33.012 100.977 1.00 171.62 ? 217 ALA A N     1 
ATOM   1651 C  CA    . ALA A 1 217 ? 74.706  -31.912 101.826 1.00 30.24  ? 217 ALA A CA    1 
ATOM   1652 C  C     . ALA A 1 217 ? 74.462  -32.166 103.310 1.00 40.60  ? 217 ALA A C     1 
ATOM   1653 O  O     . ALA A 1 217 ? 74.181  -33.291 103.737 1.00 48.81  ? 217 ALA A O     1 
ATOM   1654 C  CB    . ALA A 1 217 ? 74.057  -30.629 101.414 1.00 24.64  ? 217 ALA A CB    1 
ATOM   1655 N  N     . ILE A 1 218 ? 74.566  -31.089 104.077 1.00 191.05 ? 218 ILE A N     1 
ATOM   1656 C  CA    . ILE A 1 218 ? 74.458  -31.118 105.527 1.00 193.05 ? 218 ILE A CA    1 
ATOM   1657 C  C     . ILE A 1 218 ? 73.271  -30.267 105.985 1.00 203.17 ? 218 ILE A C     1 
ATOM   1658 O  O     . ILE A 1 218 ? 73.172  -29.082 105.658 1.00 203.95 ? 218 ILE A O     1 
ATOM   1659 C  CB    . ILE A 1 218 ? 75.760  -30.579 106.166 1.00 177.61 ? 218 ILE A CB    1 
ATOM   1660 C  CG1   . ILE A 1 218 ? 76.955  -31.430 105.731 1.00 155.69 ? 218 ILE A CG1   1 
ATOM   1661 C  CG2   . ILE A 1 218 ? 75.651  -30.507 107.690 1.00 181.92 ? 218 ILE A CG2   1 
ATOM   1662 C  CD1   . ILE A 1 218 ? 78.268  -30.718 105.881 1.00 150.76 ? 218 ILE A CD1   1 
ATOM   1663 N  N     . ILE A 1 219 ? 72.359  -30.885 106.726 1.00 207.74 ? 219 ILE A N     1 
ATOM   1664 C  CA    . ILE A 1 219 ? 71.237  -30.164 107.295 1.00 218.04 ? 219 ILE A CA    1 
ATOM   1665 C  C     . ILE A 1 219 ? 71.457  -29.936 108.792 1.00 206.23 ? 219 ILE A C     1 
ATOM   1666 O  O     . ILE A 1 219 ? 71.641  -30.884 109.555 1.00 196.11 ? 219 ILE A O     1 
ATOM   1667 C  CB    . ILE A 1 219 ? 69.927  -30.913 107.087 1.00 241.39 ? 219 ILE A CB    1 
ATOM   1668 C  CG1   . ILE A 1 219 ? 69.774  -31.325 105.625 1.00 256.94 ? 219 ILE A CG1   1 
ATOM   1669 C  CG2   . ILE A 1 219 ? 68.755  -30.043 107.502 1.00 245.71 ? 219 ILE A CG2   1 
ATOM   1670 C  CD1   . ILE A 1 219 ? 68.440  -31.945 105.321 1.00 265.31 ? 219 ILE A CD1   1 
ATOM   1671 N  N     . GLN A 1 220 ? 71.456  -28.671 109.200 1.00 211.50 ? 220 GLN A N     1 
ATOM   1672 C  CA    . GLN A 1 220 ? 71.692  -28.303 110.591 1.00 221.48 ? 220 GLN A CA    1 
ATOM   1673 C  C     . GLN A 1 220 ? 70.433  -27.671 111.177 1.00 213.37 ? 220 GLN A C     1 
ATOM   1674 O  O     . GLN A 1 220 ? 69.910  -26.699 110.621 1.00 208.96 ? 220 GLN A O     1 
ATOM   1675 C  CB    . GLN A 1 220 ? 72.835  -27.294 110.691 1.00 239.68 ? 220 GLN A CB    1 
ATOM   1676 C  CG    . GLN A 1 220 ? 74.206  -27.776 110.270 1.00 246.29 ? 220 GLN A CG    1 
ATOM   1677 C  CD    . GLN A 1 220 ? 75.151  -26.609 109.992 1.00 253.64 ? 220 GLN A CD    1 
ATOM   1678 O  OE1   . GLN A 1 220 ? 74.760  -25.441 110.093 1.00 265.32 ? 220 GLN A OE1   1 
ATOM   1679 N  NE2   . GLN A 1 220 ? 76.393  -26.920 109.636 1.00 246.46 ? 220 GLN A NE2   1 
ATOM   1680 N  N     . GLY A 1 221 ? 69.943  -28.218 112.290 1.00 207.34 ? 221 GLY A N     1 
ATOM   1681 C  CA    . GLY A 1 221 ? 68.852  -27.588 113.013 1.00 196.03 ? 221 GLY A CA    1 
ATOM   1682 C  C     . GLY A 1 221 ? 67.800  -28.533 113.528 1.00 183.21 ? 221 GLY A C     1 
ATOM   1683 O  O     . GLY A 1 221 ? 66.639  -28.431 113.144 1.00 186.83 ? 221 GLY A O     1 
ATOM   1684 N  N     . ARG A 1 222 ? 68.205  -29.438 114.411 1.00 188.74 ? 222 ARG A N     1 
ATOM   1685 C  CA    . ARG A 1 222 ? 67.296  -30.420 114.996 1.00 188.60 ? 222 ARG A CA    1 
ATOM   1686 C  C     . ARG A 1 222 ? 65.978  -29.823 115.489 1.00 186.87 ? 222 ARG A C     1 
ATOM   1687 O  O     . ARG A 1 222 ? 64.918  -30.395 115.263 1.00 196.00 ? 222 ARG A O     1 
ATOM   1688 C  CB    . ARG A 1 222 ? 67.978  -31.164 116.147 1.00 194.49 ? 222 ARG A CB    1 
ATOM   1689 C  CG    . ARG A 1 222 ? 68.380  -32.604 115.840 1.00 201.21 ? 222 ARG A CG    1 
ATOM   1690 C  CD    . ARG A 1 222 ? 69.483  -32.672 114.777 1.00 213.09 ? 222 ARG A CD    1 
ATOM   1691 N  NE    . ARG A 1 222 ? 69.769  -34.043 114.340 1.00 218.65 ? 222 ARG A NE    1 
ATOM   1692 C  CZ    . ARG A 1 222 ? 70.839  -34.750 114.705 1.00 216.56 ? 222 ARG A CZ    1 
ATOM   1693 N  NH1   . ARG A 1 222 ? 71.748  -34.221 115.515 1.00 212.74 ? 222 ARG A NH1   1 
ATOM   1694 N  NH2   . ARG A 1 222 ? 71.002  -35.989 114.248 1.00 211.44 ? 222 ARG A NH2   1 
ATOM   1695 N  N     . ASP A 1 223 ? 66.034  -28.676 116.151 1.00 186.47 ? 223 ASP A N     1 
ATOM   1696 C  CA    . ASP A 1 223 ? 64.842  -28.111 116.794 1.00 206.84 ? 223 ASP A CA    1 
ATOM   1697 C  C     . ASP A 1 223 ? 63.875  -27.445 115.826 1.00 200.96 ? 223 ASP A C     1 
ATOM   1698 O  O     . ASP A 1 223 ? 62.661  -27.493 116.011 1.00 200.38 ? 223 ASP A O     1 
ATOM   1699 C  CB    . ASP A 1 223 ? 65.244  -27.115 117.875 1.00 227.80 ? 223 ASP A CB    1 
ATOM   1700 C  CG    . ASP A 1 223 ? 66.619  -27.398 118.428 1.00 250.73 ? 223 ASP A CG    1 
ATOM   1701 O  OD1   . ASP A 1 223 ? 67.603  -27.119 117.700 1.00 258.91 ? 223 ASP A OD1   1 
ATOM   1702 O  OD2   . ASP A 1 223 ? 66.714  -27.904 119.572 1.00 254.71 ? 223 ASP A OD2   1 
ATOM   1703 N  N     . GLU A 1 224 ? 64.423  -26.797 114.810 1.00 194.94 ? 224 GLU A N     1 
ATOM   1704 C  CA    . GLU A 1 224 ? 63.624  -26.257 113.724 1.00 187.19 ? 224 GLU A CA    1 
ATOM   1705 C  C     . GLU A 1 224 ? 63.022  -27.389 112.859 1.00 185.90 ? 224 GLU A C     1 
ATOM   1706 O  O     . GLU A 1 224 ? 61.874  -27.303 112.404 1.00 181.66 ? 224 GLU A O     1 
ATOM   1707 C  CB    . GLU A 1 224 ? 64.477  -25.304 112.901 1.00 187.54 ? 224 GLU A CB    1 
ATOM   1708 C  CG    . GLU A 1 224 ? 64.796  -24.005 113.629 1.00 192.99 ? 224 GLU A CG    1 
ATOM   1709 C  CD    . GLU A 1 224 ? 63.574  -23.098 113.762 1.00 208.69 ? 224 GLU A CD    1 
ATOM   1710 O  OE1   . GLU A 1 224 ? 62.740  -23.077 112.824 1.00 204.36 ? 224 GLU A OE1   1 
ATOM   1711 O  OE2   . GLU A 1 224 ? 63.450  -22.411 114.804 1.00 213.62 ? 224 GLU A OE2   1 
ATOM   1712 N  N     . ILE A 1 225 ? 63.774  -28.466 112.660 1.00 207.40 ? 225 ILE A N     1 
ATOM   1713 C  CA    . ILE A 1 225 ? 63.184  -29.641 112.038 1.00 230.89 ? 225 ILE A CA    1 
ATOM   1714 C  C     . ILE A 1 225 ? 61.954  -30.089 112.842 1.00 235.12 ? 225 ILE A C     1 
ATOM   1715 O  O     . ILE A 1 225 ? 60.872  -30.284 112.279 1.00 256.26 ? 225 ILE A O     1 
ATOM   1716 C  CB    . ILE A 1 225 ? 64.195  -30.789 111.907 1.00 246.19 ? 225 ILE A CB    1 
ATOM   1717 C  CG1   . ILE A 1 225 ? 65.350  -30.381 110.987 1.00 244.89 ? 225 ILE A CG1   1 
ATOM   1718 C  CG2   . ILE A 1 225 ? 63.502  -32.046 111.394 1.00 258.15 ? 225 ILE A CG2   1 
ATOM   1719 C  CD1   . ILE A 1 225 ? 66.300  -31.518 110.652 1.00 242.73 ? 225 ILE A CD1   1 
ATOM   1720 N  N     . LYS A 1 226 ? 62.121  -30.227 114.161 1.00 210.23 ? 226 LYS A N     1 
ATOM   1721 C  CA    . LYS A 1 226 ? 61.017  -30.595 115.055 1.00 189.82 ? 226 LYS A CA    1 
ATOM   1722 C  C     . LYS A 1 226 ? 59.883  -29.579 114.945 1.00 184.06 ? 226 LYS A C     1 
ATOM   1723 O  O     . LYS A 1 226 ? 58.704  -29.956 114.895 1.00 183.79 ? 226 LYS A O     1 
ATOM   1724 C  CB    . LYS A 1 226 ? 61.497  -30.715 116.510 1.00 188.11 ? 226 LYS A CB    1 
ATOM   1725 C  CG    . LYS A 1 226 ? 60.429  -31.118 117.555 1.00 190.02 ? 226 LYS A CG    1 
ATOM   1726 N  N     . LYS A 1 227 ? 60.241  -28.295 114.902 1.00 184.35 ? 227 LYS A N     1 
ATOM   1727 C  CA    . LYS A 1 227 ? 59.242  -27.231 114.891 1.00 188.03 ? 227 LYS A CA    1 
ATOM   1728 C  C     . LYS A 1 227 ? 58.424  -27.408 113.626 1.00 187.05 ? 227 LYS A C     1 
ATOM   1729 O  O     . LYS A 1 227 ? 57.188  -27.373 113.670 1.00 191.76 ? 227 LYS A O     1 
ATOM   1730 C  CB    . LYS A 1 227 ? 59.878  -25.827 114.993 1.00 190.10 ? 227 LYS A CB    1 
ATOM   1731 C  CG    . LYS A 1 227 ? 58.873  -24.650 114.926 1.00 196.26 ? 227 LYS A CG    1 
ATOM   1732 C  CD    . LYS A 1 227 ? 59.538  -23.258 115.148 1.00 196.29 ? 227 LYS A CD    1 
ATOM   1733 N  N     . ALA A 1 228 ? 59.118  -27.657 112.517 1.00 183.81 ? 228 ALA A N     1 
ATOM   1734 C  CA    . ALA A 1 228 ? 58.451  -27.831 111.226 1.00 221.66 ? 228 ALA A CA    1 
ATOM   1735 C  C     . ALA A 1 228 ? 57.590  -29.090 111.199 1.00 228.80 ? 228 ALA A C     1 
ATOM   1736 O  O     . ALA A 1 228 ? 56.490  -29.079 110.650 1.00 215.97 ? 228 ALA A O     1 
ATOM   1737 C  CB    . ALA A 1 228 ? 59.464  -27.828 110.068 1.00 224.59 ? 228 ALA A CB    1 
ATOM   1738 N  N     . TYR A 1 229 ? 58.066  -30.173 111.803 1.00 254.00 ? 229 TYR A N     1 
ATOM   1739 C  CA    . TYR A 1 229 ? 57.243  -31.372 111.834 1.00 264.73 ? 229 TYR A CA    1 
ATOM   1740 C  C     . TYR A 1 229 ? 55.965  -31.194 112.673 1.00 227.99 ? 229 TYR A C     1 
ATOM   1741 O  O     . TYR A 1 229 ? 54.993  -31.938 112.503 1.00 219.75 ? 229 TYR A O     1 
ATOM   1742 C  CB    . TYR A 1 229 ? 58.045  -32.585 112.293 1.00 295.40 ? 229 TYR A CB    1 
ATOM   1743 C  CG    . TYR A 1 229 ? 59.015  -33.088 111.259 1.00 302.59 ? 229 TYR A CG    1 
ATOM   1744 C  CD1   . TYR A 1 229 ? 58.960  -32.631 109.946 1.00 306.01 ? 229 TYR A CD1   1 
ATOM   1745 C  CD2   . TYR A 1 229 ? 59.993  -34.014 111.592 1.00 292.97 ? 229 TYR A CD2   1 
ATOM   1746 C  CE1   . TYR A 1 229 ? 59.851  -33.083 109.001 1.00 294.96 ? 229 TYR A CE1   1 
ATOM   1747 C  CE2   . TYR A 1 229 ? 60.890  -34.476 110.645 1.00 281.48 ? 229 TYR A CE2   1 
ATOM   1748 C  CZ    . TYR A 1 229 ? 60.815  -34.003 109.354 1.00 277.24 ? 229 TYR A CZ    1 
ATOM   1749 O  OH    . TYR A 1 229 ? 61.708  -34.451 108.410 1.00 258.88 ? 229 TYR A OH    1 
ATOM   1750 N  N     . GLU A 1 230 ? 55.963  -30.202 113.561 1.00 200.94 ? 230 GLU A N     1 
ATOM   1751 C  CA    . GLU A 1 230 ? 54.805  -29.962 114.410 1.00 200.16 ? 230 GLU A CA    1 
ATOM   1752 C  C     . GLU A 1 230 ? 53.829  -28.982 113.795 1.00 202.71 ? 230 GLU A C     1 
ATOM   1753 O  O     . GLU A 1 230 ? 52.617  -29.131 113.944 1.00 210.73 ? 230 GLU A O     1 
ATOM   1754 C  CB    . GLU A 1 230 ? 55.233  -29.399 115.763 1.00 208.60 ? 230 GLU A CB    1 
ATOM   1755 C  CG    . GLU A 1 230 ? 55.710  -30.415 116.751 1.00 236.10 ? 230 GLU A CG    1 
ATOM   1756 C  CD    . GLU A 1 230 ? 56.409  -29.763 117.924 1.00 271.49 ? 230 GLU A CD    1 
ATOM   1757 O  OE1   . GLU A 1 230 ? 56.858  -28.591 117.785 1.00 287.45 ? 230 GLU A OE1   1 
ATOM   1758 O  OE2   . GLU A 1 230 ? 56.503  -30.423 118.985 1.00 280.72 ? 230 GLU A OE2   1 
ATOM   1759 N  N     . THR A 1 231 ? 54.362  -27.969 113.126 1.00 192.66 ? 231 THR A N     1 
ATOM   1760 C  CA    . THR A 1 231 ? 53.562  -26.823 112.714 1.00 197.64 ? 231 THR A CA    1 
ATOM   1761 C  C     . THR A 1 231 ? 53.539  -26.632 111.213 1.00 199.57 ? 231 THR A C     1 
ATOM   1762 O  O     . THR A 1 231 ? 52.706  -25.897 110.690 1.00 202.97 ? 231 THR A O     1 
ATOM   1763 C  CB    . THR A 1 231 ? 54.132  -25.531 113.316 1.00 198.48 ? 231 THR A CB    1 
ATOM   1764 O  OG1   . THR A 1 231 ? 55.406  -25.256 112.722 1.00 210.30 ? 231 THR A OG1   1 
ATOM   1765 C  CG2   . THR A 1 231 ? 54.323  -25.705 114.772 1.00 198.73 ? 231 THR A CG2   1 
ATOM   1766 N  N     . GLY A 1 232 ? 54.483  -27.268 110.530 1.00 199.62 ? 232 GLY A N     1 
ATOM   1767 C  CA    . GLY A 1 232 ? 54.615  -27.111 109.099 1.00 206.26 ? 232 GLY A CA    1 
ATOM   1768 C  C     . GLY A 1 232 ? 55.484  -25.936 108.695 1.00 208.47 ? 232 GLY A C     1 
ATOM   1769 O  O     . GLY A 1 232 ? 55.719  -25.734 107.512 1.00 199.99 ? 232 GLY A O     1 
ATOM   1770 N  N     . LYS A 1 233 ? 55.937  -25.137 109.659 1.00 216.71 ? 233 LYS A N     1 
ATOM   1771 C  CA    . LYS A 1 233 ? 56.865  -24.052 109.345 1.00 218.06 ? 233 LYS A CA    1 
ATOM   1772 C  C     . LYS A 1 233 ? 58.155  -24.236 110.119 1.00 195.64 ? 233 LYS A C     1 
ATOM   1773 O  O     . LYS A 1 233 ? 58.146  -24.763 111.241 1.00 202.90 ? 233 LYS A O     1 
ATOM   1774 C  CB    . LYS A 1 233 ? 56.260  -22.693 109.659 1.00 242.26 ? 233 LYS A CB    1 
ATOM   1775 C  CG    . LYS A 1 233 ? 55.189  -22.205 108.686 1.00 242.05 ? 233 LYS A CG    1 
ATOM   1776 C  CD    . LYS A 1 233 ? 55.239  -20.666 108.544 1.00 226.50 ? 233 LYS A CD    1 
ATOM   1777 C  CE    . LYS A 1 233 ? 53.982  -20.083 107.923 1.00 217.48 ? 233 LYS A CE    1 
ATOM   1778 N  NZ    . LYS A 1 233 ? 54.162  -19.640 106.499 1.00 226.91 ? 233 LYS A NZ    1 
ATOM   1779 N  N     . GLY A 1 234 ? 59.263  -23.810 109.521 1.00 187.30 ? 234 GLY A N     1 
ATOM   1780 C  CA    . GLY A 1 234 ? 60.573  -23.928 110.147 1.00 187.50 ? 234 GLY A CA    1 
ATOM   1781 C  C     . GLY A 1 234 ? 61.726  -23.565 109.228 1.00 191.45 ? 234 GLY A C     1 
ATOM   1782 O  O     . GLY A 1 234 ? 61.676  -23.830 108.035 1.00 189.55 ? 234 GLY A O     1 
ATOM   1783 N  N     . ARG A 1 235 ? 62.770  -22.956 109.788 1.00 193.90 ? 235 ARG A N     1 
ATOM   1784 C  CA    . ARG A 1 235 ? 63.942  -22.536 109.020 1.00 188.77 ? 235 ARG A CA    1 
ATOM   1785 C  C     . ARG A 1 235 ? 65.095  -23.428 109.447 1.00 182.22 ? 235 ARG A C     1 
ATOM   1786 O  O     . ARG A 1 235 ? 65.406  -23.506 110.619 1.00 183.69 ? 235 ARG A O     1 
ATOM   1787 C  CB    . ARG A 1 235 ? 64.252  -21.048 109.293 1.00 193.48 ? 235 ARG A CB    1 
ATOM   1788 C  CG    . ARG A 1 235 ? 65.458  -20.422 108.565 1.00 185.93 ? 235 ARG A CG    1 
ATOM   1789 N  N     . VAL A 1 236 ? 65.703  -24.123 108.498 1.00 176.24 ? 236 VAL A N     1 
ATOM   1790 C  CA    . VAL A 1 236 ? 66.806  -25.032 108.781 1.00 174.24 ? 236 VAL A CA    1 
ATOM   1791 C  C     . VAL A 1 236 ? 68.008  -24.540 107.952 1.00 180.38 ? 236 VAL A C     1 
ATOM   1792 O  O     . VAL A 1 236 ? 67.819  -23.798 106.991 1.00 188.58 ? 236 VAL A O     1 
ATOM   1793 C  CB    . VAL A 1 236 ? 66.396  -26.484 108.388 1.00 223.42 ? 236 VAL A CB    1 
ATOM   1794 C  CG1   . VAL A 1 236 ? 67.090  -26.928 107.121 1.00 229.07 ? 236 VAL A CG1   1 
ATOM   1795 C  CG2   . VAL A 1 236 ? 66.641  -27.472 109.519 1.00 213.53 ? 236 VAL A CG2   1 
ATOM   1796 N  N     . VAL A 1 237 ? 69.237  -24.906 108.313 1.00 170.94 ? 237 VAL A N     1 
ATOM   1797 C  CA    . VAL A 1 237 ? 70.377  -24.546 107.462 1.00 167.65 ? 237 VAL A CA    1 
ATOM   1798 C  C     . VAL A 1 237 ? 70.842  -25.702 106.590 1.00 167.02 ? 237 VAL A C     1 
ATOM   1799 O  O     . VAL A 1 237 ? 70.908  -26.844 107.039 1.00 172.69 ? 237 VAL A O     1 
ATOM   1800 C  CB    . VAL A 1 237 ? 71.579  -24.008 108.267 1.00 171.06 ? 237 VAL A CB    1 
ATOM   1801 C  CG1   . VAL A 1 237 ? 72.802  -23.846 107.358 1.00 169.56 ? 237 VAL A CG1   1 
ATOM   1802 C  CG2   . VAL A 1 237 ? 71.225  -22.684 108.898 1.00 180.69 ? 237 VAL A CG2   1 
ATOM   1803 N  N     . VAL A 1 238 ? 71.155  -25.412 105.333 1.00 177.60 ? 238 VAL A N     1 
ATOM   1804 C  CA    . VAL A 1 238 ? 71.648  -26.453 104.437 1.00 208.13 ? 238 VAL A CA    1 
ATOM   1805 C  C     . VAL A 1 238 ? 73.019  -26.069 103.910 1.00 186.28 ? 238 VAL A C     1 
ATOM   1806 O  O     . VAL A 1 238 ? 73.186  -24.997 103.322 1.00 168.63 ? 238 VAL A O     1 
ATOM   1807 C  CB    . VAL A 1 238 ? 70.695  -26.688 103.259 1.00 263.52 ? 238 VAL A CB    1 
ATOM   1808 C  CG1   . VAL A 1 238 ? 71.210  -27.832 102.396 1.00 271.91 ? 238 VAL A CG1   1 
ATOM   1809 C  CG2   . VAL A 1 238 ? 69.292  -26.976 103.764 1.00 292.51 ? 238 VAL A CG2   1 
ATOM   1810 N  N     . ARG A 1 239 ? 74.006  -26.934 104.127 1.00 187.08 ? 239 ARG A N     1 
ATOM   1811 C  CA    . ARG A 1 239 ? 75.395  -26.554 103.883 1.00 188.50 ? 239 ARG A CA    1 
ATOM   1812 C  C     . ARG A 1 239 ? 76.192  -27.568 103.067 1.00 159.76 ? 239 ARG A C     1 
ATOM   1813 O  O     . ARG A 1 239 ? 76.080  -28.777 103.261 1.00 145.16 ? 239 ARG A O     1 
ATOM   1814 C  CB    . ARG A 1 239 ? 76.121  -26.296 105.204 1.00 220.18 ? 239 ARG A CB    1 
ATOM   1815 C  CG    . ARG A 1 239 ? 77.627  -26.196 105.027 1.00 242.73 ? 239 ARG A CG    1 
ATOM   1816 C  CD    . ARG A 1 239 ? 78.353  -26.131 106.344 1.00 263.08 ? 239 ARG A CD    1 
ATOM   1817 N  NE    . ARG A 1 239 ? 78.134  -24.870 107.046 1.00 286.58 ? 239 ARG A NE    1 
ATOM   1818 C  CZ    . ARG A 1 239 ? 78.838  -24.490 108.107 1.00 306.92 ? 239 ARG A CZ    1 
ATOM   1819 N  NH1   . ARG A 1 239 ? 79.800  -25.279 108.563 1.00 307.93 ? 239 ARG A NH1   1 
ATOM   1820 N  NH2   . ARG A 1 239 ? 78.591  -23.330 108.708 1.00 321.25 ? 239 ARG A NH2   1 
ATOM   1821 N  N     . SER A 1 240 ? 77.022  -27.060 102.171 1.00 146.77 ? 240 SER A N     1 
ATOM   1822 C  CA    . SER A 1 240 ? 77.760  -27.913 101.263 1.00 142.66 ? 240 SER A CA    1 
ATOM   1823 C  C     . SER A 1 240 ? 78.700  -28.849 102.023 1.00 140.57 ? 240 SER A C     1 
ATOM   1824 O  O     . SER A 1 240 ? 79.269  -28.454 103.031 1.00 142.47 ? 240 SER A O     1 
ATOM   1825 C  CB    . SER A 1 240 ? 78.531  -27.058 100.240 1.00 143.13 ? 240 SER A CB    1 
ATOM   1826 O  OG    . SER A 1 240 ? 77.645  -26.259 99.464  1.00 144.26 ? 240 SER A OG    1 
ATOM   1827 N  N     . LYS A 1 241 ? 78.832  -30.091 101.549 1.00 136.79 ? 241 LYS A N     1 
ATOM   1828 C  CA    . LYS A 1 241 ? 79.879  -30.997 102.006 1.00 134.26 ? 241 LYS A CA    1 
ATOM   1829 C  C     . LYS A 1 241 ? 81.218  -30.504 101.465 1.00 138.93 ? 241 LYS A C     1 
ATOM   1830 O  O     . LYS A 1 241 ? 81.374  -30.302 100.263 1.00 149.75 ? 241 LYS A O     1 
ATOM   1831 C  CB    . LYS A 1 241 ? 79.632  -32.455 101.568 1.00 130.55 ? 241 LYS A CB    1 
ATOM   1832 C  CG    . LYS A 1 241 ? 80.688  -33.457 102.135 1.00 137.11 ? 241 LYS A CG    1 
ATOM   1833 C  CD    . LYS A 1 241 ? 80.454  -34.942 101.805 1.00 133.87 ? 241 LYS A CD    1 
ATOM   1834 N  N     . THR A 1 242 ? 82.181  -30.314 102.359 1.00 144.60 ? 242 THR A N     1 
ATOM   1835 C  CA    . THR A 1 242 ? 83.473  -29.732 102.006 1.00 154.83 ? 242 THR A CA    1 
ATOM   1836 C  C     . THR A 1 242 ? 84.657  -30.498 102.610 1.00 155.65 ? 242 THR A C     1 
ATOM   1837 O  O     . THR A 1 242 ? 84.626  -30.923 103.760 1.00 166.54 ? 242 THR A O     1 
ATOM   1838 C  CB    . THR A 1 242 ? 83.558  -28.218 102.405 1.00 162.46 ? 242 THR A CB    1 
ATOM   1839 O  OG1   . THR A 1 242 ? 83.128  -28.026 103.766 1.00 163.37 ? 242 THR A OG1   1 
ATOM   1840 C  CG2   . THR A 1 242 ? 82.686  -27.372 101.488 1.00 160.35 ? 242 THR A CG2   1 
ATOM   1841 N  N     . GLU A 1 243 ? 85.694  -30.683 101.810 1.00 149.39 ? 243 GLU A N     1 
ATOM   1842 C  CA    . GLU A 1 243 ? 86.932  -31.263 102.286 1.00 152.95 ? 243 GLU A CA    1 
ATOM   1843 C  C     . GLU A 1 243 ? 87.994  -30.220 101.996 1.00 151.77 ? 243 GLU A C     1 
ATOM   1844 O  O     . GLU A 1 243 ? 87.748  -29.289 101.232 1.00 153.18 ? 243 GLU A O     1 
ATOM   1845 C  CB    . GLU A 1 243 ? 87.242  -32.568 101.548 1.00 157.89 ? 243 GLU A CB    1 
ATOM   1846 N  N     . ILE A 1 244 ? 89.161  -30.348 102.620 1.00 163.37 ? 244 ILE A N     1 
ATOM   1847 C  CA    . ILE A 1 244 ? 90.286  -29.487 102.282 1.00 187.58 ? 244 ILE A CA    1 
ATOM   1848 C  C     . ILE A 1 244 ? 91.412  -30.364 101.749 1.00 183.07 ? 244 ILE A C     1 
ATOM   1849 O  O     . ILE A 1 244 ? 91.574  -31.494 102.198 1.00 176.15 ? 244 ILE A O     1 
ATOM   1850 C  CB    . ILE A 1 244 ? 90.763  -28.647 103.482 1.00 213.38 ? 244 ILE A CB    1 
ATOM   1851 C  CG1   . ILE A 1 244 ? 89.589  -27.909 104.125 1.00 203.41 ? 244 ILE A CG1   1 
ATOM   1852 C  CG2   . ILE A 1 244 ? 91.807  -27.639 103.043 1.00 237.95 ? 244 ILE A CG2   1 
ATOM   1853 C  CD1   . ILE A 1 244 ? 88.641  -28.823 104.892 1.00 186.04 ? 244 ILE A CD1   1 
ATOM   1854 N  N     . GLU A 1 245 ? 92.164  -29.863 100.773 1.00 186.06 ? 245 GLU A N     1 
ATOM   1855 C  CA    . GLU A 1 245 ? 93.268  -30.626 100.191 1.00 184.20 ? 245 GLU A CA    1 
ATOM   1856 C  C     . GLU A 1 245 ? 94.557  -29.815 100.191 1.00 174.97 ? 245 GLU A C     1 
ATOM   1857 O  O     . GLU A 1 245 ? 94.602  -28.708 99.649  1.00 174.59 ? 245 GLU A O     1 
ATOM   1858 C  CB    . GLU A 1 245 ? 92.941  -31.061 98.759  1.00 191.11 ? 245 GLU A CB    1 
ATOM   1859 C  CG    . GLU A 1 245 ? 91.775  -32.023 98.638  1.00 195.33 ? 245 GLU A CG    1 
ATOM   1860 C  CD    . GLU A 1 245 ? 91.461  -32.376 97.191  1.00 198.22 ? 245 GLU A CD    1 
ATOM   1861 O  OE1   . GLU A 1 245 ? 91.976  -31.690 96.281  1.00 202.38 ? 245 GLU A OE1   1 
ATOM   1862 O  OE2   . GLU A 1 245 ? 90.697  -33.342 96.964  1.00 195.93 ? 245 GLU A OE2   1 
ATOM   1863 N  N     . LYS A 1 246 ? 95.610  -30.375 100.779 1.00 165.80 ? 246 LYS A N     1 
ATOM   1864 C  CA    . LYS A 1 246 ? 96.873  -29.651 100.920 1.00 166.33 ? 246 LYS A CA    1 
ATOM   1865 C  C     . LYS A 1 246 ? 97.708  -29.737 99.649  1.00 174.85 ? 246 LYS A C     1 
ATOM   1866 O  O     . LYS A 1 246 ? 98.498  -30.659 99.487  1.00 183.20 ? 246 LYS A O     1 
ATOM   1867 C  CB    . LYS A 1 246 ? 97.667  -30.167 102.130 1.00 165.79 ? 246 LYS A CB    1 
ATOM   1868 C  CG    . LYS A 1 246 ? 96.991  -29.904 103.482 1.00 173.38 ? 246 LYS A CG    1 
ATOM   1869 C  CD    . LYS A 1 246 ? 97.605  -30.734 104.597 1.00 177.11 ? 246 LYS A CD    1 
ATOM   1870 N  N     . LEU A 1 247 ? 97.518  -28.779 98.746  1.00 175.53 ? 247 LEU A N     1 
ATOM   1871 C  CA    . LEU A 1 247 ? 98.321  -28.686 97.530  1.00 172.57 ? 247 LEU A CA    1 
ATOM   1872 C  C     . LEU A 1 247 ? 99.807  -28.484 97.869  1.00 185.05 ? 247 LEU A C     1 
ATOM   1873 O  O     . LEU A 1 247 ? 100.151 -28.096 98.993  1.00 184.83 ? 247 LEU A O     1 
ATOM   1874 C  CB    . LEU A 1 247 ? 97.823  -27.526 96.661  1.00 167.01 ? 247 LEU A CB    1 
ATOM   1875 C  CG    . LEU A 1 247 ? 96.367  -27.548 96.188  1.00 170.95 ? 247 LEU A CG    1 
ATOM   1876 N  N     . LYS A 1 248 ? 100.686 -28.739 96.901  1.00 190.79 ? 248 LYS A N     1 
ATOM   1877 C  CA    . LYS A 1 248 ? 102.124 -28.545 97.105  1.00 194.54 ? 248 LYS A CA    1 
ATOM   1878 C  C     . LYS A 1 248 ? 102.461 -27.070 97.337  1.00 197.37 ? 248 LYS A C     1 
ATOM   1879 O  O     . LYS A 1 248 ? 101.663 -26.187 97.023  1.00 197.55 ? 248 LYS A O     1 
ATOM   1880 C  CB    . LYS A 1 248 ? 102.923 -29.085 95.915  1.00 190.97 ? 248 LYS A CB    1 
ATOM   1881 N  N     . GLY A 1 249 ? 103.635 -26.809 97.901  1.00 208.96 ? 249 GLY A N     1 
ATOM   1882 C  CA    . GLY A 1 249 ? 104.097 -25.444 98.094  1.00 229.75 ? 249 GLY A CA    1 
ATOM   1883 C  C     . GLY A 1 249 ? 103.346 -24.612 99.124  1.00 240.57 ? 249 GLY A C     1 
ATOM   1884 O  O     . GLY A 1 249 ? 103.299 -23.383 99.014  1.00 261.49 ? 249 GLY A O     1 
ATOM   1885 N  N     . GLY A 1 250 ? 102.752 -25.275 100.116 1.00 220.32 ? 250 GLY A N     1 
ATOM   1886 C  CA    . GLY A 1 250 ? 102.139 -24.590 101.249 1.00 210.70 ? 250 GLY A CA    1 
ATOM   1887 C  C     . GLY A 1 250 ? 100.754 -23.992 101.029 1.00 204.30 ? 250 GLY A C     1 
ATOM   1888 O  O     . GLY A 1 250 ? 100.218 -23.302 101.907 1.00 204.70 ? 250 GLY A O     1 
ATOM   1889 N  N     . LYS A 1 251 ? 100.177 -24.252 99.858  1.00 197.50 ? 251 LYS A N     1 
ATOM   1890 C  CA    . LYS A 1 251 ? 98.849  -23.759 99.521  1.00 208.84 ? 251 LYS A CA    1 
ATOM   1891 C  C     . LYS A 1 251 ? 97.794  -24.801 99.904  1.00 243.74 ? 251 LYS A C     1 
ATOM   1892 O  O     . LYS A 1 251 ? 98.066  -26.002 99.915  1.00 240.80 ? 251 LYS A O     1 
ATOM   1893 C  CB    . LYS A 1 251 ? 98.759  -23.463 98.015  1.00 195.12 ? 251 LYS A CB    1 
ATOM   1894 C  CG    . LYS A 1 251 ? 99.835  -22.525 97.460  1.00 191.72 ? 251 LYS A CG    1 
ATOM   1895 C  CD    . LYS A 1 251 ? 99.711  -22.375 95.941  1.00 181.17 ? 251 LYS A CD    1 
ATOM   1896 N  N     . GLU A 1 252 ? 96.588  -24.345 100.229 1.00 274.92 ? 252 GLU A N     1 
ATOM   1897 C  CA    . GLU A 1 252 ? 95.479  -25.267 100.450 1.00 169.69 ? 252 GLU A CA    1 
ATOM   1898 C  C     . GLU A 1 252 ? 94.396  -25.111 99.376  1.00 155.79 ? 252 GLU A C     1 
ATOM   1899 O  O     . GLU A 1 252 ? 94.459  -24.218 98.528  1.00 143.70 ? 252 GLU A O     1 
ATOM   1900 C  CB    . GLU A 1 252 ? 94.899  -25.119 101.864 1.00 177.86 ? 252 GLU A CB    1 
ATOM   1901 C  CG    . GLU A 1 252 ? 95.749  -25.790 102.949 1.00 182.46 ? 252 GLU A CG    1 
ATOM   1902 C  CD    . GLU A 1 252 ? 95.039  -25.918 104.303 1.00 181.48 ? 252 GLU A CD    1 
ATOM   1903 O  OE1   . GLU A 1 252 ? 94.209  -25.047 104.650 1.00 178.67 ? 252 GLU A OE1   1 
ATOM   1904 O  OE2   . GLU A 1 252 ? 95.318  -26.900 105.025 1.00 180.65 ? 252 GLU A OE2   1 
ATOM   1905 N  N     . GLN A 1 253 ? 93.405  -25.993 99.417  1.00 241.23 ? 253 GLN A N     1 
ATOM   1906 C  CA    . GLN A 1 253 ? 92.343  -25.996 98.422  1.00 214.43 ? 253 GLN A CA    1 
ATOM   1907 C  C     . GLN A 1 253 ? 91.065  -26.569 99.021  1.00 177.80 ? 253 GLN A C     1 
ATOM   1908 O  O     . GLN A 1 253 ? 91.069  -27.681 99.560  1.00 160.21 ? 253 GLN A O     1 
ATOM   1909 C  CB    . GLN A 1 253 ? 92.793  -26.815 97.223  1.00 208.12 ? 253 GLN A CB    1 
ATOM   1910 C  CG    . GLN A 1 253 ? 91.693  -27.344 96.373  1.00 186.36 ? 253 GLN A CG    1 
ATOM   1911 C  CD    . GLN A 1 253 ? 92.191  -27.768 95.021  1.00 161.80 ? 253 GLN A CD    1 
ATOM   1912 O  OE1   . GLN A 1 253 ? 92.948  -27.045 94.377  1.00 147.16 ? 253 GLN A OE1   1 
ATOM   1913 N  NE2   . GLN A 1 253 ? 91.772  -28.949 94.574  1.00 157.23 ? 253 GLN A NE2   1 
ATOM   1914 N  N     . ILE A 1 254 ? 89.981  -25.799 98.954  1.00 163.83 ? 254 ILE A N     1 
ATOM   1915 C  CA    . ILE A 1 254 ? 88.677  -26.244 99.456  1.00 158.92 ? 254 ILE A CA    1 
ATOM   1916 C  C     . ILE A 1 254 ? 87.920  -26.980 98.361  1.00 151.93 ? 254 ILE A C     1 
ATOM   1917 O  O     . ILE A 1 254 ? 87.685  -26.423 97.292  1.00 145.87 ? 254 ILE A O     1 
ATOM   1918 C  CB    . ILE A 1 254 ? 87.796  -25.061 99.858  1.00 167.87 ? 254 ILE A CB    1 
ATOM   1919 C  CG1   . ILE A 1 254 ? 88.484  -24.198 100.903 1.00 172.48 ? 254 ILE A CG1   1 
ATOM   1920 C  CG2   . ILE A 1 254 ? 86.445  -25.542 100.377 1.00 170.90 ? 254 ILE A CG2   1 
ATOM   1921 C  CD1   . ILE A 1 254 ? 87.811  -22.853 101.052 1.00 175.57 ? 254 ILE A CD1   1 
ATOM   1922 N  N     . VAL A 1 255 ? 87.526  -28.220 98.622  1.00 153.61 ? 255 VAL A N     1 
ATOM   1923 C  CA    . VAL A 1 255 ? 86.795  -28.978 97.618  1.00 146.96 ? 255 VAL A CA    1 
ATOM   1924 C  C     . VAL A 1 255 ? 85.367  -29.282 98.024  1.00 134.00 ? 255 VAL A C     1 
ATOM   1925 O  O     . VAL A 1 255 ? 85.125  -30.042 98.949  1.00 124.16 ? 255 VAL A O     1 
ATOM   1926 C  CB    . VAL A 1 255 ? 87.487  -30.295 97.275  1.00 146.54 ? 255 VAL A CB    1 
ATOM   1927 C  CG1   . VAL A 1 255 ? 86.729  -30.994 96.148  1.00 141.08 ? 255 VAL A CG1   1 
ATOM   1928 C  CG2   . VAL A 1 255 ? 88.943  -30.046 96.889  1.00 148.51 ? 255 VAL A CG2   1 
ATOM   1929 N  N     . ILE A 1 256 ? 84.428  -28.689 97.299  1.00 130.34 ? 256 ILE A N     1 
ATOM   1930 C  CA    . ILE A 1 256 ? 83.005  -28.904 97.507  1.00 116.22 ? 256 ILE A CA    1 
ATOM   1931 C  C     . ILE A 1 256 ? 82.532  -30.116 96.706  1.00 105.95 ? 256 ILE A C     1 
ATOM   1932 O  O     . ILE A 1 256 ? 82.965  -30.306 95.581  1.00 105.39 ? 256 ILE A O     1 
ATOM   1933 C  CB    . ILE A 1 256 ? 82.244  -27.661 97.051  1.00 112.37 ? 256 ILE A CB    1 
ATOM   1934 C  CG1   . ILE A 1 256 ? 82.679  -26.460 97.897  1.00 118.94 ? 256 ILE A CG1   1 
ATOM   1935 C  CG2   . ILE A 1 256 ? 80.752  -27.895 97.125  1.00 116.20 ? 256 ILE A CG2   1 
ATOM   1936 C  CD1   . ILE A 1 256 ? 82.310  -25.124 97.308  1.00 124.33 ? 256 ILE A CD1   1 
ATOM   1937 N  N     . THR A 1 257 ? 81.654  -30.937 97.276  1.00 105.36 ? 257 THR A N     1 
ATOM   1938 C  CA    . THR A 1 257 ? 81.205  -32.146 96.578  1.00 105.20 ? 257 THR A CA    1 
ATOM   1939 C  C     . THR A 1 257 ? 79.707  -32.401 96.667  1.00 105.90 ? 257 THR A C     1 
ATOM   1940 O  O     . THR A 1 257 ? 79.185  -33.276 95.980  1.00 102.73 ? 257 THR A O     1 
ATOM   1941 C  CB    . THR A 1 257 ? 81.961  -33.418 97.032  1.00 107.11 ? 257 THR A CB    1 
ATOM   1942 O  OG1   . THR A 1 257 ? 81.745  -33.646 98.432  1.00 113.94 ? 257 THR A OG1   1 
ATOM   1943 C  CG2   . THR A 1 257 ? 83.451  -33.284 96.745  1.00 102.36 ? 257 THR A CG2   1 
ATOM   1944 N  N     . GLU A 1 258 ? 79.016  -31.649 97.512  1.00 120.06 ? 258 GLU A N     1 
ATOM   1945 C  CA    . GLU A 1 258 ? 77.554  -31.681 97.539  1.00 134.10 ? 258 GLU A CA    1 
ATOM   1946 C  C     . GLU A 1 258 ? 77.113  -30.276 97.858  1.00 123.48 ? 258 GLU A C     1 
ATOM   1947 O  O     . GLU A 1 258 ? 77.666  -29.631 98.741  1.00 104.70 ? 258 GLU A O     1 
ATOM   1948 C  CB    . GLU A 1 258 ? 77.009  -32.654 98.585  1.00 158.81 ? 258 GLU A CB    1 
ATOM   1949 C  CG    . GLU A 1 258 ? 77.412  -34.108 98.377  1.00 162.13 ? 258 GLU A CG    1 
ATOM   1950 C  CD    . GLU A 1 258 ? 77.025  -35.023 99.548  1.00 152.09 ? 258 GLU A CD    1 
ATOM   1951 O  OE1   . GLU A 1 258 ? 76.060  -34.704 100.277 1.00 155.49 ? 258 GLU A OE1   1 
ATOM   1952 O  OE2   . GLU A 1 258 ? 77.687  -36.068 99.741  1.00 153.36 ? 258 GLU A OE2   1 
ATOM   1953 N  N     . ILE A 1 259 ? 76.138  -29.782 97.117  1.00 122.66 ? 259 ILE A N     1 
ATOM   1954 C  CA    . ILE A 1 259 ? 75.644  -28.450 97.367  1.00 133.16 ? 259 ILE A CA    1 
ATOM   1955 C  C     . ILE A 1 259 ? 74.201  -28.499 97.830  1.00 105.42 ? 259 ILE A C     1 
ATOM   1956 O  O     . ILE A 1 259 ? 73.584  -29.563 97.872  1.00 103.27 ? 259 ILE A O     1 
ATOM   1957 C  CB    . ILE A 1 259 ? 75.811  -27.525 96.148  1.00 149.10 ? 259 ILE A CB    1 
ATOM   1958 C  CG1   . ILE A 1 259 ? 74.992  -28.021 94.948  1.00 150.98 ? 259 ILE A CG1   1 
ATOM   1959 C  CG2   . ILE A 1 259 ? 77.278  -27.393 95.784  1.00 159.05 ? 259 ILE A CG2   1 
ATOM   1960 C  CD1   . ILE A 1 259 ? 74.949  -27.011 93.819  1.00 154.65 ? 259 ILE A CD1   1 
ATOM   1961 N  N     . PRO A 1 260 ? 73.673  -27.339 98.219  1.00 108.37 ? 260 PRO A N     1 
ATOM   1962 C  CA    . PRO A 1 260 ? 72.323  -27.230 98.769  1.00 109.28 ? 260 PRO A CA    1 
ATOM   1963 C  C     . PRO A 1 260 ? 71.266  -27.429 97.711  1.00 107.34 ? 260 PRO A C     1 
ATOM   1964 O  O     . PRO A 1 260 ? 71.414  -27.003 96.565  1.00 107.40 ? 260 PRO A O     1 
ATOM   1965 C  CB    . PRO A 1 260 ? 72.272  -25.788 99.282  1.00 116.09 ? 260 PRO A CB    1 
ATOM   1966 C  CG    . PRO A 1 260 ? 73.695  -25.375 99.421  1.00 117.50 ? 260 PRO A CG    1 
ATOM   1967 C  CD    . PRO A 1 260 ? 74.440  -26.092 98.364  1.00 111.37 ? 260 PRO A CD    1 
ATOM   1968 N  N     . TYR A 1 261 ? 70.188  -28.076 98.125  1.00 116.33 ? 261 TYR A N     1 
ATOM   1969 C  CA    . TYR A 1 261 ? 69.028  -28.314 97.291  1.00 128.40 ? 261 TYR A CA    1 
ATOM   1970 C  C     . TYR A 1 261 ? 68.514  -27.042 96.630  1.00 137.02 ? 261 TYR A C     1 
ATOM   1971 O  O     . TYR A 1 261 ? 68.446  -25.993 97.265  1.00 149.88 ? 261 TYR A O     1 
ATOM   1972 C  CB    . TYR A 1 261 ? 67.930  -28.915 98.168  1.00 144.28 ? 261 TYR A CB    1 
ATOM   1973 C  CG    . TYR A 1 261 ? 66.685  -29.345 97.449  1.00 160.08 ? 261 TYR A CG    1 
ATOM   1974 C  CD1   . TYR A 1 261 ? 66.735  -30.338 96.460  1.00 187.74 ? 261 TYR A CD1   1 
ATOM   1975 C  CD2   . TYR A 1 261 ? 65.448  -28.795 97.777  1.00 161.39 ? 261 TYR A CD2   1 
ATOM   1976 C  CE1   . TYR A 1 261 ? 65.584  -30.756 95.798  1.00 176.27 ? 261 TYR A CE1   1 
ATOM   1977 C  CE2   . TYR A 1 261 ? 64.286  -29.206 97.125  1.00 181.44 ? 261 TYR A CE2   1 
ATOM   1978 C  CZ    . TYR A 1 261 ? 64.360  -30.187 96.132  1.00 175.03 ? 261 TYR A CZ    1 
ATOM   1979 O  OH    . TYR A 1 261 ? 63.216  -30.596 95.485  1.00 197.55 ? 261 TYR A OH    1 
ATOM   1980 N  N     . GLU A 1 262 ? 68.136  -27.173 95.359  1.00 138.60 ? 262 GLU A N     1 
ATOM   1981 C  CA    . GLU A 1 262 ? 67.578  -26.098 94.522  1.00 151.18 ? 262 GLU A CA    1 
ATOM   1982 C  C     . GLU A 1 262 ? 68.593  -25.038 94.104  1.00 141.21 ? 262 GLU A C     1 
ATOM   1983 O  O     . GLU A 1 262 ? 68.203  -23.964 93.660  1.00 108.84 ? 262 GLU A O     1 
ATOM   1984 C  CB    . GLU A 1 262 ? 66.365  -25.408 95.163  1.00 172.73 ? 262 GLU A CB    1 
ATOM   1985 C  CG    . GLU A 1 262 ? 65.142  -26.285 95.368  1.00 165.34 ? 262 GLU A CG    1 
ATOM   1986 C  CD    . GLU A 1 262 ? 64.019  -25.566 96.125  1.00 147.85 ? 262 GLU A CD    1 
ATOM   1987 O  OE1   . GLU A 1 262 ? 63.463  -24.581 95.584  1.00 145.49 ? 262 GLU A OE1   1 
ATOM   1988 O  OE2   . GLU A 1 262 ? 63.697  -25.982 97.262  1.00 150.39 ? 262 GLU A OE2   1 
ATOM   1989 N  N     . ILE A 1 263 ? 69.882  -25.330 94.252  1.00 137.63 ? 263 ILE A N     1 
ATOM   1990 C  CA    . ILE A 1 263 ? 70.909  -24.354 93.908  1.00 128.94 ? 263 ILE A CA    1 
ATOM   1991 C  C     . ILE A 1 263 ? 71.558  -24.684 92.570  1.00 112.79 ? 263 ILE A C     1 
ATOM   1992 O  O     . ILE A 1 263 ? 72.019  -25.802 92.349  1.00 103.29 ? 263 ILE A O     1 
ATOM   1993 C  CB    . ILE A 1 263 ? 71.993  -24.228 95.010  1.00 164.45 ? 263 ILE A CB    1 
ATOM   1994 C  CG1   . ILE A 1 263 ? 71.399  -23.582 96.256  1.00 176.61 ? 263 ILE A CG1   1 
ATOM   1995 C  CG2   . ILE A 1 263 ? 73.163  -23.398 94.527  1.00 161.41 ? 263 ILE A CG2   1 
ATOM   1996 C  CD1   . ILE A 1 263 ? 70.824  -22.203 96.019  1.00 186.86 ? 263 ILE A CD1   1 
ATOM   1997 N  N     . ASN A 1 264 ? 71.570  -23.698 91.680  1.00 106.77 ? 264 ASN A N     1 
ATOM   1998 C  CA    . ASN A 1 264 ? 72.182  -23.824 90.370  1.00 104.73 ? 264 ASN A CA    1 
ATOM   1999 C  C     . ASN A 1 264 ? 73.716  -23.874 90.493  1.00 113.28 ? 264 ASN A C     1 
ATOM   2000 O  O     . ASN A 1 264 ? 74.330  -22.878 90.838  1.00 107.80 ? 264 ASN A O     1 
ATOM   2001 C  CB    . ASN A 1 264 ? 71.710  -22.641 89.520  1.00 106.88 ? 264 ASN A CB    1 
ATOM   2002 C  CG    . ASN A 1 264 ? 72.193  -22.696 88.081  1.00 112.49 ? 264 ASN A CG    1 
ATOM   2003 O  OD1   . ASN A 1 264 ? 73.386  -22.869 87.802  1.00 126.83 ? 264 ASN A OD1   1 
ATOM   2004 N  ND2   . ASN A 1 264 ? 71.262  -22.520 87.150  1.00 106.21 ? 264 ASN A ND2   1 
ATOM   2005 N  N     . LYS A 1 265 ? 74.325  -25.033 90.228  1.00 120.93 ? 265 LYS A N     1 
ATOM   2006 C  CA    . LYS A 1 265 ? 75.775  -25.208 90.410  1.00 124.22 ? 265 LYS A CA    1 
ATOM   2007 C  C     . LYS A 1 265 ? 76.557  -24.093 89.747  1.00 123.80 ? 265 LYS A C     1 
ATOM   2008 O  O     . LYS A 1 265 ? 77.401  -23.455 90.372  1.00 122.31 ? 265 LYS A O     1 
ATOM   2009 C  CB    . LYS A 1 265 ? 76.259  -26.568 89.869  1.00 119.02 ? 265 LYS A CB    1 
ATOM   2010 C  CG    . LYS A 1 265 ? 77.774  -26.826 90.048  1.00 107.70 ? 265 LYS A CG    1 
ATOM   2011 C  CD    . LYS A 1 265 ? 78.183  -28.236 89.573  1.00 98.72  ? 265 LYS A CD    1 
ATOM   2012 C  CE    . LYS A 1 265 ? 78.227  -28.383 88.023  1.00 93.09  ? 265 LYS A CE    1 
ATOM   2013 N  N     . ALA A 1 266 ? 76.253  -23.859 88.477  1.00 125.77 ? 266 ALA A N     1 
ATOM   2014 C  CA    . ALA A 1 266 ? 76.982  -22.899 87.653  1.00 130.48 ? 266 ALA A CA    1 
ATOM   2015 C  C     . ALA A 1 266 ? 76.900  -21.453 88.141  1.00 118.98 ? 266 ALA A C     1 
ATOM   2016 O  O     . ALA A 1 266 ? 77.879  -20.726 88.032  1.00 109.90 ? 266 ALA A O     1 
ATOM   2017 C  CB    . ALA A 1 266 ? 76.514  -22.992 86.208  1.00 146.40 ? 266 ALA A CB    1 
ATOM   2018 N  N     . ASN A 1 267 ? 75.736  -21.034 88.644  1.00 114.87 ? 267 ASN A N     1 
ATOM   2019 C  CA    . ASN A 1 267 ? 75.571  -19.684 89.191  1.00 118.77 ? 267 ASN A CA    1 
ATOM   2020 C  C     . ASN A 1 267 ? 76.372  -19.560 90.468  1.00 126.59 ? 267 ASN A C     1 
ATOM   2021 O  O     . ASN A 1 267 ? 76.957  -18.515 90.765  1.00 118.84 ? 267 ASN A O     1 
ATOM   2022 C  CB    . ASN A 1 267 ? 74.094  -19.331 89.457  1.00 123.72 ? 267 ASN A CB    1 
ATOM   2023 C  CG    . ASN A 1 267 ? 73.246  -19.273 88.164  1.00 134.00 ? 267 ASN A CG    1 
ATOM   2024 O  OD1   . ASN A 1 267 ? 72.030  -19.481 88.199  1.00 139.60 ? 267 ASN A OD1   1 
ATOM   2025 N  ND2   . ASN A 1 267 ? 73.893  -19.002 87.027  1.00 138.18 ? 267 ASN A ND2   1 
ATOM   2026 N  N     . LEU A 1 268 ? 76.420  -20.656 91.210  1.00 148.15 ? 268 LEU A N     1 
ATOM   2027 C  CA    . LEU A 1 268 ? 77.105  -20.679 92.480  1.00 182.23 ? 268 LEU A CA    1 
ATOM   2028 C  C     . LEU A 1 268 ? 78.590  -20.549 92.197  1.00 188.15 ? 268 LEU A C     1 
ATOM   2029 O  O     . LEU A 1 268 ? 79.303  -19.813 92.889  1.00 205.91 ? 268 LEU A O     1 
ATOM   2030 C  CB    . LEU A 1 268 ? 76.797  -21.987 93.208  1.00 203.63 ? 268 LEU A CB    1 
ATOM   2031 C  CG    . LEU A 1 268 ? 77.061  -22.201 94.708  1.00 226.74 ? 268 LEU A CG    1 
ATOM   2032 C  CD1   . LEU A 1 268 ? 78.129  -23.255 94.905  1.00 235.26 ? 268 LEU A CD1   1 
ATOM   2033 C  CD2   . LEU A 1 268 ? 77.394  -20.904 95.452  1.00 235.41 ? 268 LEU A CD2   1 
ATOM   2034 N  N     . VAL A 1 269 ? 79.056  -21.252 91.167  1.00 163.22 ? 269 VAL A N     1 
ATOM   2035 C  CA    . VAL A 1 269 ? 80.476  -21.235 90.874  1.00 136.61 ? 269 VAL A CA    1 
ATOM   2036 C  C     . VAL A 1 269 ? 80.881  -19.843 90.443  1.00 134.06 ? 269 VAL A C     1 
ATOM   2037 O  O     . VAL A 1 269 ? 81.980  -19.384 90.768  1.00 144.78 ? 269 VAL A O     1 
ATOM   2038 C  CB    . VAL A 1 269 ? 80.874  -22.254 89.804  1.00 110.06 ? 269 VAL A CB    1 
ATOM   2039 C  CG1   . VAL A 1 269 ? 82.251  -21.907 89.258  1.00 110.89 ? 269 VAL A CG1   1 
ATOM   2040 C  CG2   . VAL A 1 269 ? 80.866  -23.660 90.397  1.00 107.47 ? 269 VAL A CG2   1 
ATOM   2041 N  N     . LYS A 1 270 ? 79.978  -19.169 89.727  1.00 117.18 ? 270 LYS A N     1 
ATOM   2042 C  CA    . LYS A 1 270 ? 80.260  -17.828 89.206  1.00 120.01 ? 270 LYS A CA    1 
ATOM   2043 C  C     . LYS A 1 270 ? 80.260  -16.806 90.333  1.00 125.36 ? 270 LYS A C     1 
ATOM   2044 O  O     . LYS A 1 270 ? 81.122  -15.947 90.389  1.00 130.41 ? 270 LYS A O     1 
ATOM   2045 C  CB    . LYS A 1 270 ? 79.276  -17.428 88.094  1.00 118.84 ? 270 LYS A CB    1 
ATOM   2046 C  CG    . LYS A 1 270 ? 79.229  -15.932 87.758  1.00 122.16 ? 270 LYS A CG    1 
ATOM   2047 C  CD    . LYS A 1 270 ? 80.301  -15.494 86.725  1.00 122.48 ? 270 LYS A CD    1 
ATOM   2048 N  N     . LYS A 1 271 ? 79.305  -16.916 91.247  1.00 124.76 ? 271 LYS A N     1 
ATOM   2049 C  CA    . LYS A 1 271 ? 79.245  -15.993 92.363  1.00 132.31 ? 271 LYS A CA    1 
ATOM   2050 C  C     . LYS A 1 271 ? 80.468  -16.138 93.296  1.00 148.47 ? 271 LYS A C     1 
ATOM   2051 O  O     . LYS A 1 271 ? 80.932  -15.146 93.883  1.00 134.26 ? 271 LYS A O     1 
ATOM   2052 C  CB    . LYS A 1 271 ? 77.922  -16.150 93.117  1.00 128.70 ? 271 LYS A CB    1 
ATOM   2053 C  CG    . LYS A 1 271 ? 77.859  -15.358 94.420  1.00 133.67 ? 271 LYS A CG    1 
ATOM   2054 C  CD    . LYS A 1 271 ? 76.486  -15.468 95.098  1.00 146.32 ? 271 LYS A CD    1 
ATOM   2055 C  CE    . LYS A 1 271 ? 76.041  -16.932 95.267  1.00 152.70 ? 271 LYS A CE    1 
ATOM   2056 N  NZ    . LYS A 1 271 ? 74.696  -17.043 95.878  1.00 179.39 ? 271 LYS A NZ    1 
ATOM   2057 N  N     . ILE A 1 272 ? 80.994  -17.361 93.421  1.00 177.41 ? 272 ILE A N     1 
ATOM   2058 C  CA    . ILE A 1 272 ? 82.170  -17.611 94.256  1.00 210.83 ? 272 ILE A CA    1 
ATOM   2059 C  C     . ILE A 1 272 ? 83.395  -17.025 93.594  1.00 233.43 ? 272 ILE A C     1 
ATOM   2060 O  O     . ILE A 1 272 ? 84.291  -16.510 94.261  1.00 243.50 ? 272 ILE A O     1 
ATOM   2061 C  CB    . ILE A 1 272 ? 82.442  -19.102 94.480  1.00 213.63 ? 272 ILE A CB    1 
ATOM   2062 C  CG1   . ILE A 1 272 ? 81.315  -19.751 95.281  1.00 221.52 ? 272 ILE A CG1   1 
ATOM   2063 C  CG2   . ILE A 1 272 ? 83.761  -19.295 95.203  1.00 210.59 ? 272 ILE A CG2   1 
ATOM   2064 C  CD1   . ILE A 1 272 ? 81.416  -21.263 95.363  1.00 224.82 ? 272 ILE A CD1   1 
ATOM   2065 N  N     . ASP A 1 273 ? 83.437  -17.107 92.275  1.00 233.03 ? 273 ASP A N     1 
ATOM   2066 C  CA    . ASP A 1 273 ? 84.511  -16.481 91.515  1.00 220.24 ? 273 ASP A CA    1 
ATOM   2067 C  C     . ASP A 1 273 ? 84.374  -14.954 91.536  1.00 231.45 ? 273 ASP A C     1 
ATOM   2068 O  O     . ASP A 1 273 ? 85.374  -14.241 91.442  1.00 243.26 ? 273 ASP A O     1 
ATOM   2069 C  CB    . ASP A 1 273 ? 84.536  -17.015 90.079  1.00 185.36 ? 273 ASP A CB    1 
ATOM   2070 C  CG    . ASP A 1 273 ? 85.749  -16.534 89.290  1.00 155.18 ? 273 ASP A CG    1 
ATOM   2071 O  OD1   . ASP A 1 273 ? 86.891  -16.940 89.631  1.00 147.09 ? 273 ASP A OD1   1 
ATOM   2072 O  OD2   . ASP A 1 273 ? 85.554  -15.765 88.314  1.00 144.65 ? 273 ASP A OD2   1 
ATOM   2073 N  N     . ASP A 1 274 ? 83.144  -14.458 91.674  1.00 218.12 ? 274 ASP A N     1 
ATOM   2074 C  CA    . ASP A 1 274 ? 82.900  -13.015 91.770  1.00 195.32 ? 274 ASP A CA    1 
ATOM   2075 C  C     . ASP A 1 274 ? 83.555  -12.504 93.041  1.00 186.37 ? 274 ASP A C     1 
ATOM   2076 O  O     . ASP A 1 274 ? 84.148  -11.419 93.070  1.00 190.22 ? 274 ASP A O     1 
ATOM   2077 C  CB    . ASP A 1 274 ? 81.397  -12.705 91.799  1.00 178.03 ? 274 ASP A CB    1 
ATOM   2078 C  CG    . ASP A 1 274 ? 80.792  -12.535 90.404  1.00 176.05 ? 274 ASP A CG    1 
ATOM   2079 O  OD1   . ASP A 1 274 ? 81.520  -12.700 89.395  1.00 183.85 ? 274 ASP A OD1   1 
ATOM   2080 O  OD2   . ASP A 1 274 ? 79.576  -12.248 90.319  1.00 179.07 ? 274 ASP A OD2   1 
ATOM   2081 N  N     . VAL A 1 275 ? 83.439  -13.306 94.096  1.00 172.06 ? 275 VAL A N     1 
ATOM   2082 C  CA    . VAL A 1 275 ? 84.102  -13.011 95.348  1.00 171.16 ? 275 VAL A CA    1 
ATOM   2083 C  C     . VAL A 1 275 ? 85.610  -12.910 95.142  1.00 185.29 ? 275 VAL A C     1 
ATOM   2084 O  O     . VAL A 1 275 ? 86.258  -12.050 95.725  1.00 187.15 ? 275 VAL A O     1 
ATOM   2085 C  CB    . VAL A 1 275 ? 83.794  -14.064 96.413  1.00 161.21 ? 275 VAL A CB    1 
ATOM   2086 C  CG1   . VAL A 1 275 ? 84.879  -14.065 97.497  1.00 170.76 ? 275 VAL A CG1   1 
ATOM   2087 C  CG2   . VAL A 1 275 ? 82.424  -13.817 97.005  1.00 150.23 ? 275 VAL A CG2   1 
ATOM   2088 N  N     . ARG A 1 276 ? 86.170  -13.775 94.306  1.00 197.42 ? 276 ARG A N     1 
ATOM   2089 C  CA    . ARG A 1 276 ? 87.609  -13.734 94.077  1.00 205.94 ? 276 ARG A CA    1 
ATOM   2090 C  C     . ARG A 1 276 ? 88.029  -12.543 93.205  1.00 207.15 ? 276 ARG A C     1 
ATOM   2091 O  O     . ARG A 1 276 ? 89.002  -11.848 93.516  1.00 195.36 ? 276 ARG A O     1 
ATOM   2092 C  CB    . ARG A 1 276 ? 88.110  -15.045 93.480  1.00 203.35 ? 276 ARG A CB    1 
ATOM   2093 C  CG    . ARG A 1 276 ? 89.588  -15.019 93.142  1.00 201.90 ? 276 ARG A CG    1 
ATOM   2094 C  CD    . ARG A 1 276 ? 89.928  -15.974 92.012  1.00 194.38 ? 276 ARG A CD    1 
ATOM   2095 N  NE    . ARG A 1 276 ? 89.290  -15.584 90.767  1.00 190.78 ? 276 ARG A NE    1 
ATOM   2096 C  CZ    . ARG A 1 276 ? 89.932  -15.025 89.747  1.00 191.32 ? 276 ARG A CZ    1 
ATOM   2097 N  NH1   . ARG A 1 276 ? 91.236  -14.799 89.831  1.00 179.15 ? 276 ARG A NH1   1 
ATOM   2098 N  NH2   . ARG A 1 276 ? 89.274  -14.698 88.641  1.00 203.77 ? 276 ARG A NH2   1 
ATOM   2099 N  N     . VAL A 1 277 ? 87.300  -12.313 92.117  1.00 215.39 ? 277 VAL A N     1 
ATOM   2100 C  CA    . VAL A 1 277 ? 87.591  -11.199 91.220  1.00 171.80 ? 277 VAL A CA    1 
ATOM   2101 C  C     . VAL A 1 277 ? 87.423  -9.849  91.923  1.00 151.69 ? 277 VAL A C     1 
ATOM   2102 O  O     . VAL A 1 277 ? 88.145  -8.903  91.633  1.00 137.59 ? 277 VAL A O     1 
ATOM   2103 C  CB    . VAL A 1 277 ? 86.706  -11.240 89.943  1.00 176.24 ? 277 VAL A CB    1 
ATOM   2104 C  CG1   . VAL A 1 277 ? 86.846  -9.961  89.152  1.00 172.60 ? 277 VAL A CG1   1 
ATOM   2105 C  CG2   . VAL A 1 277 ? 87.057  -12.453 89.068  1.00 178.70 ? 277 VAL A CG2   1 
ATOM   2106 N  N     . ASN A 1 278 ? 86.481  -9.759  92.858  1.00 172.23 ? 278 ASN A N     1 
ATOM   2107 C  CA    . ASN A 1 278 ? 86.256  -8.497  93.564  1.00 171.14 ? 278 ASN A CA    1 
ATOM   2108 C  C     . ASN A 1 278 ? 87.077  -8.355  94.842  1.00 166.34 ? 278 ASN A C     1 
ATOM   2109 O  O     . ASN A 1 278 ? 87.065  -7.304  95.479  1.00 166.76 ? 278 ASN A O     1 
ATOM   2110 C  CB    . ASN A 1 278 ? 84.774  -8.308  93.888  1.00 177.02 ? 278 ASN A CB    1 
ATOM   2111 C  CG    . ASN A 1 278 ? 83.961  -7.860  92.684  1.00 185.74 ? 278 ASN A CG    1 
ATOM   2112 O  OD1   . ASN A 1 278 ? 84.391  -7.003  91.897  1.00 178.46 ? 278 ASN A OD1   1 
ATOM   2113 N  ND2   . ASN A 1 278 ? 82.778  -8.442  92.532  1.00 199.14 ? 278 ASN A ND2   1 
ATOM   2114 N  N     . ASN A 1 279 ? 87.783  -9.418  95.216  1.00 162.65 ? 279 ASN A N     1 
ATOM   2115 C  CA    . ASN A 1 279 ? 88.545  -9.444  96.461  1.00 160.34 ? 279 ASN A CA    1 
ATOM   2116 C  C     . ASN A 1 279 ? 87.765  -8.916  97.686  1.00 165.15 ? 279 ASN A C     1 
ATOM   2117 O  O     . ASN A 1 279 ? 88.277  -8.113  98.476  1.00 160.08 ? 279 ASN A O     1 
ATOM   2118 C  CB    . ASN A 1 279 ? 89.888  -8.721  96.290  1.00 154.97 ? 279 ASN A CB    1 
ATOM   2119 C  CG    . ASN A 1 279 ? 91.079  -9.629  96.573  1.00 157.56 ? 279 ASN A CG    1 
ATOM   2120 O  OD1   . ASN A 1 279 ? 91.430  -10.477 95.750  1.00 165.88 ? 279 ASN A OD1   1 
ATOM   2121 N  ND2   . ASN A 1 279 ? 91.703  -9.459  97.743  1.00 148.52 ? 279 ASN A ND2   1 
ATOM   2122 N  N     . LYS A 1 280 ? 86.526  -9.381  97.834  1.00 170.08 ? 280 LYS A N     1 
ATOM   2123 C  CA    . LYS A 1 280 ? 85.688  -9.005  98.964  1.00 168.59 ? 280 LYS A CA    1 
ATOM   2124 C  C     . LYS A 1 280 ? 86.307  -9.555  100.237 1.00 153.31 ? 280 LYS A C     1 
ATOM   2125 O  O     . LYS A 1 280 ? 86.225  -8.945  101.311 1.00 154.03 ? 280 LYS A O     1 
ATOM   2126 C  CB    . LYS A 1 280 ? 84.282  -9.563  98.781  1.00 176.47 ? 280 LYS A CB    1 
ATOM   2127 C  CG    . LYS A 1 280 ? 83.616  -9.155  97.472  1.00 183.83 ? 280 LYS A CG    1 
ATOM   2128 C  CD    . LYS A 1 280 ? 83.016  -7.765  97.565  1.00 193.94 ? 280 LYS A CD    1 
ATOM   2129 C  CE    . LYS A 1 280 ? 82.104  -7.636  98.780  1.00 197.13 ? 280 LYS A CE    1 
ATOM   2130 N  NZ    . LYS A 1 280 ? 81.589  -6.248  98.932  1.00 201.41 ? 280 LYS A NZ    1 
ATOM   2131 N  N     . VAL A 1 281 ? 86.915  -10.730 100.100 1.00 149.74 ? 281 VAL A N     1 
ATOM   2132 C  CA    . VAL A 1 281 ? 87.765  -11.308 101.131 1.00 146.40 ? 281 VAL A CA    1 
ATOM   2133 C  C     . VAL A 1 281 ? 89.035  -11.782 100.433 1.00 143.09 ? 281 VAL A C     1 
ATOM   2134 O  O     . VAL A 1 281 ? 88.999  -12.141 99.258  1.00 146.30 ? 281 VAL A O     1 
ATOM   2135 C  CB    . VAL A 1 281 ? 87.079  -12.478 101.889 1.00 138.71 ? 281 VAL A CB    1 
ATOM   2136 C  CG1   . VAL A 1 281 ? 86.910  -13.696 100.988 1.00 134.96 ? 281 VAL A CG1   1 
ATOM   2137 C  CG2   . VAL A 1 281 ? 87.898  -12.862 103.080 1.00 139.43 ? 281 VAL A CG2   1 
ATOM   2138 N  N     . ALA A 1 282 ? 90.160  -11.761 101.141 1.00 141.86 ? 282 ALA A N     1 
ATOM   2139 C  CA    . ALA A 1 282 ? 91.448  -12.103 100.545 1.00 140.26 ? 282 ALA A CA    1 
ATOM   2140 C  C     . ALA A 1 282 ? 91.731  -13.597 100.648 1.00 136.80 ? 282 ALA A C     1 
ATOM   2141 O  O     . ALA A 1 282 ? 91.314  -14.249 101.599 1.00 138.25 ? 282 ALA A O     1 
ATOM   2142 C  CB    . ALA A 1 282 ? 92.551  -11.319 101.223 1.00 143.13 ? 282 ALA A CB    1 
ATOM   2143 N  N     . GLY A 1 283 ? 92.439  -14.143 99.667  1.00 135.02 ? 283 GLY A N     1 
ATOM   2144 C  CA    . GLY A 1 283 ? 92.813  -15.542 99.729  1.00 131.81 ? 283 GLY A CA    1 
ATOM   2145 C  C     . GLY A 1 283 ? 92.594  -16.419 98.507  1.00 134.58 ? 283 GLY A C     1 
ATOM   2146 O  O     . GLY A 1 283 ? 93.397  -17.320 98.286  1.00 133.86 ? 283 GLY A O     1 
ATOM   2147 N  N     . ILE A 1 284 ? 91.526  -16.193 97.733  1.00 133.96 ? 284 ILE A N     1 
ATOM   2148 C  CA    . ILE A 1 284 ? 91.161  -17.144 96.666  1.00 140.94 ? 284 ILE A CA    1 
ATOM   2149 C  C     . ILE A 1 284 ? 92.060  -17.008 95.419  1.00 139.62 ? 284 ILE A C     1 
ATOM   2150 O  O     . ILE A 1 284 ? 92.161  -15.946 94.796  1.00 153.15 ? 284 ILE A O     1 
ATOM   2151 C  CB    . ILE A 1 284 ? 89.616  -17.170 96.317  1.00 123.97 ? 284 ILE A CB    1 
ATOM   2152 N  N     . ALA A 1 285 ? 92.734  -18.107 95.092  1.00 134.47 ? 285 ALA A N     1 
ATOM   2153 C  CA    . ALA A 1 285 ? 93.686  -18.143 93.993  1.00 135.81 ? 285 ALA A CA    1 
ATOM   2154 C  C     . ALA A 1 285 ? 92.960  -18.359 92.678  1.00 140.86 ? 285 ALA A C     1 
ATOM   2155 O  O     . ALA A 1 285 ? 93.145  -17.606 91.734  1.00 133.77 ? 285 ALA A O     1 
ATOM   2156 C  CB    . ALA A 1 285 ? 94.711  -19.249 94.219  1.00 131.88 ? 285 ALA A CB    1 
ATOM   2157 N  N     . GLU A 1 286 ? 92.124  -19.388 92.630  1.00 154.77 ? 286 GLU A N     1 
ATOM   2158 C  CA    . GLU A 1 286 ? 91.357  -19.672 91.439  1.00 164.41 ? 286 GLU A CA    1 
ATOM   2159 C  C     . GLU A 1 286 ? 90.099  -20.479 91.779  1.00 151.36 ? 286 GLU A C     1 
ATOM   2160 O  O     . GLU A 1 286 ? 90.112  -21.297 92.696  1.00 139.12 ? 286 GLU A O     1 
ATOM   2161 C  CB    . GLU A 1 286 ? 92.233  -20.436 90.452  1.00 179.51 ? 286 GLU A CB    1 
ATOM   2162 C  CG    . GLU A 1 286 ? 91.579  -20.728 89.127  1.00 190.41 ? 286 GLU A CG    1 
ATOM   2163 C  CD    . GLU A 1 286 ? 92.362  -21.752 88.340  1.00 196.21 ? 286 GLU A CD    1 
ATOM   2164 O  OE1   . GLU A 1 286 ? 93.342  -22.291 88.901  1.00 192.89 ? 286 GLU A OE1   1 
ATOM   2165 O  OE2   . GLU A 1 286 ? 92.007  -22.013 87.170  1.00 202.72 ? 286 GLU A OE2   1 
ATOM   2166 N  N     . VAL A 1 287 ? 89.015  -20.230 91.050  1.00 152.01 ? 287 VAL A N     1 
ATOM   2167 C  CA    . VAL A 1 287 ? 87.839  -21.089 91.128  1.00 150.07 ? 287 VAL A CA    1 
ATOM   2168 C  C     . VAL A 1 287 ? 87.755  -21.982 89.874  1.00 154.75 ? 287 VAL A C     1 
ATOM   2169 O  O     . VAL A 1 287 ? 87.953  -21.524 88.748  1.00 157.85 ? 287 VAL A O     1 
ATOM   2170 C  CB    . VAL A 1 287 ? 86.545  -20.278 91.320  1.00 143.47 ? 287 VAL A CB    1 
ATOM   2171 C  CG1   . VAL A 1 287 ? 85.365  -21.216 91.524  1.00 132.62 ? 287 VAL A CG1   1 
ATOM   2172 C  CG2   . VAL A 1 287 ? 86.682  -19.332 92.507  1.00 147.89 ? 287 VAL A CG2   1 
ATOM   2173 N  N     . ARG A 1 288 ? 87.474  -23.262 90.087  1.00 154.39 ? 288 ARG A N     1 
ATOM   2174 C  CA    . ARG A 1 288 ? 87.562  -24.268 89.037  1.00 151.17 ? 288 ARG A CA    1 
ATOM   2175 C  C     . ARG A 1 288 ? 86.423  -25.255 89.219  1.00 138.82 ? 288 ARG A C     1 
ATOM   2176 O  O     . ARG A 1 288 ? 86.415  -26.004 90.197  1.00 132.51 ? 288 ARG A O     1 
ATOM   2177 C  CB    . ARG A 1 288 ? 88.879  -25.029 89.186  1.00 159.12 ? 288 ARG A CB    1 
ATOM   2178 C  CG    . ARG A 1 288 ? 89.678  -25.226 87.918  1.00 172.53 ? 288 ARG A CG    1 
ATOM   2179 C  CD    . ARG A 1 288 ? 90.923  -26.057 88.208  1.00 190.88 ? 288 ARG A CD    1 
ATOM   2180 N  NE    . ARG A 1 288 ? 91.723  -25.480 89.282  1.00 206.29 ? 288 ARG A NE    1 
ATOM   2181 C  CZ    . ARG A 1 288 ? 92.119  -26.137 90.371  1.00 206.24 ? 288 ARG A CZ    1 
ATOM   2182 N  NH1   . ARG A 1 288 ? 91.799  -27.410 90.542  1.00 199.04 ? 288 ARG A NH1   1 
ATOM   2183 N  NH2   . ARG A 1 288 ? 92.843  -25.523 91.295  1.00 208.82 ? 288 ARG A NH2   1 
ATOM   2184 N  N     . ASP A 1 289 ? 85.457  -25.261 88.302  1.00 131.13 ? 289 ASP A N     1 
ATOM   2185 C  CA    . ASP A 1 289 ? 84.415  -26.281 88.349  1.00 111.59 ? 289 ASP A CA    1 
ATOM   2186 C  C     . ASP A 1 289 ? 85.000  -27.519 87.694  1.00 100.33 ? 289 ASP A C     1 
ATOM   2187 O  O     . ASP A 1 289 ? 85.383  -27.479 86.531  1.00 99.29  ? 289 ASP A O     1 
ATOM   2188 C  CB    . ASP A 1 289 ? 83.138  -25.826 87.635  1.00 101.18 ? 289 ASP A CB    1 
ATOM   2189 C  CG    . ASP A 1 289 ? 81.960  -26.794 87.846  1.00 97.08  ? 289 ASP A CG    1 
ATOM   2190 O  OD1   . ASP A 1 289 ? 80.823  -26.466 87.428  1.00 97.88  ? 289 ASP A OD1   1 
ATOM   2191 O  OD2   . ASP A 1 289 ? 82.163  -27.880 88.430  1.00 91.64  ? 289 ASP A OD2   1 
ATOM   2192 N  N     . GLU A 1 290 ? 85.110  -28.605 88.448  1.00 100.16 ? 290 GLU A N     1 
ATOM   2193 C  CA    . GLU A 1 290 ? 85.729  -29.818 87.926  1.00 114.31 ? 290 GLU A CA    1 
ATOM   2194 C  C     . GLU A 1 290 ? 84.751  -30.984 87.845  1.00 89.18  ? 290 GLU A C     1 
ATOM   2195 O  O     . GLU A 1 290 ? 85.162  -32.142 87.754  1.00 91.34  ? 290 GLU A O     1 
ATOM   2196 C  CB    . GLU A 1 290 ? 86.957  -30.194 88.759  1.00 161.61 ? 290 GLU A CB    1 
ATOM   2197 C  CG    . GLU A 1 290 ? 88.147  -29.275 88.500  1.00 195.97 ? 290 GLU A CG    1 
ATOM   2198 C  CD    . GLU A 1 290 ? 89.310  -29.462 89.475  1.00 211.13 ? 290 GLU A CD    1 
ATOM   2199 O  OE1   . GLU A 1 290 ? 89.285  -30.385 90.317  1.00 220.18 ? 290 GLU A OE1   1 
ATOM   2200 O  OE2   . GLU A 1 290 ? 90.261  -28.665 89.389  1.00 209.21 ? 290 GLU A OE2   1 
ATOM   2201 N  N     . SER A 1 291 ? 83.460  -30.675 87.880  1.00 86.45  ? 291 SER A N     1 
ATOM   2202 C  CA    . SER A 1 291 ? 82.442  -31.713 87.812  1.00 85.94  ? 291 SER A CA    1 
ATOM   2203 C  C     . SER A 1 291 ? 82.423  -32.324 86.420  1.00 100.64 ? 291 SER A C     1 
ATOM   2204 O  O     . SER A 1 291 ? 82.332  -31.609 85.421  1.00 100.71 ? 291 SER A O     1 
ATOM   2205 C  CB    . SER A 1 291 ? 81.055  -31.145 88.099  1.00 84.40  ? 291 SER A CB    1 
ATOM   2206 O  OG    . SER A 1 291 ? 81.079  -30.115 89.057  1.00 86.49  ? 291 SER A OG    1 
ATOM   2207 N  N     . ASP A 1 292 ? 82.507  -33.646 86.353  1.00 109.67 ? 292 ASP A N     1 
ATOM   2208 C  CA    . ASP A 1 292 ? 82.291  -34.341 85.091  1.00 123.13 ? 292 ASP A CA    1 
ATOM   2209 C  C     . ASP A 1 292 ? 80.963  -35.093 85.143  1.00 128.45 ? 292 ASP A C     1 
ATOM   2210 O  O     . ASP A 1 292 ? 80.174  -34.914 86.075  1.00 130.66 ? 292 ASP A O     1 
ATOM   2211 C  CB    . ASP A 1 292 ? 83.463  -35.275 84.740  1.00 149.48 ? 292 ASP A CB    1 
ATOM   2212 C  CG    . ASP A 1 292 ? 83.741  -36.314 85.819  1.00 177.10 ? 292 ASP A CG    1 
ATOM   2213 O  OD1   . ASP A 1 292 ? 82.858  -36.550 86.678  1.00 181.38 ? 292 ASP A OD1   1 
ATOM   2214 O  OD2   . ASP A 1 292 ? 84.845  -36.903 85.798  1.00 192.18 ? 292 ASP A OD2   1 
ATOM   2215 N  N     . ARG A 1 293 ? 80.725  -35.931 84.138  1.00 140.29 ? 293 ARG A N     1 
ATOM   2216 C  CA    . ARG A 1 293 ? 79.465  -36.658 84.020  1.00 156.49 ? 293 ARG A CA    1 
ATOM   2217 C  C     . ARG A 1 293 ? 79.192  -37.581 85.213  1.00 165.93 ? 293 ARG A C     1 
ATOM   2218 O  O     . ARG A 1 293 ? 78.052  -37.991 85.436  1.00 202.21 ? 293 ARG A O     1 
ATOM   2219 C  CB    . ARG A 1 293 ? 79.415  -37.438 82.696  1.00 172.50 ? 293 ARG A CB    1 
ATOM   2220 C  CG    . ARG A 1 293 ? 80.031  -38.829 82.732  1.00 156.46 ? 293 ARG A CG    1 
ATOM   2221 C  CD    . ARG A 1 293 ? 80.466  -39.273 81.345  1.00 151.23 ? 293 ARG A CD    1 
ATOM   2222 N  NE    . ARG A 1 293 ? 81.907  -39.111 81.175  1.00 143.85 ? 293 ARG A NE    1 
ATOM   2223 C  CZ    . ARG A 1 293 ? 82.516  -37.936 81.068  1.00 135.58 ? 293 ARG A CZ    1 
ATOM   2224 N  NH1   . ARG A 1 293 ? 81.813  -36.812 81.113  1.00 136.74 ? 293 ARG A NH1   1 
ATOM   2225 N  NH2   . ARG A 1 293 ? 83.831  -37.883 80.921  1.00 127.54 ? 293 ARG A NH2   1 
ATOM   2226 N  N     . ASP A 1 294 ? 80.233  -37.895 85.982  1.00 142.25 ? 294 ASP A N     1 
ATOM   2227 C  CA    . ASP A 1 294 ? 80.082  -38.792 87.128  1.00 117.00 ? 294 ASP A CA    1 
ATOM   2228 C  C     . ASP A 1 294 ? 80.789  -38.278 88.381  1.00 107.68 ? 294 ASP A C     1 
ATOM   2229 O  O     . ASP A 1 294 ? 81.735  -38.885 88.884  1.00 109.47 ? 294 ASP A O     1 
ATOM   2230 C  CB    . ASP A 1 294 ? 80.532  -40.215 86.770  1.00 135.63 ? 294 ASP A CB    1 
ATOM   2231 C  CG    . ASP A 1 294 ? 81.922  -40.257 86.155  1.00 130.13 ? 294 ASP A CG    1 
ATOM   2232 O  OD1   . ASP A 1 294 ? 82.546  -41.339 86.180  1.00 148.75 ? 294 ASP A OD1   1 
ATOM   2233 O  OD2   . ASP A 1 294 ? 82.391  -39.215 85.652  1.00 143.18 ? 294 ASP A OD2   1 
ATOM   2234 N  N     . GLY A 1 295 ? 80.312  -37.151 88.885  1.00 101.06 ? 295 GLY A N     1 
ATOM   2235 C  CA    . GLY A 1 295 ? 80.889  -36.561 90.072  1.00 98.99  ? 295 GLY A CA    1 
ATOM   2236 C  C     . GLY A 1 295 ? 80.786  -35.052 90.089  1.00 94.85  ? 295 GLY A C     1 
ATOM   2237 O  O     . GLY A 1 295 ? 81.058  -34.382 89.091  1.00 100.95 ? 295 GLY A O     1 
ATOM   2238 N  N     . LEU A 1 296 ? 80.377  -34.521 91.234  1.00 90.21  ? 296 LEU A N     1 
ATOM   2239 C  CA    . LEU A 1 296 ? 80.348  -33.083 91.461  1.00 85.61  ? 296 LEU A CA    1 
ATOM   2240 C  C     . LEU A 1 296 ? 81.612  -32.656 92.229  1.00 84.80  ? 296 LEU A C     1 
ATOM   2241 O  O     . LEU A 1 296 ? 81.902  -33.172 93.299  1.00 84.23  ? 296 LEU A O     1 
ATOM   2242 C  CB    . LEU A 1 296 ? 79.081  -32.717 92.230  1.00 89.07  ? 296 LEU A CB    1 
ATOM   2243 C  CG    . LEU A 1 296 ? 78.749  -31.237 92.342  1.00 103.39 ? 296 LEU A CG    1 
ATOM   2244 C  CD1   . LEU A 1 296 ? 77.299  -31.056 92.741  1.00 115.45 ? 296 LEU A CD1   1 
ATOM   2245 C  CD2   . LEU A 1 296 ? 79.677  -30.566 93.343  1.00 101.79 ? 296 LEU A CD2   1 
ATOM   2246 N  N     . ARG A 1 297 ? 82.379  -31.733 91.665  1.00 85.93  ? 297 ARG A N     1 
ATOM   2247 C  CA    . ARG A 1 297 ? 83.605  -31.284 92.310  1.00 87.65  ? 297 ARG A CA    1 
ATOM   2248 C  C     . ARG A 1 297 ? 83.976  -29.857 91.950  1.00 92.39  ? 297 ARG A C     1 
ATOM   2249 O  O     . ARG A 1 297 ? 84.301  -29.561 90.804  1.00 93.64  ? 297 ARG A O     1 
ATOM   2250 C  CB    . ARG A 1 297 ? 84.778  -32.210 91.977  1.00 98.97  ? 297 ARG A CB    1 
ATOM   2251 C  CG    . ARG A 1 297 ? 86.128  -31.519 92.069  1.00 119.84 ? 297 ARG A CG    1 
ATOM   2252 C  CD    . ARG A 1 297 ? 87.276  -32.487 91.891  1.00 137.43 ? 297 ARG A CD    1 
ATOM   2253 N  NE    . ARG A 1 297 ? 87.870  -32.853 93.171  1.00 149.95 ? 297 ARG A NE    1 
ATOM   2254 C  CZ    . ARG A 1 297 ? 89.027  -32.376 93.615  1.00 160.62 ? 297 ARG A CZ    1 
ATOM   2255 N  NH1   . ARG A 1 297 ? 89.728  -31.523 92.880  1.00 174.65 ? 297 ARG A NH1   1 
ATOM   2256 N  NH2   . ARG A 1 297 ? 89.488  -32.763 94.792  1.00 154.44 ? 297 ARG A NH2   1 
ATOM   2257 N  N     . ILE A 1 298 ? 83.939  -28.979 92.948  1.00 91.85  ? 298 ILE A N     1 
ATOM   2258 C  CA    . ILE A 1 298 ? 84.394  -27.606 92.785  1.00 94.29  ? 298 ILE A CA    1 
ATOM   2259 C  C     . ILE A 1 298 ? 85.670  -27.379 93.582  1.00 95.84  ? 298 ILE A C     1 
ATOM   2260 O  O     . ILE A 1 298 ? 85.736  -27.700 94.767  1.00 95.94  ? 298 ILE A O     1 
ATOM   2261 C  CB    . ILE A 1 298 ? 83.335  -26.607 93.260  1.00 96.03  ? 298 ILE A CB    1 
ATOM   2262 C  CG1   . ILE A 1 298 ? 82.010  -26.869 92.538  1.00 94.28  ? 298 ILE A CG1   1 
ATOM   2263 C  CG2   . ILE A 1 298 ? 83.828  -25.183 93.063  1.00 99.56  ? 298 ILE A CG2   1 
ATOM   2264 C  CD1   . ILE A 1 298 ? 80.815  -26.184 93.160  1.00 101.53 ? 298 ILE A CD1   1 
ATOM   2265 N  N     . ALA A 1 299 ? 86.686  -26.843 92.921  1.00 97.06  ? 299 ALA A N     1 
ATOM   2266 C  CA    . ALA A 1 299 ? 87.953  -26.550 93.569  1.00 98.69  ? 299 ALA A CA    1 
ATOM   2267 C  C     . ALA A 1 299 ? 88.060  -25.044 93.781  1.00 102.29 ? 299 ALA A C     1 
ATOM   2268 O  O     . ALA A 1 299 ? 88.011  -24.266 92.824  1.00 104.98 ? 299 ALA A O     1 
ATOM   2269 N  N     . ILE A 1 300 ? 88.185  -24.641 95.044  1.00 104.38 ? 300 ILE A N     1 
ATOM   2270 C  CA    . ILE A 1 300 ? 88.479  -23.260 95.410  1.00 114.16 ? 300 ILE A CA    1 
ATOM   2271 C  C     . ILE A 1 300 ? 89.914  -23.233 95.928  1.00 119.71 ? 300 ILE A C     1 
ATOM   2272 O  O     . ILE A 1 300 ? 90.158  -23.405 97.128  1.00 125.26 ? 300 ILE A O     1 
ATOM   2273 C  CB    . ILE A 1 300 ? 87.527  -22.750 96.516  1.00 126.60 ? 300 ILE A CB    1 
ATOM   2274 C  CG1   . ILE A 1 300 ? 86.076  -22.807 96.049  1.00 124.55 ? 300 ILE A CG1   1 
ATOM   2275 C  CG2   . ILE A 1 300 ? 87.881  -21.327 96.934  1.00 138.82 ? 300 ILE A CG2   1 
ATOM   2276 C  CD1   . ILE A 1 300 ? 85.104  -22.323 97.092  1.00 124.59 ? 300 ILE A CD1   1 
ATOM   2277 N  N     . GLU A 1 301 ? 90.860  -23.040 95.012  1.00 122.21 ? 301 GLU A N     1 
ATOM   2278 C  CA    . GLU A 1 301 ? 92.278  -23.000 95.351  1.00 133.46 ? 301 GLU A CA    1 
ATOM   2279 C  C     . GLU A 1 301 ? 92.624  -21.722 96.117  1.00 166.91 ? 301 GLU A C     1 
ATOM   2280 O  O     . GLU A 1 301 ? 92.230  -20.625 95.726  1.00 174.08 ? 301 GLU A O     1 
ATOM   2281 C  CB    . GLU A 1 301 ? 93.129  -23.113 94.082  1.00 129.17 ? 301 GLU A CB    1 
ATOM   2282 C  CG    . GLU A 1 301 ? 94.607  -23.386 94.333  1.00 138.13 ? 301 GLU A CG    1 
ATOM   2283 C  CD    . GLU A 1 301 ? 95.379  -23.646 93.049  1.00 144.36 ? 301 GLU A CD    1 
ATOM   2284 O  OE1   . GLU A 1 301 ? 96.085  -22.728 92.584  1.00 153.43 ? 301 GLU A OE1   1 
ATOM   2285 O  OE2   . GLU A 1 301 ? 95.287  -24.767 92.506  1.00 137.36 ? 301 GLU A OE2   1 
ATOM   2286 N  N     . LEU A 1 302 ? 93.360  -21.866 97.212  1.00 192.49 ? 302 LEU A N     1 
ATOM   2287 C  CA    . LEU A 1 302 ? 93.724  -20.707 98.018  1.00 211.34 ? 302 LEU A CA    1 
ATOM   2288 C  C     . LEU A 1 302 ? 95.178  -20.287 97.811  1.00 210.86 ? 302 LEU A C     1 
ATOM   2289 O  O     . LEU A 1 302 ? 96.019  -21.092 97.411  1.00 201.00 ? 302 LEU A O     1 
ATOM   2290 C  CB    . LEU A 1 302 ? 93.428  -20.980 99.486  1.00 211.34 ? 302 LEU A CB    1 
ATOM   2291 C  CG    . LEU A 1 302 ? 91.940  -21.249 99.690  1.00 190.54 ? 302 LEU A CG    1 
ATOM   2292 C  CD1   . LEU A 1 302 ? 91.692  -21.938 101.007 1.00 183.70 ? 302 LEU A CD1   1 
ATOM   2293 C  CD2   . LEU A 1 302 ? 91.123  -19.959 99.583  1.00 179.17 ? 302 LEU A CD2   1 
ATOM   2294 N  N     . LYS A 1 303 ? 95.457  -19.011 98.059  1.00 210.48 ? 303 LYS A N     1 
ATOM   2295 C  CA    . LYS A 1 303 ? 96.818  -18.491 97.991  1.00 193.55 ? 303 LYS A CA    1 
ATOM   2296 C  C     . LYS A 1 303 ? 97.660  -19.004 99.163  1.00 184.23 ? 303 LYS A C     1 
ATOM   2297 O  O     . LYS A 1 303 ? 97.122  -19.421 100.195 1.00 188.35 ? 303 LYS A O     1 
ATOM   2298 C  CB    . LYS A 1 303 ? 96.803  -16.956 97.998  1.00 181.27 ? 303 LYS A CB    1 
ATOM   2299 C  CG    . LYS A 1 303 ? 96.311  -16.297 96.703  1.00 163.96 ? 303 LYS A CG    1 
ATOM   2300 C  CD    . LYS A 1 303 ? 96.043  -14.807 96.922  1.00 153.58 ? 303 LYS A CD    1 
ATOM   2301 C  CE    . LYS A 1 303 ? 95.703  -14.069 95.634  1.00 149.20 ? 303 LYS A CE    1 
ATOM   2302 N  NZ    . LYS A 1 303 ? 95.249  -12.680 95.941  1.00 152.58 ? 303 LYS A NZ    1 
ATOM   2303 N  N     . LYS A 1 304 ? 98.981  -18.976 98.997  1.00 172.81 ? 304 LYS A N     1 
ATOM   2304 C  CA    . LYS A 1 304 ? 99.899  -19.313 100.085 1.00 174.30 ? 304 LYS A CA    1 
ATOM   2305 C  C     . LYS A 1 304 ? 99.678  -18.374 101.272 1.00 181.58 ? 304 LYS A C     1 
ATOM   2306 O  O     . LYS A 1 304 ? 99.622  -17.154 101.110 1.00 193.51 ? 304 LYS A O     1 
ATOM   2307 C  CB    . LYS A 1 304 ? 101.354 -19.235 99.613  1.00 177.25 ? 304 LYS A CB    1 
ATOM   2308 N  N     . ASP A 1 305 ? 99.545  -18.942 102.463 1.00 175.54 ? 305 ASP A N     1 
ATOM   2309 C  CA    . ASP A 1 305 ? 99.356  -18.116 103.649 1.00 175.75 ? 305 ASP A CA    1 
ATOM   2310 C  C     . ASP A 1 305 ? 97.990  -17.434 103.595 1.00 171.82 ? 305 ASP A C     1 
ATOM   2311 O  O     . ASP A 1 305 ? 97.846  -16.251 103.915 1.00 185.31 ? 305 ASP A O     1 
ATOM   2312 C  CB    . ASP A 1 305 ? 100.486 -17.080 103.774 1.00 183.83 ? 305 ASP A CB    1 
ATOM   2313 N  N     . ALA A 1 306 ? 96.989  -18.198 103.171 1.00 162.48 ? 306 ALA A N     1 
ATOM   2314 C  CA    . ALA A 1 306 ? 95.614  -17.726 103.131 1.00 164.07 ? 306 ALA A CA    1 
ATOM   2315 C  C     . ALA A 1 306 ? 94.844  -18.368 104.270 1.00 170.37 ? 306 ALA A C     1 
ATOM   2316 O  O     . ALA A 1 306 ? 94.932  -19.581 104.480 1.00 149.35 ? 306 ALA A O     1 
ATOM   2317 C  CB    . ALA A 1 306 ? 94.980  -18.076 101.802 1.00 162.20 ? 306 ALA A CB    1 
ATOM   2318 N  N     . ASN A 1 307 ? 94.093  -17.557 105.008 1.00 199.44 ? 307 ASN A N     1 
ATOM   2319 C  CA    . ASN A 1 307 ? 93.326  -18.066 106.145 1.00 79.21  ? 307 ASN A CA    1 
ATOM   2320 C  C     . ASN A 1 307 ? 92.070  -18.837 105.717 1.00 72.17  ? 307 ASN A C     1 
ATOM   2321 O  O     . ASN A 1 307 ? 90.988  -18.255 105.568 1.00 69.14  ? 307 ASN A O     1 
ATOM   2322 C  CB    . ASN A 1 307 ? 92.968  -16.932 107.109 1.00 88.08  ? 307 ASN A CB    1 
ATOM   2323 C  CG    . ASN A 1 307 ? 91.986  -17.367 108.169 1.00 99.07  ? 307 ASN A CG    1 
ATOM   2324 O  OD1   . ASN A 1 307 ? 91.694  -18.558 108.315 1.00 95.59  ? 307 ASN A OD1   1 
ATOM   2325 N  ND2   . ASN A 1 307 ? 91.461  -16.404 108.919 1.00 109.03 ? 307 ASN A ND2   1 
ATOM   2326 N  N     . THR A 1 308 ? 92.209  -20.147 105.542 1.00 243.86 ? 308 THR A N     1 
ATOM   2327 C  CA    . THR A 1 308 ? 91.151  -20.918 104.911 1.00 239.71 ? 308 THR A CA    1 
ATOM   2328 C  C     . THR A 1 308 ? 89.826  -20.921 105.686 1.00 214.00 ? 308 THR A C     1 
ATOM   2329 O  O     . THR A 1 308 ? 88.757  -21.011 105.095 1.00 205.73 ? 308 THR A O     1 
ATOM   2330 C  CB    . THR A 1 308 ? 91.617  -22.350 104.501 1.00 182.32 ? 308 THR A CB    1 
ATOM   2331 O  OG1   . THR A 1 308 ? 91.097  -23.326 105.408 1.00 187.05 ? 308 THR A OG1   1 
ATOM   2332 C  CG2   . THR A 1 308 ? 93.135  -22.435 104.448 1.00 191.65 ? 308 THR A CG2   1 
ATOM   2333 N  N     . GLU A 1 309 ? 89.880  -20.795 106.998 1.00 194.03 ? 309 GLU A N     1 
ATOM   2334 C  CA    . GLU A 1 309 ? 88.642  -20.765 107.761 1.00 188.87 ? 309 GLU A CA    1 
ATOM   2335 C  C     . GLU A 1 309 ? 87.888  -19.471 107.471 1.00 191.18 ? 309 GLU A C     1 
ATOM   2336 O  O     . GLU A 1 309 ? 86.663  -19.476 107.361 1.00 189.27 ? 309 GLU A O     1 
ATOM   2337 C  CB    . GLU A 1 309 ? 88.899  -20.929 109.270 1.00 185.25 ? 309 GLU A CB    1 
ATOM   2338 N  N     . LEU A 1 310 ? 88.617  -18.362 107.347 1.00 208.93 ? 310 LEU A N     1 
ATOM   2339 C  CA    . LEU A 1 310 ? 87.971  -17.074 107.093 1.00 237.45 ? 310 LEU A CA    1 
ATOM   2340 C  C     . LEU A 1 310 ? 87.264  -17.118 105.742 1.00 228.93 ? 310 LEU A C     1 
ATOM   2341 O  O     . LEU A 1 310 ? 86.096  -16.747 105.638 1.00 217.35 ? 310 LEU A O     1 
ATOM   2342 C  CB    . LEU A 1 310 ? 88.965  -15.895 107.166 1.00 267.51 ? 310 LEU A CB    1 
ATOM   2343 N  N     . VAL A 1 311 ? 87.973  -17.585 104.716 1.00 229.74 ? 311 VAL A N     1 
ATOM   2344 C  CA    . VAL A 1 311 ? 87.412  -17.672 103.369 1.00 224.98 ? 311 VAL A CA    1 
ATOM   2345 C  C     . VAL A 1 311 ? 86.157  -18.551 103.347 1.00 236.29 ? 311 VAL A C     1 
ATOM   2346 O  O     . VAL A 1 311 ? 85.116  -18.154 102.817 1.00 245.83 ? 311 VAL A O     1 
ATOM   2347 C  CB    . VAL A 1 311 ? 88.444  -18.209 102.348 1.00 206.39 ? 311 VAL A CB    1 
ATOM   2348 C  CG1   . VAL A 1 311 ? 87.745  -18.693 101.081 1.00 198.09 ? 311 VAL A CG1   1 
ATOM   2349 C  CG2   . VAL A 1 311 ? 89.499  -17.145 102.020 1.00 200.62 ? 311 VAL A CG2   1 
ATOM   2350 N  N     . LEU A 1 312 ? 86.258  -19.735 103.945 1.00 232.82 ? 312 LEU A N     1 
ATOM   2351 C  CA    . LEU A 1 312 ? 85.144  -20.673 103.966 1.00 221.68 ? 312 LEU A CA    1 
ATOM   2352 C  C     . LEU A 1 312 ? 83.909  -20.060 104.603 1.00 215.27 ? 312 LEU A C     1 
ATOM   2353 O  O     . LEU A 1 312 ? 82.822  -20.044 104.014 1.00 225.32 ? 312 LEU A O     1 
ATOM   2354 C  CB    . LEU A 1 312 ? 85.525  -21.950 104.701 1.00 210.28 ? 312 LEU A CB    1 
ATOM   2355 C  CG    . LEU A 1 312 ? 84.562  -23.077 104.352 1.00 196.95 ? 312 LEU A CG    1 
ATOM   2356 C  CD1   . LEU A 1 312 ? 84.316  -23.128 102.814 1.00 193.56 ? 312 LEU A CD1   1 
ATOM   2357 C  CD2   . LEU A 1 312 ? 85.107  -24.381 104.879 1.00 188.55 ? 312 LEU A CD2   1 
ATOM   2358 N  N     . ASN A 1 313 ? 84.085  -19.559 105.815 1.00 191.10 ? 313 ASN A N     1 
ATOM   2359 C  CA    . ASN A 1 313 ? 83.003  -18.903 106.530 1.00 168.30 ? 313 ASN A CA    1 
ATOM   2360 C  C     . ASN A 1 313 ? 82.367  -17.767 105.726 1.00 164.31 ? 313 ASN A C     1 
ATOM   2361 O  O     . ASN A 1 313 ? 81.145  -17.630 105.685 1.00 159.85 ? 313 ASN A O     1 
ATOM   2362 C  CB    . ASN A 1 313 ? 83.499  -18.391 107.888 1.00 171.59 ? 313 ASN A CB    1 
ATOM   2363 C  CG    . ASN A 1 313 ? 83.378  -19.437 109.005 1.00 170.32 ? 313 ASN A CG    1 
ATOM   2364 O  OD1   . ASN A 1 313 ? 83.330  -20.648 108.765 1.00 158.44 ? 313 ASN A OD1   1 
ATOM   2365 N  ND2   . ASN A 1 313 ? 83.325  -18.954 110.238 1.00 181.56 ? 313 ASN A ND2   1 
ATOM   2366 N  N     . TYR A 1 314 ? 83.191  -16.959 105.069 1.00 178.32 ? 314 TYR A N     1 
ATOM   2367 C  CA    . TYR A 1 314 ? 82.664  -15.854 104.279 1.00 194.09 ? 314 TYR A CA    1 
ATOM   2368 C  C     . TYR A 1 314 ? 81.814  -16.358 103.113 1.00 218.96 ? 314 TYR A C     1 
ATOM   2369 O  O     . TYR A 1 314 ? 80.723  -15.824 102.848 1.00 226.10 ? 314 TYR A O     1 
ATOM   2370 C  CB    . TYR A 1 314 ? 83.773  -14.939 103.775 1.00 182.31 ? 314 TYR A CB    1 
ATOM   2371 C  CG    . TYR A 1 314 ? 83.241  -13.831 102.905 1.00 170.96 ? 314 TYR A CG    1 
ATOM   2372 C  CD1   . TYR A 1 314 ? 83.146  -13.991 101.516 1.00 169.82 ? 314 TYR A CD1   1 
ATOM   2373 C  CD2   . TYR A 1 314 ? 82.792  -12.634 103.465 1.00 168.81 ? 314 TYR A CD2   1 
ATOM   2374 C  CE1   . TYR A 1 314 ? 82.639  -12.981 100.713 1.00 169.34 ? 314 TYR A CE1   1 
ATOM   2375 C  CE2   . TYR A 1 314 ? 82.285  -11.613 102.663 1.00 170.83 ? 314 TYR A CE2   1 
ATOM   2376 C  CZ    . TYR A 1 314 ? 82.210  -11.794 101.293 1.00 173.80 ? 314 TYR A CZ    1 
ATOM   2377 O  OH    . TYR A 1 314 ? 81.702  -10.793 100.500 1.00 183.90 ? 314 TYR A OH    1 
ATOM   2378 N  N     . LEU A 1 315 ? 82.311  -17.384 102.421 1.00 228.83 ? 315 LEU A N     1 
ATOM   2379 C  CA    . LEU A 1 315 ? 81.555  -17.983 101.332 1.00 230.96 ? 315 LEU A CA    1 
ATOM   2380 C  C     . LEU A 1 315 ? 80.257  -18.589 101.864 1.00 221.67 ? 315 LEU A C     1 
ATOM   2381 O  O     . LEU A 1 315 ? 79.224  -18.517 101.203 1.00 213.79 ? 315 LEU A O     1 
ATOM   2382 C  CB    . LEU A 1 315 ? 82.381  -19.021 100.565 1.00 233.54 ? 315 LEU A CB    1 
ATOM   2383 C  CG    . LEU A 1 315 ? 83.560  -18.454 99.762  1.00 231.66 ? 315 LEU A CG    1 
ATOM   2384 C  CD1   . LEU A 1 315 ? 84.434  -19.568 99.193  1.00 229.61 ? 315 LEU A CD1   1 
ATOM   2385 C  CD2   . LEU A 1 315 ? 83.104  -17.496 98.656  1.00 228.18 ? 315 LEU A CD2   1 
ATOM   2386 N  N     . PHE A 1 316 ? 80.299  -19.166 103.061 1.00 216.10 ? 316 PHE A N     1 
ATOM   2387 C  CA    . PHE A 1 316 ? 79.086  -19.759 103.621 1.00 203.84 ? 316 PHE A CA    1 
ATOM   2388 C  C     . PHE A 1 316 ? 77.995  -18.707 103.814 1.00 192.94 ? 316 PHE A C     1 
ATOM   2389 O  O     . PHE A 1 316 ? 76.802  -19.001 103.636 1.00 179.47 ? 316 PHE A O     1 
ATOM   2390 C  CB    . PHE A 1 316 ? 79.364  -20.471 104.957 1.00 206.55 ? 316 PHE A CB    1 
ATOM   2391 C  CG    . PHE A 1 316 ? 79.894  -21.872 104.812 1.00 221.18 ? 316 PHE A CG    1 
ATOM   2392 C  CD1   . PHE A 1 316 ? 80.797  -22.380 105.722 1.00 235.38 ? 316 PHE A CD1   1 
ATOM   2393 C  CD2   . PHE A 1 316 ? 79.480  -22.684 103.775 1.00 228.90 ? 316 PHE A CD2   1 
ATOM   2394 C  CE1   . PHE A 1 316 ? 81.284  -23.665 105.593 1.00 247.01 ? 316 PHE A CE1   1 
ATOM   2395 C  CE2   . PHE A 1 316 ? 79.959  -23.974 103.650 1.00 240.33 ? 316 PHE A CE2   1 
ATOM   2396 C  CZ    . PHE A 1 316 ? 80.862  -24.464 104.558 1.00 248.19 ? 316 PHE A CZ    1 
ATOM   2397 N  N     . LYS A 1 317 ? 78.409  -17.491 104.180 1.00 198.78 ? 317 LYS A N     1 
ATOM   2398 C  CA    . LYS A 1 317 ? 77.472  -16.423 104.546 1.00 200.70 ? 317 LYS A CA    1 
ATOM   2399 C  C     . LYS A 1 317 ? 77.046  -15.597 103.328 1.00 213.26 ? 317 LYS A C     1 
ATOM   2400 O  O     . LYS A 1 317 ? 75.885  -15.227 103.186 1.00 202.31 ? 317 LYS A O     1 
ATOM   2401 C  CB    . LYS A 1 317 ? 78.079  -15.527 105.653 1.00 189.69 ? 317 LYS A CB    1 
ATOM   2402 C  CG    . LYS A 1 317 ? 77.364  -14.168 105.928 1.00 197.95 ? 317 LYS A CG    1 
ATOM   2403 C  CD    . LYS A 1 317 ? 77.777  -13.562 107.296 1.00 242.30 ? 317 LYS A CD    1 
ATOM   2404 C  CE    . LYS A 1 317 ? 77.787  -12.017 107.342 1.00 264.91 ? 317 LYS A CE    1 
ATOM   2405 N  NZ    . LYS A 1 317 ? 76.491  -11.352 107.669 1.00 285.04 ? 317 LYS A NZ    1 
ATOM   2406 N  N     . TYR A 1 318 ? 77.991  -15.327 102.444 1.00 226.28 ? 318 TYR A N     1 
ATOM   2407 C  CA    . TYR A 1 318 ? 77.744  -14.418 101.333 1.00 210.54 ? 318 TYR A CA    1 
ATOM   2408 C  C     . TYR A 1 318 ? 77.495  -15.089 99.965  1.00 189.18 ? 318 TYR A C     1 
ATOM   2409 O  O     . TYR A 1 318 ? 77.329  -14.413 98.936  1.00 171.03 ? 318 TYR A O     1 
ATOM   2410 C  CB    . TYR A 1 318 ? 78.876  -13.388 101.267 1.00 201.84 ? 318 TYR A CB    1 
ATOM   2411 C  CG    . TYR A 1 318 ? 78.773  -12.387 102.379 1.00 186.05 ? 318 TYR A CG    1 
ATOM   2412 C  CD1   . TYR A 1 318 ? 77.975  -11.255 102.236 1.00 179.22 ? 318 TYR A CD1   1 
ATOM   2413 C  CD2   . TYR A 1 318 ? 79.444  -12.582 103.582 1.00 178.77 ? 318 TYR A CD2   1 
ATOM   2414 C  CE1   . TYR A 1 318 ? 77.853  -10.344 103.243 1.00 178.31 ? 318 TYR A CE1   1 
ATOM   2415 C  CE2   . TYR A 1 318 ? 79.334  -11.667 104.605 1.00 176.90 ? 318 TYR A CE2   1 
ATOM   2416 C  CZ    . TYR A 1 318 ? 78.534  -10.549 104.435 1.00 182.51 ? 318 TYR A CZ    1 
ATOM   2417 O  OH    . TYR A 1 318 ? 78.408  -9.629  105.456 1.00 192.52 ? 318 TYR A OH    1 
ATOM   2418 N  N     . THR A 1 319 ? 77.477  -16.415 99.952  1.00 184.92 ? 319 THR A N     1 
ATOM   2419 C  CA    . THR A 1 319 ? 76.988  -17.125 98.784  1.00 177.59 ? 319 THR A CA    1 
ATOM   2420 C  C     . THR A 1 319 ? 75.971  -18.182 99.196  1.00 172.10 ? 319 THR A C     1 
ATOM   2421 O  O     . THR A 1 319 ? 75.498  -18.213 100.352 1.00 171.98 ? 319 THR A O     1 
ATOM   2422 C  CB    . THR A 1 319 ? 78.128  -17.754 97.924  1.00 159.07 ? 319 THR A CB    1 
ATOM   2423 O  OG1   . THR A 1 319 ? 78.671  -18.904 98.584  1.00 158.28 ? 319 THR A OG1   1 
ATOM   2424 C  CG2   . THR A 1 319 ? 79.225  -16.762 97.680  1.00 162.53 ? 319 THR A CG2   1 
ATOM   2425 N  N     . ASP A 1 320 ? 75.599  -18.998 98.216  1.00 186.40 ? 320 ASP A N     1 
ATOM   2426 C  CA    . ASP A 1 320 ? 74.660  -20.079 98.417  1.00 205.50 ? 320 ASP A CA    1 
ATOM   2427 C  C     . ASP A 1 320 ? 75.441  -21.363 98.669  1.00 187.95 ? 320 ASP A C     1 
ATOM   2428 O  O     . ASP A 1 320 ? 74.867  -22.455 98.696  1.00 180.34 ? 320 ASP A O     1 
ATOM   2429 C  CB    . ASP A 1 320 ? 73.706  -20.214 97.224  1.00 233.88 ? 320 ASP A CB    1 
ATOM   2430 C  CG    . ASP A 1 320 ? 72.624  -19.138 97.216  1.00 243.98 ? 320 ASP A CG    1 
ATOM   2431 O  OD1   . ASP A 1 320 ? 72.466  -18.454 98.246  1.00 238.91 ? 320 ASP A OD1   1 
ATOM   2432 O  OD2   . ASP A 1 320 ? 71.921  -18.975 96.196  1.00 250.85 ? 320 ASP A OD2   1 
ATOM   2433 N  N     . LEU A 1 321 ? 76.750  -21.235 98.878  1.00 174.50 ? 321 LEU A N     1 
ATOM   2434 C  CA    . LEU A 1 321 ? 77.530  -22.357 99.386  1.00 158.82 ? 321 LEU A CA    1 
ATOM   2435 C  C     . LEU A 1 321 ? 76.819  -22.903 100.631 1.00 150.38 ? 321 LEU A C     1 
ATOM   2436 O  O     . LEU A 1 321 ? 76.959  -24.078 100.996 1.00 149.15 ? 321 LEU A O     1 
ATOM   2437 C  CB    . LEU A 1 321 ? 78.935  -21.898 99.739  1.00 156.82 ? 321 LEU A CB    1 
ATOM   2438 C  CG    . LEU A 1 321 ? 80.060  -22.823 99.299  1.00 161.06 ? 321 LEU A CG    1 
ATOM   2439 C  CD1   . LEU A 1 321 ? 80.821  -23.363 100.489 1.00 169.61 ? 321 LEU A CD1   1 
ATOM   2440 C  CD2   . LEU A 1 321 ? 79.501  -23.948 98.429  1.00 155.75 ? 321 LEU A CD2   1 
ATOM   2441 N  N     . GLN A 1 322 ? 76.057  -22.013 101.268 1.00 149.96 ? 322 GLN A N     1 
ATOM   2442 C  CA    . GLN A 1 322 ? 75.188  -22.321 102.384 1.00 147.89 ? 322 GLN A CA    1 
ATOM   2443 C  C     . GLN A 1 322 ? 73.990  -21.392 102.333 1.00 147.22 ? 322 GLN A C     1 
ATOM   2444 O  O     . GLN A 1 322 ? 74.166  -20.161 102.235 1.00 154.69 ? 322 GLN A O     1 
ATOM   2445 C  CB    . GLN A 1 322 ? 75.906  -22.141 103.741 1.00 185.73 ? 322 GLN A CB    1 
ATOM   2446 C  CG    . GLN A 1 322 ? 74.964  -22.265 104.953 1.00 212.13 ? 322 GLN A CG    1 
ATOM   2447 C  CD    . GLN A 1 322 ? 75.675  -22.062 106.300 1.00 245.23 ? 322 GLN A CD    1 
ATOM   2448 O  OE1   . GLN A 1 322 ? 76.810  -22.504 106.491 1.00 240.22 ? 322 GLN A OE1   1 
ATOM   2449 N  NE2   . GLN A 1 322 ? 75.002  -21.394 107.237 1.00 271.93 ? 322 GLN A NE2   1 
ATOM   2450 N  N     . ILE A 1 323 ? 72.809  -21.997 102.496 1.00 144.85 ? 323 ILE A N     1 
ATOM   2451 C  CA    . ILE A 1 323 ? 71.516  -21.329 102.477 1.00 169.31 ? 323 ILE A CA    1 
ATOM   2452 C  C     . ILE A 1 323 ? 70.647  -21.733 103.667 1.00 149.17 ? 323 ILE A C     1 
ATOM   2453 O  O     . ILE A 1 323 ? 70.894  -22.732 104.343 1.00 144.58 ? 323 ILE A O     1 
ATOM   2454 C  CB    . ILE A 1 323 ? 70.689  -21.759 101.241 1.00 208.86 ? 323 ILE A CB    1 
ATOM   2455 C  CG1   . ILE A 1 323 ? 70.133  -23.176 101.455 1.00 241.02 ? 323 ILE A CG1   1 
ATOM   2456 C  CG2   . ILE A 1 323 ? 71.503  -21.635 99.931  1.00 212.51 ? 323 ILE A CG2   1 
ATOM   2457 C  CD1   . ILE A 1 323 ? 69.309  -23.677 100.291 1.00 259.81 ? 323 ILE A CD1   1 
ATOM   2458 N  N     . ASN A 1 324 ? 69.599  -20.948 103.889 1.00 150.66 ? 324 ASN A N     1 
ATOM   2459 C  CA    . ASN A 1 324 ? 68.523  -21.322 104.783 1.00 154.05 ? 324 ASN A CA    1 
ATOM   2460 C  C     . ASN A 1 324 ? 67.425  -22.013 103.985 1.00 170.44 ? 324 ASN A C     1 
ATOM   2461 O  O     . ASN A 1 324 ? 67.060  -21.539 102.923 1.00 166.25 ? 324 ASN A O     1 
ATOM   2462 C  CB    . ASN A 1 324 ? 67.927  -20.073 105.439 1.00 144.54 ? 324 ASN A CB    1 
ATOM   2463 C  CG    . ASN A 1 324 ? 68.958  -19.241 106.212 1.00 143.68 ? 324 ASN A CG    1 
ATOM   2464 O  OD1   . ASN A 1 324 ? 69.879  -19.771 106.833 1.00 143.27 ? 324 ASN A OD1   1 
ATOM   2465 N  ND2   . ASN A 1 324 ? 68.790  -17.929 106.174 1.00 144.66 ? 324 ASN A ND2   1 
ATOM   2466 N  N     . TYR A 1 325 ? 66.894  -23.124 104.480 1.00 192.92 ? 325 TYR A N     1 
ATOM   2467 C  CA    . TYR A 1 325 ? 65.743  -23.745 103.836 1.00 206.48 ? 325 TYR A CA    1 
ATOM   2468 C  C     . TYR A 1 325 ? 64.512  -23.622 104.715 1.00 174.15 ? 325 TYR A C     1 
ATOM   2469 O  O     . TYR A 1 325 ? 64.525  -24.051 105.869 1.00 152.43 ? 325 TYR A O     1 
ATOM   2470 C  CB    . TYR A 1 325 ? 65.995  -25.219 103.491 1.00 234.29 ? 325 TYR A CB    1 
ATOM   2471 C  CG    . TYR A 1 325 ? 64.773  -25.883 102.907 1.00 226.41 ? 325 TYR A CG    1 
ATOM   2472 C  CD1   . TYR A 1 325 ? 63.771  -26.393 103.733 1.00 198.97 ? 325 TYR A CD1   1 
ATOM   2473 C  CD2   . TYR A 1 325 ? 64.598  -25.978 101.515 1.00 220.24 ? 325 TYR A CD2   1 
ATOM   2474 C  CE1   . TYR A 1 325 ? 62.626  -26.989 103.194 1.00 170.14 ? 325 TYR A CE1   1 
ATOM   2475 C  CE2   . TYR A 1 325 ? 63.459  -26.576 100.963 1.00 190.52 ? 325 TYR A CE2   1 
ATOM   2476 C  CZ    . TYR A 1 325 ? 62.476  -27.079 101.808 1.00 164.81 ? 325 TYR A CZ    1 
ATOM   2477 O  OH    . TYR A 1 325 ? 61.344  -27.663 101.284 1.00 125.16 ? 325 TYR A OH    1 
ATOM   2478 N  N     . ASN A 1 326 ? 63.449  -23.050 104.165 1.00 166.05 ? 326 ASN A N     1 
ATOM   2479 C  CA    . ASN A 1 326 ? 62.202  -22.831 104.899 1.00 150.78 ? 326 ASN A CA    1 
ATOM   2480 C  C     . ASN A 1 326 ? 61.079  -23.809 104.579 1.00 133.89 ? 326 ASN A C     1 
ATOM   2481 O  O     . ASN A 1 326 ? 60.567  -23.817 103.465 1.00 136.97 ? 326 ASN A O     1 
ATOM   2482 C  CB    . ASN A 1 326 ? 61.680  -21.409 104.666 1.00 148.35 ? 326 ASN A CB    1 
ATOM   2483 C  CG    . ASN A 1 326 ? 62.518  -20.368 105.360 1.00 146.92 ? 326 ASN A CG    1 
ATOM   2484 O  OD1   . ASN A 1 326 ? 62.293  -20.051 106.531 1.00 164.90 ? 326 ASN A OD1   1 
ATOM   2485 N  ND2   . ASN A 1 326 ? 63.493  -19.825 104.646 1.00 153.75 ? 326 ASN A ND2   1 
ATOM   2486 N  N     . PHE A 1 327 ? 60.698  -24.616 105.565 1.00 129.86 ? 327 PHE A N     1 
ATOM   2487 C  CA    . PHE A 1 327 ? 59.487  -25.413 105.493 1.00 130.93 ? 327 PHE A CA    1 
ATOM   2488 C  C     . PHE A 1 327 ? 58.287  -24.480 105.440 1.00 126.44 ? 327 PHE A C     1 
ATOM   2489 O  O     . PHE A 1 327 ? 58.250  -23.459 106.122 1.00 127.65 ? 327 PHE A O     1 
ATOM   2490 C  CB    . PHE A 1 327 ? 59.328  -26.295 106.726 1.00 141.90 ? 327 PHE A CB    1 
ATOM   2491 C  CG    . PHE A 1 327 ? 60.275  -27.459 106.802 1.00 165.91 ? 327 PHE A CG    1 
ATOM   2492 C  CD1   . PHE A 1 327 ? 59.837  -28.741 106.513 1.00 171.36 ? 327 PHE A CD1   1 
ATOM   2493 C  CD2   . PHE A 1 327 ? 61.581  -27.289 107.246 1.00 198.55 ? 327 PHE A CD2   1 
ATOM   2494 C  CE1   . PHE A 1 327 ? 60.706  -29.832 106.622 1.00 197.83 ? 327 PHE A CE1   1 
ATOM   2495 C  CE2   . PHE A 1 327 ? 62.453  -28.375 107.360 1.00 223.85 ? 327 PHE A CE2   1 
ATOM   2496 C  CZ    . PHE A 1 327 ? 62.023  -29.642 107.047 1.00 222.46 ? 327 PHE A CZ    1 
ATOM   2497 N  N     . ASN A 1 328 ? 57.306  -24.839 104.627 1.00 125.06 ? 328 ASN A N     1 
ATOM   2498 C  CA    . ASN A 1 328 ? 56.019  -24.163 104.620 1.00 124.69 ? 328 ASN A CA    1 
ATOM   2499 C  C     . ASN A 1 328 ? 55.018  -25.181 104.093 1.00 122.60 ? 328 ASN A C     1 
ATOM   2500 O  O     . ASN A 1 328 ? 54.322  -24.959 103.112 1.00 122.96 ? 328 ASN A O     1 
ATOM   2501 C  CB    . ASN A 1 328 ? 56.065  -22.884 103.775 1.00 129.08 ? 328 ASN A CB    1 
ATOM   2502 C  CG    . ASN A 1 328 ? 54.772  -22.078 103.837 1.00 131.83 ? 328 ASN A CG    1 
ATOM   2503 O  OD1   . ASN A 1 328 ? 54.588  -21.142 103.064 1.00 135.08 ? 328 ASN A OD1   1 
ATOM   2504 N  ND2   . ASN A 1 328 ? 53.874  -22.437 104.742 1.00 136.58 ? 328 ASN A ND2   1 
ATOM   2505 N  N     . MET A 1 329 ? 54.978  -26.318 104.777 1.00 121.36 ? 329 MET A N     1 
ATOM   2506 C  CA    . MET A 1 329 ? 54.169  -27.450 104.379 1.00 127.12 ? 329 MET A CA    1 
ATOM   2507 C  C     . MET A 1 329 ? 52.676  -27.138 104.302 1.00 128.46 ? 329 MET A C     1 
ATOM   2508 O  O     . MET A 1 329 ? 51.944  -27.289 105.287 1.00 125.04 ? 329 MET A O     1 
ATOM   2509 C  CB    . MET A 1 329 ? 54.441  -28.627 105.319 1.00 137.31 ? 329 MET A CB    1 
ATOM   2510 C  CG    . MET A 1 329 ? 55.917  -28.789 105.612 1.00 144.28 ? 329 MET A CG    1 
ATOM   2511 S  SD    . MET A 1 329 ? 56.498  -30.478 105.828 1.00 342.71 ? 329 MET A SD    1 
ATOM   2512 C  CE    . MET A 1 329 ? 55.978  -30.769 107.538 1.00 231.84 ? 329 MET A CE    1 
ATOM   2513 N  N     . VAL A 1 330 ? 52.245  -26.701 103.121 1.00 148.64 ? 330 VAL A N     1 
ATOM   2514 C  CA    . VAL A 1 330 ? 50.827  -26.584 102.778 1.00 169.31 ? 330 VAL A CA    1 
ATOM   2515 C  C     . VAL A 1 330 ? 50.411  -27.631 101.731 1.00 198.85 ? 330 VAL A C     1 
ATOM   2516 O  O     . VAL A 1 330 ? 51.097  -27.837 100.734 1.00 201.21 ? 330 VAL A O     1 
ATOM   2517 C  CB    . VAL A 1 330 ? 50.490  -25.173 102.256 1.00 160.01 ? 330 VAL A CB    1 
ATOM   2518 C  CG1   . VAL A 1 330 ? 49.004  -25.065 101.846 1.00 153.40 ? 330 VAL A CG1   1 
ATOM   2519 C  CG2   . VAL A 1 330 ? 50.824  -24.152 103.326 1.00 158.08 ? 330 VAL A CG2   1 
ATOM   2520 N  N     . ALA A 1 331 ? 49.289  -28.298 101.970 1.00 223.33 ? 331 ALA A N     1 
ATOM   2521 C  CA    . ALA A 1 331 ? 48.775  -29.267 101.022 1.00 242.05 ? 331 ALA A CA    1 
ATOM   2522 C  C     . ALA A 1 331 ? 47.265  -29.131 100.951 1.00 226.38 ? 331 ALA A C     1 
ATOM   2523 O  O     . ALA A 1 331 ? 46.670  -28.355 101.697 1.00 232.42 ? 331 ALA A O     1 
ATOM   2524 C  CB    . ALA A 1 331 ? 49.180  -30.675 101.422 1.00 264.08 ? 331 ALA A CB    1 
ATOM   2525 N  N     . ILE A 1 332 ? 46.641  -29.867 100.041 1.00 200.25 ? 332 ILE A N     1 
ATOM   2526 C  CA    . ILE A 1 332 ? 45.198  -29.792 99.889  1.00 174.98 ? 332 ILE A CA    1 
ATOM   2527 C  C     . ILE A 1 332 ? 44.570  -30.998 100.546 1.00 149.82 ? 332 ILE A C     1 
ATOM   2528 O  O     . ILE A 1 332 ? 44.806  -32.154 100.148 1.00 134.23 ? 332 ILE A O     1 
ATOM   2529 C  CB    . ILE A 1 332 ? 44.752  -29.698 98.394  1.00 139.99 ? 332 ILE A CB    1 
ATOM   2530 C  CG1   . ILE A 1 332 ? 45.120  -28.344 97.814  1.00 142.49 ? 332 ILE A CG1   1 
ATOM   2531 C  CG2   . ILE A 1 332 ? 43.235  -29.843 98.281  1.00 134.83 ? 332 ILE A CG2   1 
ATOM   2532 C  CD1   . ILE A 1 332 ? 44.206  -27.245 98.332  1.00 143.17 ? 332 ILE A CD1   1 
ATOM   2533 N  N     . ASP A 1 333 ? 43.765  -30.710 101.562 1.00 143.43 ? 333 ASP A N     1 
ATOM   2534 C  CA    . ASP A 1 333 ? 43.099  -31.719 102.369 1.00 128.49 ? 333 ASP A CA    1 
ATOM   2535 C  C     . ASP A 1 333 ? 41.610  -31.415 102.288 1.00 115.10 ? 333 ASP A C     1 
ATOM   2536 O  O     . ASP A 1 333 ? 41.187  -30.275 102.524 1.00 108.85 ? 333 ASP A O     1 
ATOM   2537 C  CB    . ASP A 1 333 ? 43.598  -31.643 103.822 1.00 125.20 ? 333 ASP A CB    1 
ATOM   2538 C  CG    . ASP A 1 333 ? 43.065  -32.772 104.698 1.00 120.04 ? 333 ASP A CG    1 
ATOM   2539 O  OD1   . ASP A 1 333 ? 43.750  -33.151 105.667 1.00 128.24 ? 333 ASP A OD1   1 
ATOM   2540 O  OD2   . ASP A 1 333 ? 41.963  -33.283 104.428 1.00 123.72 ? 333 ASP A OD2   1 
ATOM   2541 N  N     . ASN A 1 334 ? 40.819  -32.422 101.927 1.00 111.41 ? 334 ASN A N     1 
ATOM   2542 C  CA    . ASN A 1 334 ? 39.389  -32.215 101.769 1.00 105.40 ? 334 ASN A CA    1 
ATOM   2543 C  C     . ASN A 1 334 ? 39.105  -30.866 101.089 1.00 103.61 ? 334 ASN A C     1 
ATOM   2544 O  O     . ASN A 1 334 ? 38.469  -29.968 101.663 1.00 106.81 ? 334 ASN A O     1 
ATOM   2545 C  CB    . ASN A 1 334 ? 38.691  -32.336 103.130 1.00 108.66 ? 334 ASN A CB    1 
ATOM   2546 C  CG    . ASN A 1 334 ? 37.216  -32.005 103.063 1.00 113.16 ? 334 ASN A CG    1 
ATOM   2547 O  OD1   . ASN A 1 334 ? 36.737  -31.162 103.811 1.00 116.14 ? 334 ASN A OD1   1 
ATOM   2548 N  ND2   . ASN A 1 334 ? 36.492  -32.657 102.158 1.00 110.80 ? 334 ASN A ND2   1 
ATOM   2549 N  N     . PHE A 1 335 ? 39.649  -30.732 99.879  1.00 105.48 ? 335 PHE A N     1 
ATOM   2550 C  CA    . PHE A 1 335 ? 39.348  -29.636 98.957  1.00 106.71 ? 335 PHE A CA    1 
ATOM   2551 C  C     . PHE A 1 335 ? 39.865  -28.267 99.349  1.00 109.97 ? 335 PHE A C     1 
ATOM   2552 O  O     . PHE A 1 335 ? 39.710  -27.306 98.603  1.00 112.79 ? 335 PHE A O     1 
ATOM   2553 C  CB    . PHE A 1 335 ? 37.850  -29.585 98.688  1.00 118.03 ? 335 PHE A CB    1 
ATOM   2554 C  CG    . PHE A 1 335 ? 37.335  -30.819 98.022  1.00 139.73 ? 335 PHE A CG    1 
ATOM   2555 C  CD1   . PHE A 1 335 ? 36.534  -31.713 98.717  1.00 147.80 ? 335 PHE A CD1   1 
ATOM   2556 C  CD2   . PHE A 1 335 ? 37.691  -31.107 96.703  1.00 151.11 ? 335 PHE A CD2   1 
ATOM   2557 C  CE1   . PHE A 1 335 ? 36.075  -32.865 98.103  1.00 152.44 ? 335 PHE A CE1   1 
ATOM   2558 C  CE2   . PHE A 1 335 ? 37.234  -32.246 96.085  1.00 155.77 ? 335 PHE A CE2   1 
ATOM   2559 C  CZ    . PHE A 1 335 ? 36.425  -33.131 96.788  1.00 155.37 ? 335 PHE A CZ    1 
ATOM   2560 N  N     . THR A 1 336 ? 40.492  -28.173 100.510 1.00 110.85 ? 336 THR A N     1 
ATOM   2561 C  CA    . THR A 1 336 ? 40.922  -26.876 100.995 1.00 109.45 ? 336 THR A CA    1 
ATOM   2562 C  C     . THR A 1 336 ? 42.401  -26.891 101.441 1.00 114.59 ? 336 THR A C     1 
ATOM   2563 O  O     . THR A 1 336 ? 42.939  -27.946 101.799 1.00 118.83 ? 336 THR A O     1 
ATOM   2564 C  CB    . THR A 1 336 ? 39.911  -26.354 102.073 1.00 123.60 ? 336 THR A CB    1 
ATOM   2565 O  OG1   . THR A 1 336 ? 40.576  -26.067 103.307 1.00 116.77 ? 336 THR A OG1   1 
ATOM   2566 C  CG2   . THR A 1 336 ? 38.824  -27.388 102.319 1.00 110.45 ? 336 THR A CG2   1 
ATOM   2567 N  N     . PRO A 1 337 ? 43.074  -25.729 101.370 1.00 118.52 ? 337 PRO A N     1 
ATOM   2568 C  CA    . PRO A 1 337 ? 44.488  -25.655 101.772 1.00 128.35 ? 337 PRO A CA    1 
ATOM   2569 C  C     . PRO A 1 337 ? 44.691  -25.753 103.294 1.00 135.18 ? 337 PRO A C     1 
ATOM   2570 O  O     . PRO A 1 337 ? 43.970  -25.124 104.078 1.00 143.39 ? 337 PRO A O     1 
ATOM   2571 C  CB    . PRO A 1 337 ? 44.941  -24.289 101.244 1.00 129.03 ? 337 PRO A CB    1 
ATOM   2572 C  CG    . PRO A 1 337 ? 43.684  -23.489 101.048 1.00 123.36 ? 337 PRO A CG    1 
ATOM   2573 C  CD    . PRO A 1 337 ? 42.571  -24.467 100.793 1.00 117.44 ? 337 PRO A CD    1 
ATOM   2574 N  N     . ARG A 1 338 ? 45.664  -26.564 103.703 1.00 130.49 ? 338 ARG A N     1 
ATOM   2575 C  CA    . ARG A 1 338 ? 45.967  -26.771 105.120 1.00 130.49 ? 338 ARG A CA    1 
ATOM   2576 C  C     . ARG A 1 338 ? 47.457  -26.615 105.355 1.00 127.84 ? 338 ARG A C     1 
ATOM   2577 O  O     . ARG A 1 338 ? 48.276  -27.106 104.582 1.00 126.36 ? 338 ARG A O     1 
ATOM   2578 C  CB    . ARG A 1 338 ? 45.553  -28.176 105.566 1.00 137.93 ? 338 ARG A CB    1 
ATOM   2579 C  CG    . ARG A 1 338 ? 44.334  -28.251 106.451 1.00 136.86 ? 338 ARG A CG    1 
ATOM   2580 C  CD    . ARG A 1 338 ? 44.677  -28.944 107.778 1.00 142.51 ? 338 ARG A CD    1 
ATOM   2581 N  NE    . ARG A 1 338 ? 44.554  -30.406 107.745 1.00 146.14 ? 338 ARG A NE    1 
ATOM   2582 C  CZ    . ARG A 1 338 ? 44.734  -31.196 108.805 1.00 144.48 ? 338 ARG A CZ    1 
ATOM   2583 N  NH1   . ARG A 1 338 ? 45.046  -30.672 109.979 1.00 148.72 ? 338 ARG A NH1   1 
ATOM   2584 N  NH2   . ARG A 1 338 ? 44.601  -32.510 108.697 1.00 152.08 ? 338 ARG A NH2   1 
ATOM   2585 N  N     . GLN A 1 339 ? 47.822  -25.922 106.418 1.00 127.89 ? 339 GLN A N     1 
ATOM   2586 C  CA    . GLN A 1 339 ? 49.196  -25.980 106.848 1.00 122.65 ? 339 GLN A CA    1 
ATOM   2587 C  C     . GLN A 1 339 ? 49.245  -27.194 107.730 1.00 116.07 ? 339 GLN A C     1 
ATOM   2588 O  O     . GLN A 1 339 ? 48.403  -27.348 108.606 1.00 125.78 ? 339 GLN A O     1 
ATOM   2589 C  CB    . GLN A 1 339 ? 49.572  -24.745 107.635 1.00 119.12 ? 339 GLN A CB    1 
ATOM   2590 C  CG    . GLN A 1 339 ? 51.049  -24.592 107.799 1.00 123.01 ? 339 GLN A CG    1 
ATOM   2591 C  CD    . GLN A 1 339 ? 51.396  -23.298 108.466 1.00 132.66 ? 339 GLN A CD    1 
ATOM   2592 O  OE1   . GLN A 1 339 ? 52.202  -23.265 109.392 1.00 141.13 ? 339 GLN A OE1   1 
ATOM   2593 N  NE2   . GLN A 1 339 ? 50.782  -22.215 108.010 1.00 134.89 ? 339 GLN A NE2   1 
ATOM   2594 N  N     . VAL A 1 340 ? 50.206  -28.072 107.492 1.00 115.79 ? 340 VAL A N     1 
ATOM   2595 C  CA    . VAL A 1 340 ? 50.233  -29.339 108.202 1.00 119.32 ? 340 VAL A CA    1 
ATOM   2596 C  C     . VAL A 1 340 ? 51.645  -29.773 108.569 1.00 139.32 ? 340 VAL A C     1 
ATOM   2597 O  O     . VAL A 1 340 ? 52.592  -29.573 107.808 1.00 146.45 ? 340 VAL A O     1 
ATOM   2598 C  CB    . VAL A 1 340 ? 49.575  -30.466 107.375 1.00 112.66 ? 340 VAL A CB    1 
ATOM   2599 C  CG1   . VAL A 1 340 ? 48.109  -30.151 107.099 1.00 111.69 ? 340 VAL A CG1   1 
ATOM   2600 C  CG2   . VAL A 1 340 ? 50.334  -30.651 106.081 1.00 119.14 ? 340 VAL A CG2   1 
ATOM   2601 N  N     . ILE A 1 342 ? 51.832  -32.145 110.476 1.00 111.97 ? 342 ILE A N     1 
ATOM   2602 C  CA    . ILE A 1 342 ? 52.088  -33.538 110.170 1.00 75.44  ? 342 ILE A CA    1 
ATOM   2603 C  C     . ILE A 1 342 ? 50.920  -34.456 110.531 1.00 73.80  ? 342 ILE A C     1 
ATOM   2604 O  O     . ILE A 1 342 ? 50.708  -35.454 109.861 1.00 34.23  ? 342 ILE A O     1 
ATOM   2605 C  CB    . ILE A 1 342 ? 53.343  -34.025 110.904 1.00 65.53  ? 342 ILE A CB    1 
ATOM   2606 C  CG1   . ILE A 1 342 ? 54.302  -34.651 109.912 1.00 80.83  ? 342 ILE A CG1   1 
ATOM   2607 C  CG2   . ILE A 1 342 ? 52.994  -34.996 111.998 1.00 40.71  ? 342 ILE A CG2   1 
ATOM   2608 C  CD1   . ILE A 1 342 ? 54.784  -33.659 108.907 1.00 91.39  ? 342 ILE A CD1   1 
ATOM   2609 N  N     . VAL A 1 343 ? 50.163  -34.126 111.582 1.00 54.80  ? 343 VAL A N     1 
ATOM   2610 C  CA    . VAL A 1 343 ? 49.138  -35.044 112.085 1.00 56.96  ? 343 VAL A CA    1 
ATOM   2611 C  C     . VAL A 1 343 ? 47.895  -35.184 111.186 1.00 68.23  ? 343 VAL A C     1 
ATOM   2612 O  O     . VAL A 1 343 ? 47.512  -36.294 110.835 1.00 60.40  ? 343 VAL A O     1 
ATOM   2613 C  CB    . VAL A 1 343 ? 48.771  -34.766 113.579 1.00 29.23  ? 343 VAL A CB    1 
ATOM   2614 C  CG1   . VAL A 1 343 ? 47.357  -35.222 113.893 1.00 28.30  ? 343 VAL A CG1   1 
ATOM   2615 C  CG2   . VAL A 1 343 ? 49.769  -35.459 114.505 1.00 41.70  ? 343 VAL A CG2   1 
ATOM   2616 N  N     . PRO A 1 344 ? 47.249  -34.072 110.829 1.00 84.39  ? 344 PRO A N     1 
ATOM   2617 C  CA    . PRO A 1 344 ? 46.162  -34.125 109.830 1.00 89.07  ? 344 PRO A CA    1 
ATOM   2618 C  C     . PRO A 1 344 ? 46.600  -34.670 108.451 1.00 86.07  ? 344 PRO A C     1 
ATOM   2619 O  O     . PRO A 1 344 ? 45.796  -35.331 107.787 1.00 96.04  ? 344 PRO A O     1 
ATOM   2620 C  CB    . PRO A 1 344 ? 45.729  -32.658 109.681 1.00 72.01  ? 344 PRO A CB    1 
ATOM   2621 C  CG    . PRO A 1 344 ? 46.135  -31.998 110.929 1.00 69.14  ? 344 PRO A CG    1 
ATOM   2622 C  CD    . PRO A 1 344 ? 47.378  -32.744 111.445 1.00 79.53  ? 344 PRO A CD    1 
ATOM   2623 N  N     . ILE A 1 345 ? 47.828  -34.373 108.023 1.00 56.54  ? 345 ILE A N     1 
ATOM   2624 C  CA    . ILE A 1 345 ? 48.366  -34.917 106.776 1.00 31.98  ? 345 ILE A CA    1 
ATOM   2625 C  C     . ILE A 1 345 ? 48.388  -36.458 106.768 1.00 65.92  ? 345 ILE A C     1 
ATOM   2626 O  O     . ILE A 1 345 ? 47.758  -37.094 105.921 1.00 67.93  ? 345 ILE A O     1 
ATOM   2627 C  CB    . ILE A 1 345 ? 49.789  -34.378 106.503 1.00 33.02  ? 345 ILE A CB    1 
ATOM   2628 C  CG1   . ILE A 1 345 ? 49.735  -32.934 105.988 1.00 54.65  ? 345 ILE A CG1   1 
ATOM   2629 C  CG2   . ILE A 1 345 ? 50.525  -35.274 105.526 1.00 26.27  ? 345 ILE A CG2   1 
ATOM   2630 C  CD1   . ILE A 1 345 ? 51.083  -32.207 106.023 1.00 66.26  ? 345 ILE A CD1   1 
ATOM   2631 N  N     . LEU A 1 346 ? 49.108  -37.044 107.718 1.00 64.86  ? 346 LEU A N     1 
ATOM   2632 C  CA    . LEU A 1 346 ? 49.195  -38.494 107.845 1.00 32.51  ? 346 LEU A CA    1 
ATOM   2633 C  C     . LEU A 1 346 ? 47.842  -39.128 108.072 1.00 60.90  ? 346 LEU A C     1 
ATOM   2634 O  O     . LEU A 1 346 ? 47.591  -40.260 107.671 1.00 61.89  ? 346 LEU A O     1 
ATOM   2635 C  CB    . LEU A 1 346 ? 50.123  -38.878 109.001 1.00 30.47  ? 346 LEU A CB    1 
ATOM   2636 C  CG    . LEU A 1 346 ? 51.586  -38.601 108.649 1.00 63.11  ? 346 LEU A CG    1 
ATOM   2637 C  CD1   . LEU A 1 346 ? 52.513  -39.125 109.696 1.00 51.77  ? 346 LEU A CD1   1 
ATOM   2638 C  CD2   . LEU A 1 346 ? 51.919  -39.229 107.307 1.00 52.92  ? 346 LEU A CD2   1 
ATOM   2639 N  N     . SER A 1 347 ? 46.958  -38.415 108.738 1.00 85.56  ? 347 SER A N     1 
ATOM   2640 C  CA    . SER A 1 347 ? 45.728  -39.069 109.122 1.00 74.23  ? 347 SER A CA    1 
ATOM   2641 C  C     . SER A 1 347 ? 44.786  -39.093 107.925 1.00 89.24  ? 347 SER A C     1 
ATOM   2642 O  O     . SER A 1 347 ? 44.086  -40.091 107.697 1.00 131.92 ? 347 SER A O     1 
ATOM   2643 C  CB    . SER A 1 347 ? 45.099  -38.445 110.392 1.00 67.78  ? 347 SER A CB    1 
ATOM   2644 O  OG    . SER A 1 347 ? 44.257  -37.351 110.071 1.00 88.26  ? 347 SER A OG    1 
ATOM   2645 N  N     . SER A 1 348 ? 44.776  -37.998 107.165 1.00 65.22  ? 348 SER A N     1 
ATOM   2646 C  CA    . SER A 1 348 ? 44.015  -37.929 105.906 1.00 72.86  ? 348 SER A CA    1 
ATOM   2647 C  C     . SER A 1 348 ? 44.505  -39.009 104.959 1.00 55.29  ? 348 SER A C     1 
ATOM   2648 O  O     . SER A 1 348 ? 43.717  -39.725 104.344 1.00 66.60  ? 348 SER A O     1 
ATOM   2649 C  CB    . SER A 1 348 ? 44.171  -36.572 105.238 1.00 76.35  ? 348 SER A CB    1 
ATOM   2650 O  OG    . SER A 1 348 ? 43.480  -35.575 105.971 1.00 72.11  ? 348 SER A OG    1 
ATOM   2651 N  N     . TYR A 1 349 ? 45.817  -39.145 104.877 1.00 35.05  ? 349 TYR A N     1 
ATOM   2652 C  CA    . TYR A 1 349 ? 46.387  -40.167 104.016 1.00 47.32  ? 349 TYR A CA    1 
ATOM   2653 C  C     . TYR A 1 349 ? 45.899  -41.546 104.430 1.00 55.70  ? 349 TYR A C     1 
ATOM   2654 O  O     . TYR A 1 349 ? 45.495  -42.339 103.578 1.00 67.83  ? 349 TYR A O     1 
ATOM   2655 C  CB    . TYR A 1 349 ? 47.924  -40.109 104.009 1.00 26.75  ? 349 TYR A CB    1 
ATOM   2656 C  CG    . TYR A 1 349 ? 48.532  -41.197 103.178 1.00 39.18  ? 349 TYR A CG    1 
ATOM   2657 C  CD1   . TYR A 1 349 ? 48.522  -41.125 101.775 1.00 46.68  ? 349 TYR A CD1   1 
ATOM   2658 C  CD2   . TYR A 1 349 ? 49.101  -42.311 103.778 1.00 41.69  ? 349 TYR A CD2   1 
ATOM   2659 C  CE1   . TYR A 1 349 ? 49.072  -42.141 101.006 1.00 56.11  ? 349 TYR A CE1   1 
ATOM   2660 C  CE2   . TYR A 1 349 ? 49.660  -43.333 103.017 1.00 55.87  ? 349 TYR A CE2   1 
ATOM   2661 C  CZ    . TYR A 1 349 ? 49.636  -43.245 101.630 1.00 54.86  ? 349 TYR A CZ    1 
ATOM   2662 O  OH    . TYR A 1 349 ? 50.194  -44.257 100.879 1.00 43.52  ? 349 TYR A OH    1 
ATOM   2663 N  N     . ILE A 1 350 ? 45.930  -41.817 105.737 1.00 43.42  ? 350 ILE A N     1 
ATOM   2664 C  CA    . ILE A 1 350 ? 45.524  -43.110 106.284 1.00 34.32  ? 350 ILE A CA    1 
ATOM   2665 C  C     . ILE A 1 350 ? 44.037  -43.396 106.014 1.00 41.40  ? 350 ILE A C     1 
ATOM   2666 O  O     . ILE A 1 350 ? 43.656  -44.519 105.677 1.00 46.31  ? 350 ILE A O     1 
ATOM   2667 C  CB    . ILE A 1 350 ? 45.879  -43.194 107.780 1.00 69.84  ? 350 ILE A CB    1 
ATOM   2668 C  CG1   . ILE A 1 350 ? 47.396  -43.382 107.928 1.00 63.99  ? 350 ILE A CG1   1 
ATOM   2669 C  CG2   . ILE A 1 350 ? 45.085  -44.318 108.515 1.00 35.58  ? 350 ILE A CG2   1 
ATOM   2670 C  CD1   . ILE A 1 350 ? 47.904  -43.313 109.379 1.00 30.15  ? 350 ILE A CD1   1 
ATOM   2671 N  N     . ALA A 1 351 ? 43.204  -42.367 106.116 1.00 53.95  ? 351 ALA A N     1 
ATOM   2672 C  CA    . ALA A 1 351 ? 41.774  -42.524 105.874 1.00 46.18  ? 351 ALA A CA    1 
ATOM   2673 C  C     . ALA A 1 351 ? 41.544  -42.747 104.386 1.00 70.15  ? 351 ALA A C     1 
ATOM   2674 O  O     . ALA A 1 351 ? 40.672  -43.509 103.978 1.00 67.77  ? 351 ALA A O     1 
ATOM   2675 C  CB    . ALA A 1 351 ? 41.024  -41.264 106.337 1.00 47.79  ? 351 ALA A CB    1 
ATOM   2676 N  N     . HIS A 1 352 ? 42.339  -42.057 103.580 1.00 65.39  ? 352 HIS A N     1 
ATOM   2677 C  CA    . HIS A 1 352 ? 42.299  -42.236 102.139 1.00 63.71  ? 352 HIS A CA    1 
ATOM   2678 C  C     . HIS A 1 352 ? 42.647  -43.671 101.732 1.00 51.72  ? 352 HIS A C     1 
ATOM   2679 O  O     . HIS A 1 352 ? 41.886  -44.308 101.002 1.00 56.84  ? 352 HIS A O     1 
ATOM   2680 C  CB    . HIS A 1 352 ? 43.212  -41.231 101.437 1.00 45.04  ? 352 HIS A CB    1 
ATOM   2681 C  CG    . HIS A 1 352 ? 43.230  -41.389 99.952  1.00 80.59  ? 352 HIS A CG    1 
ATOM   2682 N  ND1   . HIS A 1 352 ? 42.130  -41.128 99.167  1.00 96.29  ? 352 HIS A ND1   1 
ATOM   2683 C  CD2   . HIS A 1 352 ? 44.213  -41.802 99.115  1.00 99.15  ? 352 HIS A CD2   1 
ATOM   2684 C  CE1   . HIS A 1 352 ? 42.431  -41.384 97.905  1.00 118.01 ? 352 HIS A CE1   1 
ATOM   2685 N  NE2   . HIS A 1 352 ? 43.683  -41.799 97.848  1.00 104.29 ? 352 HIS A NE2   1 
ATOM   2686 N  N     . ARG A 1 353 ? 43.776  -44.184 102.213 1.00 78.74  ? 353 ARG A N     1 
ATOM   2687 C  CA    . ARG A 1 353 ? 44.157  -45.563 101.910 1.00 72.99  ? 353 ARG A CA    1 
ATOM   2688 C  C     . ARG A 1 353 ? 43.085  -46.539 102.357 1.00 81.94  ? 353 ARG A C     1 
ATOM   2689 O  O     . ARG A 1 353 ? 42.913  -47.602 101.761 1.00 77.10  ? 353 ARG A O     1 
ATOM   2690 C  CB    . ARG A 1 353 ? 45.482  -45.943 102.565 1.00 75.73  ? 353 ARG A CB    1 
ATOM   2691 C  CG    . ARG A 1 353 ? 46.680  -45.217 101.990 1.00 33.30  ? 353 ARG A CG    1 
ATOM   2692 C  CD    . ARG A 1 353 ? 46.864  -45.569 100.550 1.00 67.49  ? 353 ARG A CD    1 
ATOM   2693 N  NE    . ARG A 1 353 ? 47.070  -47.002 100.347 1.00 68.03  ? 353 ARG A NE    1 
ATOM   2694 C  CZ    . ARG A 1 353 ? 47.019  -47.591 99.151  1.00 68.92  ? 353 ARG A CZ    1 
ATOM   2695 N  NH1   . ARG A 1 353 ? 46.751  -46.868 98.059  1.00 69.37  ? 353 ARG A NH1   1 
ATOM   2696 N  NH2   . ARG A 1 353 ? 47.226  -48.904 99.044  1.00 69.59  ? 353 ARG A NH2   1 
ATOM   2697 N  N     . ARG A 1 354 ? 42.378  -46.182 103.422 1.00 76.79  ? 354 ARG A N     1 
ATOM   2698 C  CA    . ARG A 1 354 ? 41.329  -47.037 103.944 1.00 90.87  ? 354 ARG A CA    1 
ATOM   2699 C  C     . ARG A 1 354 ? 40.216  -47.135 102.904 1.00 93.58  ? 354 ARG A C     1 
ATOM   2700 O  O     . ARG A 1 354 ? 39.839  -48.233 102.502 1.00 134.97 ? 354 ARG A O     1 
ATOM   2701 C  CB    . ARG A 1 354 ? 40.789  -46.508 105.282 1.00 75.38  ? 354 ARG A CB    1 
ATOM   2702 C  CG    . ARG A 1 354 ? 39.574  -47.284 105.803 1.00 94.75  ? 354 ARG A CG    1 
ATOM   2703 C  CD    . ARG A 1 354 ? 39.080  -46.784 107.165 1.00 93.36  ? 354 ARG A CD    1 
ATOM   2704 N  NE    . ARG A 1 354 ? 37.920  -47.542 107.656 1.00 99.53  ? 354 ARG A NE    1 
ATOM   2705 C  CZ    . ARG A 1 354 ? 36.660  -47.346 107.254 1.00 97.65  ? 354 ARG A CZ    1 
ATOM   2706 N  NH1   . ARG A 1 354 ? 36.370  -46.416 106.336 1.00 98.37  ? 354 ARG A NH1   1 
ATOM   2707 N  NH2   . ARG A 1 354 ? 35.685  -48.089 107.761 1.00 100.45 ? 354 ARG A NH2   1 
ATOM   2708 N  N     . GLU A 1 355 ? 39.695  -45.985 102.482 1.00 79.08  ? 355 GLU A N     1 
ATOM   2709 C  CA    . GLU A 1 355 ? 38.680  -45.936 101.429 1.00 109.22 ? 355 GLU A CA    1 
ATOM   2710 C  C     . GLU A 1 355 ? 39.158  -46.728 100.213 1.00 96.51  ? 355 GLU A C     1 
ATOM   2711 O  O     . GLU A 1 355 ? 38.453  -47.599 99.701  1.00 134.80 ? 355 GLU A O     1 
ATOM   2712 C  CB    . GLU A 1 355 ? 38.395  -44.493 101.017 1.00 123.31 ? 355 GLU A CB    1 
ATOM   2713 C  CG    . GLU A 1 355 ? 37.641  -43.725 102.050 1.00 111.25 ? 355 GLU A CG    1 
ATOM   2714 C  CD    . GLU A 1 355 ? 36.350  -44.415 102.435 1.00 93.74  ? 355 GLU A CD    1 
ATOM   2715 O  OE1   . GLU A 1 355 ? 35.967  -44.370 103.622 1.00 60.62  ? 355 GLU A OE1   1 
ATOM   2716 O  OE2   . GLU A 1 355 ? 35.719  -45.010 101.545 1.00 91.43  ? 355 GLU A OE2   1 
ATOM   2717 N  N     . VAL A 1 356 ? 40.380  -46.439 99.781  1.00 63.15  ? 356 VAL A N     1 
ATOM   2718 C  CA    . VAL A 1 356 ? 40.955  -47.122 98.654  1.00 53.23  ? 356 VAL A CA    1 
ATOM   2719 C  C     . VAL A 1 356 ? 40.957  -48.635 98.803  1.00 62.49  ? 356 VAL A C     1 
ATOM   2720 O  O     . VAL A 1 356 ? 40.389  -49.353 97.975  1.00 53.28  ? 356 VAL A O     1 
ATOM   2721 C  CB    . VAL A 1 356 ? 42.345  -46.600 98.372  1.00 51.30  ? 356 VAL A CB    1 
ATOM   2722 C  CG1   . VAL A 1 356 ? 43.110  -47.556 97.454  1.00 52.39  ? 356 VAL A CG1   1 
ATOM   2723 C  CG2   . VAL A 1 356 ? 42.213  -45.229 97.743  1.00 61.06  ? 356 VAL A CG2   1 
ATOM   2724 N  N     . ILE A 1 357 ? 41.584  -49.124 99.858  1.00 34.41  ? 357 ILE A N     1 
ATOM   2725 C  CA    . ILE A 1 357 ? 41.647  -50.556 100.061 1.00 50.60  ? 357 ILE A CA    1 
ATOM   2726 C  C     . ILE A 1 357 ? 40.249  -51.172 100.211 1.00 57.46  ? 357 ILE A C     1 
ATOM   2727 O  O     . ILE A 1 357 ? 39.964  -52.233 99.647  1.00 57.23  ? 357 ILE A O     1 
ATOM   2728 C  CB    . ILE A 1 357 ? 42.562  -50.890 101.230 1.00 33.92  ? 357 ILE A CB    1 
ATOM   2729 C  CG1   . ILE A 1 357 ? 43.999  -50.493 100.874 1.00 77.94  ? 357 ILE A CG1   1 
ATOM   2730 C  CG2   . ILE A 1 357 ? 42.460  -52.374 101.594 1.00 92.73  ? 357 ILE A CG2   1 
ATOM   2731 C  CD1   . ILE A 1 357 ? 44.965  -50.564 102.041 1.00 37.01  ? 357 ILE A CD1   1 
ATOM   2732 N  N     . LEU A 1 358 ? 39.361  -50.502 100.934 1.00 62.65  ? 358 LEU A N     1 
ATOM   2733 C  CA    . LEU A 1 358 ? 38.014  -51.030 101.055 1.00 93.73  ? 358 LEU A CA    1 
ATOM   2734 C  C     . LEU A 1 358 ? 37.383  -51.152 99.667  1.00 103.73 ? 358 LEU A C     1 
ATOM   2735 O  O     . LEU A 1 358 ? 36.849  -52.209 99.304  1.00 129.95 ? 358 LEU A O     1 
ATOM   2736 C  CB    . LEU A 1 358 ? 37.149  -50.161 101.967 1.00 78.37  ? 358 LEU A CB    1 
ATOM   2737 C  CG    . LEU A 1 358 ? 37.363  -50.351 103.474 1.00 85.49  ? 358 LEU A CG    1 
ATOM   2738 C  CD1   . LEU A 1 358 ? 36.576  -49.310 104.277 1.00 104.41 ? 358 LEU A CD1   1 
ATOM   2739 C  CD2   . LEU A 1 358 ? 37.001  -51.762 103.898 1.00 89.24  ? 358 LEU A CD2   1 
ATOM   2740 N  N     . ALA A 1 359 ? 37.453  -50.071 98.894  1.00 95.07  ? 359 ALA A N     1 
ATOM   2741 C  CA    . ALA A 1 359 ? 36.893  -50.048 97.538  1.00 74.28  ? 359 ALA A CA    1 
ATOM   2742 C  C     . ALA A 1 359 ? 37.526  -51.098 96.606  1.00 71.44  ? 359 ALA A C     1 
ATOM   2743 O  O     . ALA A 1 359 ? 36.821  -51.821 95.892  1.00 50.01  ? 359 ALA A O     1 
ATOM   2744 C  CB    . ALA A 1 359 ? 37.004  -48.632 96.925  1.00 73.27  ? 359 ALA A CB    1 
ATOM   2745 N  N     . ARG A 1 360 ? 38.855  -51.172 96.607  1.00 63.82  ? 360 ARG A N     1 
ATOM   2746 C  CA    . ARG A 1 360 ? 39.534  -52.176 95.813  1.00 60.74  ? 360 ARG A CA    1 
ATOM   2747 C  C     . ARG A 1 360 ? 38.953  -53.547 96.122  1.00 74.66  ? 360 ARG A C     1 
ATOM   2748 O  O     . ARG A 1 360 ? 38.676  -54.335 95.218  1.00 60.41  ? 360 ARG A O     1 
ATOM   2749 C  CB    . ARG A 1 360 ? 41.039  -52.167 96.082  1.00 59.14  ? 360 ARG A CB    1 
ATOM   2750 C  CG    . ARG A 1 360 ? 41.833  -53.112 95.195  1.00 68.85  ? 360 ARG A CG    1 
ATOM   2751 C  CD    . ARG A 1 360 ? 42.810  -53.939 96.007  1.00 48.49  ? 360 ARG A CD    1 
ATOM   2752 N  NE    . ARG A 1 360 ? 43.982  -53.179 96.439  1.00 58.12  ? 360 ARG A NE    1 
ATOM   2753 C  CZ    . ARG A 1 360 ? 44.639  -53.371 97.583  1.00 81.39  ? 360 ARG A CZ    1 
ATOM   2754 N  NH1   . ARG A 1 360 ? 44.239  -54.291 98.463  1.00 35.60  ? 360 ARG A NH1   1 
ATOM   2755 N  NH2   . ARG A 1 360 ? 45.698  -52.626 97.855  1.00 77.99  ? 360 ARG A NH2   1 
ATOM   2756 N  N     . SER A 1 361 ? 38.759  -53.825 97.405  1.00 47.56  ? 361 SER A N     1 
ATOM   2757 C  CA    . SER A 1 361 ? 38.358  -55.159 97.848  1.00 49.97  ? 361 SER A CA    1 
ATOM   2758 C  C     . SER A 1 361 ? 36.905  -55.471 97.496  1.00 74.20  ? 361 SER A C     1 
ATOM   2759 O  O     . SER A 1 361 ? 36.585  -56.602 97.160  1.00 87.42  ? 361 SER A O     1 
ATOM   2760 C  CB    . SER A 1 361 ? 38.632  -55.347 99.353  1.00 59.77  ? 361 SER A CB    1 
ATOM   2761 O  OG    . SER A 1 361 ? 40.024  -55.323 99.632  1.00 56.24  ? 361 SER A OG    1 
ATOM   2762 N  N     . ARG A 1 362 ? 36.027  -54.469 97.556  1.00 87.18  ? 362 ARG A N     1 
ATOM   2763 C  CA    . ARG A 1 362 ? 34.658  -54.658 97.099  1.00 90.33  ? 362 ARG A CA    1 
ATOM   2764 C  C     . ARG A 1 362 ? 34.676  -55.021 95.627  1.00 65.16  ? 362 ARG A C     1 
ATOM   2765 O  O     . ARG A 1 362 ? 33.995  -55.951 95.189  1.00 79.62  ? 362 ARG A O     1 
ATOM   2766 C  CB    . ARG A 1 362 ? 33.830  -53.400 97.312  1.00 99.86  ? 362 ARG A CB    1 
ATOM   2767 C  CG    . ARG A 1 362 ? 33.636  -53.041 98.786  1.00 150.45 ? 362 ARG A CG    1 
ATOM   2768 C  CD    . ARG A 1 362 ? 32.565  -51.974 98.946  1.00 174.70 ? 362 ARG A CD    1 
ATOM   2769 N  NE    . ARG A 1 362 ? 32.871  -51.067 100.051 1.00 143.35 ? 362 ARG A NE    1 
ATOM   2770 C  CZ    . ARG A 1 362 ? 33.525  -49.914 99.919  1.00 109.61 ? 362 ARG A CZ    1 
ATOM   2771 N  NH1   . ARG A 1 362 ? 33.951  -49.507 98.723  1.00 93.98  ? 362 ARG A NH1   1 
ATOM   2772 N  NH2   . ARG A 1 362 ? 33.753  -49.165 100.987 1.00 119.24 ? 362 ARG A NH2   1 
ATOM   2773 N  N     . PHE A 1 363 ? 35.499  -54.298 94.873  1.00 75.47  ? 363 PHE A N     1 
ATOM   2774 C  CA    . PHE A 1 363 ? 35.598  -54.505 93.438  1.00 90.23  ? 363 PHE A CA    1 
ATOM   2775 C  C     . PHE A 1 363 ? 36.061  -55.936 93.090  1.00 92.16  ? 363 PHE A C     1 
ATOM   2776 O  O     . PHE A 1 363 ? 35.401  -56.636 92.318  1.00 61.43  ? 363 PHE A O     1 
ATOM   2777 C  CB    . PHE A 1 363 ? 36.503  -53.442 92.807  1.00 89.32  ? 363 PHE A CB    1 
ATOM   2778 C  CG    . PHE A 1 363 ? 36.678  -53.596 91.329  1.00 100.69 ? 363 PHE A CG    1 
ATOM   2779 C  CD1   . PHE A 1 363 ? 35.885  -52.876 90.448  1.00 98.72  ? 363 PHE A CD1   1 
ATOM   2780 C  CD2   . PHE A 1 363 ? 37.632  -54.476 90.818  1.00 111.55 ? 363 PHE A CD2   1 
ATOM   2781 C  CE1   . PHE A 1 363 ? 36.043  -53.020 89.088  1.00 76.66  ? 363 PHE A CE1   1 
ATOM   2782 C  CE2   . PHE A 1 363 ? 37.790  -54.633 89.446  1.00 94.71  ? 363 PHE A CE2   1 
ATOM   2783 C  CZ    . PHE A 1 363 ? 36.997  -53.905 88.581  1.00 75.51  ? 363 PHE A CZ    1 
ATOM   2784 N  N     . ASP A 1 364 ? 37.172  -56.387 93.669  1.00 89.66  ? 364 ASP A N     1 
ATOM   2785 C  CA    . ASP A 1 364 ? 37.630  -57.741 93.384  1.00 73.58  ? 364 ASP A CA    1 
ATOM   2786 C  C     . ASP A 1 364 ? 36.642  -58.799 93.842  1.00 94.10  ? 364 ASP A C     1 
ATOM   2787 O  O     . ASP A 1 364 ? 36.552  -59.863 93.234  1.00 74.87  ? 364 ASP A O     1 
ATOM   2788 C  CB    . ASP A 1 364 ? 38.983  -58.024 94.027  1.00 84.80  ? 364 ASP A CB    1 
ATOM   2789 C  CG    . ASP A 1 364 ? 40.113  -57.266 93.363  1.00 51.12  ? 364 ASP A CG    1 
ATOM   2790 O  OD1   . ASP A 1 364 ? 39.911  -56.757 92.232  1.00 51.48  ? 364 ASP A OD1   1 
ATOM   2791 O  OD2   . ASP A 1 364 ? 41.203  -57.198 93.970  1.00 58.95  ? 364 ASP A OD2   1 
ATOM   2792 N  N     . LYS A 1 365 ? 35.926  -58.517 94.927  1.00 92.06  ? 365 LYS A N     1 
ATOM   2793 C  CA    . LYS A 1 365 ? 35.019  -59.505 95.507  1.00 102.19 ? 365 LYS A CA    1 
ATOM   2794 C  C     . LYS A 1 365 ? 33.807  -59.643 94.592  1.00 109.64 ? 365 LYS A C     1 
ATOM   2795 O  O     . LYS A 1 365 ? 33.331  -60.741 94.303  1.00 130.94 ? 365 LYS A O     1 
ATOM   2796 C  CB    . LYS A 1 365 ? 34.603  -59.110 96.937  1.00 105.07 ? 365 LYS A CB    1 
ATOM   2797 C  CG    . LYS A 1 365 ? 33.657  -60.082 97.585  1.00 117.41 ? 365 LYS A CG    1 
ATOM   2798 C  CD    . LYS A 1 365 ? 33.376  -59.708 99.013  1.00 134.56 ? 365 LYS A CD    1 
ATOM   2799 C  CE    . LYS A 1 365 ? 32.477  -58.495 99.092  1.00 157.68 ? 365 LYS A CE    1 
ATOM   2800 N  NZ    . LYS A 1 365 ? 31.045  -58.886 99.215  1.00 191.30 ? 365 LYS A NZ    1 
ATOM   2801 N  N     . GLU A 1 366 ? 33.319  -58.499 94.144  1.00 88.04  ? 366 GLU A N     1 
ATOM   2802 C  CA    . GLU A 1 366 ? 32.282  -58.442 93.126  1.00 128.23 ? 366 GLU A CA    1 
ATOM   2803 C  C     . GLU A 1 366 ? 32.651  -59.319 91.901  1.00 75.82  ? 366 GLU A C     1 
ATOM   2804 O  O     . GLU A 1 366 ? 31.882  -60.201 91.507  1.00 92.94  ? 366 GLU A O     1 
ATOM   2805 C  CB    . GLU A 1 366 ? 32.079  -56.986 92.738  1.00 142.21 ? 366 GLU A CB    1 
ATOM   2806 C  CG    . GLU A 1 366 ? 30.685  -56.481 92.904  1.00 137.06 ? 366 GLU A CG    1 
ATOM   2807 C  CD    . GLU A 1 366 ? 29.936  -56.490 91.590  1.00 134.79 ? 366 GLU A CD    1 
ATOM   2808 O  OE1   . GLU A 1 366 ? 29.580  -57.594 91.118  1.00 121.78 ? 366 GLU A OE1   1 
ATOM   2809 O  OE2   . GLU A 1 366 ? 29.722  -55.392 91.027  1.00 125.59 ? 366 GLU A OE2   1 
ATOM   2810 N  N     . LYS A 1 367 ? 33.836  -59.095 91.332  1.00 98.65  ? 367 LYS A N     1 
ATOM   2811 C  CA    . LYS A 1 367 ? 34.326  -59.925 90.238  1.00 89.17  ? 367 LYS A CA    1 
ATOM   2812 C  C     . LYS A 1 367 ? 34.323  -61.392 90.583  1.00 91.72  ? 367 LYS A C     1 
ATOM   2813 O  O     . LYS A 1 367 ? 33.843  -62.217 89.811  1.00 74.30  ? 367 LYS A O     1 
ATOM   2814 C  CB    . LYS A 1 367 ? 35.739  -59.525 89.824  1.00 114.54 ? 367 LYS A CB    1 
ATOM   2815 C  CG    . LYS A 1 367 ? 35.817  -58.805 88.493  1.00 136.66 ? 367 LYS A CG    1 
ATOM   2816 C  CD    . LYS A 1 367 ? 37.275  -58.577 88.061  1.00 109.59 ? 367 LYS A CD    1 
ATOM   2817 C  CE    . LYS A 1 367 ? 37.864  -59.771 87.297  1.00 97.67  ? 367 LYS A CE    1 
ATOM   2818 N  NZ    . LYS A 1 367 ? 37.987  -61.028 88.108  1.00 92.22  ? 367 LYS A NZ    1 
ATOM   2819 N  N     . ALA A 1 368 ? 34.874  -61.720 91.743  1.00 83.67  ? 368 ALA A N     1 
ATOM   2820 C  CA    . ALA A 1 368 ? 34.984  -63.107 92.169  1.00 96.08  ? 368 ALA A CA    1 
ATOM   2821 C  C     . ALA A 1 368 ? 33.611  -63.765 92.341  1.00 117.07 ? 368 ALA A C     1 
ATOM   2822 O  O     . ALA A 1 368 ? 33.447  -64.946 92.036  1.00 116.28 ? 368 ALA A O     1 
ATOM   2823 C  CB    . ALA A 1 368 ? 35.769  -63.190 93.445  1.00 104.58 ? 368 ALA A CB    1 
ATOM   2824 N  N     . GLU A 1 369 ? 32.634  -63.007 92.838  1.00 128.84 ? 369 GLU A N     1 
ATOM   2825 C  CA    . GLU A 1 369 ? 31.295  -63.552 93.006  1.00 141.66 ? 369 GLU A CA    1 
ATOM   2826 C  C     . GLU A 1 369 ? 30.612  -63.831 91.662  1.00 107.58 ? 369 GLU A C     1 
ATOM   2827 O  O     . GLU A 1 369 ? 30.046  -64.918 91.477  1.00 111.66 ? 369 GLU A O     1 
ATOM   2828 C  CB    . GLU A 1 369 ? 30.405  -62.631 93.835  1.00 160.57 ? 369 GLU A CB    1 
ATOM   2829 C  CG    . GLU A 1 369 ? 30.848  -62.424 95.255  1.00 176.03 ? 369 GLU A CG    1 
ATOM   2830 C  CD    . GLU A 1 369 ? 29.688  -62.529 96.248  1.00 234.15 ? 369 GLU A CD    1 
ATOM   2831 O  OE1   . GLU A 1 369 ? 29.931  -62.995 97.397  1.00 260.31 ? 369 GLU A OE1   1 
ATOM   2832 O  OE2   . GLU A 1 369 ? 28.544  -62.155 95.863  1.00 213.31 ? 369 GLU A OE2   1 
ATOM   2833 N  N     . LYS A 1 370 ? 30.637  -62.842 90.757  1.00 99.34  ? 370 LYS A N     1 
ATOM   2834 C  CA    . LYS A 1 370 ? 30.004  -62.962 89.434  1.00 101.64 ? 370 LYS A CA    1 
ATOM   2835 C  C     . LYS A 1 370 ? 30.493  -64.242 88.772  1.00 107.14 ? 370 LYS A C     1 
ATOM   2836 O  O     . LYS A 1 370 ? 29.702  -65.029 88.248  1.00 110.20 ? 370 LYS A O     1 
ATOM   2837 C  CB    . LYS A 1 370 ? 30.232  -61.712 88.559  1.00 102.02 ? 370 LYS A CB    1 
ATOM   2838 C  CG    . LYS A 1 370 ? 29.332  -60.530 88.992  1.00 106.84 ? 370 LYS A CG    1 
ATOM   2839 C  CD    . LYS A 1 370 ? 29.486  -59.255 88.161  1.00 105.88 ? 370 LYS A CD    1 
ATOM   2840 N  N     . ARG A 1 371 ? 31.792  -64.474 88.900  1.00 96.98  ? 371 ARG A N     1 
ATOM   2841 C  CA    . ARG A 1 371 ? 32.431  -65.673 88.385  1.00 102.53 ? 371 ARG A CA    1 
ATOM   2842 C  C     . ARG A 1 371 ? 32.014  -66.950 89.098  1.00 117.20 ? 371 ARG A C     1 
ATOM   2843 O  O     . ARG A 1 371 ? 31.774  -67.973 88.458  1.00 88.48  ? 371 ARG A O     1 
ATOM   2844 C  CB    . ARG A 1 371 ? 33.952  -65.540 88.459  1.00 108.40 ? 371 ARG A CB    1 
ATOM   2845 C  CG    . ARG A 1 371 ? 34.688  -66.802 88.029  1.00 98.78  ? 371 ARG A CG    1 
ATOM   2846 C  CD    . ARG A 1 371 ? 34.449  -67.056 86.557  1.00 92.72  ? 371 ARG A CD    1 
ATOM   2847 N  NE    . ARG A 1 371 ? 34.976  -68.332 86.090  1.00 97.15  ? 371 ARG A NE    1 
ATOM   2848 C  CZ    . ARG A 1 371 ? 34.627  -68.884 84.932  1.00 96.84  ? 371 ARG A CZ    1 
ATOM   2849 N  NH1   . ARG A 1 371 ? 33.755  -68.251 84.148  1.00 108.59 ? 371 ARG A NH1   1 
ATOM   2850 N  NH2   . ARG A 1 371 ? 35.139  -70.056 84.565  1.00 106.95 ? 371 ARG A NH2   1 
ATOM   2851 N  N     . LEU A 1 372 ? 31.976  -66.896 90.426  1.00 85.01  ? 372 LEU A N     1 
ATOM   2852 C  CA    . LEU A 1 372 ? 31.629  -68.051 91.235  1.00 127.65 ? 372 LEU A CA    1 
ATOM   2853 C  C     . LEU A 1 372 ? 30.205  -68.468 90.880  1.00 91.03  ? 372 LEU A C     1 
ATOM   2854 O  O     . LEU A 1 372 ? 29.920  -69.642 90.644  1.00 108.68 ? 372 LEU A O     1 
ATOM   2855 C  CB    . LEU A 1 372 ? 31.787  -67.703 92.709  1.00 132.61 ? 372 LEU A CB    1 
ATOM   2856 C  CG    . LEU A 1 372 ? 31.623  -68.724 93.852  1.00 122.05 ? 372 LEU A CG    1 
ATOM   2857 C  CD1   . LEU A 1 372 ? 30.267  -68.532 94.512  1.00 142.67 ? 372 LEU A CD1   1 
ATOM   2858 C  CD2   . LEU A 1 372 ? 31.862  -70.185 93.407  1.00 110.84 ? 372 LEU A CD2   1 
ATOM   2859 N  N     . HIS A 1 373 ? 29.333  -67.477 90.773  1.00 91.54  ? 373 HIS A N     1 
ATOM   2860 C  CA    . HIS A 1 373 ? 27.952  -67.668 90.341  1.00 126.48 ? 373 HIS A CA    1 
ATOM   2861 C  C     . HIS A 1 373 ? 27.819  -68.411 88.996  1.00 117.06 ? 373 HIS A C     1 
ATOM   2862 O  O     . HIS A 1 373 ? 26.947  -69.274 88.840  1.00 122.90 ? 373 HIS A O     1 
ATOM   2863 C  CB    . HIS A 1 373 ? 27.292  -66.297 90.256  1.00 109.86 ? 373 HIS A CB    1 
ATOM   2864 C  CG    . HIS A 1 373 ? 25.807  -66.336 90.085  1.00 116.12 ? 373 HIS A CG    1 
ATOM   2865 N  ND1   . HIS A 1 373 ? 24.994  -67.174 90.814  1.00 116.64 ? 373 HIS A ND1   1 
ATOM   2866 C  CD2   . HIS A 1 373 ? 24.983  -65.604 89.295  1.00 121.38 ? 373 HIS A CD2   1 
ATOM   2867 C  CE1   . HIS A 1 373 ? 23.737  -66.977 90.460  1.00 121.22 ? 373 HIS A CE1   1 
ATOM   2868 N  NE2   . HIS A 1 373 ? 23.703  -66.027 89.542  1.00 124.41 ? 373 HIS A NE2   1 
ATOM   2869 N  N     . ILE A 1 374 ? 28.680  -68.072 88.029  1.00 111.23 ? 374 ILE A N     1 
ATOM   2870 C  CA    . ILE A 1 374 ? 28.659  -68.715 86.714  1.00 126.01 ? 374 ILE A CA    1 
ATOM   2871 C  C     . ILE A 1 374 ? 29.196  -70.140 86.789  1.00 98.86  ? 374 ILE A C     1 
ATOM   2872 O  O     . ILE A 1 374 ? 28.530  -71.090 86.375  1.00 102.17 ? 374 ILE A O     1 
ATOM   2873 C  CB    . ILE A 1 374 ? 29.423  -67.885 85.666  1.00 116.01 ? 374 ILE A CB    1 
ATOM   2874 C  CG1   . ILE A 1 374 ? 28.544  -66.740 85.173  1.00 113.02 ? 374 ILE A CG1   1 
ATOM   2875 C  CG2   . ILE A 1 374 ? 29.914  -68.761 84.484  1.00 104.56 ? 374 ILE A CG2   1 
ATOM   2876 C  CD1   . ILE A 1 374 ? 29.363  -65.558 84.712  1.00 127.40 ? 374 ILE A CD1   1 
ATOM   2877 N  N     . VAL A 1 375 ? 30.397  -70.284 87.329  1.00 95.99  ? 375 VAL A N     1 
ATOM   2878 C  CA    . VAL A 1 375 ? 30.956  -71.603 87.615  1.00 96.61  ? 375 VAL A CA    1 
ATOM   2879 C  C     . VAL A 1 375 ? 29.985  -72.545 88.332  1.00 99.75  ? 375 VAL A C     1 
ATOM   2880 O  O     . VAL A 1 375 ? 30.001  -73.748 88.097  1.00 117.68 ? 375 VAL A O     1 
ATOM   2881 C  CB    . VAL A 1 375 ? 32.195  -71.482 88.485  1.00 93.00  ? 375 VAL A CB    1 
ATOM   2882 C  CG1   . VAL A 1 375 ? 32.641  -72.863 88.979  1.00 93.85  ? 375 VAL A CG1   1 
ATOM   2883 C  CG2   . VAL A 1 375 ? 33.293  -70.742 87.723  1.00 105.86 ? 375 VAL A CG2   1 
ATOM   2884 N  N     . GLU A 1 376 ? 29.146  -72.006 89.217  1.00 131.83 ? 376 GLU A N     1 
ATOM   2885 C  CA    . GLU A 1 376 ? 28.114  -72.831 89.859  1.00 155.62 ? 376 GLU A CA    1 
ATOM   2886 C  C     . GLU A 1 376 ? 27.072  -73.325 88.876  1.00 133.41 ? 376 GLU A C     1 
ATOM   2887 O  O     . GLU A 1 376 ? 26.690  -74.482 88.924  1.00 138.85 ? 376 GLU A O     1 
ATOM   2888 C  CB    . GLU A 1 376 ? 27.401  -72.078 90.981  1.00 156.96 ? 376 GLU A CB    1 
ATOM   2889 C  CG    . GLU A 1 376 ? 28.074  -72.173 92.327  1.00 170.38 ? 376 GLU A CG    1 
ATOM   2890 C  CD    . GLU A 1 376 ? 27.442  -71.254 93.345  1.00 137.31 ? 376 GLU A CD    1 
ATOM   2891 O  OE1   . GLU A 1 376 ? 26.554  -70.448 92.970  1.00 152.94 ? 376 GLU A OE1   1 
ATOM   2892 O  OE2   . GLU A 1 376 ? 27.841  -71.349 94.526  1.00 120.15 ? 376 GLU A OE2   1 
ATOM   2893 N  N     . GLY A 1 377 ? 26.595  -72.437 88.006  1.00 107.36 ? 377 GLY A N     1 
ATOM   2894 C  CA    . GLY A 1 377 ? 25.695  -72.824 86.935  1.00 110.82 ? 377 GLY A CA    1 
ATOM   2895 C  C     . GLY A 1 377 ? 26.265  -73.878 85.989  1.00 128.96 ? 377 GLY A C     1 
ATOM   2896 O  O     . GLY A 1 377 ? 25.564  -74.824 85.617  1.00 115.41 ? 377 GLY A O     1 
ATOM   2897 N  N     . LEU A 1 378 ? 27.531  -73.727 85.600  1.00 109.25 ? 378 LEU A N     1 
ATOM   2898 C  CA    . LEU A 1 378 ? 28.163  -74.673 84.679  1.00 129.74 ? 378 LEU A CA    1 
ATOM   2899 C  C     . LEU A 1 378 ? 28.308  -76.061 85.278  1.00 111.64 ? 378 LEU A C     1 
ATOM   2900 O  O     . LEU A 1 378 ? 28.080  -77.065 84.594  1.00 114.39 ? 378 LEU A O     1 
ATOM   2901 C  CB    . LEU A 1 378 ? 29.528  -74.179 84.186  1.00 117.05 ? 378 LEU A CB    1 
ATOM   2902 C  CG    . LEU A 1 378 ? 29.534  -72.768 83.594  1.00 141.25 ? 378 LEU A CG    1 
ATOM   2903 C  CD1   . LEU A 1 378 ? 30.938  -72.392 83.198  1.00 156.84 ? 378 LEU A CD1   1 
ATOM   2904 C  CD2   . LEU A 1 378 ? 28.563  -72.636 82.422  1.00 153.74 ? 378 LEU A CD2   1 
ATOM   2905 N  N     . ILE A 1 379 ? 28.700  -76.116 86.550  1.00 109.84 ? 379 ILE A N     1 
ATOM   2906 C  CA    . ILE A 1 379 ? 28.799  -77.387 87.262  1.00 111.18 ? 379 ILE A CA    1 
ATOM   2907 C  C     . ILE A 1 379 ? 27.458  -78.097 87.182  1.00 115.41 ? 379 ILE A C     1 
ATOM   2908 O  O     . ILE A 1 379 ? 27.403  -79.297 86.948  1.00 117.92 ? 379 ILE A O     1 
ATOM   2909 C  CB    . ILE A 1 379 ? 29.209  -77.172 88.725  1.00 128.40 ? 379 ILE A CB    1 
ATOM   2910 C  CG1   . ILE A 1 379 ? 30.639  -76.645 88.791  1.00 104.65 ? 379 ILE A CG1   1 
ATOM   2911 C  CG2   . ILE A 1 379 ? 29.092  -78.460 89.535  1.00 130.48 ? 379 ILE A CG2   1 
ATOM   2912 C  CD1   . ILE A 1 379 ? 31.129  -76.398 90.182  1.00 102.08 ? 379 ILE A CD1   1 
ATOM   2913 N  N     . ARG A 1 380 ? 26.383  -77.330 87.340  1.00 158.52 ? 380 ARG A N     1 
ATOM   2914 C  CA    . ARG A 1 380 ? 25.025  -77.852 87.236  1.00 149.30 ? 380 ARG A CA    1 
ATOM   2915 C  C     . ARG A 1 380 ? 24.672  -78.299 85.828  1.00 161.13 ? 380 ARG A C     1 
ATOM   2916 O  O     . ARG A 1 380 ? 24.186  -79.411 85.628  1.00 164.88 ? 380 ARG A O     1 
ATOM   2917 C  CB    . ARG A 1 380 ? 24.002  -76.813 87.707  1.00 141.56 ? 380 ARG A CB    1 
ATOM   2918 C  CG    . ARG A 1 380 ? 23.374  -77.166 89.027  1.00 129.66 ? 380 ARG A CG    1 
ATOM   2919 C  CD    . ARG A 1 380 ? 21.865  -77.114 88.954  1.00 127.74 ? 380 ARG A CD    1 
ATOM   2920 N  NE    . ARG A 1 380 ? 21.395  -75.746 88.799  1.00 129.92 ? 380 ARG A NE    1 
ATOM   2921 C  CZ    . ARG A 1 380 ? 20.152  -75.433 88.452  1.00 155.57 ? 380 ARG A CZ    1 
ATOM   2922 N  NH1   . ARG A 1 380 ? 19.267  -76.406 88.223  1.00 184.39 ? 380 ARG A NH1   1 
ATOM   2923 N  NH2   . ARG A 1 380 ? 19.807  -74.155 88.323  1.00 149.84 ? 380 ARG A NH2   1 
ATOM   2924 N  N     . VAL A 1 381 ? 24.901  -77.419 84.857  1.00 162.87 ? 381 VAL A N     1 
ATOM   2925 C  CA    . VAL A 1 381 ? 24.622  -77.727 83.470  1.00 158.67 ? 381 VAL A CA    1 
ATOM   2926 C  C     . VAL A 1 381 ? 25.164  -79.098 83.063  1.00 158.42 ? 381 VAL A C     1 
ATOM   2927 O  O     . VAL A 1 381 ? 24.522  -79.817 82.306  1.00 147.62 ? 381 VAL A O     1 
ATOM   2928 C  CB    . VAL A 1 381 ? 25.199  -76.643 82.529  1.00 167.49 ? 381 VAL A CB    1 
ATOM   2929 C  CG1   . VAL A 1 381 ? 25.411  -77.208 81.157  1.00 146.46 ? 381 VAL A CG1   1 
ATOM   2930 C  CG2   . VAL A 1 381 ? 24.284  -75.435 82.469  1.00 197.97 ? 381 VAL A CG2   1 
ATOM   2931 N  N     . ILE A 1 382 ? 26.342  -79.462 83.558  1.00 123.21 ? 382 ILE A N     1 
ATOM   2932 C  CA    . ILE A 1 382 ? 26.983  -80.689 83.096  1.00 125.02 ? 382 ILE A CA    1 
ATOM   2933 C  C     . ILE A 1 382 ? 26.209  -81.920 83.539  1.00 145.91 ? 382 ILE A C     1 
ATOM   2934 O  O     . ILE A 1 382 ? 26.276  -82.972 82.910  1.00 134.65 ? 382 ILE A O     1 
ATOM   2935 C  CB    . ILE A 1 382 ? 28.431  -80.809 83.576  1.00 121.91 ? 382 ILE A CB    1 
ATOM   2936 C  CG1   . ILE A 1 382 ? 29.289  -79.692 82.993  1.00 117.55 ? 382 ILE A CG1   1 
ATOM   2937 C  CG2   . ILE A 1 382 ? 29.016  -82.118 83.132  1.00 125.24 ? 382 ILE A CG2   1 
ATOM   2938 C  CD1   . ILE A 1 382 ? 30.714  -79.717 83.496  1.00 114.00 ? 382 ILE A CD1   1 
ATOM   2939 N  N     . SER A 1 383 ? 25.472  -81.767 84.629  1.00 171.74 ? 383 SER A N     1 
ATOM   2940 C  CA    . SER A 1 383 ? 24.668  -82.835 85.203  1.00 199.93 ? 383 SER A CA    1 
ATOM   2941 C  C     . SER A 1 383 ? 23.412  -83.022 84.378  1.00 200.76 ? 383 SER A C     1 
ATOM   2942 O  O     . SER A 1 383 ? 22.719  -84.024 84.523  1.00 208.97 ? 383 SER A O     1 
ATOM   2943 C  CB    . SER A 1 383 ? 24.266  -82.465 86.639  1.00 212.81 ? 383 SER A CB    1 
ATOM   2944 N  N     . ILE A 1 384 ? 23.119  -82.036 83.527  1.00 186.24 ? 384 ILE A N     1 
ATOM   2945 C  CA    . ILE A 1 384 ? 21.888  -82.008 82.731  1.00 178.71 ? 384 ILE A CA    1 
ATOM   2946 C  C     . ILE A 1 384 ? 22.103  -81.518 81.300  1.00 143.86 ? 384 ILE A C     1 
ATOM   2947 O  O     . ILE A 1 384 ? 21.184  -80.980 80.674  1.00 144.32 ? 384 ILE A O     1 
ATOM   2948 C  CB    . ILE A 1 384 ? 20.807  -81.127 83.384  1.00 209.95 ? 384 ILE A CB    1 
ATOM   2949 C  CG1   . ILE A 1 384 ? 21.379  -79.745 83.736  1.00 212.23 ? 384 ILE A CG1   1 
ATOM   2950 C  CG2   . ILE A 1 384 ? 20.245  -81.824 84.615  1.00 229.88 ? 384 ILE A CG2   1 
ATOM   2951 C  CD1   . ILE A 1 384 ? 20.321  -78.676 84.002  1.00 216.77 ? 384 ILE A CD1   1 
ATOM   2952 N  N     . LEU A 1 385 ? 24.136  -81.663 80.048  1.00 136.21 ? 385 LEU A N     1 
ATOM   2953 C  CA    . LEU A 1 385 ? 24.541  -81.233 78.709  1.00 134.51 ? 385 LEU A CA    1 
ATOM   2954 C  C     . LEU A 1 385 ? 23.548  -81.613 77.637  1.00 138.37 ? 385 LEU A C     1 
ATOM   2955 O  O     . LEU A 1 385 ? 23.054  -80.760 76.902  1.00 138.58 ? 385 LEU A O     1 
ATOM   2956 C  CB    . LEU A 1 385 ? 25.862  -81.884 78.338  1.00 133.50 ? 385 LEU A CB    1 
ATOM   2957 C  CG    . LEU A 1 385 ? 27.022  -80.932 78.167  1.00 128.95 ? 385 LEU A CG    1 
ATOM   2958 C  CD1   . LEU A 1 385 ? 28.119  -81.708 77.500  1.00 128.49 ? 385 LEU A CD1   1 
ATOM   2959 C  CD2   . LEU A 1 385 ? 26.588  -79.760 77.328  1.00 175.13 ? 385 LEU A CD2   1 
ATOM   2960 N  N     . ASP A 1 386 ? 23.286  -82.913 77.549  1.00 143.55 ? 386 ASP A N     1 
ATOM   2961 C  CA    . ASP A 1 386 ? 22.465  -83.454 76.486  1.00 158.74 ? 386 ASP A CA    1 
ATOM   2962 C  C     . ASP A 1 386 ? 21.109  -82.786 76.369  1.00 148.88 ? 386 ASP A C     1 
ATOM   2963 O  O     . ASP A 1 386 ? 20.670  -82.457 75.255  1.00 149.29 ? 386 ASP A O     1 
ATOM   2964 C  CB    . ASP A 1 386 ? 22.361  -84.972 76.598  1.00 166.43 ? 386 ASP A CB    1 
ATOM   2965 C  CG    . ASP A 1 386 ? 23.613  -85.670 76.087  1.00 163.19 ? 386 ASP A CG    1 
ATOM   2966 O  OD1   . ASP A 1 386 ? 24.353  -85.051 75.281  1.00 155.67 ? 386 ASP A OD1   1 
ATOM   2967 O  OD2   . ASP A 1 386 ? 23.860  -86.831 76.486  1.00 164.15 ? 386 ASP A OD2   1 
ATOM   2968 N  N     . GLU A 1 387 ? 20.469  -82.549 77.509  1.00 149.16 ? 387 GLU A N     1 
ATOM   2969 C  CA    . GLU A 1 387 ? 19.161  -81.894 77.516  1.00 150.09 ? 387 GLU A CA    1 
ATOM   2970 C  C     . GLU A 1 387 ? 19.248  -80.379 77.397  1.00 176.27 ? 387 GLU A C     1 
ATOM   2971 O  O     . GLU A 1 387 ? 18.275  -79.750 76.978  1.00 147.29 ? 387 GLU A O     1 
ATOM   2972 C  CB    . GLU A 1 387 ? 18.306  -82.289 78.737  1.00 157.86 ? 387 GLU A CB    1 
ATOM   2973 C  CG    . GLU A 1 387 ? 19.060  -82.459 80.034  1.00 158.81 ? 387 GLU A CG    1 
ATOM   2974 C  CD    . GLU A 1 387 ? 19.566  -83.883 80.230  1.00 171.45 ? 387 GLU A CD    1 
ATOM   2975 O  OE1   . GLU A 1 387 ? 18.824  -84.703 80.818  1.00 178.43 ? 387 GLU A OE1   1 
ATOM   2976 O  OE2   . GLU A 1 387 ? 20.705  -84.183 79.798  1.00 170.19 ? 387 GLU A OE2   1 
ATOM   2977 N  N     . VAL A 1 388 ? 20.386  -79.796 77.780  1.00 176.78 ? 388 VAL A N     1 
ATOM   2978 C  CA    . VAL A 1 388 ? 20.614  -78.367 77.544  1.00 205.00 ? 388 VAL A CA    1 
ATOM   2979 C  C     . VAL A 1 388 ? 20.858  -78.070 76.051  1.00 246.90 ? 388 VAL A C     1 
ATOM   2980 O  O     . VAL A 1 388 ? 20.375  -77.070 75.536  1.00 263.74 ? 388 VAL A O     1 
ATOM   2981 C  CB    . VAL A 1 388 ? 21.766  -77.784 78.404  1.00 290.12 ? 388 VAL A CB    1 
ATOM   2982 C  CG1   . VAL A 1 388 ? 22.392  -76.578 77.727  1.00 246.51 ? 388 VAL A CG1   1 
ATOM   2983 C  CG2   . VAL A 1 388 ? 21.257  -77.376 79.741  1.00 295.60 ? 388 VAL A CG2   1 
ATOM   2984 N  N     . ILE A 1 389 ? 21.596  -78.934 75.358  1.00 217.22 ? 389 ILE A N     1 
ATOM   2985 C  CA    . ILE A 1 389 ? 21.777  -78.753 73.919  1.00 193.25 ? 389 ILE A CA    1 
ATOM   2986 C  C     . ILE A 1 389 ? 20.450  -78.961 73.200  1.00 175.65 ? 389 ILE A C     1 
ATOM   2987 O  O     . ILE A 1 389 ? 20.117  -78.227 72.268  1.00 144.87 ? 389 ILE A O     1 
ATOM   2988 C  CB    . ILE A 1 389 ? 22.788  -79.728 73.335  1.00 190.15 ? 389 ILE A CB    1 
ATOM   2989 C  CG1   . ILE A 1 389 ? 24.210  -79.303 73.686  1.00 208.53 ? 389 ILE A CG1   1 
ATOM   2990 C  CG2   . ILE A 1 389 ? 22.648  -79.753 71.846  1.00 165.20 ? 389 ILE A CG2   1 
ATOM   2991 C  CD1   . ILE A 1 389 ? 25.189  -80.461 73.696  1.00 209.47 ? 389 ILE A CD1   1 
ATOM   2992 N  N     . ALA A 1 390 ? 19.703  -79.971 73.641  1.00 147.58 ? 390 ALA A N     1 
ATOM   2993 C  CA    . ALA A 1 390 ? 18.368  -80.228 73.121  1.00 151.47 ? 390 ALA A CA    1 
ATOM   2994 C  C     . ALA A 1 390 ? 17.473  -79.000 73.259  1.00 172.44 ? 390 ALA A C     1 
ATOM   2995 O  O     . ALA A 1 390 ? 16.719  -78.651 72.338  1.00 153.10 ? 390 ALA A O     1 
ATOM   2996 C  CB    . ALA A 1 390 ? 17.714  -81.429 73.838  1.00 157.04 ? 390 ALA A CB    1 
ATOM   2997 N  N     . LEU A 1 391 ? 17.551  -78.364 74.424  1.00 148.83 ? 391 LEU A N     1 
ATOM   2998 C  CA    . LEU A 1 391 ? 16.727  -77.198 74.722  1.00 148.38 ? 391 LEU A CA    1 
ATOM   2999 C  C     . LEU A 1 391 ? 17.091  -76.025 73.808  1.00 167.20 ? 391 LEU A C     1 
ATOM   3000 O  O     . LEU A 1 391 ? 16.216  -75.335 73.272  1.00 147.69 ? 391 LEU A O     1 
ATOM   3001 C  CB    . LEU A 1 391 ? 16.852  -76.828 76.213  1.00 165.47 ? 391 LEU A CB    1 
ATOM   3002 C  CG    . LEU A 1 391 ? 16.066  -75.665 76.816  1.00 169.13 ? 391 LEU A CG    1 
ATOM   3003 C  CD1   . LEU A 1 391 ? 15.721  -75.949 78.263  1.00 167.63 ? 391 LEU A CD1   1 
ATOM   3004 C  CD2   . LEU A 1 391 ? 16.857  -74.372 76.712  1.00 171.98 ? 391 LEU A CD2   1 
ATOM   3005 N  N     . ILE A 1 392 ? 18.387  -75.803 73.618  1.00 170.80 ? 392 ILE A N     1 
ATOM   3006 C  CA    . ILE A 1 392 ? 18.816  -74.737 72.733  1.00 166.81 ? 392 ILE A CA    1 
ATOM   3007 C  C     . ILE A 1 392 ? 18.485  -75.087 71.281  1.00 169.09 ? 392 ILE A C     1 
ATOM   3008 O  O     . ILE A 1 392 ? 18.118  -74.219 70.497  1.00 144.11 ? 392 ILE A O     1 
ATOM   3009 C  CB    . ILE A 1 392 ? 20.293  -74.451 72.889  1.00 209.59 ? 392 ILE A CB    1 
ATOM   3010 C  CG1   . ILE A 1 392 ? 20.552  -73.840 74.262  1.00 240.18 ? 392 ILE A CG1   1 
ATOM   3011 C  CG2   . ILE A 1 392 ? 20.752  -73.502 71.807  1.00 214.43 ? 392 ILE A CG2   1 
ATOM   3012 C  CD1   . ILE A 1 392 ? 22.016  -73.685 74.560  1.00 256.86 ? 392 ILE A CD1   1 
ATOM   3013 N  N     . ARG A 1 393 ? 18.614  -76.365 70.938  1.00 146.24 ? 393 ARG A N     1 
ATOM   3014 C  CA    . ARG A 1 393 ? 18.150  -76.869 69.655  1.00 149.33 ? 393 ARG A CA    1 
ATOM   3015 C  C     . ARG A 1 393 ? 16.661  -76.550 69.415  1.00 152.33 ? 393 ARG A C     1 
ATOM   3016 O  O     . ARG A 1 393 ? 16.252  -76.271 68.288  1.00 153.83 ? 393 ARG A O     1 
ATOM   3017 C  CB    . ARG A 1 393 ? 18.393  -78.379 69.580  1.00 151.48 ? 393 ARG A CB    1 
ATOM   3018 C  CG    . ARG A 1 393 ? 18.191  -78.988 68.201  1.00 154.29 ? 393 ARG A CG    1 
ATOM   3019 C  CD    . ARG A 1 393 ? 19.057  -78.301 67.148  1.00 156.79 ? 393 ARG A CD    1 
ATOM   3020 N  NE    . ARG A 1 393 ? 18.461  -78.440 65.825  1.00 170.28 ? 393 ARG A NE    1 
ATOM   3021 C  CZ    . ARG A 1 393 ? 18.576  -79.531 65.083  1.00 191.93 ? 393 ARG A CZ    1 
ATOM   3022 N  NH1   . ARG A 1 393 ? 19.273  -80.557 65.548  1.00 193.64 ? 393 ARG A NH1   1 
ATOM   3023 N  NH2   . ARG A 1 393 ? 17.995  -79.597 63.894  1.00 209.39 ? 393 ARG A NH2   1 
ATOM   3024 N  N     . ALA A 1 394 ? 15.867  -76.566 70.484  1.00 173.92 ? 394 ALA A N     1 
ATOM   3025 C  CA    . ALA A 1 394 ? 14.425  -76.339 70.393  1.00 37.23  ? 394 ALA A CA    1 
ATOM   3026 C  C     . ALA A 1 394 ? 14.034  -74.884 70.568  1.00 44.87  ? 394 ALA A C     1 
ATOM   3027 O  O     . ALA A 1 394 ? 12.877  -74.522 70.346  1.00 44.00  ? 394 ALA A O     1 
ATOM   3028 C  CB    . ALA A 1 394 ? 13.673  -77.190 71.419  1.00 27.83  ? 394 ALA A CB    1 
ATOM   3029 N  N     . SER A 1 395 ? 14.982  -74.052 70.991  1.00 135.05 ? 395 SER A N     1 
ATOM   3030 C  CA    . SER A 1 395 ? 14.676  -72.640 71.172  1.00 137.61 ? 395 SER A CA    1 
ATOM   3031 C  C     . SER A 1 395 ? 14.576  -71.951 69.804  1.00 111.25 ? 395 SER A C     1 
ATOM   3032 O  O     . SER A 1 395 ? 15.104  -72.447 68.798  1.00 98.10  ? 395 SER A O     1 
ATOM   3033 C  CB    . SER A 1 395 ? 15.687  -71.960 72.102  1.00 159.06 ? 395 SER A CB    1 
ATOM   3034 N  N     . GLU A 1 396 ? 13.866  -70.828 69.773  1.00 103.58 ? 396 GLU A N     1 
ATOM   3035 C  CA    . GLU A 1 396 ? 13.560  -70.129 68.528  1.00 100.52 ? 396 GLU A CA    1 
ATOM   3036 C  C     . GLU A 1 396 ? 14.682  -69.172 68.143  1.00 97.23  ? 396 GLU A C     1 
ATOM   3037 O  O     . GLU A 1 396 ? 14.873  -68.879 66.977  1.00 103.76 ? 396 GLU A O     1 
ATOM   3038 C  CB    . GLU A 1 396 ? 12.202  -69.399 68.629  1.00 92.98  ? 396 GLU A CB    1 
ATOM   3039 N  N     . ASN A 1 397 ? 15.427  -68.706 69.139  1.00 103.88 ? 397 ASN A N     1 
ATOM   3040 C  CA    . ASN A 1 397 ? 16.551  -67.786 68.950  1.00 118.57 ? 397 ASN A CA    1 
ATOM   3041 C  C     . ASN A 1 397 ? 17.257  -67.550 70.281  1.00 128.90 ? 397 ASN A C     1 
ATOM   3042 O  O     . ASN A 1 397 ? 16.902  -68.151 71.291  1.00 144.03 ? 397 ASN A O     1 
ATOM   3043 C  CB    . ASN A 1 397 ? 16.080  -66.446 68.400  1.00 118.81 ? 397 ASN A CB    1 
ATOM   3044 C  CG    . ASN A 1 397 ? 14.959  -65.859 69.218  1.00 112.18 ? 397 ASN A CG    1 
ATOM   3045 O  OD1   . ASN A 1 397 ? 15.186  -65.244 70.262  1.00 115.50 ? 397 ASN A OD1   1 
ATOM   3046 N  ND2   . ASN A 1 397 ? 13.730  -66.068 68.763  1.00 110.22 ? 397 ASN A ND2   1 
ATOM   3047 N  N     . LYS A 1 398 ? 18.245  -66.662 70.293  1.00 117.15 ? 398 LYS A N     1 
ATOM   3048 C  CA    . LYS A 1 398 ? 19.012  -66.446 71.510  1.00 109.95 ? 398 LYS A CA    1 
ATOM   3049 C  C     . LYS A 1 398 ? 18.102  -66.153 72.706  1.00 128.08 ? 398 LYS A C     1 
ATOM   3050 O  O     . LYS A 1 398 ? 18.092  -66.893 73.685  1.00 148.22 ? 398 LYS A O     1 
ATOM   3051 C  CB    . LYS A 1 398 ? 20.041  -65.335 71.320  1.00 90.07  ? 398 LYS A CB    1 
ATOM   3052 C  CG    . LYS A 1 398 ? 21.058  -65.262 72.435  1.00 86.45  ? 398 LYS A CG    1 
ATOM   3053 C  CD    . LYS A 1 398 ? 22.025  -64.113 72.236  1.00 85.94  ? 398 LYS A CD    1 
ATOM   3054 C  CE    . LYS A 1 398 ? 22.971  -63.986 73.408  1.00 85.56  ? 398 LYS A CE    1 
ATOM   3055 N  NZ    . LYS A 1 398 ? 23.668  -62.680 73.389  1.00 85.68  ? 398 LYS A NZ    1 
ATOM   3056 N  N     . ALA A 1 399 ? 17.321  -65.085 72.610  1.00 120.92 ? 399 ALA A N     1 
ATOM   3057 C  CA    . ALA A 1 399 ? 16.461  -64.683 73.712  1.00 115.65 ? 399 ALA A CA    1 
ATOM   3058 C  C     . ALA A 1 399 ? 15.515  -65.795 74.172  1.00 117.91 ? 399 ALA A C     1 
ATOM   3059 O  O     . ALA A 1 399 ? 15.302  -65.960 75.371  1.00 106.37 ? 399 ALA A O     1 
ATOM   3060 C  CB    . ALA A 1 399 ? 15.693  -63.431 73.356  1.00 112.14 ? 399 ALA A CB    1 
ATOM   3061 N  N     . ASP A 1 400 ? 14.945  -66.555 73.239  1.00 134.69 ? 400 ASP A N     1 
ATOM   3062 C  CA    . ASP A 1 400 ? 14.072  -67.668 73.636  1.00 147.56 ? 400 ASP A CA    1 
ATOM   3063 C  C     . ASP A 1 400 ? 14.850  -68.799 74.342  1.00 151.30 ? 400 ASP A C     1 
ATOM   3064 O  O     . ASP A 1 400 ? 14.330  -69.460 75.240  1.00 151.18 ? 400 ASP A O     1 
ATOM   3065 C  CB    . ASP A 1 400 ? 13.268  -68.226 72.443  1.00 152.70 ? 400 ASP A CB    1 
ATOM   3066 C  CG    . ASP A 1 400 ? 12.281  -69.324 72.865  1.00 155.08 ? 400 ASP A CG    1 
ATOM   3067 O  OD1   . ASP A 1 400 ? 12.073  -70.300 72.100  1.00 169.01 ? 400 ASP A OD1   1 
ATOM   3068 O  OD2   . ASP A 1 400 ? 11.710  -69.207 73.972  1.00 142.10 ? 400 ASP A OD2   1 
ATOM   3069 N  N     . ALA A 1 401 ? 16.092  -69.014 73.923  1.00 157.19 ? 401 ALA A N     1 
ATOM   3070 C  CA    . ALA A 1 401 ? 16.941  -70.042 74.512  1.00 170.67 ? 401 ALA A CA    1 
ATOM   3071 C  C     . ALA A 1 401 ? 17.246  -69.753 75.998  1.00 164.36 ? 401 ALA A C     1 
ATOM   3072 O  O     . ALA A 1 401 ? 17.153  -70.631 76.855  1.00 163.69 ? 401 ALA A O     1 
ATOM   3073 C  CB    . ALA A 1 401 ? 18.235  -70.170 73.700  1.00 187.24 ? 401 ALA A CB    1 
ATOM   3074 N  N     . LYS A 1 402 ? 17.626  -68.513 76.279  1.00 157.45 ? 402 LYS A N     1 
ATOM   3075 C  CA    . LYS A 1 402 ? 17.855  -68.071 77.633  1.00 150.55 ? 402 LYS A CA    1 
ATOM   3076 C  C     . LYS A 1 402 ? 16.597  -68.258 78.475  1.00 145.98 ? 402 LYS A C     1 
ATOM   3077 O  O     . LYS A 1 402 ? 16.633  -68.888 79.533  1.00 128.22 ? 402 LYS A O     1 
ATOM   3078 C  CB    . LYS A 1 402 ? 18.290  -66.613 77.628  1.00 149.10 ? 402 LYS A CB    1 
ATOM   3079 C  CG    . LYS A 1 402 ? 19.692  -66.420 77.098  1.00 147.48 ? 402 LYS A CG    1 
ATOM   3080 C  CD    . LYS A 1 402 ? 19.968  -64.973 76.750  1.00 150.36 ? 402 LYS A CD    1 
ATOM   3081 C  CE    . LYS A 1 402 ? 20.239  -64.141 77.975  1.00 155.12 ? 402 LYS A CE    1 
ATOM   3082 N  NZ    . LYS A 1 402 ? 20.612  -62.759 77.590  1.00 158.84 ? 402 LYS A NZ    1 
ATOM   3083 N  N     . GLU A 1 403 ? 15.483  -67.716 78.003  1.00 161.72 ? 403 GLU A N     1 
ATOM   3084 C  CA    . GLU A 1 403 ? 14.207  -67.897 78.682  1.00 168.56 ? 403 GLU A CA    1 
ATOM   3085 C  C     . GLU A 1 403 ? 13.971  -69.367 79.024  1.00 145.17 ? 403 GLU A C     1 
ATOM   3086 O  O     . GLU A 1 403 ? 13.667  -69.701 80.169  1.00 121.91 ? 403 GLU A O     1 
ATOM   3087 C  CB    . GLU A 1 403 ? 13.055  -67.346 77.834  1.00 181.02 ? 403 GLU A CB    1 
ATOM   3088 C  CG    . GLU A 1 403 ? 11.741  -67.195 78.586  1.00 171.40 ? 403 GLU A CG    1 
ATOM   3089 C  CD    . GLU A 1 403 ? 11.881  -66.365 79.859  1.00 151.06 ? 403 GLU A CD    1 
ATOM   3090 O  OE1   . GLU A 1 403 ? 11.054  -66.567 80.778  1.00 146.08 ? 403 GLU A OE1   1 
ATOM   3091 O  OE2   . GLU A 1 403 ? 12.806  -65.515 79.942  1.00 145.32 ? 403 GLU A OE2   1 
ATOM   3092 N  N     . ASN A 1 404 ? 14.131  -70.246 78.043  1.00 140.79 ? 404 ASN A N     1 
ATOM   3093 C  CA    . ASN A 1 404 ? 13.902  -71.670 78.269  1.00 126.37 ? 404 ASN A CA    1 
ATOM   3094 C  C     . ASN A 1 404 ? 14.846  -72.284 79.306  1.00 109.40 ? 404 ASN A C     1 
ATOM   3095 O  O     . ASN A 1 404 ? 14.492  -73.244 79.986  1.00 99.31  ? 404 ASN A O     1 
ATOM   3096 C  CB    . ASN A 1 404 ? 13.995  -72.454 76.956  1.00 123.95 ? 404 ASN A CB    1 
ATOM   3097 C  CG    . ASN A 1 404 ? 12.820  -72.207 76.041  1.00 120.71 ? 404 ASN A CG    1 
ATOM   3098 O  OD1   . ASN A 1 404 ? 11.673  -72.223 76.475  1.00 117.07 ? 404 ASN A OD1   1 
ATOM   3099 N  ND2   . ASN A 1 404 ? 13.098  -71.980 74.760  1.00 122.24 ? 404 ASN A ND2   1 
ATOM   3100 N  N     . LEU A 1 405 ? 16.053  -71.741 79.410  1.00 113.34 ? 405 LEU A N     1 
ATOM   3101 C  CA    . LEU A 1 405 ? 17.032  -72.255 80.363  1.00 120.51 ? 405 LEU A CA    1 
ATOM   3102 C  C     . LEU A 1 405 ? 16.654  -71.822 81.771  1.00 101.37 ? 405 LEU A C     1 
ATOM   3103 O  O     . LEU A 1 405 ? 16.828  -72.577 82.723  1.00 97.80  ? 405 LEU A O     1 
ATOM   3104 C  CB    . LEU A 1 405 ? 18.448  -71.771 80.037  1.00 148.39 ? 405 LEU A CB    1 
ATOM   3105 C  CG    . LEU A 1 405 ? 19.255  -72.499 78.960  1.00 174.58 ? 405 LEU A CG    1 
ATOM   3106 C  CD1   . LEU A 1 405 ? 20.451  -71.660 78.534  1.00 188.41 ? 405 LEU A CD1   1 
ATOM   3107 C  CD2   . LEU A 1 405 ? 19.707  -73.858 79.466  1.00 178.70 ? 405 LEU A CD2   1 
ATOM   3108 N  N     . LYS A 1 406 ? 16.152  -70.598 81.901  1.00 99.95  ? 406 LYS A N     1 
ATOM   3109 C  CA    . LYS A 1 406 ? 15.658  -70.124 83.186  1.00 106.58 ? 406 LYS A CA    1 
ATOM   3110 C  C     . LYS A 1 406 ? 14.466  -70.973 83.609  1.00 114.98 ? 406 LYS A C     1 
ATOM   3111 O  O     . LYS A 1 406 ? 14.488  -71.637 84.645  1.00 116.22 ? 406 LYS A O     1 
ATOM   3112 C  CB    . LYS A 1 406 ? 15.209  -68.674 83.088  1.00 112.78 ? 406 LYS A CB    1 
ATOM   3113 C  CG    . LYS A 1 406 ? 16.307  -67.672 82.868  1.00 117.47 ? 406 LYS A CG    1 
ATOM   3114 C  CD    . LYS A 1 406 ? 15.671  -66.332 82.561  1.00 118.25 ? 406 LYS A CD    1 
ATOM   3115 C  CE    . LYS A 1 406 ? 16.679  -65.264 82.189  1.00 117.80 ? 406 LYS A CE    1 
ATOM   3116 N  NZ    . LYS A 1 406 ? 15.939  -64.070 81.678  1.00 119.55 ? 406 LYS A NZ    1 
ATOM   3117 N  N     . VAL A 1 407 ? 13.425  -70.951 82.788  1.00 110.34 ? 407 VAL A N     1 
ATOM   3118 C  CA    . VAL A 1 407 ? 12.189  -71.642 83.116  1.00 106.94 ? 407 VAL A CA    1 
ATOM   3119 C  C     . VAL A 1 407 ? 12.355  -73.145 83.369  1.00 105.00 ? 407 VAL A C     1 
ATOM   3120 O  O     . VAL A 1 407 ? 11.811  -73.671 84.331  1.00 111.93 ? 407 VAL A O     1 
ATOM   3121 C  CB    . VAL A 1 407 ? 11.112  -71.408 82.041  1.00 103.91 ? 407 VAL A CB    1 
ATOM   3122 C  CG1   . VAL A 1 407 ? 9.940   -72.355 82.257  1.00 100.43 ? 407 VAL A CG1   1 
ATOM   3123 C  CG2   . VAL A 1 407 ? 10.663  -69.935 82.039  1.00 96.28  ? 407 VAL A CG2   1 
ATOM   3124 N  N     . SER A 1 408 ? 13.106  -73.839 82.524  1.00 96.05  ? 408 SER A N     1 
ATOM   3125 C  CA    . SER A 1 408 ? 13.175  -75.292 82.652  1.00 95.60  ? 408 SER A CA    1 
ATOM   3126 C  C     . SER A 1 408 ? 14.197  -75.769 83.698  1.00 102.81 ? 408 SER A C     1 
ATOM   3127 O  O     . SER A 1 408 ? 14.022  -76.829 84.296  1.00 105.31 ? 408 SER A O     1 
ATOM   3128 C  CB    . SER A 1 408 ? 13.401  -75.973 81.282  1.00 92.97  ? 408 SER A CB    1 
ATOM   3129 N  N     . TYR A 1 409 ? 15.251  -74.993 83.940  1.00 97.49  ? 409 TYR A N     1 
ATOM   3130 C  CA    . TYR A 1 409 ? 16.334  -75.472 84.809  1.00 106.74 ? 409 TYR A CA    1 
ATOM   3131 C  C     . TYR A 1 409 ? 16.825  -74.465 85.838  1.00 116.17 ? 409 TYR A C     1 
ATOM   3132 O  O     . TYR A 1 409 ? 17.827  -74.708 86.502  1.00 109.81 ? 409 TYR A O     1 
ATOM   3133 C  CB    . TYR A 1 409 ? 17.534  -75.983 83.988  1.00 113.42 ? 409 TYR A CB    1 
ATOM   3134 C  CG    . TYR A 1 409 ? 17.230  -77.196 83.142  1.00 117.60 ? 409 TYR A CG    1 
ATOM   3135 C  CD1   . TYR A 1 409 ? 17.176  -78.462 83.706  1.00 118.52 ? 409 TYR A CD1   1 
ATOM   3136 C  CD2   . TYR A 1 409 ? 17.005  -77.077 81.767  1.00 122.00 ? 409 TYR A CD2   1 
ATOM   3137 C  CE1   . TYR A 1 409 ? 16.901  -79.582 82.932  1.00 129.78 ? 409 TYR A CE1   1 
ATOM   3138 C  CE2   . TYR A 1 409 ? 16.728  -78.192 80.982  1.00 132.64 ? 409 TYR A CE2   1 
ATOM   3139 C  CZ    . TYR A 1 409 ? 16.680  -79.444 81.570  1.00 147.99 ? 409 TYR A CZ    1 
ATOM   3140 O  OH    . TYR A 1 409 ? 16.394  -80.563 80.817  1.00 175.10 ? 409 TYR A OH    1 
ATOM   3141 N  N     . ASP A 1 410 ? 16.149  -73.326 85.945  1.00 127.71 ? 410 ASP A N     1 
ATOM   3142 C  CA    . ASP A 1 410 ? 16.413  -72.354 87.020  1.00 121.78 ? 410 ASP A CA    1 
ATOM   3143 C  C     . ASP A 1 410 ? 17.698  -71.547 86.922  1.00 113.17 ? 410 ASP A C     1 
ATOM   3144 O  O     . ASP A 1 410 ? 18.044  -70.834 87.855  1.00 100.28 ? 410 ASP A O     1 
ATOM   3145 C  CB    . ASP A 1 410 ? 16.372  -73.027 88.394  1.00 116.25 ? 410 ASP A CB    1 
ATOM   3146 C  CG    . ASP A 1 410 ? 15.002  -73.531 88.747  1.00 114.55 ? 410 ASP A CG    1 
ATOM   3147 O  OD1   . ASP A 1 410 ? 14.102  -72.687 88.938  1.00 111.30 ? 410 ASP A OD1   1 
ATOM   3148 O  OD2   . ASP A 1 410 ? 14.833  -74.768 88.829  1.00 118.24 ? 410 ASP A OD2   1 
ATOM   3149 N  N     . PHE A 1 411 ? 18.416  -71.650 85.817  1.00 118.22 ? 411 PHE A N     1 
ATOM   3150 C  CA    . PHE A 1 411 ? 19.568  -70.786 85.638  1.00 114.89 ? 411 PHE A CA    1 
ATOM   3151 C  C     . PHE A 1 411 ? 19.092  -69.342 85.683  1.00 96.80  ? 411 PHE A C     1 
ATOM   3152 O  O     . PHE A 1 411 ? 17.994  -69.030 85.217  1.00 93.39  ? 411 PHE A O     1 
ATOM   3153 C  CB    . PHE A 1 411 ? 20.267  -71.071 84.296  1.00 125.87 ? 411 PHE A CB    1 
ATOM   3154 C  CG    . PHE A 1 411 ? 20.848  -72.450 84.197  1.00 134.37 ? 411 PHE A CG    1 
ATOM   3155 C  CD1   . PHE A 1 411 ? 22.022  -72.770 84.850  1.00 137.74 ? 411 PHE A CD1   1 
ATOM   3156 C  CD2   . PHE A 1 411 ? 20.221  -73.428 83.447  1.00 139.00 ? 411 PHE A CD2   1 
ATOM   3157 C  CE1   . PHE A 1 411 ? 22.562  -74.045 84.754  1.00 141.10 ? 411 PHE A CE1   1 
ATOM   3158 C  CE2   . PHE A 1 411 ? 20.752  -74.707 83.361  1.00 142.55 ? 411 PHE A CE2   1 
ATOM   3159 C  CZ    . PHE A 1 411 ? 21.925  -75.012 84.012  1.00 142.58 ? 411 PHE A CZ    1 
ATOM   3160 N  N     . THR A 1 412 ? 19.916  -68.458 86.232  1.00 89.99  ? 412 THR A N     1 
ATOM   3161 C  CA    . THR A 1 412 ? 19.655  -67.025 86.113  1.00 92.49  ? 412 THR A CA    1 
ATOM   3162 C  C     . THR A 1 412 ? 20.035  -66.475 84.740  1.00 102.56 ? 412 THR A C     1 
ATOM   3163 O  O     . THR A 1 412 ? 20.755  -67.121 83.973  1.00 91.77  ? 412 THR A O     1 
ATOM   3164 C  CB    . THR A 1 412 ? 20.451  -66.205 87.138  1.00 90.36  ? 412 THR A CB    1 
ATOM   3165 O  OG1   . THR A 1 412 ? 21.849  -66.347 86.869  1.00 89.86  ? 412 THR A OG1   1 
ATOM   3166 C  CG2   . THR A 1 412 ? 20.159  -66.687 88.547  1.00 92.82  ? 412 THR A CG2   1 
ATOM   3167 N  N     . GLU A 1 413 ? 19.552  -65.271 84.451  1.00 134.59 ? 413 GLU A N     1 
ATOM   3168 C  CA    . GLU A 1 413 ? 19.961  -64.519 83.276  1.00 162.58 ? 413 GLU A CA    1 
ATOM   3169 C  C     . GLU A 1 413 ? 21.466  -64.598 83.029  1.00 163.51 ? 413 GLU A C     1 
ATOM   3170 O  O     . GLU A 1 413 ? 21.903  -65.101 82.005  1.00 177.75 ? 413 GLU A O     1 
ATOM   3171 C  CB    . GLU A 1 413 ? 19.554  -63.056 83.423  1.00 180.30 ? 413 GLU A CB    1 
ATOM   3172 C  CG    . GLU A 1 413 ? 20.217  -62.145 82.421  1.00 192.06 ? 413 GLU A CG    1 
ATOM   3173 C  CD    . GLU A 1 413 ? 19.644  -62.301 81.032  1.00 201.65 ? 413 GLU A CD    1 
ATOM   3174 O  OE1   . GLU A 1 413 ? 20.286  -61.820 80.072  1.00 203.10 ? 413 GLU A OE1   1 
ATOM   3175 O  OE2   . GLU A 1 413 ? 18.551  -62.897 80.902  1.00 206.16 ? 413 GLU A OE2   1 
ATOM   3176 N  N     . GLU A 1 414 ? 22.257  -64.112 83.976  1.00 142.28 ? 414 GLU A N     1 
ATOM   3177 C  CA    . GLU A 1 414 ? 23.708  -64.074 83.807  1.00 118.34 ? 414 GLU A CA    1 
ATOM   3178 C  C     . GLU A 1 414 ? 24.321  -65.433 83.448  1.00 97.76  ? 414 GLU A C     1 
ATOM   3179 O  O     . GLU A 1 414 ? 25.274  -65.501 82.680  1.00 86.04  ? 414 GLU A O     1 
ATOM   3180 C  CB    . GLU A 1 414 ? 24.404  -63.438 85.027  1.00 115.50 ? 414 GLU A CB    1 
ATOM   3181 C  CG    . GLU A 1 414 ? 23.567  -63.431 86.317  1.00 119.30 ? 414 GLU A CG    1 
ATOM   3182 C  CD    . GLU A 1 414 ? 22.476  -62.358 86.337  1.00 129.20 ? 414 GLU A CD    1 
ATOM   3183 O  OE1   . GLU A 1 414 ? 21.448  -62.566 87.022  1.00 126.83 ? 414 GLU A OE1   1 
ATOM   3184 O  OE2   . GLU A 1 414 ? 22.655  -61.306 85.680  1.00 132.71 ? 414 GLU A OE2   1 
ATOM   3185 N  N     . GLN A 1 415 ? 23.767  -66.505 83.994  1.00 87.16  ? 415 GLN A N     1 
ATOM   3186 C  CA    . GLN A 1 415 ? 24.256  -67.852 83.709  1.00 86.63  ? 415 GLN A CA    1 
ATOM   3187 C  C     . GLN A 1 415 ? 23.783  -68.300 82.336  1.00 86.51  ? 415 GLN A C     1 
ATOM   3188 O  O     . GLN A 1 415 ? 24.519  -68.948 81.586  1.00 92.38  ? 415 GLN A O     1 
ATOM   3189 C  CB    . GLN A 1 415 ? 23.749  -68.846 84.757  1.00 87.13  ? 415 GLN A CB    1 
ATOM   3190 C  CG    . GLN A 1 415 ? 24.163  -68.524 86.179  1.00 87.32  ? 415 GLN A CG    1 
ATOM   3191 C  CD    . GLN A 1 415 ? 23.578  -69.490 87.188  1.00 87.90  ? 415 GLN A CD    1 
ATOM   3192 O  OE1   . GLN A 1 415 ? 22.362  -69.683 87.253  1.00 88.63  ? 415 GLN A OE1   1 
ATOM   3193 N  NE2   . GLN A 1 415 ? 24.445  -70.112 87.978  1.00 87.59  ? 415 GLN A NE2   1 
ATOM   3194 N  N     . ALA A 1 416 ? 22.533  -67.968 82.032  1.00 87.22  ? 416 ALA A N     1 
ATOM   3195 C  CA    . ALA A 1 416 ? 21.931  -68.276 80.748  1.00 87.26  ? 416 ALA A CA    1 
ATOM   3196 C  C     . ALA A 1 416 ? 22.741  -67.629 79.625  1.00 90.18  ? 416 ALA A C     1 
ATOM   3197 O  O     . ALA A 1 416 ? 23.074  -68.279 78.633  1.00 89.30  ? 416 ALA A O     1 
ATOM   3198 C  CB    . ALA A 1 416 ? 20.504  -67.786 80.722  1.00 88.22  ? 416 ALA A CB    1 
ATOM   3199 N  N     . GLU A 1 417 ? 23.066  -66.352 79.802  1.00 111.31 ? 417 GLU A N     1 
ATOM   3200 C  CA    . GLU A 1 417 ? 23.889  -65.622 78.853  1.00 123.24 ? 417 GLU A CA    1 
ATOM   3201 C  C     . GLU A 1 417 ? 25.215  -66.331 78.652  1.00 99.71  ? 417 GLU A C     1 
ATOM   3202 O  O     . GLU A 1 417 ? 25.651  -66.542 77.527  1.00 84.41  ? 417 GLU A O     1 
ATOM   3203 C  CB    . GLU A 1 417 ? 24.139  -64.192 79.338  1.00 143.50 ? 417 GLU A CB    1 
ATOM   3204 C  CG    . GLU A 1 417 ? 24.960  -63.323 78.385  1.00 141.70 ? 417 GLU A CG    1 
ATOM   3205 C  CD    . GLU A 1 417 ? 24.223  -62.988 77.076  1.00 130.38 ? 417 GLU A CD    1 
ATOM   3206 O  OE1   . GLU A 1 417 ? 22.970  -63.111 77.023  1.00 145.25 ? 417 GLU A OE1   1 
ATOM   3207 O  OE2   . GLU A 1 417 ? 24.910  -62.607 76.094  1.00 104.85 ? 417 GLU A OE2   1 
ATOM   3208 N  N     . ALA A 1 418 ? 25.868  -66.704 79.741  1.00 88.18  ? 418 ALA A N     1 
ATOM   3209 C  CA    . ALA A 1 418 ? 27.146  -67.386 79.613  1.00 84.37  ? 418 ALA A CA    1 
ATOM   3210 C  C     . ALA A 1 418 ? 27.019  -68.715 78.864  1.00 83.73  ? 418 ALA A C     1 
ATOM   3211 O  O     . ALA A 1 418 ? 27.868  -69.056 78.046  1.00 83.05  ? 418 ALA A O     1 
ATOM   3212 C  CB    . ALA A 1 418 ? 27.774  -67.610 80.980  1.00 90.18  ? 418 ALA A CB    1 
ATOM   3213 N  N     . ILE A 1 419 ? 25.973  -69.473 79.174  1.00 84.35  ? 419 ILE A N     1 
ATOM   3214 C  CA    . ILE A 1 419 ? 25.841  -70.831 78.675  1.00 98.01  ? 419 ILE A CA    1 
ATOM   3215 C  C     . ILE A 1 419 ? 25.610  -70.795 77.179  1.00 84.05  ? 419 ILE A C     1 
ATOM   3216 O  O     . ILE A 1 419 ? 26.134  -71.602 76.420  1.00 83.57  ? 419 ILE A O     1 
ATOM   3217 C  CB    . ILE A 1 419 ? 24.634  -71.524 79.304  1.00 138.35 ? 419 ILE A CB    1 
ATOM   3218 C  CG1   . ILE A 1 419 ? 24.891  -71.814 80.779  1.00 150.20 ? 419 ILE A CG1   1 
ATOM   3219 C  CG2   . ILE A 1 419 ? 24.311  -72.795 78.558  1.00 168.71 ? 419 ILE A CG2   1 
ATOM   3220 C  CD1   . ILE A 1 419 ? 23.682  -72.395 81.528  1.00 158.77 ? 419 ILE A CD1   1 
ATOM   3221 N  N     . VAL A 1 420 ? 24.810  -69.829 76.778  1.00 84.48  ? 420 VAL A N     1 
ATOM   3222 C  CA    . VAL A 1 420 ? 24.294  -69.734 75.434  1.00 84.52  ? 420 VAL A CA    1 
ATOM   3223 C  C     . VAL A 1 420 ? 25.309  -69.076 74.501  1.00 83.78  ? 420 VAL A C     1 
ATOM   3224 O  O     . VAL A 1 420 ? 25.230  -69.226 73.295  1.00 83.59  ? 420 VAL A O     1 
ATOM   3225 C  CB    . VAL A 1 420 ? 22.991  -68.926 75.476  1.00 98.40  ? 420 VAL A CB    1 
ATOM   3226 C  CG1   . VAL A 1 420 ? 23.100  -67.652 74.656  1.00 85.26  ? 420 VAL A CG1   1 
ATOM   3227 C  CG2   . VAL A 1 420 ? 21.860  -69.774 75.051  1.00 113.59 ? 420 VAL A CG2   1 
ATOM   3228 N  N     . THR A 1 421 ? 26.271  -68.353 75.069  1.00 83.37  ? 421 THR A N     1 
ATOM   3229 C  CA    . THR A 1 421 ? 27.326  -67.745 74.271  1.00 82.66  ? 421 THR A CA    1 
ATOM   3230 C  C     . THR A 1 421 ? 28.618  -68.556 74.285  1.00 81.89  ? 421 THR A C     1 
ATOM   3231 O  O     . THR A 1 421 ? 29.671  -68.064 73.844  1.00 81.27  ? 421 THR A O     1 
ATOM   3232 C  CB    . THR A 1 421 ? 27.639  -66.319 74.718  1.00 82.70  ? 421 THR A CB    1 
ATOM   3233 O  OG1   . THR A 1 421 ? 28.182  -66.329 76.051  1.00 82.67  ? 421 THR A OG1   1 
ATOM   3234 C  CG2   . THR A 1 421 ? 26.376  -65.452 74.653  1.00 91.98  ? 421 THR A CG2   1 
ATOM   3235 N  N     . LEU A 1 422 ? 28.543  -69.794 74.776  1.00 81.96  ? 422 LEU A N     1 
ATOM   3236 C  CA    . LEU A 1 422 ? 29.682  -70.707 74.694  1.00 81.31  ? 422 LEU A CA    1 
ATOM   3237 C  C     . LEU A 1 422 ? 29.923  -71.123 73.224  1.00 80.91  ? 422 LEU A C     1 
ATOM   3238 O  O     . LEU A 1 422 ? 28.989  -71.270 72.432  1.00 81.26  ? 422 LEU A O     1 
ATOM   3239 C  CB    . LEU A 1 422 ? 29.470  -71.951 75.574  1.00 81.58  ? 422 LEU A CB    1 
ATOM   3240 C  CG    . LEU A 1 422 ? 29.456  -71.798 77.102  1.00 81.90  ? 422 LEU A CG    1 
ATOM   3241 C  CD1   . LEU A 1 422 ? 29.052  -73.102 77.772  1.00 133.00 ? 422 LEU A CD1   1 
ATOM   3242 C  CD2   . LEU A 1 422 ? 30.793  -71.331 77.624  1.00 81.34  ? 422 LEU A CD2   1 
ATOM   3243 N  N     . GLN A 1 423 ? 31.178  -71.312 72.863  1.00 80.20  ? 423 GLN A N     1 
ATOM   3244 C  CA    . GLN A 1 423 ? 31.491  -71.825 71.551  1.00 79.83  ? 423 GLN A CA    1 
ATOM   3245 C  C     . GLN A 1 423 ? 31.272  -73.338 71.510  1.00 79.97  ? 423 GLN A C     1 
ATOM   3246 O  O     . GLN A 1 423 ? 31.449  -74.027 72.519  1.00 80.08  ? 423 GLN A O     1 
ATOM   3247 C  CB    . GLN A 1 423 ? 32.913  -71.436 71.164  1.00 85.81  ? 423 GLN A CB    1 
ATOM   3248 C  CG    . GLN A 1 423 ? 33.169  -69.942 71.294  1.00 89.43  ? 423 GLN A CG    1 
ATOM   3249 C  CD    . GLN A 1 423 ? 34.486  -69.521 70.664  1.00 90.76  ? 423 GLN A CD    1 
ATOM   3250 O  OE1   . GLN A 1 423 ? 34.858  -68.355 70.723  1.00 94.36  ? 423 GLN A OE1   1 
ATOM   3251 N  NE2   . GLN A 1 423 ? 35.192  -70.469 70.057  1.00 77.84  ? 423 GLN A NE2   1 
ATOM   3252 N  N     . LEU A 1 424 ? 30.864  -73.837 70.346  1.00 107.63 ? 424 LEU A N     1 
ATOM   3253 C  CA    . LEU A 1 424 ? 30.546  -75.248 70.175  1.00 124.06 ? 424 LEU A CA    1 
ATOM   3254 C  C     . LEU A 1 424 ? 31.640  -76.161 70.705  1.00 137.42 ? 424 LEU A C     1 
ATOM   3255 O  O     . LEU A 1 424 ? 31.356  -77.270 71.134  1.00 158.96 ? 424 LEU A O     1 
ATOM   3256 C  CB    . LEU A 1 424 ? 30.301  -75.578 68.693  1.00 125.80 ? 424 LEU A CB    1 
ATOM   3257 C  CG    . LEU A 1 424 ? 28.922  -75.307 68.107  1.00 128.09 ? 424 LEU A CG    1 
ATOM   3258 C  CD1   . LEU A 1 424 ? 28.885  -75.801 66.692  1.00 125.97 ? 424 LEU A CD1   1 
ATOM   3259 C  CD2   . LEU A 1 424 ? 27.879  -76.030 68.907  1.00 133.23 ? 424 LEU A CD2   1 
ATOM   3260 N  N     . TYR A 1 425 ? 32.892  -75.722 70.663  1.00 116.23 ? 425 TYR A N     1 
ATOM   3261 C  CA    . TYR A 1 425 ? 33.956  -76.668 70.955  1.00 93.19  ? 425 TYR A CA    1 
ATOM   3262 C  C     . TYR A 1 425 ? 33.995  -76.997 72.449  1.00 88.23  ? 425 TYR A C     1 
ATOM   3263 O  O     . TYR A 1 425 ? 34.484  -78.053 72.855  1.00 80.62  ? 425 TYR A O     1 
ATOM   3264 C  CB    . TYR A 1 425 ? 35.315  -76.217 70.394  1.00 78.16  ? 425 TYR A CB    1 
ATOM   3265 C  CG    . TYR A 1 425 ? 35.967  -75.112 71.153  1.00 77.89  ? 425 TYR A CG    1 
ATOM   3266 C  CD1   . TYR A 1 425 ? 35.884  -73.802 70.714  1.00 77.76  ? 425 TYR A CD1   1 
ATOM   3267 C  CD2   . TYR A 1 425 ? 36.672  -75.375 72.320  1.00 77.99  ? 425 TYR A CD2   1 
ATOM   3268 C  CE1   . TYR A 1 425 ? 36.486  -72.782 71.416  1.00 85.04  ? 425 TYR A CE1   1 
ATOM   3269 C  CE2   . TYR A 1 425 ? 37.269  -74.361 73.037  1.00 77.61  ? 425 TYR A CE2   1 
ATOM   3270 C  CZ    . TYR A 1 425 ? 37.175  -73.070 72.580  1.00 82.43  ? 425 TYR A CZ    1 
ATOM   3271 O  OH    . TYR A 1 425 ? 37.767  -72.062 73.293  1.00 82.33  ? 425 TYR A OH    1 
ATOM   3272 N  N     . ARG A 1 426 ? 33.438  -76.104 73.255  1.00 105.60 ? 426 ARG A N     1 
ATOM   3273 C  CA    . ARG A 1 426 ? 33.345  -76.326 74.679  1.00 125.14 ? 426 ARG A CA    1 
ATOM   3274 C  C     . ARG A 1 426 ? 32.620  -77.622 74.992  1.00 146.15 ? 426 ARG A C     1 
ATOM   3275 O  O     . ARG A 1 426 ? 32.876  -78.233 76.018  1.00 134.92 ? 426 ARG A O     1 
ATOM   3276 C  CB    . ARG A 1 426 ? 32.593  -75.178 75.334  1.00 120.52 ? 426 ARG A CB    1 
ATOM   3277 C  CG    . ARG A 1 426 ? 33.275  -73.851 75.215  1.00 110.01 ? 426 ARG A CG    1 
ATOM   3278 C  CD    . ARG A 1 426 ? 34.622  -73.894 75.858  1.00 99.40  ? 426 ARG A CD    1 
ATOM   3279 N  NE    . ARG A 1 426 ? 35.312  -72.619 75.723  1.00 98.03  ? 426 ARG A NE    1 
ATOM   3280 C  CZ    . ARG A 1 426 ? 36.444  -72.313 76.352  1.00 109.27 ? 426 ARG A CZ    1 
ATOM   3281 N  NH1   . ARG A 1 426 ? 37.015  -73.198 77.166  1.00 108.19 ? 426 ARG A NH1   1 
ATOM   3282 N  NH2   . ARG A 1 426 ? 37.004  -71.118 76.167  1.00 123.38 ? 426 ARG A NH2   1 
ATOM   3283 N  N     . LEU A 1 427 ? 31.700  -78.044 74.133  1.00 172.77 ? 427 LEU A N     1 
ATOM   3284 C  CA    . LEU A 1 427 ? 30.953  -79.266 74.415  1.00 181.17 ? 427 LEU A CA    1 
ATOM   3285 C  C     . LEU A 1 427 ? 31.825  -80.528 74.471  1.00 156.45 ? 427 LEU A C     1 
ATOM   3286 O  O     . LEU A 1 427 ? 31.331  -81.616 74.790  1.00 138.38 ? 427 LEU A O     1 
ATOM   3287 C  CB    . LEU A 1 427 ? 29.854  -79.466 73.393  1.00 199.89 ? 427 LEU A CB    1 
ATOM   3288 C  CG    . LEU A 1 427 ? 28.902  -78.297 73.181  1.00 211.55 ? 427 LEU A CG    1 
ATOM   3289 C  CD1   . LEU A 1 427 ? 28.027  -78.629 71.992  1.00 209.09 ? 427 LEU A CD1   1 
ATOM   3290 C  CD2   . LEU A 1 427 ? 28.057  -78.033 74.414  1.00 221.51 ? 427 LEU A CD2   1 
ATOM   3291 N  N     . THR A 1 428 ? 33.112  -80.386 74.161  1.00 139.79 ? 428 THR A N     1 
ATOM   3292 C  CA    . THR A 1 428 ? 34.032  -81.518 74.165  1.00 103.42 ? 428 THR A CA    1 
ATOM   3293 C  C     . THR A 1 428 ? 34.500  -81.797 75.585  1.00 90.82  ? 428 THR A C     1 
ATOM   3294 O  O     . THR A 1 428 ? 34.938  -82.907 75.911  1.00 93.49  ? 428 THR A O     1 
ATOM   3295 C  CB    . THR A 1 428 ? 35.263  -81.261 73.264  1.00 85.06  ? 428 THR A CB    1 
ATOM   3296 O  OG1   . THR A 1 428 ? 35.957  -80.095 73.710  1.00 78.99  ? 428 THR A OG1   1 
ATOM   3297 C  CG2   . THR A 1 428 ? 34.851  -81.063 71.786  1.00 79.29  ? 428 THR A CG2   1 
ATOM   3298 N  N     . ASN A 1 429 ? 34.391  -80.777 76.433  1.00 98.90  ? 429 ASN A N     1 
ATOM   3299 C  CA    . ASN A 1 429 ? 34.794  -80.886 77.830  1.00 93.94  ? 429 ASN A CA    1 
ATOM   3300 C  C     . ASN A 1 429 ? 33.752  -81.461 78.771  1.00 85.84  ? 429 ASN A C     1 
ATOM   3301 O  O     . ASN A 1 429 ? 32.556  -81.198 78.648  1.00 90.78  ? 429 ASN A O     1 
ATOM   3302 C  CB    . ASN A 1 429 ? 35.239  -79.547 78.390  1.00 96.24  ? 429 ASN A CB    1 
ATOM   3303 C  CG    . ASN A 1 429 ? 35.949  -79.709 79.696  1.00 110.02 ? 429 ASN A CG    1 
ATOM   3304 O  OD1   . ASN A 1 429 ? 36.678  -80.685 79.893  1.00 106.96 ? 429 ASN A OD1   1 
ATOM   3305 N  ND2   . ASN A 1 429 ? 35.723  -78.782 80.615  1.00 117.62 ? 429 ASN A ND2   1 
ATOM   3306 N  N     . ASP A 1 431 ? 34.407  -82.602 82.641  1.00 205.56 ? 431 ASP A N     1 
ATOM   3307 C  CA    . ASP A 1 431 ? 35.214  -82.605 83.846  1.00 150.13 ? 431 ASP A CA    1 
ATOM   3308 C  C     . ASP A 1 431 ? 34.699  -81.555 84.820  1.00 142.10 ? 431 ASP A C     1 
ATOM   3309 O  O     . ASP A 1 431 ? 34.930  -80.354 84.675  1.00 116.26 ? 431 ASP A O     1 
ATOM   3310 C  CB    . ASP A 1 431 ? 36.713  -82.395 83.558  1.00 161.31 ? 431 ASP A CB    1 
ATOM   3311 C  CG    . ASP A 1 431 ? 37.567  -82.423 84.847  1.00 187.15 ? 431 ASP A CG    1 
ATOM   3312 O  OD1   . ASP A 1 431 ? 38.600  -81.718 84.914  1.00 192.71 ? 431 ASP A OD1   1 
ATOM   3313 O  OD2   . ASP A 1 431 ? 37.194  -83.153 85.802  1.00 204.71 ? 431 ASP A OD2   1 
ATOM   3314 N  N     . VAL A 1 432 ? 33.991  -82.028 85.827  1.00 244.33 ? 432 VAL A N     1 
ATOM   3315 C  CA    . VAL A 1 432 ? 33.474  -81.147 86.848  1.00 219.86 ? 432 VAL A CA    1 
ATOM   3316 C  C     . VAL A 1 432 ? 34.576  -80.757 87.851  1.00 179.79 ? 432 VAL A C     1 
ATOM   3317 O  O     . VAL A 1 432 ? 34.526  -79.697 88.470  1.00 158.80 ? 432 VAL A O     1 
ATOM   3318 C  CB    . VAL A 1 432 ? 32.267  -81.805 87.519  1.00 211.88 ? 432 VAL A CB    1 
ATOM   3319 C  CG1   . VAL A 1 432 ? 32.345  -81.682 89.025  1.00 202.06 ? 432 VAL A CG1   1 
ATOM   3320 C  CG2   . VAL A 1 432 ? 30.986  -81.217 86.958  1.00 204.97 ? 432 VAL A CG2   1 
ATOM   3321 N  N     . VAL A 1 433 ? 35.591  -81.602 87.968  1.00 155.74 ? 433 VAL A N     1 
ATOM   3322 C  CA    . VAL A 1 433 ? 36.683  -81.398 88.916  1.00 131.86 ? 433 VAL A CA    1 
ATOM   3323 C  C     . VAL A 1 433 ? 37.461  -80.087 88.727  1.00 117.42 ? 433 VAL A C     1 
ATOM   3324 O  O     . VAL A 1 433 ? 37.725  -79.360 89.693  1.00 106.00 ? 433 VAL A O     1 
ATOM   3325 C  CB    . VAL A 1 433 ? 37.660  -82.581 88.868  1.00 137.16 ? 433 VAL A CB    1 
ATOM   3326 C  CG1   . VAL A 1 433 ? 38.935  -82.256 89.614  1.00 129.86 ? 433 VAL A CG1   1 
ATOM   3327 C  CG2   . VAL A 1 433 ? 36.997  -83.811 89.438  1.00 150.13 ? 433 VAL A CG2   1 
ATOM   3328 N  N     . VAL A 1 434 ? 37.850  -79.792 87.492  1.00 119.91 ? 434 VAL A N     1 
ATOM   3329 C  CA    . VAL A 1 434 ? 38.575  -78.558 87.214  1.00 123.60 ? 434 VAL A CA    1 
ATOM   3330 C  C     . VAL A 1 434 ? 37.751  -77.358 87.692  1.00 109.68 ? 434 VAL A C     1 
ATOM   3331 O  O     . VAL A 1 434 ? 38.277  -76.443 88.349  1.00 101.02 ? 434 VAL A O     1 
ATOM   3332 C  CB    . VAL A 1 434 ? 38.854  -78.414 85.721  1.00 156.89 ? 434 VAL A CB    1 
ATOM   3333 C  CG1   . VAL A 1 434 ? 37.534  -78.503 84.923  1.00 150.05 ? 434 VAL A CG1   1 
ATOM   3334 C  CG2   . VAL A 1 434 ? 39.584  -77.100 85.435  1.00 188.53 ? 434 VAL A CG2   1 
ATOM   3335 N  N     . LEU A 1 435 ? 36.458  -77.377 87.362  1.00 105.82 ? 435 LEU A N     1 
ATOM   3336 C  CA    . LEU A 1 435 ? 35.520  -76.346 87.793  1.00 102.74 ? 435 LEU A CA    1 
ATOM   3337 C  C     . LEU A 1 435 ? 35.431  -76.259 89.327  1.00 106.93 ? 435 LEU A C     1 
ATOM   3338 O  O     . LEU A 1 435 ? 35.466  -75.171 89.897  1.00 114.34 ? 435 LEU A O     1 
ATOM   3339 C  CB    . LEU A 1 435 ? 34.133  -76.572 87.171  1.00 106.92 ? 435 LEU A CB    1 
ATOM   3340 C  CG    . LEU A 1 435 ? 34.033  -76.292 85.664  1.00 113.12 ? 435 LEU A CG    1 
ATOM   3341 C  CD1   . LEU A 1 435 ? 32.739  -76.857 85.034  1.00 103.93 ? 435 LEU A CD1   1 
ATOM   3342 C  CD2   . LEU A 1 435 ? 34.193  -74.796 85.389  1.00 121.02 ? 435 LEU A CD2   1 
ATOM   3343 N  N     . GLN A 1 436 ? 35.330  -77.399 89.993  1.00 109.20 ? 436 GLN A N     1 
ATOM   3344 C  CA    . GLN A 1 436 ? 35.270  -77.409 91.455  1.00 124.19 ? 436 GLN A CA    1 
ATOM   3345 C  C     . GLN A 1 436 ? 36.529  -76.841 92.112  1.00 103.50 ? 436 GLN A C     1 
ATOM   3346 O  O     . GLN A 1 436 ? 36.445  -76.121 93.100  1.00 96.95  ? 436 GLN A O     1 
ATOM   3347 C  CB    . GLN A 1 436 ? 34.932  -78.809 91.973  1.00 165.49 ? 436 GLN A CB    1 
ATOM   3348 C  CG    . GLN A 1 436 ? 33.572  -79.277 91.468  1.00 186.75 ? 436 GLN A CG    1 
ATOM   3349 C  CD    . GLN A 1 436 ? 33.194  -80.661 91.951  1.00 190.80 ? 436 GLN A CD    1 
ATOM   3350 O  OE1   . GLN A 1 436 ? 34.031  -81.559 92.041  1.00 189.25 ? 436 GLN A OE1   1 
ATOM   3351 N  NE2   . GLN A 1 436 ? 31.917  -80.842 92.263  1.00 190.46 ? 436 GLN A NE2   1 
ATOM   3352 N  N     . GLU A 1 437 ? 37.695  -77.137 91.555  1.00 99.86  ? 437 GLU A N     1 
ATOM   3353 C  CA    . GLU A 1 437 ? 38.912  -76.477 92.010  1.00 98.55  ? 437 GLU A CA    1 
ATOM   3354 C  C     . GLU A 1 437 ? 38.731  -74.958 91.925  1.00 96.00  ? 437 GLU A C     1 
ATOM   3355 O  O     . GLU A 1 437 ? 39.058  -74.237 92.868  1.00 105.95 ? 437 GLU A O     1 
ATOM   3356 C  CB    . GLU A 1 437 ? 40.150  -76.930 91.209  1.00 100.88 ? 437 GLU A CB    1 
ATOM   3357 C  CG    . GLU A 1 437 ? 40.576  -78.391 91.421  1.00 108.34 ? 437 GLU A CG    1 
ATOM   3358 N  N     . GLU A 1 438 ? 38.192  -74.467 90.812  1.00 95.85  ? 438 GLU A N     1 
ATOM   3359 C  CA    . GLU A 1 438 ? 38.002  -73.019 90.660  1.00 124.47 ? 438 GLU A CA    1 
ATOM   3360 C  C     . GLU A 1 438 ? 37.004  -72.442 91.677  1.00 91.77  ? 438 GLU A C     1 
ATOM   3361 O  O     . GLU A 1 438 ? 37.232  -71.373 92.231  1.00 90.38  ? 438 GLU A O     1 
ATOM   3362 C  CB    . GLU A 1 438 ? 37.598  -72.615 89.226  1.00 152.67 ? 438 GLU A CB    1 
ATOM   3363 C  CG    . GLU A 1 438 ? 37.943  -71.150 88.944  1.00 168.22 ? 438 GLU A CG    1 
ATOM   3364 C  CD    . GLU A 1 438 ? 37.286  -70.541 87.712  1.00 161.99 ? 438 GLU A CD    1 
ATOM   3365 O  OE1   . GLU A 1 438 ? 37.376  -69.296 87.586  1.00 148.80 ? 438 GLU A OE1   1 
ATOM   3366 O  OE2   . GLU A 1 438 ? 36.709  -71.280 86.874  1.00 162.27 ? 438 GLU A OE2   1 
ATOM   3367 N  N     . GLU A 1 439 ? 35.902  -73.160 91.887  1.00 94.06  ? 439 GLU A N     1 
ATOM   3368 C  CA    . GLU A 1 439 ? 34.852  -72.806 92.835  1.00 108.05 ? 439 GLU A CA    1 
ATOM   3369 C  C     . GLU A 1 439 ? 35.469  -72.650 94.228  1.00 90.27  ? 439 GLU A C     1 
ATOM   3370 O  O     . GLU A 1 439 ? 35.151  -71.722 94.965  1.00 88.27  ? 439 GLU A O     1 
ATOM   3371 C  CB    . GLU A 1 439 ? 33.798  -73.915 92.839  1.00 134.65 ? 439 GLU A CB    1 
ATOM   3372 C  CG    . GLU A 1 439 ? 32.422  -73.548 93.328  1.00 156.88 ? 439 GLU A CG    1 
ATOM   3373 C  CD    . GLU A 1 439 ? 31.516  -74.786 93.495  1.00 173.95 ? 439 GLU A CD    1 
ATOM   3374 O  OE1   . GLU A 1 439 ? 30.283  -74.682 93.273  1.00 168.02 ? 439 GLU A OE1   1 
ATOM   3375 O  OE2   . GLU A 1 439 ? 32.036  -75.869 93.850  1.00 190.04 ? 439 GLU A OE2   1 
ATOM   3376 N  N     . ALA A 1 440 ? 36.382  -73.550 94.565  1.00 91.63  ? 440 ALA A N     1 
ATOM   3377 C  CA    . ALA A 1 440 ? 37.013  -73.517 95.879  1.00 90.84  ? 440 ALA A CA    1 
ATOM   3378 C  C     . ALA A 1 440 ? 37.980  -72.349 96.012  1.00 88.92  ? 440 ALA A C     1 
ATOM   3379 O  O     . ALA A 1 440 ? 37.986  -71.659 97.031  1.00 90.03  ? 440 ALA A O     1 
ATOM   3380 C  CB    . ALA A 1 440 ? 37.715  -74.851 96.188  1.00 93.01  ? 440 ALA A CB    1 
ATOM   3381 N  N     . GLU A 1 441 ? 38.791  -72.121 94.984  1.00 89.27  ? 441 GLU A N     1 
ATOM   3382 C  CA    . GLU A 1 441 ? 39.733  -71.008 95.019  1.00 88.56  ? 441 GLU A CA    1 
ATOM   3383 C  C     . GLU A 1 441 ? 38.980  -69.669 95.110  1.00 85.31  ? 441 GLU A C     1 
ATOM   3384 O  O     . GLU A 1 441 ? 39.408  -68.760 95.824  1.00 83.52  ? 441 GLU A O     1 
ATOM   3385 C  CB    . GLU A 1 441 ? 40.750  -71.061 93.848  1.00 88.61  ? 441 GLU A CB    1 
ATOM   3386 N  N     . LEU A 1 442 ? 37.844  -69.565 94.427  1.00 85.43  ? 442 LEU A N     1 
ATOM   3387 C  CA    . LEU A 1 442 ? 37.022  -68.352 94.501  1.00 83.41  ? 442 LEU A CA    1 
ATOM   3388 C  C     . LEU A 1 442 ? 36.414  -68.125 95.883  1.00 82.11  ? 442 LEU A C     1 
ATOM   3389 O  O     . LEU A 1 442 ? 36.359  -67.000 96.374  1.00 80.10  ? 442 LEU A O     1 
ATOM   3390 C  CB    . LEU A 1 442 ? 35.918  -68.358 93.440  1.00 87.89  ? 442 LEU A CB    1 
ATOM   3391 C  CG    . LEU A 1 442 ? 36.404  -68.221 91.985  1.00 100.13 ? 442 LEU A CG    1 
ATOM   3392 C  CD1   . LEU A 1 442 ? 35.252  -68.367 91.023  1.00 85.67  ? 442 LEU A CD1   1 
ATOM   3393 C  CD2   . LEU A 1 442 ? 37.103  -66.895 91.766  1.00 116.94 ? 442 LEU A CD2   1 
ATOM   3394 N  N     . ARG A 1 443 ? 35.959  -69.201 96.510  1.00 83.35  ? 443 ARG A N     1 
ATOM   3395 C  CA    . ARG A 1 443 ? 35.408  -69.096 97.853  1.00 82.36  ? 443 ARG A CA    1 
ATOM   3396 C  C     . ARG A 1 443 ? 36.462  -68.605 98.839  1.00 81.14  ? 443 ARG A C     1 
ATOM   3397 O  O     . ARG A 1 443 ? 36.197  -67.712 99.634  1.00 79.30  ? 443 ARG A O     1 
ATOM   3398 C  CB    . ARG A 1 443 ? 34.769  -70.417 98.298  1.00 86.38  ? 443 ARG A CB    1 
ATOM   3399 C  CG    . ARG A 1 443 ? 33.448  -70.657 97.598  1.00 98.51  ? 443 ARG A CG    1 
ATOM   3400 C  CD    . ARG A 1 443 ? 32.689  -71.873 98.064  1.00 104.79 ? 443 ARG A CD    1 
ATOM   3401 N  NE    . ARG A 1 443 ? 31.460  -71.962 97.288  1.00 107.48 ? 443 ARG A NE    1 
ATOM   3402 C  CZ    . ARG A 1 443 ? 30.951  -73.087 96.798  1.00 119.74 ? 443 ARG A CZ    1 
ATOM   3403 N  NH1   . ARG A 1 443 ? 31.548  -74.251 97.037  1.00 126.40 ? 443 ARG A NH1   1 
ATOM   3404 N  NH2   . ARG A 1 443 ? 29.839  -73.044 96.067  1.00 117.80 ? 443 ARG A NH2   1 
ATOM   3405 N  N     . GLU A 1 444 ? 37.663  -69.159 98.771  1.00 82.18  ? 444 GLU A N     1 
ATOM   3406 C  CA    . GLU A 1 444 ? 38.728  -68.665 99.621  1.00 81.09  ? 444 GLU A CA    1 
ATOM   3407 C  C     . GLU A 1 444 ? 38.993  -67.194 99.346  1.00 79.02  ? 444 GLU A C     1 
ATOM   3408 O  O     . GLU A 1 444 ? 39.124  -66.397 100.261 1.00 80.01  ? 444 GLU A O     1 
ATOM   3409 C  CB    . GLU A 1 444 ? 40.005  -69.487 99.449  1.00 82.67  ? 444 GLU A CB    1 
ATOM   3410 C  CG    . GLU A 1 444 ? 39.894  -70.919 99.972  1.00 84.69  ? 444 GLU A CG    1 
ATOM   3411 N  N     . LYS A 1 445 ? 39.055  -66.835 98.074  1.00 79.21  ? 445 LYS A N     1 
ATOM   3412 C  CA    . LYS A 1 445 ? 39.396  -65.479 97.672  1.00 77.53  ? 445 LYS A CA    1 
ATOM   3413 C  C     . LYS A 1 445 ? 38.353  -64.509 98.238  1.00 75.63  ? 445 LYS A C     1 
ATOM   3414 O  O     . LYS A 1 445 ? 38.680  -63.470 98.782  1.00 73.92  ? 445 LYS A O     1 
ATOM   3415 C  CB    . LYS A 1 445 ? 39.520  -65.402 96.129  1.00 129.60 ? 445 LYS A CB    1 
ATOM   3416 C  CG    . LYS A 1 445 ? 39.959  -64.035 95.572  1.00 144.86 ? 445 LYS A CG    1 
ATOM   3417 C  CD    . LYS A 1 445 ? 40.475  -64.097 94.127  1.00 157.96 ? 445 LYS A CD    1 
ATOM   3418 N  N     . ILE A 1 446 ? 37.088  -64.876 98.118  1.00 76.02  ? 446 ILE A N     1 
ATOM   3419 C  CA    . ILE A 1 446 ? 35.999  -64.070 98.656  1.00 74.42  ? 446 ILE A CA    1 
ATOM   3420 C  C     . ILE A 1 446 ? 36.035  -63.941 100.197 1.00 73.38  ? 446 ILE A C     1 
ATOM   3421 O  O     . ILE A 1 446 ? 35.709  -62.896 100.762 1.00 71.56  ? 446 ILE A O     1 
ATOM   3422 C  CB    . ILE A 1 446 ? 34.644  -64.635 98.197  1.00 112.78 ? 446 ILE A CB    1 
ATOM   3423 C  CG1   . ILE A 1 446 ? 34.423  -64.315 96.715  1.00 125.58 ? 446 ILE A CG1   1 
ATOM   3424 C  CG2   . ILE A 1 446 ? 33.501  -64.114 99.082  1.00 115.62 ? 446 ILE A CG2   1 
ATOM   3425 C  CD1   . ILE A 1 446 ? 33.341  -65.143 96.070  1.00 145.20 ? 446 ILE A CD1   1 
ATOM   3426 N  N     . ALA A 1 447 ? 36.448  -64.999 100.875 1.00 74.60  ? 447 ALA A N     1 
ATOM   3427 C  CA    . ALA A 1 447 ? 36.548  -64.928 102.325 1.00 116.87 ? 447 ALA A CA    1 
ATOM   3428 C  C     . ALA A 1 447 ? 37.609  -63.917 102.735 1.00 92.75  ? 447 ALA A C     1 
ATOM   3429 O  O     . ALA A 1 447 ? 37.337  -63.053 103.552 1.00 70.62  ? 447 ALA A O     1 
ATOM   3430 C  CB    . ALA A 1 447 ? 36.827  -66.303 102.938 1.00 151.40 ? 447 ALA A CB    1 
ATOM   3431 N  N     . MET A 1 448 ? 38.806  -64.013 102.159 1.00 72.88  ? 448 MET A N     1 
ATOM   3432 C  CA    . MET A 1 448 ? 39.844  -63.043 102.472 1.00 71.56  ? 448 MET A CA    1 
ATOM   3433 C  C     . MET A 1 448 ? 39.342  -61.625 102.285 1.00 69.62  ? 448 MET A C     1 
ATOM   3434 O  O     . MET A 1 448 ? 39.467  -60.801 103.174 1.00 71.82  ? 448 MET A O     1 
ATOM   3435 C  CB    . MET A 1 448 ? 41.130  -63.298 101.688 1.00 72.59  ? 448 MET A CB    1 
ATOM   3436 C  CG    . MET A 1 448 ? 42.003  -64.390 102.304 1.00 74.01  ? 448 MET A CG    1 
ATOM   3437 N  N     . LEU A 1 449 ? 38.741  -61.351 101.141 1.00 69.74  ? 449 LEU A N     1 
ATOM   3438 C  CA    . LEU A 1 449 ? 38.307  -60.002 100.849 1.00 68.08  ? 449 LEU A CA    1 
ATOM   3439 C  C     . LEU A 1 449 ? 37.191  -59.547 101.802 1.00 66.76  ? 449 LEU A C     1 
ATOM   3440 O  O     . LEU A 1 449 ? 37.161  -58.408 102.258 1.00 65.09  ? 449 LEU A O     1 
ATOM   3441 C  CB    . LEU A 1 449 ? 37.859  -59.897 99.377  1.00 68.71  ? 449 LEU A CB    1 
ATOM   3442 C  CG    . LEU A 1 449 ? 38.899  -60.258 98.290  1.00 70.06  ? 449 LEU A CG    1 
ATOM   3443 C  CD1   . LEU A 1 449 ? 38.230  -60.695 97.005  1.00 71.28  ? 449 LEU A CD1   1 
ATOM   3444 C  CD2   . LEU A 1 449 ? 39.826  -59.100 98.026  1.00 77.08  ? 449 LEU A CD2   1 
ATOM   3445 N  N     . ALA A 1 450 ? 36.258  -60.439 102.084 1.00 83.83  ? 450 ALA A N     1 
ATOM   3446 C  CA    . ALA A 1 450 ? 35.102  -60.059 102.881 1.00 98.63  ? 450 ALA A CA    1 
ATOM   3447 C  C     . ALA A 1 450 ? 35.540  -59.696 104.306 1.00 112.65 ? 450 ALA A C     1 
ATOM   3448 O  O     . ALA A 1 450 ? 35.018  -58.763 104.908 1.00 115.14 ? 450 ALA A O     1 
ATOM   3449 C  CB    . ALA A 1 450 ? 34.071  -61.178 102.885 1.00 103.40 ? 450 ALA A CB    1 
ATOM   3450 N  N     . ALA A 1 451 ? 36.514  -60.432 104.829 1.00 124.61 ? 451 ALA A N     1 
ATOM   3451 C  CA    . ALA A 1 451 ? 37.116  -60.114 106.118 1.00 138.20 ? 451 ALA A CA    1 
ATOM   3452 C  C     . ALA A 1 451 ? 37.680  -58.698 106.130 1.00 108.32 ? 451 ALA A C     1 
ATOM   3453 O  O     . ALA A 1 451 ? 37.261  -57.855 106.913 1.00 89.71  ? 451 ALA A O     1 
ATOM   3454 C  CB    . ALA A 1 451 ? 38.197  -61.125 106.476 1.00 171.43 ? 451 ALA A CB    1 
ATOM   3455 N  N     . ILE A 1 452 ? 38.636  -58.441 105.254 1.00 102.53 ? 452 ILE A N     1 
ATOM   3456 C  CA    . ILE A 1 452 ? 39.164  -57.105 105.072 1.00 97.72  ? 452 ILE A CA    1 
ATOM   3457 C  C     . ILE A 1 452 ? 38.080  -56.046 105.171 1.00 73.16  ? 452 ILE A C     1 
ATOM   3458 O  O     . ILE A 1 452 ? 38.258  -55.006 105.798 1.00 65.43  ? 452 ILE A O     1 
ATOM   3459 C  CB    . ILE A 1 452 ? 39.858  -56.989 103.707 1.00 122.67 ? 452 ILE A CB    1 
ATOM   3460 C  CG1   . ILE A 1 452 ? 41.158  -57.794 103.712 1.00 134.80 ? 452 ILE A CG1   1 
ATOM   3461 C  CG2   . ILE A 1 452 ? 40.139  -55.533 103.365 1.00 128.70 ? 452 ILE A CG2   1 
ATOM   3462 C  CD1   . ILE A 1 452 ? 41.780  -57.920 102.323 1.00 140.32 ? 452 ILE A CD1   1 
ATOM   3463 N  N     . ILE A 1 453 ? 36.948  -56.308 104.542 1.00 74.97  ? 453 ILE A N     1 
ATOM   3464 C  CA    . ILE A 1 453 ? 35.884  -55.325 104.520 1.00 84.58  ? 453 ILE A CA    1 
ATOM   3465 C  C     . ILE A 1 453 ? 35.193  -55.202 105.889 1.00 91.54  ? 453 ILE A C     1 
ATOM   3466 O  O     . ILE A 1 453 ? 34.850  -54.102 106.322 1.00 81.41  ? 453 ILE A O     1 
ATOM   3467 C  CB    . ILE A 1 453 ? 34.867  -55.654 103.415 1.00 92.04  ? 453 ILE A CB    1 
ATOM   3468 C  CG1   . ILE A 1 453 ? 35.536  -55.522 102.029 1.00 92.55  ? 453 ILE A CG1   1 
ATOM   3469 C  CG2   . ILE A 1 453 ? 33.624  -54.780 103.536 1.00 101.86 ? 453 ILE A CG2   1 
ATOM   3470 C  CD1   . ILE A 1 453 ? 34.643  -55.885 100.837 1.00 98.84  ? 453 ILE A CD1   1 
ATOM   3471 N  N     . GLY A 1 454 ? 35.008  -56.331 106.572 1.00 106.33 ? 454 GLY A N     1 
ATOM   3472 C  CA    . GLY A 1 454 ? 34.213  -56.372 107.784 1.00 113.52 ? 454 GLY A CA    1 
ATOM   3473 C  C     . GLY A 1 454 ? 34.987  -56.128 109.071 1.00 114.46 ? 454 GLY A C     1 
ATOM   3474 O  O     . GLY A 1 454 ? 34.390  -55.856 110.110 1.00 122.97 ? 454 GLY A O     1 
ATOM   3475 N  N     . ASP A 1 455 ? 36.311  -56.203 108.990 1.00 103.18 ? 455 ASP A N     1 
ATOM   3476 C  CA    . ASP A 1 455 ? 37.156  -56.077 110.153 1.00 95.29  ? 455 ASP A CA    1 
ATOM   3477 C  C     . ASP A 1 455 ? 38.271  -55.045 109.995 1.00 73.81  ? 455 ASP A C     1 
ATOM   3478 O  O     . ASP A 1 455 ? 39.301  -55.286 109.356 1.00 64.27  ? 455 ASP A O     1 
ATOM   3479 C  CB    . ASP A 1 455 ? 37.753  -57.435 110.550 1.00 112.17 ? 455 ASP A CB    1 
ATOM   3480 C  CG    . ASP A 1 455 ? 38.695  -57.326 111.740 1.00 120.44 ? 455 ASP A CG    1 
ATOM   3481 O  OD1   . ASP A 1 455 ? 38.307  -56.700 112.756 1.00 132.05 ? 455 ASP A OD1   1 
ATOM   3482 O  OD2   . ASP A 1 455 ? 39.830  -57.840 111.655 1.00 110.38 ? 455 ASP A OD2   1 
ATOM   3483 N  N     . GLU A 1 456 ? 39.231  -53.522 108.930 1.00 67.36  ? 456 GLU A N     1 
ATOM   3484 C  CA    . GLU A 1 456 ? 40.212  -52.452 108.962 1.00 63.09  ? 456 GLU A CA    1 
ATOM   3485 C  C     . GLU A 1 456 ? 41.656  -52.894 109.243 1.00 62.19  ? 456 GLU A C     1 
ATOM   3486 O  O     . GLU A 1 456 ? 42.592  -52.375 108.652 1.00 64.34  ? 456 GLU A O     1 
ATOM   3487 C  CB    . GLU A 1 456 ? 39.762  -51.402 109.968 1.00 70.50  ? 456 GLU A CB    1 
ATOM   3488 C  CG    . GLU A 1 456 ? 40.176  -49.974 109.635 1.00 82.99  ? 456 GLU A CG    1 
ATOM   3489 C  CD    . GLU A 1 456 ? 39.145  -49.217 108.796 1.00 106.24 ? 456 GLU A CD    1 
ATOM   3490 O  OE1   . GLU A 1 456 ? 39.253  -47.969 108.718 1.00 118.32 ? 456 GLU A OE1   1 
ATOM   3491 O  OE2   . GLU A 1 456 ? 38.237  -49.858 108.216 1.00 106.11 ? 456 GLU A OE2   1 
ATOM   3492 N  N     . ARG A 1 457 ? 41.844  -53.846 110.139 1.00 62.53  ? 457 ARG A N     1 
ATOM   3493 C  CA    . ARG A 1 457 ? 43.199  -54.245 110.513 1.00 61.81  ? 457 ARG A CA    1 
ATOM   3494 C  C     . ARG A 1 457 ? 43.870  -55.052 109.405 1.00 60.89  ? 457 ARG A C     1 
ATOM   3495 O  O     . ARG A 1 457 ? 45.063  -54.911 109.149 1.00 60.54  ? 457 ARG A O     1 
ATOM   3496 C  CB    . ARG A 1 457 ? 43.193  -55.046 111.821 1.00 62.54  ? 457 ARG A CB    1 
ATOM   3497 C  CG    . ARG A 1 457 ? 44.575  -55.508 112.261 1.00 72.10  ? 457 ARG A CG    1 
ATOM   3498 C  CD    . ARG A 1 457 ? 44.458  -56.354 113.487 1.00 97.61  ? 457 ARG A CD    1 
ATOM   3499 N  NE    . ARG A 1 457 ? 45.701  -56.953 113.966 1.00 124.70 ? 457 ARG A NE    1 
ATOM   3500 C  CZ    . ARG A 1 457 ? 45.729  -57.816 114.982 1.00 149.00 ? 457 ARG A CZ    1 
ATOM   3501 N  NH1   . ARG A 1 457 ? 44.598  -58.154 115.581 1.00 165.30 ? 457 ARG A NH1   1 
ATOM   3502 N  NH2   . ARG A 1 457 ? 46.867  -58.345 115.404 1.00 150.53 ? 457 ARG A NH2   1 
ATOM   3503 N  N     . THR A 1 458 ? 43.096  -55.917 108.768 1.00 61.24  ? 458 THR A N     1 
ATOM   3504 C  CA    . THR A 1 458 ? 43.622  -56.747 107.708 1.00 63.95  ? 458 THR A CA    1 
ATOM   3505 C  C     . THR A 1 458 ? 44.114  -55.830 106.595 1.00 66.46  ? 458 THR A C     1 
ATOM   3506 O  O     . THR A 1 458 ? 45.180  -56.039 106.020 1.00 70.36  ? 458 THR A O     1 
ATOM   3507 C  CB    . THR A 1 458 ? 42.545  -57.670 107.137 1.00 65.06  ? 458 THR A CB    1 
ATOM   3508 O  OG1   . THR A 1 458 ? 42.090  -58.565 108.151 1.00 65.80  ? 458 THR A OG1   1 
ATOM   3509 C  CG2   . THR A 1 458 ? 43.108  -58.476 105.982 1.00 65.61  ? 458 THR A CG2   1 
ATOM   3510 N  N     . MET A 1 459 ? 43.322  -54.805 106.318 1.00 94.61  ? 459 MET A N     1 
ATOM   3511 C  CA    . MET A 1 459 ? 43.631  -53.821 105.293 1.00 139.27 ? 459 MET A CA    1 
ATOM   3512 C  C     . MET A 1 459 ? 44.907  -53.023 105.605 1.00 141.43 ? 459 MET A C     1 
ATOM   3513 O  O     . MET A 1 459 ? 45.799  -52.943 104.771 1.00 156.38 ? 459 MET A O     1 
ATOM   3514 C  CB    . MET A 1 459 ? 42.425  -52.910 105.097 1.00 176.27 ? 459 MET A CB    1 
ATOM   3515 C  CG    . MET A 1 459 ? 42.581  -51.894 104.044 1.00 198.32 ? 459 MET A CG    1 
ATOM   3516 S  SD    . MET A 1 459 ? 43.497  -50.476 104.622 1.00 222.51 ? 459 MET A SD    1 
ATOM   3517 C  CE    . MET A 1 459 ? 42.451  -49.838 105.937 1.00 134.90 ? 459 MET A CE    1 
ATOM   3518 N  N     . TYR A 1 460 ? 45.003  -52.458 106.809 1.00 124.35 ? 460 TYR A N     1 
ATOM   3519 C  CA    . TYR A 1 460 ? 46.214  -51.751 107.231 1.00 112.92 ? 460 TYR A CA    1 
ATOM   3520 C  C     . TYR A 1 460 ? 47.474  -52.634 107.205 1.00 81.25  ? 460 TYR A C     1 
ATOM   3521 O  O     . TYR A 1 460 ? 48.560  -52.155 106.894 1.00 61.47  ? 460 TYR A O     1 
ATOM   3522 C  CB    . TYR A 1 460 ? 46.033  -51.109 108.610 1.00 142.57 ? 460 TYR A CB    1 
ATOM   3523 C  CG    . TYR A 1 460 ? 45.222  -49.841 108.597 1.00 158.79 ? 460 TYR A CG    1 
ATOM   3524 C  CD1   . TYR A 1 460 ? 45.612  -48.766 107.824 1.00 144.90 ? 460 TYR A CD1   1 
ATOM   3525 C  CD2   . TYR A 1 460 ? 44.067  -49.714 109.376 1.00 171.60 ? 460 TYR A CD2   1 
ATOM   3526 C  CE1   . TYR A 1 460 ? 44.880  -47.599 107.803 1.00 135.26 ? 460 TYR A CE1   1 
ATOM   3527 C  CE2   . TYR A 1 460 ? 43.318  -48.541 109.366 1.00 161.54 ? 460 TYR A CE2   1 
ATOM   3528 C  CZ    . TYR A 1 460 ? 43.737  -47.487 108.573 1.00 140.13 ? 460 TYR A CZ    1 
ATOM   3529 O  OH    . TYR A 1 460 ? 43.025  -46.314 108.531 1.00 129.64 ? 460 TYR A OH    1 
ATOM   3530 N  N     . ASN A 1 461 ? 47.345  -53.916 107.522 1.00 61.63  ? 461 ASN A N     1 
ATOM   3531 C  CA    . ASN A 1 461 ? 48.495  -54.799 107.366 1.00 63.14  ? 461 ASN A CA    1 
ATOM   3532 C  C     . ASN A 1 461 ? 48.959  -54.887 105.917 1.00 64.19  ? 461 ASN A C     1 
ATOM   3533 O  O     . ASN A 1 461 ? 50.151  -54.957 105.648 1.00 65.94  ? 461 ASN A O     1 
ATOM   3534 C  CB    . ASN A 1 461 ? 48.189  -56.205 107.859 1.00 64.00  ? 461 ASN A CB    1 
ATOM   3535 C  CG    . ASN A 1 461 ? 48.106  -56.290 109.372 1.00 63.42  ? 461 ASN A CG    1 
ATOM   3536 O  OD1   . ASN A 1 461 ? 48.633  -55.440 110.089 1.00 62.64  ? 461 ASN A OD1   1 
ATOM   3537 N  ND2   . ASN A 1 461 ? 47.441  -57.335 109.863 1.00 63.95  ? 461 ASN A ND2   1 
ATOM   3538 N  N     . LEU A 1 462 ? 48.005  -54.922 104.988 1.00 85.39  ? 462 LEU A N     1 
ATOM   3539 C  CA    . LEU A 1 462 ? 48.326  -55.052 103.583 1.00 117.00 ? 462 LEU A CA    1 
ATOM   3540 C  C     . LEU A 1 462 ? 49.115  -53.809 103.190 1.00 121.44 ? 462 LEU A C     1 
ATOM   3541 O  O     . LEU A 1 462 ? 50.152  -53.890 102.543 1.00 115.77 ? 462 LEU A O     1 
ATOM   3542 C  CB    . LEU A 1 462 ? 47.047  -55.157 102.748 1.00 154.61 ? 462 LEU A CB    1 
ATOM   3543 C  CG    . LEU A 1 462 ? 47.042  -56.097 101.529 1.00 187.63 ? 462 LEU A CG    1 
ATOM   3544 C  CD1   . LEU A 1 462 ? 45.935  -55.732 100.558 1.00 193.64 ? 462 LEU A CD1   1 
ATOM   3545 C  CD2   . LEU A 1 462 ? 48.371  -56.089 100.846 1.00 200.05 ? 462 LEU A CD2   1 
ATOM   3546 N  N     . MET A 1 463 ? 48.617  -52.662 103.631 1.00 128.34 ? 463 MET A N     1 
ATOM   3547 C  CA    . MET A 1 463 ? 49.198  -51.376 103.321 1.00 122.32 ? 463 MET A CA    1 
ATOM   3548 C  C     . MET A 1 463 ? 50.609  -51.244 103.880 1.00 121.92 ? 463 MET A C     1 
ATOM   3549 O  O     . MET A 1 463 ? 51.475  -50.626 103.270 1.00 114.87 ? 463 MET A O     1 
ATOM   3550 C  CB    . MET A 1 463 ? 48.276  -50.293 103.850 1.00 105.76 ? 463 MET A CB    1 
ATOM   3551 C  CG    . MET A 1 463 ? 48.835  -48.892 103.900 1.00 92.65  ? 463 MET A CG    1 
ATOM   3552 S  SD    . MET A 1 463 ? 47.461  -47.811 104.399 1.00 60.00  ? 463 MET A SD    1 
ATOM   3553 C  CE    . MET A 1 463 ? 48.352  -46.324 104.693 1.00 60.36  ? 463 MET A CE    1 
ATOM   3554 N  N     . LYS A 1 464 ? 50.850  -51.831 105.041 1.00 124.19 ? 464 LYS A N     1 
ATOM   3555 C  CA    . LYS A 1 464 ? 52.194  -51.800 105.606 1.00 122.56 ? 464 LYS A CA    1 
ATOM   3556 C  C     . LYS A 1 464 ? 53.060  -52.784 104.820 1.00 92.07  ? 464 LYS A C     1 
ATOM   3557 O  O     . LYS A 1 464 ? 54.197  -52.476 104.443 1.00 74.63  ? 464 LYS A O     1 
ATOM   3558 C  CB    . LYS A 1 464 ? 52.189  -52.135 107.116 1.00 146.87 ? 464 LYS A CB    1 
ATOM   3559 C  CG    . LYS A 1 464 ? 51.668  -51.009 108.022 1.00 152.55 ? 464 LYS A CG    1 
ATOM   3560 C  CD    . LYS A 1 464 ? 50.932  -51.562 109.245 1.00 136.74 ? 464 LYS A CD    1 
ATOM   3561 C  CE    . LYS A 1 464 ? 51.649  -52.798 109.773 1.00 116.92 ? 464 LYS A CE    1 
ATOM   3562 N  NZ    . LYS A 1 464 ? 50.958  -53.451 110.918 1.00 102.77 ? 464 LYS A NZ    1 
ATOM   3563 N  N     . LYS A 1 465 ? 52.507  -53.969 104.566 1.00 66.70  ? 465 LYS A N     1 
ATOM   3564 C  CA    . LYS A 1 465 ? 53.232  -54.998 103.849 1.00 68.30  ? 465 LYS A CA    1 
ATOM   3565 C  C     . LYS A 1 465 ? 53.696  -54.438 102.502 1.00 68.97  ? 465 LYS A C     1 
ATOM   3566 O  O     . LYS A 1 465 ? 54.788  -54.749 102.044 1.00 70.28  ? 465 LYS A O     1 
ATOM   3567 C  CB    . LYS A 1 465 ? 52.382  -56.273 103.684 1.00 68.72  ? 465 LYS A CB    1 
ATOM   3568 C  CG    . LYS A 1 465 ? 52.857  -57.203 102.581 1.00 70.84  ? 465 LYS A CG    1 
ATOM   3569 C  CD    . LYS A 1 465 ? 52.389  -58.644 102.785 1.00 77.97  ? 465 LYS A CD    1 
ATOM   3570 C  CE    . LYS A 1 465 ? 51.599  -59.188 101.577 1.00 85.82  ? 465 LYS A CE    1 
ATOM   3571 N  NZ    . LYS A 1 465 ? 52.165  -58.810 100.226 1.00 93.43  ? 465 LYS A NZ    1 
ATOM   3572 N  N     . GLU A 1 466 ? 52.882  -53.577 101.900 1.00 68.13  ? 466 GLU A N     1 
ATOM   3573 C  CA    . GLU A 1 466 ? 53.178  -53.062 100.563 1.00 97.74  ? 466 GLU A CA    1 
ATOM   3574 C  C     . GLU A 1 466 ? 54.151  -51.900 100.616 1.00 69.01  ? 466 GLU A C     1 
ATOM   3575 O  O     . GLU A 1 466 ? 54.963  -51.722 99.711  1.00 71.18  ? 466 GLU A O     1 
ATOM   3576 C  CB    . GLU A 1 466 ? 51.894  -52.676 99.818  1.00 131.73 ? 466 GLU A CB    1 
ATOM   3577 C  CG    . GLU A 1 466 ? 51.146  -53.883 99.276  1.00 153.89 ? 466 GLU A CG    1 
ATOM   3578 C  CD    . GLU A 1 466 ? 49.812  -53.549 98.602  1.00 143.82 ? 466 GLU A CD    1 
ATOM   3579 O  OE1   . GLU A 1 466 ? 49.454  -52.349 98.536  1.00 129.45 ? 466 GLU A OE1   1 
ATOM   3580 O  OE2   . GLU A 1 466 ? 49.125  -54.498 98.132  1.00 140.71 ? 466 GLU A OE2   1 
ATOM   3581 N  N     . LEU A 1 467 ? 54.071  -51.117 101.687 1.00 68.08  ? 467 LEU A N     1 
ATOM   3582 C  CA    . LEU A 1 467 ? 54.972  -49.990 101.869 1.00 92.80  ? 467 LEU A CA    1 
ATOM   3583 C  C     . LEU A 1 467 ? 56.383  -50.491 102.158 1.00 69.85  ? 467 LEU A C     1 
ATOM   3584 O  O     . LEU A 1 467 ? 57.361  -49.895 101.728 1.00 70.94  ? 467 LEU A O     1 
ATOM   3585 C  CB    . LEU A 1 467 ? 54.463  -49.076 102.985 1.00 113.45 ? 467 LEU A CB    1 
ATOM   3586 C  CG    . LEU A 1 467 ? 53.428  -48.094 102.443 1.00 131.96 ? 467 LEU A CG    1 
ATOM   3587 C  CD1   . LEU A 1 467 ? 52.585  -47.448 103.517 1.00 152.61 ? 467 LEU A CD1   1 
ATOM   3588 C  CD2   . LEU A 1 467 ? 54.119  -47.045 101.629 1.00 122.15 ? 467 LEU A CD2   1 
ATOM   3589 N  N     . ARG A 1 468 ? 56.487  -51.596 102.891 1.00 69.90  ? 468 ARG A N     1 
ATOM   3590 C  CA    . ARG A 1 468 ? 57.787  -52.168 103.188 1.00 71.24  ? 468 ARG A CA    1 
ATOM   3591 C  C     . ARG A 1 468 ? 58.422  -52.723 101.916 1.00 72.62  ? 468 ARG A C     1 
ATOM   3592 O  O     . ARG A 1 468 ? 59.626  -52.612 101.720 1.00 73.89  ? 468 ARG A O     1 
ATOM   3593 C  CB    . ARG A 1 468 ? 57.676  -53.261 104.242 1.00 106.82 ? 468 ARG A CB    1 
ATOM   3594 C  CG    . ARG A 1 468 ? 57.272  -52.762 105.614 1.00 125.64 ? 468 ARG A CG    1 
ATOM   3595 C  CD    . ARG A 1 468 ? 57.254  -53.908 106.621 1.00 147.00 ? 468 ARG A CD    1 
ATOM   3596 N  NE    . ARG A 1 468 ? 56.921  -53.471 107.972 1.00 160.57 ? 468 ARG A NE    1 
ATOM   3597 C  CZ    . ARG A 1 468 ? 55.755  -53.699 108.566 1.00 164.67 ? 468 ARG A CZ    1 
ATOM   3598 N  NH1   . ARG A 1 468 ? 54.798  -54.358 107.921 1.00 173.60 ? 468 ARG A NH1   1 
ATOM   3599 N  NH2   . ARG A 1 468 ? 55.551  -53.266 109.805 1.00 155.32 ? 468 ARG A NH2   1 
ATOM   3600 N  N     . GLU A 1 469 ? 57.617  -53.338 101.058 1.00 72.48  ? 469 GLU A N     1 
ATOM   3601 C  CA    . GLU A 1 469 ? 58.136  -53.822 99.778  1.00 73.82  ? 469 GLU A CA    1 
ATOM   3602 C  C     . GLU A 1 469 ? 58.733  -52.660 98.983  1.00 81.39  ? 469 GLU A C     1 
ATOM   3603 O  O     . GLU A 1 469 ? 59.853  -52.753 98.499  1.00 75.64  ? 469 GLU A O     1 
ATOM   3604 C  CB    . GLU A 1 469 ? 57.055  -54.550 98.971  1.00 90.32  ? 469 GLU A CB    1 
ATOM   3605 C  CG    . GLU A 1 469 ? 56.873  -56.009 99.374  1.00 99.31  ? 469 GLU A CG    1 
ATOM   3606 C  CD    . GLU A 1 469 ? 55.454  -56.535 99.122  1.00 110.36 ? 469 GLU A CD    1 
ATOM   3607 O  OE1   . GLU A 1 469 ? 54.608  -55.753 98.626  1.00 118.78 ? 469 GLU A OE1   1 
ATOM   3608 O  OE2   . GLU A 1 469 ? 55.186  -57.725 99.426  1.00 109.97 ? 469 GLU A OE2   1 
ATOM   3609 N  N     . VAL A 1 470 ? 57.997  -51.558 98.898  1.00 99.32  ? 470 VAL A N     1 
ATOM   3610 C  CA    . VAL A 1 470 ? 58.442  -50.395 98.153  1.00 114.99 ? 470 VAL A CA    1 
ATOM   3611 C  C     . VAL A 1 470 ? 59.751  -49.859 98.702  1.00 93.33  ? 470 VAL A C     1 
ATOM   3612 O  O     . VAL A 1 470 ? 60.608  -49.382 97.961  1.00 76.50  ? 470 VAL A O     1 
ATOM   3613 C  CB    . VAL A 1 470 ? 57.373  -49.287 98.172  1.00 144.98 ? 470 VAL A CB    1 
ATOM   3614 C  CG1   . VAL A 1 470 ? 57.954  -47.955 97.668  1.00 140.24 ? 470 VAL A CG1   1 
ATOM   3615 C  CG2   . VAL A 1 470 ? 56.188  -49.722 97.344  1.00 168.67 ? 470 VAL A CG2   1 
ATOM   3616 N  N     . LYS A 1 471 ? 59.904  -49.948 100.011 1.00 96.09  ? 471 LYS A N     1 
ATOM   3617 C  CA    . LYS A 1 471 ? 61.093  -49.438 100.666 1.00 104.39 ? 471 LYS A CA    1 
ATOM   3618 C  C     . LYS A 1 471 ? 62.255  -50.360 100.347 1.00 108.11 ? 471 LYS A C     1 
ATOM   3619 O  O     . LYS A 1 471 ? 63.335  -49.910 99.958  1.00 78.39  ? 471 LYS A O     1 
ATOM   3620 C  CB    . LYS A 1 471 ? 60.855  -49.376 102.165 1.00 113.26 ? 471 LYS A CB    1 
ATOM   3621 C  CG    . LYS A 1 471 ? 62.115  -49.262 102.994 1.00 122.77 ? 471 LYS A CG    1 
ATOM   3622 C  CD    . LYS A 1 471 ? 61.762  -49.162 104.457 1.00 120.37 ? 471 LYS A CD    1 
ATOM   3623 C  CE    . LYS A 1 471 ? 63.001  -49.271 105.318 1.00 109.29 ? 471 LYS A CE    1 
ATOM   3624 N  NZ    . LYS A 1 471 ? 62.658  -49.766 106.680 1.00 93.31  ? 471 LYS A NZ    1 
ATOM   3625 N  N     . LYS A 1 472 ? 62.020  -51.661 100.476 1.00 111.98 ? 472 LYS A N     1 
ATOM   3626 C  CA    . LYS A 1 472 ? 63.084  -52.627 100.258 1.00 103.82 ? 472 LYS A CA    1 
ATOM   3627 C  C     . LYS A 1 472 ? 63.613  -52.477 98.852  1.00 84.22  ? 472 LYS A C     1 
ATOM   3628 O  O     . LYS A 1 472 ? 64.796  -52.686 98.599  1.00 87.36  ? 472 LYS A O     1 
ATOM   3629 C  CB    . LYS A 1 472 ? 62.599  -54.055 100.472 1.00 107.98 ? 472 LYS A CB    1 
ATOM   3630 C  CG    . LYS A 1 472 ? 63.603  -55.096 100.021 1.00 108.68 ? 472 LYS A CG    1 
ATOM   3631 C  CD    . LYS A 1 472 ? 63.348  -56.423 100.720 1.00 109.08 ? 472 LYS A CD    1 
ATOM   3632 C  CE    . LYS A 1 472 ? 64.024  -57.584 99.993  1.00 118.63 ? 472 LYS A CE    1 
ATOM   3633 N  NZ    . LYS A 1 472 ? 63.568  -58.907 100.543 1.00 127.91 ? 472 LYS A NZ    1 
ATOM   3634 N  N     . LYS A 1 473 ? 62.725  -52.092 97.946  1.00 78.67  ? 473 LYS A N     1 
ATOM   3635 C  CA    . LYS A 1 473 ? 63.076  -52.004 96.550  1.00 79.64  ? 473 LYS A CA    1 
ATOM   3636 C  C     . LYS A 1 473 ? 63.789  -50.698 96.206  1.00 80.35  ? 473 LYS A C     1 
ATOM   3637 O  O     . LYS A 1 473 ? 64.803  -50.722 95.517  1.00 81.78  ? 473 LYS A O     1 
ATOM   3638 C  CB    . LYS A 1 473 ? 61.830  -52.186 95.678  1.00 78.81  ? 473 LYS A CB    1 
ATOM   3639 C  CG    . LYS A 1 473 ? 62.138  -52.496 94.223  1.00 79.96  ? 473 LYS A CG    1 
ATOM   3640 C  CD    . LYS A 1 473 ? 60.880  -52.680 93.397  1.00 90.69  ? 473 LYS A CD    1 
ATOM   3641 C  CE    . LYS A 1 473 ? 61.244  -53.067 91.972  1.00 103.57 ? 473 LYS A CE    1 
ATOM   3642 N  NZ    . LYS A 1 473 ? 60.021  -53.260 91.151  1.00 113.18 ? 473 LYS A NZ    1 
ATOM   3643 N  N     . PHE A 1 474 ? 63.282  -49.570 96.702  1.00 83.62  ? 474 PHE A N     1 
ATOM   3644 C  CA    . PHE A 1 474 ? 63.761  -48.256 96.245  1.00 89.83  ? 474 PHE A CA    1 
ATOM   3645 C  C     . PHE A 1 474 ? 64.565  -47.457 97.257  1.00 81.10  ? 474 PHE A C     1 
ATOM   3646 O  O     . PHE A 1 474 ? 64.990  -46.334 96.971  1.00 87.57  ? 474 PHE A O     1 
ATOM   3647 C  CB    . PHE A 1 474 ? 62.594  -47.410 95.712  1.00 95.03  ? 474 PHE A CB    1 
ATOM   3648 C  CG    . PHE A 1 474 ? 61.932  -48.013 94.506  1.00 90.93  ? 474 PHE A CG    1 
ATOM   3649 C  CD1   . PHE A 1 474 ? 62.522  -47.914 93.256  1.00 87.17  ? 474 PHE A CD1   1 
ATOM   3650 C  CD2   . PHE A 1 474 ? 60.739  -48.716 94.627  1.00 77.67  ? 474 PHE A CD2   1 
ATOM   3651 C  CE1   . PHE A 1 474 ? 61.921  -48.484 92.143  1.00 80.13  ? 474 PHE A CE1   1 
ATOM   3652 C  CE2   . PHE A 1 474 ? 60.134  -49.293 93.521  1.00 77.68  ? 474 PHE A CE2   1 
ATOM   3653 C  CZ    . PHE A 1 474 ? 60.728  -49.175 92.275  1.00 78.93  ? 474 PHE A CZ    1 
ATOM   3654 N  N     . THR A 1 476 ? 66.824  -46.735 99.474  1.00 86.40  ? 476 THR A N     1 
ATOM   3655 C  CA    . THR A 1 476 ? 68.213  -46.378 99.227  1.00 87.17  ? 476 THR A CA    1 
ATOM   3656 C  C     . THR A 1 476 ? 68.709  -45.610 100.452 1.00 88.07  ? 476 THR A C     1 
ATOM   3657 O  O     . THR A 1 476 ? 67.907  -45.166 101.268 1.00 86.30  ? 476 THR A O     1 
ATOM   3658 C  CB    . THR A 1 476 ? 68.358  -45.517 97.942  1.00 109.91 ? 476 THR A CB    1 
ATOM   3659 O  OG1   . THR A 1 476 ? 67.953  -44.168 98.197  1.00 90.27  ? 476 THR A OG1   1 
ATOM   3660 C  CG2   . THR A 1 476 ? 67.506  -46.080 96.823  1.00 124.72 ? 476 THR A CG2   1 
ATOM   3661 N  N     . PRO A 1 477 ? 70.032  -45.459 100.587 1.00 97.10  ? 477 PRO A N     1 
ATOM   3662 C  CA    . PRO A 1 477 ? 70.639  -44.799 101.751 1.00 99.91  ? 477 PRO A CA    1 
ATOM   3663 C  C     . PRO A 1 477 ? 70.461  -43.273 101.780 1.00 92.27  ? 477 PRO A C     1 
ATOM   3664 O  O     . PRO A 1 477 ? 70.297  -42.668 100.718 1.00 92.36  ? 477 PRO A O     1 
ATOM   3665 C  CB    . PRO A 1 477 ? 72.129  -45.156 101.608 1.00 116.65 ? 477 PRO A CB    1 
ATOM   3666 C  CG    . PRO A 1 477 ? 72.163  -46.368 100.716 1.00 118.45 ? 477 PRO A CG    1 
ATOM   3667 C  CD    . PRO A 1 477 ? 71.045  -46.109 99.738  1.00 104.99 ? 477 PRO A CD    1 
ATOM   3668 N  N     . ARG A 1 478 ? 70.499  -42.680 102.979 1.00 93.26  ? 478 ARG A N     1 
ATOM   3669 C  CA    . ARG A 1 478 ? 70.508  -41.226 103.170 1.00 95.01  ? 478 ARG A CA    1 
ATOM   3670 C  C     . ARG A 1 478 ? 71.607  -40.579 102.349 1.00 97.62  ? 478 ARG A C     1 
ATOM   3671 O  O     . ARG A 1 478 ? 72.696  -41.136 102.208 1.00 101.14 ? 478 ARG A O     1 
ATOM   3672 C  CB    . ARG A 1 478 ? 70.754  -40.841 104.646 1.00 96.60  ? 478 ARG A CB    1 
ATOM   3673 C  CG    . ARG A 1 478 ? 69.550  -40.931 105.599 1.00 107.20 ? 478 ARG A CG    1 
ATOM   3674 C  CD    . ARG A 1 478 ? 69.667  -40.001 106.842 1.00 96.71  ? 478 ARG A CD    1 
ATOM   3675 N  NE    . ARG A 1 478 ? 69.502  -38.594 106.487 1.00 98.26  ? 478 ARG A NE    1 
ATOM   3676 C  CZ    . ARG A 1 478 ? 68.342  -37.941 106.483 1.00 96.87  ? 478 ARG A CZ    1 
ATOM   3677 N  NH1   . ARG A 1 478 ? 67.207  -38.551 106.821 1.00 115.03 ? 478 ARG A NH1   1 
ATOM   3678 N  NH2   . ARG A 1 478 ? 68.319  -36.669 106.130 1.00 99.29  ? 478 ARG A NH2   1 
ATOM   3679 N  N     . LEU A 1 479 ? 71.328  -39.389 101.833 1.00 98.40  ? 479 LEU A N     1 
ATOM   3680 C  CA    . LEU A 1 479 ? 72.344  -38.619 101.131 1.00 101.12 ? 479 LEU A CA    1 
ATOM   3681 C  C     . LEU A 1 479 ? 72.794  -37.465 102.006 1.00 106.42 ? 479 LEU A C     1 
ATOM   3682 O  O     . LEU A 1 479 ? 73.988  -37.168 102.088 1.00 119.99 ? 479 LEU A O     1 
ATOM   3683 C  CB    . LEU A 1 479 ? 71.814  -38.085 99.788  1.00 102.23 ? 479 LEU A CB    1 
ATOM   3684 C  CG    . LEU A 1 479 ? 71.292  -39.171 98.846  1.00 102.45 ? 479 LEU A CG    1 
ATOM   3685 C  CD1   . LEU A 1 479 ? 70.918  -38.584 97.491  1.00 101.94 ? 479 LEU A CD1   1 
ATOM   3686 C  CD2   . LEU A 1 479 ? 72.342  -40.247 98.698  1.00 103.04 ? 479 LEU A CD2   1 
ATOM   3687 N  N     . SER A 1 480 ? 71.825  -36.807 102.635 1.00 110.08 ? 480 SER A N     1 
ATOM   3688 C  CA    . SER A 1 480 ? 72.083  -35.632 103.470 1.00 120.15 ? 480 SER A CA    1 
ATOM   3689 C  C     . SER A 1 480 ? 72.318  -35.974 104.952 1.00 125.42 ? 480 SER A C     1 
ATOM   3690 O  O     . SER A 1 480 ? 71.460  -36.568 105.613 1.00 105.07 ? 480 SER A O     1 
ATOM   3691 C  CB    . SER A 1 480 ? 70.919  -34.648 103.375 1.00 115.46 ? 480 SER A CB    1 
ATOM   3692 O  OG    . SER A 1 480 ? 70.563  -34.391 102.042 1.00 108.06 ? 480 SER A OG    1 
ATOM   3693 N  N     . SER A 1 481 ? 73.481  -35.589 105.467 1.00 141.18 ? 481 SER A N     1 
ATOM   3694 C  CA    . SER A 1 481 ? 73.778  -35.768 106.885 1.00 145.45 ? 481 SER A CA    1 
ATOM   3695 C  C     . SER A 1 481 ? 72.946  -34.823 107.749 1.00 146.39 ? 481 SER A C     1 
ATOM   3696 O  O     . SER A 1 481 ? 72.559  -33.732 107.320 1.00 156.29 ? 481 SER A O     1 
ATOM   3697 C  CB    . SER A 1 481 ? 75.278  -35.607 107.175 1.00 145.46 ? 481 SER A CB    1 
ATOM   3698 O  OG    . SER A 1 481 ? 75.789  -34.403 106.633 1.00 143.85 ? 481 SER A OG    1 
ATOM   3699 N  N     . LEU A 1 482 ? 72.649  -35.270 108.963 1.00 137.45 ? 482 LEU A N     1 
ATOM   3700 C  CA    . LEU A 1 482 ? 71.936  -34.453 109.935 1.00 146.54 ? 482 LEU A CA    1 
ATOM   3701 C  C     . LEU A 1 482 ? 72.866  -33.970 111.054 1.00 176.86 ? 482 LEU A C     1 
ATOM   3702 O  O     . LEU A 1 482 ? 73.763  -34.696 111.497 1.00 175.35 ? 482 LEU A O     1 
ATOM   3703 C  CB    . LEU A 1 482 ? 70.749  -35.221 110.504 1.00 133.73 ? 482 LEU A CB    1 
ATOM   3704 C  CG    . LEU A 1 482 ? 69.658  -35.520 109.482 1.00 126.04 ? 482 LEU A CG    1 
ATOM   3705 C  CD1   . LEU A 1 482 ? 68.585  -36.364 110.117 1.00 115.97 ? 482 LEU A CD1   1 
ATOM   3706 C  CD2   . LEU A 1 482 ? 69.083  -34.233 108.963 1.00 131.83 ? 482 LEU A CD2   1 
ATOM   3707 N  N     . GLU A 1 483 ? 72.650  -32.731 111.484 1.00 205.76 ? 483 GLU A N     1 
ATOM   3708 C  CA    . GLU A 1 483 ? 73.459  -32.118 112.532 1.00 223.61 ? 483 GLU A CA    1 
ATOM   3709 C  C     . GLU A 1 483 ? 72.612  -31.251 113.466 1.00 228.74 ? 483 GLU A C     1 
ATOM   3710 O  O     . GLU A 1 483 ? 71.720  -30.524 113.019 1.00 248.69 ? 483 GLU A O     1 
ATOM   3711 C  CB    . GLU A 1 483 ? 74.590  -31.297 111.918 1.00 228.04 ? 483 GLU A CB    1 
ATOM   3712 C  CG    . GLU A 1 483 ? 75.673  -32.142 111.283 1.00 218.76 ? 483 GLU A CG    1 
ATOM   3713 C  CD    . GLU A 1 483 ? 76.788  -31.302 110.689 1.00 214.42 ? 483 GLU A CD    1 
ATOM   3714 O  OE1   . GLU A 1 483 ? 76.792  -30.066 110.911 1.00 230.05 ? 483 GLU A OE1   1 
ATOM   3715 O  OE2   . GLU A 1 483 ? 77.654  -31.883 109.994 1.00 196.87 ? 483 GLU A OE2   1 
ATOM   3716 N  N     . ASP A 1 484 ? 72.900  -31.337 114.764 1.00 73.71  ? 484 ASP A N     1 
ATOM   3717 C  CA    . ASP A 1 484 ? 72.140  -30.616 115.780 1.00 66.90  ? 484 ASP A CA    1 
ATOM   3718 C  C     . ASP A 1 484 ? 72.261  -29.107 115.610 1.00 59.87  ? 484 ASP A C     1 
ATOM   3719 O  O     . ASP A 1 484 ? 71.255  -28.401 115.635 1.00 182.83 ? 484 ASP A O     1 
ATOM   3720 C  CB    . ASP A 1 484 ? 72.581  -31.040 117.186 1.00 65.88  ? 484 ASP A CB    1 
ATOM   3721 N  N     . ALA B 2 47  ? 27.796  20.569  9.144   1.00 449.80 ? 24  ALA C N     1 
ATOM   3722 C  CA    . ALA B 2 47  ? 28.998  21.402  9.133   1.00 448.17 ? 24  ALA C CA    1 
ATOM   3723 C  C     . ALA B 2 47  ? 29.692  21.331  10.491  1.00 448.32 ? 24  ALA C C     1 
ATOM   3724 O  O     . ALA B 2 47  ? 30.835  21.757  10.649  1.00 448.80 ? 24  ALA C O     1 
ATOM   3725 C  CB    . ALA B 2 47  ? 28.652  22.845  8.770   1.00 449.38 ? 24  ALA C CB    1 
ATOM   3726 N  N     . VAL B 2 48  ? 28.977  20.801  11.478  1.00 452.02 ? 25  VAL C N     1 
ATOM   3727 C  CA    . VAL B 2 48  ? 29.559  20.473  12.779  1.00 455.51 ? 25  VAL C CA    1 
ATOM   3728 C  C     . VAL B 2 48  ? 29.801  18.963  12.779  1.00 464.61 ? 25  VAL C C     1 
ATOM   3729 O  O     . VAL B 2 48  ? 30.642  18.434  13.515  1.00 467.92 ? 25  VAL C O     1 
ATOM   3730 C  CB    . VAL B 2 48  ? 28.645  20.943  13.966  1.00 454.90 ? 25  VAL C CB    1 
ATOM   3731 C  CG1   . VAL B 2 48  ? 27.279  21.420  13.459  1.00 457.22 ? 25  VAL C CG1   1 
ATOM   3732 C  CG2   . VAL B 2 48  ? 28.510  19.872  15.054  1.00 455.29 ? 25  VAL C CG2   1 
ATOM   3733 N  N     . ARG B 2 49  ? 29.075  18.291  11.891  1.00 466.12 ? 26  ARG C N     1 
ATOM   3734 C  CA    . ARG B 2 49  ? 29.198  16.856  11.666  1.00 457.94 ? 26  ARG C CA    1 
ATOM   3735 C  C     . ARG B 2 49  ? 30.639  16.467  11.337  1.00 454.13 ? 26  ARG C C     1 
ATOM   3736 O  O     . ARG B 2 49  ? 31.072  15.355  11.645  1.00 451.20 ? 26  ARG C O     1 
ATOM   3737 C  CB    . ARG B 2 49  ? 28.273  16.457  10.513  1.00 455.52 ? 26  ARG C CB    1 
ATOM   3738 C  CG    . ARG B 2 49  ? 27.631  15.078  10.606  1.00 447.97 ? 26  ARG C CG    1 
ATOM   3739 C  CD    . ARG B 2 49  ? 26.300  15.074  9.847   1.00 448.23 ? 26  ARG C CD    1 
ATOM   3740 N  NE    . ARG B 2 49  ? 26.022  13.820  9.157   1.00 451.00 ? 26  ARG C NE    1 
ATOM   3741 C  CZ    . ARG B 2 49  ? 25.581  12.716  9.752   1.00 450.57 ? 26  ARG C CZ    1 
ATOM   3742 N  NH1   . ARG B 2 49  ? 25.381  12.698  11.059  1.00 448.54 ? 26  ARG C NH1   1 
ATOM   3743 N  NH2   . ARG B 2 49  ? 25.349  11.620  9.042   1.00 452.63 ? 26  ARG C NH2   1 
ATOM   3744 N  N     . LYS B 2 50  ? 31.373  17.404  10.732  1.00 455.06 ? 27  LYS C N     1 
ATOM   3745 C  CA    . LYS B 2 50  ? 32.718  17.154  10.196  1.00 456.64 ? 27  LYS C CA    1 
ATOM   3746 C  C     . LYS B 2 50  ? 33.843  17.200  11.242  1.00 459.26 ? 27  LYS C C     1 
ATOM   3747 O  O     . LYS B 2 50  ? 34.802  16.426  11.176  1.00 462.57 ? 27  LYS C O     1 
ATOM   3748 C  CB    . LYS B 2 50  ? 33.012  18.134  9.055   1.00 456.14 ? 27  LYS C CB    1 
ATOM   3749 N  N     . ARG B 2 51  ? 33.731  18.114  12.198  1.00 455.54 ? 28  ARG C N     1 
ATOM   3750 C  CA    . ARG B 2 51  ? 34.679  18.174  13.305  1.00 440.64 ? 28  ARG C CA    1 
ATOM   3751 C  C     . ARG B 2 51  ? 33.921  18.134  14.633  1.00 424.41 ? 28  ARG C C     1 
ATOM   3752 O  O     . ARG B 2 51  ? 33.872  19.136  15.355  1.00 421.12 ? 28  ARG C O     1 
ATOM   3753 C  CB    . ARG B 2 51  ? 35.540  19.439  13.212  1.00 440.72 ? 28  ARG C CB    1 
ATOM   3754 N  N     . PRO B 2 52  ? 33.337  16.963  14.960  1.00 411.93 ? 29  PRO C N     1 
ATOM   3755 C  CA    . PRO B 2 52  ? 32.380  16.778  16.061  1.00 407.33 ? 29  PRO C CA    1 
ATOM   3756 C  C     . PRO B 2 52  ? 32.988  16.975  17.452  1.00 400.50 ? 29  PRO C C     1 
ATOM   3757 O  O     . PRO B 2 52  ? 32.303  17.455  18.373  1.00 397.98 ? 29  PRO C O     1 
ATOM   3758 C  CB    . PRO B 2 52  ? 31.927  15.329  15.881  1.00 406.26 ? 29  PRO C CB    1 
ATOM   3759 C  CG    . PRO B 2 52  ? 33.072  14.667  15.229  1.00 405.43 ? 29  PRO C CG    1 
ATOM   3760 C  CD    . PRO B 2 52  ? 33.680  15.683  14.316  1.00 408.66 ? 29  PRO C CD    1 
ATOM   3761 N  N     . GLY B 2 53  ? 34.259  16.607  17.595  1.00 397.04 ? 30  GLY C N     1 
ATOM   3762 C  CA    . GLY B 2 53  ? 34.972  16.779  18.847  1.00 390.30 ? 30  GLY C CA    1 
ATOM   3763 C  C     . GLY B 2 53  ? 35.004  18.224  19.301  1.00 387.18 ? 30  GLY C C     1 
ATOM   3764 O  O     . GLY B 2 53  ? 34.960  18.518  20.500  1.00 378.75 ? 30  GLY C O     1 
ATOM   3765 N  N     . MET B 2 54  ? 35.072  19.135  18.338  1.00 393.33 ? 31  MET C N     1 
ATOM   3766 C  CA    . MET B 2 54  ? 35.138  20.557  18.648  1.00 392.16 ? 31  MET C CA    1 
ATOM   3767 C  C     . MET B 2 54  ? 33.866  21.023  19.368  1.00 396.09 ? 31  MET C C     1 
ATOM   3768 O  O     . MET B 2 54  ? 33.923  21.846  20.287  1.00 395.46 ? 31  MET C O     1 
ATOM   3769 C  CB    . MET B 2 54  ? 35.402  21.381  17.378  1.00 394.89 ? 31  MET C CB    1 
ATOM   3770 N  N     . TYR B 2 55  ? 32.725  20.471  18.971  1.00 402.88 ? 32  TYR C N     1 
ATOM   3771 C  CA    . TYR B 2 55  ? 31.449  20.895  19.529  1.00 408.23 ? 32  TYR C CA    1 
ATOM   3772 C  C     . TYR B 2 55  ? 31.069  20.087  20.765  1.00 401.92 ? 32  TYR C C     1 
ATOM   3773 O  O     . TYR B 2 55  ? 30.268  20.538  21.597  1.00 406.06 ? 32  TYR C O     1 
ATOM   3774 C  CB    . TYR B 2 55  ? 30.351  20.768  18.478  1.00 424.24 ? 32  TYR C CB    1 
ATOM   3775 C  CG    . TYR B 2 55  ? 30.484  21.716  17.312  1.00 438.87 ? 32  TYR C CG    1 
ATOM   3776 C  CD1   . TYR B 2 55  ? 31.458  21.522  16.335  1.00 442.82 ? 32  TYR C CD1   1 
ATOM   3777 C  CD2   . TYR B 2 55  ? 29.621  22.796  17.178  1.00 450.47 ? 32  TYR C CD2   1 
ATOM   3778 C  CE1   . TYR B 2 55  ? 31.576  22.387  15.265  1.00 452.15 ? 32  TYR C CE1   1 
ATOM   3779 C  CE2   . TYR B 2 55  ? 29.729  23.667  16.115  1.00 459.85 ? 32  TYR C CE2   1 
ATOM   3780 C  CZ    . TYR B 2 55  ? 30.706  23.459  15.158  1.00 461.61 ? 32  TYR C CZ    1 
ATOM   3781 O  OH    . TYR B 2 55  ? 30.805  24.330  14.097  1.00 469.77 ? 32  TYR C OH    1 
ATOM   3782 N  N     . ILE B 2 56  ? 31.655  18.896  20.883  1.00 391.71 ? 33  ILE C N     1 
ATOM   3783 C  CA    . ILE B 2 56  ? 31.241  17.931  21.907  1.00 385.62 ? 33  ILE C CA    1 
ATOM   3784 C  C     . ILE B 2 56  ? 32.389  17.214  22.626  1.00 379.36 ? 33  ILE C C     1 
ATOM   3785 O  O     . ILE B 2 56  ? 32.280  16.904  23.810  1.00 376.38 ? 33  ILE C O     1 
ATOM   3786 C  CB    . ILE B 2 56  ? 30.265  16.899  21.293  1.00 393.40 ? 33  ILE C CB    1 
ATOM   3787 C  CG1   . ILE B 2 56  ? 28.836  17.256  21.668  1.00 382.49 ? 33  ILE C CG1   1 
ATOM   3788 C  CG2   . ILE B 2 56  ? 30.599  15.477  21.702  1.00 398.37 ? 33  ILE C CG2   1 
ATOM   3789 C  CD1   . ILE B 2 56  ? 27.860  16.816  20.649  1.00 385.42 ? 33  ILE C CD1   1 
ATOM   3790 N  N     . GLY B 2 57  ? 33.490  16.980  21.914  1.00 376.90 ? 34  GLY C N     1 
ATOM   3791 C  CA    . GLY B 2 57  ? 34.542  16.094  22.386  1.00 363.33 ? 34  GLY C CA    1 
ATOM   3792 C  C     . GLY B 2 57  ? 34.073  14.656  22.240  1.00 369.53 ? 34  GLY C C     1 
ATOM   3793 O  O     . GLY B 2 57  ? 33.780  13.998  23.240  1.00 361.48 ? 34  GLY C O     1 
ATOM   3794 N  N     . SER B 2 58  ? 33.982  14.174  21.000  1.00 387.56 ? 35  SER C N     1 
ATOM   3795 C  CA    . SER B 2 58  ? 33.445  12.834  20.726  1.00 395.38 ? 35  SER C CA    1 
ATOM   3796 C  C     . SER B 2 58  ? 34.141  11.786  21.595  1.00 394.15 ? 35  SER C C     1 
ATOM   3797 O  O     . SER B 2 58  ? 35.296  11.965  21.997  1.00 387.94 ? 35  SER C O     1 
ATOM   3798 C  CB    . SER B 2 58  ? 33.539  12.477  19.223  1.00 396.72 ? 35  SER C CB    1 
ATOM   3799 O  OG    . SER B 2 58  ? 32.963  11.209  18.907  1.00 392.45 ? 35  SER C OG    1 
ATOM   3800 N  N     . THR B 2 59  ? 33.416  10.718  21.910  1.00 397.67 ? 36  THR C N     1 
ATOM   3801 C  CA    . THR B 2 59  ? 33.948  9.638   22.730  1.00 387.05 ? 36  THR C CA    1 
ATOM   3802 C  C     . THR B 2 59  ? 33.080  8.389   22.628  1.00 387.53 ? 36  THR C C     1 
ATOM   3803 O  O     . THR B 2 59  ? 32.257  8.253   21.718  1.00 393.92 ? 36  THR C O     1 
ATOM   3804 C  CB    . THR B 2 59  ? 34.071  10.053  24.212  1.00 371.32 ? 36  THR C CB    1 
ATOM   3805 N  N     . ASP B 2 60  ? 33.288  7.476   23.569  1.00 380.43 ? 37  ASP C N     1 
ATOM   3806 C  CA    . ASP B 2 60  ? 32.532  6.230   23.629  1.00 386.57 ? 37  ASP C CA    1 
ATOM   3807 C  C     . ASP B 2 60  ? 32.335  5.812   25.081  1.00 369.75 ? 37  ASP C C     1 
ATOM   3808 O  O     . ASP B 2 60  ? 33.102  5.010   25.618  1.00 365.03 ? 37  ASP C O     1 
ATOM   3809 C  CB    . ASP B 2 60  ? 33.245  5.118   22.855  1.00 396.88 ? 37  ASP C CB    1 
ATOM   3810 N  N     . GLY B 2 61  ? 31.300  6.361   25.707  1.00 361.60 ? 38  GLY C N     1 
ATOM   3811 C  CA    . GLY B 2 61  ? 30.403  7.282   25.032  1.00 386.77 ? 38  GLY C CA    1 
ATOM   3812 C  C     . GLY B 2 61  ? 30.270  8.559   25.818  1.00 406.34 ? 38  GLY C C     1 
ATOM   3813 O  O     . GLY B 2 61  ? 29.169  9.018   26.095  1.00 424.11 ? 38  GLY C O     1 
ATOM   3814 N  N     . ALA B 2 62  ? 31.404  9.126   26.196  1.00 402.64 ? 39  ALA C N     1 
ATOM   3815 C  CA    . ALA B 2 62  ? 31.388  10.365  26.952  1.00 397.33 ? 39  ALA C CA    1 
ATOM   3816 C  C     . ALA B 2 62  ? 30.910  11.504  26.062  1.00 416.93 ? 39  ALA C C     1 
ATOM   3817 O  O     . ALA B 2 62  ? 30.409  12.517  26.547  1.00 419.69 ? 39  ALA C O     1 
ATOM   3818 C  CB    . ALA B 2 62  ? 32.759  10.663  27.524  1.00 378.82 ? 39  ALA C CB    1 
ATOM   3819 N  N     . GLY B 2 63  ? 31.059  11.329  24.754  1.00 427.56 ? 40  GLY C N     1 
ATOM   3820 C  CA    . GLY B 2 63  ? 30.582  12.317  23.809  1.00 436.87 ? 40  GLY C CA    1 
ATOM   3821 C  C     . GLY B 2 63  ? 29.075  12.239  23.700  1.00 444.08 ? 40  GLY C C     1 
ATOM   3822 O  O     . GLY B 2 63  ? 28.375  13.253  23.797  1.00 455.97 ? 40  GLY C O     1 
ATOM   3823 N  N     . LEU B 2 64  ? 28.578  11.022  23.492  1.00 435.13 ? 41  LEU C N     1 
ATOM   3824 C  CA    . LEU B 2 64  ? 27.142  10.777  23.436  1.00 430.98 ? 41  LEU C CA    1 
ATOM   3825 C  C     . LEU B 2 64  ? 26.503  11.327  24.692  1.00 443.62 ? 41  LEU C C     1 
ATOM   3826 O  O     . LEU B 2 64  ? 25.489  12.017  24.647  1.00 453.47 ? 41  LEU C O     1 
ATOM   3827 C  CB    . LEU B 2 64  ? 26.843  9.284   23.341  1.00 410.41 ? 41  LEU C CB    1 
ATOM   3828 C  CG    . LEU B 2 64  ? 25.352  8.958   23.390  1.00 397.58 ? 41  LEU C CG    1 
ATOM   3829 C  CD1   . LEU B 2 64  ? 24.739  9.225   22.037  1.00 401.63 ? 41  LEU C CD1   1 
ATOM   3830 C  CD2   . LEU B 2 64  ? 25.087  7.528   23.835  1.00 388.71 ? 41  LEU C CD2   1 
ATOM   3831 N  N     . HIS B 2 65  ? 27.119  11.038  25.827  1.00 444.06 ? 42  HIS C N     1 
ATOM   3832 C  CA    . HIS B 2 65  ? 26.611  11.573  27.071  1.00 444.05 ? 42  HIS C CA    1 
ATOM   3833 C  C     . HIS B 2 65  ? 26.937  13.049  27.256  1.00 450.31 ? 42  HIS C C     1 
ATOM   3834 O  O     . HIS B 2 65  ? 26.717  13.606  28.325  1.00 451.27 ? 42  HIS C O     1 
ATOM   3835 C  CB    . HIS B 2 65  ? 27.050  10.716  28.255  1.00 419.96 ? 42  HIS C CB    1 
ATOM   3836 C  CG    . HIS B 2 65  ? 26.276  9.446   28.370  1.00 391.08 ? 42  HIS C CG    1 
ATOM   3837 N  ND1   . HIS B 2 65  ? 26.819  8.280   28.860  1.00 367.86 ? 42  HIS C ND1   1 
ATOM   3838 C  CD2   . HIS B 2 65  ? 24.996  9.155   28.035  1.00 378.98 ? 42  HIS C CD2   1 
ATOM   3839 C  CE1   . HIS B 2 65  ? 25.902  7.327   28.829  1.00 355.50 ? 42  HIS C CE1   1 
ATOM   3840 N  NE2   . HIS B 2 65  ? 24.789  7.832   28.330  1.00 361.91 ? 42  HIS C NE2   1 
ATOM   3841 N  N     . HIS B 2 66  ? 27.432  13.692  26.204  1.00 449.23 ? 43  HIS C N     1 
ATOM   3842 C  CA    . HIS B 2 66  ? 27.730  15.108  26.297  1.00 436.47 ? 43  HIS C CA    1 
ATOM   3843 C  C     . HIS B 2 66  ? 26.694  15.962  25.595  1.00 436.53 ? 43  HIS C C     1 
ATOM   3844 O  O     . HIS B 2 66  ? 26.363  17.039  26.094  1.00 428.84 ? 43  HIS C O     1 
ATOM   3845 C  CB    . HIS B 2 66  ? 29.136  15.427  25.797  1.00 419.35 ? 43  HIS C CB    1 
ATOM   3846 C  CG    . HIS B 2 66  ? 29.991  16.114  26.814  1.00 389.80 ? 43  HIS C CG    1 
ATOM   3847 N  ND1   . HIS B 2 66  ? 30.208  17.476  26.807  1.00 381.83 ? 43  HIS C ND1   1 
ATOM   3848 C  CD2   . HIS B 2 66  ? 30.678  15.629  27.876  1.00 370.48 ? 43  HIS C CD2   1 
ATOM   3849 C  CE1   . HIS B 2 66  ? 30.994  17.799  27.818  1.00 366.48 ? 43  HIS C CE1   1 
ATOM   3850 N  NE2   . HIS B 2 66  ? 31.294  16.697  28.482  1.00 359.37 ? 43  HIS C NE2   1 
ATOM   3851 N  N     . LEU B 2 67  ? 26.157  15.504  24.465  1.00 435.14 ? 44  LEU C N     1 
ATOM   3852 C  CA    . LEU B 2 67  ? 25.101  16.301  23.844  1.00 425.36 ? 44  LEU C CA    1 
ATOM   3853 C  C     . LEU B 2 67  ? 23.762  16.180  24.561  1.00 425.03 ? 44  LEU C C     1 
ATOM   3854 O  O     . LEU B 2 67  ? 22.888  17.047  24.427  1.00 428.60 ? 44  LEU C O     1 
ATOM   3855 C  CB    . LEU B 2 67  ? 24.945  16.073  22.344  1.00 406.18 ? 44  LEU C CB    1 
ATOM   3856 C  CG    . LEU B 2 67  ? 25.187  14.715  21.720  1.00 385.97 ? 44  LEU C CG    1 
ATOM   3857 C  CD1   . LEU B 2 67  ? 24.414  13.656  22.418  1.00 386.60 ? 44  LEU C CD1   1 
ATOM   3858 C  CD2   . LEU B 2 67  ? 24.753  14.795  20.273  1.00 404.56 ? 44  LEU C CD2   1 
ATOM   3859 N  N     . VAL B 2 68  ? 23.595  15.117  25.339  1.00 417.84 ? 45  VAL C N     1 
ATOM   3860 C  CA    . VAL B 2 68  ? 22.393  15.028  26.157  1.00 417.53 ? 45  VAL C CA    1 
ATOM   3861 C  C     . VAL B 2 68  ? 22.509  16.068  27.281  1.00 412.30 ? 45  VAL C C     1 
ATOM   3862 O  O     . VAL B 2 68  ? 21.540  16.762  27.606  1.00 417.43 ? 45  VAL C O     1 
ATOM   3863 C  CB    . VAL B 2 68  ? 22.116  13.570  26.643  1.00 403.74 ? 45  VAL C CB    1 
ATOM   3864 C  CG1   . VAL B 2 68  ? 23.407  12.862  26.905  1.00 392.00 ? 45  VAL C CG1   1 
ATOM   3865 C  CG2   . VAL B 2 68  ? 21.181  13.538  27.869  1.00 400.35 ? 45  VAL C CG2   1 
ATOM   3866 N  N     . TRP B 2 69  ? 23.713  16.205  27.829  1.00 400.79 ? 46  TRP C N     1 
ATOM   3867 C  CA    . TRP B 2 69  ? 23.982  17.270  28.774  1.00 383.04 ? 46  TRP C CA    1 
ATOM   3868 C  C     . TRP B 2 69  ? 23.656  18.597  28.130  1.00 374.35 ? 46  TRP C C     1 
ATOM   3869 O  O     . TRP B 2 69  ? 22.983  19.423  28.725  1.00 362.75 ? 46  TRP C O     1 
ATOM   3870 C  CB    . TRP B 2 69  ? 25.442  17.271  29.164  1.00 375.17 ? 46  TRP C CB    1 
ATOM   3871 C  CG    . TRP B 2 69  ? 25.898  16.205  30.107  1.00 358.81 ? 46  TRP C CG    1 
ATOM   3872 C  CD1   . TRP B 2 69  ? 27.092  16.194  30.770  1.00 340.62 ? 46  TRP C CD1   1 
ATOM   3873 C  CD2   . TRP B 2 69  ? 25.216  14.997  30.499  1.00 357.44 ? 46  TRP C CD2   1 
ATOM   3874 N  NE1   . TRP B 2 69  ? 27.197  15.075  31.548  1.00 330.31 ? 46  TRP C NE1   1 
ATOM   3875 C  CE2   . TRP B 2 69  ? 26.065  14.318  31.397  1.00 340.96 ? 46  TRP C CE2   1 
ATOM   3876 C  CE3   . TRP B 2 69  ? 23.982  14.418  30.179  1.00 368.19 ? 46  TRP C CE3   1 
ATOM   3877 C  CZ2   . TRP B 2 69  ? 25.721  13.094  31.976  1.00 339.44 ? 46  TRP C CZ2   1 
ATOM   3878 C  CZ3   . TRP B 2 69  ? 23.643  13.206  30.756  1.00 364.09 ? 46  TRP C CZ3   1 
ATOM   3879 C  CH2   . TRP B 2 69  ? 24.509  12.558  31.645  1.00 350.19 ? 46  TRP C CH2   1 
ATOM   3880 N  N     . GLU B 2 70  ? 24.127  18.802  26.905  1.00 380.18 ? 47  GLU C N     1 
ATOM   3881 C  CA    . GLU B 2 70  ? 23.865  20.067  26.220  1.00 390.84 ? 47  GLU C CA    1 
ATOM   3882 C  C     . GLU B 2 70  ? 22.369  20.363  26.066  1.00 398.70 ? 47  GLU C C     1 
ATOM   3883 O  O     . GLU B 2 70  ? 21.944  21.491  26.338  1.00 387.90 ? 47  GLU C O     1 
ATOM   3884 C  CB    . GLU B 2 70  ? 24.565  20.135  24.861  1.00 404.44 ? 47  GLU C CB    1 
ATOM   3885 C  CG    . GLU B 2 70  ? 26.064  19.864  24.901  1.00 400.63 ? 47  GLU C CG    1 
ATOM   3886 C  CD    . GLU B 2 70  ? 26.813  20.772  25.857  1.00 390.30 ? 47  GLU C CD    1 
ATOM   3887 O  OE1   . GLU B 2 70  ? 27.479  20.259  26.783  1.00 374.14 ? 47  GLU C OE1   1 
ATOM   3888 O  OE2   . GLU B 2 70  ? 26.752  22.002  25.677  1.00 397.50 ? 47  GLU C OE2   1 
ATOM   3889 N  N     . ILE B 2 71  ? 21.578  19.364  25.655  1.00 417.33 ? 48  ILE C N     1 
ATOM   3890 C  CA    . ILE B 2 71  ? 20.139  19.569  25.437  1.00 427.89 ? 48  ILE C CA    1 
ATOM   3891 C  C     . ILE B 2 71  ? 19.376  19.787  26.731  1.00 405.62 ? 48  ILE C C     1 
ATOM   3892 O  O     . ILE B 2 71  ? 18.499  20.658  26.827  1.00 409.83 ? 48  ILE C O     1 
ATOM   3893 C  CB    . ILE B 2 71  ? 19.478  18.387  24.753  1.00 439.54 ? 48  ILE C CB    1 
ATOM   3894 C  CG1   . ILE B 2 71  ? 20.060  18.190  23.372  1.00 431.35 ? 48  ILE C CG1   1 
ATOM   3895 C  CG2   . ILE B 2 71  ? 17.988  18.637  24.618  1.00 451.94 ? 48  ILE C CG2   1 
ATOM   3896 C  CD1   . ILE B 2 71  ? 19.000  17.987  22.318  1.00 427.28 ? 48  ILE C CD1   1 
ATOM   3897 N  N     . VAL B 2 72  ? 19.701  18.970  27.721  1.00 374.98 ? 49  VAL C N     1 
ATOM   3898 C  CA    . VAL B 2 72  ? 19.046  19.056  29.009  1.00 350.14 ? 49  VAL C CA    1 
ATOM   3899 C  C     . VAL B 2 72  ? 19.343  20.396  29.684  1.00 340.36 ? 49  VAL C C     1 
ATOM   3900 O  O     . VAL B 2 72  ? 18.433  21.059  30.189  1.00 345.61 ? 49  VAL C O     1 
ATOM   3901 C  CB    . VAL B 2 72  ? 19.432  17.862  29.896  1.00 340.82 ? 49  VAL C CB    1 
ATOM   3902 C  CG1   . VAL B 2 72  ? 19.791  18.299  31.318  1.00 322.95 ? 49  VAL C CG1   1 
ATOM   3903 C  CG2   . VAL B 2 72  ? 18.306  16.858  29.899  1.00 352.72 ? 49  VAL C CG2   1 
ATOM   3904 N  N     . ASP B 2 73  ? 20.611  20.808  29.657  1.00 336.31 ? 50  ASP C N     1 
ATOM   3905 C  CA    . ASP B 2 73  ? 21.012  22.080  30.247  1.00 324.41 ? 50  ASP C CA    1 
ATOM   3906 C  C     . ASP B 2 73  ? 20.408  23.198  29.440  1.00 328.35 ? 50  ASP C C     1 
ATOM   3907 O  O     . ASP B 2 73  ? 20.121  24.265  29.965  1.00 327.31 ? 50  ASP C O     1 
ATOM   3908 C  CB    . ASP B 2 73  ? 22.531  22.218  30.306  1.00 321.00 ? 50  ASP C CB    1 
ATOM   3909 C  CG    . ASP B 2 73  ? 23.167  21.271  31.312  1.00 315.94 ? 50  ASP C CG    1 
ATOM   3910 O  OD1   . ASP B 2 73  ? 22.454  20.380  31.865  1.00 315.33 ? 50  ASP C OD1   1 
ATOM   3911 O  OD2   . ASP B 2 73  ? 24.391  21.408  31.543  1.00 310.87 ? 50  ASP C OD2   1 
ATOM   3912 N  N     . ASN B 2 74  ? 20.183  22.957  28.159  1.00 352.78 ? 51  ASN C N     1 
ATOM   3913 C  CA    . ASN B 2 74  ? 19.564  23.996  27.355  1.00 377.21 ? 51  ASN C CA    1 
ATOM   3914 C  C     . ASN B 2 74  ? 18.091  24.212  27.696  1.00 377.87 ? 51  ASN C C     1 
ATOM   3915 O  O     . ASN B 2 74  ? 17.621  25.355  27.778  1.00 380.24 ? 51  ASN C O     1 
ATOM   3916 C  CB    . ASN B 2 74  ? 19.735  23.741  25.858  1.00 403.23 ? 51  ASN C CB    1 
ATOM   3917 C  CG    . ASN B 2 74  ? 19.114  24.825  25.036  1.00 425.76 ? 51  ASN C CG    1 
ATOM   3918 O  OD1   . ASN B 2 74  ? 19.741  25.828  24.724  1.00 421.12 ? 51  ASN C OD1   1 
ATOM   3919 N  ND2   . ASN B 2 74  ? 17.854  24.662  24.735  1.00 448.24 ? 51  ASN C ND2   1 
ATOM   3920 N  N     . ALA B 2 75  ? 17.371  23.110  27.882  1.00 374.00 ? 52  ALA C N     1 
ATOM   3921 C  CA    . ALA B 2 75  ? 15.958  23.174  28.203  1.00 371.04 ? 52  ALA C CA    1 
ATOM   3922 C  C     . ALA B 2 75  ? 15.770  23.669  29.640  1.00 351.85 ? 52  ALA C C     1 
ATOM   3923 O  O     . ALA B 2 75  ? 14.744  24.287  29.969  1.00 353.96 ? 52  ALA C O     1 
ATOM   3924 C  CB    . ALA B 2 75  ? 15.333  21.836  28.020  1.00 375.76 ? 52  ALA C CB    1 
ATOM   3925 N  N     . VAL B 2 76  ? 16.761  23.392  30.491  1.00 339.83 ? 53  VAL C N     1 
ATOM   3926 C  CA    . VAL B 2 76  ? 16.796  23.972  31.829  1.00 332.75 ? 53  VAL C CA    1 
ATOM   3927 C  C     . VAL B 2 76  ? 16.913  25.474  31.676  1.00 335.53 ? 53  VAL C C     1 
ATOM   3928 O  O     . VAL B 2 76  ? 16.074  26.227  32.177  1.00 336.10 ? 53  VAL C O     1 
ATOM   3929 C  CB    . VAL B 2 76  ? 17.996  23.477  32.682  1.00 306.41 ? 53  VAL C CB    1 
ATOM   3930 C  CG1   . VAL B 2 76  ? 18.208  24.381  33.912  1.00 295.92 ? 53  VAL C CG1   1 
ATOM   3931 C  CG2   . VAL B 2 76  ? 17.815  22.023  33.097  1.00 302.35 ? 53  VAL C CG2   1 
ATOM   3932 N  N     . ASP B 2 77  ? 17.952  25.898  30.963  1.00 341.89 ? 54  ASP C N     1 
ATOM   3933 C  CA    . ASP B 2 77  ? 18.207  27.313  30.746  1.00 361.87 ? 54  ASP C CA    1 
ATOM   3934 C  C     . ASP B 2 77  ? 16.954  27.985  30.236  1.00 386.22 ? 54  ASP C C     1 
ATOM   3935 O  O     . ASP B 2 77  ? 16.656  29.114  30.606  1.00 382.80 ? 54  ASP C O     1 
ATOM   3936 C  CB    . ASP B 2 77  ? 19.366  27.526  29.770  1.00 365.48 ? 54  ASP C CB    1 
ATOM   3937 C  CG    . ASP B 2 77  ? 20.713  27.387  30.438  1.00 348.95 ? 54  ASP C CG    1 
ATOM   3938 O  OD1   . ASP B 2 77  ? 20.734  27.276  31.681  1.00 333.74 ? 54  ASP C OD1   1 
ATOM   3939 O  OD2   . ASP B 2 77  ? 21.743  27.395  29.729  1.00 349.94 ? 54  ASP C OD2   1 
ATOM   3940 N  N     . GLU B 2 78  ? 16.196  27.271  29.417  1.00 403.61 ? 55  GLU C N     1 
ATOM   3941 C  CA    . GLU B 2 78  ? 14.978  27.828  28.871  1.00 403.12 ? 55  GLU C CA    1 
ATOM   3942 C  C     . GLU B 2 78  ? 13.886  27.936  29.941  1.00 386.58 ? 55  GLU C C     1 
ATOM   3943 O  O     . GLU B 2 78  ? 13.171  28.934  30.007  1.00 388.15 ? 55  GLU C O     1 
ATOM   3944 C  CB    . GLU B 2 78  ? 14.513  26.989  27.683  1.00 406.93 ? 55  GLU C CB    1 
ATOM   3945 C  CG    . GLU B 2 78  ? 13.337  27.574  26.936  1.00 419.99 ? 55  GLU C CG    1 
ATOM   3946 C  CD    . GLU B 2 78  ? 13.662  28.899  26.272  1.00 430.96 ? 55  GLU C CD    1 
ATOM   3947 O  OE1   . GLU B 2 78  ? 14.852  29.142  25.964  1.00 425.34 ? 55  GLU C OE1   1 
ATOM   3948 O  OE2   . GLU B 2 78  ? 12.720  29.696  26.059  1.00 443.90 ? 55  GLU C OE2   1 
ATOM   3949 N  N     . ALA B 2 79  ? 13.763  26.913  30.785  1.00 367.64 ? 56  ALA C N     1 
ATOM   3950 C  CA    . ALA B 2 79  ? 12.736  26.932  31.826  1.00 362.01 ? 56  ALA C CA    1 
ATOM   3951 C  C     . ALA B 2 79  ? 13.013  27.996  32.884  1.00 351.82 ? 56  ALA C C     1 
ATOM   3952 O  O     . ALA B 2 79  ? 12.090  28.548  33.467  1.00 356.32 ? 56  ALA C O     1 
ATOM   3953 C  CB    . ALA B 2 79  ? 12.589  25.568  32.469  1.00 353.89 ? 56  ALA C CB    1 
ATOM   3954 N  N     . LEU B 2 80  ? 14.288  28.284  33.121  1.00 341.26 ? 57  LEU C N     1 
ATOM   3955 C  CA    . LEU B 2 80  ? 14.690  29.282  34.107  1.00 342.10 ? 57  LEU C CA    1 
ATOM   3956 C  C     . LEU B 2 80  ? 14.157  30.692  33.813  1.00 360.07 ? 57  LEU C C     1 
ATOM   3957 O  O     . LEU B 2 80  ? 13.769  31.428  34.730  1.00 357.08 ? 57  LEU C O     1 
ATOM   3958 C  CB    . LEU B 2 80  ? 16.213  29.335  34.195  1.00 336.75 ? 57  LEU C CB    1 
ATOM   3959 C  CG    . LEU B 2 80  ? 16.958  28.135  34.773  1.00 327.11 ? 57  LEU C CG    1 
ATOM   3960 C  CD1   . LEU B 2 80  ? 18.472  28.350  34.649  1.00 318.94 ? 57  LEU C CD1   1 
ATOM   3961 C  CD2   . LEU B 2 80  ? 16.535  27.899  36.228  1.00 317.51 ? 57  LEU C CD2   1 
ATOM   3962 N  N     . SER B 2 81  ? 14.154  31.066  32.533  1.00 376.28 ? 58  SER C N     1 
ATOM   3963 C  CA    . SER B 2 81  ? 13.759  32.416  32.102  1.00 381.80 ? 58  SER C CA    1 
ATOM   3964 C  C     . SER B 2 81  ? 12.237  32.582  32.021  1.00 390.36 ? 58  SER C C     1 
ATOM   3965 O  O     . SER B 2 81  ? 11.481  31.855  32.674  1.00 389.07 ? 58  SER C O     1 
ATOM   3966 C  CB    . SER B 2 81  ? 14.417  32.781  30.755  1.00 385.69 ? 58  SER C CB    1 
ATOM   3967 O  OG    . SER B 2 81  ? 13.614  32.422  29.635  1.00 395.71 ? 58  SER C OG    1 
ATOM   3968 N  N     . ASP B 2 85  ? 9.431   24.831  34.138  1.00 373.66 ? 62  ASP C N     1 
ATOM   3969 C  CA    . ASP B 2 85  ? 9.472   24.431  35.539  1.00 361.35 ? 62  ASP C CA    1 
ATOM   3970 C  C     . ASP B 2 85  ? 9.401   22.915  35.718  1.00 361.03 ? 62  ASP C C     1 
ATOM   3971 O  O     . ASP B 2 85  ? 9.387   22.429  36.847  1.00 350.47 ? 62  ASP C O     1 
ATOM   3972 C  CB    . ASP B 2 85  ? 8.351   25.109  36.333  1.00 364.06 ? 62  ASP C CB    1 
ATOM   3973 N  N     . ARG B 2 86  ? 9.352   22.173  34.610  1.00 375.30 ? 63  ARG C N     1 
ATOM   3974 C  CA    . ARG B 2 86  ? 9.486   20.712  34.660  1.00 380.82 ? 63  ARG C CA    1 
ATOM   3975 C  C     . ARG B 2 86  ? 10.122  20.150  33.392  1.00 392.46 ? 63  ARG C C     1 
ATOM   3976 O  O     . ARG B 2 86  ? 9.515   20.197  32.332  1.00 399.91 ? 63  ARG C O     1 
ATOM   3977 C  CB    . ARG B 2 86  ? 8.126   20.045  34.882  1.00 387.16 ? 63  ARG C CB    1 
ATOM   3978 N  N     . ILE B 2 87  ? 11.339  19.621  33.491  1.00 394.50 ? 64  ILE C N     1 
ATOM   3979 C  CA    . ILE B 2 87  ? 11.966  18.969  32.339  1.00 407.75 ? 64  ILE C CA    1 
ATOM   3980 C  C     . ILE B 2 87  ? 11.957  17.439  32.525  1.00 411.28 ? 64  ILE C C     1 
ATOM   3981 O  O     . ILE B 2 87  ? 12.385  16.924  33.554  1.00 406.64 ? 64  ILE C O     1 
ATOM   3982 C  CB    . ILE B 2 87  ? 13.413  19.513  32.040  1.00 336.47 ? 64  ILE C CB    1 
ATOM   3983 N  N     . ASP B 2 88  ? 11.438  16.713  31.541  1.00 418.60 ? 65  ASP C N     1 
ATOM   3984 C  CA    . ASP B 2 88  ? 11.380  15.258  31.618  1.00 409.64 ? 65  ASP C CA    1 
ATOM   3985 C  C     . ASP B 2 88  ? 12.228  14.645  30.526  1.00 422.23 ? 65  ASP C C     1 
ATOM   3986 O  O     . ASP B 2 88  ? 12.026  14.932  29.350  1.00 433.92 ? 65  ASP C O     1 
ATOM   3987 C  CB    . ASP B 2 88  ? 9.947   14.754  31.420  1.00 401.88 ? 65  ASP C CB    1 
ATOM   3988 C  CG    . ASP B 2 88  ? 8.981   15.275  32.466  1.00 386.91 ? 65  ASP C CG    1 
ATOM   3989 O  OD1   . ASP B 2 88  ? 8.980   14.756  33.610  1.00 374.60 ? 65  ASP C OD1   1 
ATOM   3990 O  OD2   . ASP B 2 88  ? 8.200   16.190  32.123  1.00 389.71 ? 65  ASP C OD2   1 
ATOM   3991 N  N     . VAL B 2 89  ? 13.161  13.782  30.911  1.00 417.64 ? 66  VAL C N     1 
ATOM   3992 C  CA    . VAL B 2 89  ? 13.904  12.990  29.936  1.00 426.64 ? 66  VAL C CA    1 
ATOM   3993 C  C     . VAL B 2 89  ? 13.400  11.538  29.875  1.00 426.41 ? 66  VAL C C     1 
ATOM   3994 O  O     . VAL B 2 89  ? 12.924  10.969  30.878  1.00 426.40 ? 66  VAL C O     1 
ATOM   3995 C  CB    . VAL B 2 89  ? 15.413  12.988  30.222  1.00 419.82 ? 66  VAL C CB    1 
ATOM   3996 C  CG1   . VAL B 2 89  ? 16.173  12.683  28.954  1.00 417.63 ? 66  VAL C CG1   1 
ATOM   3997 C  CG2   . VAL B 2 89  ? 15.844  14.320  30.764  1.00 426.06 ? 66  VAL C CG2   1 
ATOM   3998 N  N     . THR B 2 90  ? 13.525  10.945  28.690  1.00 425.27 ? 67  THR C N     1 
ATOM   3999 C  CA    . THR B 2 90  ? 13.062  9.585   28.442  1.00 418.95 ? 67  THR C CA    1 
ATOM   4000 C  C     . THR B 2 90  ? 14.014  8.815   27.532  1.00 419.49 ? 67  THR C C     1 
ATOM   4001 O  O     . THR B 2 90  ? 14.340  9.269   26.435  1.00 423.62 ? 67  THR C O     1 
ATOM   4002 C  CB    . THR B 2 90  ? 11.683  9.603   27.776  1.00 420.33 ? 67  THR C CB    1 
ATOM   4003 O  OG1   . THR B 2 90  ? 10.806  10.460  28.523  1.00 417.25 ? 67  THR C OG1   1 
ATOM   4004 C  CG2   . THR B 2 90  ? 11.113  8.196   27.684  1.00 418.66 ? 67  THR C CG2   1 
ATOM   4005 N  N     . ILE B 2 91  ? 14.470  7.654   27.990  1.00 413.79 ? 68  ILE C N     1 
ATOM   4006 C  CA    . ILE B 2 91  ? 15.215  6.768   27.116  1.00 407.95 ? 68  ILE C CA    1 
ATOM   4007 C  C     . ILE B 2 91  ? 14.177  5.834   26.579  1.00 398.03 ? 68  ILE C C     1 
ATOM   4008 O  O     . ILE B 2 91  ? 13.383  5.307   27.342  1.00 394.23 ? 68  ILE C O     1 
ATOM   4009 C  CB    . ILE B 2 91  ? 16.266  5.952   27.867  1.00 400.81 ? 68  ILE C CB    1 
ATOM   4010 C  CG1   . ILE B 2 91  ? 17.010  6.844   28.861  1.00 388.91 ? 68  ILE C CG1   1 
ATOM   4011 C  CG2   . ILE B 2 91  ? 17.226  5.311   26.876  1.00 403.37 ? 68  ILE C CG2   1 
ATOM   4012 C  CD1   . ILE B 2 91  ? 18.009  6.117   29.721  1.00 370.47 ? 68  ILE C CD1   1 
ATOM   4013 N  N     . ASN B 2 92  ? 14.159  5.633   25.270  1.00 393.25 ? 69  ASN C N     1 
ATOM   4014 C  CA    . ASN B 2 92  ? 13.095  4.839   24.661  1.00 399.57 ? 69  ASN C CA    1 
ATOM   4015 C  C     . ASN B 2 92  ? 13.492  3.395   24.382  1.00 398.83 ? 69  ASN C C     1 
ATOM   4016 O  O     . ASN B 2 92  ? 14.662  3.033   24.498  1.00 397.95 ? 69  ASN C O     1 
ATOM   4017 C  CB    . ASN B 2 92  ? 12.635  5.501   23.366  1.00 410.35 ? 69  ASN C CB    1 
ATOM   4018 C  CG    . ASN B 2 92  ? 12.426  6.985   23.521  1.00 412.38 ? 69  ASN C CG    1 
ATOM   4019 O  OD1   . ASN B 2 92  ? 11.902  7.453   24.538  1.00 407.26 ? 69  ASN C OD1   1 
ATOM   4020 N  ND2   . ASN B 2 92  ? 12.843  7.739   22.517  1.00 418.60 ? 69  ASN C ND2   1 
ATOM   4021 N  N     . LYS B 2 93  ? 12.516  2.572   24.012  1.00 399.07 ? 70  LYS C N     1 
ATOM   4022 C  CA    . LYS B 2 93  ? 12.811  1.203   23.609  1.00 400.31 ? 70  LYS C CA    1 
ATOM   4023 C  C     . LYS B 2 93  ? 13.665  1.253   22.347  1.00 404.36 ? 70  LYS C C     1 
ATOM   4024 O  O     . LYS B 2 93  ? 14.576  0.441   22.165  1.00 404.00 ? 70  LYS C O     1 
ATOM   4025 C  CB    . LYS B 2 93  ? 11.524  0.405   23.369  1.00 403.50 ? 70  LYS C CB    1 
ATOM   4026 N  N     . ASP B 2 94  ? 13.364  2.233   21.496  1.00 410.10 ? 71  ASP C N     1 
ATOM   4027 C  CA    . ASP B 2 94  ? 14.087  2.453   20.245  1.00 414.90 ? 71  ASP C CA    1 
ATOM   4028 C  C     . ASP B 2 94  ? 15.594  2.539   20.465  1.00 412.47 ? 71  ASP C C     1 
ATOM   4029 O  O     . ASP B 2 94  ? 16.382  1.923   19.740  1.00 410.92 ? 71  ASP C O     1 
ATOM   4030 C  CB    . ASP B 2 94  ? 13.593  3.740   19.579  1.00 416.96 ? 71  ASP C CB    1 
ATOM   4031 N  N     . GLY B 2 95  ? 15.974  3.291   21.493  1.00 410.62 ? 72  GLY C N     1 
ATOM   4032 C  CA    . GLY B 2 95  ? 17.362  3.603   21.782  1.00 406.32 ? 72  GLY C CA    1 
ATOM   4033 C  C     . GLY B 2 95  ? 17.480  5.108   21.822  1.00 405.77 ? 72  GLY C C     1 
ATOM   4034 O  O     . GLY B 2 95  ? 18.377  5.661   22.457  1.00 402.42 ? 72  GLY C O     1 
ATOM   4035 N  N     . SER B 2 96  ? 16.540  5.753   21.134  1.00 408.89 ? 73  SER C N     1 
ATOM   4036 C  CA    . SER B 2 96  ? 16.431  7.203   21.051  1.00 407.25 ? 73  SER C CA    1 
ATOM   4037 C  C     . SER B 2 96  ? 16.216  7.823   22.412  1.00 404.32 ? 73  SER C C     1 
ATOM   4038 O  O     . SER B 2 96  ? 15.826  7.139   23.366  1.00 398.66 ? 73  SER C O     1 
ATOM   4039 C  CB    . SER B 2 96  ? 15.246  7.573   20.172  1.00 411.94 ? 73  SER C CB    1 
ATOM   4040 O  OG    . SER B 2 96  ? 14.084  6.909   20.637  1.00 411.05 ? 73  SER C OG    1 
ATOM   4041 N  N     . LEU B 2 97  ? 16.454  9.133   22.478  1.00 415.24 ? 74  LEU C N     1 
ATOM   4042 C  CA    . LEU B 2 97  ? 16.349  9.909   23.715  1.00 424.06 ? 74  LEU C CA    1 
ATOM   4043 C  C     . LEU B 2 97  ? 15.428  11.084  23.497  1.00 434.36 ? 74  LEU C C     1 
ATOM   4044 O  O     . LEU B 2 97  ? 15.530  11.778  22.490  1.00 435.20 ? 74  LEU C O     1 
ATOM   4045 C  CB    . LEU B 2 97  ? 17.717  10.448  24.129  1.00 427.25 ? 74  LEU C CB    1 
ATOM   4046 C  CG    . LEU B 2 97  ? 17.760  11.248  25.423  1.00 427.38 ? 74  LEU C CG    1 
ATOM   4047 C  CD1   . LEU B 2 97  ? 17.851  10.319  26.602  1.00 419.90 ? 74  LEU C CD1   1 
ATOM   4048 C  CD2   . LEU B 2 97  ? 18.941  12.172  25.402  1.00 429.33 ? 74  LEU C CD2   1 
ATOM   4049 N  N     . THR B 2 98  ? 14.536  11.325  24.444  1.00 442.22 ? 75  THR C N     1 
ATOM   4050 C  CA    . THR B 2 98  ? 13.617  12.440  24.296  1.00 451.78 ? 75  THR C CA    1 
ATOM   4051 C  C     . THR B 2 98  ? 13.499  13.329  25.525  1.00 455.06 ? 75  THR C C     1 
ATOM   4052 O  O     . THR B 2 98  ? 13.048  12.886  26.584  1.00 455.23 ? 75  THR C O     1 
ATOM   4053 C  CB    . THR B 2 98  ? 12.216  11.971  23.888  1.00 449.85 ? 75  THR C CB    1 
ATOM   4054 O  OG1   . THR B 2 98  ? 11.244  12.785  24.548  1.00 455.05 ? 75  THR C OG1   1 
ATOM   4055 C  CG2   . THR B 2 98  ? 12.005  10.537  24.276  1.00 436.46 ? 75  THR C CG2   1 
ATOM   4056 N  N     . VAL B 2 99  ? 13.896  14.588  25.354  1.00 455.26 ? 76  VAL C N     1 
ATOM   4057 C  CA    . VAL B 2 99  ? 13.738  15.621  26.368  1.00 448.84 ? 76  VAL C CA    1 
ATOM   4058 C  C     . VAL B 2 99  ? 12.525  16.487  26.054  1.00 459.22 ? 76  VAL C C     1 
ATOM   4059 O  O     . VAL B 2 99  ? 12.366  16.964  24.930  1.00 467.04 ? 76  VAL C O     1 
ATOM   4060 C  CB    . VAL B 2 99  ? 14.972  16.530  26.430  1.00 438.18 ? 76  VAL C CB    1 
ATOM   4061 C  CG1   . VAL B 2 99  ? 14.746  17.678  27.395  1.00 422.71 ? 76  VAL C CG1   1 
ATOM   4062 C  CG2   . VAL B 2 99  ? 16.191  15.729  26.840  1.00 431.89 ? 76  VAL C CG2   1 
ATOM   4063 N  N     . GLN B 2 100 ? 11.657  16.683  27.038  1.00 458.98 ? 77  GLN C N     1 
ATOM   4064 C  CA    . GLN B 2 100 ? 10.541  17.586  26.831  1.00 464.08 ? 77  GLN C CA    1 
ATOM   4065 C  C     . GLN B 2 100 ? 10.360  18.484  28.039  1.00 456.78 ? 77  GLN C C     1 
ATOM   4066 O  O     . GLN B 2 100 ? 10.795  18.140  29.128  1.00 445.74 ? 77  GLN C O     1 
ATOM   4067 C  CB    . GLN B 2 100 ? 9.263   16.828  26.506  1.00 467.89 ? 77  GLN C CB    1 
ATOM   4068 C  CG    . GLN B 2 100 ? 8.519   16.321  27.703  1.00 460.24 ? 77  GLN C CG    1 
ATOM   4069 C  CD    . GLN B 2 100 ? 7.018   16.326  27.473  1.00 459.84 ? 77  GLN C CD    1 
ATOM   4070 O  OE1   . GLN B 2 100 ? 6.397   17.392  27.409  1.00 460.03 ? 77  GLN C OE1   1 
ATOM   4071 N  NE2   . GLN B 2 100 ? 6.428   15.135  27.333  1.00 459.34 ? 77  GLN C NE2   1 
ATOM   4072 N  N     . ASP B 2 101 ? 9.753   19.651  27.830  1.00 461.12 ? 78  ASP C N     1 
ATOM   4073 C  CA    . ASP B 2 101 ? 9.535   20.617  28.905  1.00 455.28 ? 78  ASP C CA    1 
ATOM   4074 C  C     . ASP B 2 101 ? 8.099   21.172  28.994  1.00 453.36 ? 78  ASP C C     1 
ATOM   4075 O  O     . ASP B 2 101 ? 7.402   21.369  27.960  1.00 459.81 ? 78  ASP C O     1 
ATOM   4076 C  CB    . ASP B 2 101 ? 10.628  21.721  28.948  1.00 469.45 ? 78  ASP C CB    1 
ATOM   4077 C  CG    . ASP B 2 101 ? 10.464  22.803  27.872  1.00 475.87 ? 78  ASP C CG    1 
ATOM   4078 O  OD1   . ASP B 2 101 ? 9.755   22.582  26.869  1.00 478.47 ? 78  ASP C OD1   1 
ATOM   4079 O  OD2   . ASP B 2 101 ? 11.078  23.885  28.033  1.00 477.81 ? 78  ASP C OD2   1 
ATOM   4080 N  N     . HIS B 2 102 ? 7.709   21.385  30.261  1.00 442.63 ? 79  HIS C N     1 
ATOM   4081 C  CA    . HIS B 2 102 ? 6.400   21.819  30.744  1.00 446.70 ? 79  HIS C CA    1 
ATOM   4082 C  C     . HIS B 2 102 ? 5.616   22.711  29.783  1.00 441.99 ? 79  HIS C C     1 
ATOM   4083 O  O     . HIS B 2 102 ? 4.591   23.295  30.150  1.00 433.55 ? 79  HIS C O     1 
ATOM   4084 C  CB    . HIS B 2 102 ? 6.579   22.526  32.100  1.00 453.24 ? 79  HIS C CB    1 
ATOM   4085 N  N     . THR B 2 117 ? 10.475  32.524  20.336  1.00 488.30 ? 94  THR C N     1 
ATOM   4086 C  CA    . THR B 2 117 ? 9.956   31.172  20.161  1.00 491.24 ? 94  THR C CA    1 
ATOM   4087 C  C     . THR B 2 117 ? 10.752  30.169  20.990  1.00 483.84 ? 94  THR C C     1 
ATOM   4088 O  O     . THR B 2 117 ? 11.884  29.824  20.622  1.00 482.73 ? 94  THR C O     1 
ATOM   4089 C  CB    . THR B 2 117 ? 10.004  30.740  18.684  1.00 497.90 ? 94  THR C CB    1 
ATOM   4090 O  OG1   . THR B 2 117 ? 9.163   31.600  17.904  1.00 499.51 ? 94  THR C OG1   1 
ATOM   4091 C  CG2   . THR B 2 117 ? 9.533   29.290  18.527  1.00 504.71 ? 94  THR C CG2   1 
ATOM   4092 N  N     . VAL B 2 118 ? 10.147  29.703  22.092  1.00 478.72 ? 95  VAL C N     1 
ATOM   4093 C  CA    . VAL B 2 118 ? 10.771  28.747  23.016  1.00 472.89 ? 95  VAL C CA    1 
ATOM   4094 C  C     . VAL B 2 118 ? 11.421  27.608  22.248  1.00 477.09 ? 95  VAL C C     1 
ATOM   4095 O  O     . VAL B 2 118 ? 12.453  27.089  22.671  1.00 473.79 ? 95  VAL C O     1 
ATOM   4096 C  CB    . VAL B 2 118 ? 9.764   28.170  24.088  1.00 524.36 ? 95  VAL C CB    1 
ATOM   4097 C  CG1   . VAL B 2 118 ? 8.477   27.691  23.428  1.00 528.55 ? 95  VAL C CG1   1 
ATOM   4098 C  CG2   . VAL B 2 118 ? 10.405  27.036  24.974  1.00 414.56 ? 95  VAL C CG2   1 
ATOM   4099 N  N     . GLU B 2 119 ? 10.833  27.250  21.102  1.00 488.74 ? 96  GLU C N     1 
ATOM   4100 C  CA    . GLU B 2 119 ? 11.269  26.074  20.351  1.00 500.95 ? 96  GLU C CA    1 
ATOM   4101 C  C     . GLU B 2 119 ? 12.721  26.106  19.894  1.00 508.43 ? 96  GLU C C     1 
ATOM   4102 O  O     . GLU B 2 119 ? 13.509  25.236  20.284  1.00 515.26 ? 96  GLU C O     1 
ATOM   4103 C  CB    . GLU B 2 119 ? 10.358  25.770  19.162  1.00 511.24 ? 96  GLU C CB    1 
ATOM   4104 C  CG    . GLU B 2 119 ? 10.842  24.555  18.333  1.00 517.74 ? 96  GLU C CG    1 
ATOM   4105 C  CD    . GLU B 2 119 ? 11.148  23.306  19.177  1.00 519.79 ? 96  GLU C CD    1 
ATOM   4106 O  OE1   . GLU B 2 119 ? 12.233  22.719  19.007  1.00 523.57 ? 96  GLU C OE1   1 
ATOM   4107 O  OE2   . GLU B 2 119 ? 10.309  22.901  20.007  1.00 517.45 ? 96  GLU C OE2   1 
ATOM   4108 N  N     . VAL B 2 120 ? 13.093  27.077  19.065  1.00 506.06 ? 97  VAL C N     1 
ATOM   4109 C  CA    . VAL B 2 120 ? 14.458  27.030  18.569  1.00 496.91 ? 97  VAL C CA    1 
ATOM   4110 C  C     . VAL B 2 120 ? 15.465  27.580  19.549  1.00 490.63 ? 97  VAL C C     1 
ATOM   4111 O  O     . VAL B 2 120 ? 16.629  27.161  19.532  1.00 492.27 ? 97  VAL C O     1 
ATOM   4112 C  CB    . VAL B 2 120 ? 14.631  27.645  17.217  1.00 493.07 ? 97  VAL C CB    1 
ATOM   4113 C  CG1   . VAL B 2 120 ? 15.908  27.093  16.600  1.00 496.78 ? 97  VAL C CG1   1 
ATOM   4114 C  CG2   . VAL B 2 120 ? 13.448  27.278  16.366  1.00 486.90 ? 97  VAL C CG2   1 
ATOM   4115 N  N     . ILE B 2 121 ? 15.029  28.479  20.432  1.00 480.63 ? 98  ILE C N     1 
ATOM   4116 C  CA    . ILE B 2 121 ? 15.917  28.870  21.521  1.00 467.02 ? 98  ILE C CA    1 
ATOM   4117 C  C     . ILE B 2 121 ? 16.219  27.626  22.347  1.00 463.41 ? 98  ILE C C     1 
ATOM   4118 O  O     . ILE B 2 121 ? 17.310  27.516  22.927  1.00 452.80 ? 98  ILE C O     1 
ATOM   4119 C  CB    . ILE B 2 121 ? 15.388  30.052  22.383  1.00 458.26 ? 98  ILE C CB    1 
ATOM   4120 C  CG1   . ILE B 2 121 ? 16.342  30.354  23.540  1.00 450.04 ? 98  ILE C CG1   1 
ATOM   4121 C  CG2   . ILE B 2 121 ? 14.041  29.759  22.930  1.00 461.27 ? 98  ILE C CG2   1 
ATOM   4122 C  CD1   . ILE B 2 121 ? 17.732  30.714  23.099  1.00 448.19 ? 98  ILE C CD1   1 
ATOM   4123 N  N     . PHE B 2 122 ? 15.260  26.685  22.346  1.00 477.68 ? 99  PHE C N     1 
ATOM   4124 C  CA    . PHE B 2 122 ? 15.430  25.359  22.947  1.00 487.80 ? 99  PHE C CA    1 
ATOM   4125 C  C     . PHE B 2 122 ? 16.394  24.509  22.116  1.00 494.78 ? 99  PHE C C     1 
ATOM   4126 O  O     . PHE B 2 122 ? 17.474  24.203  22.608  1.00 487.52 ? 99  PHE C O     1 
ATOM   4127 C  CB    . PHE B 2 122 ? 14.081  24.676  23.219  1.00 490.88 ? 99  PHE C CB    1 
ATOM   4128 C  CG    . PHE B 2 122 ? 14.158  23.282  23.875  1.00 483.39 ? 99  PHE C CG    1 
ATOM   4129 C  CD1   . PHE B 2 122 ? 15.361  22.621  24.111  1.00 479.43 ? 99  PHE C CD1   1 
ATOM   4130 C  CD2   . PHE B 2 122 ? 12.968  22.622  24.226  1.00 481.94 ? 99  PHE C CD2   1 
ATOM   4131 C  CE1   . PHE B 2 122 ? 15.379  21.350  24.670  1.00 478.46 ? 99  PHE C CE1   1 
ATOM   4132 C  CE2   . PHE B 2 122 ? 12.983  21.359  24.786  1.00 480.65 ? 99  PHE C CE2   1 
ATOM   4133 C  CZ    . PHE B 2 122 ? 14.186  20.724  25.006  1.00 479.76 ? 99  PHE C CZ    1 
ATOM   4134 N  N     . THR B 2 123 ? 16.072  24.128  20.887  1.00 501.84 ? 100 THR C N     1 
ATOM   4135 C  CA    . THR B 2 123 ? 16.999  23.219  20.194  1.00 490.81 ? 100 THR C CA    1 
ATOM   4136 C  C     . THR B 2 123 ? 18.418  23.768  19.913  1.00 476.73 ? 100 THR C C     1 
ATOM   4137 O  O     . THR B 2 123 ? 19.225  23.058  19.320  1.00 471.46 ? 100 THR C O     1 
ATOM   4138 C  CB    . THR B 2 123 ? 16.417  22.633  18.902  1.00 493.81 ? 100 THR C CB    1 
ATOM   4139 O  OG1   . THR B 2 123 ? 14.996  22.633  19.000  1.00 472.97 ? 100 THR C OG1   1 
ATOM   4140 C  CG2   . THR B 2 123 ? 16.908  21.207  18.675  1.00 512.04 ? 100 THR C CG2   1 
ATOM   4141 N  N     . ILE B 2 124 ? 18.740  24.998  20.323  1.00 471.13 ? 101 ILE C N     1 
ATOM   4142 C  CA    . ILE B 2 124 ? 20.138  25.437  20.222  1.00 463.94 ? 101 ILE C CA    1 
ATOM   4143 C  C     . ILE B 2 124 ? 20.956  24.844  21.378  1.00 446.32 ? 101 ILE C C     1 
ATOM   4144 O  O     . ILE B 2 124 ? 20.555  24.914  22.528  1.00 448.02 ? 101 ILE C O     1 
ATOM   4145 C  CB    . ILE B 2 124 ? 20.293  26.974  20.193  1.00 470.18 ? 101 ILE C CB    1 
ATOM   4146 N  N     . LEU B 2 125 ? 22.086  24.219  21.071  1.00 429.94 ? 102 LEU C N     1 
ATOM   4147 C  CA    . LEU B 2 125 ? 22.954  23.705  22.127  1.00 413.49 ? 102 LEU C CA    1 
ATOM   4148 C  C     . LEU B 2 125 ? 24.448  23.850  21.829  1.00 402.65 ? 102 LEU C C     1 
ATOM   4149 O  O     . LEU B 2 125 ? 24.838  24.490  20.854  1.00 412.46 ? 102 LEU C O     1 
ATOM   4150 C  CB    . LEU B 2 125 ? 22.595  22.271  22.576  1.00 414.58 ? 102 LEU C CB    1 
ATOM   4151 C  CG    . LEU B 2 125 ? 21.907  21.117  21.798  1.00 420.06 ? 102 LEU C CG    1 
ATOM   4152 C  CD1   . LEU B 2 125 ? 20.470  21.444  21.474  1.00 426.35 ? 102 LEU C CD1   1 
ATOM   4153 C  CD2   . LEU B 2 125 ? 22.618  20.589  20.547  1.00 423.07 ? 102 LEU C CD2   1 
ATOM   4154 N  N     . HIS B 2 126 ? 25.257  23.176  22.646  1.00 390.64 ? 103 HIS C N     1 
ATOM   4155 C  CA    . HIS B 2 126 ? 26.538  23.700  23.110  1.00 398.70 ? 103 HIS C CA    1 
ATOM   4156 C  C     . HIS B 2 126 ? 26.047  24.884  23.964  1.00 384.12 ? 103 HIS C C     1 
ATOM   4157 O  O     . HIS B 2 126 ? 25.786  25.977  23.458  1.00 383.54 ? 103 HIS C O     1 
ATOM   4158 C  CB    . HIS B 2 126 ? 27.477  24.077  21.965  1.00 425.81 ? 103 HIS C CB    1 
ATOM   4159 N  N     . ALA B 2 127 ? 25.841  24.623  25.258  1.00 382.50 ? 104 ALA C N     1 
ATOM   4160 C  CA    . ALA B 2 127 ? 24.962  25.456  26.079  1.00 394.71 ? 104 ALA C CA    1 
ATOM   4161 C  C     . ALA B 2 127 ? 25.464  25.678  27.507  1.00 377.09 ? 104 ALA C C     1 
ATOM   4162 O  O     . ALA B 2 127 ? 24.689  26.044  28.392  1.00 365.09 ? 104 ALA C O     1 
ATOM   4163 C  CB    . ALA B 2 127 ? 23.556  24.839  26.113  1.00 415.01 ? 104 ALA C CB    1 
ATOM   4164 N  N     . GLY B 2 128 ? 26.757  25.472  27.734  1.00 377.62 ? 105 GLY C N     1 
ATOM   4165 C  CA    . GLY B 2 128 ? 27.322  25.528  29.073  1.00 376.12 ? 105 GLY C CA    1 
ATOM   4166 C  C     . GLY B 2 128 ? 27.052  26.787  29.891  1.00 386.84 ? 105 GLY C C     1 
ATOM   4167 O  O     . GLY B 2 128 ? 27.976  27.494  30.315  1.00 387.27 ? 105 GLY C O     1 
ATOM   4168 N  N     . GLY B 2 129 ? 25.783  27.059  30.148  1.00 395.54 ? 106 GLY C N     1 
ATOM   4169 C  CA    . GLY B 2 129 ? 25.464  28.180  30.998  1.00 391.36 ? 106 GLY C CA    1 
ATOM   4170 C  C     . GLY B 2 129 ? 24.220  27.936  31.808  1.00 385.47 ? 106 GLY C C     1 
ATOM   4171 O  O     . GLY B 2 129 ? 23.597  26.881  31.688  1.00 377.64 ? 106 GLY C O     1 
ATOM   4172 N  N     . LYS B 2 130 ? 23.884  28.916  32.644  1.00 386.82 ? 107 LYS C N     1 
ATOM   4173 C  CA    . LYS B 2 130 ? 22.608  28.933  33.355  1.00 386.70 ? 107 LYS C CA    1 
ATOM   4174 C  C     . LYS B 2 130 ? 22.258  30.324  33.871  1.00 400.46 ? 107 LYS C C     1 
ATOM   4175 O  O     . LYS B 2 130 ? 21.997  31.226  33.076  1.00 410.00 ? 107 LYS C O     1 
ATOM   4176 C  CB    . LYS B 2 130 ? 22.584  27.906  34.490  1.00 362.63 ? 107 LYS C CB    1 
ATOM   4177 N  N     . PHE B 2 131 ? 22.236  30.483  35.194  1.00 400.73 ? 108 PHE C N     1 
ATOM   4178 C  CA    . PHE B 2 131 ? 21.925  31.766  35.831  1.00 402.09 ? 108 PHE C CA    1 
ATOM   4179 C  C     . PHE B 2 131 ? 20.520  32.290  35.497  1.00 408.20 ? 108 PHE C C     1 
ATOM   4180 O  O     . PHE B 2 131 ? 20.309  33.498  35.332  1.00 409.20 ? 108 PHE C O     1 
ATOM   4181 C  CB    . PHE B 2 131 ? 22.980  32.816  35.470  1.00 404.35 ? 108 PHE C CB    1 
ATOM   4182 C  CG    . PHE B 2 131 ? 23.759  33.307  36.639  1.00 389.02 ? 108 PHE C CG    1 
ATOM   4183 C  CD1   . PHE B 2 131 ? 23.544  32.774  37.895  1.00 385.31 ? 108 PHE C CD1   1 
ATOM   4184 C  CD2   . PHE B 2 131 ? 24.698  34.315  36.490  1.00 382.02 ? 108 PHE C CD2   1 
ATOM   4185 C  CE1   . PHE B 2 131 ? 24.252  33.230  38.978  1.00 373.77 ? 108 PHE C CE1   1 
ATOM   4186 C  CE2   . PHE B 2 131 ? 25.410  34.779  37.575  1.00 391.65 ? 108 PHE C CE2   1 
ATOM   4187 C  CZ    . PHE B 2 131 ? 25.188  34.233  38.824  1.00 385.52 ? 108 PHE C CZ    1 
ATOM   4188 N  N     . LEU B 2 142 ? 11.253  26.156  13.560  1.00 474.11 ? 119 LEU C N     1 
ATOM   4189 C  CA    . LEU B 2 142 ? 11.709  26.341  12.180  1.00 480.34 ? 119 LEU C CA    1 
ATOM   4190 C  C     . LEU B 2 142 ? 12.840  27.397  12.001  1.00 498.29 ? 119 LEU C C     1 
ATOM   4191 O  O     . LEU B 2 142 ? 13.855  27.119  11.341  1.00 495.96 ? 119 LEU C O     1 
ATOM   4192 C  CB    . LEU B 2 142 ? 10.516  26.615  11.232  1.00 486.29 ? 119 LEU C CB    1 
ATOM   4193 C  CG    . LEU B 2 142 ? 9.893   28.022  11.138  1.00 489.43 ? 119 LEU C CG    1 
ATOM   4194 C  CD1   . LEU B 2 142 ? 9.084   28.201  9.854   1.00 496.97 ? 119 LEU C CD1   1 
ATOM   4195 C  CD2   . LEU B 2 142 ? 9.047   28.387  12.362  1.00 488.72 ? 119 LEU C CD2   1 
ATOM   4196 N  N     . HIS B 2 143 ? 12.661  28.578  12.605  1.00 495.23 ? 120 HIS C N     1 
ATOM   4197 C  CA    . HIS B 2 143 ? 13.511  29.766  12.382  1.00 490.49 ? 120 HIS C CA    1 
ATOM   4198 C  C     . HIS B 2 143 ? 15.019  29.513  12.281  1.00 487.13 ? 120 HIS C C     1 
ATOM   4199 O  O     . HIS B 2 143 ? 15.601  29.652  11.204  1.00 492.29 ? 120 HIS C O     1 
ATOM   4200 C  CB    . HIS B 2 143 ? 13.240  30.828  13.457  1.00 485.58 ? 120 HIS C CB    1 
ATOM   4201 N  N     . GLY B 2 144 ? 15.644  29.156  13.402  1.00 480.66 ? 121 GLY C N     1 
ATOM   4202 C  CA    . GLY B 2 144 ? 17.061  28.831  13.427  1.00 475.93 ? 121 GLY C CA    1 
ATOM   4203 C  C     . GLY B 2 144 ? 17.398  27.515  12.751  1.00 478.14 ? 121 GLY C C     1 
ATOM   4204 O  O     . GLY B 2 144 ? 17.475  27.453  11.529  1.00 483.22 ? 121 GLY C O     1 
ATOM   4205 N  N     . VAL B 2 145 ? 17.607  26.469  13.556  1.00 476.06 ? 122 VAL C N     1 
ATOM   4206 C  CA    . VAL B 2 145 ? 17.974  25.099  13.111  1.00 477.57 ? 122 VAL C CA    1 
ATOM   4207 C  C     . VAL B 2 145 ? 19.240  25.026  12.247  1.00 473.98 ? 122 VAL C C     1 
ATOM   4208 O  O     . VAL B 2 145 ? 19.657  23.949  11.809  1.00 471.20 ? 122 VAL C O     1 
ATOM   4209 C  CB    . VAL B 2 145 ? 16.781  24.293  12.488  1.00 449.67 ? 122 VAL C CB    1 
ATOM   4210 C  CG1   . VAL B 2 145 ? 16.650  24.560  10.982  1.00 458.82 ? 122 VAL C CG1   1 
ATOM   4211 C  CG2   . VAL B 2 145 ? 16.918  22.785  12.800  1.00 448.84 ? 122 VAL C CG2   1 
ATOM   4212 N  N     . GLY B 2 146 ? 19.847  26.189  12.025  1.00 478.36 ? 123 GLY C N     1 
ATOM   4213 C  CA    . GLY B 2 146 ? 21.183  26.276  11.474  1.00 477.20 ? 123 GLY C CA    1 
ATOM   4214 C  C     . GLY B 2 146 ? 22.131  26.030  12.628  1.00 467.95 ? 123 GLY C C     1 
ATOM   4215 O  O     . GLY B 2 146 ? 22.290  26.882  13.515  1.00 461.55 ? 123 GLY C O     1 
ATOM   4216 N  N     . SER B 2 147 ? 22.731  24.844  12.622  1.00 464.63 ? 124 SER C N     1 
ATOM   4217 C  CA    . SER B 2 147 ? 23.617  24.392  13.691  1.00 459.28 ? 124 SER C CA    1 
ATOM   4218 C  C     . SER B 2 147 ? 22.912  24.210  15.037  1.00 472.57 ? 124 SER C C     1 
ATOM   4219 O  O     . SER B 2 147 ? 23.150  24.938  15.996  1.00 476.52 ? 124 SER C O     1 
ATOM   4220 C  CB    . SER B 2 147 ? 24.848  25.294  13.833  1.00 452.09 ? 124 SER C CB    1 
ATOM   4221 N  N     . SER B 2 148 ? 22.016  23.238  15.080  1.00 482.63 ? 125 SER C N     1 
ATOM   4222 C  CA    . SER B 2 148 ? 21.631  22.626  16.328  1.00 487.83 ? 125 SER C CA    1 
ATOM   4223 C  C     . SER B 2 148 ? 22.576  21.450  16.384  1.00 490.55 ? 125 SER C C     1 
ATOM   4224 O  O     . SER B 2 148 ? 22.463  20.534  15.575  1.00 499.52 ? 125 SER C O     1 
ATOM   4225 C  CB    . SER B 2 148 ? 20.186  22.140  16.252  1.00 492.96 ? 125 SER C CB    1 
ATOM   4226 O  OG    . SER B 2 148 ? 19.856  21.323  17.362  1.00 490.50 ? 125 SER C OG    1 
ATOM   4227 N  N     . VAL B 2 149 ? 23.534  21.473  17.303  1.00 479.91 ? 126 VAL C N     1 
ATOM   4228 C  CA    . VAL B 2 149 ? 24.589  20.461  17.291  1.00 466.09 ? 126 VAL C CA    1 
ATOM   4229 C  C     . VAL B 2 149 ? 24.066  19.025  17.464  1.00 454.47 ? 126 VAL C C     1 
ATOM   4230 O  O     . VAL B 2 149 ? 24.760  18.063  17.128  1.00 451.36 ? 126 VAL C O     1 
ATOM   4231 C  CB    . VAL B 2 149 ? 25.760  20.808  18.257  1.00 412.66 ? 126 VAL C CB    1 
ATOM   4232 C  CG1   . VAL B 2 149 ? 25.614  22.241  18.754  1.00 415.58 ? 126 VAL C CG1   1 
ATOM   4233 C  CG2   . VAL B 2 149 ? 25.859  19.815  19.425  1.00 403.86 ? 126 VAL C CG2   1 
ATOM   4234 N  N     . VAL B 2 150 ? 22.835  18.878  17.945  1.00 448.69 ? 127 VAL C N     1 
ATOM   4235 C  CA    . VAL B 2 150 ? 22.207  17.557  17.934  1.00 448.23 ? 127 VAL C CA    1 
ATOM   4236 C  C     . VAL B 2 150 ? 21.656  17.200  16.560  1.00 473.64 ? 127 VAL C C     1 
ATOM   4237 O  O     . VAL B 2 150 ? 21.921  16.112  16.048  1.00 478.93 ? 127 VAL C O     1 
ATOM   4238 C  CB    . VAL B 2 150 ? 21.091  17.385  18.995  1.00 432.44 ? 127 VAL C CB    1 
ATOM   4239 C  CG1   . VAL B 2 150 ? 21.711  17.123  20.353  1.00 416.68 ? 127 VAL C CG1   1 
ATOM   4240 C  CG2   . VAL B 2 150 ? 20.152  18.583  19.007  1.00 436.06 ? 127 VAL C CG2   1 
ATOM   4241 N  N     . ASN B 2 151 ? 20.896  18.123  15.976  1.00 490.59 ? 128 ASN C N     1 
ATOM   4242 C  CA    . ASN B 2 151 ? 20.277  17.924  14.678  1.00 501.81 ? 128 ASN C CA    1 
ATOM   4243 C  C     . ASN B 2 151 ? 21.316  17.440  13.688  1.00 508.10 ? 128 ASN C C     1 
ATOM   4244 O  O     . ASN B 2 151 ? 21.067  16.536  12.886  1.00 512.44 ? 128 ASN C O     1 
ATOM   4245 C  CB    . ASN B 2 151 ? 19.672  19.236  14.197  1.00 499.19 ? 128 ASN C CB    1 
ATOM   4246 C  CG    . ASN B 2 151 ? 18.806  19.064  12.980  1.00 495.43 ? 128 ASN C CG    1 
ATOM   4247 O  OD1   . ASN B 2 151 ? 18.100  18.064  12.851  1.00 493.37 ? 128 ASN C OD1   1 
ATOM   4248 N  ND2   . ASN B 2 151 ? 18.854  20.040  12.071  1.00 494.66 ? 128 ASN C ND2   1 
ATOM   4249 N  N     . ALA B 2 152 ? 22.500  18.039  13.785  1.00 504.79 ? 129 ALA C N     1 
ATOM   4250 C  CA    . ALA B 2 152 ? 23.647  17.679  12.966  1.00 499.71 ? 129 ALA C CA    1 
ATOM   4251 C  C     . ALA B 2 152 ? 24.151  16.282  13.284  1.00 497.59 ? 129 ALA C C     1 
ATOM   4252 O  O     . ALA B 2 152 ? 24.637  15.583  12.404  1.00 497.17 ? 129 ALA C O     1 
ATOM   4253 C  CB    . ALA B 2 152 ? 24.756  18.679  13.178  1.00 491.09 ? 129 ALA C CB    1 
ATOM   4254 N  N     . LEU B 2 153 ? 24.026  15.875  14.543  1.00 494.33 ? 130 LEU C N     1 
ATOM   4255 C  CA    . LEU B 2 153 ? 24.598  14.615  15.002  1.00 483.61 ? 130 LEU C CA    1 
ATOM   4256 C  C     . LEU B 2 153 ? 23.556  13.523  15.267  1.00 491.53 ? 130 LEU C C     1 
ATOM   4257 O  O     . LEU B 2 153 ? 23.783  12.635  16.083  1.00 481.39 ? 130 LEU C O     1 
ATOM   4258 C  CB    . LEU B 2 153 ? 25.417  14.852  16.266  1.00 457.25 ? 130 LEU C CB    1 
ATOM   4259 C  CG    . LEU B 2 153 ? 26.856  15.345  16.099  1.00 430.82 ? 130 LEU C CG    1 
ATOM   4260 C  CD1   . LEU B 2 153 ? 26.931  16.624  15.293  1.00 431.20 ? 130 LEU C CD1   1 
ATOM   4261 C  CD2   . LEU B 2 153 ? 27.504  15.543  17.457  1.00 409.07 ? 130 LEU C CD2   1 
ATOM   4262 N  N     . SER B 2 154 ? 22.427  13.566  14.572  1.00 506.21 ? 131 SER C N     1 
ATOM   4263 C  CA    . SER B 2 154 ? 21.347  12.628  14.851  1.00 508.22 ? 131 SER C CA    1 
ATOM   4264 C  C     . SER B 2 154 ? 20.897  11.887  13.601  1.00 503.19 ? 131 SER C C     1 
ATOM   4265 O  O     . SER B 2 154 ? 20.818  12.477  12.531  1.00 507.23 ? 131 SER C O     1 
ATOM   4266 C  CB    . SER B 2 154 ? 20.155  13.374  15.454  1.00 515.45 ? 131 SER C CB    1 
ATOM   4267 O  OG    . SER B 2 154 ? 19.664  14.357  14.553  1.00 522.75 ? 131 SER C OG    1 
ATOM   4268 N  N     . SER B 2 155 ? 20.597  10.596  13.744  1.00 490.38 ? 132 SER C N     1 
ATOM   4269 C  CA    . SER B 2 155 ? 20.022  9.810   12.655  1.00 481.60 ? 132 SER C CA    1 
ATOM   4270 C  C     . SER B 2 155 ? 18.776  10.519  12.178  1.00 477.23 ? 132 SER C C     1 
ATOM   4271 O  O     . SER B 2 155 ? 18.782  11.162  11.140  1.00 473.86 ? 132 SER C O     1 
ATOM   4272 C  CB    . SER B 2 155 ? 19.657  8.403   13.125  1.00 477.28 ? 132 SER C CB    1 
ATOM   4273 O  OG    . SER B 2 155 ? 20.808  7.642   13.435  1.00 472.26 ? 132 SER C OG    1 
ATOM   4274 N  N     . TRP B 2 156 ? 17.702  10.400  12.947  1.00 478.20 ? 133 TRP C N     1 
ATOM   4275 C  CA    . TRP B 2 156 ? 16.562  11.278  12.763  1.00 485.06 ? 133 TRP C CA    1 
ATOM   4276 C  C     . TRP B 2 156 ? 16.396  12.111  14.005  1.00 487.96 ? 133 TRP C C     1 
ATOM   4277 O  O     . TRP B 2 156 ? 16.928  11.780  15.061  1.00 489.81 ? 133 TRP C O     1 
ATOM   4278 C  CB    . TRP B 2 156 ? 15.278  10.503  12.488  1.00 482.57 ? 133 TRP C CB    1 
ATOM   4279 C  CG    . TRP B 2 156 ? 15.009  9.399   13.440  1.00 471.89 ? 133 TRP C CG    1 
ATOM   4280 C  CD1   . TRP B 2 156 ? 15.234  8.074   13.227  1.00 464.92 ? 133 TRP C CD1   1 
ATOM   4281 C  CD2   . TRP B 2 156 ? 14.452  9.506   14.757  1.00 468.43 ? 133 TRP C CD2   1 
ATOM   4282 N  NE1   . TRP B 2 156 ? 14.858  7.346   14.328  1.00 458.45 ? 133 TRP C NE1   1 
ATOM   4283 C  CE2   . TRP B 2 156 ? 14.375  8.201   15.282  1.00 460.63 ? 133 TRP C CE2   1 
ATOM   4284 C  CE3   . TRP B 2 156 ? 14.013  10.577  15.543  1.00 471.85 ? 133 TRP C CE3   1 
ATOM   4285 C  CZ2   . TRP B 2 156 ? 13.875  7.936   16.564  1.00 458.54 ? 133 TRP C CZ2   1 
ATOM   4286 C  CZ3   . TRP B 2 156 ? 13.521  10.312  16.820  1.00 468.59 ? 133 TRP C CZ3   1 
ATOM   4287 C  CH2   . TRP B 2 156 ? 13.458  9.003   17.314  1.00 462.17 ? 133 TRP C CH2   1 
ATOM   4288 N  N     . LEU B 2 157 ? 15.672  13.210  13.869  1.00 485.36 ? 134 LEU C N     1 
ATOM   4289 C  CA    . LEU B 2 157 ? 15.260  13.981  15.028  1.00 472.06 ? 134 LEU C CA    1 
ATOM   4290 C  C     . LEU B 2 157 ? 13.866  14.499  14.767  1.00 468.02 ? 134 LEU C C     1 
ATOM   4291 O  O     . LEU B 2 157 ? 13.617  15.183  13.779  1.00 472.80 ? 134 LEU C O     1 
ATOM   4292 C  CB    . LEU B 2 157 ? 16.225  15.126  15.334  1.00 464.48 ? 134 LEU C CB    1 
ATOM   4293 C  CG    . LEU B 2 157 ? 15.808  16.017  16.508  1.00 452.36 ? 134 LEU C CG    1 
ATOM   4294 C  CD1   . LEU B 2 157 ? 17.000  16.393  17.369  1.00 441.80 ? 134 LEU C CD1   1 
ATOM   4295 C  CD2   . LEU B 2 157 ? 15.125  17.276  16.007  1.00 454.20 ? 134 LEU C CD2   1 
ATOM   4296 N  N     . GLU B 2 158 ? 12.950  14.132  15.650  1.00 458.18 ? 135 GLU C N     1 
ATOM   4297 C  CA    . GLU B 2 158 ? 11.582  14.585  15.567  1.00 457.47 ? 135 GLU C CA    1 
ATOM   4298 C  C     . GLU B 2 158 ? 11.456  15.649  16.632  1.00 451.28 ? 135 GLU C C     1 
ATOM   4299 O  O     . GLU B 2 158 ? 12.004  15.510  17.730  1.00 445.33 ? 135 GLU C O     1 
ATOM   4300 C  CB    . GLU B 2 158 ? 10.602  13.425  15.809  1.00 457.63 ? 135 GLU C CB    1 
ATOM   4301 N  N     . VAL B 2 159 ? 10.764  16.726  16.281  1.00 454.36 ? 136 VAL C N     1 
ATOM   4302 C  CA    . VAL B 2 159 ? 10.534  17.848  17.179  1.00 457.35 ? 136 VAL C CA    1 
ATOM   4303 C  C     . VAL B 2 159 ? 9.044   18.242  17.154  1.00 462.99 ? 136 VAL C C     1 
ATOM   4304 O  O     . VAL B 2 159 ? 8.358   18.107  16.121  1.00 469.30 ? 136 VAL C O     1 
ATOM   4305 C  CB    . VAL B 2 159 ? 11.436  19.036  16.825  1.00 464.39 ? 136 VAL C CB    1 
ATOM   4306 C  CG1   . VAL B 2 159 ? 10.830  19.862  15.702  1.00 478.19 ? 136 VAL C CG1   1 
ATOM   4307 C  CG2   . VAL B 2 159 ? 11.660  19.868  18.040  1.00 459.20 ? 136 VAL C CG2   1 
ATOM   4308 N  N     . GLU B 2 160 ? 8.534   18.685  18.302  1.00 462.31 ? 137 GLU C N     1 
ATOM   4309 C  CA    . GLU B 2 160 ? 7.108   18.981  18.425  1.00 468.40 ? 137 GLU C CA    1 
ATOM   4310 C  C     . GLU B 2 160 ? 6.838   20.083  19.456  1.00 465.65 ? 137 GLU C C     1 
ATOM   4311 O  O     . GLU B 2 160 ? 7.386   20.055  20.560  1.00 461.47 ? 137 GLU C O     1 
ATOM   4312 C  CB    . GLU B 2 160 ? 6.307   17.708  18.750  1.00 470.97 ? 137 GLU C CB    1 
ATOM   4313 N  N     . ILE B 2 161 ? 6.003   21.059  19.074  1.00 471.39 ? 138 ILE C N     1 
ATOM   4314 C  CA    . ILE B 2 161 ? 5.601   22.153  19.962  1.00 479.19 ? 138 ILE C CA    1 
ATOM   4315 C  C     . ILE B 2 161 ? 4.098   22.211  20.120  1.00 483.49 ? 138 ILE C C     1 
ATOM   4316 O  O     . ILE B 2 161 ? 3.366   22.191  19.133  1.00 490.13 ? 138 ILE C O     1 
ATOM   4317 C  CB    . ILE B 2 161 ? 5.978   23.546  19.413  1.00 491.78 ? 138 ILE C CB    1 
ATOM   4318 C  CG1   . ILE B 2 161 ? 7.385   23.566  18.834  1.00 494.03 ? 138 ILE C CG1   1 
ATOM   4319 C  CG2   . ILE B 2 161 ? 5.830   24.589  20.501  1.00 492.94 ? 138 ILE C CG2   1 
ATOM   4320 C  CD1   . ILE B 2 161 ? 7.431   24.138  17.438  1.00 499.73 ? 138 ILE C CD1   1 
ATOM   4321 N  N     . THR B 2 162 ? 3.641   22.317  21.365  1.00 480.95 ? 139 THR C N     1 
ATOM   4322 C  CA    . THR B 2 162 ? 2.238   22.587  21.639  1.00 487.62 ? 139 THR C CA    1 
ATOM   4323 C  C     . THR B 2 162 ? 2.117   24.035  22.115  1.00 484.94 ? 139 THR C C     1 
ATOM   4324 O  O     . THR B 2 162 ? 2.624   24.378  23.173  1.00 482.94 ? 139 THR C O     1 
ATOM   4325 C  CB    . THR B 2 162 ? 1.687   21.626  22.703  1.00 493.30 ? 139 THR C CB    1 
ATOM   4326 O  OG1   . THR B 2 162 ? 2.613   20.548  22.899  1.00 493.91 ? 139 THR C OG1   1 
ATOM   4327 C  CG2   . THR B 2 162 ? 0.365   21.047  22.259  1.00 500.14 ? 139 THR C CG2   1 
ATOM   4328 N  N     . ARG B 2 163 ? 1.472   24.885  21.321  1.00 487.14 ? 140 ARG C N     1 
ATOM   4329 C  CA    . ARG B 2 163 ? 1.392   26.313  21.630  1.00 490.88 ? 140 ARG C CA    1 
ATOM   4330 C  C     . ARG B 2 163 ? 0.158   26.987  21.033  1.00 498.44 ? 140 ARG C C     1 
ATOM   4331 O  O     . ARG B 2 163 ? -0.229  26.703  19.898  1.00 503.52 ? 140 ARG C O     1 
ATOM   4332 C  CB    . ARG B 2 163 ? 2.651   27.035  21.146  1.00 499.24 ? 140 ARG C CB    1 
ATOM   4333 N  N     . ASP B 2 164 ? -0.444  27.877  21.824  1.00 502.09 ? 141 ASP C N     1 
ATOM   4334 C  CA    . ASP B 2 164 ? -1.602  28.696  21.426  1.00 505.49 ? 141 ASP C CA    1 
ATOM   4335 C  C     . ASP B 2 164 ? -2.943  27.943  21.297  1.00 508.06 ? 141 ASP C C     1 
ATOM   4336 O  O     . ASP B 2 164 ? -4.009  28.538  21.469  1.00 508.56 ? 141 ASP C O     1 
ATOM   4337 C  CB    . ASP B 2 164 ? -1.307  29.530  20.164  1.00 504.88 ? 141 ASP C CB    1 
ATOM   4338 N  N     . GLY B 2 165 ? -2.896  26.646  21.010  1.00 509.29 ? 142 GLY C N     1 
ATOM   4339 C  CA    . GLY B 2 165 ? -4.116  25.884  20.825  1.00 510.63 ? 142 GLY C CA    1 
ATOM   4340 C  C     . GLY B 2 165 ? -4.008  24.875  19.702  1.00 513.67 ? 142 GLY C C     1 
ATOM   4341 O  O     . GLY B 2 165 ? -5.007  24.296  19.269  1.00 516.43 ? 142 GLY C O     1 
ATOM   4342 N  N     . ALA B 2 166 ? -2.780  24.669  19.234  1.00 512.54 ? 143 ALA C N     1 
ATOM   4343 C  CA    . ALA B 2 166 ? -2.483  23.671  18.211  1.00 512.46 ? 143 ALA C CA    1 
ATOM   4344 C  C     . ALA B 2 166 ? -1.221  22.896  18.592  1.00 514.00 ? 143 ALA C C     1 
ATOM   4345 O  O     . ALA B 2 166 ? -0.551  23.218  19.572  1.00 513.07 ? 143 ALA C O     1 
ATOM   4346 C  CB    . ALA B 2 166 ? -2.305  24.342  16.855  1.00 513.20 ? 143 ALA C CB    1 
ATOM   4347 N  N     . VAL B 2 167 ? -0.901  21.865  17.825  1.00 514.65 ? 144 VAL C N     1 
ATOM   4348 C  CA    . VAL B 2 167 ? 0.368   21.178  18.034  1.00 507.98 ? 144 VAL C CA    1 
ATOM   4349 C  C     . VAL B 2 167 ? 1.068   20.914  16.694  1.00 506.78 ? 144 VAL C C     1 
ATOM   4350 O  O     . VAL B 2 167 ? 0.457   20.461  15.723  1.00 508.40 ? 144 VAL C O     1 
ATOM   4351 C  CB    . VAL B 2 167 ? 0.209   19.902  18.917  1.00 496.77 ? 144 VAL C CB    1 
ATOM   4352 C  CG1   . VAL B 2 167 ? -0.742  18.890  18.282  1.00 493.92 ? 144 VAL C CG1   1 
ATOM   4353 C  CG2   . VAL B 2 167 ? 1.556   19.280  19.228  1.00 495.99 ? 144 VAL C CG2   1 
ATOM   4354 N  N     . TYR B 2 168 ? 2.350   21.248  16.643  1.00 502.03 ? 145 TYR C N     1 
ATOM   4355 C  CA    . TYR B 2 168 ? 3.115   21.189  15.410  1.00 500.48 ? 145 TYR C CA    1 
ATOM   4356 C  C     . TYR B 2 168 ? 4.227   20.179  15.561  1.00 495.18 ? 145 TYR C C     1 
ATOM   4357 O  O     . TYR B 2 168 ? 4.816   20.057  16.629  1.00 493.37 ? 145 TYR C O     1 
ATOM   4358 C  CB    . TYR B 2 168 ? 3.699   22.564  15.076  1.00 500.12 ? 145 TYR C CB    1 
ATOM   4359 C  CG    . TYR B 2 168 ? 2.652   23.644  14.957  1.00 507.91 ? 145 TYR C CG    1 
ATOM   4360 C  CD1   . TYR B 2 168 ? 2.265   24.390  16.063  1.00 507.03 ? 145 TYR C CD1   1 
ATOM   4361 C  CD2   . TYR B 2 168 ? 2.039   23.909  13.744  1.00 514.13 ? 145 TYR C CD2   1 
ATOM   4362 C  CE1   . TYR B 2 168 ? 1.294   25.374  15.957  1.00 511.39 ? 145 TYR C CE1   1 
ATOM   4363 C  CE2   . TYR B 2 168 ? 1.068   24.891  13.630  1.00 514.87 ? 145 TYR C CE2   1 
ATOM   4364 C  CZ    . TYR B 2 168 ? 0.700   25.622  14.738  1.00 513.16 ? 145 TYR C CZ    1 
ATOM   4365 O  OH    . TYR B 2 168 ? -0.262  26.601  14.621  1.00 513.54 ? 145 TYR C OH    1 
ATOM   4366 N  N     . LYS B 2 169 ? 4.503   19.447  14.491  1.00 494.97 ? 146 LYS C N     1 
ATOM   4367 C  CA    . LYS B 2 169 ? 5.580   18.467  14.499  1.00 495.29 ? 146 LYS C CA    1 
ATOM   4368 C  C     . LYS B 2 169 ? 6.391   18.655  13.236  1.00 504.81 ? 146 LYS C C     1 
ATOM   4369 O  O     . LYS B 2 169 ? 5.885   19.170  12.234  1.00 513.45 ? 146 LYS C O     1 
ATOM   4370 C  CB    . LYS B 2 169 ? 5.031   17.031  14.563  1.00 494.65 ? 146 LYS C CB    1 
ATOM   4371 N  N     . GLN B 2 170 ? 7.653   18.251  13.295  1.00 504.87 ? 147 GLN C N     1 
ATOM   4372 C  CA    . GLN B 2 170 ? 8.523   18.241  12.129  1.00 512.00 ? 147 GLN C CA    1 
ATOM   4373 C  C     . GLN B 2 170 ? 9.709   17.340  12.428  1.00 508.48 ? 147 GLN C C     1 
ATOM   4374 O  O     . GLN B 2 170 ? 10.204  17.326  13.548  1.00 509.72 ? 147 GLN C O     1 
ATOM   4375 C  CB    . GLN B 2 170 ? 8.995   19.658  11.804  1.00 518.35 ? 147 GLN C CB    1 
ATOM   4376 C  CG    . GLN B 2 170 ? 10.240  19.718  10.931  1.00 524.55 ? 147 GLN C CG    1 
ATOM   4377 C  CD    . GLN B 2 170 ? 10.390  21.041  10.226  1.00 532.07 ? 147 GLN C CD    1 
ATOM   4378 O  OE1   . GLN B 2 170 ? 9.629   21.354  9.312   1.00 532.53 ? 147 GLN C OE1   1 
ATOM   4379 N  NE2   . GLN B 2 170 ? 11.369  21.831  10.647  1.00 534.81 ? 147 GLN C NE2   1 
ATOM   4380 N  N     . ARG B 2 171 ? 10.167  16.573  11.445  1.00 502.79 ? 148 ARG C N     1 
ATOM   4381 C  CA    . ARG B 2 171 ? 11.338  15.742  11.678  1.00 489.77 ? 148 ARG C CA    1 
ATOM   4382 C  C     . ARG B 2 171 ? 12.372  15.878  10.581  1.00 490.46 ? 148 ARG C C     1 
ATOM   4383 O  O     . ARG B 2 171 ? 12.077  16.340  9.482   1.00 492.35 ? 148 ARG C O     1 
ATOM   4384 C  CB    . ARG B 2 171 ? 10.956  14.276  11.840  1.00 479.11 ? 148 ARG C CB    1 
ATOM   4385 C  CG    . ARG B 2 171 ? 10.815  13.533  10.530  1.00 481.32 ? 148 ARG C CG    1 
ATOM   4386 C  CD    . ARG B 2 171 ? 11.509  12.182  10.605  1.00 480.84 ? 148 ARG C CD    1 
ATOM   4387 N  NE    . ARG B 2 171 ? 11.138  11.438  11.807  1.00 477.77 ? 148 ARG C NE    1 
ATOM   4388 C  CZ    . ARG B 2 171 ? 11.547  10.202  12.075  1.00 474.59 ? 148 ARG C CZ    1 
ATOM   4389 N  NH1   . ARG B 2 171 ? 12.339  9.562   11.220  1.00 476.99 ? 148 ARG C NH1   1 
ATOM   4390 N  NH2   . ARG B 2 171 ? 11.155  9.606   13.195  1.00 467.73 ? 148 ARG C NH2   1 
ATOM   4391 N  N     . PHE B 2 172 ? 13.591  15.457  10.895  1.00 486.08 ? 149 PHE C N     1 
ATOM   4392 C  CA    . PHE B 2 172 ? 14.704  15.562  9.973   1.00 481.90 ? 149 PHE C CA    1 
ATOM   4393 C  C     . PHE B 2 172 ? 15.471  14.255  10.009  1.00 468.28 ? 149 PHE C C     1 
ATOM   4394 O  O     . PHE B 2 172 ? 15.355  13.496  10.970  1.00 462.12 ? 149 PHE C O     1 
ATOM   4395 C  CB    . PHE B 2 172 ? 15.644  16.690  10.398  1.00 484.12 ? 149 PHE C CB    1 
ATOM   4396 C  CG    . PHE B 2 172 ? 14.943  17.905  10.933  1.00 490.47 ? 149 PHE C CG    1 
ATOM   4397 C  CD1   . PHE B 2 172 ? 14.549  17.968  12.257  1.00 493.85 ? 149 PHE C CD1   1 
ATOM   4398 C  CD2   . PHE B 2 172 ? 14.706  18.995  10.120  1.00 494.33 ? 149 PHE C CD2   1 
ATOM   4399 C  CE1   . PHE B 2 172 ? 13.906  19.083  12.750  1.00 499.06 ? 149 PHE C CE1   1 
ATOM   4400 C  CE2   . PHE B 2 172 ? 14.068  20.118  10.612  1.00 499.40 ? 149 PHE C CE2   1 
ATOM   4401 C  CZ    . PHE B 2 172 ? 13.669  20.160  11.928  1.00 501.69 ? 149 PHE C CZ    1 
ATOM   4402 N  N     . GLU B 2 173 ? 16.265  14.003  8.973   1.00 467.10 ? 150 GLU C N     1 
ATOM   4403 C  CA    . GLU B 2 173 ? 17.152  12.844  8.954   1.00 464.00 ? 150 GLU C CA    1 
ATOM   4404 C  C     . GLU B 2 173 ? 18.635  13.244  8.806   1.00 466.48 ? 150 GLU C C     1 
ATOM   4405 O  O     . GLU B 2 173 ? 18.964  14.219  8.125   1.00 472.66 ? 150 GLU C O     1 
ATOM   4406 C  CB    . GLU B 2 173 ? 16.730  11.865  7.854   1.00 465.30 ? 150 GLU C CB    1 
ATOM   4407 N  N     . ASN B 2 174 ? 19.511  12.477  9.461   1.00 460.46 ? 151 ASN C N     1 
ATOM   4408 C  CA    . ASN B 2 174 ? 20.979  12.652  9.444   1.00 456.36 ? 151 ASN C CA    1 
ATOM   4409 C  C     . ASN B 2 174 ? 21.563  14.066  9.628   1.00 456.09 ? 151 ASN C C     1 
ATOM   4410 O  O     . ASN B 2 174 ? 21.839  14.499  10.751  1.00 453.55 ? 151 ASN C O     1 
ATOM   4411 C  CB    . ASN B 2 174 ? 21.633  11.920  8.255   1.00 456.20 ? 151 ASN C CB    1 
ATOM   4412 C  CG    . ASN B 2 174 ? 20.929  12.182  6.943   1.00 461.40 ? 151 ASN C CG    1 
ATOM   4413 O  OD1   . ASN B 2 174 ? 21.119  13.231  6.323   1.00 466.04 ? 151 ASN C OD1   1 
ATOM   4414 N  ND2   . ASN B 2 174 ? 20.111  11.231  6.510   1.00 462.04 ? 151 ASN C ND2   1 
ATOM   4415 N  N     . GLY B 2 175 ? 21.777  14.770  8.527   1.00 462.67 ? 152 GLY C N     1 
ATOM   4416 C  CA    . GLY B 2 175 ? 22.370  16.087  8.606   1.00 462.65 ? 152 GLY C CA    1 
ATOM   4417 C  C     . GLY B 2 175 ? 21.432  17.062  9.283   1.00 464.42 ? 152 GLY C C     1 
ATOM   4418 O  O     . GLY B 2 175 ? 21.848  18.110  9.784   1.00 465.26 ? 152 GLY C O     1 
ATOM   4419 N  N     . GLY B 2 176 ? 20.153  16.707  9.313   1.00 471.44 ? 153 GLY C N     1 
ATOM   4420 C  CA    . GLY B 2 176 ? 19.133  17.636  9.752   1.00 476.69 ? 153 GLY C CA    1 
ATOM   4421 C  C     . GLY B 2 176 ? 18.447  18.198  8.524   1.00 480.14 ? 153 GLY C C     1 
ATOM   4422 O  O     . GLY B 2 176 ? 17.969  19.333  8.522   1.00 483.83 ? 153 GLY C O     1 
ATOM   4423 N  N     . LYS B 2 177 ? 18.434  17.397  7.460   1.00 477.41 ? 154 LYS C N     1 
ATOM   4424 C  CA    . LYS B 2 177 ? 17.670  17.724  6.266   1.00 483.78 ? 154 LYS C CA    1 
ATOM   4425 C  C     . LYS B 2 177 ? 16.217  17.337  6.519   1.00 486.09 ? 154 LYS C C     1 
ATOM   4426 O  O     . LYS B 2 177 ? 15.904  16.156  6.720   1.00 482.33 ? 154 LYS C O     1 
ATOM   4427 C  CB    . LYS B 2 177 ? 18.227  16.987  5.047   1.00 487.43 ? 154 LYS C CB    1 
ATOM   4428 N  N     . PRO B 2 178 ? 15.325  18.341  6.530   1.00 501.74 ? 155 PRO C N     1 
ATOM   4429 C  CA    . PRO B 2 178 ? 13.896  18.215  6.848   1.00 508.31 ? 155 PRO C CA    1 
ATOM   4430 C  C     . PRO B 2 178 ? 13.117  17.205  5.992   1.00 506.63 ? 155 PRO C C     1 
ATOM   4431 O  O     . PRO B 2 178 ? 12.893  17.423  4.799   1.00 511.52 ? 155 PRO C O     1 
ATOM   4432 C  CB    . PRO B 2 178 ? 13.358  19.639  6.638   1.00 520.39 ? 155 PRO C CB    1 
ATOM   4433 C  CG    . PRO B 2 178 ? 14.405  20.349  5.862   1.00 523.07 ? 155 PRO C CG    1 
ATOM   4434 C  CD    . PRO B 2 178 ? 15.700  19.739  6.273   1.00 512.36 ? 155 PRO C CD    1 
ATOM   4435 N  N     . VAL B 2 179 ? 12.698  16.114  6.625   1.00 500.91 ? 156 VAL C N     1 
ATOM   4436 C  CA    . VAL B 2 179 ? 11.881  15.105  5.970   1.00 506.21 ? 156 VAL C CA    1 
ATOM   4437 C  C     . VAL B 2 179 ? 10.486  15.650  5.649   1.00 520.15 ? 156 VAL C C     1 
ATOM   4438 O  O     . VAL B 2 179 ? 9.882   15.273  4.650   1.00 521.83 ? 156 VAL C O     1 
ATOM   4439 C  CB    . VAL B 2 179 ? 11.770  13.836  6.833   1.00 497.37 ? 156 VAL C CB    1 
ATOM   4440 N  N     . THR B 2 180 ? 9.981   16.542  6.495   1.00 525.56 ? 157 THR C N     1 
ATOM   4441 C  CA    . THR B 2 180 ? 8.718   17.230  6.229   1.00 532.40 ? 157 THR C CA    1 
ATOM   4442 C  C     . THR B 2 180 ? 8.757   18.674  6.742   1.00 535.03 ? 157 THR C C     1 
ATOM   4443 O  O     . THR B 2 180 ? 9.695   19.071  7.445   1.00 537.85 ? 157 THR C O     1 
ATOM   4444 C  CB    . THR B 2 180 ? 7.525   16.499  6.874   1.00 535.35 ? 157 THR C CB    1 
ATOM   4445 N  N     . THR B 2 181 ? 7.745   19.460  6.382   1.00 533.92 ? 158 THR C N     1 
ATOM   4446 C  CA    . THR B 2 181 ? 7.597   20.809  6.927   1.00 533.16 ? 158 THR C CA    1 
ATOM   4447 C  C     . THR B 2 181 ? 6.882   20.765  8.264   1.00 533.21 ? 158 THR C C     1 
ATOM   4448 O  O     . THR B 2 181 ? 6.165   19.813  8.555   1.00 531.73 ? 158 THR C O     1 
ATOM   4449 C  CB    . THR B 2 181 ? 6.769   21.702  6.013   1.00 531.38 ? 158 THR C CB    1 
ATOM   4450 O  OG1   . THR B 2 181 ? 5.799   20.899  5.323   1.00 530.14 ? 158 THR C OG1   1 
ATOM   4451 C  CG2   . THR B 2 181 ? 7.666   22.408  5.011   1.00 531.17 ? 158 THR C CG2   1 
ATOM   4452 N  N     . LEU B 2 182 ? 7.074   21.799  9.074   1.00 531.96 ? 159 LEU C N     1 
ATOM   4453 C  CA    . LEU B 2 182 ? 6.399   21.879  10.356  1.00 523.42 ? 159 LEU C CA    1 
ATOM   4454 C  C     . LEU B 2 182 ? 4.906   22.095  10.150  1.00 517.60 ? 159 LEU C C     1 
ATOM   4455 O  O     . LEU B 2 182 ? 4.482   23.163  9.706   1.00 515.27 ? 159 LEU C O     1 
ATOM   4456 C  CB    . LEU B 2 182 ? 6.972   23.017  11.183  1.00 515.71 ? 159 LEU C CB    1 
ATOM   4457 C  CG    . LEU B 2 182 ? 6.423   23.136  12.601  1.00 500.44 ? 159 LEU C CG    1 
ATOM   4458 C  CD1   . LEU B 2 182 ? 7.342   22.414  13.575  1.00 491.56 ? 159 LEU C CD1   1 
ATOM   4459 C  CD2   . LEU B 2 182 ? 6.259   24.594  12.981  1.00 497.72 ? 159 LEU C CD2   1 
ATOM   4460 N  N     . LYS B 2 183 ? 4.116   21.076  10.481  1.00 515.06 ? 160 LYS C N     1 
ATOM   4461 C  CA    . LYS B 2 183 ? 2.669   21.096  10.253  1.00 516.07 ? 160 LYS C CA    1 
ATOM   4462 C  C     . LYS B 2 183 ? 1.900   20.951  11.559  1.00 515.64 ? 160 LYS C C     1 
ATOM   4463 O  O     . LYS B 2 183 ? 2.429   20.435  12.548  1.00 517.36 ? 160 LYS C O     1 
ATOM   4464 C  CB    . LYS B 2 183 ? 2.254   19.982  9.279   1.00 518.05 ? 160 LYS C CB    1 
ATOM   4465 N  N     . LYS B 2 184 ? 0.655   21.424  11.560  1.00 514.73 ? 161 LYS C N     1 
ATOM   4466 C  CA    . LYS B 2 184 ? -0.226  21.222  12.699  1.00 516.12 ? 161 LYS C CA    1 
ATOM   4467 C  C     . LYS B 2 184 ? -0.699  19.768  12.680  1.00 516.97 ? 161 LYS C C     1 
ATOM   4468 O  O     . LYS B 2 184 ? -1.441  19.362  11.786  1.00 517.82 ? 161 LYS C O     1 
ATOM   4469 C  CB    . LYS B 2 184 ? -1.415  22.188  12.645  1.00 517.68 ? 161 LYS C CB    1 
ATOM   4470 N  N     . ILE B 2 185 ? -0.242  18.970  13.638  1.00 516.59 ? 162 ILE C N     1 
ATOM   4471 C  CA    . ILE B 2 185 ? -0.661  17.573  13.679  1.00 514.92 ? 162 ILE C CA    1 
ATOM   4472 C  C     . ILE B 2 185 ? -1.806  17.336  14.652  1.00 511.99 ? 162 ILE C C     1 
ATOM   4473 O  O     . ILE B 2 185 ? -2.136  16.194  14.953  1.00 505.63 ? 162 ILE C O     1 
ATOM   4474 C  CB    . ILE B 2 185 ? 0.514   16.578  13.946  1.00 483.47 ? 162 ILE C CB    1 
ATOM   4475 C  CG1   . ILE B 2 185 ? 1.275   16.912  15.233  1.00 477.19 ? 162 ILE C CG1   1 
ATOM   4476 C  CG2   . ILE B 2 185 ? 1.463   16.549  12.764  1.00 489.39 ? 162 ILE C CG2   1 
ATOM   4477 C  CD1   . ILE B 2 185 ? 0.810   16.156  16.443  1.00 473.79 ? 162 ILE C CD1   1 
ATOM   4478 N  N     . GLY B 2 186 ? -2.418  18.413  15.136  1.00 513.17 ? 163 GLY C N     1 
ATOM   4479 C  CA    . GLY B 2 186 ? -3.576  18.264  15.997  1.00 512.66 ? 163 GLY C CA    1 
ATOM   4480 C  C     . GLY B 2 186 ? -3.992  19.440  16.864  1.00 513.33 ? 163 GLY C C     1 
ATOM   4481 O  O     . GLY B 2 186 ? -3.351  20.504  16.894  1.00 516.46 ? 163 GLY C O     1 
ATOM   4482 N  N     . THR B 2 187 ? -5.094  19.216  17.581  1.00 511.50 ? 164 THR C N     1 
ATOM   4483 C  CA    . THR B 2 187 ? -5.698  20.200  18.478  1.00 514.82 ? 164 THR C CA    1 
ATOM   4484 C  C     . THR B 2 187 ? -5.087  20.140  19.883  1.00 521.87 ? 164 THR C C     1 
ATOM   4485 O  O     . THR B 2 187 ? -5.007  19.074  20.505  1.00 526.28 ? 164 THR C O     1 
ATOM   4486 C  CB    . THR B 2 187 ? -7.236  20.009  18.573  1.00 500.59 ? 164 THR C CB    1 
ATOM   4487 N  N     . ALA B 2 188 ? -4.661  21.301  20.371  1.00 523.81 ? 165 ALA C N     1 
ATOM   4488 C  CA    . ALA B 2 188 ? -4.018  21.403  21.673  1.00 523.84 ? 165 ALA C CA    1 
ATOM   4489 C  C     . ALA B 2 188 ? -4.963  21.974  22.718  1.00 521.83 ? 165 ALA C C     1 
ATOM   4490 O  O     . ALA B 2 188 ? -5.684  22.937  22.443  1.00 523.96 ? 165 ALA C O     1 
ATOM   4491 C  CB    . ALA B 2 188 ? -2.788  22.266  21.575  1.00 525.45 ? 165 ALA C CB    1 
ATOM   4492 N  N     . PRO B 2 189 ? -4.944  21.389  23.934  1.00 514.65 ? 166 PRO C N     1 
ATOM   4493 C  CA    . PRO B 2 189 ? -5.797  21.800  25.057  1.00 505.18 ? 166 PRO C CA    1 
ATOM   4494 C  C     . PRO B 2 189 ? -5.581  23.260  25.447  1.00 503.18 ? 166 PRO C C     1 
ATOM   4495 O  O     . PRO B 2 189 ? -4.735  23.543  26.296  1.00 498.38 ? 166 PRO C O     1 
ATOM   4496 C  CB    . PRO B 2 189 ? -5.342  20.881  26.199  1.00 499.89 ? 166 PRO C CB    1 
ATOM   4497 C  CG    . PRO B 2 189 ? -4.752  19.700  25.522  1.00 503.07 ? 166 PRO C CG    1 
ATOM   4498 C  CD    . PRO B 2 189 ? -4.090  20.241  24.291  1.00 510.06 ? 166 PRO C CD    1 
ATOM   4499 N  N     . LYS B 2 190 ? -6.344  24.160  24.829  1.00 510.49 ? 167 LYS C N     1 
ATOM   4500 C  CA    . LYS B 2 190 ? -6.271  25.593  25.110  1.00 510.98 ? 167 LYS C CA    1 
ATOM   4501 C  C     . LYS B 2 190 ? -4.886  26.178  24.820  1.00 510.97 ? 167 LYS C C     1 
ATOM   4502 O  O     . LYS B 2 190 ? -4.138  25.652  23.995  1.00 512.57 ? 167 LYS C O     1 
ATOM   4503 C  CB    . LYS B 2 190 ? -6.706  25.895  26.550  1.00 507.05 ? 167 LYS C CB    1 
ATOM   4504 N  N     . SER B 2 191 ? -4.551  27.269  25.502  1.00 508.46 ? 168 SER C N     1 
ATOM   4505 C  CA    . SER B 2 191 ? -3.306  27.982  25.237  1.00 506.08 ? 168 SER C CA    1 
ATOM   4506 C  C     . SER B 2 191 ? -2.072  27.287  25.828  1.00 497.63 ? 168 SER C C     1 
ATOM   4507 O  O     . SER B 2 191 ? -0.947  27.758  25.626  1.00 499.08 ? 168 SER C O     1 
ATOM   4508 C  CB    . SER B 2 191 ? -3.400  29.429  25.737  1.00 504.00 ? 168 SER C CB    1 
ATOM   4509 N  N     . LYS B 2 192 ? -2.290  26.175  26.539  1.00 487.08 ? 169 LYS C N     1 
ATOM   4510 C  CA    . LYS B 2 192 ? -1.215  25.406  27.184  1.00 472.63 ? 169 LYS C CA    1 
ATOM   4511 C  C     . LYS B 2 192 ? -0.014  25.115  26.274  1.00 472.23 ? 169 LYS C C     1 
ATOM   4512 O  O     . LYS B 2 192 ? -0.163  24.575  25.175  1.00 477.54 ? 169 LYS C O     1 
ATOM   4513 C  CB    . LYS B 2 192 ? -1.762  24.093  27.752  1.00 466.55 ? 169 LYS C CB    1 
ATOM   4514 N  N     . THR B 2 193 ? 1.177   25.476  26.751  1.00 464.31 ? 170 THR C N     1 
ATOM   4515 C  CA    . THR B 2 193 ? 2.408   25.345  25.970  1.00 460.12 ? 170 THR C CA    1 
ATOM   4516 C  C     . THR B 2 193 ? 3.335   24.206  26.437  1.00 453.99 ? 170 THR C C     1 
ATOM   4517 O  O     . THR B 2 193 ? 3.287   23.784  27.595  1.00 450.15 ? 170 THR C O     1 
ATOM   4518 C  CB    . THR B 2 193 ? 3.197   26.666  25.947  1.00 462.55 ? 170 THR C CB    1 
ATOM   4519 N  N     . GLY B 2 194 ? 4.176   23.715  25.528  1.00 457.65 ? 171 GLY C N     1 
ATOM   4520 C  CA    . GLY B 2 194 ? 5.160   22.691  25.853  1.00 460.49 ? 171 GLY C CA    1 
ATOM   4521 C  C     . GLY B 2 194 ? 6.059   22.341  24.676  1.00 470.88 ? 171 GLY C C     1 
ATOM   4522 O  O     . GLY B 2 194 ? 5.598   22.320  23.529  1.00 476.35 ? 171 GLY C O     1 
ATOM   4523 N  N     . THR B 2 195 ? 7.337   22.060  24.946  1.00 474.33 ? 172 THR C N     1 
ATOM   4524 C  CA    . THR B 2 195 ? 8.269   21.750  23.844  1.00 483.49 ? 172 THR C CA    1 
ATOM   4525 C  C     . THR B 2 195 ? 8.848   20.341  23.989  1.00 470.78 ? 172 THR C C     1 
ATOM   4526 O  O     . THR B 2 195 ? 9.090   19.901  25.094  1.00 462.53 ? 172 THR C O     1 
ATOM   4527 C  CB    . THR B 2 195 ? 9.416   22.786  23.738  1.00 495.05 ? 172 THR C CB    1 
ATOM   4528 N  N     . LYS B 2 196 ? 9.052   19.621  22.889  1.00 468.79 ? 173 LYS C N     1 
ATOM   4529 C  CA    . LYS B 2 196 ? 9.610   18.266  22.979  1.00 461.61 ? 173 LYS C CA    1 
ATOM   4530 C  C     . LYS B 2 196 ? 10.539  17.913  21.808  1.00 450.01 ? 173 LYS C C     1 
ATOM   4531 O  O     . LYS B 2 196 ? 10.176  18.093  20.633  1.00 448.77 ? 173 LYS C O     1 
ATOM   4532 C  CB    . LYS B 2 196 ? 8.493   17.221  23.109  1.00 469.98 ? 173 LYS C CB    1 
ATOM   4533 N  N     . VAL B 2 197 ? 11.738  17.423  22.144  1.00 441.89 ? 174 VAL C N     1 
ATOM   4534 C  CA    . VAL B 2 197 ? 12.704  16.916  21.158  1.00 442.66 ? 174 VAL C CA    1 
ATOM   4535 C  C     . VAL B 2 197 ? 13.049  15.433  21.413  1.00 440.47 ? 174 VAL C C     1 
ATOM   4536 O  O     . VAL B 2 197 ? 13.463  15.052  22.505  1.00 441.81 ? 174 VAL C O     1 
ATOM   4537 C  CB    . VAL B 2 197 ? 14.011  17.753  21.121  1.00 415.63 ? 174 VAL C CB    1 
ATOM   4538 N  N     . THR B 2 198 ? 12.854  14.595  20.403  1.00 436.09 ? 175 THR C N     1 
ATOM   4539 C  CA    . THR B 2 198 ? 13.304  13.222  20.500  1.00 423.88 ? 175 THR C CA    1 
ATOM   4540 C  C     . THR B 2 198 ? 14.263  12.951  19.342  1.00 423.66 ? 175 THR C C     1 
ATOM   4541 O  O     . THR B 2 198 ? 14.022  13.399  18.223  1.00 432.03 ? 175 THR C O     1 
ATOM   4542 C  CB    . THR B 2 198 ? 12.116  12.242  20.502  1.00 422.08 ? 175 THR C CB    1 
ATOM   4543 O  OG1   . THR B 2 198 ? 12.605  10.900  20.486  1.00 415.50 ? 175 THR C OG1   1 
ATOM   4544 C  CG2   . THR B 2 198 ? 11.216  12.462  19.305  1.00 432.11 ? 175 THR C CG2   1 
ATOM   4545 N  N     . PHE B 2 199 ? 15.367  12.256  19.611  1.00 419.05 ? 176 PHE C N     1 
ATOM   4546 C  CA    . PHE B 2 199 ? 16.377  12.012  18.578  1.00 418.59 ? 176 PHE C CA    1 
ATOM   4547 C  C     . PHE B 2 199 ? 17.171  10.737  18.792  1.00 415.10 ? 176 PHE C C     1 
ATOM   4548 O  O     . PHE B 2 199 ? 17.309  10.250  19.912  1.00 410.73 ? 176 PHE C O     1 
ATOM   4549 C  CB    . PHE B 2 199 ? 17.358  13.173  18.504  1.00 416.79 ? 176 PHE C CB    1 
ATOM   4550 C  CG    . PHE B 2 199 ? 18.383  13.170  19.602  1.00 411.34 ? 176 PHE C CG    1 
ATOM   4551 C  CD1   . PHE B 2 199 ? 18.036  13.528  20.899  1.00 408.26 ? 176 PHE C CD1   1 
ATOM   4552 C  CD2   . PHE B 2 199 ? 19.704  12.822  19.336  1.00 410.87 ? 176 PHE C CD2   1 
ATOM   4553 C  CE1   . PHE B 2 199 ? 18.983  13.528  21.917  1.00 400.47 ? 176 PHE C CE1   1 
ATOM   4554 C  CE2   . PHE B 2 199 ? 20.660  12.823  20.351  1.00 404.78 ? 176 PHE C CE2   1 
ATOM   4555 C  CZ    . PHE B 2 199 ? 20.294  13.172  21.646  1.00 395.77 ? 176 PHE C CZ    1 
ATOM   4556 N  N     . MET B 2 200 ? 17.693  10.201  17.695  1.00 419.25 ? 177 MET C N     1 
ATOM   4557 C  CA    . MET B 2 200 ? 18.577  9.047   17.742  1.00 423.64 ? 177 MET C CA    1 
ATOM   4558 C  C     . MET B 2 200 ? 19.881  9.512   17.123  1.00 433.30 ? 177 MET C C     1 
ATOM   4559 O  O     . MET B 2 200 ? 19.904  9.897   15.959  1.00 450.63 ? 177 MET C O     1 
ATOM   4560 C  CB    . MET B 2 200 ? 17.985  7.854   16.962  1.00 427.06 ? 177 MET C CB    1 
ATOM   4561 C  CG    . MET B 2 200 ? 18.227  6.474   17.593  1.00 423.95 ? 177 MET C CG    1 
ATOM   4562 N  N     . PRO B 2 201 ? 20.962  9.524   17.916  1.00 421.58 ? 178 PRO C N     1 
ATOM   4563 C  CA    . PRO B 2 201 ? 22.301  9.842   17.418  1.00 425.15 ? 178 PRO C CA    1 
ATOM   4564 C  C     . PRO B 2 201 ? 22.659  8.854   16.323  1.00 444.02 ? 178 PRO C C     1 
ATOM   4565 O  O     . PRO B 2 201 ? 22.236  7.697   16.433  1.00 442.06 ? 178 PRO C O     1 
ATOM   4566 C  CB    . PRO B 2 201 ? 23.192  9.591   18.643  1.00 407.95 ? 178 PRO C CB    1 
ATOM   4567 C  CG    . PRO B 2 201 ? 22.396  8.707   19.526  1.00 401.68 ? 178 PRO C CG    1 
ATOM   4568 C  CD    . PRO B 2 201 ? 20.986  9.136   19.334  1.00 406.79 ? 178 PRO C CD    1 
ATOM   4569 N  N     . ASP B 2 202 ? 23.386  9.267   15.285  1.00 461.73 ? 179 ASP C N     1 
ATOM   4570 C  CA    . ASP B 2 202 ? 23.743  8.267   14.277  1.00 469.85 ? 179 ASP C CA    1 
ATOM   4571 C  C     . ASP B 2 202 ? 24.990  7.482   14.666  1.00 465.47 ? 179 ASP C C     1 
ATOM   4572 O  O     . ASP B 2 202 ? 25.952  8.039   15.210  1.00 467.13 ? 179 ASP C O     1 
ATOM   4573 C  CB    . ASP B 2 202 ? 23.714  8.778   12.810  1.00 472.88 ? 179 ASP C CB    1 
ATOM   4574 C  CG    . ASP B 2 202 ? 24.938  9.593   12.409  1.00 468.29 ? 179 ASP C CG    1 
ATOM   4575 O  OD1   . ASP B 2 202 ? 25.922  9.661   13.165  1.00 465.51 ? 179 ASP C OD1   1 
ATOM   4576 O  OD2   . ASP B 2 202 ? 24.912  10.159  11.294  1.00 466.42 ? 179 ASP C OD2   1 
ATOM   4577 N  N     . ALA B 2 203 ? 24.930  6.174   14.426  1.00 457.54 ? 180 ALA C N     1 
ATOM   4578 C  CA    . ALA B 2 203 ? 25.994  5.262   14.823  1.00 445.30 ? 180 ALA C CA    1 
ATOM   4579 C  C     . ALA B 2 203 ? 27.188  5.372   13.880  1.00 443.13 ? 180 ALA C C     1 
ATOM   4580 O  O     . ALA B 2 203 ? 28.078  4.519   13.883  1.00 434.35 ? 180 ALA C O     1 
ATOM   4581 C  CB    . ALA B 2 203 ? 25.477  3.831   14.875  1.00 441.22 ? 180 ALA C CB    1 
ATOM   4582 N  N     . THR B 2 204 ? 27.191  6.427   13.069  1.00 451.81 ? 181 THR C N     1 
ATOM   4583 C  CA    . THR B 2 204 ? 28.305  6.725   12.192  1.00 452.25 ? 181 THR C CA    1 
ATOM   4584 C  C     . THR B 2 204 ? 29.310  7.544   12.973  1.00 454.25 ? 181 THR C C     1 
ATOM   4585 O  O     . THR B 2 204 ? 30.408  7.078   13.292  1.00 453.58 ? 181 THR C O     1 
ATOM   4586 C  CB    . THR B 2 204 ? 27.849  7.565   11.002  1.00 450.00 ? 181 THR C CB    1 
ATOM   4587 O  OG1   . THR B 2 204 ? 26.701  6.956   10.405  1.00 453.60 ? 181 THR C OG1   1 
ATOM   4588 C  CG2   . THR B 2 204 ? 28.969  7.687   9.970   1.00 444.72 ? 181 THR C CG2   1 
ATOM   4589 N  N     . ILE B 2 205 ? 28.910  8.773   13.289  1.00 455.85 ? 182 ILE C N     1 
ATOM   4590 C  CA    . ILE B 2 205 ? 29.787  9.721   13.960  1.00 452.88 ? 182 ILE C CA    1 
ATOM   4591 C  C     . ILE B 2 205 ? 29.903  9.383   15.447  1.00 448.24 ? 182 ILE C C     1 
ATOM   4592 O  O     . ILE B 2 205 ? 30.780  9.900   16.147  1.00 439.39 ? 182 ILE C O     1 
ATOM   4593 C  CB    . ILE B 2 205 ? 29.341  11.197  13.715  1.00 437.25 ? 182 ILE C CB    1 
ATOM   4594 C  CG1   . ILE B 2 205 ? 28.644  11.786  14.937  1.00 429.37 ? 182 ILE C CG1   1 
ATOM   4595 C  CG2   . ILE B 2 205 ? 28.462  11.310  12.469  1.00 448.01 ? 182 ILE C CG2   1 
ATOM   4596 C  CD1   . ILE B 2 205 ? 29.495  12.815  15.660  1.00 420.09 ? 182 ILE C CD1   1 
ATOM   4597 N  N     . PHE B 2 206 ? 29.031  8.495   15.915  1.00 452.13 ? 183 PHE C N     1 
ATOM   4598 C  CA    . PHE B 2 206 ? 29.105  7.992   17.284  1.00 441.51 ? 183 PHE C CA    1 
ATOM   4599 C  C     . PHE B 2 206 ? 29.393  6.496   17.302  1.00 442.30 ? 183 PHE C C     1 
ATOM   4600 O  O     . PHE B 2 206 ? 28.802  5.742   16.536  1.00 446.40 ? 183 PHE C O     1 
ATOM   4601 C  CB    . PHE B 2 206 ? 27.810  8.291   18.052  1.00 425.45 ? 183 PHE C CB    1 
ATOM   4602 C  CG    . PHE B 2 206 ? 27.741  9.688   18.594  1.00 402.96 ? 183 PHE C CG    1 
ATOM   4603 C  CD1   . PHE B 2 206 ? 28.496  10.054  19.696  1.00 388.49 ? 183 PHE C CD1   1 
ATOM   4604 C  CD2   . PHE B 2 206 ? 26.935  10.640  17.997  1.00 399.45 ? 183 PHE C CD2   1 
ATOM   4605 C  CE1   . PHE B 2 206 ? 28.442  11.340  20.197  1.00 378.73 ? 183 PHE C CE1   1 
ATOM   4606 C  CE2   . PHE B 2 206 ? 26.877  11.932  18.497  1.00 395.51 ? 183 PHE C CE2   1 
ATOM   4607 C  CZ    . PHE B 2 206 ? 27.631  12.279  19.598  1.00 385.45 ? 183 PHE C CZ    1 
ATOM   4608 N  N     . SER B 2 207 ? 30.299  6.074   18.182  1.00 434.75 ? 184 SER C N     1 
ATOM   4609 C  CA    . SER B 2 207 ? 30.639  4.657   18.327  1.00 425.08 ? 184 SER C CA    1 
ATOM   4610 C  C     . SER B 2 207 ? 29.730  3.907   19.311  1.00 412.70 ? 184 SER C C     1 
ATOM   4611 O  O     . SER B 2 207 ? 29.647  2.681   19.275  1.00 411.63 ? 184 SER C O     1 
ATOM   4612 C  CB    . SER B 2 207 ? 32.102  4.506   18.743  1.00 420.65 ? 184 SER C CB    1 
ATOM   4613 O  OG    . SER B 2 207 ? 32.455  5.489   19.698  1.00 415.72 ? 184 SER C OG    1 
ATOM   4614 N  N     . THR B 2 208 ? 29.057  4.655   20.184  1.00 400.91 ? 185 THR C N     1 
ATOM   4615 C  CA    . THR B 2 208 ? 28.144  4.089   21.174  1.00 385.74 ? 185 THR C CA    1 
ATOM   4616 C  C     . THR B 2 208 ? 26.810  4.823   21.147  1.00 392.61 ? 185 THR C C     1 
ATOM   4617 O  O     . THR B 2 208 ? 26.771  6.040   21.322  1.00 393.37 ? 185 THR C O     1 
ATOM   4618 C  CB    . THR B 2 208 ? 28.717  4.227   22.585  1.00 365.58 ? 185 THR C CB    1 
ATOM   4619 O  OG1   . THR B 2 208 ? 30.085  3.794   22.588  1.00 359.24 ? 185 THR C OG1   1 
ATOM   4620 C  CG2   . THR B 2 208 ? 27.901  3.397   23.578  1.00 359.57 ? 185 THR C CG2   1 
ATOM   4621 N  N     . THR B 2 209 ? 25.721  4.089   20.930  1.00 393.06 ? 186 THR C N     1 
ATOM   4622 C  CA    . THR B 2 209 ? 24.394  4.692   20.879  1.00 398.08 ? 186 THR C CA    1 
ATOM   4623 C  C     . THR B 2 209 ? 23.565  4.306   22.103  1.00 391.67 ? 186 THR C C     1 
ATOM   4624 O  O     . THR B 2 209 ? 22.353  4.525   22.129  1.00 394.99 ? 186 THR C O     1 
ATOM   4625 C  CB    . THR B 2 209 ? 23.639  4.290   19.596  1.00 411.04 ? 186 THR C CB    1 
ATOM   4626 N  N     . ASP B 2 210 ? 24.219  3.737   23.117  1.00 390.56 ? 187 ASP C N     1 
ATOM   4627 C  CA    . ASP B 2 210 ? 23.512  3.194   24.287  1.00 387.08 ? 187 ASP C CA    1 
ATOM   4628 C  C     . ASP B 2 210 ? 23.542  4.143   25.471  1.00 376.74 ? 187 ASP C C     1 
ATOM   4629 O  O     . ASP B 2 210 ? 24.476  4.099   26.276  1.00 366.35 ? 187 ASP C O     1 
ATOM   4630 C  CB    . ASP B 2 210 ? 24.099  1.840   24.716  1.00 386.77 ? 187 ASP C CB    1 
ATOM   4631 N  N     . PHE B 2 211 ? 22.520  4.993   25.577  1.00 382.94 ? 188 PHE C N     1 
ATOM   4632 C  CA    . PHE B 2 211 ? 22.420  5.927   26.693  1.00 374.70 ? 188 PHE C CA    1 
ATOM   4633 C  C     . PHE B 2 211 ? 22.350  5.152   27.992  1.00 348.29 ? 188 PHE C C     1 
ATOM   4634 O  O     . PHE B 2 211 ? 21.505  4.275   28.146  1.00 349.18 ? 188 PHE C O     1 
ATOM   4635 C  CB    . PHE B 2 211 ? 21.174  6.807   26.572  1.00 392.74 ? 188 PHE C CB    1 
ATOM   4636 C  CG    . PHE B 2 211 ? 21.208  7.753   25.413  1.00 405.21 ? 188 PHE C CG    1 
ATOM   4637 C  CD1   . PHE B 2 211 ? 22.108  8.801   25.388  1.00 401.27 ? 188 PHE C CD1   1 
ATOM   4638 C  CD2   . PHE B 2 211 ? 20.332  7.602   24.356  1.00 410.75 ? 188 PHE C CD2   1 
ATOM   4639 C  CE1   . PHE B 2 211 ? 22.134  9.684   24.321  1.00 407.30 ? 188 PHE C CE1   1 
ATOM   4640 C  CE2   . PHE B 2 211 ? 20.357  8.469   23.289  1.00 414.12 ? 188 PHE C CE2   1 
ATOM   4641 C  CZ    . PHE B 2 211 ? 21.259  9.512   23.271  1.00 412.43 ? 188 PHE C CZ    1 
ATOM   4642 N  N     . LYS B 2 212 ? 23.247  5.465   28.917  1.00 326.15 ? 189 LYS C N     1 
ATOM   4643 C  CA    . LYS B 2 212 ? 23.212  4.853   30.235  1.00 308.25 ? 189 LYS C CA    1 
ATOM   4644 C  C     . LYS B 2 212 ? 22.330  5.668   31.203  1.00 303.66 ? 189 LYS C C     1 
ATOM   4645 O  O     . LYS B 2 212 ? 22.451  6.889   31.308  1.00 303.10 ? 189 LYS C O     1 
ATOM   4646 C  CB    . LYS B 2 212 ? 24.633  4.654   30.774  1.00 296.21 ? 189 LYS C CB    1 
ATOM   4647 N  N     . TYR B 2 213 ? 21.432  4.978   31.894  1.00 298.30 ? 190 TYR C N     1 
ATOM   4648 C  CA    . TYR B 2 213 ? 20.497  5.614   32.815  1.00 295.96 ? 190 TYR C CA    1 
ATOM   4649 C  C     . TYR B 2 213 ? 21.191  5.996   34.116  1.00 298.26 ? 190 TYR C C     1 
ATOM   4650 O  O     . TYR B 2 213 ? 20.820  6.969   34.759  1.00 297.64 ? 190 TYR C O     1 
ATOM   4651 C  CB    . TYR B 2 213 ? 19.320  4.669   33.057  1.00 297.63 ? 190 TYR C CB    1 
ATOM   4652 C  CG    . TYR B 2 213 ? 18.430  4.945   34.249  1.00 293.80 ? 190 TYR C CG    1 
ATOM   4653 C  CD1   . TYR B 2 213 ? 18.837  4.640   35.543  1.00 283.95 ? 190 TYR C CD1   1 
ATOM   4654 C  CD2   . TYR B 2 213 ? 17.148  5.437   34.073  1.00 299.88 ? 190 TYR C CD2   1 
ATOM   4655 C  CE1   . TYR B 2 213 ? 18.010  4.869   36.630  1.00 278.74 ? 190 TYR C CE1   1 
ATOM   4656 C  CE2   . TYR B 2 213 ? 16.306  5.661   35.153  1.00 294.93 ? 190 TYR C CE2   1 
ATOM   4657 C  CZ    . TYR B 2 213 ? 16.744  5.374   36.430  1.00 284.97 ? 190 TYR C CZ    1 
ATOM   4658 O  OH    . TYR B 2 213 ? 15.912  5.590   37.508  1.00 281.63 ? 190 TYR C OH    1 
ATOM   4659 N  N     . ASN B 2 214 ? 22.196  5.228   34.509  1.00 307.76 ? 191 ASN C N     1 
ATOM   4660 C  CA    . ASN B 2 214 ? 22.962  5.549   35.709  1.00 316.19 ? 191 ASN C CA    1 
ATOM   4661 C  C     . ASN B 2 214 ? 23.628  6.929   35.602  1.00 335.77 ? 191 ASN C C     1 
ATOM   4662 O  O     . ASN B 2 214 ? 23.486  7.789   36.489  1.00 339.34 ? 191 ASN C O     1 
ATOM   4663 C  CB    . ASN B 2 214 ? 24.004  4.454   35.984  1.00 308.94 ? 191 ASN C CB    1 
ATOM   4664 N  N     . THR B 2 215 ? 24.327  7.131   34.490  1.00 346.14 ? 192 THR C N     1 
ATOM   4665 C  CA    . THR B 2 215 ? 25.038  8.372   34.221  1.00 341.91 ? 192 THR C CA    1 
ATOM   4666 C  C     . THR B 2 215 ? 24.111  9.590   34.096  1.00 341.18 ? 192 THR C C     1 
ATOM   4667 O  O     . THR B 2 215 ? 24.320  10.626  34.759  1.00 343.80 ? 192 THR C O     1 
ATOM   4668 C  CB    . THR B 2 215 ? 25.867  8.228   32.949  1.00 346.20 ? 192 THR C CB    1 
ATOM   4669 O  OG1   . THR B 2 215 ? 26.937  7.307   33.191  1.00 347.60 ? 192 THR C OG1   1 
ATOM   4670 C  CG2   . THR B 2 215 ? 26.443  9.565   32.538  1.00 337.20 ? 192 THR C CG2   1 
ATOM   4671 N  N     . ILE B 2 216 ? 23.092  9.458   33.248  1.00 332.20 ? 193 ILE C N     1 
ATOM   4672 C  CA    . ILE B 2 216 ? 22.091  10.506  33.072  1.00 316.07 ? 193 ILE C CA    1 
ATOM   4673 C  C     . ILE B 2 216 ? 21.465  10.850  34.417  1.00 298.01 ? 193 ILE C C     1 
ATOM   4674 O  O     . ILE B 2 216 ? 21.197  12.025  34.732  1.00 295.68 ? 193 ILE C O     1 
ATOM   4675 C  CB    . ILE B 2 216 ? 21.002  10.077  32.070  1.00 314.53 ? 193 ILE C CB    1 
ATOM   4676 C  CG1   . ILE B 2 216 ? 21.616  9.918   30.687  1.00 305.13 ? 193 ILE C CG1   1 
ATOM   4677 C  CG2   . ILE B 2 216 ? 19.865  11.099  32.009  1.00 327.32 ? 193 ILE C CG2   1 
ATOM   4678 C  CD1   . ILE B 2 216 ? 20.621  10.081  29.579  1.00 322.76 ? 193 ILE C CD1   1 
ATOM   4679 N  N     . SER B 2 217 ? 21.258  9.818   35.223  1.00 282.96 ? 194 SER C N     1 
ATOM   4680 C  CA    . SER B 2 217 ? 20.728  10.034  36.549  1.00 266.26 ? 194 SER C CA    1 
ATOM   4681 C  C     . SER B 2 217 ? 21.631  10.927  37.367  1.00 266.11 ? 194 SER C C     1 
ATOM   4682 O  O     . SER B 2 217 ? 21.169  11.942  37.862  1.00 254.62 ? 194 SER C O     1 
ATOM   4683 C  CB    . SER B 2 217 ? 20.496  8.732   37.293  1.00 255.42 ? 194 SER C CB    1 
ATOM   4684 O  OG    . SER B 2 217 ? 20.085  9.048   38.607  1.00 250.56 ? 194 SER C OG    1 
ATOM   4685 N  N     . GLU B 2 218 ? 22.907  10.562  37.508  1.00 286.95 ? 195 GLU C N     1 
ATOM   4686 C  CA    . GLU B 2 218 ? 23.811  11.346  38.361  1.00 297.86 ? 195 GLU C CA    1 
ATOM   4687 C  C     . GLU B 2 218 ? 23.858  12.797  37.901  1.00 312.12 ? 195 GLU C C     1 
ATOM   4688 O  O     . GLU B 2 218 ? 23.863  13.725  38.726  1.00 319.24 ? 195 GLU C O     1 
ATOM   4689 C  CB    . GLU B 2 218 ? 25.217  10.751  38.401  1.00 294.30 ? 195 GLU C CB    1 
ATOM   4690 C  CG    . GLU B 2 218 ? 26.060  11.227  39.582  1.00 279.24 ? 195 GLU C CG    1 
ATOM   4691 C  CD    . GLU B 2 218 ? 27.553  10.888  39.431  1.00 267.71 ? 195 GLU C CD    1 
ATOM   4692 O  OE1   . GLU B 2 218 ? 28.295  10.962  40.444  1.00 246.82 ? 195 GLU C OE1   1 
ATOM   4693 O  OE2   . GLU B 2 218 ? 27.989  10.554  38.301  1.00 279.69 ? 195 GLU C OE2   1 
ATOM   4694 N  N     . ARG B 2 219 ? 23.863  12.990  36.583  1.00 311.38 ? 196 ARG C N     1 
ATOM   4695 C  CA    . ARG B 2 219 ? 23.822  14.345  36.034  1.00 302.32 ? 196 ARG C CA    1 
ATOM   4696 C  C     . ARG B 2 219 ? 22.586  15.068  36.536  1.00 298.45 ? 196 ARG C C     1 
ATOM   4697 O  O     . ARG B 2 219 ? 22.704  15.927  37.395  1.00 296.22 ? 196 ARG C O     1 
ATOM   4698 C  CB    . ARG B 2 219 ? 23.818  14.332  34.511  1.00 305.71 ? 196 ARG C CB    1 
ATOM   4699 C  CG    . ARG B 2 219 ? 24.192  15.653  33.880  1.00 301.39 ? 196 ARG C CG    1 
ATOM   4700 C  CD    . ARG B 2 219 ? 25.507  16.156  34.459  1.00 282.81 ? 196 ARG C CD    1 
ATOM   4701 N  NE    . ARG B 2 219 ? 26.282  17.013  33.552  1.00 279.30 ? 196 ARG C NE    1 
ATOM   4702 C  CZ    . ARG B 2 219 ? 25.868  18.180  33.065  1.00 281.06 ? 196 ARG C CZ    1 
ATOM   4703 N  NH1   . ARG B 2 219 ? 24.661  18.659  33.363  1.00 284.21 ? 196 ARG C NH1   1 
ATOM   4704 N  NH2   . ARG B 2 219 ? 26.662  18.872  32.263  1.00 284.90 ? 196 ARG C NH2   1 
ATOM   4705 N  N     . LEU B 2 220 ? 21.410  14.691  36.020  1.00 296.64 ? 197 LEU C N     1 
ATOM   4706 C  CA    . LEU B 2 220 ? 20.138  15.338  36.377  1.00 289.93 ? 197 LEU C CA    1 
ATOM   4707 C  C     . LEU B 2 220 ? 20.014  15.597  37.869  1.00 277.34 ? 197 LEU C C     1 
ATOM   4708 O  O     . LEU B 2 220 ? 19.521  16.642  38.308  1.00 273.61 ? 197 LEU C O     1 
ATOM   4709 C  CB    . LEU B 2 220 ? 18.950  14.499  35.900  1.00 286.52 ? 197 LEU C CB    1 
ATOM   4710 C  CG    . LEU B 2 220 ? 18.756  14.564  34.383  1.00 286.75 ? 197 LEU C CG    1 
ATOM   4711 C  CD1   . LEU B 2 220 ? 17.504  13.844  33.925  1.00 289.36 ? 197 LEU C CD1   1 
ATOM   4712 C  CD2   . LEU B 2 220 ? 18.724  16.018  33.929  1.00 287.40 ? 197 LEU C CD2   1 
ATOM   4713 N  N     . ASN B 2 221 ? 20.503  14.642  38.642  1.00 265.89 ? 198 ASN C N     1 
ATOM   4714 C  CA    . ASN B 2 221 ? 20.473  14.727  40.082  1.00 245.06 ? 198 ASN C CA    1 
ATOM   4715 C  C     . ASN B 2 221 ? 21.259  15.925  40.517  1.00 244.74 ? 198 ASN C C     1 
ATOM   4716 O  O     . ASN B 2 221 ? 20.683  16.906  40.974  1.00 241.24 ? 198 ASN C O     1 
ATOM   4717 C  CB    . ASN B 2 221 ? 21.098  13.477  40.704  1.00 224.44 ? 198 ASN C CB    1 
ATOM   4718 C  CG    . ASN B 2 221 ? 20.572  13.183  42.099  1.00 217.49 ? 198 ASN C CG    1 
ATOM   4719 O  OD1   . ASN B 2 221 ? 20.159  14.075  42.828  1.00 213.04 ? 198 ASN C OD1   1 
ATOM   4720 N  ND2   . ASN B 2 221 ? 20.558  11.913  42.454  1.00 220.09 ? 198 ASN C ND2   1 
ATOM   4721 N  N     . GLU B 2 222 ? 22.579  15.851  40.368  1.00 247.72 ? 199 GLU C N     1 
ATOM   4722 C  CA    . GLU B 2 222 ? 23.420  16.924  40.889  1.00 240.38 ? 199 GLU C CA    1 
ATOM   4723 C  C     . GLU B 2 222 ? 23.073  18.288  40.276  1.00 245.18 ? 199 GLU C C     1 
ATOM   4724 O  O     . GLU B 2 222 ? 23.317  19.326  40.894  1.00 232.44 ? 199 GLU C O     1 
ATOM   4725 C  CB    . GLU B 2 222 ? 24.905  16.583  40.761  1.00 231.49 ? 199 GLU C CB    1 
ATOM   4726 C  CG    . GLU B 2 222 ? 25.312  15.421  41.639  1.00 217.73 ? 199 GLU C CG    1 
ATOM   4727 C  CD    . GLU B 2 222 ? 26.699  14.894  41.320  1.00 210.69 ? 199 GLU C CD    1 
ATOM   4728 O  OE1   . GLU B 2 222 ? 26.953  13.692  41.544  1.00 217.72 ? 199 GLU C OE1   1 
ATOM   4729 O  OE2   . GLU B 2 222 ? 27.545  15.680  40.851  1.00 211.88 ? 199 GLU C OE2   1 
ATOM   4730 N  N     . SER B 2 223 ? 22.466  18.268  39.087  1.00 261.71 ? 200 SER C N     1 
ATOM   4731 C  CA    . SER B 2 223 ? 21.947  19.469  38.427  1.00 272.71 ? 200 SER C CA    1 
ATOM   4732 C  C     . SER B 2 223 ? 20.831  20.102  39.244  1.00 275.88 ? 200 SER C C     1 
ATOM   4733 O  O     . SER B 2 223 ? 20.829  21.306  39.489  1.00 278.64 ? 200 SER C O     1 
ATOM   4734 C  CB    . SER B 2 223 ? 21.428  19.155  37.004  1.00 283.45 ? 200 SER C CB    1 
ATOM   4735 O  OG    . SER B 2 223 ? 22.449  19.156  36.001  1.00 286.76 ? 200 SER C OG    1 
ATOM   4736 N  N     . ALA B 2 224 ? 19.887  19.281  39.677  1.00 274.94 ? 201 ALA C N     1 
ATOM   4737 C  CA    . ALA B 2 224 ? 18.703  19.788  40.366  1.00 274.23 ? 201 ALA C CA    1 
ATOM   4738 C  C     . ALA B 2 224 ? 18.906  20.481  41.719  1.00 266.83 ? 201 ALA C C     1 
ATOM   4739 O  O     . ALA B 2 224 ? 17.968  21.080  42.235  1.00 265.82 ? 201 ALA C O     1 
ATOM   4740 C  CB    . ALA B 2 224 ? 17.689  18.684  40.519  1.00 271.59 ? 201 ALA C CB    1 
ATOM   4741 N  N     . PHE B 2 225 ? 20.088  20.399  42.316  1.00 257.91 ? 202 PHE C N     1 
ATOM   4742 C  CA    . PHE B 2 225 ? 20.246  20.978  43.646  1.00 237.35 ? 202 PHE C CA    1 
ATOM   4743 C  C     . PHE B 2 225 ? 20.178  22.483  43.592  1.00 221.36 ? 202 PHE C C     1 
ATOM   4744 O  O     . PHE B 2 225 ? 19.389  23.100  44.310  1.00 215.93 ? 202 PHE C O     1 
ATOM   4745 C  CB    . PHE B 2 225 ? 21.538  20.534  44.319  1.00 228.96 ? 202 PHE C CB    1 
ATOM   4746 C  CG    . PHE B 2 225 ? 21.537  19.096  44.705  1.00 211.53 ? 202 PHE C CG    1 
ATOM   4747 C  CD1   . PHE B 2 225 ? 20.959  18.688  45.888  1.00 204.67 ? 202 PHE C CD1   1 
ATOM   4748 C  CD2   . PHE B 2 225 ? 22.079  18.144  43.870  1.00 209.89 ? 202 PHE C CD2   1 
ATOM   4749 C  CE1   . PHE B 2 225 ? 20.943  17.362  46.239  1.00 202.14 ? 202 PHE C CE1   1 
ATOM   4750 C  CE2   . PHE B 2 225 ? 22.059  16.818  44.217  1.00 209.93 ? 202 PHE C CE2   1 
ATOM   4751 C  CZ    . PHE B 2 225 ? 21.489  16.432  45.399  1.00 205.74 ? 202 PHE C CZ    1 
ATOM   4752 N  N     . LEU B 2 226 ? 21.003  23.069  42.729  1.00 222.93 ? 203 LEU C N     1 
ATOM   4753 C  CA    . LEU B 2 226 ? 21.087  24.518  42.621  1.00 192.48 ? 203 LEU C CA    1 
ATOM   4754 C  C     . LEU B 2 226 ? 19.911  25.073  41.837  1.00 228.62 ? 203 LEU C C     1 
ATOM   4755 O  O     . LEU B 2 226 ? 19.671  26.270  41.855  1.00 232.83 ? 203 LEU C O     1 
ATOM   4756 C  CB    . LEU B 2 226 ? 22.400  24.952  41.967  1.00 177.54 ? 203 LEU C CB    1 
ATOM   4757 C  CG    . LEU B 2 226 ? 23.719  24.821  42.739  1.00 169.75 ? 203 LEU C CG    1 
ATOM   4758 C  CD1   . LEU B 2 226 ? 23.479  24.599  44.229  1.00 167.13 ? 203 LEU C CD1   1 
ATOM   4759 C  CD2   . LEU B 2 226 ? 24.614  23.732  42.141  1.00 166.94 ? 203 LEU C CD2   1 
ATOM   4760 N  N     . LEU B 2 227 ? 19.168  24.207  41.161  1.00 289.88 ? 204 LEU C N     1 
ATOM   4761 C  CA    . LEU B 2 227 ? 18.049  24.660  40.347  1.00 301.82 ? 204 LEU C CA    1 
ATOM   4762 C  C     . LEU B 2 227 ? 16.728  24.709  41.106  1.00 284.57 ? 204 LEU C C     1 
ATOM   4763 O  O     . LEU B 2 227 ? 15.797  23.986  40.755  1.00 287.21 ? 204 LEU C O     1 
ATOM   4764 C  CB    . LEU B 2 227 ? 17.900  23.771  39.106  1.00 318.52 ? 204 LEU C CB    1 
ATOM   4765 C  CG    . LEU B 2 227 ? 18.671  24.210  37.851  1.00 323.25 ? 204 LEU C CG    1 
ATOM   4766 C  CD1   . LEU B 2 227 ? 19.799  25.217  38.171  1.00 318.89 ? 204 LEU C CD1   1 
ATOM   4767 C  CD2   . LEU B 2 227 ? 19.213  22.993  37.098  1.00 319.32 ? 204 LEU C CD2   1 
ATOM   4768 N  N     . LYS B 2 228 ? 16.639  25.579  42.117  1.00 269.69 ? 205 LYS C N     1 
ATOM   4769 C  CA    . LYS B 2 228 ? 15.470  25.640  43.018  1.00 272.93 ? 205 LYS C CA    1 
ATOM   4770 C  C     . LYS B 2 228 ? 14.123  25.809  42.294  1.00 281.87 ? 205 LYS C C     1 
ATOM   4771 O  O     . LYS B 2 228 ? 13.076  25.319  42.755  1.00 271.20 ? 205 LYS C O     1 
ATOM   4772 C  CB    . LYS B 2 228 ? 15.650  26.745  44.063  1.00 265.76 ? 205 LYS C CB    1 
ATOM   4773 N  N     . ASN B 2 229 ? 14.175  26.496  41.155  1.00 294.69 ? 206 ASN C N     1 
ATOM   4774 C  CA    . ASN B 2 229 ? 12.999  26.775  40.336  1.00 307.81 ? 206 ASN C CA    1 
ATOM   4775 C  C     . ASN B 2 229 ? 12.453  25.551  39.578  1.00 316.06 ? 206 ASN C C     1 
ATOM   4776 O  O     . ASN B 2 229 ? 11.281  25.527  39.188  1.00 326.92 ? 206 ASN C O     1 
ATOM   4777 C  CB    . ASN B 2 229 ? 13.314  27.909  39.347  1.00 308.97 ? 206 ASN C CB    1 
ATOM   4778 N  N     . VAL B 2 230 ? 13.303  24.541  39.382  1.00 305.37 ? 207 VAL C N     1 
ATOM   4779 C  CA    . VAL B 2 230 ? 13.000  23.454  38.453  1.00 331.90 ? 207 VAL C CA    1 
ATOM   4780 C  C     . VAL B 2 230 ? 12.845  22.079  39.114  1.00 319.69 ? 207 VAL C C     1 
ATOM   4781 O  O     . VAL B 2 230 ? 13.365  21.817  40.205  1.00 302.73 ? 207 VAL C O     1 
ATOM   4782 C  CB    . VAL B 2 230 ? 14.073  23.354  37.345  1.00 360.61 ? 207 VAL C CB    1 
ATOM   4783 N  N     . THR B 2 231 ? 12.109  21.208  38.432  1.00 334.10 ? 208 THR C N     1 
ATOM   4784 C  CA    . THR B 2 231 ? 12.044  19.793  38.775  1.00 351.89 ? 208 THR C CA    1 
ATOM   4785 C  C     . THR B 2 231 ? 12.250  18.971  37.499  1.00 393.73 ? 208 THR C C     1 
ATOM   4786 O  O     . THR B 2 231 ? 11.631  19.228  36.460  1.00 421.84 ? 208 THR C O     1 
ATOM   4787 C  CB    . THR B 2 231 ? 10.711  19.423  39.483  1.00 353.23 ? 208 THR C CB    1 
ATOM   4788 O  OG1   . THR B 2 231 ? 10.104  18.293  38.845  1.00 367.30 ? 208 THR C OG1   1 
ATOM   4789 C  CG2   . THR B 2 231 ? 9.742   20.587  39.447  1.00 352.78 ? 208 THR C CG2   1 
ATOM   4790 N  N     . LEU B 2 232 ? 13.152  18.002  37.565  1.00 400.38 ? 209 LEU C N     1 
ATOM   4791 C  CA    . LEU B 2 232 ? 13.411  17.177  36.395  1.00 412.20 ? 209 LEU C CA    1 
ATOM   4792 C  C     . LEU B 2 232 ? 13.395  15.662  36.654  1.00 409.02 ? 209 LEU C C     1 
ATOM   4793 O  O     . LEU B 2 232 ? 13.796  15.192  37.723  1.00 407.23 ? 209 LEU C O     1 
ATOM   4794 C  CB    . LEU B 2 232 ? 14.680  17.630  35.651  1.00 408.04 ? 209 LEU C CB    1 
ATOM   4795 C  CG    . LEU B 2 232 ? 15.769  18.354  36.440  1.00 385.10 ? 209 LEU C CG    1 
ATOM   4796 C  CD1   . LEU B 2 232 ? 16.333  17.450  37.511  1.00 367.62 ? 209 LEU C CD1   1 
ATOM   4797 C  CD2   . LEU B 2 232 ? 16.869  18.843  35.523  1.00 380.90 ? 209 LEU C CD2   1 
ATOM   4798 N  N     . SER B 2 233 ? 12.918  14.921  35.651  1.00 405.54 ? 210 SER C N     1 
ATOM   4799 C  CA    . SER B 2 233 ? 12.705  13.475  35.756  1.00 393.98 ? 210 SER C CA    1 
ATOM   4800 C  C     . SER B 2 233 ? 13.466  12.677  34.705  1.00 400.99 ? 210 SER C C     1 
ATOM   4801 O  O     . SER B 2 233 ? 13.897  13.212  33.683  1.00 410.37 ? 210 SER C O     1 
ATOM   4802 C  CB    . SER B 2 233 ? 11.224  13.150  35.594  1.00 389.63 ? 210 SER C CB    1 
ATOM   4803 O  OG    . SER B 2 233 ? 10.867  13.111  34.222  1.00 393.32 ? 210 SER C OG    1 
ATOM   4804 N  N     . LEU B 2 234 ? 13.598  11.384  34.951  1.00 392.71 ? 211 LEU C N     1 
ATOM   4805 C  CA    . LEU B 2 234 ? 14.309  10.508  34.041  1.00 380.91 ? 211 LEU C CA    1 
ATOM   4806 C  C     . LEU B 2 234 ? 13.555  9.205   34.051  1.00 379.82 ? 211 LEU C C     1 
ATOM   4807 O  O     . LEU B 2 234 ? 13.440  8.574   35.104  1.00 360.77 ? 211 LEU C O     1 
ATOM   4808 C  CB    . LEU B 2 234 ? 15.727  10.255  34.562  1.00 353.94 ? 211 LEU C CB    1 
ATOM   4809 C  CG    . LEU B 2 234 ? 16.863  9.674   33.705  1.00 339.19 ? 211 LEU C CG    1 
ATOM   4810 C  CD1   . LEU B 2 234 ? 17.946  9.182   34.617  1.00 316.65 ? 211 LEU C CD1   1 
ATOM   4811 C  CD2   . LEU B 2 234 ? 16.450  8.550   32.774  1.00 346.40 ? 211 LEU C CD2   1 
ATOM   4812 N  N     . THR B 2 235 ? 13.047  8.797   32.894  1.00 398.97 ? 212 THR C N     1 
ATOM   4813 C  CA    . THR B 2 235 ? 12.438  7.471   32.776  1.00 402.84 ? 212 THR C CA    1 
ATOM   4814 C  C     . THR B 2 235 ? 13.129  6.619   31.709  1.00 419.31 ? 212 THR C C     1 
ATOM   4815 O  O     . THR B 2 235 ? 13.278  7.035   30.555  1.00 431.60 ? 212 THR C O     1 
ATOM   4816 C  CB    . THR B 2 235 ? 10.922  7.548   32.470  1.00 393.92 ? 212 THR C CB    1 
ATOM   4817 O  OG1   . THR B 2 235 ? 10.701  8.453   31.382  1.00 396.64 ? 212 THR C OG1   1 
ATOM   4818 C  CG2   . THR B 2 235 ? 10.139  8.035   33.684  1.00 382.94 ? 212 THR C CG2   1 
ATOM   4819 N  N     . ASP B 2 236 ? 13.561  5.428   32.107  1.00 420.67 ? 213 ASP C N     1 
ATOM   4820 C  CA    . ASP B 2 236 ? 14.152  4.470   31.189  1.00 421.52 ? 213 ASP C CA    1 
ATOM   4821 C  C     . ASP B 2 236 ? 13.096  3.445   30.831  1.00 421.98 ? 213 ASP C C     1 
ATOM   4822 O  O     . ASP B 2 236 ? 12.708  2.639   31.681  1.00 426.41 ? 213 ASP C O     1 
ATOM   4823 C  CB    . ASP B 2 236 ? 15.337  3.768   31.842  1.00 414.67 ? 213 ASP C CB    1 
ATOM   4824 C  CG    . ASP B 2 236 ? 16.145  2.950   30.859  1.00 410.25 ? 213 ASP C CG    1 
ATOM   4825 O  OD1   . ASP B 2 236 ? 15.604  2.612   29.785  1.00 418.51 ? 213 ASP C OD1   1 
ATOM   4826 O  OD2   . ASP B 2 236 ? 17.322  2.643   31.159  1.00 391.03 ? 213 ASP C OD2   1 
ATOM   4827 N  N     . LYS B 2 237 ? 12.652  3.474   29.574  1.00 410.13 ? 214 LYS C N     1 
ATOM   4828 C  CA    . LYS B 2 237 ? 11.602  2.582   29.087  1.00 390.24 ? 214 LYS C CA    1 
ATOM   4829 C  C     . LYS B 2 237 ? 12.125  1.182   28.756  1.00 381.70 ? 214 LYS C C     1 
ATOM   4830 O  O     . LYS B 2 237 ? 11.332  0.236   28.602  1.00 381.94 ? 214 LYS C O     1 
ATOM   4831 C  CB    . LYS B 2 237 ? 10.902  3.175   27.864  1.00 380.70 ? 214 LYS C CB    1 
ATOM   4832 C  CG    . LYS B 2 237 ? 10.058  4.388   28.163  1.00 377.09 ? 214 LYS C CG    1 
ATOM   4833 C  CD    . LYS B 2 237 ? 8.575   4.135   27.954  1.00 382.36 ? 214 LYS C CD    1 
ATOM   4834 C  CE    . LYS B 2 237 ? 7.890   3.652   29.225  1.00 379.85 ? 214 LYS C CE    1 
ATOM   4835 N  NZ    . LYS B 2 237 ? 6.411   3.575   29.033  1.00 385.03 ? 214 LYS C NZ    1 
ATOM   4836 N  N     . ARG B 2 238 ? 13.453  1.066   28.636  1.00 381.62 ? 215 ARG C N     1 
ATOM   4837 C  CA    . ARG B 2 238 ? 14.119  -0.230  28.474  1.00 386.38 ? 215 ARG C CA    1 
ATOM   4838 C  C     . ARG B 2 238 ? 14.089  -1.013  29.786  1.00 377.61 ? 215 ARG C C     1 
ATOM   4839 O  O     . ARG B 2 238 ? 13.537  -2.097  29.857  1.00 373.31 ? 215 ARG C O     1 
ATOM   4840 C  CB    . ARG B 2 238 ? 15.567  -0.040  28.033  1.00 385.16 ? 215 ARG C CB    1 
ATOM   4841 C  CG    . ARG B 2 238 ? 15.736  0.736   26.749  1.00 386.78 ? 215 ARG C CG    1 
ATOM   4842 C  CD    . ARG B 2 238 ? 17.200  1.102   26.521  1.00 381.60 ? 215 ARG C CD    1 
ATOM   4843 N  NE    . ARG B 2 238 ? 17.741  1.858   27.650  1.00 373.44 ? 215 ARG C NE    1 
ATOM   4844 C  CZ    . ARG B 2 238 ? 18.991  2.310   27.735  1.00 374.21 ? 215 ARG C CZ    1 
ATOM   4845 N  NH1   . ARG B 2 238 ? 19.855  2.089   26.748  1.00 370.87 ? 215 ARG C NH1   1 
ATOM   4846 N  NH2   . ARG B 2 238 ? 19.378  2.979   28.816  1.00 377.30 ? 215 ARG C NH2   1 
ATOM   4847 N  N     . THR B 2 239 ? 14.678  -0.445  30.829  1.00 370.34 ? 216 THR C N     1 
ATOM   4848 C  CA    . THR B 2 239 ? 14.704  -1.082  32.141  1.00 353.40 ? 216 THR C CA    1 
ATOM   4849 C  C     . THR B 2 239 ? 13.414  -0.814  32.938  1.00 343.58 ? 216 THR C C     1 
ATOM   4850 O  O     . THR B 2 239 ? 13.277  -1.258  34.077  1.00 321.58 ? 216 THR C O     1 
ATOM   4851 C  CB    . THR B 2 239 ? 15.934  -0.601  32.959  1.00 322.53 ? 216 THR C CB    1 
ATOM   4852 N  N     . ASP B 2 240 ? 12.471  -0.090  32.340  1.00 360.11 ? 217 ASP C N     1 
ATOM   4853 C  CA    . ASP B 2 240 ? 11.214  0.266   33.003  1.00 357.58 ? 217 ASP C CA    1 
ATOM   4854 C  C     . ASP B 2 240 ? 11.400  0.915   34.377  1.00 336.45 ? 217 ASP C C     1 
ATOM   4855 O  O     . ASP B 2 240 ? 10.576  0.733   35.271  1.00 328.55 ? 217 ASP C O     1 
ATOM   4856 C  CB    . ASP B 2 240 ? 10.334  -0.978  33.143  1.00 359.98 ? 217 ASP C CB    1 
ATOM   4857 N  N     . GLU B 2 241 ? 12.478  1.679   34.544  1.00 329.19 ? 218 GLU C N     1 
ATOM   4858 C  CA    . GLU B 2 241 ? 12.711  2.364   35.828  1.00 322.46 ? 218 GLU C CA    1 
ATOM   4859 C  C     . GLU B 2 241 ? 12.702  3.909   35.732  1.00 326.30 ? 218 GLU C C     1 
ATOM   4860 O  O     . GLU B 2 241 ? 12.724  4.474   34.638  1.00 341.07 ? 218 GLU C O     1 
ATOM   4861 C  CB    . GLU B 2 241 ? 13.974  1.838   36.538  1.00 316.17 ? 218 GLU C CB    1 
ATOM   4862 C  CG    . GLU B 2 241 ? 15.206  1.622   35.655  1.00 327.06 ? 218 GLU C CG    1 
ATOM   4863 C  CD    . GLU B 2 241 ? 16.509  1.510   36.461  1.00 327.80 ? 218 GLU C CD    1 
ATOM   4864 O  OE1   . GLU B 2 241 ? 16.475  1.750   37.694  1.00 331.08 ? 218 GLU C OE1   1 
ATOM   4865 O  OE2   . GLU B 2 241 ? 17.564  1.193   35.856  1.00 325.39 ? 218 GLU C OE2   1 
ATOM   4866 N  N     . ALA B 2 242 ? 12.657  4.589   36.875  1.00 313.16 ? 219 ALA C N     1 
ATOM   4867 C  CA    . ALA B 2 242 ? 12.433  6.035   36.871  1.00 310.47 ? 219 ALA C CA    1 
ATOM   4868 C  C     . ALA B 2 242 ? 12.849  6.757   38.151  1.00 296.99 ? 219 ALA C C     1 
ATOM   4869 O  O     . ALA B 2 242 ? 12.666  6.226   39.247  1.00 291.06 ? 219 ALA C O     1 
ATOM   4870 C  CB    . ALA B 2 242 ? 10.970  6.312   36.605  1.00 320.85 ? 219 ALA C CB    1 
ATOM   4871 N  N     . ILE B 2 243 ? 13.396  7.971   38.009  1.00 302.74 ? 220 ILE C N     1 
ATOM   4872 C  CA    . ILE B 2 243 ? 13.428  8.918   39.130  1.00 297.62 ? 220 ILE C CA    1 
ATOM   4873 C  C     . ILE B 2 243 ? 12.872  10.271  38.712  1.00 311.00 ? 220 ILE C C     1 
ATOM   4874 O  O     . ILE B 2 243 ? 12.543  10.494  37.538  1.00 319.61 ? 220 ILE C O     1 
ATOM   4875 C  CB    . ILE B 2 243 ? 14.833  9.175   39.714  1.00 278.20 ? 220 ILE C CB    1 
ATOM   4876 C  CG1   . ILE B 2 243 ? 15.838  8.144   39.246  1.00 258.44 ? 220 ILE C CG1   1 
ATOM   4877 C  CG2   . ILE B 2 243 ? 14.791  9.239   41.224  1.00 276.67 ? 220 ILE C CG2   1 
ATOM   4878 C  CD1   . ILE B 2 243 ? 16.835  8.734   38.288  1.00 267.16 ? 220 ILE C CD1   1 
ATOM   4879 N  N     . GLU B 2 244 ? 12.796  11.164  39.701  1.00 318.16 ? 221 GLU C N     1 
ATOM   4880 C  CA    . GLU B 2 244 ? 12.382  12.556  39.555  1.00 345.69 ? 221 GLU C CA    1 
ATOM   4881 C  C     . GLU B 2 244 ? 13.218  13.326  40.586  1.00 351.78 ? 221 GLU C C     1 
ATOM   4882 O  O     . GLU B 2 244 ? 13.592  12.751  41.609  1.00 350.80 ? 221 GLU C O     1 
ATOM   4883 C  CB    . GLU B 2 244 ? 10.881  12.650  39.825  1.00 355.29 ? 221 GLU C CB    1 
ATOM   4884 C  CG    . GLU B 2 244 ? 10.326  14.028  40.089  1.00 351.77 ? 221 GLU C CG    1 
ATOM   4885 C  CD    . GLU B 2 244 ? 8.798   14.061  40.030  1.00 346.24 ? 221 GLU C CD    1 
ATOM   4886 O  OE1   . GLU B 2 244 ? 8.216   15.174  40.048  1.00 340.17 ? 221 GLU C OE1   1 
ATOM   4887 O  OE2   . GLU B 2 244 ? 8.187   12.971  39.949  1.00 346.43 ? 221 GLU C OE2   1 
ATOM   4888 N  N     . PHE B 2 245 ? 13.563  14.589  40.312  1.00 352.36 ? 222 PHE C N     1 
ATOM   4889 C  CA    . PHE B 2 245 ? 14.421  15.371  41.230  1.00 324.56 ? 222 PHE C CA    1 
ATOM   4890 C  C     . PHE B 2 245 ? 13.913  16.767  41.550  1.00 309.66 ? 222 PHE C C     1 
ATOM   4891 O  O     . PHE B 2 245 ? 13.474  17.490  40.656  1.00 319.92 ? 222 PHE C O     1 
ATOM   4892 C  CB    . PHE B 2 245 ? 15.840  15.520  40.687  1.00 309.83 ? 222 PHE C CB    1 
ATOM   4893 C  CG    . PHE B 2 245 ? 16.506  14.223  40.362  1.00 286.37 ? 222 PHE C CG    1 
ATOM   4894 C  CD1   . PHE B 2 245 ? 16.382  13.665  39.099  1.00 279.82 ? 222 PHE C CD1   1 
ATOM   4895 C  CD2   . PHE B 2 245 ? 17.266  13.564  41.307  1.00 266.37 ? 222 PHE C CD2   1 
ATOM   4896 C  CE1   . PHE B 2 245 ? 16.994  12.474  38.794  1.00 274.89 ? 222 PHE C CE1   1 
ATOM   4897 C  CE2   . PHE B 2 245 ? 17.868  12.371  41.005  1.00 252.84 ? 222 PHE C CE2   1 
ATOM   4898 C  CZ    . PHE B 2 245 ? 17.746  11.828  39.750  1.00 259.18 ? 222 PHE C CZ    1 
ATOM   4899 N  N     . HIS B 2 246 ? 14.021  17.154  42.822  1.00 280.98 ? 223 HIS C N     1 
ATOM   4900 C  CA    . HIS B 2 246 ? 13.578  18.476  43.276  1.00 267.86 ? 223 HIS C CA    1 
ATOM   4901 C  C     . HIS B 2 246 ? 14.209  18.834  44.626  1.00 253.24 ? 223 HIS C C     1 
ATOM   4902 O  O     . HIS B 2 246 ? 14.338  17.971  45.493  1.00 251.49 ? 223 HIS C O     1 
ATOM   4903 C  CB    . HIS B 2 246 ? 12.056  18.516  43.377  1.00 275.98 ? 223 HIS C CB    1 
ATOM   4904 C  CG    . HIS B 2 246 ? 11.486  19.890  43.251  1.00 285.48 ? 223 HIS C CG    1 
ATOM   4905 N  ND1   . HIS B 2 246 ? 12.177  21.016  43.639  1.00 283.42 ? 223 HIS C ND1   1 
ATOM   4906 C  CD2   . HIS B 2 246 ? 10.299  20.320  42.768  1.00 301.98 ? 223 HIS C CD2   1 
ATOM   4907 C  CE1   . HIS B 2 246 ? 11.438  22.085  43.400  1.00 296.52 ? 223 HIS C CE1   1 
ATOM   4908 N  NE2   . HIS B 2 246 ? 10.294  21.693  42.872  1.00 307.84 ? 223 HIS C NE2   1 
ATOM   4909 N  N     . TYR B 2 247 ? 14.621  20.085  44.812  1.00 245.55 ? 224 TYR C N     1 
ATOM   4910 C  CA    . TYR B 2 247 ? 15.282  20.453  46.064  1.00 237.10 ? 224 TYR C CA    1 
ATOM   4911 C  C     . TYR B 2 247 ? 14.960  21.849  46.542  1.00 248.56 ? 224 TYR C C     1 
ATOM   4912 O  O     . TYR B 2 247 ? 15.382  22.840  45.930  1.00 253.51 ? 224 TYR C O     1 
ATOM   4913 C  CB    . TYR B 2 247 ? 16.798  20.299  45.960  1.00 229.54 ? 224 TYR C CB    1 
ATOM   4914 C  CG    . TYR B 2 247 ? 17.231  18.881  45.778  1.00 229.23 ? 224 TYR C CG    1 
ATOM   4915 C  CD1   . TYR B 2 247 ? 17.223  17.994  46.838  1.00 223.72 ? 224 TYR C CD1   1 
ATOM   4916 C  CD2   . TYR B 2 247 ? 17.625  18.417  44.538  1.00 235.40 ? 224 TYR C CD2   1 
ATOM   4917 C  CE1   . TYR B 2 247 ? 17.603  16.686  46.667  1.00 223.62 ? 224 TYR C CE1   1 
ATOM   4918 C  CE2   . TYR B 2 247 ? 18.008  17.111  44.355  1.00 234.89 ? 224 TYR C CE2   1 
ATOM   4919 C  CZ    . TYR B 2 247 ? 17.993  16.248  45.420  1.00 229.41 ? 224 TYR C CZ    1 
ATOM   4920 O  OH    . TYR B 2 247 ? 18.372  14.945  45.233  1.00 231.50 ? 224 TYR C OH    1 
ATOM   4921 N  N     . GLU B 2 248 ? 14.244  21.915  47.665  1.00 250.62 ? 225 GLU C N     1 
ATOM   4922 C  CA    . GLU B 2 248 ? 13.802  23.188  48.232  1.00 247.66 ? 225 GLU C CA    1 
ATOM   4923 C  C     . GLU B 2 248 ? 14.898  23.911  49.012  1.00 238.56 ? 225 GLU C C     1 
ATOM   4924 O  O     . GLU B 2 248 ? 14.920  25.132  49.028  1.00 243.02 ? 225 GLU C O     1 
ATOM   4925 C  CB    . GLU B 2 248 ? 12.559  23.001  49.109  1.00 248.44 ? 225 GLU C CB    1 
ATOM   4926 N  N     . VAL B 2 251 ? 21.504  23.754  49.593  1.00 258.13 ? 228 VAL C N     1 
ATOM   4927 C  CA    . VAL B 2 251 ? 22.943  23.547  49.756  1.00 248.90 ? 228 VAL C CA    1 
ATOM   4928 C  C     . VAL B 2 251 ? 23.213  22.725  51.010  1.00 235.97 ? 228 VAL C C     1 
ATOM   4929 O  O     . VAL B 2 251 ? 24.265  22.120  51.153  1.00 237.37 ? 228 VAL C O     1 
ATOM   4930 C  CB    . VAL B 2 251 ? 23.730  24.905  49.800  1.00 182.51 ? 228 VAL C CB    1 
ATOM   4931 C  CG1   . VAL B 2 251 ? 23.525  25.601  51.118  1.00 175.85 ? 228 VAL C CG1   1 
ATOM   4932 C  CG2   . VAL B 2 251 ? 25.209  24.685  49.566  1.00 186.10 ? 228 VAL C CG2   1 
ATOM   4933 N  N     . GLN B 2 252 ? 22.244  22.707  51.915  1.00 217.50 ? 229 GLN C N     1 
ATOM   4934 C  CA    . GLN B 2 252 ? 22.384  21.965  53.152  1.00 194.20 ? 229 GLN C CA    1 
ATOM   4935 C  C     . GLN B 2 252 ? 22.103  20.496  52.865  1.00 191.86 ? 229 GLN C C     1 
ATOM   4936 O  O     . GLN B 2 252 ? 22.791  19.603  53.369  1.00 183.64 ? 229 GLN C O     1 
ATOM   4937 C  CB    . GLN B 2 252 ? 21.426  22.526  54.211  1.00 196.36 ? 229 GLN C CB    1 
ATOM   4938 C  CG    . GLN B 2 252 ? 21.852  23.906  54.740  1.00 203.40 ? 229 GLN C CG    1 
ATOM   4939 C  CD    . GLN B 2 252 ? 20.711  24.697  55.375  1.00 212.63 ? 229 GLN C CD    1 
ATOM   4940 O  OE1   . GLN B 2 252 ? 20.250  25.701  54.822  1.00 219.01 ? 229 GLN C OE1   1 
ATOM   4941 N  NE2   . GLN B 2 252 ? 20.261  24.254  56.544  1.00 211.94 ? 229 GLN C NE2   1 
ATOM   4942 N  N     . ASP B 2 253 ? 21.103  20.255  52.028  1.00 209.18 ? 230 ASP C N     1 
ATOM   4943 C  CA    . ASP B 2 253 ? 20.786  18.902  51.621  1.00 219.95 ? 230 ASP C CA    1 
ATOM   4944 C  C     . ASP B 2 253 ? 22.000  18.295  50.925  1.00 244.84 ? 230 ASP C C     1 
ATOM   4945 O  O     . ASP B 2 253 ? 22.448  17.222  51.282  1.00 247.84 ? 230 ASP C O     1 
ATOM   4946 C  CB    . ASP B 2 253 ? 19.537  18.884  50.726  1.00 209.76 ? 230 ASP C CB    1 
ATOM   4947 C  CG    . ASP B 2 253 ? 18.280  19.424  51.443  1.00 217.84 ? 230 ASP C CG    1 
ATOM   4948 O  OD1   . ASP B 2 253 ? 18.170  19.260  52.678  1.00 217.70 ? 230 ASP C OD1   1 
ATOM   4949 O  OD2   . ASP B 2 253 ? 17.394  20.009  50.773  1.00 227.07 ? 230 ASP C OD2   1 
ATOM   4950 N  N     . PHE B 2 254 ? 22.557  19.016  49.965  1.00 261.92 ? 231 PHE C N     1 
ATOM   4951 C  CA    . PHE B 2 254 ? 23.747  18.595  49.213  1.00 269.01 ? 231 PHE C CA    1 
ATOM   4952 C  C     . PHE B 2 254 ? 24.863  18.016  50.091  1.00 267.57 ? 231 PHE C C     1 
ATOM   4953 O  O     . PHE B 2 254 ? 25.574  17.128  49.655  1.00 276.51 ? 231 PHE C O     1 
ATOM   4954 C  CB    . PHE B 2 254 ? 24.287  19.792  48.407  1.00 264.77 ? 231 PHE C CB    1 
ATOM   4955 C  CG    . PHE B 2 254 ? 24.883  19.438  47.060  1.00 257.57 ? 231 PHE C CG    1 
ATOM   4956 C  CD1   . PHE B 2 254 ? 25.752  18.373  46.909  1.00 253.86 ? 231 PHE C CD1   1 
ATOM   4957 C  CD2   . PHE B 2 254 ? 24.593  20.208  45.947  1.00 256.06 ? 231 PHE C CD2   1 
ATOM   4958 C  CE1   . PHE B 2 254 ? 26.302  18.071  45.671  1.00 255.51 ? 231 PHE C CE1   1 
ATOM   4959 C  CE2   . PHE B 2 254 ? 25.137  19.907  44.711  1.00 257.60 ? 231 PHE C CE2   1 
ATOM   4960 C  CZ    . PHE B 2 254 ? 25.995  18.838  44.577  1.00 257.82 ? 231 PHE C CZ    1 
ATOM   4961 N  N     . VAL B 2 255 ? 25.027  18.501  51.319  1.00 245.44 ? 232 VAL C N     1 
ATOM   4962 C  CA    . VAL B 2 255 ? 26.117  17.996  52.156  1.00 207.45 ? 232 VAL C CA    1 
ATOM   4963 C  C     . VAL B 2 255 ? 25.705  16.691  52.772  1.00 214.68 ? 232 VAL C C     1 
ATOM   4964 O  O     . VAL B 2 255 ? 26.545  15.845  53.097  1.00 203.59 ? 232 VAL C O     1 
ATOM   4965 C  CB    . VAL B 2 255 ? 26.521  18.941  53.286  1.00 169.13 ? 232 VAL C CB    1 
ATOM   4966 C  CG1   . VAL B 2 255 ? 27.956  18.634  53.735  1.00 158.81 ? 232 VAL C CG1   1 
ATOM   4967 C  CG2   . VAL B 2 255 ? 26.427  20.354  52.819  1.00 173.70 ? 232 VAL C CG2   1 
ATOM   4968 N  N     . SER B 2 256 ? 24.403  16.527  52.946  1.00 233.69 ? 233 SER C N     1 
ATOM   4969 C  CA    . SER B 2 256 ? 23.884  15.239  53.344  1.00 242.95 ? 233 SER C CA    1 
ATOM   4970 C  C     . SER B 2 256 ? 24.134  14.276  52.188  1.00 252.63 ? 233 SER C C     1 
ATOM   4971 O  O     . SER B 2 256 ? 24.863  13.287  52.348  1.00 252.46 ? 233 SER C O     1 
ATOM   4972 C  CB    . SER B 2 256 ? 22.406  15.345  53.663  1.00 241.18 ? 233 SER C CB    1 
ATOM   4973 O  OG    . SER B 2 256 ? 22.142  16.603  54.252  1.00 233.90 ? 233 SER C OG    1 
ATOM   4974 N  N     . TYR B 2 257 ? 23.578  14.588  51.015  1.00 254.16 ? 234 TYR C N     1 
ATOM   4975 C  CA    . TYR B 2 257 ? 23.771  13.756  49.825  1.00 240.21 ? 234 TYR C CA    1 
ATOM   4976 C  C     . TYR B 2 257 ? 25.223  13.374  49.601  1.00 228.29 ? 234 TYR C C     1 
ATOM   4977 O  O     . TYR B 2 257 ? 25.522  12.371  48.972  1.00 204.07 ? 234 TYR C O     1 
ATOM   4978 C  CB    . TYR B 2 257 ? 23.251  14.457  48.580  1.00 223.81 ? 234 TYR C CB    1 
ATOM   4979 C  CG    . TYR B 2 257 ? 23.620  13.761  47.275  1.00 198.27 ? 234 TYR C CG    1 
ATOM   4980 C  CD1   . TYR B 2 257 ? 23.024  12.558  46.905  1.00 198.76 ? 234 TYR C CD1   1 
ATOM   4981 C  CD2   . TYR B 2 257 ? 24.552  14.313  46.412  1.00 189.43 ? 234 TYR C CD2   1 
ATOM   4982 C  CE1   . TYR B 2 257 ? 23.352  11.935  45.713  1.00 201.41 ? 234 TYR C CE1   1 
ATOM   4983 C  CE2   . TYR B 2 257 ? 24.880  13.701  45.222  1.00 192.85 ? 234 TYR C CE2   1 
ATOM   4984 C  CZ    . TYR B 2 257 ? 24.285  12.515  44.875  1.00 199.97 ? 234 TYR C CZ    1 
ATOM   4985 O  OH    . TYR B 2 257 ? 24.634  11.909  43.683  1.00 206.06 ? 234 TYR C OH    1 
ATOM   4986 N  N     . LEU B 2 258 ? 26.124  14.177  50.133  1.00 237.72 ? 235 LEU C N     1 
ATOM   4987 C  CA    . LEU B 2 258 ? 27.536  13.960  49.929  1.00 231.49 ? 235 LEU C CA    1 
ATOM   4988 C  C     . LEU B 2 258 ? 28.090  13.032  50.990  1.00 235.13 ? 235 LEU C C     1 
ATOM   4989 O  O     . LEU B 2 258 ? 29.130  12.399  50.783  1.00 236.75 ? 235 LEU C O     1 
ATOM   4990 C  CB    . LEU B 2 258 ? 28.272  15.303  49.969  1.00 209.76 ? 235 LEU C CB    1 
ATOM   4991 C  CG    . LEU B 2 258 ? 28.982  15.691  48.680  1.00 197.42 ? 235 LEU C CG    1 
ATOM   4992 C  CD1   . LEU B 2 258 ? 28.045  15.483  47.513  1.00 204.23 ? 235 LEU C CD1   1 
ATOM   4993 C  CD2   . LEU B 2 258 ? 29.450  17.123  48.758  1.00 188.32 ? 235 LEU C CD2   1 
ATOM   4994 N  N     . ASN B 2 259 ? 27.403  12.973  52.129  1.00 227.83 ? 236 ASN C N     1 
ATOM   4995 C  CA    . ASN B 2 259 ? 27.879  12.216  53.286  1.00 202.41 ? 236 ASN C CA    1 
ATOM   4996 C  C     . ASN B 2 259 ? 26.910  11.121  53.691  1.00 181.30 ? 236 ASN C C     1 
ATOM   4997 O  O     . ASN B 2 259 ? 26.882  10.704  54.847  1.00 176.33 ? 236 ASN C O     1 
ATOM   4998 C  CB    . ASN B 2 259 ? 28.141  13.140  54.477  1.00 196.20 ? 236 ASN C CB    1 
ATOM   4999 C  CG    . ASN B 2 259 ? 29.566  13.643  54.523  1.00 179.73 ? 236 ASN C CG    1 
ATOM   5000 O  OD1   . ASN B 2 259 ? 30.339  13.481  53.573  1.00 185.08 ? 236 ASN C OD1   1 
ATOM   5001 N  ND2   . ASN B 2 259 ? 29.923  14.272  55.627  1.00 158.74 ? 236 ASN C ND2   1 
ATOM   5002 N  N     . GLU B 2 260 ? 26.128  10.658  52.719  1.00 191.98 ? 237 GLU C N     1 
ATOM   5003 C  CA    . GLU B 2 260 ? 25.075  9.677   52.956  1.00 201.69 ? 237 GLU C CA    1 
ATOM   5004 C  C     . GLU B 2 260 ? 25.529  8.409   53.679  1.00 201.97 ? 237 GLU C C     1 
ATOM   5005 O  O     . GLU B 2 260 ? 25.049  8.104   54.772  1.00 203.89 ? 237 GLU C O     1 
ATOM   5006 C  CB    . GLU B 2 260 ? 24.372  9.321   51.645  1.00 209.26 ? 237 GLU C CB    1 
ATOM   5007 C  CG    . GLU B 2 260 ? 23.191  10.225  51.332  1.00 215.33 ? 237 GLU C CG    1 
ATOM   5008 C  CD    . GLU B 2 260 ? 22.291  9.664   50.245  1.00 227.21 ? 237 GLU C CD    1 
ATOM   5009 O  OE1   . GLU B 2 260 ? 22.371  8.444   49.965  1.00 231.86 ? 237 GLU C OE1   1 
ATOM   5010 O  OE2   . GLU B 2 260 ? 21.499  10.448  49.671  1.00 235.62 ? 237 GLU C OE2   1 
ATOM   5011 N  N     . ASP B 2 261 ? 26.443  7.665   53.075  1.00 198.87 ? 238 ASP C N     1 
ATOM   5012 C  CA    . ASP B 2 261 ? 26.863  6.406   53.676  1.00 195.00 ? 238 ASP C CA    1 
ATOM   5013 C  C     . ASP B 2 261 ? 28.157  6.559   54.469  1.00 187.71 ? 238 ASP C C     1 
ATOM   5014 O  O     . ASP B 2 261 ? 28.927  5.602   54.588  1.00 193.16 ? 238 ASP C O     1 
ATOM   5015 C  CB    . ASP B 2 261 ? 27.015  5.314   52.611  1.00 196.76 ? 238 ASP C CB    1 
ATOM   5016 N  N     . LYS B 2 262 ? 28.396  7.752   55.010  1.00 172.92 ? 239 LYS C N     1 
ATOM   5017 C  CA    . LYS B 2 262 ? 29.614  7.985   55.780  1.00 159.18 ? 239 LYS C CA    1 
ATOM   5018 C  C     . LYS B 2 262 ? 29.309  8.257   57.253  1.00 151.97 ? 239 LYS C C     1 
ATOM   5019 O  O     . LYS B 2 262 ? 28.164  8.531   57.616  1.00 150.02 ? 239 LYS C O     1 
ATOM   5020 C  CB    . LYS B 2 262 ? 30.420  9.132   55.163  1.00 155.08 ? 239 LYS C CB    1 
ATOM   5021 N  N     . GLU B 2 263 ? 30.331  8.174   58.103  1.00 149.02 ? 240 GLU C N     1 
ATOM   5022 C  CA    . GLU B 2 263 ? 30.150  8.485   59.526  1.00 149.87 ? 240 GLU C CA    1 
ATOM   5023 C  C     . GLU B 2 263 ? 30.537  9.936   59.873  1.00 150.04 ? 240 GLU C C     1 
ATOM   5024 O  O     . GLU B 2 263 ? 31.430  10.521  59.266  1.00 152.20 ? 240 GLU C O     1 
ATOM   5025 C  CB    . GLU B 2 263 ? 30.866  7.467   60.428  1.00 140.76 ? 240 GLU C CB    1 
ATOM   5026 N  N     . ILE B 2 264 ? 29.879  10.483  60.889  1.00 142.98 ? 241 ILE C N     1 
ATOM   5027 C  CA    . ILE B 2 264 ? 29.705  11.918  61.042  1.00 147.57 ? 241 ILE C CA    1 
ATOM   5028 C  C     . ILE B 2 264 ? 30.301  12.533  62.313  1.00 156.73 ? 241 ILE C C     1 
ATOM   5029 O  O     . ILE B 2 264 ? 29.733  12.401  63.395  1.00 151.44 ? 241 ILE C O     1 
ATOM   5030 C  CB    . ILE B 2 264 ? 28.204  12.199  61.022  1.00 157.10 ? 241 ILE C CB    1 
ATOM   5031 C  CG1   . ILE B 2 264 ? 27.614  11.631  59.739  1.00 156.20 ? 241 ILE C CG1   1 
ATOM   5032 C  CG2   . ILE B 2 264 ? 27.922  13.669  61.125  1.00 166.27 ? 241 ILE C CG2   1 
ATOM   5033 C  CD1   . ILE B 2 264 ? 28.280  12.198  58.501  1.00 151.04 ? 241 ILE C CD1   1 
ATOM   5034 N  N     . LEU B 2 265 ? 31.417  13.248  62.168  1.00 172.42 ? 242 LEU C N     1 
ATOM   5035 C  CA    . LEU B 2 265 ? 32.104  13.898  63.303  1.00 183.40 ? 242 LEU C CA    1 
ATOM   5036 C  C     . LEU B 2 265 ? 31.373  15.130  63.898  1.00 239.87 ? 242 LEU C C     1 
ATOM   5037 O  O     . LEU B 2 265 ? 31.395  15.344  65.110  1.00 247.64 ? 242 LEU C O     1 
ATOM   5038 C  CB    . LEU B 2 265 ? 33.540  14.294  62.916  1.00 183.10 ? 242 LEU C CB    1 
ATOM   5039 C  CG    . LEU B 2 265 ? 34.618  13.257  62.550  1.00 176.92 ? 242 LEU C CG    1 
ATOM   5040 C  CD1   . LEU B 2 265 ? 35.810  13.327  63.503  1.00 178.08 ? 242 LEU C CD1   1 
ATOM   5041 C  CD2   . LEU B 2 265 ? 34.084  11.832  62.479  1.00 171.36 ? 242 LEU C CD2   1 
ATOM   5042 N  N     . THR B 2 266 ? 30.758  15.940  63.038  1.00 235.04 ? 243 THR C N     1 
ATOM   5043 C  CA    . THR B 2 266 ? 30.060  17.163  63.433  1.00 238.31 ? 243 THR C CA    1 
ATOM   5044 C  C     . THR B 2 266 ? 28.764  17.184  62.654  1.00 233.07 ? 243 THR C C     1 
ATOM   5045 O  O     . THR B 2 266 ? 28.690  16.565  61.601  1.00 241.43 ? 243 THR C O     1 
ATOM   5046 C  CB    . THR B 2 266 ? 30.827  18.420  62.973  1.00 247.13 ? 243 THR C CB    1 
ATOM   5047 O  OG1   . THR B 2 266 ? 30.510  18.694  61.604  1.00 268.98 ? 243 THR C OG1   1 
ATOM   5048 C  CG2   . THR B 2 266 ? 32.332  18.246  63.114  1.00 230.71 ? 243 THR C CG2   1 
ATOM   5049 N  N     . PRO B 2 267 ? 27.749  17.930  63.126  1.00 215.92 ? 244 PRO C N     1 
ATOM   5050 C  CA    . PRO B 2 267 ? 26.512  18.020  62.336  1.00 216.96 ? 244 PRO C CA    1 
ATOM   5051 C  C     . PRO B 2 267 ? 26.711  18.945  61.147  1.00 237.02 ? 244 PRO C C     1 
ATOM   5052 O  O     . PRO B 2 267 ? 27.849  19.294  60.836  1.00 256.22 ? 244 PRO C O     1 
ATOM   5053 C  CB    . PRO B 2 267 ? 25.537  18.655  63.307  1.00 198.64 ? 244 PRO C CB    1 
ATOM   5054 C  CG    . PRO B 2 267 ? 26.408  19.536  64.129  1.00 191.30 ? 244 PRO C CG    1 
ATOM   5055 C  CD    . PRO B 2 267 ? 27.692  18.788  64.319  1.00 198.58 ? 244 PRO C CD    1 
ATOM   5056 N  N     . VAL B 2 268 ? 25.631  19.349  60.488  1.00 229.46 ? 245 VAL C N     1 
ATOM   5057 C  CA    . VAL B 2 268 ? 25.761  20.232  59.328  1.00 217.11 ? 245 VAL C CA    1 
ATOM   5058 C  C     . VAL B 2 268 ? 25.825  21.708  59.734  1.00 231.62 ? 245 VAL C C     1 
ATOM   5059 O  O     . VAL B 2 268 ? 24.906  22.237  60.361  1.00 229.61 ? 245 VAL C O     1 
ATOM   5060 C  CB    . VAL B 2 268 ? 24.621  20.028  58.313  1.00 192.81 ? 245 VAL C CB    1 
ATOM   5061 C  CG1   . VAL B 2 268 ? 25.149  20.188  56.919  1.00 178.61 ? 245 VAL C CG1   1 
ATOM   5062 C  CG2   . VAL B 2 268 ? 24.012  18.653  58.470  1.00 188.87 ? 245 VAL C CG2   1 
ATOM   5063 N  N     . LEU B 2 269 ? 26.926  22.355  59.366  1.00 245.33 ? 246 LEU C N     1 
ATOM   5064 C  CA    . LEU B 2 269 ? 27.150  23.766  59.656  1.00 252.55 ? 246 LEU C CA    1 
ATOM   5065 C  C     . LEU B 2 269 ? 26.812  24.578  58.416  1.00 225.97 ? 246 LEU C C     1 
ATOM   5066 O  O     . LEU B 2 269 ? 27.367  24.350  57.349  1.00 223.86 ? 246 LEU C O     1 
ATOM   5067 C  CB    . LEU B 2 269 ? 28.616  24.010  60.019  1.00 277.68 ? 246 LEU C CB    1 
ATOM   5068 C  CG    . LEU B 2 269 ? 29.196  23.645  61.386  1.00 290.84 ? 246 LEU C CG    1 
ATOM   5069 C  CD1   . LEU B 2 269 ? 28.826  22.248  61.822  1.00 290.25 ? 246 LEU C CD1   1 
ATOM   5070 C  CD2   . LEU B 2 269 ? 30.708  23.788  61.332  1.00 295.58 ? 246 LEU C CD2   1 
ATOM   5071 N  N     . TYR B 2 270 ? 25.915  25.542  58.564  1.00 205.44 ? 247 TYR C N     1 
ATOM   5072 C  CA    . TYR B 2 270 ? 25.436  26.322  57.432  1.00 194.82 ? 247 TYR C CA    1 
ATOM   5073 C  C     . TYR B 2 270 ? 25.597  27.827  57.656  1.00 189.70 ? 247 TYR C C     1 
ATOM   5074 O  O     . TYR B 2 270 ? 25.114  28.358  58.652  1.00 175.61 ? 247 TYR C O     1 
ATOM   5075 C  CB    . TYR B 2 270 ? 23.972  25.985  57.181  1.00 191.32 ? 247 TYR C CB    1 
ATOM   5076 C  CG    . TYR B 2 270 ? 23.310  26.912  56.218  1.00 187.63 ? 247 TYR C CG    1 
ATOM   5077 C  CD1   . TYR B 2 270 ? 23.838  27.115  54.954  1.00 188.06 ? 247 TYR C CD1   1 
ATOM   5078 C  CD2   . TYR B 2 270 ? 22.155  27.579  56.559  1.00 191.08 ? 247 TYR C CD2   1 
ATOM   5079 C  CE1   . TYR B 2 270 ? 23.241  27.958  54.060  1.00 192.76 ? 247 TYR C CE1   1 
ATOM   5080 C  CE2   . TYR B 2 270 ? 21.542  28.425  55.666  1.00 204.27 ? 247 TYR C CE2   1 
ATOM   5081 C  CZ    . TYR B 2 270 ? 22.091  28.609  54.416  1.00 206.03 ? 247 TYR C CZ    1 
ATOM   5082 O  OH    . TYR B 2 270 ? 21.490  29.458  53.521  1.00 219.66 ? 247 TYR C OH    1 
ATOM   5083 N  N     . PHE B 2 271 ? 26.257  28.508  56.720  1.00 200.13 ? 248 PHE C N     1 
ATOM   5084 C  CA    . PHE B 2 271 ? 26.548  29.943  56.853  1.00 201.80 ? 248 PHE C CA    1 
ATOM   5085 C  C     . PHE B 2 271 ? 26.073  30.809  55.677  1.00 191.57 ? 248 PHE C C     1 
ATOM   5086 O  O     . PHE B 2 271 ? 26.601  30.702  54.573  1.00 194.43 ? 248 PHE C O     1 
ATOM   5087 C  CB    . PHE B 2 271 ? 28.042  30.128  57.082  1.00 214.01 ? 248 PHE C CB    1 
ATOM   5088 C  CG    . PHE B 2 271 ? 28.547  29.376  58.265  1.00 223.86 ? 248 PHE C CG    1 
ATOM   5089 C  CD1   . PHE B 2 271 ? 27.923  29.508  59.492  1.00 214.84 ? 248 PHE C CD1   1 
ATOM   5090 C  CD2   . PHE B 2 271 ? 29.616  28.512  58.149  1.00 238.77 ? 248 PHE C CD2   1 
ATOM   5091 C  CE1   . PHE B 2 271 ? 28.370  28.814  60.590  1.00 214.63 ? 248 PHE C CE1   1 
ATOM   5092 C  CE2   . PHE B 2 271 ? 30.067  27.798  59.247  1.00 238.56 ? 248 PHE C CE2   1 
ATOM   5093 C  CZ    . PHE B 2 271 ? 29.442  27.950  60.469  1.00 226.02 ? 248 PHE C CZ    1 
ATOM   5094 N  N     . GLU B 2 272 ? 25.077  31.665  55.931  1.00 187.59 ? 249 GLU C N     1 
ATOM   5095 C  CA    . GLU B 2 272 ? 24.485  32.539  54.901  1.00 194.22 ? 249 GLU C CA    1 
ATOM   5096 C  C     . GLU B 2 272 ? 25.016  33.990  54.986  1.00 196.05 ? 249 GLU C C     1 
ATOM   5097 O  O     . GLU B 2 272 ? 25.574  34.397  56.007  1.00 196.54 ? 249 GLU C O     1 
ATOM   5098 C  CB    . GLU B 2 272 ? 22.946  32.508  54.982  1.00 211.31 ? 249 GLU C CB    1 
ATOM   5099 N  N     . GLY B 2 273 ? 24.857  34.761  53.915  1.00 200.81 ? 250 GLY C N     1 
ATOM   5100 C  CA    . GLY B 2 273 ? 25.367  36.120  53.906  1.00 203.49 ? 250 GLY C CA    1 
ATOM   5101 C  C     . GLY B 2 273 ? 25.498  36.831  52.567  1.00 210.49 ? 250 GLY C C     1 
ATOM   5102 O  O     . GLY B 2 273 ? 26.017  36.277  51.595  1.00 203.13 ? 250 GLY C O     1 
ATOM   5103 N  N     . GLU B 2 274 ? 25.007  38.073  52.537  1.00 221.69 ? 251 GLU C N     1 
ATOM   5104 C  CA    . GLU B 2 274 ? 25.232  39.020  51.443  1.00 223.44 ? 251 GLU C CA    1 
ATOM   5105 C  C     . GLU B 2 274 ? 26.368  39.961  51.861  1.00 222.91 ? 251 GLU C C     1 
ATOM   5106 O  O     . GLU B 2 274 ? 26.484  40.290  53.039  1.00 221.22 ? 251 GLU C O     1 
ATOM   5107 C  CB    . GLU B 2 274 ? 23.964  39.851  51.171  1.00 224.74 ? 251 GLU C CB    1 
ATOM   5108 C  CG    . GLU B 2 274 ? 22.739  39.066  50.705  1.00 221.98 ? 251 GLU C CG    1 
ATOM   5109 N  N     . ASP B 2 275 ? 27.202  40.386  50.915  1.00 231.37 ? 252 ASP C N     1 
ATOM   5110 C  CA    . ASP B 2 275 ? 28.252  41.372  51.210  1.00 249.41 ? 252 ASP C CA    1 
ATOM   5111 C  C     . ASP B 2 275 ? 28.779  42.071  49.960  1.00 278.14 ? 252 ASP C C     1 
ATOM   5112 O  O     . ASP B 2 275 ? 29.635  41.545  49.248  1.00 291.81 ? 252 ASP C O     1 
ATOM   5113 C  CB    . ASP B 2 275 ? 29.407  40.745  51.990  1.00 237.61 ? 252 ASP C CB    1 
ATOM   5114 N  N     . ASN B 2 276 ? 28.273  43.278  49.737  1.00 285.04 ? 253 ASN C N     1 
ATOM   5115 C  CA    . ASN B 2 276 ? 28.517  44.056  48.517  1.00 290.20 ? 253 ASN C CA    1 
ATOM   5116 C  C     . ASN B 2 276 ? 28.387  43.299  47.182  1.00 295.31 ? 253 ASN C C     1 
ATOM   5117 O  O     . ASN B 2 276 ? 29.375  42.994  46.505  1.00 303.11 ? 253 ASN C O     1 
ATOM   5118 C  CB    . ASN B 2 276 ? 29.787  44.946  48.601  1.00 285.70 ? 253 ASN C CB    1 
ATOM   5119 C  CG    . ASN B 2 276 ? 31.090  44.156  48.682  1.00 288.68 ? 253 ASN C CG    1 
ATOM   5120 O  OD1   . ASN B 2 276 ? 31.810  44.226  49.680  1.00 289.07 ? 253 ASN C OD1   1 
ATOM   5121 N  ND2   . ASN B 2 276 ? 31.415  43.438  47.614  1.00 292.89 ? 253 ASN C ND2   1 
ATOM   5122 N  N     . GLY B 2 277 ? 27.136  43.011  46.829  1.00 291.86 ? 254 GLY C N     1 
ATOM   5123 C  CA    . GLY B 2 277 ? 26.795  42.483  45.519  1.00 294.11 ? 254 GLY C CA    1 
ATOM   5124 C  C     . GLY B 2 277 ? 26.810  40.975  45.478  1.00 294.73 ? 254 GLY C C     1 
ATOM   5125 O  O     . GLY B 2 277 ? 26.057  40.344  44.729  1.00 302.06 ? 254 GLY C O     1 
ATOM   5126 N  N     . PHE B 2 278 ? 27.669  40.397  46.311  1.00 289.24 ? 255 PHE C N     1 
ATOM   5127 C  CA    . PHE B 2 278 ? 27.918  38.968  46.304  1.00 281.68 ? 255 PHE C CA    1 
ATOM   5128 C  C     . PHE B 2 278 ? 27.027  38.269  47.322  1.00 277.54 ? 255 PHE C C     1 
ATOM   5129 O  O     . PHE B 2 278 ? 26.780  38.785  48.414  1.00 283.74 ? 255 PHE C O     1 
ATOM   5130 C  CB    . PHE B 2 278 ? 29.402  38.692  46.561  1.00 257.98 ? 255 PHE C CB    1 
ATOM   5131 C  CG    . PHE B 2 278 ? 30.298  39.109  45.426  1.00 226.91 ? 255 PHE C CG    1 
ATOM   5132 C  CD1   . PHE B 2 278 ? 30.382  40.440  45.038  1.00 223.78 ? 255 PHE C CD1   1 
ATOM   5133 C  CD2   . PHE B 2 278 ? 31.052  38.178  44.744  1.00 207.54 ? 255 PHE C CD2   1 
ATOM   5134 C  CE1   . PHE B 2 278 ? 31.196  40.837  43.988  1.00 226.16 ? 255 PHE C CE1   1 
ATOM   5135 C  CE2   . PHE B 2 278 ? 31.871  38.567  43.702  1.00 212.48 ? 255 PHE C CE2   1 
ATOM   5136 C  CZ    . PHE B 2 278 ? 31.942  39.902  43.321  1.00 219.87 ? 255 PHE C CZ    1 
ATOM   5137 N  N     . GLN B 2 279 ? 26.526  37.101  46.939  1.00 256.76 ? 256 GLN C N     1 
ATOM   5138 C  CA    . GLN B 2 279 ? 25.676  36.297  47.811  1.00 228.71 ? 256 GLN C CA    1 
ATOM   5139 C  C     . GLN B 2 279 ? 26.291  34.901  48.020  1.00 221.87 ? 256 GLN C C     1 
ATOM   5140 O  O     . GLN B 2 279 ? 26.169  34.034  47.156  1.00 220.37 ? 256 GLN C O     1 
ATOM   5141 C  CB    . GLN B 2 279 ? 24.264  36.202  47.218  1.00 220.68 ? 256 GLN C CB    1 
ATOM   5142 C  CG    . GLN B 2 279 ? 23.211  35.695  48.184  1.00 220.82 ? 256 GLN C CG    1 
ATOM   5143 N  N     . VAL B 2 280 ? 26.962  34.700  49.156  1.00 219.25 ? 257 VAL C N     1 
ATOM   5144 C  CA    . VAL B 2 280 ? 27.586  33.409  49.461  1.00 212.69 ? 257 VAL C CA    1 
ATOM   5145 C  C     . VAL B 2 280 ? 26.784  32.602  50.479  1.00 204.91 ? 257 VAL C C     1 
ATOM   5146 O  O     . VAL B 2 280 ? 26.159  33.151  51.385  1.00 207.61 ? 257 VAL C O     1 
ATOM   5147 C  CB    . VAL B 2 280 ? 29.076  33.536  49.898  1.00 201.91 ? 257 VAL C CB    1 
ATOM   5148 C  CG1   . VAL B 2 280 ? 29.557  34.967  49.763  1.00 191.96 ? 257 VAL C CG1   1 
ATOM   5149 C  CG2   . VAL B 2 280 ? 29.308  33.003  51.313  1.00 205.52 ? 257 VAL C CG2   1 
ATOM   5150 N  N     . GLU B 2 281 ? 26.811  31.288  50.305  1.00 203.83 ? 258 GLU C N     1 
ATOM   5151 C  CA    . GLU B 2 281 ? 25.954  30.388  51.045  1.00 201.19 ? 258 GLU C CA    1 
ATOM   5152 C  C     . GLU B 2 281 ? 26.679  29.054  51.139  1.00 194.34 ? 258 GLU C C     1 
ATOM   5153 O  O     . GLU B 2 281 ? 26.853  28.376  50.127  1.00 195.18 ? 258 GLU C O     1 
ATOM   5154 C  CB    . GLU B 2 281 ? 24.657  30.226  50.275  1.00 207.66 ? 258 GLU C CB    1 
ATOM   5155 C  CG    . GLU B 2 281 ? 23.585  29.498  51.018  1.00 205.02 ? 258 GLU C CG    1 
ATOM   5156 C  CD    . GLU B 2 281 ? 22.291  29.433  50.238  1.00 216.37 ? 258 GLU C CD    1 
ATOM   5157 O  OE1   . GLU B 2 281 ? 22.110  28.453  49.472  1.00 219.64 ? 258 GLU C OE1   1 
ATOM   5158 O  OE2   . GLU B 2 281 ? 21.459  30.363  50.392  1.00 223.56 ? 258 GLU C OE2   1 
ATOM   5159 N  N     . VAL B 2 282 ? 27.127  28.690  52.342  1.00 199.78 ? 259 VAL C N     1 
ATOM   5160 C  CA    . VAL B 2 282 ? 27.949  27.493  52.527  1.00 207.13 ? 259 VAL C CA    1 
ATOM   5161 C  C     . VAL B 2 282 ? 27.416  26.581  53.607  1.00 189.89 ? 259 VAL C C     1 
ATOM   5162 O  O     . VAL B 2 282 ? 26.976  27.046  54.658  1.00 188.68 ? 259 VAL C O     1 
ATOM   5163 C  CB    . VAL B 2 282 ? 29.372  27.841  52.979  1.00 223.61 ? 259 VAL C CB    1 
ATOM   5164 C  CG1   . VAL B 2 282 ? 30.346  26.813  52.468  1.00 247.56 ? 259 VAL C CG1   1 
ATOM   5165 C  CG2   . VAL B 2 282 ? 29.758  29.200  52.485  1.00 213.03 ? 259 VAL C CG2   1 
ATOM   5166 N  N     . ALA B 2 283 ? 27.474  25.276  53.356  1.00 177.79 ? 260 ALA C N     1 
ATOM   5167 C  CA    . ALA B 2 283 ? 27.323  24.282  54.418  1.00 173.25 ? 260 ALA C CA    1 
ATOM   5168 C  C     . ALA B 2 283 ? 28.592  23.430  54.572  1.00 170.66 ? 260 ALA C C     1 
ATOM   5169 O  O     . ALA B 2 283 ? 29.240  23.073  53.586  1.00 170.38 ? 260 ALA C O     1 
ATOM   5170 C  CB    . ALA B 2 283 ? 26.088  23.413  54.196  1.00 170.46 ? 260 ALA C CB    1 
ATOM   5171 N  N     . LEU B 2 284 ? 28.962  23.128  55.811  1.00 164.03 ? 261 LEU C N     1 
ATOM   5172 C  CA    . LEU B 2 284 ? 30.160  22.331  56.070  1.00 169.57 ? 261 LEU C CA    1 
ATOM   5173 C  C     . LEU B 2 284 ? 29.825  21.131  56.997  1.00 171.02 ? 261 LEU C C     1 
ATOM   5174 O  O     . LEU B 2 284 ? 29.043  21.289  57.933  1.00 176.73 ? 261 LEU C O     1 
ATOM   5175 C  CB    . LEU B 2 284 ? 31.264  23.234  56.649  1.00 185.35 ? 261 LEU C CB    1 
ATOM   5176 N  N     . GLN B 2 285 ? 30.367  19.937  56.719  1.00 164.06 ? 262 GLN C N     1 
ATOM   5177 C  CA    . GLN B 2 285 ? 30.168  18.753  57.601  1.00 156.70 ? 262 GLN C CA    1 
ATOM   5178 C  C     . GLN B 2 285 ? 31.263  17.671  57.539  1.00 155.46 ? 262 GLN C C     1 
ATOM   5179 O  O     . GLN B 2 285 ? 31.381  16.945  56.548  1.00 162.83 ? 262 GLN C O     1 
ATOM   5180 C  CB    . GLN B 2 285 ? 28.811  18.085  57.372  1.00 161.74 ? 262 GLN C CB    1 
ATOM   5181 C  CG    . GLN B 2 285 ? 28.532  16.953  58.345  1.00 172.26 ? 262 GLN C CG    1 
ATOM   5182 C  CD    . GLN B 2 285 ? 27.409  16.043  57.879  1.00 183.77 ? 262 GLN C CD    1 
ATOM   5183 O  OE1   . GLN B 2 285 ? 27.477  15.457  56.797  1.00 177.73 ? 262 GLN C OE1   1 
ATOM   5184 N  NE2   . GLN B 2 285 ? 26.365  15.921  58.692  1.00 196.13 ? 262 GLN C NE2   1 
ATOM   5185 N  N     . TYR B 2 286 ? 32.028  17.545  58.620  1.00 146.25 ? 263 TYR C N     1 
ATOM   5186 C  CA    . TYR B 2 286 ? 33.161  16.626  58.672  1.00 137.24 ? 263 TYR C CA    1 
ATOM   5187 C  C     . TYR B 2 286 ? 32.773  15.156  58.714  1.00 143.54 ? 263 TYR C C     1 
ATOM   5188 O  O     . TYR B 2 286 ? 31.729  14.798  59.254  1.00 148.31 ? 263 TYR C O     1 
ATOM   5189 C  CB    . TYR B 2 286 ? 33.929  16.871  59.945  1.00 133.57 ? 263 TYR C CB    1 
ATOM   5190 C  CG    . TYR B 2 286 ? 34.929  17.972  59.907  1.00 136.64 ? 263 TYR C CG    1 
ATOM   5191 C  CD1   . TYR B 2 286 ? 36.214  17.744  59.453  1.00 138.82 ? 263 TYR C CD1   1 
ATOM   5192 C  CD2   . TYR B 2 286 ? 34.614  19.224  60.391  1.00 143.46 ? 263 TYR C CD2   1 
ATOM   5193 C  CE1   . TYR B 2 286 ? 37.153  18.745  59.454  1.00 143.08 ? 263 TYR C CE1   1 
ATOM   5194 C  CE2   . TYR B 2 286 ? 35.542  20.238  60.390  1.00 148.74 ? 263 TYR C CE2   1 
ATOM   5195 C  CZ    . TYR B 2 286 ? 36.812  19.994  59.926  1.00 147.75 ? 263 TYR C CZ    1 
ATOM   5196 O  OH    . TYR B 2 286 ? 37.742  21.005  59.938  1.00 151.88 ? 263 TYR C OH    1 
ATOM   5197 N  N     . ASN B 2 287 ? 33.642  14.301  58.181  1.00 146.89 ? 264 ASN C N     1 
ATOM   5198 C  CA    . ASN B 2 287 ? 33.533  12.855  58.408  1.00 153.75 ? 264 ASN C CA    1 
ATOM   5199 C  C     . ASN B 2 287 ? 34.827  12.177  58.911  1.00 177.52 ? 264 ASN C C     1 
ATOM   5200 O  O     . ASN B 2 287 ? 35.885  12.806  59.051  1.00 182.13 ? 264 ASN C O     1 
ATOM   5201 C  CB    . ASN B 2 287 ? 32.936  12.107  57.194  1.00 157.82 ? 264 ASN C CB    1 
ATOM   5202 C  CG    . ASN B 2 287 ? 33.532  12.542  55.868  1.00 166.21 ? 264 ASN C CG    1 
ATOM   5203 O  OD1   . ASN B 2 287 ? 34.669  12.206  55.536  1.00 167.00 ? 264 ASN C OD1   1 
ATOM   5204 N  ND2   . ASN B 2 287 ? 32.746  13.268  55.085  1.00 172.59 ? 264 ASN C ND2   1 
ATOM   5205 N  N     . ASP B 2 288 ? 34.730  10.885  59.197  1.00 200.44 ? 265 ASP C N     1 
ATOM   5206 C  CA    . ASP B 2 288 ? 35.893  10.149  59.661  1.00 220.50 ? 265 ASP C CA    1 
ATOM   5207 C  C     . ASP B 2 288 ? 36.820  9.816   58.501  1.00 231.87 ? 265 ASP C C     1 
ATOM   5208 O  O     . ASP B 2 288 ? 37.843  9.149   58.675  1.00 241.79 ? 265 ASP C O     1 
ATOM   5209 C  CB    . ASP B 2 288 ? 35.466  8.869   60.369  1.00 225.37 ? 265 ASP C CB    1 
ATOM   5210 C  CG    . ASP B 2 288 ? 34.462  8.069   59.572  1.00 229.40 ? 265 ASP C CG    1 
ATOM   5211 O  OD1   . ASP B 2 288 ? 34.249  8.374   58.379  1.00 246.22 ? 265 ASP C OD1   1 
ATOM   5212 O  OD2   . ASP B 2 288 ? 33.889  7.124   60.151  1.00 217.40 ? 265 ASP C OD2   1 
ATOM   5213 N  N     . GLY B 2 289 ? 36.443  10.282  57.316  1.00 228.54 ? 266 GLY C N     1 
ATOM   5214 C  CA    . GLY B 2 289 ? 37.223  10.053  56.121  1.00 225.02 ? 266 GLY C CA    1 
ATOM   5215 C  C     . GLY B 2 289 ? 38.549  10.778  56.166  1.00 225.85 ? 266 GLY C C     1 
ATOM   5216 O  O     . GLY B 2 289 ? 38.905  11.402  57.173  1.00 222.41 ? 266 GLY C O     1 
ATOM   5217 N  N     . PHE B 2 290 ? 39.279  10.690  55.061  1.00 234.89 ? 267 PHE C N     1 
ATOM   5218 C  CA    . PHE B 2 290 ? 40.589  11.302  54.941  1.00 245.74 ? 267 PHE C CA    1 
ATOM   5219 C  C     . PHE B 2 290 ? 40.571  12.355  53.844  1.00 246.56 ? 267 PHE C C     1 
ATOM   5220 O  O     . PHE B 2 290 ? 40.899  13.519  54.076  1.00 255.87 ? 267 PHE C O     1 
ATOM   5221 C  CB    . PHE B 2 290 ? 41.617  10.232  54.617  1.00 250.80 ? 267 PHE C CB    1 
ATOM   5222 C  CG    . PHE B 2 290 ? 42.972  10.772  54.281  1.00 249.30 ? 267 PHE C CG    1 
ATOM   5223 C  CD1   . PHE B 2 290 ? 43.776  11.323  55.266  1.00 247.81 ? 267 PHE C CD1   1 
ATOM   5224 C  CD2   . PHE B 2 290 ? 43.455  10.703  52.981  1.00 243.89 ? 267 PHE C CD2   1 
ATOM   5225 C  CE1   . PHE B 2 290 ? 45.036  11.806  54.964  1.00 241.90 ? 267 PHE C CE1   1 
ATOM   5226 C  CE2   . PHE B 2 290 ? 44.714  11.186  52.669  1.00 238.33 ? 267 PHE C CE2   1 
ATOM   5227 C  CZ    . PHE B 2 290 ? 45.507  11.738  53.662  1.00 237.28 ? 267 PHE C CZ    1 
ATOM   5228 N  N     . SER B 2 291 ? 40.188  11.936  52.642  1.00 235.03 ? 268 SER C N     1 
ATOM   5229 C  CA    . SER B 2 291 ? 40.056  12.853  51.522  1.00 225.68 ? 268 SER C CA    1 
ATOM   5230 C  C     . SER B 2 291 ? 38.992  13.883  51.843  1.00 230.25 ? 268 SER C C     1 
ATOM   5231 O  O     . SER B 2 291 ? 37.889  13.527  52.274  1.00 240.46 ? 268 SER C O     1 
ATOM   5232 C  CB    . SER B 2 291 ? 39.674  12.100  50.246  1.00 219.30 ? 268 SER C CB    1 
ATOM   5233 N  N     . ASP B 2 292 ? 39.333  15.157  51.659  1.00 221.73 ? 269 ASP C N     1 
ATOM   5234 C  CA    . ASP B 2 292 ? 38.343  16.220  51.775  1.00 214.87 ? 269 ASP C CA    1 
ATOM   5235 C  C     . ASP B 2 292 ? 37.531  16.249  50.495  1.00 228.26 ? 269 ASP C C     1 
ATOM   5236 O  O     . ASP B 2 292 ? 37.952  15.701  49.471  1.00 230.08 ? 269 ASP C O     1 
ATOM   5237 C  CB    . ASP B 2 292 ? 38.986  17.583  52.025  1.00 193.67 ? 269 ASP C CB    1 
ATOM   5238 C  CG    . ASP B 2 292 ? 39.610  18.176  50.780  1.00 182.80 ? 269 ASP C CG    1 
ATOM   5239 O  OD1   . ASP B 2 292 ? 40.283  17.432  50.032  1.00 188.21 ? 269 ASP C OD1   1 
ATOM   5240 O  OD2   . ASP B 2 292 ? 39.430  19.395  50.553  1.00 186.21 ? 269 ASP C OD2   1 
ATOM   5241 N  N     . ASN B 2 293 ? 36.366  16.880  50.554  1.00 234.24 ? 270 ASN C N     1 
ATOM   5242 C  CA    . ASN B 2 293 ? 35.466  16.864  49.415  1.00 232.73 ? 270 ASN C CA    1 
ATOM   5243 C  C     . ASN B 2 293 ? 34.653  18.135  49.299  1.00 226.29 ? 270 ASN C C     1 
ATOM   5244 O  O     . ASN B 2 293 ? 33.537  18.219  49.815  1.00 216.79 ? 270 ASN C O     1 
ATOM   5245 C  CB    . ASN B 2 293 ? 34.538  15.666  49.500  1.00 224.85 ? 270 ASN C CB    1 
ATOM   5246 C  CG    . ASN B 2 293 ? 33.944  15.318  48.172  1.00 208.51 ? 270 ASN C CG    1 
ATOM   5247 O  OD1   . ASN B 2 293 ? 34.646  14.845  47.284  1.00 196.14 ? 270 ASN C OD1   1 
ATOM   5248 N  ND2   . ASN B 2 293 ? 32.648  15.551  48.016  1.00 205.59 ? 270 ASN C ND2   1 
ATOM   5249 N  N     . ILE B 2 294 ? 35.211  19.121  48.602  1.00 225.13 ? 271 ILE C N     1 
ATOM   5250 C  CA    . ILE B 2 294 ? 34.609  20.446  48.551  1.00 218.60 ? 271 ILE C CA    1 
ATOM   5251 C  C     . ILE B 2 294 ? 34.098  20.827  47.164  1.00 206.18 ? 271 ILE C C     1 
ATOM   5252 O  O     . ILE B 2 294 ? 34.869  20.981  46.220  1.00 194.18 ? 271 ILE C O     1 
ATOM   5253 C  CB    . ILE B 2 294 ? 35.582  21.509  49.086  1.00 218.45 ? 271 ILE C CB    1 
ATOM   5254 C  CG1   . ILE B 2 294 ? 35.625  21.440  50.608  1.00 217.37 ? 271 ILE C CG1   1 
ATOM   5255 C  CG2   . ILE B 2 294 ? 35.134  22.885  48.682  1.00 219.25 ? 271 ILE C CG2   1 
ATOM   5256 C  CD1   . ILE B 2 294 ? 36.974  21.740  51.182  1.00 211.54 ? 271 ILE C CD1   1 
ATOM   5257 N  N     . LEU B 2 295 ? 32.785  20.971  47.050  1.00 206.33 ? 272 LEU C N     1 
ATOM   5258 C  CA    . LEU B 2 295 ? 32.181  21.423  45.809  1.00 204.69 ? 272 LEU C CA    1 
ATOM   5259 C  C     . LEU B 2 295 ? 31.911  22.922  45.892  1.00 192.29 ? 272 LEU C C     1 
ATOM   5260 O  O     . LEU B 2 295 ? 31.601  23.439  46.969  1.00 191.12 ? 272 LEU C O     1 
ATOM   5261 C  CB    . LEU B 2 295 ? 30.869  20.692  45.567  1.00 218.39 ? 272 LEU C CB    1 
ATOM   5262 C  CG    . LEU B 2 295 ? 30.895  19.176  45.669  1.00 226.11 ? 272 LEU C CG    1 
ATOM   5263 C  CD1   . LEU B 2 295 ? 29.592  18.626  45.137  1.00 233.15 ? 272 LEU C CD1   1 
ATOM   5264 C  CD2   . LEU B 2 295 ? 32.058  18.647  44.887  1.00 229.79 ? 272 LEU C CD2   1 
ATOM   5265 N  N     . SER B 2 296 ? 32.019  23.613  44.756  1.00 195.79 ? 273 SER C N     1 
ATOM   5266 C  CA    . SER B 2 296 ? 31.820  25.062  44.700  1.00 212.44 ? 273 SER C CA    1 
ATOM   5267 C  C     . SER B 2 296 ? 30.885  25.438  43.563  1.00 220.91 ? 273 SER C C     1 
ATOM   5268 O  O     . SER B 2 296 ? 30.925  24.840  42.493  1.00 228.86 ? 273 SER C O     1 
ATOM   5269 C  CB    . SER B 2 296 ? 33.156  25.755  44.499  1.00 227.40 ? 273 SER C CB    1 
ATOM   5270 O  OG    . SER B 2 296 ? 33.846  25.125  43.437  1.00 241.99 ? 273 SER C OG    1 
ATOM   5271 N  N     . PHE B 2 297 ? 30.046  26.438  43.787  1.00 217.28 ? 274 PHE C N     1 
ATOM   5272 C  CA    . PHE B 2 297 ? 29.125  26.869  42.748  1.00 211.90 ? 274 PHE C CA    1 
ATOM   5273 C  C     . PHE B 2 297 ? 28.984  28.394  42.609  1.00 214.31 ? 274 PHE C C     1 
ATOM   5274 O  O     . PHE B 2 297 ? 28.545  29.079  43.532  1.00 210.02 ? 274 PHE C O     1 
ATOM   5275 C  CB    . PHE B 2 297 ? 27.754  26.256  42.995  1.00 204.73 ? 274 PHE C CB    1 
ATOM   5276 C  CG    . PHE B 2 297 ? 27.704  24.792  42.761  1.00 198.23 ? 274 PHE C CG    1 
ATOM   5277 C  CD1   . PHE B 2 297 ? 28.120  23.908  43.732  1.00 187.31 ? 274 PHE C CD1   1 
ATOM   5278 C  CD2   . PHE B 2 297 ? 27.227  24.290  41.570  1.00 208.49 ? 274 PHE C CD2   1 
ATOM   5279 C  CE1   . PHE B 2 297 ? 28.072  22.549  43.513  1.00 190.76 ? 274 PHE C CE1   1 
ATOM   5280 C  CE2   . PHE B 2 297 ? 27.174  22.935  41.348  1.00 211.69 ? 274 PHE C CE2   1 
ATOM   5281 C  CZ    . PHE B 2 297 ? 27.599  22.066  42.320  1.00 202.99 ? 274 PHE C CZ    1 
ATOM   5282 N  N     . VAL B 2 298 ? 29.344  28.926  41.449  1.00 238.26 ? 275 VAL C N     1 
ATOM   5283 C  CA    . VAL B 2 298 ? 29.002  30.311  41.159  1.00 277.04 ? 275 VAL C CA    1 
ATOM   5284 C  C     . VAL B 2 298 ? 27.912  30.412  40.104  1.00 324.75 ? 275 VAL C C     1 
ATOM   5285 O  O     . VAL B 2 298 ? 28.050  29.898  38.992  1.00 348.69 ? 275 VAL C O     1 
ATOM   5286 C  CB    . VAL B 2 298 ? 30.236  31.181  40.800  1.00 258.47 ? 275 VAL C CB    1 
ATOM   5287 C  CG1   . VAL B 2 298 ? 31.382  30.321  40.360  1.00 242.79 ? 275 VAL C CG1   1 
ATOM   5288 C  CG2   . VAL B 2 298 ? 29.882  32.259  39.770  1.00 277.65 ? 275 VAL C CG2   1 
ATOM   5289 N  N     . ASN B 2 299 ? 26.820  31.063  40.497  1.00 339.98 ? 276 ASN C N     1 
ATOM   5290 C  CA    . ASN B 2 299 ? 25.689  31.342  39.622  1.00 357.73 ? 276 ASN C CA    1 
ATOM   5291 C  C     . ASN B 2 299 ? 25.026  30.084  39.135  1.00 348.11 ? 276 ASN C C     1 
ATOM   5292 O  O     . ASN B 2 299 ? 24.792  29.928  37.937  1.00 373.05 ? 276 ASN C O     1 
ATOM   5293 C  CB    . ASN B 2 299 ? 26.113  32.203  38.435  1.00 386.84 ? 276 ASN C CB    1 
ATOM   5294 C  CG    . ASN B 2 299 ? 26.449  33.619  38.839  1.00 396.20 ? 276 ASN C CG    1 
ATOM   5295 O  OD1   . ASN B 2 299 ? 26.514  33.933  40.032  1.00 421.32 ? 276 ASN C OD1   1 
ATOM   5296 N  ND2   . ASN B 2 299 ? 26.647  34.490  37.850  1.00 396.66 ? 276 ASN C ND2   1 
ATOM   5297 N  N     . ASN B 2 300 ? 24.731  29.204  40.090  1.00 311.51 ? 277 ASN C N     1 
ATOM   5298 C  CA    . ASN B 2 300 ? 24.116  27.887  39.860  1.00 294.79 ? 277 ASN C CA    1 
ATOM   5299 C  C     . ASN B 2 300 ? 24.891  26.832  39.071  1.00 278.85 ? 277 ASN C C     1 
ATOM   5300 O  O     . ASN B 2 300 ? 24.424  25.711  39.016  1.00 266.34 ? 277 ASN C O     1 
ATOM   5301 C  CB    . ASN B 2 300 ? 22.685  27.986  39.315  1.00 308.16 ? 277 ASN C CB    1 
ATOM   5302 C  CG    . ASN B 2 300 ? 21.721  28.577  40.321  1.00 308.06 ? 277 ASN C CG    1 
ATOM   5303 O  OD1   . ASN B 2 300 ? 21.936  28.494  41.535  1.00 297.69 ? 277 ASN C OD1   1 
ATOM   5304 N  ND2   . ASN B 2 300 ? 20.643  29.188  39.818  1.00 319.31 ? 277 ASN C ND2   1 
ATOM   5305 N  N     . VAL B 2 301 ? 26.046  27.153  38.476  1.00 275.40 ? 278 VAL C N     1 
ATOM   5306 C  CA    . VAL B 2 301 ? 26.876  26.104  37.864  1.00 258.14 ? 278 VAL C CA    1 
ATOM   5307 C  C     . VAL B 2 301 ? 28.204  25.784  38.581  1.00 228.90 ? 278 VAL C C     1 
ATOM   5308 O  O     . VAL B 2 301 ? 28.695  26.553  39.401  1.00 215.40 ? 278 VAL C O     1 
ATOM   5309 C  CB    . VAL B 2 301 ? 27.100  26.329  36.370  1.00 261.03 ? 278 VAL C CB    1 
ATOM   5310 C  CG1   . VAL B 2 301 ? 26.071  27.305  35.849  1.00 280.96 ? 278 VAL C CG1   1 
ATOM   5311 C  CG2   . VAL B 2 301 ? 28.534  26.794  36.080  1.00 221.26 ? 278 VAL C CG2   1 
ATOM   5312 N  N     . ARG B 2 302 ? 28.775  24.626  38.292  1.00 218.02 ? 279 ARG C N     1 
ATOM   5313 C  CA    . ARG B 2 302 ? 29.898  24.152  39.085  1.00 200.97 ? 279 ARG C CA    1 
ATOM   5314 C  C     . ARG B 2 302 ? 31.209  24.736  38.615  1.00 196.10 ? 279 ARG C C     1 
ATOM   5315 O  O     . ARG B 2 302 ? 31.474  24.792  37.418  1.00 207.34 ? 279 ARG C O     1 
ATOM   5316 C  CB    . ARG B 2 302 ? 29.964  22.615  39.061  1.00 208.51 ? 279 ARG C CB    1 
ATOM   5317 C  CG    . ARG B 2 302 ? 31.266  21.986  39.618  1.00 215.85 ? 279 ARG C CG    1 
ATOM   5318 C  CD    . ARG B 2 302 ? 31.194  21.625  41.111  1.00 230.80 ? 279 ARG C CD    1 
ATOM   5319 N  NE    . ARG B 2 302 ? 32.199  20.626  41.490  1.00 247.77 ? 279 ARG C NE    1 
ATOM   5320 C  CZ    . ARG B 2 302 ? 32.033  19.313  41.342  1.00 267.13 ? 279 ARG C CZ    1 
ATOM   5321 N  NH1   . ARG B 2 302 ? 30.907  18.846  40.824  1.00 283.68 ? 279 ARG C NH1   1 
ATOM   5322 N  NH2   . ARG B 2 302 ? 32.988  18.466  41.705  1.00 264.38 ? 279 ARG C NH2   1 
ATOM   5323 N  N     . THR B 2 303 ? 32.031  25.163  39.567  1.00 188.30 ? 280 THR C N     1 
ATOM   5324 C  CA    . THR B 2 303 ? 33.432  25.426  39.271  1.00 196.03 ? 280 THR C CA    1 
ATOM   5325 C  C     . THR B 2 303 ? 34.318  24.222  39.560  1.00 205.46 ? 280 THR C C     1 
ATOM   5326 O  O     . THR B 2 303 ? 35.069  24.255  40.530  1.00 214.42 ? 280 THR C O     1 
ATOM   5327 C  CB    . THR B 2 303 ? 33.984  26.572  40.106  1.00 191.96 ? 280 THR C CB    1 
ATOM   5328 O  OG1   . THR B 2 303 ? 33.389  26.539  41.406  1.00 202.18 ? 280 THR C OG1   1 
ATOM   5329 C  CG2   . THR B 2 303 ? 33.693  27.886  39.443  1.00 184.13 ? 280 THR C CG2   1 
ATOM   5330 N  N     . LYS B 2 304 ? 34.257  23.190  38.711  1.00 208.64 ? 281 LYS C N     1 
ATOM   5331 C  CA    . LYS B 2 304 ? 35.020  21.942  38.908  1.00 220.49 ? 281 LYS C CA    1 
ATOM   5332 C  C     . LYS B 2 304 ? 36.473  22.187  39.300  1.00 236.70 ? 281 LYS C C     1 
ATOM   5333 O  O     . LYS B 2 304 ? 37.072  21.373  40.002  1.00 249.99 ? 281 LYS C O     1 
ATOM   5334 C  CB    . LYS B 2 304 ? 34.975  21.045  37.660  1.00 224.49 ? 281 LYS C CB    1 
ATOM   5335 N  N     . ASP B 2 305 ? 37.024  23.323  38.858  1.00 237.09 ? 282 ASP C N     1 
ATOM   5336 C  CA    . ASP B 2 305 ? 38.435  23.652  39.081  1.00 230.56 ? 282 ASP C CA    1 
ATOM   5337 C  C     . ASP B 2 305 ? 38.676  24.634  40.227  1.00 236.63 ? 282 ASP C C     1 
ATOM   5338 O  O     . ASP B 2 305 ? 39.770  25.186  40.362  1.00 229.65 ? 282 ASP C O     1 
ATOM   5339 C  CB    . ASP B 2 305 ? 39.094  24.168  37.795  1.00 219.03 ? 282 ASP C CB    1 
ATOM   5340 C  CG    . ASP B 2 305 ? 39.484  23.043  36.842  1.00 205.24 ? 282 ASP C CG    1 
ATOM   5341 O  OD1   . ASP B 2 305 ? 39.449  21.859  37.258  1.00 202.01 ? 282 ASP C OD1   1 
ATOM   5342 O  OD2   . ASP B 2 305 ? 39.839  23.342  35.678  1.00 205.97 ? 282 ASP C OD2   1 
ATOM   5343 N  N     . GLY B 2 306 ? 37.661  24.845  41.058  1.00 246.10 ? 283 GLY C N     1 
ATOM   5344 C  CA    . GLY B 2 306 ? 37.806  25.705  42.218  1.00 238.89 ? 283 GLY C CA    1 
ATOM   5345 C  C     . GLY B 2 306 ? 37.681  27.177  41.882  1.00 229.06 ? 283 GLY C C     1 
ATOM   5346 O  O     . GLY B 2 306 ? 36.756  27.609  41.195  1.00 225.46 ? 283 GLY C O     1 
ATOM   5347 N  N     . GLY B 2 307 ? 38.625  27.965  42.367  1.00 224.50 ? 284 GLY C N     1 
ATOM   5348 C  CA    . GLY B 2 307 ? 38.578  29.388  42.116  1.00 233.24 ? 284 GLY C CA    1 
ATOM   5349 C  C     . GLY B 2 307 ? 38.791  30.216  43.365  1.00 240.97 ? 284 GLY C C     1 
ATOM   5350 O  O     . GLY B 2 307 ? 39.008  29.691  44.459  1.00 251.65 ? 284 GLY C O     1 
ATOM   5351 N  N     . THR B 2 308 ? 38.721  31.526  43.188  1.00 237.85 ? 285 THR C N     1 
ATOM   5352 C  CA    . THR B 2 308 ? 38.987  32.479  44.247  1.00 233.21 ? 285 THR C CA    1 
ATOM   5353 C  C     . THR B 2 308 ? 37.994  32.373  45.415  1.00 242.02 ? 285 THR C C     1 
ATOM   5354 O  O     . THR B 2 308 ? 38.378  32.532  46.569  1.00 248.20 ? 285 THR C O     1 
ATOM   5355 C  CB    . THR B 2 308 ? 39.001  33.901  43.676  1.00 228.36 ? 285 THR C CB    1 
ATOM   5356 O  OG1   . THR B 2 308 ? 37.660  34.365  43.501  1.00 224.65 ? 285 THR C OG1   1 
ATOM   5357 C  CG2   . THR B 2 308 ? 39.703  33.911  42.334  1.00 234.23 ? 285 THR C CG2   1 
ATOM   5358 N  N     . HIS B 2 309 ? 36.725  32.102  45.112  1.00 240.55 ? 286 HIS C N     1 
ATOM   5359 C  CA    . HIS B 2 309 ? 35.727  31.861  46.153  1.00 228.18 ? 286 HIS C CA    1 
ATOM   5360 C  C     . HIS B 2 309 ? 36.094  30.665  47.034  1.00 224.58 ? 286 HIS C C     1 
ATOM   5361 O  O     . HIS B 2 309 ? 35.896  30.685  48.257  1.00 221.60 ? 286 HIS C O     1 
ATOM   5362 C  CB    . HIS B 2 309 ? 34.333  31.676  45.557  1.00 217.10 ? 286 HIS C CB    1 
ATOM   5363 C  CG    . HIS B 2 309 ? 34.258  30.655  44.465  1.00 203.32 ? 286 HIS C CG    1 
ATOM   5364 N  ND1   . HIS B 2 309 ? 35.370  30.133  43.841  1.00 200.83 ? 286 HIS C ND1   1 
ATOM   5365 C  CD2   . HIS B 2 309 ? 33.188  30.065  43.874  1.00 197.14 ? 286 HIS C CD2   1 
ATOM   5366 C  CE1   . HIS B 2 309 ? 34.993  29.265  42.918  1.00 201.40 ? 286 HIS C CE1   1 
ATOM   5367 N  NE2   . HIS B 2 309 ? 33.672  29.207  42.915  1.00 199.04 ? 286 HIS C NE2   1 
ATOM   5368 N  N     . GLU B 2 310 ? 36.633  29.624  46.404  1.00 222.85 ? 287 GLU C N     1 
ATOM   5369 C  CA    . GLU B 2 310 ? 37.072  28.441  47.124  1.00 213.89 ? 287 GLU C CA    1 
ATOM   5370 C  C     . GLU B 2 310 ? 38.252  28.829  48.000  1.00 203.53 ? 287 GLU C C     1 
ATOM   5371 O  O     . GLU B 2 310 ? 38.240  28.552  49.197  1.00 189.41 ? 287 GLU C O     1 
ATOM   5372 C  CB    . GLU B 2 310 ? 37.431  27.304  46.156  1.00 211.69 ? 287 GLU C CB    1 
ATOM   5373 C  CG    . GLU B 2 310 ? 37.264  25.892  46.746  1.00 203.59 ? 287 GLU C CG    1 
ATOM   5374 C  CD    . GLU B 2 310 ? 36.992  24.808  45.689  1.00 204.24 ? 287 GLU C CD    1 
ATOM   5375 O  OE1   . GLU B 2 310 ? 36.161  25.043  44.787  1.00 212.59 ? 287 GLU C OE1   1 
ATOM   5376 O  OE2   . GLU B 2 310 ? 37.598  23.712  45.767  1.00 198.38 ? 287 GLU C OE2   1 
ATOM   5377 N  N     . THR B 2 311 ? 39.247  29.507  47.421  1.00 207.38 ? 288 THR C N     1 
ATOM   5378 C  CA    . THR B 2 311 ? 40.422  29.948  48.187  1.00 200.82 ? 288 THR C CA    1 
ATOM   5379 C  C     . THR B 2 311 ? 40.042  30.880  49.308  1.00 188.20 ? 288 THR C C     1 
ATOM   5380 O  O     . THR B 2 311 ? 40.781  31.023  50.274  1.00 169.25 ? 288 THR C O     1 
ATOM   5381 C  CB    . THR B 2 311 ? 41.452  30.715  47.339  1.00 207.15 ? 288 THR C CB    1 
ATOM   5382 O  OG1   . THR B 2 311 ? 41.037  30.749  45.968  1.00 219.24 ? 288 THR C OG1   1 
ATOM   5383 C  CG2   . THR B 2 311 ? 42.834  30.076  47.473  1.00 196.63 ? 288 THR C CG2   1 
ATOM   5384 N  N     . GLY B 2 312 ? 38.901  31.543  49.159  1.00 200.41 ? 289 GLY C N     1 
ATOM   5385 C  CA    . GLY B 2 312 ? 38.411  32.437  50.186  1.00 212.05 ? 289 GLY C CA    1 
ATOM   5386 C  C     . GLY B 2 312 ? 37.897  31.609  51.327  1.00 217.23 ? 289 GLY C C     1 
ATOM   5387 O  O     . GLY B 2 312 ? 38.121  31.943  52.488  1.00 224.48 ? 289 GLY C O     1 
ATOM   5388 N  N     . LEU B 2 313 ? 37.227  30.512  50.974  1.00 213.94 ? 290 LEU C N     1 
ATOM   5389 C  CA    . LEU B 2 313 ? 36.647  29.567  51.937  1.00 216.92 ? 290 LEU C CA    1 
ATOM   5390 C  C     . LEU B 2 313 ? 37.678  28.741  52.696  1.00 228.95 ? 290 LEU C C     1 
ATOM   5391 O  O     . LEU B 2 313 ? 37.546  28.533  53.906  1.00 249.69 ? 290 LEU C O     1 
ATOM   5392 C  CB    . LEU B 2 313 ? 35.697  28.601  51.230  1.00 215.93 ? 290 LEU C CB    1 
ATOM   5393 C  CG    . LEU B 2 313 ? 35.142  27.512  52.144  1.00 230.10 ? 290 LEU C CG    1 
ATOM   5394 C  CD1   . LEU B 2 313 ? 33.937  28.031  52.921  1.00 237.02 ? 290 LEU C CD1   1 
ATOM   5395 C  CD2   . LEU B 2 313 ? 34.803  26.285  51.340  1.00 244.03 ? 290 LEU C CD2   1 
ATOM   5396 N  N     . LYS B 2 314 ? 38.681  28.243  51.978  1.00 217.91 ? 291 LYS C N     1 
ATOM   5397 C  CA    . LYS B 2 314 ? 39.756  27.491  52.614  1.00 209.54 ? 291 LYS C CA    1 
ATOM   5398 C  C     . LYS B 2 314 ? 40.583  28.400  53.541  1.00 212.85 ? 291 LYS C C     1 
ATOM   5399 O  O     . LYS B 2 314 ? 40.845  28.053  54.694  1.00 229.83 ? 291 LYS C O     1 
ATOM   5400 C  CB    . LYS B 2 314 ? 40.629  26.773  51.568  1.00 200.98 ? 291 LYS C CB    1 
ATOM   5401 N  N     . SER B 2 315 ? 40.961  29.579  53.043  1.00 196.47 ? 292 SER C N     1 
ATOM   5402 C  CA    . SER B 2 315 ? 41.757  30.533  53.820  1.00 185.50 ? 292 SER C CA    1 
ATOM   5403 C  C     . SER B 2 315 ? 41.015  31.053  55.047  1.00 190.70 ? 292 SER C C     1 
ATOM   5404 O  O     . SER B 2 315 ? 41.635  31.542  55.993  1.00 177.40 ? 292 SER C O     1 
ATOM   5405 C  CB    . SER B 2 315 ? 42.212  31.708  52.944  1.00 178.24 ? 292 SER C CB    1 
ATOM   5406 N  N     . ALA B 2 316 ? 39.690  30.947  55.026  1.00 211.45 ? 293 ALA C N     1 
ATOM   5407 C  CA    . ALA B 2 316 ? 38.871  31.419  56.134  1.00 224.92 ? 293 ALA C CA    1 
ATOM   5408 C  C     . ALA B 2 316 ? 38.991  30.493  57.337  1.00 231.39 ? 293 ALA C C     1 
ATOM   5409 O  O     . ALA B 2 316 ? 39.219  30.957  58.458  1.00 223.27 ? 293 ALA C O     1 
ATOM   5410 C  CB    . ALA B 2 316 ? 37.415  31.564  55.708  1.00 226.05 ? 293 ALA C CB    1 
ATOM   5411 N  N     . ILE B 2 317 ? 38.856  29.187  57.099  1.00 245.50 ? 294 ILE C N     1 
ATOM   5412 C  CA    . ILE B 2 317 ? 38.915  28.202  58.184  1.00 252.54 ? 294 ILE C CA    1 
ATOM   5413 C  C     . ILE B 2 317 ? 40.313  28.012  58.784  1.00 249.92 ? 294 ILE C C     1 
ATOM   5414 O  O     . ILE B 2 317 ? 40.471  28.080  60.005  1.00 243.66 ? 294 ILE C O     1 
ATOM   5415 C  CB    . ILE B 2 317 ? 38.265  26.831  57.817  1.00 262.78 ? 294 ILE C CB    1 
ATOM   5416 C  CG1   . ILE B 2 317 ? 38.615  26.420  56.389  1.00 261.36 ? 294 ILE C CG1   1 
ATOM   5417 C  CG2   . ILE B 2 317 ? 36.754  26.897  57.966  1.00 266.30 ? 294 ILE C CG2   1 
ATOM   5418 C  CD1   . ILE B 2 317 ? 39.744  25.422  56.304  1.00 260.03 ? 294 ILE C CD1   1 
ATOM   5419 N  N     . THR B 2 318 ? 41.322  27.805  57.944  1.00 245.50 ? 295 THR C N     1 
ATOM   5420 C  CA    . THR B 2 318 ? 42.673  27.567  58.454  1.00 220.11 ? 295 THR C CA    1 
ATOM   5421 C  C     . THR B 2 318 ? 43.141  28.684  59.401  1.00 181.24 ? 295 THR C C     1 
ATOM   5422 O  O     . THR B 2 318 ? 43.923  28.448  60.318  1.00 164.10 ? 295 THR C O     1 
ATOM   5423 C  CB    . THR B 2 318 ? 43.707  27.332  57.319  1.00 221.68 ? 295 THR C CB    1 
ATOM   5424 O  OG1   . THR B 2 318 ? 44.020  28.569  56.678  1.00 214.19 ? 295 THR C OG1   1 
ATOM   5425 C  CG2   . THR B 2 318 ? 43.167  26.369  56.284  1.00 230.23 ? 295 THR C CG2   1 
ATOM   5426 N  N     . LYS B 2 319 ? 42.621  29.891  59.196  1.00 166.27 ? 296 LYS C N     1 
ATOM   5427 C  CA    . LYS B 2 319 ? 43.002  31.042  60.008  1.00 169.52 ? 296 LYS C CA    1 
ATOM   5428 C  C     . LYS B 2 319 ? 41.966  31.392  61.079  1.00 173.19 ? 296 LYS C C     1 
ATOM   5429 O  O     . LYS B 2 319 ? 42.297  32.066  62.051  1.00 178.38 ? 296 LYS C O     1 
ATOM   5430 C  CB    . LYS B 2 319 ? 43.278  32.264  59.127  1.00 168.82 ? 296 LYS C CB    1 
ATOM   5431 N  N     . VAL B 2 320 ? 40.720  30.949  60.907  1.00 172.58 ? 297 VAL C N     1 
ATOM   5432 C  CA    . VAL B 2 320 ? 39.693  31.219  61.921  1.00 178.30 ? 297 VAL C CA    1 
ATOM   5433 C  C     . VAL B 2 320 ? 39.776  30.240  63.083  1.00 179.76 ? 297 VAL C C     1 
ATOM   5434 O  O     . VAL B 2 320 ? 39.397  30.582  64.206  1.00 183.68 ? 297 VAL C O     1 
ATOM   5435 C  CB    . VAL B 2 320 ? 38.251  31.192  61.358  1.00 190.79 ? 297 VAL C CB    1 
ATOM   5436 C  CG1   . VAL B 2 320 ? 37.795  29.771  61.138  1.00 193.25 ? 297 VAL C CG1   1 
ATOM   5437 C  CG2   . VAL B 2 320 ? 37.300  31.865  62.319  1.00 201.10 ? 297 VAL C CG2   1 
ATOM   5438 N  N     . MET B 2 321 ? 40.273  29.032  62.804  1.00 176.12 ? 298 MET C N     1 
ATOM   5439 C  CA    . MET B 2 321 ? 40.367  27.973  63.812  1.00 188.42 ? 298 MET C CA    1 
ATOM   5440 C  C     . MET B 2 321 ? 41.699  28.044  64.540  1.00 202.69 ? 298 MET C C     1 
ATOM   5441 O  O     . MET B 2 321 ? 41.780  27.760  65.739  1.00 215.06 ? 298 MET C O     1 
ATOM   5442 C  CB    . MET B 2 321 ? 40.181  26.594  63.183  1.00 195.27 ? 298 MET C CB    1 
ATOM   5443 C  CG    . MET B 2 321 ? 38.797  26.342  62.628  1.00 204.01 ? 298 MET C CG    1 
ATOM   5444 S  SD    . MET B 2 321 ? 38.056  24.840  63.284  1.00 216.47 ? 298 MET C SD    1 
ATOM   5445 C  CE    . MET B 2 321 ? 37.217  24.191  61.835  1.00 191.50 ? 298 MET C CE    1 
ATOM   5446 N  N     . ASN B 2 322 ? 42.738  28.418  63.798  1.00 199.33 ? 299 ASN C N     1 
ATOM   5447 C  CA    . ASN B 2 322 ? 44.021  28.736  64.394  1.00 185.36 ? 299 ASN C CA    1 
ATOM   5448 C  C     . ASN B 2 322 ? 43.831  29.771  65.487  1.00 182.22 ? 299 ASN C C     1 
ATOM   5449 O  O     . ASN B 2 322 ? 44.380  29.635  66.572  1.00 186.01 ? 299 ASN C O     1 
ATOM   5450 C  CB    . ASN B 2 322 ? 45.004  29.244  63.344  1.00 171.41 ? 299 ASN C CB    1 
ATOM   5451 C  CG    . ASN B 2 322 ? 46.120  28.258  63.077  1.00 166.60 ? 299 ASN C CG    1 
ATOM   5452 O  OD1   . ASN B 2 322 ? 45.882  27.062  62.879  1.00 161.56 ? 299 ASN C OD1   1 
ATOM   5453 N  ND2   . ASN B 2 322 ? 47.358  28.752  63.091  1.00 171.79 ? 299 ASN C ND2   1 
ATOM   5454 N  N     . ASP B 2 323 ? 43.032  30.796  65.207  1.00 176.59 ? 300 ASP C N     1 
ATOM   5455 C  CA    . ASP B 2 323 ? 42.654  31.752  66.239  1.00 180.06 ? 300 ASP C CA    1 
ATOM   5456 C  C     . ASP B 2 323 ? 41.944  31.019  67.365  1.00 183.85 ? 300 ASP C C     1 
ATOM   5457 O  O     . ASP B 2 323 ? 42.264  31.224  68.534  1.00 188.16 ? 300 ASP C O     1 
ATOM   5458 C  CB    . ASP B 2 323 ? 41.762  32.867  65.689  1.00 177.30 ? 300 ASP C CB    1 
ATOM   5459 N  N     . TYR B 2 324 ? 40.993  30.149  67.026  1.00 181.51 ? 301 TYR C N     1 
ATOM   5460 C  CA    . TYR B 2 324 ? 40.249  29.465  68.079  1.00 180.22 ? 301 TYR C CA    1 
ATOM   5461 C  C     . TYR B 2 324 ? 41.140  28.537  68.907  1.00 184.40 ? 301 TYR C C     1 
ATOM   5462 O  O     . TYR B 2 324 ? 40.920  28.355  70.109  1.00 184.25 ? 301 TYR C O     1 
ATOM   5463 C  CB    . TYR B 2 324 ? 39.005  28.732  67.568  1.00 187.99 ? 301 TYR C CB    1 
ATOM   5464 C  CG    . TYR B 2 324 ? 38.211  28.170  68.727  1.00 198.12 ? 301 TYR C CG    1 
ATOM   5465 C  CD1   . TYR B 2 324 ? 37.521  29.007  69.593  1.00 198.37 ? 301 TYR C CD1   1 
ATOM   5466 C  CD2   . TYR B 2 324 ? 38.191  26.808  68.989  1.00 208.34 ? 301 TYR C CD2   1 
ATOM   5467 C  CE1   . TYR B 2 324 ? 36.816  28.499  70.669  1.00 205.17 ? 301 TYR C CE1   1 
ATOM   5468 C  CE2   . TYR B 2 324 ? 37.493  26.291  70.064  1.00 214.69 ? 301 TYR C CE2   1 
ATOM   5469 C  CZ    . TYR B 2 324 ? 36.807  27.141  70.898  1.00 215.13 ? 301 TYR C CZ    1 
ATOM   5470 O  OH    . TYR B 2 324 ? 36.108  26.630  71.962  1.00 222.43 ? 301 TYR C OH    1 
ATOM   5471 N  N     . ALA B 2 325 ? 42.150  27.961  68.264  1.00 205.18 ? 302 ALA C N     1 
ATOM   5472 C  CA    . ALA B 2 325 ? 43.174  27.217  68.988  1.00 223.70 ? 302 ALA C CA    1 
ATOM   5473 C  C     . ALA B 2 325 ? 43.896  28.177  69.915  1.00 204.79 ? 302 ALA C C     1 
ATOM   5474 O  O     . ALA B 2 325 ? 43.765  28.089  71.137  1.00 187.87 ? 302 ALA C O     1 
ATOM   5475 C  CB    . ALA B 2 325 ? 44.155  26.578  68.021  1.00 249.09 ? 302 ALA C CB    1 
ATOM   5476 N  N     . ARG B 2 326 ? 44.635  29.098  69.301  1.00 204.03 ? 303 ARG C N     1 
ATOM   5477 C  CA    . ARG B 2 326 ? 45.435  30.111  69.984  1.00 202.79 ? 303 ARG C CA    1 
ATOM   5478 C  C     . ARG B 2 326 ? 44.826  30.611  71.283  1.00 209.70 ? 303 ARG C C     1 
ATOM   5479 O  O     . ARG B 2 326 ? 45.480  30.598  72.322  1.00 209.95 ? 303 ARG C O     1 
ATOM   5480 C  CB    . ARG B 2 326 ? 45.664  31.299  69.054  1.00 196.31 ? 303 ARG C CB    1 
ATOM   5481 C  CG    . ARG B 2 326 ? 46.662  31.044  67.958  1.00 186.10 ? 303 ARG C CG    1 
ATOM   5482 C  CD    . ARG B 2 326 ? 47.979  30.717  68.561  1.00 177.94 ? 303 ARG C CD    1 
ATOM   5483 N  NE    . ARG B 2 326 ? 49.020  30.602  67.557  1.00 179.38 ? 303 ARG C NE    1 
ATOM   5484 C  CZ    . ARG B 2 326 ? 50.311  30.548  67.850  1.00 187.41 ? 303 ARG C CZ    1 
ATOM   5485 N  NH1   . ARG B 2 326 ? 50.706  30.607  69.118  1.00 191.80 ? 303 ARG C NH1   1 
ATOM   5486 N  NH2   . ARG B 2 326 ? 51.206  30.441  66.880  1.00 189.27 ? 303 ARG C NH2   1 
ATOM   5487 N  N     . LYS B 2 327 ? 43.565  31.027  71.216  1.00 214.88 ? 304 LYS C N     1 
ATOM   5488 C  CA    . LYS B 2 327 ? 42.846  31.561  72.370  1.00 216.61 ? 304 LYS C CA    1 
ATOM   5489 C  C     . LYS B 2 327 ? 42.670  30.503  73.449  1.00 210.32 ? 304 LYS C C     1 
ATOM   5490 O  O     . LYS B 2 327 ? 43.365  29.488  73.442  1.00 204.10 ? 304 LYS C O     1 
ATOM   5491 C  CB    . LYS B 2 327 ? 41.480  32.101  71.941  1.00 219.67 ? 304 LYS C CB    1 
ATOM   5492 N  N     . THR B 2 328 ? 41.712  30.721  74.352  1.00 210.57 ? 305 THR C N     1 
ATOM   5493 C  CA    . THR B 2 328 ? 41.500  29.856  75.529  1.00 210.70 ? 305 THR C CA    1 
ATOM   5494 C  C     . THR B 2 328 ? 41.623  28.327  75.302  1.00 226.42 ? 305 THR C C     1 
ATOM   5495 O  O     . THR B 2 328 ? 41.449  27.539  76.238  1.00 231.67 ? 305 THR C O     1 
ATOM   5496 C  CB    . THR B 2 328 ? 40.159  30.183  76.251  1.00 240.05 ? 305 THR C CB    1 
ATOM   5497 N  N     . GLY B 2 329 ? 41.931  27.924  74.070  1.00 213.28 ? 306 GLY C N     1 
ATOM   5498 C  CA    . GLY B 2 329 ? 42.272  26.550  73.767  1.00 202.97 ? 306 GLY C CA    1 
ATOM   5499 C  C     . GLY B 2 329 ? 43.767  26.272  73.801  1.00 195.72 ? 306 GLY C C     1 
ATOM   5500 O  O     . GLY B 2 329 ? 44.498  26.738  74.676  1.00 194.64 ? 306 GLY C O     1 
ATOM   5501 N  N     . LEU B 2 330 ? 44.221  25.523  72.805  1.00 189.74 ? 307 LEU C N     1 
ATOM   5502 C  CA    . LEU B 2 330 ? 45.530  24.893  72.832  1.00 190.34 ? 307 LEU C CA    1 
ATOM   5503 C  C     . LEU B 2 330 ? 46.386  25.269  71.625  1.00 207.02 ? 307 LEU C C     1 
ATOM   5504 O  O     . LEU B 2 330 ? 45.975  25.115  70.478  1.00 223.27 ? 307 LEU C O     1 
ATOM   5505 C  CB    . LEU B 2 330 ? 45.366  23.376  72.924  1.00 184.72 ? 307 LEU C CB    1 
ATOM   5506 C  CG    . LEU B 2 330 ? 44.174  22.611  72.314  1.00 189.23 ? 307 LEU C CG    1 
ATOM   5507 C  CD1   . LEU B 2 330 ? 42.805  22.913  72.958  1.00 186.05 ? 307 LEU C CD1   1 
ATOM   5508 C  CD2   . LEU B 2 330 ? 44.112  22.768  70.808  1.00 199.57 ? 307 LEU C CD2   1 
ATOM   5509 N  N     . LEU B 2 331 ? 47.581  25.777  71.886  1.00 205.21 ? 308 LEU C N     1 
ATOM   5510 C  CA    . LEU B 2 331 ? 48.446  26.229  70.808  1.00 207.09 ? 308 LEU C CA    1 
ATOM   5511 C  C     . LEU B 2 331 ? 49.886  26.051  71.222  1.00 214.93 ? 308 LEU C C     1 
ATOM   5512 O  O     . LEU B 2 331 ? 50.778  25.934  70.383  1.00 213.30 ? 308 LEU C O     1 
ATOM   5513 C  CB    . LEU B 2 331 ? 48.185  27.703  70.509  1.00 208.52 ? 308 LEU C CB    1 
ATOM   5514 N  N     . LYS B 2 332 ? 50.092  26.046  72.537  1.00 221.18 ? 309 LYS C N     1 
ATOM   5515 C  CA    . LYS B 2 332 ? 51.417  25.999  73.144  1.00 225.14 ? 309 LYS C CA    1 
ATOM   5516 C  C     . LYS B 2 332 ? 52.282  27.202  72.742  1.00 226.10 ? 309 LYS C C     1 
ATOM   5517 O  O     . LYS B 2 332 ? 53.484  27.212  73.009  1.00 234.42 ? 309 LYS C O     1 
ATOM   5518 C  CB    . LYS B 2 332 ? 52.127  24.675  72.818  1.00 236.29 ? 309 LYS C CB    1 
ATOM   5519 N  N     . GLU B 2 333 ? 51.663  28.215  72.123  1.00 218.30 ? 310 GLU C N     1 
ATOM   5520 C  CA    . GLU B 2 333 ? 52.385  29.365  71.572  1.00 214.65 ? 310 GLU C CA    1 
ATOM   5521 C  C     . GLU B 2 333 ? 53.543  28.873  70.702  1.00 214.23 ? 310 GLU C C     1 
ATOM   5522 O  O     . GLU B 2 333 ? 53.481  27.768  70.161  1.00 215.45 ? 310 GLU C O     1 
ATOM   5523 C  CB    . GLU B 2 333 ? 52.891  30.278  72.691  1.00 215.84 ? 310 GLU C CB    1 
ATOM   5524 C  CG    . GLU B 2 333 ? 52.913  31.752  72.338  1.00 217.76 ? 310 GLU C CG    1 
ATOM   5525 N  N     . LYS B 2 334 ? 54.588  29.689  70.570  1.00 211.12 ? 311 LYS C N     1 
ATOM   5526 C  CA    . LYS B 2 334 ? 55.842  29.281  69.924  1.00 205.03 ? 311 LYS C CA    1 
ATOM   5527 C  C     . LYS B 2 334 ? 55.708  28.541  68.585  1.00 200.37 ? 311 LYS C C     1 
ATOM   5528 O  O     . LYS B 2 334 ? 54.679  28.600  67.909  1.00 198.11 ? 311 LYS C O     1 
ATOM   5529 C  CB    . LYS B 2 334 ? 56.681  28.436  70.886  1.00 202.16 ? 311 LYS C CB    1 
ATOM   5530 N  N     . GLU B 2 339 ? 47.834  25.552  61.020  1.00 148.40 ? 316 GLU C N     1 
ATOM   5531 C  CA    . GLU B 2 339 ? 48.398  24.340  60.425  1.00 147.61 ? 316 GLU C CA    1 
ATOM   5532 C  C     . GLU B 2 339 ? 48.194  24.185  58.880  1.00 161.25 ? 316 GLU C C     1 
ATOM   5533 O  O     . GLU B 2 339 ? 49.153  23.936  58.147  1.00 160.22 ? 316 GLU C O     1 
ATOM   5534 C  CB    . GLU B 2 339 ? 47.932  23.097  61.207  1.00 140.30 ? 316 GLU C CB    1 
ATOM   5535 N  N     . GLY B 2 340 ? 46.963  24.327  58.387  1.00 160.48 ? 317 GLY C N     1 
ATOM   5536 C  CA    . GLY B 2 340 ? 46.715  24.237  56.953  1.00 161.08 ? 317 GLY C CA    1 
ATOM   5537 C  C     . GLY B 2 340 ? 45.624  23.280  56.484  1.00 158.55 ? 317 GLY C C     1 
ATOM   5538 O  O     . GLY B 2 340 ? 44.449  23.455  56.802  1.00 160.99 ? 317 GLY C O     1 
ATOM   5539 N  N     . SER B 2 341 ? 46.015  22.269  55.709  1.00 158.72 ? 318 SER C N     1 
ATOM   5540 C  CA    . SER B 2 341 ? 45.077  21.291  55.144  1.00 157.01 ? 318 SER C CA    1 
ATOM   5541 C  C     . SER B 2 341 ? 44.671  20.222  56.159  1.00 156.60 ? 318 SER C C     1 
ATOM   5542 O  O     . SER B 2 341 ? 43.802  19.381  55.909  1.00 162.06 ? 318 SER C O     1 
ATOM   5543 C  CB    . SER B 2 341 ? 45.707  20.602  53.937  1.00 161.51 ? 318 SER C CB    1 
ATOM   5544 O  OG    . SER B 2 341 ? 46.605  19.591  54.353  1.00 164.22 ? 318 SER C OG    1 
ATOM   5545 N  N     . ASP B 2 342 ? 45.328  20.258  57.302  1.00 162.57 ? 319 ASP C N     1 
ATOM   5546 C  CA    . ASP B 2 342 ? 45.024  19.364  58.399  1.00 172.41 ? 319 ASP C CA    1 
ATOM   5547 C  C     . ASP B 2 342 ? 43.598  19.616  58.905  1.00 188.12 ? 319 ASP C C     1 
ATOM   5548 O  O     . ASP B 2 342 ? 42.932  18.702  59.399  1.00 191.94 ? 319 ASP C O     1 
ATOM   5549 C  CB    . ASP B 2 342 ? 46.065  19.583  59.494  1.00 166.95 ? 319 ASP C CB    1 
ATOM   5550 C  CG    . ASP B 2 342 ? 47.479  19.711  58.928  1.00 161.47 ? 319 ASP C CG    1 
ATOM   5551 O  OD1   . ASP B 2 342 ? 47.870  18.857  58.097  1.00 159.17 ? 319 ASP C OD1   1 
ATOM   5552 O  OD2   . ASP B 2 342 ? 48.192  20.673  59.292  1.00 162.63 ? 319 ASP C OD2   1 
ATOM   5553 N  N     . TYR B 2 343 ? 43.129  20.856  58.762  1.00 197.64 ? 320 TYR C N     1 
ATOM   5554 C  CA    . TYR B 2 343 ? 41.759  21.205  59.121  1.00 205.47 ? 320 TYR C CA    1 
ATOM   5555 C  C     . TYR B 2 343 ? 40.767  20.647  58.119  1.00 193.91 ? 320 TYR C C     1 
ATOM   5556 O  O     . TYR B 2 343 ? 39.578  20.559  58.403  1.00 191.60 ? 320 TYR C O     1 
ATOM   5557 C  CB    . TYR B 2 343 ? 41.572  22.719  59.193  1.00 220.15 ? 320 TYR C CB    1 
ATOM   5558 C  CG    . TYR B 2 343 ? 42.247  23.375  60.362  1.00 224.23 ? 320 TYR C CG    1 
ATOM   5559 C  CD1   . TYR B 2 343 ? 41.650  23.400  61.615  1.00 226.85 ? 320 TYR C CD1   1 
ATOM   5560 C  CD2   . TYR B 2 343 ? 43.480  23.988  60.212  1.00 220.96 ? 320 TYR C CD2   1 
ATOM   5561 C  CE1   . TYR B 2 343 ? 42.274  24.007  62.695  1.00 227.65 ? 320 TYR C CE1   1 
ATOM   5562 C  CE2   . TYR B 2 343 ? 44.111  24.606  61.283  1.00 221.37 ? 320 TYR C CE2   1 
ATOM   5563 C  CZ    . TYR B 2 343 ? 43.506  24.611  62.522  1.00 229.53 ? 320 TYR C CZ    1 
ATOM   5564 O  OH    . TYR B 2 343 ? 44.143  25.220  63.581  1.00 241.11 ? 320 TYR C OH    1 
ATOM   5565 N  N     . ARG B 2 344 ? 41.246  20.278  56.940  1.00 180.68 ? 321 ARG C N     1 
ATOM   5566 C  CA    . ARG B 2 344 ? 40.339  19.851  55.882  1.00 162.92 ? 321 ARG C CA    1 
ATOM   5567 C  C     . ARG B 2 344 ? 40.191  18.338  55.761  1.00 163.80 ? 321 ARG C C     1 
ATOM   5568 O  O     . ARG B 2 344 ? 39.407  17.866  54.935  1.00 167.61 ? 321 ARG C O     1 
ATOM   5569 C  CB    . ARG B 2 344 ? 40.767  20.431  54.532  1.00 152.05 ? 321 ARG C CB    1 
ATOM   5570 C  CG    . ARG B 2 344 ? 40.313  21.846  54.258  1.00 151.16 ? 321 ARG C CG    1 
ATOM   5571 C  CD    . ARG B 2 344 ? 40.603  22.199  52.813  1.00 149.66 ? 321 ARG C CD    1 
ATOM   5572 N  NE    . ARG B 2 344 ? 42.027  22.119  52.493  1.00 154.88 ? 321 ARG C NE    1 
ATOM   5573 C  CZ    . ARG B 2 344 ? 42.907  23.098  52.712  1.00 162.90 ? 321 ARG C CZ    1 
ATOM   5574 N  NH1   . ARG B 2 344 ? 42.509  24.244  53.265  1.00 169.10 ? 321 ARG C NH1   1 
ATOM   5575 N  NH2   . ARG B 2 344 ? 44.186  22.937  52.376  1.00 160.66 ? 321 ARG C NH2   1 
ATOM   5576 N  N     . GLU B 2 345 ? 40.948  17.590  56.570  1.00 164.52 ? 322 GLU C N     1 
ATOM   5577 C  CA    . GLU B 2 345 ? 40.844  16.123  56.608  1.00 168.98 ? 322 GLU C CA    1 
ATOM   5578 C  C     . GLU B 2 345 ? 39.416  15.696  56.934  1.00 166.75 ? 322 GLU C C     1 
ATOM   5579 O  O     . GLU B 2 345 ? 38.889  16.021  58.000  1.00 171.64 ? 322 GLU C O     1 
ATOM   5580 C  CB    . GLU B 2 345 ? 41.830  15.506  57.616  1.00 175.10 ? 322 GLU C CB    1 
ATOM   5581 N  N     . GLY B 2 346 ? 38.796  14.996  55.986  1.00 155.13 ? 323 GLY C N     1 
ATOM   5582 C  CA    . GLY B 2 346 ? 37.432  14.513  56.132  1.00 139.12 ? 323 GLY C CA    1 
ATOM   5583 C  C     . GLY B 2 346 ? 36.380  15.601  56.083  1.00 127.54 ? 323 GLY C C     1 
ATOM   5584 O  O     . GLY B 2 346 ? 35.198  15.347  56.284  1.00 123.23 ? 323 GLY C O     1 
ATOM   5585 N  N     . LEU B 2 347 ? 36.813  16.828  55.833  1.00 130.43 ? 324 LEU C N     1 
ATOM   5586 C  CA    . LEU B 2 347 ? 35.890  17.929  55.650  1.00 132.26 ? 324 LEU C CA    1 
ATOM   5587 C  C     . LEU B 2 347 ? 35.204  17.749  54.300  1.00 133.01 ? 324 LEU C C     1 
ATOM   5588 O  O     . LEU B 2 347 ? 35.876  17.573  53.281  1.00 131.66 ? 324 LEU C O     1 
ATOM   5589 C  CB    . LEU B 2 347 ? 36.660  19.256  55.681  1.00 128.74 ? 324 LEU C CB    1 
ATOM   5590 C  CG    . LEU B 2 347 ? 35.984  20.637  55.801  1.00 124.70 ? 324 LEU C CG    1 
ATOM   5591 C  CD1   . LEU B 2 347 ? 36.551  21.569  54.722  1.00 137.34 ? 324 LEU C CD1   1 
ATOM   5592 C  CD2   . LEU B 2 347 ? 34.439  20.612  55.781  1.00 123.14 ? 324 LEU C CD2   1 
ATOM   5593 N  N     . ALA B 2 348 ? 33.874  17.771  54.300  1.00 136.35 ? 325 ALA C N     1 
ATOM   5594 C  CA    . ALA B 2 348 ? 33.115  17.896  53.060  1.00 148.51 ? 325 ALA C CA    1 
ATOM   5595 C  C     . ALA B 2 348 ? 32.276  19.167  53.135  1.00 158.66 ? 325 ALA C C     1 
ATOM   5596 O  O     . ALA B 2 348 ? 31.769  19.512  54.203  1.00 164.64 ? 325 ALA C O     1 
ATOM   5597 C  CB    . ALA B 2 348 ? 32.236  16.683  52.828  1.00 152.74 ? 325 ALA C CB    1 
ATOM   5598 N  N     . ALA B 2 349 ? 32.148  19.869  52.009  1.00 159.38 ? 326 ALA C N     1 
ATOM   5599 C  CA    . ALA B 2 349 ? 31.464  21.168  51.985  1.00 183.63 ? 326 ALA C CA    1 
ATOM   5600 C  C     . ALA B 2 349 ? 30.996  21.577  50.594  1.00 202.20 ? 326 ALA C C     1 
ATOM   5601 O  O     . ALA B 2 349 ? 31.732  21.431  49.615  1.00 210.91 ? 326 ALA C O     1 
ATOM   5602 C  CB    . ALA B 2 349 ? 32.367  22.250  52.565  1.00 194.69 ? 326 ALA C CB    1 
ATOM   5603 N  N     . VAL B 2 350 ? 29.774  22.104  50.523  1.00 207.49 ? 327 VAL C N     1 
ATOM   5604 C  CA    . VAL B 2 350 ? 29.230  22.656  49.282  1.00 210.18 ? 327 VAL C CA    1 
ATOM   5605 C  C     . VAL B 2 350 ? 29.074  24.176  49.394  1.00 220.00 ? 327 VAL C C     1 
ATOM   5606 O  O     . VAL B 2 350 ? 28.283  24.662  50.195  1.00 226.85 ? 327 VAL C O     1 
ATOM   5607 C  CB    . VAL B 2 350 ? 27.863  22.044  48.947  1.00 199.99 ? 327 VAL C CB    1 
ATOM   5608 C  CG1   . VAL B 2 350 ? 27.417  22.492  47.573  1.00 195.63 ? 327 VAL C CG1   1 
ATOM   5609 C  CG2   . VAL B 2 350 ? 27.921  20.527  49.019  1.00 197.27 ? 327 VAL C CG2   1 
ATOM   5610 N  N     . LEU B 2 351 ? 29.831  24.916  48.582  1.00 218.98 ? 328 LEU C N     1 
ATOM   5611 C  CA    . LEU B 2 351 ? 29.920  26.383  48.674  1.00 216.25 ? 328 LEU C CA    1 
ATOM   5612 C  C     . LEU B 2 351 ? 29.362  27.048  47.421  1.00 208.71 ? 328 LEU C C     1 
ATOM   5613 O  O     . LEU B 2 351 ? 29.796  26.758  46.307  1.00 211.98 ? 328 LEU C O     1 
ATOM   5614 C  CB    . LEU B 2 351 ? 31.379  26.797  48.910  1.00 217.02 ? 328 LEU C CB    1 
ATOM   5615 C  CG    . LEU B 2 351 ? 31.932  28.222  48.842  1.00 215.99 ? 328 LEU C CG    1 
ATOM   5616 C  CD1   . LEU B 2 351 ? 32.598  28.462  47.507  1.00 215.97 ? 328 LEU C CD1   1 
ATOM   5617 C  CD2   . LEU B 2 351 ? 30.884  29.280  49.126  1.00 219.90 ? 328 LEU C CD2   1 
ATOM   5618 N  N     . SER B 2 352 ? 28.399  27.943  47.610  1.00 194.06 ? 329 SER C N     1 
ATOM   5619 C  CA    . SER B 2 352 ? 27.697  28.530  46.472  1.00 187.41 ? 329 SER C CA    1 
ATOM   5620 C  C     . SER B 2 352 ? 27.518  30.059  46.524  1.00 200.42 ? 329 SER C C     1 
ATOM   5621 O  O     . SER B 2 352 ? 26.720  30.570  47.327  1.00 207.55 ? 329 SER C O     1 
ATOM   5622 C  CB    . SER B 2 352 ? 26.340  27.847  46.277  1.00 190.67 ? 329 SER C CB    1 
ATOM   5623 O  OG    . SER B 2 352 ? 25.611  28.460  45.228  1.00 196.62 ? 329 SER C OG    1 
ATOM   5624 N  N     . ILE B 2 353 ? 28.241  30.778  45.656  1.00 206.07 ? 330 ILE C N     1 
ATOM   5625 C  CA    . ILE B 2 353 ? 28.089  32.232  45.560  1.00 222.53 ? 330 ILE C CA    1 
ATOM   5626 C  C     . ILE B 2 353 ? 27.241  32.686  44.384  1.00 244.62 ? 330 ILE C C     1 
ATOM   5627 O  O     . ILE B 2 353 ? 27.148  32.001  43.367  1.00 250.63 ? 330 ILE C O     1 
ATOM   5628 C  CB    . ILE B 2 353 ? 29.426  32.977  45.441  1.00 215.27 ? 330 ILE C CB    1 
ATOM   5629 C  CG1   . ILE B 2 353 ? 30.186  32.531  44.209  1.00 209.31 ? 330 ILE C CG1   1 
ATOM   5630 C  CG2   . ILE B 2 353 ? 30.283  32.761  46.644  1.00 207.24 ? 330 ILE C CG2   1 
ATOM   5631 C  CD1   . ILE B 2 353 ? 31.387  33.404  43.955  1.00 207.26 ? 330 ILE C CD1   1 
ATOM   5632 N  N     . LEU B 2 354 ? 26.629  33.859  44.548  1.00 257.19 ? 331 LEU C N     1 
ATOM   5633 C  CA    . LEU B 2 354 ? 25.964  34.577  43.460  1.00 273.68 ? 331 LEU C CA    1 
ATOM   5634 C  C     . LEU B 2 354 ? 26.765  35.822  43.089  1.00 286.93 ? 331 LEU C C     1 
ATOM   5635 O  O     . LEU B 2 354 ? 26.868  36.759  43.871  1.00 291.00 ? 331 LEU C O     1 
ATOM   5636 C  CB    . LEU B 2 354 ? 24.548  34.984  43.866  1.00 267.91 ? 331 LEU C CB    1 
ATOM   5637 C  CG    . LEU B 2 354 ? 23.401  34.028  43.548  1.00 253.27 ? 331 LEU C CG    1 
ATOM   5638 C  CD1   . LEU B 2 354 ? 23.907  32.651  43.200  1.00 247.70 ? 331 LEU C CD1   1 
ATOM   5639 C  CD2   . LEU B 2 354 ? 22.462  33.950  44.729  1.00 237.93 ? 331 LEU C CD2   1 
ATOM   5640 N  N     . VAL B 2 355 ? 27.344  35.812  41.898  1.00 287.99 ? 332 VAL C N     1 
ATOM   5641 C  CA    . VAL B 2 355 ? 28.086  36.953  41.377  1.00 276.38 ? 332 VAL C CA    1 
ATOM   5642 C  C     . VAL B 2 355 ? 27.183  37.752  40.427  1.00 271.94 ? 332 VAL C C     1 
ATOM   5643 O  O     . VAL B 2 355 ? 26.414  37.182  39.663  1.00 282.24 ? 332 VAL C O     1 
ATOM   5644 C  CB    . VAL B 2 355 ? 29.356  36.477  40.628  1.00 265.60 ? 332 VAL C CB    1 
ATOM   5645 C  CG1   . VAL B 2 355 ? 29.739  37.448  39.534  1.00 255.32 ? 332 VAL C CG1   1 
ATOM   5646 C  CG2   . VAL B 2 355 ? 30.504  36.263  41.592  1.00 264.29 ? 332 VAL C CG2   1 
ATOM   5647 N  N     . PRO B 2 356 ? 27.260  39.079  40.484  1.00 250.93 ? 333 PRO C N     1 
ATOM   5648 C  CA    . PRO B 2 356 ? 26.404  39.915  39.641  1.00 253.19 ? 333 PRO C CA    1 
ATOM   5649 C  C     . PRO B 2 356 ? 26.662  39.850  38.129  1.00 258.14 ? 333 PRO C C     1 
ATOM   5650 O  O     . PRO B 2 356 ? 26.064  40.660  37.421  1.00 275.11 ? 333 PRO C O     1 
ATOM   5651 C  CB    . PRO B 2 356 ? 26.685  41.329  40.160  1.00 259.71 ? 333 PRO C CB    1 
ATOM   5652 C  CG    . PRO B 2 356 ? 27.134  41.129  41.572  1.00 253.61 ? 333 PRO C CG    1 
ATOM   5653 C  CD    . PRO B 2 356 ? 27.918  39.851  41.549  1.00 245.75 ? 333 PRO C CD    1 
ATOM   5654 N  N     . GLU B 2 357 ? 27.517  38.947  37.649  1.00 248.50 ? 334 GLU C N     1 
ATOM   5655 C  CA    . GLU B 2 357 ? 27.710  38.719  36.197  1.00 260.37 ? 334 GLU C CA    1 
ATOM   5656 C  C     . GLU B 2 357 ? 28.532  39.782  35.444  1.00 271.27 ? 334 GLU C C     1 
ATOM   5657 O  O     . GLU B 2 357 ? 29.206  39.468  34.456  1.00 273.60 ? 334 GLU C O     1 
ATOM   5658 C  CB    . GLU B 2 357 ? 26.380  38.447  35.460  1.00 268.56 ? 334 GLU C CB    1 
ATOM   5659 N  N     . GLU B 2 358 ? 28.466  41.034  35.896  1.00 272.43 ? 335 GLU C N     1 
ATOM   5660 C  CA    . GLU B 2 358 ? 29.315  42.089  35.350  1.00 269.28 ? 335 GLU C CA    1 
ATOM   5661 C  C     . GLU B 2 358 ? 30.673  42.062  36.050  1.00 265.60 ? 335 GLU C C     1 
ATOM   5662 O  O     . GLU B 2 358 ? 31.614  42.765  35.661  1.00 273.67 ? 335 GLU C O     1 
ATOM   5663 C  CB    . GLU B 2 358 ? 28.656  43.451  35.509  1.00 271.43 ? 335 GLU C CB    1 
ATOM   5664 C  CG    . GLU B 2 358 ? 28.279  43.789  36.923  1.00 265.77 ? 335 GLU C CG    1 
ATOM   5665 C  CD    . GLU B 2 358 ? 26.795  44.063  37.060  1.00 273.77 ? 335 GLU C CD    1 
ATOM   5666 O  OE1   . GLU B 2 358 ? 25.988  43.325  36.446  1.00 275.10 ? 335 GLU C OE1   1 
ATOM   5667 O  OE2   . GLU B 2 358 ? 26.437  45.027  37.773  1.00 277.93 ? 335 GLU C OE2   1 
ATOM   5668 N  N     . HIS B 2 359 ? 30.772  41.233  37.085  1.00 253.00 ? 336 HIS C N     1 
ATOM   5669 C  CA    . HIS B 2 359 ? 32.022  41.055  37.798  1.00 250.74 ? 336 HIS C CA    1 
ATOM   5670 C  C     . HIS B 2 359 ? 32.519  39.644  37.586  1.00 245.05 ? 336 HIS C C     1 
ATOM   5671 O  O     . HIS B 2 359 ? 33.548  39.248  38.122  1.00 240.35 ? 336 HIS C O     1 
ATOM   5672 C  CB    . HIS B 2 359 ? 31.827  41.365  39.278  1.00 249.85 ? 336 HIS C CB    1 
ATOM   5673 C  CG    . HIS B 2 359 ? 31.357  42.762  39.523  1.00 256.89 ? 336 HIS C CG    1 
ATOM   5674 N  ND1   . HIS B 2 359 ? 32.116  43.865  39.193  1.00 264.21 ? 336 HIS C ND1   1 
ATOM   5675 C  CD2   . HIS B 2 359 ? 30.193  43.239  40.019  1.00 265.28 ? 336 HIS C CD2   1 
ATOM   5676 C  CE1   . HIS B 2 359 ? 31.447  44.964  39.497  1.00 271.05 ? 336 HIS C CE1   1 
ATOM   5677 N  NE2   . HIS B 2 359 ? 30.275  44.611  39.996  1.00 272.00 ? 336 HIS C NE2   1 
ATOM   5678 N  N     . LEU B 2 360 ? 31.784  38.894  36.774  1.00 249.40 ? 337 LEU C N     1 
ATOM   5679 C  CA    . LEU B 2 360 ? 32.073  37.484  36.563  1.00 247.86 ? 337 LEU C CA    1 
ATOM   5680 C  C     . LEU B 2 360 ? 33.254  37.316  35.643  1.00 243.22 ? 337 LEU C C     1 
ATOM   5681 O  O     . LEU B 2 360 ? 33.209  37.760  34.506  1.00 245.81 ? 337 LEU C O     1 
ATOM   5682 C  CB    . LEU B 2 360 ? 30.865  36.780  35.946  1.00 263.57 ? 337 LEU C CB    1 
ATOM   5683 C  CG    . LEU B 2 360 ? 30.323  35.580  36.725  1.00 276.93 ? 337 LEU C CG    1 
ATOM   5684 C  CD1   . LEU B 2 360 ? 29.539  34.669  35.815  1.00 289.76 ? 337 LEU C CD1   1 
ATOM   5685 C  CD2   . LEU B 2 360 ? 31.446  34.834  37.430  1.00 277.70 ? 337 LEU C CD2   1 
ATOM   5686 N  N     . GLN B 2 361 ? 34.305  36.668  36.128  1.00 236.65 ? 338 GLN C N     1 
ATOM   5687 C  CA    . GLN B 2 361 ? 35.463  36.385  35.287  1.00 232.61 ? 338 GLN C CA    1 
ATOM   5688 C  C     . GLN B 2 361 ? 36.128  35.062  35.686  1.00 226.19 ? 338 GLN C C     1 
ATOM   5689 O  O     . GLN B 2 361 ? 36.394  34.819  36.860  1.00 224.88 ? 338 GLN C O     1 
ATOM   5690 C  CB    . GLN B 2 361 ? 36.469  37.552  35.315  1.00 229.45 ? 338 GLN C CB    1 
ATOM   5691 N  N     . PHE B 2 362 ? 36.380  34.211  34.698  1.00 222.39 ? 339 PHE C N     1 
ATOM   5692 C  CA    . PHE B 2 362 ? 36.980  32.903  34.930  1.00 217.45 ? 339 PHE C CA    1 
ATOM   5693 C  C     . PHE B 2 362 ? 38.381  32.820  34.332  1.00 222.99 ? 339 PHE C C     1 
ATOM   5694 O  O     . PHE B 2 362 ? 38.952  33.827  33.943  1.00 231.65 ? 339 PHE C O     1 
ATOM   5695 C  CB    . PHE B 2 362 ? 36.086  31.813  34.331  1.00 216.79 ? 339 PHE C CB    1 
ATOM   5696 C  CG    . PHE B 2 362 ? 34.725  31.733  34.963  1.00 222.35 ? 339 PHE C CG    1 
ATOM   5697 C  CD1   . PHE B 2 362 ? 34.547  31.088  36.170  1.00 221.70 ? 339 PHE C CD1   1 
ATOM   5698 C  CD2   . PHE B 2 362 ? 33.627  32.308  34.355  1.00 238.87 ? 339 PHE C CD2   1 
ATOM   5699 C  CE1   . PHE B 2 362 ? 33.306  31.021  36.751  1.00 231.09 ? 339 PHE C CE1   1 
ATOM   5700 C  CE2   . PHE B 2 362 ? 32.381  32.243  34.935  1.00 249.26 ? 339 PHE C CE2   1 
ATOM   5701 C  CZ    . PHE B 2 362 ? 32.221  31.603  36.130  1.00 243.54 ? 339 PHE C CZ    1 
ATOM   5702 N  N     . GLU B 2 363 ? 38.941  31.619  34.250  1.00 236.46 ? 340 GLU C N     1 
ATOM   5703 C  CA    . GLU B 2 363 ? 40.223  31.451  33.583  1.00 253.24 ? 340 GLU C CA    1 
ATOM   5704 C  C     . GLU B 2 363 ? 40.090  31.455  32.069  1.00 270.80 ? 340 GLU C C     1 
ATOM   5705 O  O     . GLU B 2 363 ? 39.483  32.356  31.486  1.00 271.03 ? 340 GLU C O     1 
ATOM   5706 C  CB    . GLU B 2 363 ? 40.897  30.163  34.011  1.00 245.97 ? 340 GLU C CB    1 
ATOM   5707 C  CG    . GLU B 2 363 ? 42.349  30.352  34.368  1.00 230.50 ? 340 GLU C CG    1 
ATOM   5708 C  CD    . GLU B 2 363 ? 42.524  30.845  35.792  1.00 222.30 ? 340 GLU C CD    1 
ATOM   5709 O  OE1   . GLU B 2 363 ? 41.838  31.818  36.180  1.00 222.70 ? 340 GLU C OE1   1 
ATOM   5710 O  OE2   . GLU B 2 363 ? 43.339  30.240  36.525  1.00 218.92 ? 340 GLU C OE2   1 
ATOM   5711 N  N     . GLY B 2 364 ? 40.664  30.440  31.436  1.00 284.59 ? 341 GLY C N     1 
ATOM   5712 C  CA    . GLY B 2 364 ? 40.747  30.410  29.988  1.00 301.21 ? 341 GLY C CA    1 
ATOM   5713 C  C     . GLY B 2 364 ? 39.725  29.525  29.302  1.00 310.28 ? 341 GLY C C     1 
ATOM   5714 O  O     . GLY B 2 364 ? 39.488  28.389  29.717  1.00 320.16 ? 341 GLY C O     1 
ATOM   5715 N  N     . GLN B 2 365 ? 39.115  30.061  28.249  1.00 303.93 ? 342 GLN C N     1 
ATOM   5716 C  CA    . GLN B 2 365 ? 38.178  29.316  27.409  1.00 301.42 ? 342 GLN C CA    1 
ATOM   5717 C  C     . GLN B 2 365 ? 36.920  28.843  28.145  1.00 299.86 ? 342 GLN C C     1 
ATOM   5718 O  O     . GLN B 2 365 ? 35.798  29.167  27.749  1.00 306.81 ? 342 GLN C O     1 
ATOM   5719 C  CB    . GLN B 2 365 ? 38.882  28.131  26.730  1.00 302.76 ? 342 GLN C CB    1 
ATOM   5720 N  N     . THR B 2 366 ? 37.123  28.085  29.218  1.00 302.36 ? 343 THR C N     1 
ATOM   5721 C  CA    . THR B 2 366 ? 36.043  27.399  29.915  1.00 318.06 ? 343 THR C CA    1 
ATOM   5722 C  C     . THR B 2 366 ? 35.732  28.055  31.245  1.00 302.32 ? 343 THR C C     1 
ATOM   5723 O  O     . THR B 2 366 ? 36.630  28.580  31.898  1.00 292.63 ? 343 THR C O     1 
ATOM   5724 C  CB    . THR B 2 366 ? 36.458  25.975  30.215  1.00 333.32 ? 343 THR C CB    1 
ATOM   5725 O  OG1   . THR B 2 366 ? 37.511  25.991  31.189  1.00 342.97 ? 343 THR C OG1   1 
ATOM   5726 C  CG2   . THR B 2 366 ? 36.951  25.297  28.936  1.00 332.13 ? 343 THR C CG2   1 
ATOM   5727 N  N     . LYS B 2 367 ? 34.470  28.007  31.660  1.00 295.92 ? 344 LYS C N     1 
ATOM   5728 C  CA    . LYS B 2 367 ? 34.064  28.662  32.902  1.00 275.71 ? 344 LYS C CA    1 
ATOM   5729 C  C     . LYS B 2 367 ? 34.208  27.710  34.113  1.00 245.51 ? 344 LYS C C     1 
ATOM   5730 O  O     . LYS B 2 367 ? 33.296  27.541  34.936  1.00 232.08 ? 344 LYS C O     1 
ATOM   5731 C  CB    . LYS B 2 367 ? 32.660  29.274  32.766  1.00 290.76 ? 344 LYS C CB    1 
ATOM   5732 N  N     . ASP B 2 368 ? 35.397  27.123  34.221  1.00 242.62 ? 345 ASP C N     1 
ATOM   5733 C  CA    . ASP B 2 368 ? 35.675  26.092  35.207  1.00 234.44 ? 345 ASP C CA    1 
ATOM   5734 C  C     . ASP B 2 368 ? 36.346  26.588  36.471  1.00 211.85 ? 345 ASP C C     1 
ATOM   5735 O  O     . ASP B 2 368 ? 36.350  25.884  37.475  1.00 199.71 ? 345 ASP C O     1 
ATOM   5736 C  CB    . ASP B 2 368 ? 36.550  25.010  34.583  1.00 243.92 ? 345 ASP C CB    1 
ATOM   5737 C  CG    . ASP B 2 368 ? 35.778  24.112  33.659  1.00 256.50 ? 345 ASP C CG    1 
ATOM   5738 O  OD1   . ASP B 2 368 ? 34.606  23.836  33.986  1.00 250.82 ? 345 ASP C OD1   1 
ATOM   5739 O  OD2   . ASP B 2 368 ? 36.328  23.691  32.616  1.00 275.24 ? 345 ASP C OD2   1 
ATOM   5740 N  N     . LYS B 2 369 ? 36.936  27.776  36.431  1.00 204.36 ? 346 LYS C N     1 
ATOM   5741 C  CA    . LYS B 2 369 ? 37.662  28.272  37.598  1.00 195.01 ? 346 LYS C CA    1 
ATOM   5742 C  C     . LYS B 2 369 ? 37.469  29.771  37.801  1.00 200.28 ? 346 LYS C C     1 
ATOM   5743 O  O     . LYS B 2 369 ? 37.927  30.574  36.991  1.00 209.96 ? 346 LYS C O     1 
ATOM   5744 C  CB    . LYS B 2 369 ? 39.143  27.939  37.473  1.00 191.89 ? 346 LYS C CB    1 
ATOM   5745 C  CG    . LYS B 2 369 ? 39.966  28.287  38.691  1.00 190.53 ? 346 LYS C CG    1 
ATOM   5746 C  CD    . LYS B 2 369 ? 41.435  27.989  38.423  1.00 193.93 ? 346 LYS C CD    1 
ATOM   5747 C  CE    . LYS B 2 369 ? 42.326  28.395  39.588  1.00 190.96 ? 346 LYS C CE    1 
ATOM   5748 N  NZ    . LYS B 2 369 ? 43.776  28.211  39.282  1.00 188.21 ? 346 LYS C NZ    1 
ATOM   5749 N  N     . LEU B 2 370 ? 36.792  30.144  38.883  1.00 195.14 ? 347 LEU C N     1 
ATOM   5750 C  CA    . LEU B 2 370 ? 36.446  31.543  39.110  1.00 201.02 ? 347 LEU C CA    1 
ATOM   5751 C  C     . LEU B 2 370 ? 37.706  32.360  39.366  1.00 196.89 ? 347 LEU C C     1 
ATOM   5752 O  O     . LEU B 2 370 ? 38.486  32.041  40.254  1.00 195.08 ? 347 LEU C O     1 
ATOM   5753 C  CB    . LEU B 2 370 ? 35.470  31.681  40.281  1.00 212.91 ? 347 LEU C CB    1 
ATOM   5754 C  CG    . LEU B 2 370 ? 34.983  33.111  40.511  1.00 223.04 ? 347 LEU C CG    1 
ATOM   5755 C  CD1   . LEU B 2 370 ? 34.136  33.519  39.339  1.00 229.58 ? 347 LEU C CD1   1 
ATOM   5756 C  CD2   . LEU B 2 370 ? 34.207  33.271  41.800  1.00 224.31 ? 347 LEU C CD2   1 
ATOM   5757 N  N     . GLY B 2 371 ? 37.915  33.403  38.575  1.00 206.77 ? 348 GLY C N     1 
ATOM   5758 C  CA    . GLY B 2 371 ? 39.103  34.219  38.724  1.00 212.17 ? 348 GLY C CA    1 
ATOM   5759 C  C     . GLY B 2 371 ? 38.831  35.564  39.372  1.00 225.16 ? 348 GLY C C     1 
ATOM   5760 O  O     . GLY B 2 371 ? 39.769  36.263  39.774  1.00 219.88 ? 348 GLY C O     1 
ATOM   5761 N  N     . SER B 2 372 ? 37.553  35.925  39.479  1.00 243.66 ? 349 SER C N     1 
ATOM   5762 C  CA    . SER B 2 372 ? 37.169  37.259  39.934  1.00 253.41 ? 349 SER C CA    1 
ATOM   5763 C  C     . SER B 2 372 ? 37.690  37.535  41.343  1.00 245.19 ? 349 SER C C     1 
ATOM   5764 O  O     . SER B 2 372 ? 37.304  36.870  42.299  1.00 249.44 ? 349 SER C O     1 
ATOM   5765 C  CB    . SER B 2 372 ? 35.654  37.458  39.832  1.00 260.95 ? 349 SER C CB    1 
ATOM   5766 O  OG    . SER B 2 372 ? 35.020  37.223  41.067  1.00 255.28 ? 349 SER C OG    1 
ATOM   5767 N  N     . PRO B 2 373 ? 38.563  38.543  41.463  1.00 227.60 ? 350 PRO C N     1 
ATOM   5768 C  CA    . PRO B 2 373 ? 39.399  38.755  42.645  1.00 212.75 ? 350 PRO C CA    1 
ATOM   5769 C  C     . PRO B 2 373 ? 38.588  39.043  43.905  1.00 207.76 ? 350 PRO C C     1 
ATOM   5770 O  O     . PRO B 2 373 ? 38.916  38.467  44.947  1.00 211.81 ? 350 PRO C O     1 
ATOM   5771 C  CB    . PRO B 2 373 ? 40.233  39.974  42.255  1.00 208.10 ? 350 PRO C CB    1 
ATOM   5772 C  CG    . PRO B 2 373 ? 39.330  40.757  41.343  1.00 214.49 ? 350 PRO C CG    1 
ATOM   5773 C  CD    . PRO B 2 373 ? 38.565  39.715  40.567  1.00 223.44 ? 350 PRO C CD    1 
ATOM   5774 N  N     . LEU B 2 374 ? 37.561  39.897  43.811  1.00 196.29 ? 351 LEU C N     1 
ATOM   5775 C  CA    . LEU B 2 374 ? 36.729  40.268  44.962  1.00 188.68 ? 351 LEU C CA    1 
ATOM   5776 C  C     . LEU B 2 374 ? 36.062  39.064  45.663  1.00 188.92 ? 351 LEU C C     1 
ATOM   5777 O  O     . LEU B 2 374 ? 35.659  39.163  46.824  1.00 185.51 ? 351 LEU C O     1 
ATOM   5778 C  CB    . LEU B 2 374 ? 35.655  41.283  44.557  1.00 186.63 ? 351 LEU C CB    1 
ATOM   5779 C  CG    . LEU B 2 374 ? 35.438  42.507  45.471  1.00 182.29 ? 351 LEU C CG    1 
ATOM   5780 C  CD1   . LEU B 2 374 ? 34.125  43.243  45.178  1.00 187.57 ? 351 LEU C CD1   1 
ATOM   5781 C  CD2   . LEU B 2 374 ? 35.533  42.196  46.954  1.00 173.73 ? 351 LEU C CD2   1 
ATOM   5782 N  N     . ALA B 2 375 ? 35.945  37.936  44.967  1.00 190.57 ? 352 ALA C N     1 
ATOM   5783 C  CA    . ALA B 2 375 ? 35.272  36.773  45.537  1.00 186.66 ? 352 ALA C CA    1 
ATOM   5784 C  C     . ALA B 2 375 ? 36.030  36.185  46.732  1.00 182.93 ? 352 ALA C C     1 
ATOM   5785 O  O     . ALA B 2 375 ? 35.410  35.710  47.685  1.00 179.15 ? 352 ALA C O     1 
ATOM   5786 C  CB    . ALA B 2 375 ? 35.014  35.722  44.480  1.00 183.01 ? 352 ALA C CB    1 
ATOM   5787 N  N     . ARG B 2 376 ? 37.363  36.236  46.693  1.00 192.70 ? 353 ARG C N     1 
ATOM   5788 C  CA    . ARG B 2 376 ? 38.175  35.738  47.811  1.00 204.43 ? 353 ARG C CA    1 
ATOM   5789 C  C     . ARG B 2 376 ? 37.942  36.482  49.141  1.00 203.04 ? 353 ARG C C     1 
ATOM   5790 O  O     . ARG B 2 376 ? 37.689  35.847  50.163  1.00 200.96 ? 353 ARG C O     1 
ATOM   5791 C  CB    . ARG B 2 376 ? 39.675  35.679  47.473  1.00 219.17 ? 353 ARG C CB    1 
ATOM   5792 C  CG    . ARG B 2 376 ? 40.471  34.831  48.470  1.00 223.06 ? 353 ARG C CG    1 
ATOM   5793 C  CD    . ARG B 2 376 ? 41.970  35.048  48.378  1.00 224.04 ? 353 ARG C CD    1 
ATOM   5794 N  NE    . ARG B 2 376 ? 42.411  36.116  49.272  1.00 226.85 ? 353 ARG C NE    1 
ATOM   5795 C  CZ    . ARG B 2 376 ? 42.623  37.377  48.898  1.00 235.49 ? 353 ARG C CZ    1 
ATOM   5796 N  NH1   . ARG B 2 376 ? 42.447  37.746  47.631  1.00 248.08 ? 353 ARG C NH1   1 
ATOM   5797 N  NH2   . ARG B 2 376 ? 43.019  38.270  49.797  1.00 231.65 ? 353 ARG C NH2   1 
ATOM   5798 N  N     . PRO B 2 377 ? 38.028  37.826  49.139  1.00 202.32 ? 354 PRO C N     1 
ATOM   5799 C  CA    . PRO B 2 377 ? 37.743  38.485  50.416  1.00 199.08 ? 354 PRO C CA    1 
ATOM   5800 C  C     . PRO B 2 377 ? 36.262  38.671  50.756  1.00 200.54 ? 354 PRO C C     1 
ATOM   5801 O  O     . PRO B 2 377 ? 36.008  39.275  51.794  1.00 200.58 ? 354 PRO C O     1 
ATOM   5802 C  CB    . PRO B 2 377 ? 38.398  39.855  50.251  1.00 199.78 ? 354 PRO C CB    1 
ATOM   5803 C  CG    . PRO B 2 377 ? 38.366  40.105  48.800  1.00 203.61 ? 354 PRO C CG    1 
ATOM   5804 C  CD    . PRO B 2 377 ? 38.580  38.773  48.152  1.00 204.15 ? 354 PRO C CD    1 
ATOM   5805 N  N     . VAL B 2 378 ? 35.316  38.207  49.935  1.00 200.69 ? 355 VAL C N     1 
ATOM   5806 C  CA    . VAL B 2 378 ? 33.908  38.318  50.327  1.00 197.57 ? 355 VAL C CA    1 
ATOM   5807 C  C     . VAL B 2 378 ? 33.426  37.030  50.918  1.00 199.54 ? 355 VAL C C     1 
ATOM   5808 O  O     . VAL B 2 378 ? 32.565  37.047  51.796  1.00 200.17 ? 355 VAL C O     1 
ATOM   5809 C  CB    . VAL B 2 378 ? 32.946  38.695  49.185  1.00 194.71 ? 355 VAL C CB    1 
ATOM   5810 C  CG1   . VAL B 2 378 ? 33.231  40.094  48.669  1.00 196.71 ? 355 VAL C CG1   1 
ATOM   5811 C  CG2   . VAL B 2 378 ? 33.017  37.692  48.077  1.00 195.86 ? 355 VAL C CG2   1 
ATOM   5812 N  N     . VAL B 2 379 ? 33.979  35.916  50.429  1.00 202.72 ? 356 VAL C N     1 
ATOM   5813 C  CA    . VAL B 2 379 ? 33.645  34.590  50.945  1.00 209.98 ? 356 VAL C CA    1 
ATOM   5814 C  C     . VAL B 2 379 ? 34.376  34.401  52.246  1.00 228.17 ? 356 VAL C C     1 
ATOM   5815 O  O     . VAL B 2 379 ? 33.779  34.001  53.231  1.00 233.77 ? 356 VAL C O     1 
ATOM   5816 C  CB    . VAL B 2 379 ? 34.033  33.459  49.983  1.00 200.93 ? 356 VAL C CB    1 
ATOM   5817 C  CG1   . VAL B 2 379 ? 33.762  32.115  50.626  1.00 200.86 ? 356 VAL C CG1   1 
ATOM   5818 C  CG2   . VAL B 2 379 ? 33.258  33.581  48.681  1.00 198.20 ? 356 VAL C CG2   1 
ATOM   5819 N  N     . ASP B 2 380 ? 35.667  34.716  52.251  1.00 236.36 ? 357 ASP C N     1 
ATOM   5820 C  CA    . ASP B 2 380 ? 36.436  34.767  53.496  1.00 232.92 ? 357 ASP C CA    1 
ATOM   5821 C  C     . ASP B 2 380 ? 35.780  35.702  54.512  1.00 234.60 ? 357 ASP C C     1 
ATOM   5822 O  O     . ASP B 2 380 ? 35.843  35.473  55.712  1.00 243.30 ? 357 ASP C O     1 
ATOM   5823 C  CB    . ASP B 2 380 ? 37.874  35.226  53.239  1.00 223.57 ? 357 ASP C CB    1 
ATOM   5824 C  CG    . ASP B 2 380 ? 38.804  34.929  54.408  1.00 213.86 ? 357 ASP C CG    1 
ATOM   5825 O  OD1   . ASP B 2 380 ? 38.685  35.586  55.468  1.00 214.00 ? 357 ASP C OD1   1 
ATOM   5826 O  OD2   . ASP B 2 380 ? 39.664  34.035  54.257  1.00 207.58 ? 357 ASP C OD2   1 
ATOM   5827 N  N     . GLY B 2 381 ? 35.160  36.766  54.030  1.00 219.51 ? 358 GLY C N     1 
ATOM   5828 C  CA    . GLY B 2 381 ? 34.423  37.629  54.920  1.00 199.44 ? 358 GLY C CA    1 
ATOM   5829 C  C     . GLY B 2 381 ? 33.299  36.862  55.576  1.00 178.21 ? 358 GLY C C     1 
ATOM   5830 O  O     . GLY B 2 381 ? 33.380  36.499  56.751  1.00 172.91 ? 358 GLY C O     1 
ATOM   5831 N  N     . ILE B 2 382 ? 32.258  36.605  54.796  1.00 172.51 ? 359 ILE C N     1 
ATOM   5832 C  CA    . ILE B 2 382 ? 31.031  35.968  55.264  1.00 175.85 ? 359 ILE C CA    1 
ATOM   5833 C  C     . ILE B 2 382 ? 31.259  34.721  56.125  1.00 171.98 ? 359 ILE C C     1 
ATOM   5834 O  O     . ILE B 2 382 ? 30.591  34.523  57.139  1.00 164.94 ? 359 ILE C O     1 
ATOM   5835 C  CB    . ILE B 2 382 ? 30.147  35.595  54.062  1.00 180.86 ? 359 ILE C CB    1 
ATOM   5836 C  CG1   . ILE B 2 382 ? 29.758  36.856  53.275  1.00 182.23 ? 359 ILE C CG1   1 
ATOM   5837 C  CG2   . ILE B 2 382 ? 28.918  34.809  54.513  1.00 185.28 ? 359 ILE C CG2   1 
ATOM   5838 C  CD1   . ILE B 2 382 ? 28.843  37.784  54.022  1.00 183.42 ? 359 ILE C CD1   1 
ATOM   5839 N  N     . VAL B 2 383 ? 32.212  33.889  55.721  1.00 193.56 ? 360 VAL C N     1 
ATOM   5840 C  CA    . VAL B 2 383 ? 32.463  32.631  56.417  1.00 218.57 ? 360 VAL C CA    1 
ATOM   5841 C  C     . VAL B 2 383 ? 33.256  32.832  57.694  1.00 251.51 ? 360 VAL C C     1 
ATOM   5842 O  O     . VAL B 2 383 ? 32.834  32.375  58.751  1.00 259.44 ? 360 VAL C O     1 
ATOM   5843 C  CB    . VAL B 2 383 ? 33.205  31.601  55.529  1.00 208.23 ? 360 VAL C CB    1 
ATOM   5844 C  CG1   . VAL B 2 383 ? 33.707  30.439  56.366  1.00 215.15 ? 360 VAL C CG1   1 
ATOM   5845 C  CG2   . VAL B 2 383 ? 32.300  31.101  54.417  1.00 192.20 ? 360 VAL C CG2   1 
ATOM   5846 N  N     . ALA B 2 384 ? 34.396  33.512  57.600  1.00 266.60 ? 361 ALA C N     1 
ATOM   5847 C  CA    . ALA B 2 384 ? 35.263  33.694  58.759  1.00 264.26 ? 361 ALA C CA    1 
ATOM   5848 C  C     . ALA B 2 384 ? 34.511  34.379  59.881  1.00 251.02 ? 361 ALA C C     1 
ATOM   5849 O  O     . ALA B 2 384 ? 34.814  34.174  61.050  1.00 261.25 ? 361 ALA C O     1 
ATOM   5850 C  CB    . ALA B 2 384 ? 36.507  34.479  58.402  1.00 267.73 ? 361 ALA C CB    1 
ATOM   5851 N  N     . ASP B 2 385 ? 33.521  35.184  59.519  1.00 220.39 ? 362 ASP C N     1 
ATOM   5852 C  CA    . ASP B 2 385 ? 32.697  35.842  60.517  1.00 196.60 ? 362 ASP C CA    1 
ATOM   5853 C  C     . ASP B 2 385 ? 31.837  34.820  61.246  1.00 196.84 ? 362 ASP C C     1 
ATOM   5854 O  O     . ASP B 2 385 ? 31.979  34.633  62.454  1.00 200.60 ? 362 ASP C O     1 
ATOM   5855 C  CB    . ASP B 2 385 ? 31.817  36.918  59.875  1.00 199.19 ? 362 ASP C CB    1 
ATOM   5856 N  N     . LYS B 2 386 ? 30.963  34.148  60.507  1.00 191.82 ? 363 LYS C N     1 
ATOM   5857 C  CA    . LYS B 2 386 ? 29.974  33.272  61.122  1.00 191.44 ? 363 LYS C CA    1 
ATOM   5858 C  C     . LYS B 2 386 ? 30.569  32.151  61.971  1.00 192.91 ? 363 LYS C C     1 
ATOM   5859 O  O     . LYS B 2 386 ? 29.993  31.780  62.992  1.00 196.62 ? 363 LYS C O     1 
ATOM   5860 C  CB    . LYS B 2 386 ? 29.021  32.696  60.072  1.00 192.29 ? 363 LYS C CB    1 
ATOM   5861 C  CG    . LYS B 2 386 ? 27.721  33.478  59.910  1.00 198.30 ? 363 LYS C CG    1 
ATOM   5862 C  CD    . LYS B 2 386 ? 27.917  34.736  59.071  1.00 201.29 ? 363 LYS C CD    1 
ATOM   5863 C  CE    . LYS B 2 386 ? 26.790  35.744  59.292  1.00 207.02 ? 363 LYS C CE    1 
ATOM   5864 N  NZ    . LYS B 2 386 ? 25.439  35.182  58.999  1.00 206.49 ? 363 LYS C NZ    1 
ATOM   5865 N  N     . LEU B 2 387 ? 31.715  31.614  61.572  1.00 226.43 ? 364 LEU C N     1 
ATOM   5866 C  CA    . LEU B 2 387 ? 32.259  30.483  62.323  1.00 269.85 ? 364 LEU C CA    1 
ATOM   5867 C  C     . LEU B 2 387 ? 33.446  30.803  63.232  1.00 287.59 ? 364 LEU C C     1 
ATOM   5868 O  O     . LEU B 2 387 ? 34.176  29.904  63.640  1.00 307.79 ? 364 LEU C O     1 
ATOM   5869 C  CB    . LEU B 2 387 ? 32.497  29.243  61.431  1.00 287.18 ? 364 LEU C CB    1 
ATOM   5870 C  CG    . LEU B 2 387 ? 33.716  28.945  60.547  1.00 298.51 ? 364 LEU C CG    1 
ATOM   5871 C  CD1   . LEU B 2 387 ? 34.499  30.207  60.193  1.00 292.22 ? 364 LEU C CD1   1 
ATOM   5872 C  CD2   . LEU B 2 387 ? 34.610  27.885  61.174  1.00 312.25 ? 364 LEU C CD2   1 
ATOM   5873 N  N     . THR B 2 388 ? 33.638  32.080  63.543  1.00 271.20 ? 365 THR C N     1 
ATOM   5874 C  CA    . THR B 2 388 ? 34.410  32.423  64.733  1.00 244.98 ? 365 THR C CA    1 
ATOM   5875 C  C     . THR B 2 388 ? 33.380  32.463  65.843  1.00 215.73 ? 365 THR C C     1 
ATOM   5876 O  O     . THR B 2 388 ? 33.678  32.185  67.007  1.00 219.59 ? 365 THR C O     1 
ATOM   5877 C  CB    . THR B 2 388 ? 35.140  33.786  64.652  1.00 249.81 ? 365 THR C CB    1 
ATOM   5878 O  OG1   . THR B 2 388 ? 35.404  34.130  63.290  1.00 264.04 ? 365 THR C OG1   1 
ATOM   5879 C  CG2   . THR B 2 388 ? 36.461  33.721  65.407  1.00 236.76 ? 365 THR C CG2   1 
ATOM   5880 N  N     . PHE B 2 389 ? 32.151  32.798  65.452  1.00 187.59 ? 366 PHE C N     1 
ATOM   5881 C  CA    . PHE B 2 389 ? 31.014  32.783  66.359  1.00 183.00 ? 366 PHE C CA    1 
ATOM   5882 C  C     . PHE B 2 389 ? 30.658  31.353  66.711  1.00 176.93 ? 366 PHE C C     1 
ATOM   5883 O  O     . PHE B 2 389 ? 30.546  31.019  67.888  1.00 177.24 ? 366 PHE C O     1 
ATOM   5884 C  CB    . PHE B 2 389 ? 29.801  33.487  65.741  1.00 184.78 ? 366 PHE C CB    1 
ATOM   5885 N  N     . PHE B 2 390 ? 30.495  30.509  65.691  1.00 196.69 ? 367 PHE C N     1 
ATOM   5886 C  CA    . PHE B 2 390 ? 30.075  29.128  65.908  1.00 225.43 ? 367 PHE C CA    1 
ATOM   5887 C  C     . PHE B 2 390 ? 31.025  28.357  66.839  1.00 268.42 ? 367 PHE C C     1 
ATOM   5888 O  O     . PHE B 2 390 ? 30.593  27.575  67.705  1.00 277.32 ? 367 PHE C O     1 
ATOM   5889 C  CB    . PHE B 2 390 ? 29.918  28.387  64.577  1.00 209.29 ? 367 PHE C CB    1 
ATOM   5890 C  CG    . PHE B 2 390 ? 29.591  26.912  64.735  1.00 197.13 ? 367 PHE C CG    1 
ATOM   5891 C  CD1   . PHE B 2 390 ? 28.295  26.499  65.041  1.00 178.65 ? 367 PHE C CD1   1 
ATOM   5892 C  CD2   . PHE B 2 390 ? 30.584  25.937  64.585  1.00 207.22 ? 367 PHE C CD2   1 
ATOM   5893 C  CE1   . PHE B 2 390 ? 27.995  25.148  65.187  1.00 177.09 ? 367 PHE C CE1   1 
ATOM   5894 C  CE2   . PHE B 2 390 ? 30.291  24.586  64.732  1.00 205.27 ? 367 PHE C CE2   1 
ATOM   5895 C  CZ    . PHE B 2 390 ? 28.995  24.189  65.030  1.00 191.06 ? 367 PHE C CZ    1 
ATOM   5896 N  N     . LEU B 2 391 ? 32.321  28.588  66.648  1.00 293.13 ? 368 LEU C N     1 
ATOM   5897 C  CA    . LEU B 2 391 ? 33.340  27.888  67.413  1.00 300.61 ? 368 LEU C CA    1 
ATOM   5898 C  C     . LEU B 2 391 ? 33.288  28.320  68.866  1.00 297.15 ? 368 LEU C C     1 
ATOM   5899 O  O     . LEU B 2 391 ? 33.287  27.482  69.769  1.00 301.55 ? 368 LEU C O     1 
ATOM   5900 C  CB    . LEU B 2 391 ? 34.729  28.123  66.814  1.00 297.71 ? 368 LEU C CB    1 
ATOM   5901 C  CG    . LEU B 2 391 ? 35.369  26.918  66.115  1.00 281.61 ? 368 LEU C CG    1 
ATOM   5902 C  CD1   . LEU B 2 391 ? 34.347  26.107  65.316  1.00 287.10 ? 368 LEU C CD1   1 
ATOM   5903 C  CD2   . LEU B 2 391 ? 36.510  27.373  65.221  1.00 261.54 ? 368 LEU C CD2   1 
ATOM   5904 N  N     . MET B 2 392 ? 33.227  29.630  69.093  1.00 280.51 ? 369 MET C N     1 
ATOM   5905 C  CA    . MET B 2 392 ? 33.115  30.150  70.451  1.00 260.24 ? 369 MET C CA    1 
ATOM   5906 C  C     . MET B 2 392 ? 31.794  29.691  71.083  1.00 242.59 ? 369 MET C C     1 
ATOM   5907 O  O     . MET B 2 392 ? 31.697  29.537  72.304  1.00 237.19 ? 369 MET C O     1 
ATOM   5908 C  CB    . MET B 2 392 ? 33.231  31.680  70.463  1.00 259.52 ? 369 MET C CB    1 
ATOM   5909 N  N     . GLU B 2 393 ? 30.797  29.434  70.239  1.00 229.97 ? 370 GLU C N     1 
ATOM   5910 C  CA    . GLU B 2 393 ? 29.437  29.153  70.697  1.00 214.92 ? 370 GLU C CA    1 
ATOM   5911 C  C     . GLU B 2 393 ? 29.293  27.812  71.413  1.00 210.58 ? 370 GLU C C     1 
ATOM   5912 O  O     . GLU B 2 393 ? 28.426  27.647  72.280  1.00 212.13 ? 370 GLU C O     1 
ATOM   5913 C  CB    . GLU B 2 393 ? 28.448  29.238  69.529  1.00 207.38 ? 370 GLU C CB    1 
ATOM   5914 C  CG    . GLU B 2 393 ? 26.984  29.322  69.946  1.00 212.35 ? 370 GLU C CG    1 
ATOM   5915 C  CD    . GLU B 2 393 ? 26.640  30.624  70.660  1.00 221.67 ? 370 GLU C CD    1 
ATOM   5916 O  OE1   . GLU B 2 393 ? 26.987  30.773  71.853  1.00 226.33 ? 370 GLU C OE1   1 
ATOM   5917 O  OE2   . GLU B 2 393 ? 26.015  31.500  70.027  1.00 224.55 ? 370 GLU C OE2   1 
ATOM   5918 N  N     . ASN B 2 394 ? 30.133  26.851  71.049  1.00 210.07 ? 371 ASN C N     1 
ATOM   5919 C  CA    . ASN B 2 394 ? 30.115  25.546  71.710  1.00 208.64 ? 371 ASN C CA    1 
ATOM   5920 C  C     . ASN B 2 394 ? 31.458  24.808  71.669  1.00 206.14 ? 371 ASN C C     1 
ATOM   5921 O  O     . ASN B 2 394 ? 31.898  24.330  70.620  1.00 202.52 ? 371 ASN C O     1 
ATOM   5922 C  CB    . ASN B 2 394 ? 28.961  24.670  71.186  1.00 200.67 ? 371 ASN C CB    1 
ATOM   5923 C  CG    . ASN B 2 394 ? 28.964  24.523  69.670  1.00 200.33 ? 371 ASN C CG    1 
ATOM   5924 O  OD1   . ASN B 2 394 ? 29.475  23.533  69.145  1.00 196.83 ? 371 ASN C OD1   1 
ATOM   5925 N  ND2   . ASN B 2 394 ? 28.378  25.499  68.962  1.00 210.91 ? 371 ASN C ND2   1 
ATOM   5926 N  N     . GLY B 2 395 ? 32.098  24.722  72.834  1.00 208.12 ? 372 GLY C N     1 
ATOM   5927 C  CA    . GLY B 2 395 ? 33.415  24.122  72.962  1.00 203.42 ? 372 GLY C CA    1 
ATOM   5928 C  C     . GLY B 2 395 ? 33.424  22.623  72.744  1.00 195.72 ? 372 GLY C C     1 
ATOM   5929 O  O     . GLY B 2 395 ? 34.485  21.995  72.729  1.00 190.53 ? 372 GLY C O     1 
ATOM   5930 N  N     . GLU B 2 396 ? 32.237  22.047  72.590  1.00 194.57 ? 373 GLU C N     1 
ATOM   5931 C  CA    . GLU B 2 396 ? 32.113  20.659  72.174  1.00 189.87 ? 373 GLU C CA    1 
ATOM   5932 C  C     . GLU B 2 396 ? 32.754  20.478  70.797  1.00 184.88 ? 373 GLU C C     1 
ATOM   5933 O  O     . GLU B 2 396 ? 33.972  20.295  70.687  1.00 184.17 ? 373 GLU C O     1 
ATOM   5934 C  CB    . GLU B 2 396 ? 30.644  20.237  72.133  1.00 189.45 ? 373 GLU C CB    1 
ATOM   5935 N  N     . LEU B 2 397 ? 31.950  20.581  69.739  1.00 177.42 ? 374 LEU C N     1 
ATOM   5936 C  CA    . LEU B 2 397 ? 32.441  20.314  68.389  1.00 192.01 ? 374 LEU C CA    1 
ATOM   5937 C  C     . LEU B 2 397 ? 33.624  21.196  67.997  1.00 192.12 ? 374 LEU C C     1 
ATOM   5938 O  O     . LEU B 2 397 ? 34.076  21.136  66.860  1.00 181.66 ? 374 LEU C O     1 
ATOM   5939 C  CB    . LEU B 2 397 ? 31.316  20.450  67.353  1.00 212.33 ? 374 LEU C CB    1 
ATOM   5940 N  N     . ALA B 2 398 ? 34.125  21.986  68.946  1.00 208.43 ? 375 ALA C N     1 
ATOM   5941 C  CA    . ALA B 2 398 ? 35.129  23.019  68.680  1.00 226.21 ? 375 ALA C CA    1 
ATOM   5942 C  C     . ALA B 2 398 ? 36.556  22.605  69.033  1.00 226.98 ? 375 ALA C C     1 
ATOM   5943 O  O     . ALA B 2 398 ? 37.363  22.307  68.151  1.00 232.37 ? 375 ALA C O     1 
ATOM   5944 C  CB    . ALA B 2 398 ? 34.763  24.310  69.411  1.00 240.57 ? 375 ALA C CB    1 
ATOM   5945 N  N     . SER B 2 399 ? 36.868  22.614  70.327  1.00 223.62 ? 376 SER C N     1 
ATOM   5946 C  CA    . SER B 2 399 ? 38.203  22.254  70.792  1.00 226.88 ? 376 SER C CA    1 
ATOM   5947 C  C     . SER B 2 399 ? 38.524  20.813  70.392  1.00 234.49 ? 376 SER C C     1 
ATOM   5948 O  O     . SER B 2 399 ? 39.675  20.490  70.080  1.00 249.32 ? 376 SER C O     1 
ATOM   5949 C  CB    . SER B 2 399 ? 38.331  22.462  72.304  1.00 225.97 ? 376 SER C CB    1 
ATOM   5950 N  N     . ASN B 2 400 ? 37.501  19.961  70.382  1.00 223.64 ? 377 ASN C N     1 
ATOM   5951 C  CA    . ASN B 2 400 ? 37.656  18.582  69.930  1.00 212.47 ? 377 ASN C CA    1 
ATOM   5952 C  C     . ASN B 2 400 ? 38.068  18.536  68.468  1.00 226.54 ? 377 ASN C C     1 
ATOM   5953 O  O     . ASN B 2 400 ? 38.914  17.734  68.067  1.00 237.11 ? 377 ASN C O     1 
ATOM   5954 C  CB    . ASN B 2 400 ? 36.366  17.790  70.141  1.00 190.54 ? 377 ASN C CB    1 
ATOM   5955 C  CG    . ASN B 2 400 ? 36.444  16.863  71.339  1.00 181.97 ? 377 ASN C CG    1 
ATOM   5956 O  OD1   . ASN B 2 400 ? 37.482  16.253  71.605  1.00 179.13 ? 377 ASN C OD1   1 
ATOM   5957 N  ND2   . ASN B 2 400 ? 35.343  16.751  72.073  1.00 188.07 ? 377 ASN C ND2   1 
ATOM   5958 N  N     . LEU B 2 401 ? 37.468  19.420  67.681  1.00 223.21 ? 378 LEU C N     1 
ATOM   5959 C  CA    . LEU B 2 401 ? 37.771  19.523  66.264  1.00 209.64 ? 378 LEU C CA    1 
ATOM   5960 C  C     . LEU B 2 401 ? 39.207  19.986  66.035  1.00 221.87 ? 378 LEU C C     1 
ATOM   5961 O  O     . LEU B 2 401 ? 39.868  19.556  65.093  1.00 215.37 ? 378 LEU C O     1 
ATOM   5962 C  CB    . LEU B 2 401 ? 36.811  20.511  65.619  1.00 181.81 ? 378 LEU C CB    1 
ATOM   5963 C  CG    . LEU B 2 401 ? 36.178  20.129  64.292  1.00 155.29 ? 378 LEU C CG    1 
ATOM   5964 C  CD1   . LEU B 2 401 ? 35.215  21.229  63.868  1.00 154.60 ? 378 LEU C CD1   1 
ATOM   5965 C  CD2   . LEU B 2 401 ? 37.261  19.894  63.250  1.00 147.16 ? 378 LEU C CD2   1 
ATOM   5966 N  N     . ILE B 2 402 ? 39.686  20.870  66.896  1.00 237.54 ? 379 ILE C N     1 
ATOM   5967 C  CA    . ILE B 2 402 ? 41.047  21.368  66.765  1.00 242.28 ? 379 ILE C CA    1 
ATOM   5968 C  C     . ILE B 2 402 ? 42.066  20.282  67.049  1.00 237.10 ? 379 ILE C C     1 
ATOM   5969 O  O     . ILE B 2 402 ? 43.040  20.125  66.308  1.00 239.08 ? 379 ILE C O     1 
ATOM   5970 C  CB    . ILE B 2 402 ? 41.331  22.488  67.750  1.00 247.10 ? 379 ILE C CB    1 
ATOM   5971 C  CG1   . ILE B 2 402 ? 40.298  23.602  67.595  1.00 247.13 ? 379 ILE C CG1   1 
ATOM   5972 C  CG2   . ILE B 2 402 ? 42.752  23.001  67.554  1.00 248.81 ? 379 ILE C CG2   1 
ATOM   5973 C  CD1   . ILE B 2 402 ? 40.688  24.850  68.303  1.00 247.08 ? 379 ILE C CD1   1 
ATOM   5974 N  N     . ARG B 2 403 ? 41.840  19.565  68.147  1.00 227.69 ? 380 ARG C N     1 
ATOM   5975 C  CA    . ARG B 2 403 ? 42.697  18.465  68.558  1.00 215.91 ? 380 ARG C CA    1 
ATOM   5976 C  C     . ARG B 2 403 ? 42.903  17.559  67.364  1.00 212.52 ? 380 ARG C C     1 
ATOM   5977 O  O     . ARG B 2 403 ? 44.035  17.204  67.042  1.00 203.78 ? 380 ARG C O     1 
ATOM   5978 C  CB    . ARG B 2 403 ? 42.045  17.695  69.705  1.00 207.11 ? 380 ARG C CB    1 
ATOM   5979 C  CG    . ARG B 2 403 ? 43.027  16.957  70.598  1.00 196.51 ? 380 ARG C CG    1 
ATOM   5980 C  CD    . ARG B 2 403 ? 42.344  16.375  71.841  1.00 193.48 ? 380 ARG C CD    1 
ATOM   5981 N  NE    . ARG B 2 403 ? 42.006  17.384  72.847  1.00 202.72 ? 380 ARG C NE    1 
ATOM   5982 C  CZ    . ARG B 2 403 ? 40.784  17.875  73.054  1.00 221.54 ? 380 ARG C CZ    1 
ATOM   5983 N  NH1   . ARG B 2 403 ? 39.761  17.450  72.320  1.00 221.35 ? 380 ARG C NH1   1 
ATOM   5984 N  NH2   . ARG B 2 403 ? 40.585  18.791  74.001  1.00 238.42 ? 380 ARG C NH2   1 
ATOM   5985 N  N     . LYS B 2 404 ? 41.797  17.235  66.692  1.00 216.28 ? 381 LYS C N     1 
ATOM   5986 C  CA    . LYS B 2 404 ? 41.799  16.426  65.474  1.00 207.55 ? 381 LYS C CA    1 
ATOM   5987 C  C     . LYS B 2 404 ? 42.774  16.952  64.428  1.00 200.22 ? 381 LYS C C     1 
ATOM   5988 O  O     . LYS B 2 404 ? 43.434  16.181  63.732  1.00 194.03 ? 381 LYS C O     1 
ATOM   5989 C  CB    . LYS B 2 404 ? 40.389  16.360  64.881  1.00 198.56 ? 381 LYS C CB    1 
ATOM   5990 C  CG    . LYS B 2 404 ? 40.324  15.792  63.467  1.00 182.42 ? 381 LYS C CG    1 
ATOM   5991 C  CD    . LYS B 2 404 ? 38.952  16.037  62.843  1.00 169.84 ? 381 LYS C CD    1 
ATOM   5992 C  CE    . LYS B 2 404 ? 38.909  15.721  61.349  1.00 161.00 ? 381 LYS C CE    1 
ATOM   5993 N  NZ    . LYS B 2 404 ? 38.590  14.281  61.085  1.00 158.12 ? 381 LYS C NZ    1 
ATOM   5994 N  N     . ALA B 2 405 ? 42.864  18.272  64.325  1.00 196.84 ? 382 ALA C N     1 
ATOM   5995 C  CA    . ALA B 2 405 ? 43.757  18.885  63.347  1.00 189.91 ? 382 ALA C CA    1 
ATOM   5996 C  C     . ALA B 2 405 ? 45.211  18.597  63.698  1.00 189.15 ? 382 ALA C C     1 
ATOM   5997 O  O     . ALA B 2 405 ? 46.037  18.356  62.818  1.00 194.81 ? 382 ALA C O     1 
ATOM   5998 C  CB    . ALA B 2 405 ? 43.509  20.382  63.253  1.00 185.69 ? 382 ALA C CB    1 
ATOM   5999 N  N     . ILE B 2 406 ? 45.515  18.601  64.993  1.00 179.26 ? 383 ILE C N     1 
ATOM   6000 C  CA    . ILE B 2 406 ? 46.875  18.348  65.457  1.00 165.17 ? 383 ILE C CA    1 
ATOM   6001 C  C     . ILE B 2 406 ? 47.255  16.868  65.342  1.00 154.15 ? 383 ILE C C     1 
ATOM   6002 O  O     . ILE B 2 406 ? 48.424  16.536  65.153  1.00 156.88 ? 383 ILE C O     1 
ATOM   6003 C  CB    . ILE B 2 406 ? 47.071  18.835  66.899  1.00 168.34 ? 383 ILE C CB    1 
ATOM   6004 C  CG1   . ILE B 2 406 ? 46.075  19.957  67.197  1.00 170.92 ? 383 ILE C CG1   1 
ATOM   6005 C  CG2   . ILE B 2 406 ? 48.506  19.300  67.108  1.00 169.81 ? 383 ILE C CG2   1 
ATOM   6006 C  CD1   . ILE B 2 406 ? 46.040  20.394  68.641  1.00 170.63 ? 383 ILE C CD1   1 
ATOM   6007 N  N     . LYS B 2 407 ? 46.271  15.980  65.458  1.00 152.92 ? 384 LYS C N     1 
ATOM   6008 C  CA    . LYS B 2 407 ? 46.511  14.565  65.208  1.00 148.46 ? 384 LYS C CA    1 
ATOM   6009 C  C     . LYS B 2 407 ? 46.752  14.396  63.714  1.00 143.68 ? 384 LYS C C     1 
ATOM   6010 O  O     . LYS B 2 407 ? 47.525  13.537  63.277  1.00 138.57 ? 384 LYS C O     1 
ATOM   6011 C  CB    . LYS B 2 407 ? 45.324  13.711  65.667  1.00 144.72 ? 384 LYS C CB    1 
ATOM   6012 N  N     . ALA B 2 408 ? 46.083  15.236  62.934  1.00 148.84 ? 385 ALA C N     1 
ATOM   6013 C  CA    . ALA B 2 408 ? 46.294  15.263  61.499  1.00 164.09 ? 385 ALA C CA    1 
ATOM   6014 C  C     . ALA B 2 408 ? 47.661  15.889  61.207  1.00 169.77 ? 385 ALA C C     1 
ATOM   6015 O  O     . ALA B 2 408 ? 48.392  15.427  60.325  1.00 158.82 ? 385 ALA C O     1 
ATOM   6016 C  CB    . ALA B 2 408 ? 45.178  16.035  60.817  1.00 173.49 ? 385 ALA C CB    1 
ATOM   6017 N  N     . ARG B 2 409 ? 47.994  16.926  61.976  1.00 184.48 ? 386 ARG C N     1 
ATOM   6018 C  CA    . ARG B 2 409 ? 49.273  17.626  61.863  1.00 188.34 ? 386 ARG C CA    1 
ATOM   6019 C  C     . ARG B 2 409 ? 50.419  16.722  62.261  1.00 174.05 ? 386 ARG C C     1 
ATOM   6020 O  O     . ARG B 2 409 ? 51.523  16.832  61.731  1.00 170.14 ? 386 ARG C O     1 
ATOM   6021 C  CB    . ARG B 2 409 ? 49.294  18.855  62.772  1.00 199.59 ? 386 ARG C CB    1 
ATOM   6022 N  N     . ASP B 2 410 ? 50.141  15.833  63.214  1.00 164.82 ? 387 ASP C N     1 
ATOM   6023 C  CA    . ASP B 2 410 ? 51.147  14.937  63.780  1.00 160.59 ? 387 ASP C CA    1 
ATOM   6024 C  C     . ASP B 2 410 ? 51.686  13.939  62.750  1.00 163.82 ? 387 ASP C C     1 
ATOM   6025 O  O     . ASP B 2 410 ? 52.863  13.982  62.389  1.00 162.95 ? 387 ASP C O     1 
ATOM   6026 C  CB    . ASP B 2 410 ? 50.579  14.202  64.999  1.00 160.34 ? 387 ASP C CB    1 
ATOM   6027 N  N     . ALA B 2 411 ? 50.823  13.047  62.274  1.00 166.96 ? 388 ALA C N     1 
ATOM   6028 C  CA    . ALA B 2 411 ? 51.256  12.018  61.335  1.00 167.22 ? 388 ALA C CA    1 
ATOM   6029 C  C     . ALA B 2 411 ? 51.680  12.603  59.990  1.00 165.29 ? 388 ALA C C     1 
ATOM   6030 O  O     . ALA B 2 411 ? 52.587  12.082  59.346  1.00 163.04 ? 388 ALA C O     1 
ATOM   6031 C  CB    . ALA B 2 411 ? 50.171  10.959  61.151  1.00 166.25 ? 388 ALA C CB    1 
ATOM   6032 N  N     . ARG B 2 412 ? 51.020  13.682  59.572  1.00 173.00 ? 389 ARG C N     1 
ATOM   6033 C  CA    . ARG B 2 412 ? 51.341  14.328  58.304  1.00 185.81 ? 389 ARG C CA    1 
ATOM   6034 C  C     . ARG B 2 412 ? 52.828  14.654  58.226  1.00 198.12 ? 389 ARG C C     1 
ATOM   6035 O  O     . ARG B 2 412 ? 53.524  14.201  57.318  1.00 207.65 ? 389 ARG C O     1 
ATOM   6036 C  CB    . ARG B 2 412 ? 50.509  15.596  58.104  1.00 185.60 ? 389 ARG C CB    1 
ATOM   6037 N  N     . GLU B 2 413 ? 53.319  15.422  59.194  1.00 196.73 ? 390 GLU C N     1 
ATOM   6038 C  CA    . GLU B 2 413 ? 54.738  15.746  59.249  1.00 195.65 ? 390 GLU C CA    1 
ATOM   6039 C  C     . GLU B 2 413 ? 55.561  14.489  59.531  1.00 193.29 ? 390 GLU C C     1 
ATOM   6040 O  O     . GLU B 2 413 ? 56.761  14.451  59.265  1.00 196.20 ? 390 GLU C O     1 
ATOM   6041 C  CB    . GLU B 2 413 ? 55.010  16.824  60.301  1.00 196.03 ? 390 GLU C CB    1 
ATOM   6042 N  N     . ALA B 2 414 ? 54.905  13.461  60.062  1.00 185.63 ? 391 ALA C N     1 
ATOM   6043 C  CA    . ALA B 2 414 ? 55.562  12.186  60.333  1.00 176.45 ? 391 ALA C CA    1 
ATOM   6044 C  C     . ALA B 2 414 ? 55.535  11.276  59.103  1.00 179.18 ? 391 ALA C C     1 
ATOM   6045 O  O     . ALA B 2 414 ? 55.966  10.122  59.164  1.00 184.04 ? 391 ALA C O     1 
ATOM   6046 C  CB    . ALA B 2 414 ? 54.918  11.498  61.524  1.00 175.88 ? 391 ALA C CB    1 
ATOM   6047 N  N     . ALA B 2 415 ? 55.016  11.793  57.992  1.00 184.77 ? 392 ALA C N     1 
ATOM   6048 C  CA    . ALA B 2 415 ? 55.078  11.086  56.717  1.00 205.60 ? 392 ALA C CA    1 
ATOM   6049 C  C     . ALA B 2 415 ? 56.260  11.615  55.919  1.00 211.53 ? 392 ALA C C     1 
ATOM   6050 O  O     . ALA B 2 415 ? 56.951  10.861  55.233  1.00 204.15 ? 392 ALA C O     1 
ATOM   6051 C  CB    . ALA B 2 415 ? 53.788  11.265  55.939  1.00 216.21 ? 392 ALA C CB    1 
ATOM   6052 N  N     . ARG B 2 416 ? 56.484  12.923  56.016  1.00 220.72 ? 393 ARG C N     1 
ATOM   6053 C  CA    . ARG B 2 416 ? 57.650  13.556  55.408  1.00 134.48 ? 393 ARG C CA    1 
ATOM   6054 C  C     . ARG B 2 416 ? 58.894  13.179  56.208  1.00 142.43 ? 393 ARG C C     1 
ATOM   6055 O  O     . ARG B 2 416 ? 60.022  13.295  55.722  1.00 144.60 ? 393 ARG C O     1 
ATOM   6056 C  CB    . ARG B 2 416 ? 57.478  15.075  55.362  1.00 129.67 ? 393 ARG C CB    1 
ATOM   6057 N  N     . LYS B 2 417 ? 58.672  12.728  57.439  1.00 208.93 ? 394 LYS C N     1 
ATOM   6058 C  CA    . LYS B 2 417 ? 59.741  12.195  58.271  1.00 194.78 ? 394 LYS C CA    1 
ATOM   6059 C  C     . LYS B 2 417 ? 59.808  10.678  58.111  1.00 162.57 ? 394 LYS C C     1 
ATOM   6060 O  O     . LYS B 2 417 ? 60.568  10.001  58.811  1.00 160.92 ? 394 LYS C O     1 
ATOM   6061 C  CB    . LYS B 2 417 ? 59.521  12.573  59.738  1.00 200.66 ? 394 LYS C CB    1 
ATOM   6062 N  N     . ALA B 2 418 ? 59.003  10.147  57.190  1.00 149.79 ? 395 ALA C N     1 
ATOM   6063 C  CA    . ALA B 2 418 ? 59.064  8.729   56.841  1.00 144.58 ? 395 ALA C CA    1 
ATOM   6064 C  C     . ALA B 2 418 ? 59.863  8.528   55.546  1.00 144.79 ? 395 ALA C C     1 
ATOM   6065 O  O     . ALA B 2 418 ? 60.015  7.400   55.069  1.00 145.71 ? 395 ALA C O     1 
ATOM   6066 C  CB    . ALA B 2 418 ? 57.662  8.140   56.719  1.00 137.52 ? 395 ALA C CB    1 
ATOM   6067 N  N     . ARG B 2 419 ? 60.373  9.632   54.996  1.00 141.38 ? 396 ARG C N     1 
ATOM   6068 C  CA    . ARG B 2 419 ? 61.190  9.618   53.779  1.00 135.35 ? 396 ARG C CA    1 
ATOM   6069 C  C     . ARG B 2 419 ? 62.667  9.889   54.075  1.00 133.18 ? 396 ARG C C     1 
ATOM   6070 O  O     . ARG B 2 419 ? 63.508  8.989   54.000  1.00 132.19 ? 396 ARG C O     1 
ATOM   6071 C  CB    . ARG B 2 419 ? 60.668  10.655  52.782  1.00 132.11 ? 396 ARG C CB    1 
ATOM   6072 N  N     . LEU B 2 439 ? 50.100  -2.447  68.017  1.00 102.16 ? 416 LEU C N     1 
ATOM   6073 C  CA    . LEU B 2 439 ? 48.693  -2.110  67.757  1.00 116.58 ? 416 LEU C CA    1 
ATOM   6074 C  C     . LEU B 2 439 ? 48.224  -2.243  66.300  1.00 123.37 ? 416 LEU C C     1 
ATOM   6075 O  O     . LEU B 2 439 ? 49.008  -2.103  65.354  1.00 114.90 ? 416 LEU C O     1 
ATOM   6076 C  CB    . LEU B 2 439 ? 48.430  -0.664  68.195  1.00 132.43 ? 416 LEU C CB    1 
ATOM   6077 C  CG    . LEU B 2 439 ? 47.035  -0.109  67.899  1.00 145.64 ? 416 LEU C CG    1 
ATOM   6078 C  CD1   . LEU B 2 439 ? 46.060  -0.464  69.014  1.00 139.93 ? 416 LEU C CD1   1 
ATOM   6079 C  CD2   . LEU B 2 439 ? 47.088  1.386   67.722  1.00 159.18 ? 416 LEU C CD2   1 
ATOM   6080 N  N     . THR B 2 440 ? 46.926  -2.498  66.143  1.00 140.12 ? 417 THR C N     1 
ATOM   6081 C  CA    . THR B 2 440 ? 46.263  -2.446  64.846  1.00 146.83 ? 417 THR C CA    1 
ATOM   6082 C  C     . THR B 2 440 ? 45.192  -1.383  64.950  1.00 170.25 ? 417 THR C C     1 
ATOM   6083 O  O     . THR B 2 440 ? 44.207  -1.571  65.658  1.00 185.25 ? 417 THR C O     1 
ATOM   6084 C  CB    . THR B 2 440 ? 45.575  -3.785  64.477  1.00 123.92 ? 417 THR C CB    1 
ATOM   6085 O  OG1   . THR B 2 440 ? 46.562  -4.799  64.245  1.00 114.34 ? 417 THR C OG1   1 
ATOM   6086 C  CG2   . THR B 2 440 ? 44.727  -3.621  63.218  1.00 111.75 ? 417 THR C CG2   1 
ATOM   6087 N  N     . PRO B 2 441 ? 45.371  -0.267  64.230  1.00 169.38 ? 418 PRO C N     1 
ATOM   6088 C  CA    . PRO B 2 441 ? 44.537  0.931   64.399  1.00 169.28 ? 418 PRO C CA    1 
ATOM   6089 C  C     . PRO B 2 441 ? 43.228  0.909   63.607  1.00 157.68 ? 418 PRO C C     1 
ATOM   6090 O  O     . PRO B 2 441 ? 43.128  0.213   62.601  1.00 148.05 ? 418 PRO C O     1 
ATOM   6091 C  CB    . PRO B 2 441 ? 45.440  2.056   63.878  1.00 169.99 ? 418 PRO C CB    1 
ATOM   6092 C  CG    . PRO B 2 441 ? 46.620  1.362   63.176  1.00 164.54 ? 418 PRO C CG    1 
ATOM   6093 C  CD    . PRO B 2 441 ? 46.329  -0.105  63.128  1.00 163.64 ? 418 PRO C CD    1 
ATOM   6094 N  N     . ALA B 2 442 ? 42.236  1.662   64.070  1.00 149.99 ? 419 ALA C N     1 
ATOM   6095 C  CA    . ALA B 2 442 ? 41.023  1.882   63.293  1.00 130.94 ? 419 ALA C CA    1 
ATOM   6096 C  C     . ALA B 2 442 ? 41.372  2.733   62.070  1.00 114.79 ? 419 ALA C C     1 
ATOM   6097 O  O     . ALA B 2 442 ? 42.222  3.623   62.153  1.00 110.51 ? 419 ALA C O     1 
ATOM   6098 C  CB    . ALA B 2 442 ? 39.968  2.570   64.143  1.00 127.25 ? 419 ALA C CB    1 
ATOM   6099 N  N     . GLN B 2 443 ? 40.726  2.459   60.937  1.00 112.83 ? 420 GLN C N     1 
ATOM   6100 C  CA    . GLN B 2 443 ? 41.040  3.164   59.694  1.00 118.59 ? 420 GLN C CA    1 
ATOM   6101 C  C     . GLN B 2 443 ? 40.896  4.683   59.832  1.00 131.27 ? 420 GLN C C     1 
ATOM   6102 O  O     . GLN B 2 443 ? 41.845  5.427   59.575  1.00 135.04 ? 420 GLN C O     1 
ATOM   6103 C  CB    . GLN B 2 443 ? 40.164  2.654   58.548  1.00 118.24 ? 420 GLN C CB    1 
ATOM   6104 C  CG    . GLN B 2 443 ? 40.611  3.121   57.173  1.00 115.85 ? 420 GLN C CG    1 
ATOM   6105 C  CD    . GLN B 2 443 ? 40.815  1.972   56.200  1.00 116.18 ? 420 GLN C CD    1 
ATOM   6106 O  OE1   . GLN B 2 443 ? 39.944  1.111   56.033  1.00 116.71 ? 420 GLN C OE1   1 
ATOM   6107 N  NE2   . GLN B 2 443 ? 41.977  1.953   55.550  1.00 120.00 ? 420 GLN C NE2   1 
ATOM   6108 N  N     . SER B 2 444 ? 39.712  5.137   60.238  1.00 141.90 ? 421 SER C N     1 
ATOM   6109 C  CA    . SER B 2 444 ? 39.444  6.566   60.420  1.00 154.54 ? 421 SER C CA    1 
ATOM   6110 C  C     . SER B 2 444 ? 39.404  6.958   61.907  1.00 128.15 ? 421 SER C C     1 
ATOM   6111 O  O     . SER B 2 444 ? 38.937  6.186   62.750  1.00 120.39 ? 421 SER C O     1 
ATOM   6112 C  CB    . SER B 2 444 ? 38.141  6.966   59.714  1.00 188.22 ? 421 SER C CB    1 
ATOM   6113 N  N     . LYS B 2 445 ? 39.900  8.158   62.217  1.00 121.43 ? 422 LYS C N     1 
ATOM   6114 C  CA    . LYS B 2 445 ? 39.984  8.640   63.599  1.00 121.27 ? 422 LYS C CA    1 
ATOM   6115 C  C     . LYS B 2 445 ? 38.669  9.286   64.040  1.00 116.95 ? 422 LYS C C     1 
ATOM   6116 O  O     . LYS B 2 445 ? 38.296  10.347  63.552  1.00 118.70 ? 422 LYS C O     1 
ATOM   6117 C  CB    . LYS B 2 445 ? 41.159  9.621   63.769  1.00 136.26 ? 422 LYS C CB    1 
ATOM   6118 N  N     . ASN B 2 446 ? 37.965  8.636   64.958  1.00 126.91 ? 423 ASN C N     1 
ATOM   6119 C  CA    . ASN B 2 446 ? 36.694  9.157   65.455  1.00 138.04 ? 423 ASN C CA    1 
ATOM   6120 C  C     . ASN B 2 446 ? 36.485  8.851   66.939  1.00 147.09 ? 423 ASN C C     1 
ATOM   6121 O  O     . ASN B 2 446 ? 35.832  7.869   67.295  1.00 157.15 ? 423 ASN C O     1 
ATOM   6122 C  CB    . ASN B 2 446 ? 35.526  8.620   64.619  1.00 145.95 ? 423 ASN C CB    1 
ATOM   6123 C  CG    . ASN B 2 446 ? 34.184  9.178   65.060  1.00 161.13 ? 423 ASN C CG    1 
ATOM   6124 O  OD1   . ASN B 2 446 ? 33.836  9.136   66.236  1.00 176.65 ? 423 ASN C OD1   1 
ATOM   6125 N  ND2   . ASN B 2 446 ? 33.425  9.709   64.116  1.00 157.22 ? 423 ASN C ND2   1 
ATOM   6126 N  N     . PRO B 2 447 ? 37.053  9.693   67.812  1.00 153.68 ? 424 PRO C N     1 
ATOM   6127 C  CA    . PRO B 2 447 ? 36.907  9.544   69.267  1.00 172.19 ? 424 PRO C CA    1 
ATOM   6128 C  C     . PRO B 2 447 ? 35.451  9.472   69.757  1.00 193.80 ? 424 PRO C C     1 
ATOM   6129 O  O     . PRO B 2 447 ? 35.231  9.271   70.952  1.00 190.74 ? 424 PRO C O     1 
ATOM   6130 C  CB    . PRO B 2 447 ? 37.591  10.802  69.809  1.00 169.70 ? 424 PRO C CB    1 
ATOM   6131 C  CG    . PRO B 2 447 ? 38.629  11.121  68.787  1.00 159.02 ? 424 PRO C CG    1 
ATOM   6132 C  CD    . PRO B 2 447 ? 38.013  10.754  67.455  1.00 150.22 ? 424 PRO C CD    1 
ATOM   6133 N  N     . ALA B 2 448 ? 34.481  9.618   68.861  1.00 213.21 ? 425 ALA C N     1 
ATOM   6134 C  CA    . ALA B 2 448 ? 33.071  9.569   69.247  1.00 219.06 ? 425 ALA C CA    1 
ATOM   6135 C  C     . ALA B 2 448 ? 32.458  8.171   69.110  1.00 184.03 ? 425 ALA C C     1 
ATOM   6136 O  O     . ALA B 2 448 ? 31.511  7.837   69.821  1.00 159.52 ? 425 ALA C O     1 
ATOM   6137 C  CB    . ALA B 2 448 ? 32.254  10.597  68.469  1.00 244.53 ? 425 ALA C CB    1 
ATOM   6138 N  N     . LYS B 2 449 ? 32.989  7.356   68.204  1.00 176.93 ? 426 LYS C N     1 
ATOM   6139 C  CA    . LYS B 2 449 ? 32.488  5.988   68.053  1.00 167.23 ? 426 LYS C CA    1 
ATOM   6140 C  C     . LYS B 2 449 ? 33.601  4.933   68.042  1.00 173.73 ? 426 LYS C C     1 
ATOM   6141 O  O     . LYS B 2 449 ? 33.319  3.738   67.982  1.00 174.02 ? 426 LYS C O     1 
ATOM   6142 C  CB    . LYS B 2 449 ? 31.585  5.845   66.815  1.00 150.40 ? 426 LYS C CB    1 
ATOM   6143 C  CG    . LYS B 2 449 ? 32.257  5.222   65.584  1.00 142.12 ? 426 LYS C CG    1 
ATOM   6144 C  CD    . LYS B 2 449 ? 31.247  4.515   64.677  1.00 143.74 ? 426 LYS C CD    1 
ATOM   6145 N  N     . ASN B 2 450 ? 34.857  5.367   68.121  1.00 175.86 ? 427 ASN C N     1 
ATOM   6146 C  CA    . ASN B 2 450 ? 35.983  4.430   68.079  1.00 167.05 ? 427 ASN C CA    1 
ATOM   6147 C  C     . ASN B 2 450 ? 36.082  3.494   69.292  1.00 159.02 ? 427 ASN C C     1 
ATOM   6148 O  O     . ASN B 2 450 ? 35.754  3.866   70.420  1.00 150.69 ? 427 ASN C O     1 
ATOM   6149 C  CB    . ASN B 2 450 ? 37.311  5.164   67.850  1.00 157.99 ? 427 ASN C CB    1 
ATOM   6150 C  CG    . ASN B 2 450 ? 37.692  5.248   66.373  1.00 145.24 ? 427 ASN C CG    1 
ATOM   6151 O  OD1   . ASN B 2 450 ? 36.833  5.168   65.492  1.00 134.11 ? 427 ASN C OD1   1 
ATOM   6152 N  ND2   . ASN B 2 450 ? 38.987  5.411   66.100  1.00 145.06 ? 427 ASN C ND2   1 
ATOM   6153 N  N     . GLU B 2 451 ? 36.546  2.275   69.040  1.00 156.80 ? 428 GLU C N     1 
ATOM   6154 C  CA    . GLU B 2 451 ? 36.611  1.249   70.064  1.00 151.68 ? 428 GLU C CA    1 
ATOM   6155 C  C     . GLU B 2 451 ? 38.011  0.647   70.141  1.00 130.74 ? 428 GLU C C     1 
ATOM   6156 O  O     . GLU B 2 451 ? 38.603  0.311   69.121  1.00 124.86 ? 428 GLU C O     1 
ATOM   6157 C  CB    . GLU B 2 451 ? 35.583  0.158   69.770  1.00 168.51 ? 428 GLU C CB    1 
ATOM   6158 C  CG    . GLU B 2 451 ? 34.149  0.657   69.717  1.00 185.75 ? 428 GLU C CG    1 
ATOM   6159 C  CD    . GLU B 2 451 ? 33.134  -0.473  69.652  1.00 200.57 ? 428 GLU C CD    1 
ATOM   6160 O  OE1   . GLU B 2 451 ? 33.446  -1.542  69.082  1.00 204.98 ? 428 GLU C OE1   1 
ATOM   6161 O  OE2   . GLU B 2 451 ? 32.018  -0.294  70.180  1.00 206.79 ? 428 GLU C OE2   1 
ATOM   6162 N  N     . LEU B 2 452 ? 38.539  0.526   71.358  1.00 123.46 ? 429 LEU C N     1 
ATOM   6163 C  CA    . LEU B 2 452 ? 39.844  -0.100  71.570  1.00 127.51 ? 429 LEU C CA    1 
ATOM   6164 C  C     . LEU B 2 452 ? 39.664  -1.473  72.223  1.00 129.70 ? 429 LEU C C     1 
ATOM   6165 O  O     . LEU B 2 452 ? 39.049  -1.596  73.282  1.00 132.79 ? 429 LEU C O     1 
ATOM   6166 C  CB    . LEU B 2 452 ? 40.736  0.790   72.437  1.00 138.09 ? 429 LEU C CB    1 
ATOM   6167 C  CG    . LEU B 2 452 ? 42.246  0.692   72.197  1.00 150.75 ? 429 LEU C CG    1 
ATOM   6168 C  CD1   . LEU B 2 452 ? 42.979  0.368   73.482  1.00 157.16 ? 429 LEU C CD1   1 
ATOM   6169 C  CD2   . LEU B 2 452 ? 42.574  -0.327  71.106  1.00 152.94 ? 429 LEU C CD2   1 
ATOM   6170 N  N     . TYR B 2 453 ? 40.175  -2.507  71.569  1.00 128.39 ? 430 TYR C N     1 
ATOM   6171 C  CA    . TYR B 2 453 ? 40.028  -3.866  72.087  1.00 125.07 ? 430 TYR C CA    1 
ATOM   6172 C  C     . TYR B 2 453 ? 41.345  -4.337  72.675  1.00 106.05 ? 430 TYR C C     1 
ATOM   6173 O  O     . TYR B 2 453 ? 42.331  -4.496  71.956  1.00 94.32  ? 430 TYR C O     1 
ATOM   6174 C  CB    . TYR B 2 453 ? 39.542  -4.843  70.997  1.00 141.74 ? 430 TYR C CB    1 
ATOM   6175 C  CG    . TYR B 2 453 ? 38.034  -4.853  70.786  1.00 156.82 ? 430 TYR C CG    1 
ATOM   6176 C  CD1   . TYR B 2 453 ? 37.244  -5.884  71.287  1.00 184.73 ? 430 TYR C CD1   1 
ATOM   6177 C  CD2   . TYR B 2 453 ? 37.403  -3.825  70.094  1.00 142.17 ? 430 TYR C CD2   1 
ATOM   6178 C  CE1   . TYR B 2 453 ? 35.876  -5.889  71.108  1.00 196.35 ? 430 TYR C CE1   1 
ATOM   6179 C  CE2   . TYR B 2 453 ? 36.032  -3.820  69.913  1.00 153.66 ? 430 TYR C CE2   1 
ATOM   6180 C  CZ    . TYR B 2 453 ? 35.273  -4.853  70.419  1.00 187.19 ? 430 TYR C CZ    1 
ATOM   6181 O  OH    . TYR B 2 453 ? 33.910  -4.842  70.232  1.00 206.78 ? 430 TYR C OH    1 
ATOM   6182 N  N     . LEU B 2 454 ? 41.371  -4.536  73.989  1.00 109.42 ? 431 LEU C N     1 
ATOM   6183 C  CA    . LEU B 2 454 ? 42.523  -5.165  74.614  1.00 129.09 ? 431 LEU C CA    1 
ATOM   6184 C  C     . LEU B 2 454 ? 42.247  -6.661  74.726  1.00 110.26 ? 431 LEU C C     1 
ATOM   6185 O  O     . LEU B 2 454 ? 41.386  -7.097  75.496  1.00 116.65 ? 431 LEU C O     1 
ATOM   6186 C  CB    . LEU B 2 454 ? 42.799  -4.544  75.969  1.00 178.79 ? 431 LEU C CB    1 
ATOM   6187 C  CG    . LEU B 2 454 ? 42.479  -3.059  75.984  1.00 212.59 ? 431 LEU C CG    1 
ATOM   6188 C  CD1   . LEU B 2 454 ? 41.277  -2.810  76.887  1.00 227.31 ? 431 LEU C CD1   1 
ATOM   6189 C  CD2   . LEU B 2 454 ? 43.684  -2.270  76.443  1.00 217.92 ? 431 LEU C CD2   1 
ATOM   6190 N  N     . VAL B 2 455 ? 42.971  -7.435  73.926  1.00 107.89 ? 432 VAL C N     1 
ATOM   6191 C  CA    . VAL B 2 455 ? 42.715  -8.855  73.794  1.00 125.70 ? 432 VAL C CA    1 
ATOM   6192 C  C     . VAL B 2 455 ? 43.811  -9.646  74.490  1.00 127.89 ? 432 VAL C C     1 
ATOM   6193 O  O     . VAL B 2 455 ? 44.990  -9.375  74.294  1.00 106.42 ? 432 VAL C O     1 
ATOM   6194 C  CB    . VAL B 2 455 ? 42.659  -9.263  72.310  1.00 144.64 ? 432 VAL C CB    1 
ATOM   6195 C  CG1   . VAL B 2 455 ? 42.277  -10.726 72.173  1.00 144.35 ? 432 VAL C CG1   1 
ATOM   6196 C  CG2   . VAL B 2 455 ? 41.692  -8.366  71.543  1.00 161.69 ? 432 VAL C CG2   1 
ATOM   6197 N  N     . GLU B 2 456 ? 43.413  -10.611 75.313  1.00 160.80 ? 433 GLU C N     1 
ATOM   6198 C  CA    . GLU B 2 456 ? 44.355  -11.542 75.924  1.00 177.04 ? 433 GLU C CA    1 
ATOM   6199 C  C     . GLU B 2 456 ? 45.005  -12.420 74.858  1.00 151.17 ? 433 GLU C C     1 
ATOM   6200 O  O     . GLU B 2 456 ? 44.393  -13.373 74.378  1.00 133.42 ? 433 GLU C O     1 
ATOM   6201 C  CB    . GLU B 2 456 ? 43.639  -12.431 76.952  1.00 204.09 ? 433 GLU C CB    1 
ATOM   6202 C  CG    . GLU B 2 456 ? 44.399  -13.715 77.328  1.00 209.05 ? 433 GLU C CG    1 
ATOM   6203 C  CD    . GLU B 2 456 ? 43.538  -14.707 78.102  1.00 208.97 ? 433 GLU C CD    1 
ATOM   6204 O  OE1   . GLU B 2 456 ? 44.085  -15.630 78.754  1.00 191.67 ? 433 GLU C OE1   1 
ATOM   6205 O  OE2   . GLU B 2 456 ? 42.300  -14.562 78.052  1.00 225.41 ? 433 GLU C OE2   1 
ATOM   6206 N  N     . GLY B 2 457 ? 46.237  -12.093 74.483  1.00 140.28 ? 434 GLY C N     1 
ATOM   6207 C  CA    . GLY B 2 457 ? 47.026  -12.952 73.611  1.00 126.31 ? 434 GLY C CA    1 
ATOM   6208 C  C     . GLY B 2 457 ? 47.093  -12.545 72.149  1.00 118.80 ? 434 GLY C C     1 
ATOM   6209 O  O     . GLY B 2 457 ? 46.100  -12.112 71.571  1.00 107.66 ? 434 GLY C O     1 
ATOM   6210 N  N     . ASP B 2 458 ? 48.276  -12.692 71.555  1.00 136.51 ? 435 ASP C N     1 
ATOM   6211 C  CA    . ASP B 2 458 ? 48.491  -12.382 70.144  1.00 168.00 ? 435 ASP C CA    1 
ATOM   6212 C  C     . ASP B 2 458 ? 47.623  -13.267 69.266  1.00 152.31 ? 435 ASP C C     1 
ATOM   6213 O  O     . ASP B 2 458 ? 47.159  -12.840 68.214  1.00 166.23 ? 435 ASP C O     1 
ATOM   6214 C  CB    . ASP B 2 458 ? 49.965  -12.555 69.754  1.00 212.22 ? 435 ASP C CB    1 
ATOM   6215 C  CG    . ASP B 2 458 ? 50.826  -11.364 70.156  1.00 243.69 ? 435 ASP C CG    1 
ATOM   6216 O  OD1   . ASP B 2 458 ? 50.579  -10.246 69.644  1.00 285.29 ? 435 ASP C OD1   1 
ATOM   6217 O  OD2   . ASP B 2 458 ? 51.760  -11.548 70.973  1.00 220.44 ? 435 ASP C OD2   1 
ATOM   6218 N  N     . SER B 2 459 ? 47.415  -14.504 69.708  1.00 119.51 ? 436 SER C N     1 
ATOM   6219 C  CA    . SER B 2 459 ? 46.583  -15.460 68.982  1.00 102.99 ? 436 SER C CA    1 
ATOM   6220 C  C     . SER B 2 459 ? 45.144  -14.985 68.847  1.00 96.48  ? 436 SER C C     1 
ATOM   6221 O  O     . SER B 2 459 ? 44.644  -14.812 67.737  1.00 108.53 ? 436 SER C O     1 
ATOM   6222 C  CB    . SER B 2 459 ? 46.624  -16.831 69.654  1.00 111.30 ? 436 SER C CB    1 
ATOM   6223 O  OG    . SER B 2 459 ? 47.907  -17.410 69.479  1.00 122.32 ? 436 SER C OG    1 
ATOM   6224 N  N     . ALA B 2 460 ? 44.473  -14.793 69.978  1.00 97.53  ? 437 ALA C N     1 
ATOM   6225 C  CA    . ALA B 2 460 ? 43.133  -14.226 69.958  1.00 96.11  ? 437 ALA C CA    1 
ATOM   6226 C  C     . ALA B 2 460 ? 43.158  -12.851 69.279  1.00 119.57 ? 437 ALA C C     1 
ATOM   6227 O  O     . ALA B 2 460 ? 42.208  -12.469 68.598  1.00 131.15 ? 437 ALA C O     1 
ATOM   6228 C  CB    . ALA B 2 460 ? 42.574  -14.132 71.353  1.00 97.50  ? 437 ALA C CB    1 
ATOM   6229 N  N     . GLY B 2 461 ? 44.260  -12.124 69.454  1.00 125.62 ? 438 GLY C N     1 
ATOM   6230 C  CA    . GLY B 2 461 ? 44.450  -10.837 68.806  1.00 137.42 ? 438 GLY C CA    1 
ATOM   6231 C  C     . GLY B 2 461 ? 44.327  -10.934 67.297  1.00 150.65 ? 438 GLY C C     1 
ATOM   6232 O  O     . GLY B 2 461 ? 43.825  -10.016 66.649  1.00 156.55 ? 438 GLY C O     1 
ATOM   6233 N  N     . GLY B 2 462 ? 44.796  -12.052 66.743  1.00 149.78 ? 439 GLY C N     1 
ATOM   6234 C  CA    . GLY B 2 462 ? 44.695  -12.320 65.324  1.00 133.28 ? 439 GLY C CA    1 
ATOM   6235 C  C     . GLY B 2 462 ? 43.250  -12.436 64.881  1.00 106.82 ? 439 GLY C C     1 
ATOM   6236 O  O     . GLY B 2 462 ? 42.823  -11.737 63.965  1.00 97.25  ? 439 GLY C O     1 
ATOM   6237 N  N     . SER B 2 463 ? 42.491  -13.311 65.532  1.00 95.87  ? 440 SER C N     1 
ATOM   6238 C  CA    . SER B 2 463 ? 41.089  -13.496 65.187  1.00 96.18  ? 440 SER C CA    1 
ATOM   6239 C  C     . SER B 2 463 ? 40.326  -12.185 65.335  1.00 96.63  ? 440 SER C C     1 
ATOM   6240 O  O     . SER B 2 463 ? 39.405  -11.911 64.566  1.00 103.25 ? 440 SER C O     1 
ATOM   6241 C  CB    . SER B 2 463 ? 40.457  -14.596 66.044  1.00 101.84 ? 440 SER C CB    1 
ATOM   6242 O  OG    . SER B 2 463 ? 41.137  -15.828 65.862  1.00 105.03 ? 440 SER C OG    1 
ATOM   6243 N  N     . ALA B 2 464 ? 40.730  -11.368 66.310  1.00 117.20 ? 441 ALA C N     1 
ATOM   6244 C  CA    . ALA B 2 464 ? 40.108  -10.065 66.555  1.00 155.66 ? 441 ALA C CA    1 
ATOM   6245 C  C     . ALA B 2 464 ? 40.331  -9.099  65.398  1.00 178.23 ? 441 ALA C C     1 
ATOM   6246 O  O     . ALA B 2 464 ? 39.403  -8.423  64.961  1.00 187.52 ? 441 ALA C O     1 
ATOM   6247 C  CB    . ALA B 2 464 ? 40.620  -9.458  67.852  1.00 167.28 ? 441 ALA C CB    1 
ATOM   6248 N  N     . LYS B 2 465 ? 41.570  -9.026  64.923  1.00 183.05 ? 442 LYS C N     1 
ATOM   6249 C  CA    . LYS B 2 465 ? 41.919  -8.236  63.742  1.00 177.02 ? 442 LYS C CA    1 
ATOM   6250 C  C     . LYS B 2 465 ? 41.133  -8.697  62.500  1.00 185.43 ? 442 LYS C C     1 
ATOM   6251 O  O     . LYS B 2 465 ? 40.560  -7.884  61.772  1.00 205.88 ? 442 LYS C O     1 
ATOM   6252 C  CB    . LYS B 2 465 ? 43.435  -8.311  63.516  1.00 152.03 ? 442 LYS C CB    1 
ATOM   6253 C  CG    . LYS B 2 465 ? 43.953  -7.855  62.158  1.00 121.38 ? 442 LYS C CG    1 
ATOM   6254 C  CD    . LYS B 2 465 ? 45.487  -7.808  62.182  1.00 97.20  ? 442 LYS C CD    1 
ATOM   6255 C  CE    . LYS B 2 465 ? 46.098  -8.010  60.799  1.00 96.30  ? 442 LYS C CE    1 
ATOM   6256 N  NZ    . LYS B 2 465 ? 45.488  -7.100  59.801  1.00 96.23  ? 442 LYS C NZ    1 
ATOM   6257 N  N     . GLN B 2 466 ? 41.076  -10.009 62.291  1.00 164.02 ? 443 GLN C N     1 
ATOM   6258 C  CA    . GLN B 2 466 ? 40.365  -10.592 61.152  1.00 145.28 ? 443 GLN C CA    1 
ATOM   6259 C  C     . GLN B 2 466 ? 38.838  -10.435 61.212  1.00 136.91 ? 443 GLN C C     1 
ATOM   6260 O  O     . GLN B 2 466 ? 38.192  -10.172 60.194  1.00 126.84 ? 443 GLN C O     1 
ATOM   6261 C  CB    . GLN B 2 466 ? 40.742  -12.069 61.010  1.00 143.58 ? 443 GLN C CB    1 
ATOM   6262 C  CG    . GLN B 2 466 ? 42.243  -12.275 60.896  1.00 139.89 ? 443 GLN C CG    1 
ATOM   6263 C  CD    . GLN B 2 466 ? 42.647  -13.728 60.967  1.00 134.25 ? 443 GLN C CD    1 
ATOM   6264 O  OE1   . GLN B 2 466 ? 41.797  -14.619 60.964  1.00 126.12 ? 443 GLN C OE1   1 
ATOM   6265 N  NE2   . GLN B 2 466 ? 43.957  -13.980 61.036  1.00 136.37 ? 443 GLN C NE2   1 
ATOM   6266 N  N     . GLY B 2 467 ? 38.260  -10.589 62.398  1.00 148.31 ? 444 GLY C N     1 
ATOM   6267 C  CA    . GLY B 2 467 ? 36.816  -10.546 62.526  1.00 131.67 ? 444 GLY C CA    1 
ATOM   6268 C  C     . GLY B 2 467 ? 36.205  -9.174  62.727  1.00 151.09 ? 444 GLY C C     1 
ATOM   6269 O  O     . GLY B 2 467 ? 34.986  -9.028  62.673  1.00 145.96 ? 444 GLY C O     1 
ATOM   6270 N  N     . ARG B 2 468 ? 37.040  -8.164  62.946  1.00 194.19 ? 445 ARG C N     1 
ATOM   6271 C  CA    . ARG B 2 468 ? 36.571  -6.839  63.356  1.00 204.26 ? 445 ARG C CA    1 
ATOM   6272 C  C     . ARG B 2 468 ? 35.875  -6.075  62.223  1.00 186.85 ? 445 ARG C C     1 
ATOM   6273 O  O     . ARG B 2 468 ? 35.853  -6.521  61.068  1.00 181.77 ? 445 ARG C O     1 
ATOM   6274 C  CB    . ARG B 2 468 ? 37.758  -6.001  63.855  1.00 221.42 ? 445 ARG C CB    1 
ATOM   6275 C  CG    . ARG B 2 468 ? 38.465  -5.215  62.723  1.00 230.16 ? 445 ARG C CG    1 
ATOM   6276 C  CD    . ARG B 2 468 ? 39.981  -5.352  62.736  1.00 217.60 ? 445 ARG C CD    1 
ATOM   6277 N  NE    . ARG B 2 468 ? 40.648  -4.051  62.789  1.00 182.53 ? 445 ARG C NE    1 
ATOM   6278 C  CZ    . ARG B 2 468 ? 41.506  -3.603  61.878  1.00 129.92 ? 445 ARG C CZ    1 
ATOM   6279 N  NH1   . ARG B 2 468 ? 41.824  -4.340  60.817  1.00 110.35 ? 445 ARG C NH1   1 
ATOM   6280 N  NH2   . ARG B 2 468 ? 42.058  -2.410  62.033  1.00 105.41 ? 445 ARG C NH2   1 
ATOM   6281 N  N     . ASP B 2 469 ? 35.307  -4.923  62.571  1.00 171.75 ? 446 ASP C N     1 
ATOM   6282 C  CA    . ASP B 2 469 ? 34.957  -3.901  61.593  1.00 156.24 ? 446 ASP C CA    1 
ATOM   6283 C  C     . ASP B 2 469 ? 36.061  -2.852  61.620  1.00 157.33 ? 446 ASP C C     1 
ATOM   6284 O  O     . ASP B 2 469 ? 36.089  -1.994  62.502  1.00 170.32 ? 446 ASP C O     1 
ATOM   6285 C  CB    . ASP B 2 469 ? 33.608  -3.257  61.925  1.00 142.60 ? 446 ASP C CB    1 
ATOM   6286 C  CG    . ASP B 2 469 ? 33.285  -2.061  61.022  1.00 139.06 ? 446 ASP C CG    1 
ATOM   6287 O  OD1   . ASP B 2 469 ? 32.690  -1.092  61.535  1.00 139.63 ? 446 ASP C OD1   1 
ATOM   6288 O  OD2   . ASP B 2 469 ? 33.616  -2.088  59.809  1.00 138.82 ? 446 ASP C OD2   1 
ATOM   6289 N  N     . ARG B 2 470 ? 36.970  -2.921  60.651  1.00 139.32 ? 447 ARG C N     1 
ATOM   6290 C  CA    . ARG B 2 470 ? 38.180  -2.094  60.678  1.00 117.05 ? 447 ARG C CA    1 
ATOM   6291 C  C     . ARG B 2 470 ? 37.958  -0.563  60.613  1.00 104.45 ? 447 ARG C C     1 
ATOM   6292 O  O     . ARG B 2 470 ? 38.880  0.217   60.868  1.00 102.48 ? 447 ARG C O     1 
ATOM   6293 C  CB    . ARG B 2 470 ? 39.145  -2.545  59.574  1.00 107.09 ? 447 ARG C CB    1 
ATOM   6294 C  CG    . ARG B 2 470 ? 38.746  -2.124  58.164  1.00 96.26  ? 447 ARG C CG    1 
ATOM   6295 C  CD    . ARG B 2 470 ? 39.371  -3.041  57.144  1.00 83.52  ? 447 ARG C CD    1 
ATOM   6296 N  NE    . ARG B 2 470 ? 40.817  -2.862  57.049  1.00 82.76  ? 447 ARG C NE    1 
ATOM   6297 C  CZ    . ARG B 2 470 ? 41.658  -3.803  56.617  1.00 88.02  ? 447 ARG C CZ    1 
ATOM   6298 N  NH1   . ARG B 2 470 ? 41.195  -5.001  56.257  1.00 81.31  ? 447 ARG C NH1   1 
ATOM   6299 N  NH2   . ARG B 2 470 ? 42.963  -3.551  56.553  1.00 102.51 ? 447 ARG C NH2   1 
ATOM   6300 N  N     . LYS B 2 471 ? 36.752  -0.124  60.271  1.00 98.65  ? 448 LYS C N     1 
ATOM   6301 C  CA    . LYS B 2 471 ? 36.522  1.309   60.133  1.00 104.14 ? 448 LYS C CA    1 
ATOM   6302 C  C     . LYS B 2 471 ? 36.692  2.019   61.476  1.00 105.97 ? 448 LYS C C     1 
ATOM   6303 O  O     . LYS B 2 471 ? 37.343  3.059   61.555  1.00 107.38 ? 448 LYS C O     1 
ATOM   6304 C  CB    . LYS B 2 471 ? 35.146  1.598   59.523  1.00 105.85 ? 448 LYS C CB    1 
ATOM   6305 N  N     . PHE B 2 472 ? 36.132  1.437   62.533  1.00 103.36 ? 449 PHE C N     1 
ATOM   6306 C  CA    . PHE B 2 472 ? 36.138  2.086   63.845  1.00 108.44 ? 449 PHE C CA    1 
ATOM   6307 C  C     . PHE B 2 472 ? 36.614  1.214   65.022  1.00 113.64 ? 449 PHE C C     1 
ATOM   6308 O  O     . PHE B 2 472 ? 36.420  1.584   66.180  1.00 128.54 ? 449 PHE C O     1 
ATOM   6309 C  CB    . PHE B 2 472 ? 34.746  2.651   64.152  1.00 121.87 ? 449 PHE C CB    1 
ATOM   6310 C  CG    . PHE B 2 472 ? 33.717  1.601   64.487  1.00 141.01 ? 449 PHE C CG    1 
ATOM   6311 C  CD1   . PHE B 2 472 ? 33.037  0.927   63.486  1.00 146.74 ? 449 PHE C CD1   1 
ATOM   6312 C  CD2   . PHE B 2 472 ? 33.417  1.303   65.809  1.00 152.07 ? 449 PHE C CD2   1 
ATOM   6313 C  CE1   . PHE B 2 472 ? 32.082  -0.032  63.802  1.00 150.87 ? 449 PHE C CE1   1 
ATOM   6314 C  CE2   . PHE B 2 472 ? 32.463  0.342   66.132  1.00 155.54 ? 449 PHE C CE2   1 
ATOM   6315 C  CZ    . PHE B 2 472 ? 31.796  -0.323  65.131  1.00 153.86 ? 449 PHE C CZ    1 
ATOM   6316 N  N     . GLN B 2 473 ? 37.229  0.067   64.733  1.00 105.74 ? 450 GLN C N     1 
ATOM   6317 C  CA    . GLN B 2 473 ? 37.689  -0.845  65.782  1.00 105.00 ? 450 GLN C CA    1 
ATOM   6318 C  C     . GLN B 2 473 ? 39.183  -1.110  65.680  1.00 95.33  ? 450 GLN C C     1 
ATOM   6319 O  O     . GLN B 2 473 ? 39.677  -1.588  64.648  1.00 89.41  ? 450 GLN C O     1 
ATOM   6320 C  CB    . GLN B 2 473 ? 36.930  -2.172  65.733  1.00 117.68 ? 450 GLN C CB    1 
ATOM   6321 C  CG    . GLN B 2 473 ? 35.516  -2.132  66.296  1.00 125.87 ? 450 GLN C CG    1 
ATOM   6322 C  CD    . GLN B 2 473 ? 34.781  -3.450  66.099  1.00 127.63 ? 450 GLN C CD    1 
ATOM   6323 O  OE1   . GLN B 2 473 ? 35.253  -4.326  65.379  1.00 117.48 ? 450 GLN C OE1   1 
ATOM   6324 N  NE2   . GLN B 2 473 ? 33.625  -3.594  66.734  1.00 139.45 ? 450 GLN C NE2   1 
ATOM   6325 N  N     . ALA B 2 474 ? 39.896  -0.797  66.760  1.00 102.51 ? 451 ALA C N     1 
ATOM   6326 C  CA    . ALA B 2 474 ? 41.328  -1.067  66.849  1.00 112.40 ? 451 ALA C CA    1 
ATOM   6327 C  C     . ALA B 2 474 ? 41.613  -2.281  67.740  1.00 108.91 ? 451 ALA C C     1 
ATOM   6328 O  O     . ALA B 2 474 ? 40.812  -2.639  68.604  1.00 95.25  ? 451 ALA C O     1 
ATOM   6329 C  CB    . ALA B 2 474 ? 42.067  0.156   67.360  1.00 123.30 ? 451 ALA C CB    1 
ATOM   6330 N  N     . ILE B 2 475 ? 42.762  -2.907  67.528  1.00 120.21 ? 452 ILE C N     1 
ATOM   6331 C  CA    . ILE B 2 475 ? 43.104  -4.119  68.252  1.00 122.26 ? 452 ILE C CA    1 
ATOM   6332 C  C     . ILE B 2 475 ? 44.460  -3.995  68.927  1.00 88.26  ? 452 ILE C C     1 
ATOM   6333 O  O     . ILE B 2 475 ? 45.458  -3.665  68.288  1.00 78.34  ? 452 ILE C O     1 
ATOM   6334 C  CB    . ILE B 2 475 ? 43.111  -5.346  67.310  1.00 149.61 ? 452 ILE C CB    1 
ATOM   6335 C  CG1   . ILE B 2 475 ? 41.778  -5.450  66.572  1.00 162.29 ? 452 ILE C CG1   1 
ATOM   6336 C  CG2   . ILE B 2 475 ? 43.373  -6.644  68.106  1.00 157.97 ? 452 ILE C CG2   1 
ATOM   6337 C  CD1   . ILE B 2 475 ? 40.694  -6.118  67.407  1.00 170.09 ? 452 ILE C CD1   1 
ATOM   6338 N  N     . LEU B 2 476 ? 44.485  -4.265  70.226  1.00 72.93  ? 453 LEU C N     1 
ATOM   6339 C  CA    . LEU B 2 476 ? 45.719  -4.247  70.993  1.00 73.95  ? 453 LEU C CA    1 
ATOM   6340 C  C     . LEU B 2 476 ? 45.864  -5.565  71.750  1.00 72.46  ? 453 LEU C C     1 
ATOM   6341 O  O     . LEU B 2 476 ? 45.209  -5.779  72.774  1.00 68.92  ? 453 LEU C O     1 
ATOM   6342 C  CB    . LEU B 2 476 ? 45.713  -3.083  71.986  1.00 83.15  ? 453 LEU C CB    1 
ATOM   6343 C  CG    . LEU B 2 476 ? 47.043  -2.446  72.410  1.00 83.04  ? 453 LEU C CG    1 
ATOM   6344 C  CD1   . LEU B 2 476 ? 46.849  -1.695  73.718  1.00 80.30  ? 453 LEU C CD1   1 
ATOM   6345 C  CD2   . LEU B 2 476 ? 48.155  -3.479  72.539  1.00 81.43  ? 453 LEU C CD2   1 
ATOM   6346 N  N     . PRO B 2 477 ? 46.713  -6.464  71.238  1.00 79.98  ? 454 PRO C N     1 
ATOM   6347 C  CA    . PRO B 2 477 ? 47.021  -7.715  71.937  1.00 85.06  ? 454 PRO C CA    1 
ATOM   6348 C  C     . PRO B 2 477 ? 47.876  -7.444  73.173  1.00 71.71  ? 454 PRO C C     1 
ATOM   6349 O  O     . PRO B 2 477 ? 48.897  -6.757  73.083  1.00 74.33  ? 454 PRO C O     1 
ATOM   6350 C  CB    . PRO B 2 477 ? 47.841  -8.506  70.906  1.00 107.75 ? 454 PRO C CB    1 
ATOM   6351 C  CG    . PRO B 2 477 ? 47.617  -7.818  69.606  1.00 113.46 ? 454 PRO C CG    1 
ATOM   6352 C  CD    . PRO B 2 477 ? 47.366  -6.389  69.922  1.00 96.56  ? 454 PRO C CD    1 
ATOM   6353 N  N     . LEU B 2 478 ? 47.448  -7.961  74.319  1.00 71.51  ? 455 LEU C N     1 
ATOM   6354 C  CA    . LEU B 2 478 ? 48.272  -7.954  75.517  1.00 84.53  ? 455 LEU C CA    1 
ATOM   6355 C  C     . LEU B 2 478 ? 49.001  -9.296  75.589  1.00 65.02  ? 455 LEU C C     1 
ATOM   6356 O  O     . LEU B 2 478 ? 48.377  -10.357 75.508  1.00 61.33  ? 455 LEU C O     1 
ATOM   6357 C  CB    . LEU B 2 478 ? 47.408  -7.744  76.747  1.00 124.35 ? 455 LEU C CB    1 
ATOM   6358 C  CG    . LEU B 2 478 ? 46.569  -6.472  76.656  1.00 155.97 ? 455 LEU C CG    1 
ATOM   6359 C  CD1   . LEU B 2 478 ? 45.545  -6.455  77.764  1.00 161.06 ? 455 LEU C CD1   1 
ATOM   6360 C  CD2   . LEU B 2 478 ? 47.451  -5.227  76.701  1.00 169.79 ? 455 LEU C CD2   1 
ATOM   6361 N  N     . ARG B 2 479 ? 50.322  -9.250  75.714  1.00 60.72  ? 456 ARG C N     1 
ATOM   6362 C  CA    . ARG B 2 479 ? 51.121  -10.461 75.653  1.00 58.10  ? 456 ARG C CA    1 
ATOM   6363 C  C     . ARG B 2 479 ? 51.614  -10.868 77.042  1.00 64.18  ? 456 ARG C C     1 
ATOM   6364 O  O     . ARG B 2 479 ? 52.659  -10.409 77.503  1.00 69.00  ? 456 ARG C O     1 
ATOM   6365 C  CB    . ARG B 2 479 ? 52.289  -10.263 74.684  1.00 57.00  ? 456 ARG C CB    1 
ATOM   6366 N  N     . GLY B 2 480 ? 50.846  -11.732 77.704  1.00 65.46  ? 457 GLY C N     1 
ATOM   6367 C  CA    . GLY B 2 480 ? 51.183  -12.208 79.036  1.00 57.11  ? 457 GLY C CA    1 
ATOM   6368 C  C     . GLY B 2 480 ? 50.333  -11.513 80.078  1.00 68.84  ? 457 GLY C C     1 
ATOM   6369 O  O     . GLY B 2 480 ? 49.627  -10.555 79.761  1.00 84.30  ? 457 GLY C O     1 
ATOM   6370 N  N     . LYS B 2 481 ? 50.397  -11.977 81.322  1.00 67.22  ? 458 LYS C N     1 
ATOM   6371 C  CA    . LYS B 2 481 ? 49.629  -11.331 82.381  1.00 82.35  ? 458 LYS C CA    1 
ATOM   6372 C  C     . LYS B 2 481 ? 50.111  -9.892  82.527  1.00 104.47 ? 458 LYS C C     1 
ATOM   6373 O  O     . LYS B 2 481 ? 51.310  -9.623  82.465  1.00 84.08  ? 458 LYS C O     1 
ATOM   6374 C  CB    . LYS B 2 481 ? 49.758  -12.079 83.707  1.00 78.49  ? 458 LYS C CB    1 
ATOM   6375 C  CG    . LYS B 2 481 ? 49.543  -13.586 83.605  1.00 83.94  ? 458 LYS C CG    1 
ATOM   6376 C  CD    . LYS B 2 481 ? 48.250  -14.056 84.267  1.00 101.55 ? 458 LYS C CD    1 
ATOM   6377 C  CE    . LYS B 2 481 ? 48.520  -15.288 85.133  1.00 120.30 ? 458 LYS C CE    1 
ATOM   6378 N  NZ    . LYS B 2 481 ? 47.271  -15.947 85.595  1.00 138.95 ? 458 LYS C NZ    1 
ATOM   6379 N  N     . VAL B 2 482 ? 49.166  -8.972  82.694  1.00 146.02 ? 459 VAL C N     1 
ATOM   6380 C  CA    . VAL B 2 482 ? 49.480  -7.556  82.859  1.00 168.98 ? 459 VAL C CA    1 
ATOM   6381 C  C     . VAL B 2 482 ? 50.042  -7.274  84.255  1.00 127.27 ? 459 VAL C C     1 
ATOM   6382 O  O     . VAL B 2 482 ? 49.569  -7.825  85.245  1.00 112.10 ? 459 VAL C O     1 
ATOM   6383 C  CB    . VAL B 2 482 ? 48.224  -6.687  82.654  1.00 221.24 ? 459 VAL C CB    1 
ATOM   6384 C  CG1   . VAL B 2 482 ? 48.552  -5.218  82.876  1.00 232.58 ? 459 VAL C CG1   1 
ATOM   6385 C  CG2   . VAL B 2 482 ? 47.631  -6.919  81.268  1.00 243.33 ? 459 VAL C CG2   1 
ATOM   6386 N  N     . ILE B 2 483 ? 51.044  -6.404  84.326  1.00 105.91 ? 460 ILE C N     1 
ATOM   6387 C  CA    . ILE B 2 483 ? 51.658  -6.035  85.601  1.00 99.40  ? 460 ILE C CA    1 
ATOM   6388 C  C     . ILE B 2 483 ? 50.631  -5.530  86.624  1.00 110.66 ? 460 ILE C C     1 
ATOM   6389 O  O     . ILE B 2 483 ? 49.719  -4.769  86.278  1.00 133.16 ? 460 ILE C O     1 
ATOM   6390 C  CB    . ILE B 2 483 ? 52.773  -4.974  85.400  1.00 71.00  ? 460 ILE C CB    1 
ATOM   6391 C  CG1   . ILE B 2 483 ? 53.524  -4.727  86.711  1.00 74.37  ? 460 ILE C CG1   1 
ATOM   6392 C  CG2   . ILE B 2 483 ? 52.194  -3.677  84.822  1.00 69.58  ? 460 ILE C CG2   1 
ATOM   6393 C  CD1   . ILE B 2 483 ? 54.945  -4.248  86.515  1.00 75.05  ? 460 ILE C CD1   1 
ATOM   6394 N  N     . ASN B 2 484 ? 50.779  -5.966  87.879  1.00 102.42 ? 461 ASN C N     1 
ATOM   6395 C  CA    . ASN B 2 484 ? 49.911  -5.497  88.961  1.00 112.39 ? 461 ASN C CA    1 
ATOM   6396 C  C     . ASN B 2 484 ? 50.252  -4.066  89.409  1.00 127.19 ? 461 ASN C C     1 
ATOM   6397 O  O     . ASN B 2 484 ? 51.243  -3.841  90.113  1.00 123.53 ? 461 ASN C O     1 
ATOM   6398 C  CB    . ASN B 2 484 ? 49.953  -6.450  90.154  1.00 117.15 ? 461 ASN C CB    1 
ATOM   6399 C  CG    . ASN B 2 484 ? 48.887  -6.127  91.196  1.00 132.95 ? 461 ASN C CG    1 
ATOM   6400 O  OD1   . ASN B 2 484 ? 48.462  -4.980  91.332  1.00 137.93 ? 461 ASN C OD1   1 
ATOM   6401 N  ND2   . ASN B 2 484 ? 48.443  -7.141  91.924  1.00 141.04 ? 461 ASN C ND2   1 
ATOM   6402 N  N     . THR B 2 485 ? 49.425  -3.107  89.001  1.00 144.17 ? 462 THR C N     1 
ATOM   6403 C  CA    . THR B 2 485 ? 49.735  -1.708  89.237  1.00 152.75 ? 462 THR C CA    1 
ATOM   6404 C  C     . THR B 2 485 ? 49.603  -1.280  90.705  1.00 155.16 ? 462 THR C C     1 
ATOM   6405 O  O     . THR B 2 485 ? 49.933  -0.150  91.049  1.00 139.71 ? 462 THR C O     1 
ATOM   6406 C  CB    . THR B 2 485 ? 48.927  -0.778  88.313  1.00 152.09 ? 462 THR C CB    1 
ATOM   6407 O  OG1   . THR B 2 485 ? 47.550  -1.171  88.305  1.00 136.45 ? 462 THR C OG1   1 
ATOM   6408 C  CG2   . THR B 2 485 ? 49.472  -0.856  86.905  1.00 163.21 ? 462 THR C CG2   1 
ATOM   6409 N  N     . ALA B 2 486 ? 49.140  -2.178  91.570  1.00 166.54 ? 463 ALA C N     1 
ATOM   6410 C  CA    . ALA B 2 486 ? 49.135  -1.895  93.006  1.00 161.36 ? 463 ALA C CA    1 
ATOM   6411 C  C     . ALA B 2 486 ? 50.452  -2.309  93.677  1.00 133.81 ? 463 ALA C C     1 
ATOM   6412 O  O     . ALA B 2 486 ? 51.046  -1.540  94.432  1.00 129.72 ? 463 ALA C O     1 
ATOM   6413 C  CB    . ALA B 2 486 ? 47.948  -2.564  93.700  1.00 170.68 ? 463 ALA C CB    1 
ATOM   6414 N  N     . LYS B 2 487 ? 50.900  -3.523  93.385  1.00 120.10 ? 464 LYS C N     1 
ATOM   6415 C  CA    . LYS B 2 487 ? 52.095  -4.092  93.996  1.00 115.48 ? 464 LYS C CA    1 
ATOM   6416 C  C     . LYS B 2 487 ? 53.400  -3.459  93.511  1.00 111.65 ? 464 LYS C C     1 
ATOM   6417 O  O     . LYS B 2 487 ? 54.309  -3.220  94.303  1.00 107.61 ? 464 LYS C O     1 
ATOM   6418 C  CB    . LYS B 2 487 ? 52.124  -5.616  93.778  1.00 118.36 ? 464 LYS C CB    1 
ATOM   6419 C  CG    . LYS B 2 487 ? 50.963  -6.332  94.448  1.00 132.46 ? 464 LYS C CG    1 
ATOM   6420 C  CD    . LYS B 2 487 ? 50.997  -7.824  94.251  1.00 145.36 ? 464 LYS C CD    1 
ATOM   6421 C  CE    . LYS B 2 487 ? 49.799  -8.439  94.966  1.00 156.91 ? 464 LYS C CE    1 
ATOM   6422 N  NZ    . LYS B 2 487 ? 49.475  -9.801  94.469  1.00 157.30 ? 464 LYS C NZ    1 
ATOM   6423 N  N     . ALA B 2 488 ? 53.488  -3.188  92.213  1.00 121.02 ? 465 ALA C N     1 
ATOM   6424 C  CA    . ALA B 2 488 ? 54.739  -2.723  91.619  1.00 140.63 ? 465 ALA C CA    1 
ATOM   6425 C  C     . ALA B 2 488 ? 54.953  -1.230  91.853  1.00 153.20 ? 465 ALA C C     1 
ATOM   6426 O  O     . ALA B 2 488 ? 54.030  -0.521  92.263  1.00 168.18 ? 465 ALA C O     1 
ATOM   6427 C  CB    . ALA B 2 488 ? 54.768  -3.050  90.144  1.00 145.41 ? 465 ALA C CB    1 
ATOM   6428 N  N     . LYS B 2 489 ? 56.174  -0.762  91.603  1.00 144.35 ? 466 LYS C N     1 
ATOM   6429 C  CA    . LYS B 2 489 ? 56.524  0.645   91.820  1.00 144.55 ? 466 LYS C CA    1 
ATOM   6430 C  C     . LYS B 2 489 ? 56.185  1.513   90.601  1.00 148.51 ? 466 LYS C C     1 
ATOM   6431 O  O     . LYS B 2 489 ? 56.280  1.052   89.457  1.00 146.24 ? 466 LYS C O     1 
ATOM   6432 C  CB    . LYS B 2 489 ? 58.009  0.779   92.171  1.00 146.16 ? 466 LYS C CB    1 
ATOM   6433 N  N     . MET B 2 490 ? 55.792  2.764   90.840  1.00 148.29 ? 467 MET C N     1 
ATOM   6434 C  CA    . MET B 2 490 ? 55.413  3.652   89.738  1.00 147.07 ? 467 MET C CA    1 
ATOM   6435 C  C     . MET B 2 490 ? 56.579  3.848   88.767  1.00 147.77 ? 467 MET C C     1 
ATOM   6436 O  O     . MET B 2 490 ? 56.415  4.420   87.688  1.00 137.56 ? 467 MET C O     1 
ATOM   6437 C  CB    . MET B 2 490 ? 54.898  4.999   90.249  1.00 143.31 ? 467 MET C CB    1 
ATOM   6438 C  CG    . MET B 2 490 ? 54.204  5.828   89.172  1.00 141.17 ? 467 MET C CG    1 
ATOM   6439 N  N     . ALA B 2 491 ? 57.751  3.362   89.173  1.00 154.29 ? 468 ALA C N     1 
ATOM   6440 C  CA    . ALA B 2 491 ? 58.940  3.338   88.330  1.00 150.32 ? 468 ALA C CA    1 
ATOM   6441 C  C     . ALA B 2 491 ? 58.809  2.213   87.316  1.00 149.30 ? 468 ALA C C     1 
ATOM   6442 O  O     . ALA B 2 491 ? 58.763  2.444   86.101  1.00 145.92 ? 468 ALA C O     1 
ATOM   6443 C  CB    . ALA B 2 491 ? 60.190  3.132   89.183  1.00 144.34 ? 468 ALA C CB    1 
ATOM   6444 N  N     . ASP B 2 492 ? 58.748  0.988   87.830  1.00 147.06 ? 469 ASP C N     1 
ATOM   6445 C  CA    . ASP B 2 492 ? 58.588  -0.190  86.983  1.00 131.30 ? 469 ASP C CA    1 
ATOM   6446 C  C     . ASP B 2 492 ? 57.244  -0.194  86.243  1.00 126.61 ? 469 ASP C C     1 
ATOM   6447 O  O     . ASP B 2 492 ? 57.166  -0.667  85.116  1.00 124.65 ? 469 ASP C O     1 
ATOM   6448 C  CB    . ASP B 2 492 ? 58.779  -1.474  87.799  1.00 130.14 ? 469 ASP C CB    1 
ATOM   6449 C  CG    . ASP B 2 492 ? 60.194  -1.626  88.330  1.00 142.23 ? 469 ASP C CG    1 
ATOM   6450 N  N     . ILE B 2 493 ? 56.200  0.347   86.871  1.00 140.88 ? 470 ILE C N     1 
ATOM   6451 C  CA    . ILE B 2 493 ? 54.875  0.408   86.253  1.00 163.24 ? 470 ILE C CA    1 
ATOM   6452 C  C     . ILE B 2 493 ? 54.894  1.199   84.936  1.00 164.64 ? 470 ILE C C     1 
ATOM   6453 O  O     . ILE B 2 493 ? 54.192  0.855   83.981  1.00 168.35 ? 470 ILE C O     1 
ATOM   6454 C  CB    . ILE B 2 493 ? 53.808  0.992   87.212  1.00 182.75 ? 470 ILE C CB    1 
ATOM   6455 N  N     . LEU B 2 494 ? 55.713  2.245   84.885  1.00 159.45 ? 471 LEU C N     1 
ATOM   6456 C  CA    . LEU B 2 494 ? 55.806  3.085   83.689  1.00 150.02 ? 471 LEU C CA    1 
ATOM   6457 C  C     . LEU B 2 494 ? 56.862  2.572   82.715  1.00 132.75 ? 471 LEU C C     1 
ATOM   6458 O  O     . LEU B 2 494 ? 56.941  3.036   81.583  1.00 128.73 ? 471 LEU C O     1 
ATOM   6459 C  CB    . LEU B 2 494 ? 56.079  4.555   84.056  1.00 156.12 ? 471 LEU C CB    1 
ATOM   6460 N  N     . LYS B 2 495 ? 57.674  1.622   83.161  1.00 120.64 ? 472 LYS C N     1 
ATOM   6461 C  CA    . LYS B 2 495 ? 58.650  0.991   82.280  1.00 108.13 ? 472 LYS C CA    1 
ATOM   6462 C  C     . LYS B 2 495 ? 58.122  -0.349  81.740  1.00 97.71  ? 472 LYS C C     1 
ATOM   6463 O  O     . LYS B 2 495 ? 58.903  -1.238  81.398  1.00 94.46  ? 472 LYS C O     1 
ATOM   6464 C  CB    . LYS B 2 495 ? 59.986  0.795   83.007  1.00 114.01 ? 472 LYS C CB    1 
ATOM   6465 N  N     . ASN B 2 496 ? 56.796  -0.483  81.667  1.00 96.66  ? 473 ASN C N     1 
ATOM   6466 C  CA    . ASN B 2 496 ? 56.156  -1.721  81.202  1.00 88.36  ? 473 ASN C CA    1 
ATOM   6467 C  C     . ASN B 2 496 ? 55.558  -1.575  79.788  1.00 90.31  ? 473 ASN C C     1 
ATOM   6468 O  O     . ASN B 2 496 ? 54.832  -0.620  79.502  1.00 93.46  ? 473 ASN C O     1 
ATOM   6469 C  CB    . ASN B 2 496 ? 55.079  -2.168  82.202  1.00 80.91  ? 473 ASN C CB    1 
ATOM   6470 C  CG    . ASN B 2 496 ? 54.601  -3.593  81.959  1.00 79.79  ? 473 ASN C CG    1 
ATOM   6471 O  OD1   . ASN B 2 496 ? 53.415  -3.836  81.727  1.00 77.34  ? 473 ASN C OD1   1 
ATOM   6472 N  ND2   . ASN B 2 496 ? 55.527  -4.544  82.015  1.00 82.45  ? 473 ASN C ND2   1 
ATOM   6473 N  N     . GLU B 2 497 ? 55.864  -2.515  78.901  1.00 78.03  ? 474 GLU C N     1 
ATOM   6474 C  CA    . GLU B 2 497 ? 55.432  -2.379  77.517  1.00 86.26  ? 474 GLU C CA    1 
ATOM   6475 C  C     . GLU B 2 497 ? 53.914  -2.378  77.399  1.00 97.90  ? 474 GLU C C     1 
ATOM   6476 O  O     . GLU B 2 497 ? 53.338  -1.473  76.801  1.00 114.28 ? 474 GLU C O     1 
ATOM   6477 C  CB    . GLU B 2 497 ? 56.039  -3.473  76.639  1.00 96.12  ? 474 GLU C CB    1 
ATOM   6478 C  CG    . GLU B 2 497 ? 57.544  -3.356  76.447  1.00 112.16 ? 474 GLU C CG    1 
ATOM   6479 C  CD    . GLU B 2 497 ? 58.089  -4.341  75.414  1.00 128.34 ? 474 GLU C CD    1 
ATOM   6480 O  OE1   . GLU B 2 497 ? 59.273  -4.730  75.536  1.00 115.03 ? 474 GLU C OE1   1 
ATOM   6481 O  OE2   . GLU B 2 497 ? 57.343  -4.722  74.480  1.00 153.72 ? 474 GLU C OE2   1 
ATOM   6482 N  N     . GLU B 2 498 ? 53.258  -3.383  77.967  1.00 98.34  ? 475 GLU C N     1 
ATOM   6483 C  CA    . GLU B 2 498 ? 51.803  -3.452  77.863  1.00 118.96 ? 475 GLU C CA    1 
ATOM   6484 C  C     . GLU B 2 498 ? 51.163  -2.146  78.371  1.00 143.76 ? 475 GLU C C     1 
ATOM   6485 O  O     . GLU B 2 498 ? 50.368  -1.526  77.656  1.00 171.21 ? 475 GLU C O     1 
ATOM   6486 C  CB    . GLU B 2 498 ? 51.247  -4.693  78.576  1.00 121.97 ? 475 GLU C CB    1 
ATOM   6487 N  N     . ILE B 2 499 ? 51.534  -1.728  79.587  1.00 134.42 ? 476 ILE C N     1 
ATOM   6488 C  CA    . ILE B 2 499 ? 51.067  -0.470  80.182  1.00 125.57 ? 476 ILE C CA    1 
ATOM   6489 C  C     . ILE B 2 499 ? 51.460  0.755   79.344  1.00 114.42 ? 476 ILE C C     1 
ATOM   6490 O  O     . ILE B 2 499 ? 50.613  1.594   79.019  1.00 112.96 ? 476 ILE C O     1 
ATOM   6491 C  CB    . ILE B 2 499 ? 51.616  -0.287  81.638  1.00 131.04 ? 476 ILE C CB    1 
ATOM   6492 C  CG1   . ILE B 2 499 ? 51.145  -1.421  82.533  1.00 127.31 ? 476 ILE C CG1   1 
ATOM   6493 C  CG2   . ILE B 2 499 ? 51.150  1.038   82.268  1.00 141.55 ? 476 ILE C CG2   1 
ATOM   6494 C  CD1   . ILE B 2 499 ? 49.730  -1.216  82.996  1.00 134.70 ? 476 ILE C CD1   1 
ATOM   6495 N  N     . ASN B 2 500 ? 52.742  0.848   78.989  1.00 107.22 ? 477 ASN C N     1 
ATOM   6496 C  CA    . ASN B 2 500 ? 53.283  2.030   78.300  1.00 109.17 ? 477 ASN C CA    1 
ATOM   6497 C  C     . ASN B 2 500 ? 52.658  2.318   76.948  1.00 117.25 ? 477 ASN C C     1 
ATOM   6498 O  O     . ASN B 2 500 ? 52.516  3.476   76.562  1.00 110.15 ? 477 ASN C O     1 
ATOM   6499 C  CB    . ASN B 2 500 ? 54.804  1.924   78.145  1.00 109.20 ? 477 ASN C CB    1 
ATOM   6500 C  CG    . ASN B 2 500 ? 55.543  3.061   78.829  1.00 120.94 ? 477 ASN C CG    1 
ATOM   6501 O  OD1   . ASN B 2 500 ? 56.574  3.526   78.343  1.00 122.91 ? 477 ASN C OD1   1 
ATOM   6502 N  ND2   . ASN B 2 500 ? 55.013  3.520   79.962  1.00 135.03 ? 477 ASN C ND2   1 
ATOM   6503 N  N     . THR B 2 501 ? 52.288  1.263   76.228  1.00 134.81 ? 478 THR C N     1 
ATOM   6504 C  CA    . THR B 2 501 ? 51.692  1.433   74.910  1.00 141.20 ? 478 THR C CA    1 
ATOM   6505 C  C     . THR B 2 501 ? 50.176  1.670   74.971  1.00 135.45 ? 478 THR C C     1 
ATOM   6506 O  O     . THR B 2 501 ? 49.604  2.251   74.054  1.00 125.77 ? 478 THR C O     1 
ATOM   6507 C  CB    . THR B 2 501 ? 52.037  0.258   73.955  1.00 154.01 ? 478 THR C CB    1 
ATOM   6508 O  OG1   . THR B 2 501 ? 51.102  -0.806  74.135  1.00 149.89 ? 478 THR C OG1   1 
ATOM   6509 C  CG2   . THR B 2 501 ? 53.467  -0.251  74.195  1.00 155.16 ? 478 THR C CG2   1 
ATOM   6510 N  N     . MET B 2 502 ? 49.527  1.222   76.041  1.00 136.63 ? 479 MET C N     1 
ATOM   6511 C  CA    . MET B 2 502 ? 48.138  1.618   76.301  1.00 136.21 ? 479 MET C CA    1 
ATOM   6512 C  C     . MET B 2 502 ? 48.086  3.101   76.698  1.00 101.90 ? 479 MET C C     1 
ATOM   6513 O  O     . MET B 2 502 ? 47.150  3.826   76.322  1.00 93.50  ? 479 MET C O     1 
ATOM   6514 C  CB    . MET B 2 502 ? 47.490  0.770   77.415  1.00 178.27 ? 479 MET C CB    1 
ATOM   6515 C  CG    . MET B 2 502 ? 47.215  -0.698  77.075  1.00 205.78 ? 479 MET C CG    1 
ATOM   6516 S  SD    . MET B 2 502 ? 46.792  -1.650  78.561  1.00 476.63 ? 479 MET C SD    1 
ATOM   6517 C  CE    . MET B 2 502 ? 45.086  -1.187  78.814  1.00 261.35 ? 479 MET C CE    1 
ATOM   6518 N  N     . ILE B 2 503 ? 49.081  3.539   77.472  1.00 104.74 ? 480 ILE C N     1 
ATOM   6519 C  CA    . ILE B 2 503 ? 49.169  4.939   77.878  1.00 108.91 ? 480 ILE C CA    1 
ATOM   6520 C  C     . ILE B 2 503 ? 49.286  5.805   76.628  1.00 109.36 ? 480 ILE C C     1 
ATOM   6521 O  O     . ILE B 2 503 ? 48.778  6.925   76.596  1.00 121.62 ? 480 ILE C O     1 
ATOM   6522 C  CB    . ILE B 2 503 ? 50.354  5.206   78.836  1.00 103.15 ? 480 ILE C CB    1 
ATOM   6523 N  N     . TYR B 2 504 ? 49.930  5.259   75.596  1.00 96.58  ? 481 TYR C N     1 
ATOM   6524 C  CA    . TYR B 2 504 ? 50.122  5.962   74.323  1.00 98.19  ? 481 TYR C CA    1 
ATOM   6525 C  C     . TYR B 2 504 ? 48.971  5.763   73.330  1.00 106.40 ? 481 TYR C C     1 
ATOM   6526 O  O     . TYR B 2 504 ? 48.474  6.730   72.749  1.00 115.37 ? 481 TYR C O     1 
ATOM   6527 C  CB    . TYR B 2 504 ? 51.443  5.543   73.666  1.00 101.76 ? 481 TYR C CB    1 
ATOM   6528 N  N     . THR B 2 505 ? 48.562  4.515   73.121  1.00 104.78 ? 482 THR C N     1 
ATOM   6529 C  CA    . THR B 2 505 ? 47.494  4.215   72.163  1.00 105.07 ? 482 THR C CA    1 
ATOM   6530 C  C     . THR B 2 505 ? 46.188  4.915   72.565  1.00 99.83  ? 482 THR C C     1 
ATOM   6531 O  O     . THR B 2 505 ? 45.395  5.317   71.703  1.00 91.49  ? 482 THR C O     1 
ATOM   6532 C  CB    . THR B 2 505 ? 47.283  2.670   71.958  1.00 87.85  ? 482 THR C CB    1 
ATOM   6533 N  N     . ILE B 2 506 ? 45.990  5.073   73.878  1.00 95.39  ? 483 ILE C N     1 
ATOM   6534 C  CA    . ILE B 2 506 ? 44.806  5.737   74.415  1.00 100.59 ? 483 ILE C CA    1 
ATOM   6535 C  C     . ILE B 2 506 ? 44.928  7.250   74.229  1.00 114.30 ? 483 ILE C C     1 
ATOM   6536 O  O     . ILE B 2 506 ? 43.935  7.941   73.998  1.00 116.25 ? 483 ILE C O     1 
ATOM   6537 C  CB    . ILE B 2 506 ? 44.574  5.388   75.906  1.00 102.23 ? 483 ILE C CB    1 
ATOM   6538 N  N     . GLY B 2 507 ? 46.153  7.757   74.328  1.00 121.25 ? 484 GLY C N     1 
ATOM   6539 C  CA    . GLY B 2 507 ? 46.458  9.135   73.967  1.00 125.15 ? 484 GLY C CA    1 
ATOM   6540 C  C     . GLY B 2 507 ? 46.060  10.222  74.952  1.00 133.88 ? 484 GLY C C     1 
ATOM   6541 O  O     . GLY B 2 507 ? 45.922  11.390  74.571  1.00 134.54 ? 484 GLY C O     1 
ATOM   6542 N  N     . ALA B 2 508 ? 45.887  9.857   76.219  1.00 138.46 ? 485 ALA C N     1 
ATOM   6543 C  CA    . ALA B 2 508 ? 45.478  10.824  77.233  1.00 154.11 ? 485 ALA C CA    1 
ATOM   6544 C  C     . ALA B 2 508 ? 46.511  10.998  78.343  1.00 146.06 ? 485 ALA C C     1 
ATOM   6545 O  O     . ALA B 2 508 ? 46.288  11.760  79.282  1.00 143.11 ? 485 ALA C O     1 
ATOM   6546 C  CB    . ALA B 2 508 ? 44.126  10.441  77.819  1.00 172.17 ? 485 ALA C CB    1 
ATOM   6547 N  N     . GLY B 2 509 ? 47.644  10.305  78.227  1.00 138.39 ? 486 GLY C N     1 
ATOM   6548 C  CA    . GLY B 2 509 ? 48.646  10.316  79.280  1.00 132.87 ? 486 GLY C CA    1 
ATOM   6549 C  C     . GLY B 2 509 ? 48.180  9.482   80.458  1.00 133.78 ? 486 GLY C C     1 
ATOM   6550 O  O     . GLY B 2 509 ? 47.274  8.664   80.308  1.00 136.28 ? 486 GLY C O     1 
ATOM   6551 N  N     . VAL B 2 510 ? 48.783  9.686   81.627  1.00 130.67 ? 487 VAL C N     1 
ATOM   6552 C  CA    . VAL B 2 510 ? 48.436  8.907   82.821  1.00 122.48 ? 487 VAL C CA    1 
ATOM   6553 C  C     . VAL B 2 510 ? 48.586  9.712   84.112  1.00 132.66 ? 487 VAL C C     1 
ATOM   6554 O  O     . VAL B 2 510 ? 49.225  10.768  84.136  1.00 141.81 ? 487 VAL C O     1 
ATOM   6555 C  CB    . VAL B 2 510 ? 49.292  7.631   82.951  1.00 134.49 ? 487 VAL C CB    1 
ATOM   6556 N  N     . GLY B 2 511 ? 48.002  9.201   85.188  1.00 134.51 ? 488 GLY C N     1 
ATOM   6557 C  CA    . GLY B 2 511 ? 48.107  9.852   86.477  1.00 146.68 ? 488 GLY C CA    1 
ATOM   6558 C  C     . GLY B 2 511 ? 47.332  11.148  86.501  1.00 160.28 ? 488 GLY C C     1 
ATOM   6559 O  O     . GLY B 2 511 ? 46.307  11.266  85.832  1.00 158.19 ? 488 GLY C O     1 
ATOM   6560 N  N     . ALA B 2 512 ? 47.817  12.118  87.271  1.00 171.32 ? 489 ALA C N     1 
ATOM   6561 C  CA    . ALA B 2 512 ? 47.147  13.409  87.388  1.00 174.79 ? 489 ALA C CA    1 
ATOM   6562 C  C     . ALA B 2 512 ? 47.411  14.292  86.176  1.00 175.06 ? 489 ALA C C     1 
ATOM   6563 O  O     . ALA B 2 512 ? 46.733  15.296  85.984  1.00 182.97 ? 489 ALA C O     1 
ATOM   6564 C  CB    . ALA B 2 512 ? 47.554  14.119  88.672  1.00 180.52 ? 489 ALA C CB    1 
ATOM   6565 N  N     . ASP B 2 513 ? 48.396  13.923  85.361  1.00 169.95 ? 490 ASP C N     1 
ATOM   6566 C  CA    . ASP B 2 513 ? 48.649  14.626  84.104  1.00 163.75 ? 490 ASP C CA    1 
ATOM   6567 C  C     . ASP B 2 513 ? 47.806  14.004  82.979  1.00 163.20 ? 490 ASP C C     1 
ATOM   6568 O  O     . ASP B 2 513 ? 48.341  13.637  81.934  1.00 165.82 ? 490 ASP C O     1 
ATOM   6569 C  CB    . ASP B 2 513 ? 50.139  14.565  83.745  1.00 150.42 ? 490 ASP C CB    1 
ATOM   6570 C  CG    . ASP B 2 513 ? 51.018  14.257  84.942  1.00 143.02 ? 490 ASP C CG    1 
ATOM   6571 N  N     . PHE B 2 514 ? 46.491  13.904  83.195  1.00 161.21 ? 491 PHE C N     1 
ATOM   6572 C  CA    . PHE B 2 514 ? 45.608  13.086  82.348  1.00 157.91 ? 491 PHE C CA    1 
ATOM   6573 C  C     . PHE B 2 514 ? 44.326  13.813  81.913  1.00 158.17 ? 491 PHE C C     1 
ATOM   6574 O  O     . PHE B 2 514 ? 43.473  14.126  82.742  1.00 170.97 ? 491 PHE C O     1 
ATOM   6575 C  CB    . PHE B 2 514 ? 45.257  11.776  83.087  1.00 154.67 ? 491 PHE C CB    1 
ATOM   6576 C  CG    . PHE B 2 514 ? 44.326  10.851  82.328  1.00 151.29 ? 491 PHE C CG    1 
ATOM   6577 C  CD1   . PHE B 2 514 ? 42.959  10.877  82.558  1.00 152.67 ? 491 PHE C CD1   1 
ATOM   6578 C  CD2   . PHE B 2 514 ? 44.825  9.932   81.415  1.00 145.61 ? 491 PHE C CD2   1 
ATOM   6579 C  CE1   . PHE B 2 514 ? 42.103  10.018  81.871  1.00 147.81 ? 491 PHE C CE1   1 
ATOM   6580 C  CE2   . PHE B 2 514 ? 43.973  9.072   80.726  1.00 137.91 ? 491 PHE C CE2   1 
ATOM   6581 C  CZ    . PHE B 2 514 ? 42.613  9.116   80.956  1.00 138.26 ? 491 PHE C CZ    1 
ATOM   6582 N  N     . SER B 2 515 ? 44.198  14.069  80.611  1.00 158.91 ? 492 SER C N     1 
ATOM   6583 C  CA    . SER B 2 515 ? 42.999  14.702  80.057  1.00 161.01 ? 492 SER C CA    1 
ATOM   6584 C  C     . SER B 2 515 ? 42.084  13.678  79.380  1.00 158.07 ? 492 SER C C     1 
ATOM   6585 O  O     . SER B 2 515 ? 42.517  12.948  78.488  1.00 153.75 ? 492 SER C O     1 
ATOM   6586 C  CB    . SER B 2 515 ? 43.382  15.799  79.057  1.00 160.04 ? 492 SER C CB    1 
ATOM   6587 N  N     . ILE B 2 516 ? 40.821  13.629  79.802  1.00 155.86 ? 493 ILE C N     1 
ATOM   6588 C  CA    . ILE B 2 516 ? 39.857  12.695  79.218  1.00 170.31 ? 493 ILE C CA    1 
ATOM   6589 C  C     . ILE B 2 516 ? 39.318  13.165  77.859  1.00 187.24 ? 493 ILE C C     1 
ATOM   6590 O  O     . ILE B 2 516 ? 38.621  12.421  77.170  1.00 202.22 ? 493 ILE C O     1 
ATOM   6591 C  CB    . ILE B 2 516 ? 38.671  12.437  80.167  1.00 175.18 ? 493 ILE C CB    1 
ATOM   6592 N  N     . GLU B 2 517 ? 39.641  14.398  77.477  1.00 188.67 ? 494 GLU C N     1 
ATOM   6593 C  CA    . GLU B 2 517 ? 39.171  14.942  76.205  1.00 196.77 ? 494 GLU C CA    1 
ATOM   6594 C  C     . GLU B 2 517 ? 40.189  14.768  75.082  1.00 201.02 ? 494 GLU C C     1 
ATOM   6595 O  O     . GLU B 2 517 ? 39.860  14.930  73.910  1.00 218.91 ? 494 GLU C O     1 
ATOM   6596 C  CB    . GLU B 2 517 ? 38.797  16.421  76.334  1.00 205.09 ? 494 GLU C CB    1 
ATOM   6597 C  CG    . GLU B 2 517 ? 37.442  16.669  76.967  1.00 212.83 ? 494 GLU C CG    1 
ATOM   6598 C  CD    . GLU B 2 517 ? 37.550  17.135  78.404  1.00 219.34 ? 494 GLU C CD    1 
ATOM   6599 O  OE1   . GLU B 2 517 ? 36.698  17.947  78.827  1.00 214.43 ? 494 GLU C OE1   1 
ATOM   6600 O  OE2   . GLU B 2 517 ? 38.488  16.695  79.105  1.00 228.32 ? 494 GLU C OE2   1 
ATOM   6601 N  N     . ASP B 2 518 ? 41.426  14.450  75.445  1.00 184.25 ? 495 ASP C N     1 
ATOM   6602 C  CA    . ASP B 2 518 ? 42.446  14.172  74.444  1.00 172.34 ? 495 ASP C CA    1 
ATOM   6603 C  C     . ASP B 2 518 ? 42.491  12.672  74.117  1.00 175.32 ? 495 ASP C C     1 
ATOM   6604 O  O     . ASP B 2 518 ? 43.377  12.206  73.395  1.00 171.12 ? 495 ASP C O     1 
ATOM   6605 C  CB    . ASP B 2 518 ? 43.815  14.684  74.907  1.00 164.72 ? 495 ASP C CB    1 
ATOM   6606 N  N     . ALA B 2 519 ? 41.516  11.925  74.639  1.00 190.89 ? 496 ALA C N     1 
ATOM   6607 C  CA    . ALA B 2 519 ? 41.432  10.475  74.432  1.00 208.22 ? 496 ALA C CA    1 
ATOM   6608 C  C     . ALA B 2 519 ? 41.340  10.113  72.954  1.00 182.54 ? 496 ALA C C     1 
ATOM   6609 O  O     . ALA B 2 519 ? 41.475  10.978  72.085  1.00 180.05 ? 496 ALA C O     1 
ATOM   6610 C  CB    . ALA B 2 519 ? 40.244  9.896   75.192  1.00 242.38 ? 496 ALA C CB    1 
ATOM   6611 N  N     . ASN B 2 520 ? 41.108  8.833   72.670  1.00 158.12 ? 497 ASN C N     1 
ATOM   6612 C  CA    . ASN B 2 520 ? 41.015  8.363   71.289  1.00 134.33 ? 497 ASN C CA    1 
ATOM   6613 C  C     . ASN B 2 520 ? 39.847  7.416   71.054  1.00 139.00 ? 497 ASN C C     1 
ATOM   6614 O  O     . ASN B 2 520 ? 39.547  7.066   69.913  1.00 122.55 ? 497 ASN C O     1 
ATOM   6615 C  CB    . ASN B 2 520 ? 42.323  7.694   70.844  1.00 109.91 ? 497 ASN C CB    1 
ATOM   6616 C  CG    . ASN B 2 520 ? 43.451  8.695   70.638  1.00 104.26 ? 497 ASN C CG    1 
ATOM   6617 O  OD1   . ASN B 2 520 ? 43.220  9.849   70.266  1.00 106.97 ? 497 ASN C OD1   1 
ATOM   6618 N  ND2   . ASN B 2 520 ? 44.682  8.252   70.875  1.00 98.00  ? 497 ASN C ND2   1 
ATOM   6619 N  N     . TYR B 2 521 ? 39.184  7.002   72.127  1.00 163.36 ? 498 TYR C N     1 
ATOM   6620 C  CA    . TYR B 2 521 ? 38.085  6.061   71.980  1.00 178.47 ? 498 TYR C CA    1 
ATOM   6621 C  C     . TYR B 2 521 ? 36.901  6.406   72.874  1.00 188.39 ? 498 TYR C C     1 
ATOM   6622 O  O     . TYR B 2 521 ? 37.065  6.988   73.943  1.00 218.19 ? 498 TYR C O     1 
ATOM   6623 C  CB    . TYR B 2 521 ? 38.580  4.639   72.242  1.00 176.17 ? 498 TYR C CB    1 
ATOM   6624 C  CG    . TYR B 2 521 ? 39.804  4.280   71.418  1.00 172.98 ? 498 TYR C CG    1 
ATOM   6625 C  CD1   . TYR B 2 521 ? 39.682  3.631   70.193  1.00 183.26 ? 498 TYR C CD1   1 
ATOM   6626 C  CD2   . TYR B 2 521 ? 41.084  4.607   71.857  1.00 168.40 ? 498 TYR C CD2   1 
ATOM   6627 C  CE1   . TYR B 2 521 ? 40.807  3.306   69.435  1.00 193.97 ? 498 TYR C CE1   1 
ATOM   6628 C  CE2   . TYR B 2 521 ? 42.215  4.287   71.106  1.00 178.62 ? 498 TYR C CE2   1 
ATOM   6629 C  CZ    . TYR B 2 521 ? 42.067  3.638   69.899  1.00 198.35 ? 498 TYR C CZ    1 
ATOM   6630 O  OH    . TYR B 2 521 ? 43.180  3.324   69.153  1.00 214.86 ? 498 TYR C OH    1 
ATOM   6631 N  N     . ASP B 2 522 ? 35.706  6.064   72.407  1.00 158.41 ? 499 ASP C N     1 
ATOM   6632 C  CA    . ASP B 2 522 ? 34.474  6.250   73.169  1.00 142.82 ? 499 ASP C CA    1 
ATOM   6633 C  C     . ASP B 2 522 ? 34.284  5.061   74.103  1.00 142.57 ? 499 ASP C C     1 
ATOM   6634 O  O     . ASP B 2 522 ? 33.648  5.162   75.154  1.00 146.49 ? 499 ASP C O     1 
ATOM   6635 C  CB    . ASP B 2 522 ? 33.279  6.359   72.214  1.00 151.66 ? 499 ASP C CB    1 
ATOM   6636 C  CG    . ASP B 2 522 ? 31.940  6.343   72.936  1.00 162.74 ? 499 ASP C CG    1 
ATOM   6637 O  OD1   . ASP B 2 522 ? 31.779  7.112   73.912  1.00 166.35 ? 499 ASP C OD1   1 
ATOM   6638 O  OD2   . ASP B 2 522 ? 31.053  5.558   72.525  1.00 162.59 ? 499 ASP C OD2   1 
ATOM   6639 N  N     . LYS B 2 523 ? 34.848  3.928   73.697  1.00 134.47 ? 500 LYS C N     1 
ATOM   6640 C  CA    . LYS B 2 523 ? 34.745  2.696   74.456  1.00 124.75 ? 500 LYS C CA    1 
ATOM   6641 C  C     . LYS B 2 523 ? 36.078  1.975   74.396  1.00 121.84 ? 500 LYS C C     1 
ATOM   6642 O  O     . LYS B 2 523 ? 36.652  1.799   73.322  1.00 126.66 ? 500 LYS C O     1 
ATOM   6643 C  CB    . LYS B 2 523 ? 33.636  1.805   73.884  1.00 121.87 ? 500 LYS C CB    1 
ATOM   6644 C  CG    . LYS B 2 523 ? 32.242  2.413   73.977  1.00 132.02 ? 500 LYS C CG    1 
ATOM   6645 C  CD    . LYS B 2 523 ? 31.225  1.665   73.120  1.00 144.73 ? 500 LYS C CD    1 
ATOM   6646 C  CE    . LYS B 2 523 ? 29.923  2.457   73.021  1.00 166.59 ? 500 LYS C CE    1 
ATOM   6647 N  NZ    . LYS B 2 523 ? 28.923  1.797   72.141  1.00 181.73 ? 500 LYS C NZ    1 
ATOM   6648 N  N     . ILE B 2 524 ? 36.582  1.589   75.562  1.00 129.06 ? 501 ILE C N     1 
ATOM   6649 C  CA    . ILE B 2 524 ? 37.731  0.702   75.646  1.00 147.34 ? 501 ILE C CA    1 
ATOM   6650 C  C     . ILE B 2 524 ? 37.205  -0.642  76.111  1.00 145.80 ? 501 ILE C C     1 
ATOM   6651 O  O     . ILE B 2 524 ? 36.620  -0.746  77.179  1.00 137.61 ? 501 ILE C O     1 
ATOM   6652 C  CB    . ILE B 2 524 ? 38.803  1.243   76.613  1.00 169.44 ? 501 ILE C CB    1 
ATOM   6653 C  CG1   . ILE B 2 524 ? 39.364  2.568   76.080  1.00 174.38 ? 501 ILE C CG1   1 
ATOM   6654 C  CG2   . ILE B 2 524 ? 39.908  0.220   76.816  1.00 178.53 ? 501 ILE C CG2   1 
ATOM   6655 C  CD1   . ILE B 2 524 ? 40.762  2.906   76.569  1.00 174.80 ? 501 ILE C CD1   1 
ATOM   6656 N  N     . ILE B 2 525 ? 37.393  -1.670  75.294  1.00 149.27 ? 502 ILE C N     1 
ATOM   6657 C  CA    . ILE B 2 525 ? 36.772  -2.961  75.542  1.00 138.77 ? 502 ILE C CA    1 
ATOM   6658 C  C     . ILE B 2 525 ? 37.791  -4.058  75.817  1.00 117.50 ? 502 ILE C C     1 
ATOM   6659 O  O     . ILE B 2 525 ? 38.632  -4.369  74.969  1.00 111.29 ? 502 ILE C O     1 
ATOM   6660 C  CB    . ILE B 2 525 ? 35.897  -3.387  74.361  1.00 138.35 ? 502 ILE C CB    1 
ATOM   6661 C  CG1   . ILE B 2 525 ? 34.907  -2.272  74.013  1.00 138.25 ? 502 ILE C CG1   1 
ATOM   6662 C  CG2   . ILE B 2 525 ? 35.172  -4.674  74.693  1.00 140.61 ? 502 ILE C CG2   1 
ATOM   6663 C  CD1   . ILE B 2 525 ? 34.042  -2.566  72.809  1.00 139.09 ? 502 ILE C CD1   1 
ATOM   6664 N  N     . ILE B 2 526 ? 37.705  -4.642  77.010  1.00 103.66 ? 503 ILE C N     1 
ATOM   6665 C  CA    . ILE B 2 526 ? 38.594  -5.726  77.416  1.00 97.28  ? 503 ILE C CA    1 
ATOM   6666 C  C     . ILE B 2 526 ? 38.026  -7.075  77.000  1.00 86.40  ? 503 ILE C C     1 
ATOM   6667 O  O     . ILE B 2 526 ? 36.974  -7.492  77.478  1.00 89.05  ? 503 ILE C O     1 
ATOM   6668 C  CB    . ILE B 2 526 ? 38.833  -5.726  78.932  1.00 124.97 ? 503 ILE C CB    1 
ATOM   6669 C  CG1   . ILE B 2 526 ? 39.349  -4.359  79.392  1.00 155.86 ? 503 ILE C CG1   1 
ATOM   6670 C  CG2   . ILE B 2 526 ? 39.802  -6.832  79.311  1.00 125.57 ? 503 ILE C CG2   1 
ATOM   6671 C  CD1   . ILE B 2 526 ? 39.479  -4.227  80.884  1.00 177.44 ? 503 ILE C CD1   1 
ATOM   6672 N  N     . MET B 2 527 ? 38.726  -7.759  76.105  1.00 88.75  ? 504 MET C N     1 
ATOM   6673 C  CA    . MET B 2 527 ? 38.226  -9.020  75.592  1.00 118.73 ? 504 MET C CA    1 
ATOM   6674 C  C     . MET B 2 527 ? 39.162  -10.179 75.940  1.00 124.72 ? 504 MET C C     1 
ATOM   6675 O  O     . MET B 2 527 ? 40.187  -10.379 75.285  1.00 126.54 ? 504 MET C O     1 
ATOM   6676 C  CB    . MET B 2 527 ? 38.014  -8.917  74.082  1.00 152.07 ? 504 MET C CB    1 
ATOM   6677 C  CG    . MET B 2 527 ? 37.359  -10.134 73.465  1.00 178.12 ? 504 MET C CG    1 
ATOM   6678 S  SD    . MET B 2 527 ? 36.802  -9.810  71.791  1.00 560.09 ? 504 MET C SD    1 
ATOM   6679 C  CE    . MET B 2 527 ? 38.334  -9.273  71.040  1.00 309.31 ? 504 MET C CE    1 
ATOM   6680 N  N     . THR B 2 528 ? 38.809  -10.944 76.970  1.00 137.53 ? 505 THR C N     1 
ATOM   6681 C  CA    . THR B 2 528 ? 39.661  -12.049 77.394  1.00 154.72 ? 505 THR C CA    1 
ATOM   6682 C  C     . THR B 2 528 ? 39.003  -13.401 77.145  1.00 175.89 ? 505 THR C C     1 
ATOM   6683 O  O     . THR B 2 528 ? 37.815  -13.467 76.827  1.00 175.32 ? 505 THR C O     1 
ATOM   6684 C  CB    . THR B 2 528 ? 40.033  -11.948 78.892  1.00 151.11 ? 505 THR C CB    1 
ATOM   6685 O  OG1   . THR B 2 528 ? 38.898  -12.294 79.703  1.00 146.06 ? 505 THR C OG1   1 
ATOM   6686 C  CG2   . THR B 2 528 ? 40.506  -10.546 79.233  1.00 153.58 ? 505 THR C CG2   1 
ATOM   6687 N  N     . ASP B 2 529 ? 39.792  -14.468 77.292  1.00 191.50 ? 506 ASP C N     1 
ATOM   6688 C  CA    . ASP B 2 529 ? 39.278  -15.835 77.282  1.00 190.14 ? 506 ASP C CA    1 
ATOM   6689 C  C     . ASP B 2 529 ? 38.195  -15.960 78.340  1.00 186.32 ? 506 ASP C C     1 
ATOM   6690 O  O     . ASP B 2 529 ? 38.214  -15.251 79.353  1.00 175.69 ? 506 ASP C O     1 
ATOM   6691 C  CB    . ASP B 2 529 ? 40.394  -16.843 77.590  1.00 170.97 ? 506 ASP C CB    1 
ATOM   6692 C  CG    . ASP B 2 529 ? 41.261  -17.180 76.378  1.00 135.72 ? 506 ASP C CG    1 
ATOM   6693 O  OD1   . ASP B 2 529 ? 41.390  -16.341 75.447  1.00 135.21 ? 506 ASP C OD1   1 
ATOM   6694 O  OD2   . ASP B 2 529 ? 41.830  -18.300 76.367  1.00 105.08 ? 506 ASP C OD2   1 
ATOM   6695 N  N     . ALA B 2 530 ? 37.249  -16.862 78.118  1.00 189.60 ? 507 ALA C N     1 
ATOM   6696 C  CA    . ALA B 2 530 ? 36.234  -17.118 79.130  1.00 190.47 ? 507 ALA C CA    1 
ATOM   6697 C  C     . ALA B 2 530 ? 36.748  -18.130 80.155  1.00 182.75 ? 507 ALA C C     1 
ATOM   6698 O  O     . ALA B 2 530 ? 36.038  -19.065 80.521  1.00 194.58 ? 507 ALA C O     1 
ATOM   6699 C  CB    . ALA B 2 530 ? 34.945  -17.606 78.482  1.00 200.90 ? 507 ALA C CB    1 
ATOM   6700 N  N     . ASP B 2 531 ? 37.988  -17.958 80.608  1.00 165.94 ? 508 ASP C N     1 
ATOM   6701 C  CA    . ASP B 2 531 ? 38.549  -18.863 81.610  1.00 165.80 ? 508 ASP C CA    1 
ATOM   6702 C  C     . ASP B 2 531 ? 38.962  -18.169 82.909  1.00 177.03 ? 508 ASP C C     1 
ATOM   6703 O  O     . ASP B 2 531 ? 38.650  -16.995 83.138  1.00 184.76 ? 508 ASP C O     1 
ATOM   6704 C  CB    . ASP B 2 531 ? 39.675  -19.778 81.052  1.00 114.78 ? 508 ASP C CB    1 
ATOM   6705 C  CG    . ASP B 2 531 ? 40.829  -19.013 80.368  1.00 102.92 ? 508 ASP C CG    1 
ATOM   6706 O  OD1   . ASP B 2 531 ? 41.077  -17.825 80.690  1.00 104.02 ? 508 ASP C OD1   1 
ATOM   6707 O  OD2   . ASP B 2 531 ? 41.503  -19.650 79.510  1.00 98.66  ? 508 ASP C OD2   1 
ATOM   6708 N  N     . THR B 2 532 ? 39.643  -18.924 83.765  1.00 179.22 ? 509 THR C N     1 
ATOM   6709 C  CA    . THR B 2 532 ? 40.117  -18.398 85.026  1.00 174.77 ? 509 THR C CA    1 
ATOM   6710 C  C     . THR B 2 532 ? 41.183  -17.338 84.812  1.00 181.53 ? 509 THR C C     1 
ATOM   6711 O  O     . THR B 2 532 ? 41.147  -16.281 85.443  1.00 171.33 ? 509 THR C O     1 
ATOM   6712 C  CB    . THR B 2 532 ? 40.655  -19.512 85.937  1.00 155.29 ? 509 THR C CB    1 
ATOM   6713 O  OG1   . THR B 2 532 ? 41.182  -20.575 85.135  1.00 155.64 ? 509 THR C OG1   1 
ATOM   6714 C  CG2   . THR B 2 532 ? 39.533  -20.062 86.809  1.00 142.38 ? 509 THR C CG2   1 
ATOM   6715 N  N     . ASP B 2 533 ? 42.124  -17.605 83.914  1.00 194.76 ? 510 ASP C N     1 
ATOM   6716 C  CA    . ASP B 2 533 ? 43.189  -16.640 83.659  1.00 194.20 ? 510 ASP C CA    1 
ATOM   6717 C  C     . ASP B 2 533 ? 42.708  -15.370 82.954  1.00 217.12 ? 510 ASP C C     1 
ATOM   6718 O  O     . ASP B 2 533 ? 43.303  -14.300 83.127  1.00 229.11 ? 510 ASP C O     1 
ATOM   6719 C  CB    . ASP B 2 533 ? 44.349  -17.281 82.910  1.00 157.02 ? 510 ASP C CB    1 
ATOM   6720 C  CG    . ASP B 2 533 ? 44.929  -18.465 83.654  1.00 119.99 ? 510 ASP C CG    1 
ATOM   6721 O  OD1   . ASP B 2 533 ? 45.707  -18.249 84.616  1.00 115.07 ? 510 ASP C OD1   1 
ATOM   6722 O  OD2   . ASP B 2 533 ? 44.593  -19.613 83.282  1.00 97.20  ? 510 ASP C OD2   1 
ATOM   6723 N  N     . GLY B 2 534 ? 41.631  -15.484 82.181  1.00 216.17 ? 511 GLY C N     1 
ATOM   6724 C  CA    . GLY B 2 534 ? 41.014  -14.318 81.564  1.00 208.40 ? 511 GLY C CA    1 
ATOM   6725 C  C     . GLY B 2 534 ? 40.387  -13.453 82.643  1.00 194.38 ? 511 GLY C C     1 
ATOM   6726 O  O     . GLY B 2 534 ? 40.466  -12.218 82.623  1.00 209.64 ? 511 GLY C O     1 
ATOM   6727 N  N     . ALA B 2 535 ? 39.755  -14.129 83.593  1.00 154.31 ? 512 ALA C N     1 
ATOM   6728 C  CA    . ALA B 2 535 ? 39.270  -13.481 84.790  1.00 112.52 ? 512 ALA C CA    1 
ATOM   6729 C  C     . ALA B 2 535 ? 40.417  -12.711 85.444  1.00 87.79  ? 512 ALA C C     1 
ATOM   6730 O  O     . ALA B 2 535 ? 40.302  -11.513 85.725  1.00 80.15  ? 512 ALA C O     1 
ATOM   6731 C  CB    . ALA B 2 535 ? 38.699  -14.512 85.744  1.00 103.36 ? 512 ALA C CB    1 
ATOM   6732 N  N     . HIS B 2 536 ? 41.534  -13.399 85.669  1.00 87.13  ? 513 HIS C N     1 
ATOM   6733 C  CA    . HIS B 2 536 ? 42.697  -12.768 86.282  1.00 84.78  ? 513 HIS C CA    1 
ATOM   6734 C  C     . HIS B 2 536 ? 43.138  -11.543 85.493  1.00 87.73  ? 513 HIS C C     1 
ATOM   6735 O  O     . HIS B 2 536 ? 43.358  -10.482 86.069  1.00 83.08  ? 513 HIS C O     1 
ATOM   6736 C  CB    . HIS B 2 536 ? 43.854  -13.759 86.414  1.00 88.19  ? 513 HIS C CB    1 
ATOM   6737 C  CG    . HIS B 2 536 ? 45.002  -13.242 87.223  1.00 99.64  ? 513 HIS C CG    1 
ATOM   6738 N  ND1   . HIS B 2 536 ? 46.302  -13.650 87.016  1.00 99.88  ? 513 HIS C ND1   1 
ATOM   6739 C  CD2   . HIS B 2 536 ? 45.046  -12.350 88.240  1.00 104.37 ? 513 HIS C CD2   1 
ATOM   6740 C  CE1   . HIS B 2 536 ? 47.097  -13.027 87.868  1.00 96.42  ? 513 HIS C CE1   1 
ATOM   6741 N  NE2   . HIS B 2 536 ? 46.359  -12.232 88.622  1.00 99.27  ? 513 HIS C NE2   1 
ATOM   6742 N  N     . ILE B 2 537 ? 43.260  -11.686 84.177  1.00 119.18 ? 514 ILE C N     1 
ATOM   6743 C  CA    . ILE B 2 537 ? 43.664  -10.562 83.340  1.00 153.23 ? 514 ILE C CA    1 
ATOM   6744 C  C     . ILE B 2 537 ? 42.704  -9.375  83.435  1.00 130.95 ? 514 ILE C C     1 
ATOM   6745 O  O     . ILE B 2 537 ? 43.148  -8.238  83.546  1.00 120.14 ? 514 ILE C O     1 
ATOM   6746 C  CB    . ILE B 2 537 ? 43.876  -10.986 81.884  1.00 202.62 ? 514 ILE C CB    1 
ATOM   6747 C  CG1   . ILE B 2 537 ? 45.260  -11.608 81.735  1.00 200.11 ? 514 ILE C CG1   1 
ATOM   6748 C  CG2   . ILE B 2 537 ? 43.726  -9.790  80.926  1.00 233.75 ? 514 ILE C CG2   1 
ATOM   6749 C  CD1   . ILE B 2 537 ? 45.311  -12.740 80.705  1.00 191.19 ? 514 ILE C CD1   1 
ATOM   6750 N  N     . GLN B 2 538 ? 41.399  -9.629  83.397  1.00 120.25 ? 515 GLN C N     1 
ATOM   6751 C  CA    . GLN B 2 538 ? 40.424  -8.552  83.527  1.00 110.05 ? 515 GLN C CA    1 
ATOM   6752 C  C     . GLN B 2 538 ? 40.688  -7.788  84.815  1.00 86.97  ? 515 GLN C C     1 
ATOM   6753 O  O     . GLN B 2 538 ? 40.517  -6.578  84.897  1.00 88.30  ? 515 GLN C O     1 
ATOM   6754 C  CB    . GLN B 2 538 ? 39.004  -9.108  83.569  1.00 126.11 ? 515 GLN C CB    1 
ATOM   6755 C  CG    . GLN B 2 538 ? 38.624  -9.990  82.403  1.00 134.87 ? 515 GLN C CG    1 
ATOM   6756 C  CD    . GLN B 2 538 ? 37.156  -10.361 82.442  1.00 144.48 ? 515 GLN C CD    1 
ATOM   6757 O  OE1   . GLN B 2 538 ? 36.407  -9.869  83.289  1.00 159.80 ? 515 GLN C OE1   1 
ATOM   6758 N  NE2   . GLN B 2 538 ? 36.736  -11.228 81.529  1.00 134.91 ? 515 GLN C NE2   1 
ATOM   6759 N  N     . THR B 2 539 ? 41.120  -8.523  85.822  1.00 84.77  ? 516 THR C N     1 
ATOM   6760 C  CA    . THR B 2 539 ? 41.341  -7.981  87.151  1.00 90.15  ? 516 THR C CA    1 
ATOM   6761 C  C     . THR B 2 539 ? 42.536  -7.034  87.220  1.00 91.65  ? 516 THR C C     1 
ATOM   6762 O  O     . THR B 2 539 ? 42.493  -6.023  87.913  1.00 94.30  ? 516 THR C O     1 
ATOM   6763 C  CB    . THR B 2 539 ? 41.554  -9.125  88.148  1.00 85.35  ? 516 THR C CB    1 
ATOM   6764 O  OG1   . THR B 2 539 ? 40.328  -9.384  88.838  1.00 87.99  ? 516 THR C OG1   1 
ATOM   6765 C  CG2   . THR B 2 539 ? 42.641  -8.779  89.129  1.00 86.23  ? 516 THR C CG2   1 
ATOM   6766 N  N     . LEU B 2 540 ? 43.600  -7.374  86.502  1.00 94.30  ? 517 LEU C N     1 
ATOM   6767 C  CA    . LEU B 2 540 ? 44.828  -6.589  86.520  1.00 110.79 ? 517 LEU C CA    1 
ATOM   6768 C  C     . LEU B 2 540 ? 44.710  -5.354  85.637  1.00 126.08 ? 517 LEU C C     1 
ATOM   6769 O  O     . LEU B 2 540 ? 45.427  -4.371  85.822  1.00 123.04 ? 517 LEU C O     1 
ATOM   6770 C  CB    . LEU B 2 540 ? 46.003  -7.453  86.065  1.00 107.66 ? 517 LEU C CB    1 
ATOM   6771 C  CG    . LEU B 2 540 ? 46.290  -8.658  86.963  1.00 98.42  ? 517 LEU C CG    1 
ATOM   6772 C  CD1   . LEU B 2 540 ? 46.605  -9.918  86.152  1.00 105.48 ? 517 LEU C CD1   1 
ATOM   6773 C  CD2   . LEU B 2 540 ? 47.407  -8.341  87.959  1.00 80.24  ? 517 LEU C CD2   1 
ATOM   6774 N  N     . LEU B 2 541 ? 43.805  -5.410  84.667  1.00 143.18 ? 518 LEU C N     1 
ATOM   6775 C  CA    . LEU B 2 541 ? 43.577  -4.266  83.801  1.00 159.94 ? 518 LEU C CA    1 
ATOM   6776 C  C     . LEU B 2 541 ? 42.633  -3.305  84.517  1.00 136.43 ? 518 LEU C C     1 
ATOM   6777 O  O     . LEU B 2 541 ? 42.898  -2.104  84.590  1.00 129.36 ? 518 LEU C O     1 
ATOM   6778 C  CB    . LEU B 2 541 ? 43.022  -4.688  82.430  1.00 207.10 ? 518 LEU C CB    1 
ATOM   6779 C  CG    . LEU B 2 541 ? 43.991  -5.259  81.384  1.00 254.61 ? 518 LEU C CG    1 
ATOM   6780 C  CD1   . LEU B 2 541 ? 43.227  -5.801  80.177  1.00 266.76 ? 518 LEU C CD1   1 
ATOM   6781 C  CD2   . LEU B 2 541 ? 45.031  -4.234  80.940  1.00 281.17 ? 518 LEU C CD2   1 
ATOM   6782 N  N     . LEU B 2 542 ? 41.543  -3.836  85.062  1.00 129.92 ? 519 LEU C N     1 
ATOM   6783 C  CA    . LEU B 2 542 ? 40.644  -3.005  85.861  1.00 137.93 ? 519 LEU C CA    1 
ATOM   6784 C  C     . LEU B 2 542 ? 41.395  -2.211  86.936  1.00 132.58 ? 519 LEU C C     1 
ATOM   6785 O  O     . LEU B 2 542 ? 41.154  -1.018  87.085  1.00 141.42 ? 519 LEU C O     1 
ATOM   6786 C  CB    . LEU B 2 542 ? 39.500  -3.820  86.471  1.00 157.21 ? 519 LEU C CB    1 
ATOM   6787 C  CG    . LEU B 2 542 ? 38.368  -4.209  85.511  1.00 179.68 ? 519 LEU C CG    1 
ATOM   6788 C  CD1   . LEU B 2 542 ? 37.176  -4.777  86.281  1.00 178.53 ? 519 LEU C CD1   1 
ATOM   6789 C  CD2   . LEU B 2 542 ? 37.946  -3.014  84.673  1.00 202.03 ? 519 LEU C CD2   1 
ATOM   6790 N  N     . THR B 2 543 ? 42.316  -2.840  87.668  1.00 122.02 ? 520 THR C N     1 
ATOM   6791 C  CA    . THR B 2 543 ? 43.049  -2.092  88.698  1.00 123.05 ? 520 THR C CA    1 
ATOM   6792 C  C     . THR B 2 543 ? 43.979  -1.014  88.127  1.00 131.43 ? 520 THR C C     1 
ATOM   6793 O  O     . THR B 2 543 ? 44.164  0.029   88.742  1.00 137.19 ? 520 THR C O     1 
ATOM   6794 C  CB    . THR B 2 543 ? 43.802  -2.986  89.744  1.00 122.15 ? 520 THR C CB    1 
ATOM   6795 O  OG1   . THR B 2 543 ? 45.212  -2.978  89.483  1.00 118.64 ? 520 THR C OG1   1 
ATOM   6796 C  CG2   . THR B 2 543 ? 43.256  -4.412  89.771  1.00 121.52 ? 520 THR C CG2   1 
ATOM   6797 N  N     . PHE B 2 544 ? 44.548  -1.248  86.952  1.00 134.70 ? 521 PHE C N     1 
ATOM   6798 C  CA    . PHE B 2 544 ? 45.326  -0.199  86.297  1.00 138.44 ? 521 PHE C CA    1 
ATOM   6799 C  C     . PHE B 2 544 ? 44.459  1.008   85.919  1.00 135.86 ? 521 PHE C C     1 
ATOM   6800 O  O     . PHE B 2 544 ? 44.831  2.152   86.196  1.00 126.27 ? 521 PHE C O     1 
ATOM   6801 C  CB    . PHE B 2 544 ? 46.040  -0.734  85.059  1.00 143.70 ? 521 PHE C CB    1 
ATOM   6802 C  CG    . PHE B 2 544 ? 46.502  0.343   84.106  1.00 148.42 ? 521 PHE C CG    1 
ATOM   6803 C  CD1   . PHE B 2 544 ? 45.790  0.612   82.943  1.00 142.52 ? 521 PHE C CD1   1 
ATOM   6804 C  CD2   . PHE B 2 544 ? 47.650  1.077   84.367  1.00 156.76 ? 521 PHE C CD2   1 
ATOM   6805 C  CE1   . PHE B 2 544 ? 46.212  1.597   82.055  1.00 140.49 ? 521 PHE C CE1   1 
ATOM   6806 C  CE2   . PHE B 2 544 ? 48.080  2.058   83.482  1.00 155.17 ? 521 PHE C CE2   1 
ATOM   6807 C  CZ    . PHE B 2 544 ? 47.357  2.319   82.322  1.00 145.84 ? 521 PHE C CZ    1 
ATOM   6808 N  N     . PHE B 2 545 ? 43.310  0.748   85.294  1.00 145.25 ? 522 PHE C N     1 
ATOM   6809 C  CA    . PHE B 2 545 ? 42.419  1.817   84.827  1.00 157.65 ? 522 PHE C CA    1 
ATOM   6810 C  C     . PHE B 2 545 ? 41.805  2.605   85.984  1.00 157.19 ? 522 PHE C C     1 
ATOM   6811 O  O     . PHE B 2 545 ? 41.493  3.794   85.855  1.00 147.16 ? 522 PHE C O     1 
ATOM   6812 C  CB    . PHE B 2 545 ? 41.318  1.254   83.922  1.00 174.47 ? 522 PHE C CB    1 
ATOM   6813 C  CG    . PHE B 2 545 ? 41.805  0.836   82.559  1.00 193.86 ? 522 PHE C CG    1 
ATOM   6814 C  CD1   . PHE B 2 545 ? 42.624  1.669   81.813  1.00 205.12 ? 522 PHE C CD1   1 
ATOM   6815 C  CD2   . PHE B 2 545 ? 41.455  -0.398  82.029  1.00 205.61 ? 522 PHE C CD2   1 
ATOM   6816 C  CE1   . PHE B 2 545 ? 43.078  1.285   80.556  1.00 215.75 ? 522 PHE C CE1   1 
ATOM   6817 C  CE2   . PHE B 2 545 ? 41.905  -0.789  80.780  1.00 217.09 ? 522 PHE C CE2   1 
ATOM   6818 C  CZ    . PHE B 2 545 ? 42.717  0.056   80.040  1.00 220.89 ? 522 PHE C CZ    1 
ATOM   6819 N  N     . TYR B 2 546 ? 41.635  1.928   87.113  1.00 173.86 ? 523 TYR C N     1 
ATOM   6820 C  CA    . TYR B 2 546 ? 41.135  2.567   88.317  1.00 191.84 ? 523 TYR C CA    1 
ATOM   6821 C  C     . TYR B 2 546 ? 42.241  3.411   88.942  1.00 174.70 ? 523 TYR C C     1 
ATOM   6822 O  O     . TYR B 2 546 ? 42.057  4.601   89.176  1.00 167.66 ? 523 TYR C O     1 
ATOM   6823 C  CB    . TYR B 2 546 ? 40.615  1.515   89.298  1.00 215.44 ? 523 TYR C CB    1 
ATOM   6824 C  CG    . TYR B 2 546 ? 40.219  2.057   90.646  1.00 220.09 ? 523 TYR C CG    1 
ATOM   6825 C  CD1   . TYR B 2 546 ? 39.122  2.897   90.789  1.00 219.42 ? 523 TYR C CD1   1 
ATOM   6826 C  CD2   . TYR B 2 546 ? 40.934  1.715   91.786  1.00 211.27 ? 523 TYR C CD2   1 
ATOM   6827 C  CE1   . TYR B 2 546 ? 38.754  3.390   92.038  1.00 209.74 ? 523 TYR C CE1   1 
ATOM   6828 C  CE2   . TYR B 2 546 ? 40.576  2.201   93.034  1.00 201.79 ? 523 TYR C CE2   1 
ATOM   6829 C  CZ    . TYR B 2 546 ? 39.489  3.036   93.155  1.00 197.60 ? 523 TYR C CZ    1 
ATOM   6830 O  OH    . TYR B 2 546 ? 39.140  3.507   94.396  1.00 189.39 ? 523 TYR C OH    1 
ATOM   6831 N  N     . ARG B 2 547 ? 43.399  2.802   89.178  1.00 162.82 ? 524 ARG C N     1 
ATOM   6832 C  CA    . ARG B 2 547 ? 44.505  3.516   89.812  1.00 149.58 ? 524 ARG C CA    1 
ATOM   6833 C  C     . ARG B 2 547 ? 45.046  4.663   88.959  1.00 125.03 ? 524 ARG C C     1 
ATOM   6834 O  O     . ARG B 2 547 ? 45.495  5.666   89.499  1.00 133.36 ? 524 ARG C O     1 
ATOM   6835 C  CB    . ARG B 2 547 ? 45.650  2.563   90.199  1.00 161.91 ? 524 ARG C CB    1 
ATOM   6836 C  CG    . ARG B 2 547 ? 45.351  1.597   91.367  1.00 167.42 ? 524 ARG C CG    1 
ATOM   6837 C  CD    . ARG B 2 547 ? 45.304  2.295   92.746  1.00 174.00 ? 524 ARG C CD    1 
ATOM   6838 N  NE    . ARG B 2 547 ? 46.550  2.239   93.525  1.00 181.16 ? 524 ARG C NE    1 
ATOM   6839 C  CZ    . ARG B 2 547 ? 47.703  1.726   93.099  1.00 187.28 ? 524 ARG C CZ    1 
ATOM   6840 N  NH1   . ARG B 2 547 ? 47.802  1.205   91.883  1.00 177.56 ? 524 ARG C NH1   1 
ATOM   6841 N  NH2   . ARG B 2 547 ? 48.767  1.731   93.892  1.00 201.20 ? 524 ARG C NH2   1 
ATOM   6842 N  N     . TYR B 2 548 ? 44.996  4.541   87.637  1.00 120.48 ? 525 TYR C N     1 
ATOM   6843 C  CA    . TYR B 2 548 ? 45.759  5.475   86.809  1.00 122.08 ? 525 TYR C CA    1 
ATOM   6844 C  C     . TYR B 2 548 ? 45.008  6.213   85.689  1.00 120.05 ? 525 TYR C C     1 
ATOM   6845 O  O     . TYR B 2 548 ? 45.590  7.065   85.014  1.00 121.17 ? 525 TYR C O     1 
ATOM   6846 C  CB    . TYR B 2 548 ? 47.027  4.785   86.281  1.00 124.68 ? 525 TYR C CB    1 
ATOM   6847 C  CG    . TYR B 2 548 ? 48.067  4.519   87.359  1.00 127.22 ? 525 TYR C CG    1 
ATOM   6848 C  CD1   . TYR B 2 548 ? 47.931  3.455   88.239  1.00 132.07 ? 525 TYR C CD1   1 
ATOM   6849 C  CD2   . TYR B 2 548 ? 49.183  5.339   87.493  1.00 131.30 ? 525 TYR C CD2   1 
ATOM   6850 C  CE1   . TYR B 2 548 ? 48.877  3.220   89.227  1.00 140.55 ? 525 TYR C CE1   1 
ATOM   6851 C  CE2   . TYR B 2 548 ? 50.133  5.113   88.472  1.00 136.20 ? 525 TYR C CE2   1 
ATOM   6852 C  CZ    . TYR B 2 548 ? 49.978  4.054   89.339  1.00 144.70 ? 525 TYR C CZ    1 
ATOM   6853 O  OH    . TYR B 2 548 ? 50.927  3.831   90.316  1.00 149.10 ? 525 TYR C OH    1 
ATOM   6854 N  N     . MET B 2 549 ? 43.728  5.896   85.503  1.00 120.63 ? 526 MET C N     1 
ATOM   6855 C  CA    . MET B 2 549 ? 42.889  6.563   84.494  1.00 122.04 ? 526 MET C CA    1 
ATOM   6856 C  C     . MET B 2 549 ? 41.448  6.628   84.972  1.00 124.46 ? 526 MET C C     1 
ATOM   6857 O  O     . MET B 2 549 ? 40.513  6.474   84.173  1.00 138.01 ? 526 MET C O     1 
ATOM   6858 C  CB    . MET B 2 549 ? 42.899  5.808   83.165  1.00 116.62 ? 526 MET C CB    1 
ATOM   6859 C  CG    . MET B 2 549 ? 44.202  5.827   82.403  1.00 116.29 ? 526 MET C CG    1 
ATOM   6860 S  SD    . MET B 2 549 ? 43.980  5.018   80.801  1.00 154.07 ? 526 MET C SD    1 
ATOM   6861 C  CE    . MET B 2 549 ? 42.362  5.647   80.330  1.00 222.23 ? 526 MET C CE    1 
ATOM   6862 N  N     . ARG B 2 550 ? 41.285  6.860   86.273  1.00 130.03 ? 527 ARG C N     1 
ATOM   6863 C  CA    . ARG B 2 550 ? 39.990  6.777   86.942  1.00 128.70 ? 527 ARG C CA    1 
ATOM   6864 C  C     . ARG B 2 550 ? 38.834  7.439   86.186  1.00 141.14 ? 527 ARG C C     1 
ATOM   6865 O  O     . ARG B 2 550 ? 37.734  6.891   86.136  1.00 142.71 ? 527 ARG C O     1 
ATOM   6866 C  CB    . ARG B 2 550 ? 40.092  7.316   88.376  1.00 122.03 ? 527 ARG C CB    1 
ATOM   6867 N  N     . PRO B 2 551 ? 39.078  8.618   85.589  1.00 151.45 ? 528 PRO C N     1 
ATOM   6868 C  CA    . PRO B 2 551 ? 38.013  9.258   84.806  1.00 159.12 ? 528 PRO C CA    1 
ATOM   6869 C  C     . PRO B 2 551 ? 37.423  8.340   83.732  1.00 180.61 ? 528 PRO C C     1 
ATOM   6870 O  O     . PRO B 2 551 ? 36.198  8.316   83.585  1.00 180.99 ? 528 PRO C O     1 
ATOM   6871 C  CB    . PRO B 2 551 ? 38.711  10.472  84.164  1.00 153.69 ? 528 PRO C CB    1 
ATOM   6872 C  CG    . PRO B 2 551 ? 40.184  10.251  84.368  1.00 151.52 ? 528 PRO C CG    1 
ATOM   6873 C  CD    . PRO B 2 551 ? 40.307  9.426   85.613  1.00 152.22 ? 528 PRO C CD    1 
ATOM   6874 N  N     . LEU B 2 552 ? 38.265  7.599   83.006  1.00 206.69 ? 529 LEU C N     1 
ATOM   6875 C  CA    . LEU B 2 552 ? 37.774  6.740   81.931  1.00 235.83 ? 529 LEU C CA    1 
ATOM   6876 C  C     . LEU B 2 552 ? 36.807  5.706   82.495  1.00 232.92 ? 529 LEU C C     1 
ATOM   6877 O  O     . LEU B 2 552 ? 35.767  5.428   81.899  1.00 239.46 ? 529 LEU C O     1 
ATOM   6878 C  CB    . LEU B 2 552 ? 38.924  6.080   81.153  1.00 255.28 ? 529 LEU C CB    1 
ATOM   6879 N  N     . VAL B 2 553 ? 37.137  5.155   83.660  1.00 213.50 ? 530 VAL C N     1 
ATOM   6880 C  CA    . VAL B 2 553 ? 36.256  4.188   84.310  1.00 185.20 ? 530 VAL C CA    1 
ATOM   6881 C  C     . VAL B 2 553 ? 35.060  4.899   84.950  1.00 161.20 ? 530 VAL C C     1 
ATOM   6882 O  O     . VAL B 2 553 ? 34.006  4.294   85.155  1.00 159.80 ? 530 VAL C O     1 
ATOM   6883 C  CB    . VAL B 2 553 ? 37.009  3.304   85.359  1.00 114.43 ? 530 VAL C CB    1 
ATOM   6884 N  N     . GLU B 2 554 ? 35.223  6.189   85.246  1.00 161.25 ? 531 GLU C N     1 
ATOM   6885 C  CA    . GLU B 2 554 ? 34.165  6.981   85.878  1.00 164.85 ? 531 GLU C CA    1 
ATOM   6886 C  C     . GLU B 2 554 ? 33.131  7.487   84.863  1.00 172.03 ? 531 GLU C C     1 
ATOM   6887 O  O     . GLU B 2 554 ? 31.957  7.650   85.192  1.00 172.66 ? 531 GLU C O     1 
ATOM   6888 C  CB    . GLU B 2 554 ? 34.752  8.152   86.681  1.00 162.02 ? 531 GLU C CB    1 
ATOM   6889 N  N     . ALA B 2 555 ? 33.570  7.730   83.633  1.00 193.10 ? 532 ALA C N     1 
ATOM   6890 C  CA    . ALA B 2 555 ? 32.656  8.115   82.563  1.00 209.01 ? 532 ALA C CA    1 
ATOM   6891 C  C     . ALA B 2 555 ? 32.042  6.895   81.872  1.00 197.55 ? 532 ALA C C     1 
ATOM   6892 O  O     . ALA B 2 555 ? 31.459  7.015   80.792  1.00 197.50 ? 532 ALA C O     1 
ATOM   6893 C  CB    . ALA B 2 555 ? 33.366  8.999   81.545  1.00 219.91 ? 532 ALA C CB    1 
ATOM   6894 N  N     . GLY B 2 556 ? 32.184  5.724   82.494  1.00 178.54 ? 533 GLY C N     1 
ATOM   6895 C  CA    . GLY B 2 556 ? 31.608  4.489   81.979  1.00 155.44 ? 533 GLY C CA    1 
ATOM   6896 C  C     . GLY B 2 556 ? 32.125  4.122   80.602  1.00 145.54 ? 533 GLY C C     1 
ATOM   6897 O  O     . GLY B 2 556 ? 31.381  3.618   79.756  1.00 137.88 ? 533 GLY C O     1 
ATOM   6898 N  N     . HIS B 2 557 ? 33.412  4.373   80.392  1.00 142.44 ? 534 HIS C N     1 
ATOM   6899 C  CA    . HIS B 2 557 ? 34.067  4.146   79.110  1.00 149.60 ? 534 HIS C CA    1 
ATOM   6900 C  C     . HIS B 2 557 ? 34.742  2.770   78.981  1.00 140.67 ? 534 HIS C C     1 
ATOM   6901 O  O     . HIS B 2 557 ? 35.035  2.323   77.874  1.00 120.73 ? 534 HIS C O     1 
ATOM   6902 C  CB    . HIS B 2 557 ? 35.092  5.252   78.862  1.00 168.31 ? 534 HIS C CB    1 
ATOM   6903 C  CG    . HIS B 2 557 ? 34.489  6.524   78.359  1.00 175.16 ? 534 HIS C CG    1 
ATOM   6904 N  ND1   . HIS B 2 557 ? 33.501  6.546   77.398  1.00 167.25 ? 534 HIS C ND1   1 
ATOM   6905 C  CD2   . HIS B 2 557 ? 34.729  7.817   78.683  1.00 181.59 ? 534 HIS C CD2   1 
ATOM   6906 C  CE1   . HIS B 2 557 ? 33.162  7.799   77.147  1.00 169.94 ? 534 HIS C CE1   1 
ATOM   6907 N  NE2   . HIS B 2 557 ? 33.891  8.590   77.913  1.00 178.78 ? 534 HIS C NE2   1 
ATOM   6908 N  N     . VAL B 2 558 ? 34.982  2.104   80.108  1.00 154.02 ? 535 VAL C N     1 
ATOM   6909 C  CA    . VAL B 2 558 ? 35.675  0.823   80.102  1.00 153.38 ? 535 VAL C CA    1 
ATOM   6910 C  C     . VAL B 2 558 ? 34.675  -0.337  80.144  1.00 139.28 ? 535 VAL C C     1 
ATOM   6911 O  O     . VAL B 2 558 ? 33.753  -0.339  80.955  1.00 125.27 ? 535 VAL C O     1 
ATOM   6912 C  CB    . VAL B 2 558 ? 36.682  0.714   81.277  1.00 174.35 ? 535 VAL C CB    1 
ATOM   6913 C  CG1   . VAL B 2 558 ? 37.554  -0.507  81.107  1.00 158.64 ? 535 VAL C CG1   1 
ATOM   6914 C  CG2   . VAL B 2 558 ? 37.560  1.946   81.349  1.00 185.84 ? 535 VAL C CG2   1 
ATOM   6915 N  N     . TYR B 2 559 ? 34.860  -1.316  79.263  1.00 137.52 ? 536 TYR C N     1 
ATOM   6916 C  CA    . TYR B 2 559 ? 33.927  -2.436  79.150  1.00 139.25 ? 536 TYR C CA    1 
ATOM   6917 C  C     . TYR B 2 559 ? 34.615  -3.796  79.199  1.00 161.06 ? 536 TYR C C     1 
ATOM   6918 O  O     . TYR B 2 559 ? 35.836  -3.905  79.332  1.00 159.78 ? 536 TYR C O     1 
ATOM   6919 C  CB    . TYR B 2 559 ? 33.133  -2.361  77.840  1.00 128.60 ? 536 TYR C CB    1 
ATOM   6920 C  CG    . TYR B 2 559 ? 32.393  -1.068  77.602  1.00 134.15 ? 536 TYR C CG    1 
ATOM   6921 C  CD1   . TYR B 2 559 ? 31.021  -1.060  77.392  1.00 133.13 ? 536 TYR C CD1   1 
ATOM   6922 C  CD2   . TYR B 2 559 ? 33.067  0.147   77.571  1.00 136.55 ? 536 TYR C CD2   1 
ATOM   6923 C  CE1   . TYR B 2 559 ? 30.343  0.125   77.161  1.00 136.83 ? 536 TYR C CE1   1 
ATOM   6924 C  CE2   . TYR B 2 559 ? 32.398  1.333   77.345  1.00 138.25 ? 536 TYR C CE2   1 
ATOM   6925 C  CZ    . TYR B 2 559 ? 31.038  1.319   77.140  1.00 137.70 ? 536 TYR C CZ    1 
ATOM   6926 O  OH    . TYR B 2 559 ? 30.377  2.504   76.913  1.00 138.80 ? 536 TYR C OH    1 
ATOM   6927 N  N     . ILE B 2 560 ? 33.806  -4.833  79.053  1.00 179.97 ? 537 ILE C N     1 
ATOM   6928 C  CA    . ILE B 2 560 ? 34.272  -6.197  79.128  1.00 179.64 ? 537 ILE C CA    1 
ATOM   6929 C  C     . ILE B 2 560 ? 33.383  -7.016  78.211  1.00 167.51 ? 537 ILE C C     1 
ATOM   6930 O  O     . ILE B 2 560 ? 32.185  -7.145  78.459  1.00 159.88 ? 537 ILE C O     1 
ATOM   6931 C  CB    . ILE B 2 560 ? 34.167  -6.742  80.580  1.00 175.19 ? 537 ILE C CB    1 
ATOM   6932 C  CG1   . ILE B 2 560 ? 35.014  -5.894  81.528  1.00 189.52 ? 537 ILE C CG1   1 
ATOM   6933 C  CG2   . ILE B 2 560 ? 34.619  -8.195  80.647  1.00 162.81 ? 537 ILE C CG2   1 
ATOM   6934 C  CD1   . ILE B 2 560 ? 34.859  -6.262  83.018  1.00 200.45 ? 537 ILE C CD1   1 
ATOM   6935 N  N     . ALA B 2 561 ? 33.956  -7.552  77.139  1.00 162.51 ? 538 ALA C N     1 
ATOM   6936 C  CA    . ALA B 2 561 ? 33.176  -8.359  76.212  1.00 158.72 ? 538 ALA C CA    1 
ATOM   6937 C  C     . ALA B 2 561 ? 32.779  -9.631  76.923  1.00 138.93 ? 538 ALA C C     1 
ATOM   6938 O  O     . ALA B 2 561 ? 33.388  -9.999  77.919  1.00 135.07 ? 538 ALA C O     1 
ATOM   6939 C  CB    . ALA B 2 561 ? 33.972  -8.677  74.958  1.00 166.07 ? 538 ALA C CB    1 
ATOM   6940 N  N     . PRO B 2 563 ? 30.827  -14.256 75.075  1.00 136.65 ? 540 PRO C N     1 
ATOM   6941 C  CA    . PRO B 2 563 ? 30.771  -15.367 74.121  1.00 138.83 ? 540 PRO C CA    1 
ATOM   6942 C  C     . PRO B 2 563 ? 29.761  -16.397 74.602  1.00 142.20 ? 540 PRO C C     1 
ATOM   6943 O  O     . PRO B 2 563 ? 29.506  -16.477 75.806  1.00 144.92 ? 540 PRO C O     1 
ATOM   6944 C  CB    . PRO B 2 563 ? 32.187  -15.952 74.175  1.00 134.35 ? 540 PRO C CB    1 
ATOM   6945 C  CG    . PRO B 2 563 ? 33.035  -14.857 74.730  1.00 133.62 ? 540 PRO C CG    1 
ATOM   6946 C  CD    . PRO B 2 563 ? 32.157  -14.116 75.689  1.00 133.06 ? 540 PRO C CD    1 
ATOM   6947 N  N     . PRO B 2 564 ? 29.186  -17.172 73.671  1.00 165.80 ? 541 PRO C N     1 
ATOM   6948 C  CA    . PRO B 2 564 ? 28.157  -18.168 73.992  1.00 170.48 ? 541 PRO C CA    1 
ATOM   6949 C  C     . PRO B 2 564 ? 28.736  -19.389 74.702  1.00 149.69 ? 541 PRO C C     1 
ATOM   6950 O  O     . PRO B 2 564 ? 29.898  -19.727 74.476  1.00 143.77 ? 541 PRO C O     1 
ATOM   6951 C  CB    . PRO B 2 564 ? 27.618  -18.563 72.612  1.00 194.83 ? 541 PRO C CB    1 
ATOM   6952 C  CG    . PRO B 2 564 ? 28.758  -18.327 71.684  1.00 202.60 ? 541 PRO C CG    1 
ATOM   6953 C  CD    . PRO B 2 564 ? 29.485  -17.124 72.228  1.00 190.01 ? 541 PRO C CD    1 
ATOM   6954 N  N     . LEU B 2 565 ? 27.934  -20.037 75.544  1.00 144.11 ? 542 LEU C N     1 
ATOM   6955 C  CA    . LEU B 2 565 ? 28.354  -21.255 76.234  1.00 153.87 ? 542 LEU C CA    1 
ATOM   6956 C  C     . LEU B 2 565 ? 27.950  -22.516 75.457  1.00 210.69 ? 542 LEU C C     1 
ATOM   6957 O  O     . LEU B 2 565 ? 28.634  -23.541 75.525  1.00 215.96 ? 542 LEU C O     1 
ATOM   6958 C  CB    . LEU B 2 565 ? 27.783  -21.296 77.656  1.00 123.66 ? 542 LEU C CB    1 
ATOM   6959 C  CG    . LEU B 2 565 ? 28.279  -20.242 78.649  1.00 106.99 ? 542 LEU C CG    1 
ATOM   6960 N  N     . TYR B 2 566 ? 26.853  -22.429 74.708  1.00 261.11 ? 543 TYR C N     1 
ATOM   6961 C  CA    . TYR B 2 566 ? 26.258  -23.612 74.082  1.00 301.04 ? 543 TYR C CA    1 
ATOM   6962 C  C     . TYR B 2 566 ? 25.862  -23.434 72.604  1.00 301.87 ? 543 TYR C C     1 
ATOM   6963 O  O     . TYR B 2 566 ? 25.654  -22.313 72.135  1.00 322.36 ? 543 TYR C O     1 
ATOM   6964 C  CB    . TYR B 2 566 ? 25.032  -24.068 74.883  1.00 317.07 ? 543 TYR C CB    1 
ATOM   6965 C  CG    . TYR B 2 566 ? 25.278  -24.300 76.360  1.00 296.24 ? 543 TYR C CG    1 
ATOM   6966 C  CD1   . TYR B 2 566 ? 25.930  -25.444 76.806  1.00 288.28 ? 543 TYR C CD1   1 
ATOM   6967 C  CD2   . TYR B 2 566 ? 24.839  -23.387 77.309  1.00 260.47 ? 543 TYR C CD2   1 
ATOM   6968 C  CE1   . TYR B 2 566 ? 26.151  -25.665 78.158  1.00 255.96 ? 543 TYR C CE1   1 
ATOM   6969 C  CE2   . TYR B 2 566 ? 25.054  -23.596 78.665  1.00 228.11 ? 543 TYR C CE2   1 
ATOM   6970 C  CZ    . TYR B 2 566 ? 25.711  -24.737 79.086  1.00 219.03 ? 543 TYR C CZ    1 
ATOM   6971 O  OH    . TYR B 2 566 ? 25.923  -24.955 80.435  1.00 191.09 ? 543 TYR C OH    1 
ATOM   6972 N  N     . LYS B 2 567 ? 25.748  -24.559 71.891  1.00 263.07 ? 544 LYS C N     1 
ATOM   6973 C  CA    . LYS B 2 567 ? 25.323  -24.580 70.486  1.00 215.47 ? 544 LYS C CA    1 
ATOM   6974 C  C     . LYS B 2 567 ? 24.023  -25.371 70.278  1.00 219.01 ? 544 LYS C C     1 
ATOM   6975 O  O     . LYS B 2 567 ? 24.028  -26.508 69.796  1.00 221.14 ? 544 LYS C O     1 
ATOM   6976 C  CB    . LYS B 2 567 ? 26.435  -25.141 69.589  1.00 177.11 ? 544 LYS C CB    1 
ATOM   6977 N  N     . ALA B 2 579 ? 21.602  -22.622 66.519  1.00 216.02 ? 556 ALA C N     1 
ATOM   6978 C  CA    . ALA B 2 579 ? 21.002  -22.057 67.730  1.00 222.11 ? 556 ALA C CA    1 
ATOM   6979 C  C     . ALA B 2 579 ? 21.985  -22.015 68.906  1.00 229.99 ? 556 ALA C C     1 
ATOM   6980 O  O     . ALA B 2 579 ? 22.580  -23.035 69.263  1.00 225.97 ? 556 ALA C O     1 
ATOM   6981 C  CB    . ALA B 2 579 ? 19.741  -22.834 68.117  1.00 223.78 ? 556 ALA C CB    1 
ATOM   6982 N  N     . TYR B 2 580 ? 22.136  -20.834 69.506  1.00 246.14 ? 557 TYR C N     1 
ATOM   6983 C  CA    . TYR B 2 580 ? 23.075  -20.628 70.610  1.00 259.33 ? 557 TYR C CA    1 
ATOM   6984 C  C     . TYR B 2 580 ? 22.357  -20.250 71.894  1.00 292.82 ? 557 TYR C C     1 
ATOM   6985 O  O     . TYR B 2 580 ? 21.225  -19.772 71.853  1.00 310.18 ? 557 TYR C O     1 
ATOM   6986 C  CB    . TYR B 2 580 ? 24.068  -19.523 70.255  1.00 228.85 ? 557 TYR C CB    1 
ATOM   6987 C  CG    . TYR B 2 580 ? 24.861  -19.814 69.009  1.00 191.63 ? 557 TYR C CG    1 
ATOM   6988 C  CD1   . TYR B 2 580 ? 24.371  -19.473 67.752  1.00 185.06 ? 557 TYR C CD1   1 
ATOM   6989 C  CD2   . TYR B 2 580 ? 26.098  -20.444 69.086  1.00 164.43 ? 557 TYR C CD2   1 
ATOM   6990 C  CE1   . TYR B 2 580 ? 25.098  -19.745 66.604  1.00 176.92 ? 557 TYR C CE1   1 
ATOM   6991 C  CE2   . TYR B 2 580 ? 26.830  -20.722 67.952  1.00 157.02 ? 557 TYR C CE2   1 
ATOM   6992 C  CZ    . TYR B 2 580 ? 26.329  -20.371 66.712  1.00 168.37 ? 557 TYR C CZ    1 
ATOM   6993 O  OH    . TYR B 2 580 ? 27.071  -20.654 65.587  1.00 174.02 ? 557 TYR C OH    1 
ATOM   6994 N  N     . ALA B 2 581 ? 23.026  -20.453 73.029  1.00 293.63 ? 558 ALA C N     1 
ATOM   6995 C  CA    . ALA B 2 581 ? 22.493  -20.077 74.341  1.00 281.14 ? 558 ALA C CA    1 
ATOM   6996 C  C     . ALA B 2 581 ? 23.618  -19.706 75.302  1.00 259.84 ? 558 ALA C C     1 
ATOM   6997 O  O     . ALA B 2 581 ? 24.732  -20.207 75.178  1.00 267.10 ? 558 ALA C O     1 
ATOM   6998 C  CB    . ALA B 2 581 ? 21.657  -21.208 74.930  1.00 282.10 ? 558 ALA C CB    1 
ATOM   6999 N  N     . TRP B 2 582 ? 23.314  -18.834 76.262  1.00 224.04 ? 559 TRP C N     1 
ATOM   7000 C  CA    . TRP B 2 582 ? 24.301  -18.389 77.244  1.00 183.47 ? 559 TRP C CA    1 
ATOM   7001 C  C     . TRP B 2 582 ? 23.988  -18.919 78.640  1.00 171.75 ? 559 TRP C C     1 
ATOM   7002 O  O     . TRP B 2 582 ? 24.895  -19.188 79.431  1.00 169.87 ? 559 TRP C O     1 
ATOM   7003 C  CB    . TRP B 2 582 ? 24.373  -16.860 77.279  1.00 173.03 ? 559 TRP C CB    1 
ATOM   7004 C  CG    . TRP B 2 582 ? 24.975  -16.249 76.044  1.00 168.48 ? 559 TRP C CG    1 
ATOM   7005 C  CD1   . TRP B 2 582 ? 26.160  -15.573 75.956  1.00 154.01 ? 559 TRP C CD1   1 
ATOM   7006 C  CD2   . TRP B 2 582 ? 24.423  -16.265 74.723  1.00 181.30 ? 559 TRP C CD2   1 
ATOM   7007 N  NE1   . TRP B 2 582 ? 26.378  -15.165 74.662  1.00 154.83 ? 559 TRP C NE1   1 
ATOM   7008 C  CE2   . TRP B 2 582 ? 25.329  -15.579 73.884  1.00 170.94 ? 559 TRP C CE2   1 
ATOM   7009 C  CE3   . TRP B 2 582 ? 23.253  -16.793 74.167  1.00 199.90 ? 559 TRP C CE3   1 
ATOM   7010 C  CZ2   . TRP B 2 582 ? 25.097  -15.407 72.518  1.00 179.89 ? 559 TRP C CZ2   1 
ATOM   7011 C  CZ3   . TRP B 2 582 ? 23.027  -16.624 72.814  1.00 204.39 ? 559 TRP C CZ3   1 
ATOM   7012 C  CH2   . TRP B 2 582 ? 23.945  -15.935 72.004  1.00 194.19 ? 559 TRP C CH2   1 
ATOM   7013 N  N     . THR B 2 583 ? 22.698  -19.061 78.938  1.00 186.88 ? 560 THR C N     1 
ATOM   7014 C  CA    . THR B 2 583 ? 22.243  -19.535 80.242  1.00 193.19 ? 560 THR C CA    1 
ATOM   7015 C  C     . THR B 2 583 ? 21.939  -21.034 80.217  1.00 202.18 ? 560 THR C C     1 
ATOM   7016 O  O     . THR B 2 583 ? 21.637  -21.594 79.163  1.00 206.47 ? 560 THR C O     1 
ATOM   7017 C  CB    . THR B 2 583 ? 20.978  -18.775 80.699  1.00 194.57 ? 560 THR C CB    1 
ATOM   7018 N  N     . ASP B 2 584 ? 22.025  -21.683 81.374  1.00 204.40 ? 561 ASP C N     1 
ATOM   7019 C  CA    . ASP B 2 584 ? 21.641  -23.085 81.473  1.00 204.85 ? 561 ASP C CA    1 
ATOM   7020 C  C     . ASP B 2 584 ? 20.141  -23.205 81.208  1.00 207.20 ? 561 ASP C C     1 
ATOM   7021 O  O     . ASP B 2 584 ? 19.637  -24.286 80.889  1.00 208.00 ? 561 ASP C O     1 
ATOM   7022 C  CB    . ASP B 2 584 ? 22.000  -23.654 82.847  1.00 204.60 ? 561 ASP C CB    1 
ATOM   7023 N  N     . GLY B 2 585 ? 19.440  -22.079 81.330  1.00 205.18 ? 562 GLY C N     1 
ATOM   7024 C  CA    . GLY B 2 585 ? 18.016  -22.017 81.057  1.00 206.02 ? 562 GLY C CA    1 
ATOM   7025 C  C     . GLY B 2 585 ? 17.687  -21.897 79.578  1.00 202.91 ? 562 GLY C C     1 
ATOM   7026 O  O     . GLY B 2 585 ? 16.660  -22.407 79.129  1.00 202.72 ? 562 GLY C O     1 
ATOM   7027 N  N     . GLU B 2 586 ? 18.558  -21.229 78.821  1.00 200.67 ? 563 GLU C N     1 
ATOM   7028 C  CA    . GLU B 2 586 ? 18.342  -20.999 77.386  1.00 202.10 ? 563 GLU C CA    1 
ATOM   7029 C  C     . GLU B 2 586 ? 18.535  -22.256 76.531  1.00 202.34 ? 563 GLU C C     1 
ATOM   7030 O  O     . GLU B 2 586 ? 18.046  -22.328 75.402  1.00 200.10 ? 563 GLU C O     1 
ATOM   7031 C  CB    . GLU B 2 586 ? 19.243  -19.867 76.869  1.00 193.67 ? 563 GLU C CB    1 
ATOM   7032 N  N     . LEU B 2 587 ? 19.250  -23.241 77.071  1.00 201.95 ? 564 LEU C N     1 
ATOM   7033 C  CA    . LEU B 2 587 ? 19.459  -24.507 76.375  1.00 200.91 ? 564 LEU C CA    1 
ATOM   7034 C  C     . LEU B 2 587 ? 18.244  -25.433 76.499  1.00 214.77 ? 564 LEU C C     1 
ATOM   7035 O  O     . LEU B 2 587 ? 18.032  -26.304 75.655  1.00 220.25 ? 564 LEU C O     1 
ATOM   7036 C  CB    . LEU B 2 587 ? 20.728  -25.204 76.882  1.00 188.89 ? 564 LEU C CB    1 
ATOM   7037 N  N     . GLU B 2 588 ? 17.443  -25.243 77.547  1.00 219.32 ? 565 GLU C N     1 
ATOM   7038 C  CA    . GLU B 2 588 ? 16.242  -26.052 77.751  1.00 220.78 ? 565 GLU C CA    1 
ATOM   7039 C  C     . GLU B 2 588 ? 15.083  -25.565 76.877  1.00 228.27 ? 565 GLU C C     1 
ATOM   7040 O  O     . GLU B 2 588 ? 14.152  -26.322 76.588  1.00 234.01 ? 565 GLU C O     1 
ATOM   7041 C  CB    . GLU B 2 588 ? 15.836  -26.065 79.227  1.00 216.77 ? 565 GLU C CB    1 
ATOM   7042 N  N     . GLU B 2 589 ? 15.151  -24.300 76.460  1.00 226.21 ? 566 GLU C N     1 
ATOM   7043 C  CA    . GLU B 2 589 ? 14.175  -23.726 75.532  1.00 227.44 ? 566 GLU C CA    1 
ATOM   7044 C  C     . GLU B 2 589 ? 14.503  -24.154 74.108  1.00 228.42 ? 566 GLU C C     1 
ATOM   7045 O  O     . GLU B 2 589 ? 13.624  -24.227 73.246  1.00 231.26 ? 566 GLU C O     1 
ATOM   7046 C  CB    . GLU B 2 589 ? 14.167  -22.199 75.620  1.00 221.08 ? 566 GLU C CB    1 
ATOM   7047 N  N     . LEU B 2 590 ? 15.783  -24.426 73.870  1.00 224.80 ? 567 LEU C N     1 
ATOM   7048 C  CA    . LEU B 2 590 ? 16.230  -24.958 72.592  1.00 225.00 ? 567 LEU C CA    1 
ATOM   7049 C  C     . LEU B 2 590 ? 15.961  -26.459 72.536  1.00 231.90 ? 567 LEU C C     1 
ATOM   7050 O  O     . LEU B 2 590 ? 15.724  -27.019 71.464  1.00 240.71 ? 567 LEU C O     1 
ATOM   7051 C  CB    . LEU B 2 590 ? 17.719  -24.673 72.376  1.00 216.45 ? 567 LEU C CB    1 
ATOM   7052 N  N     . ARG B 2 591 ? 15.987  -27.102 73.704  1.00 226.07 ? 568 ARG C N     1 
ATOM   7053 C  CA    . ARG B 2 591 ? 15.745  -28.539 73.811  1.00 221.50 ? 568 ARG C CA    1 
ATOM   7054 C  C     . ARG B 2 591 ? 14.438  -28.955 73.130  1.00 221.78 ? 568 ARG C C     1 
ATOM   7055 O  O     . ARG B 2 591 ? 14.222  -30.135 72.849  1.00 223.18 ? 568 ARG C O     1 
ATOM   7056 C  CB    . ARG B 2 591 ? 15.750  -28.978 75.281  1.00 218.48 ? 568 ARG C CB    1 
ATOM   7057 N  N     . LYS B 2 592 ? 13.570  -27.980 72.865  1.00 216.23 ? 569 LYS C N     1 
ATOM   7058 C  CA    . LYS B 2 592 ? 12.302  -28.238 72.189  1.00 214.39 ? 569 LYS C CA    1 
ATOM   7059 C  C     . LYS B 2 592 ? 12.280  -27.610 70.794  1.00 207.88 ? 569 LYS C C     1 
ATOM   7060 O  O     . LYS B 2 592 ? 13.236  -27.732 70.025  1.00 205.98 ? 569 LYS C O     1 
ATOM   7061 C  CB    . LYS B 2 592 ? 11.132  -27.718 73.029  1.00 224.80 ? 569 LYS C CB    1 
ATOM   7062 N  N     . LEU B 2 600 ? 24.015  -30.960 70.735  1.00 172.85 ? 577 LEU C N     1 
ATOM   7063 C  CA    . LEU B 2 600 ? 24.479  -29.898 71.635  1.00 190.40 ? 577 LEU C CA    1 
ATOM   7064 C  C     . LEU B 2 600 ? 25.993  -29.922 71.867  1.00 172.79 ? 577 LEU C C     1 
ATOM   7065 O  O     . LEU B 2 600 ? 26.526  -30.864 72.462  1.00 172.90 ? 577 LEU C O     1 
ATOM   7066 C  CB    . LEU B 2 600 ? 23.754  -29.963 72.983  1.00 227.70 ? 577 LEU C CB    1 
ATOM   7067 N  N     . GLN B 2 601 ? 26.676  -28.880 71.398  1.00 172.57 ? 578 GLN C N     1 
ATOM   7068 C  CA    . GLN B 2 601 ? 28.107  -28.714 71.647  1.00 167.24 ? 578 GLN C CA    1 
ATOM   7069 C  C     . GLN B 2 601 ? 28.339  -27.666 72.739  1.00 171.73 ? 578 GLN C C     1 
ATOM   7070 O  O     . GLN B 2 601 ? 27.736  -26.591 72.717  1.00 189.21 ? 578 GLN C O     1 
ATOM   7071 C  CB    . GLN B 2 601 ? 28.839  -28.310 70.362  1.00 154.14 ? 578 GLN C CB    1 
ATOM   7072 N  N     . ARG B 2 602 ? 29.206  -27.989 73.696  1.00 168.32 ? 579 ARG C N     1 
ATOM   7073 C  CA    . ARG B 2 602 ? 29.539  -27.072 74.786  1.00 170.59 ? 579 ARG C CA    1 
ATOM   7074 C  C     . ARG B 2 602 ? 30.882  -26.372 74.516  1.00 142.99 ? 579 ARG C C     1 
ATOM   7075 O  O     . ARG B 2 602 ? 31.929  -27.021 74.467  1.00 138.30 ? 579 ARG C O     1 
ATOM   7076 C  CB    . ARG B 2 602 ? 29.568  -27.827 76.121  1.00 194.52 ? 579 ARG C CB    1 
ATOM   7077 N  N     . TYR B 2 603 ? 30.846  -25.053 74.336  1.00 139.09 ? 580 TYR C N     1 
ATOM   7078 C  CA    . TYR B 2 603 ? 32.043  -24.294 73.952  1.00 137.43 ? 580 TYR C CA    1 
ATOM   7079 C  C     . TYR B 2 603 ? 33.098  -24.213 75.057  1.00 131.01 ? 580 TYR C C     1 
ATOM   7080 O  O     . TYR B 2 603 ? 32.826  -23.724 76.159  1.00 123.87 ? 580 TYR C O     1 
ATOM   7081 C  CB    . TYR B 2 603 ? 31.682  -22.884 73.458  1.00 142.46 ? 580 TYR C CB    1 
ATOM   7082 C  CG    . TYR B 2 603 ? 31.242  -22.811 72.005  1.00 156.81 ? 580 TYR C CG    1 
ATOM   7083 C  CD1   . TYR B 2 603 ? 32.147  -23.022 70.966  1.00 153.97 ? 580 TYR C CD1   1 
ATOM   7084 C  CD2   . TYR B 2 603 ? 29.923  -22.511 71.669  1.00 170.38 ? 580 TYR C CD2   1 
ATOM   7085 C  CE1   . TYR B 2 603 ? 31.747  -22.948 69.637  1.00 158.02 ? 580 TYR C CE1   1 
ATOM   7086 C  CE2   . TYR B 2 603 ? 29.513  -22.434 70.343  1.00 173.66 ? 580 TYR C CE2   1 
ATOM   7087 C  CZ    . TYR B 2 603 ? 30.427  -22.654 69.332  1.00 170.94 ? 580 TYR C CZ    1 
ATOM   7088 O  OH    . TYR B 2 603 ? 30.021  -22.580 68.013  1.00 180.50 ? 580 TYR C OH    1 
ATOM   7089 N  N     . LYS B 2 604 ? 34.303  -24.684 74.738  1.00 125.44 ? 581 LYS C N     1 
ATOM   7090 C  CA    . LYS B 2 604 ? 35.409  -24.721 75.688  1.00 111.92 ? 581 LYS C CA    1 
ATOM   7091 C  C     . LYS B 2 604 ? 36.345  -23.521 75.552  1.00 102.04 ? 581 LYS C C     1 
ATOM   7092 O  O     . LYS B 2 604 ? 37.153  -23.256 76.442  1.00 99.19  ? 581 LYS C O     1 
ATOM   7093 C  CB    . LYS B 2 604 ? 36.205  -26.017 75.530  1.00 106.40 ? 581 LYS C CB    1 
ATOM   7094 C  CG    . LYS B 2 604 ? 35.440  -27.275 75.911  1.00 107.27 ? 581 LYS C CG    1 
ATOM   7095 C  CD    . LYS B 2 604 ? 36.219  -28.534 75.518  1.00 104.53 ? 581 LYS C CD    1 
ATOM   7096 N  N     . GLY B 2 605 ? 36.250  -22.804 74.436  1.00 101.98 ? 582 GLY C N     1 
ATOM   7097 C  CA    . GLY B 2 605 ? 37.090  -21.639 74.224  1.00 122.21 ? 582 GLY C CA    1 
ATOM   7098 C  C     . GLY B 2 605 ? 36.700  -20.939 72.944  1.00 153.83 ? 582 GLY C C     1 
ATOM   7099 O  O     . GLY B 2 605 ? 35.891  -21.479 72.185  1.00 147.90 ? 582 GLY C O     1 
ATOM   7100 N  N     . LEU B 2 606 ? 37.256  -19.750 72.699  1.00 191.82 ? 583 LEU C N     1 
ATOM   7101 C  CA    . LEU B 2 606 ? 37.033  -19.063 71.424  1.00 221.36 ? 583 LEU C CA    1 
ATOM   7102 C  C     . LEU B 2 606 ? 37.857  -19.742 70.335  1.00 237.98 ? 583 LEU C C     1 
ATOM   7103 O  O     . LEU B 2 606 ? 37.599  -19.576 69.136  1.00 242.24 ? 583 LEU C O     1 
ATOM   7104 C  CB    . LEU B 2 606 ? 37.418  -17.583 71.507  1.00 222.92 ? 583 LEU C CB    1 
ATOM   7105 C  CG    . LEU B 2 606 ? 37.100  -16.765 72.759  1.00 226.04 ? 583 LEU C CG    1 
ATOM   7106 C  CD1   . LEU B 2 606 ? 37.406  -15.285 72.503  1.00 236.01 ? 583 LEU C CD1   1 
ATOM   7107 C  CD2   . LEU B 2 606 ? 35.654  -16.961 73.186  1.00 220.49 ? 583 LEU C CD2   1 
ATOM   7108 N  N     . GLY B 2 607 ? 38.857  -20.500 70.775  1.00 241.39 ? 584 GLY C N     1 
ATOM   7109 C  CA    . GLY B 2 607 ? 39.747  -21.215 69.881  1.00 239.34 ? 584 GLY C CA    1 
ATOM   7110 C  C     . GLY B 2 607 ? 39.053  -22.346 69.152  1.00 233.64 ? 584 GLY C C     1 
ATOM   7111 O  O     . GLY B 2 607 ? 39.524  -22.784 68.102  1.00 242.24 ? 584 GLY C O     1 
ATOM   7112 N  N     . GLU B 2 608 ? 37.941  -22.821 69.714  1.00 210.79 ? 585 GLU C N     1 
ATOM   7113 C  CA    . GLU B 2 608 ? 37.106  -23.833 69.064  1.00 181.52 ? 585 GLU C CA    1 
ATOM   7114 C  C     . GLU B 2 608 ? 35.941  -23.187 68.294  1.00 159.07 ? 585 GLU C C     1 
ATOM   7115 O  O     . GLU B 2 608 ? 35.007  -23.878 67.878  1.00 147.85 ? 585 GLU C O     1 
ATOM   7116 C  CB    . GLU B 2 608 ? 36.583  -24.857 70.087  1.00 177.02 ? 585 GLU C CB    1 
ATOM   7117 N  N     . MET B 2 609 ? 38.191  -20.058 68.300  1.00 230.56 ? 586 MET C N     1 
ATOM   7118 C  CA    . MET B 2 609 ? 37.089  -19.375 67.618  1.00 204.82 ? 586 MET C CA    1 
ATOM   7119 C  C     . MET B 2 609 ? 37.495  -18.817 66.246  1.00 165.25 ? 586 MET C C     1 
ATOM   7120 O  O     . MET B 2 609 ? 38.537  -18.171 66.108  1.00 165.07 ? 586 MET C O     1 
ATOM   7121 C  CB    . MET B 2 609 ? 36.555  -18.238 68.487  1.00 210.55 ? 586 MET C CB    1 
ATOM   7122 C  CG    . MET B 2 609 ? 35.109  -18.397 68.909  1.00 214.31 ? 586 MET C CG    1 
ATOM   7123 S  SD    . MET B 2 609 ? 34.539  -17.005 69.910  1.00 471.95 ? 586 MET C SD    1 
ATOM   7124 C  CE    . MET B 2 609 ? 35.839  -16.921 71.139  1.00 424.23 ? 586 MET C CE    1 
ATOM   7125 N  N     . ASN B 2 610 ? 36.663  -19.072 65.239  1.00 130.62 ? 587 ASN C N     1 
ATOM   7126 C  CA    . ASN B 2 610 ? 36.869  -18.519 63.902  1.00 113.17 ? 587 ASN C CA    1 
ATOM   7127 C  C     . ASN B 2 610 ? 36.484  -17.050 63.837  1.00 117.60 ? 587 ASN C C     1 
ATOM   7128 O  O     . ASN B 2 610 ? 35.498  -16.644 64.448  1.00 130.34 ? 587 ASN C O     1 
ATOM   7129 C  CB    . ASN B 2 610 ? 36.033  -19.282 62.872  1.00 117.41 ? 587 ASN C CB    1 
ATOM   7130 C  CG    . ASN B 2 610 ? 36.664  -20.599 62.457  1.00 118.38 ? 587 ASN C CG    1 
ATOM   7131 O  OD1   . ASN B 2 610 ? 37.888  -20.734 62.404  1.00 112.99 ? 587 ASN C OD1   1 
ATOM   7132 N  ND2   . ASN B 2 610 ? 35.822  -21.578 62.146  1.00 124.21 ? 587 ASN C ND2   1 
ATOM   7133 N  N     . ALA B 2 611 ? 37.244  -16.258 63.077  1.00 117.26 ? 588 ALA C N     1 
ATOM   7134 C  CA    . ALA B 2 611 ? 36.965  -14.825 62.922  1.00 114.91 ? 588 ALA C CA    1 
ATOM   7135 C  C     . ALA B 2 611 ? 35.493  -14.524 62.594  1.00 121.33 ? 588 ALA C C     1 
ATOM   7136 O  O     . ALA B 2 611 ? 34.913  -13.573 63.121  1.00 133.21 ? 588 ALA C O     1 
ATOM   7137 C  CB    . ALA B 2 611 ? 37.893  -14.203 61.879  1.00 115.66 ? 588 ALA C CB    1 
ATOM   7138 N  N     . ASP B 2 612 ? 34.893  -15.336 61.727  1.00 126.06 ? 589 ASP C N     1 
ATOM   7139 C  CA    . ASP B 2 612 ? 33.461  -15.232 61.438  1.00 125.42 ? 589 ASP C CA    1 
ATOM   7140 C  C     . ASP B 2 612 ? 32.622  -15.252 62.733  1.00 120.79 ? 589 ASP C C     1 
ATOM   7141 O  O     . ASP B 2 612 ? 31.894  -14.297 63.034  1.00 113.02 ? 589 ASP C O     1 
ATOM   7142 C  CB    . ASP B 2 612 ? 33.026  -16.359 60.487  1.00 118.07 ? 589 ASP C CB    1 
ATOM   7143 N  N     . GLN B 2 613 ? 32.744  -16.338 63.498  1.00 118.87 ? 590 GLN C N     1 
ATOM   7144 C  CA    . GLN B 2 613 ? 31.963  -16.532 64.725  1.00 122.80 ? 590 GLN C CA    1 
ATOM   7145 C  C     . GLN B 2 613 ? 32.209  -15.452 65.784  1.00 131.16 ? 590 GLN C C     1 
ATOM   7146 O  O     . GLN B 2 613 ? 31.265  -14.932 66.380  1.00 135.06 ? 590 GLN C O     1 
ATOM   7147 C  CB    . GLN B 2 613 ? 32.230  -17.926 65.314  1.00 123.26 ? 590 GLN C CB    1 
ATOM   7148 C  CG    . GLN B 2 613 ? 31.836  -19.080 64.395  1.00 126.98 ? 590 GLN C CG    1 
ATOM   7149 C  CD    . GLN B 2 613 ? 32.681  -20.322 64.620  1.00 130.00 ? 590 GLN C CD    1 
ATOM   7150 O  OE1   . GLN B 2 613 ? 33.489  -20.376 65.549  1.00 136.09 ? 590 GLN C OE1   1 
ATOM   7151 N  NE2   . GLN B 2 613 ? 32.506  -21.327 63.761  1.00 122.43 ? 590 GLN C NE2   1 
ATOM   7152 N  N     . LEU B 2 614 ? 33.479  -15.122 66.007  1.00 146.12 ? 591 LEU C N     1 
ATOM   7153 C  CA    . LEU B 2 614 ? 33.871  -14.107 66.987  1.00 164.55 ? 591 LEU C CA    1 
ATOM   7154 C  C     . LEU B 2 614 ? 33.108  -12.804 66.764  1.00 168.81 ? 591 LEU C C     1 
ATOM   7155 O  O     . LEU B 2 614 ? 32.717  -12.124 67.716  1.00 183.72 ? 591 LEU C O     1 
ATOM   7156 C  CB    . LEU B 2 614 ? 35.381  -13.847 66.900  1.00 179.58 ? 591 LEU C CB    1 
ATOM   7157 C  CG    . LEU B 2 614 ? 36.158  -13.383 68.140  1.00 196.56 ? 591 LEU C CG    1 
ATOM   7158 C  CD1   . LEU B 2 614 ? 37.546  -12.915 67.733  1.00 199.03 ? 591 LEU C CD1   1 
ATOM   7159 C  CD2   . LEU B 2 614 ? 35.423  -12.282 68.853  1.00 206.95 ? 591 LEU C CD2   1 
ATOM   7160 N  N     . TRP B 2 615 ? 32.906  -12.458 65.496  1.00 155.03 ? 592 TRP C N     1 
ATOM   7161 C  CA    . TRP B 2 615 ? 32.214  -11.229 65.144  1.00 142.42 ? 592 TRP C CA    1 
ATOM   7162 C  C     . TRP B 2 615 ? 30.754  -11.320 65.537  1.00 128.84 ? 592 TRP C C     1 
ATOM   7163 O  O     . TRP B 2 615 ? 30.283  -10.567 66.387  1.00 124.97 ? 592 TRP C O     1 
ATOM   7164 C  CB    . TRP B 2 615 ? 32.330  -10.943 63.644  1.00 146.68 ? 592 TRP C CB    1 
ATOM   7165 C  CG    . TRP B 2 615 ? 31.377  -9.875  63.183  1.00 142.89 ? 592 TRP C CG    1 
ATOM   7166 C  CD1   . TRP B 2 615 ? 30.198  -10.058 62.525  1.00 137.08 ? 592 TRP C CD1   1 
ATOM   7167 C  CD2   . TRP B 2 615 ? 31.515  -8.456  63.369  1.00 140.65 ? 592 TRP C CD2   1 
ATOM   7168 N  NE1   . TRP B 2 615 ? 29.597  -8.848  62.280  1.00 136.52 ? 592 TRP C NE1   1 
ATOM   7169 C  CE2   . TRP B 2 615 ? 30.385  -7.848  62.788  1.00 141.59 ? 592 TRP C CE2   1 
ATOM   7170 C  CE3   . TRP B 2 615 ? 32.485  -7.642  63.964  1.00 136.56 ? 592 TRP C CE3   1 
ATOM   7171 C  CZ2   . TRP B 2 615 ? 30.196  -6.467  62.787  1.00 146.89 ? 592 TRP C CZ2   1 
ATOM   7172 C  CZ3   . TRP B 2 615 ? 32.296  -6.270  63.960  1.00 138.14 ? 592 TRP C CZ3   1 
ATOM   7173 C  CH2   . TRP B 2 615 ? 31.161  -5.699  63.374  1.00 144.45 ? 592 TRP C CH2   1 
ATOM   7174 N  N     . GLU B 2 616 ? 30.047  -12.252 64.905  1.00 131.21 ? 593 GLU C N     1 
ATOM   7175 C  CA    . GLU B 2 616 ? 28.619  -12.421 65.125  1.00 137.95 ? 593 GLU C CA    1 
ATOM   7176 C  C     . GLU B 2 616 ? 28.274  -12.421 66.612  1.00 139.48 ? 593 GLU C C     1 
ATOM   7177 O  O     . GLU B 2 616 ? 27.255  -11.858 67.021  1.00 144.47 ? 593 GLU C O     1 
ATOM   7178 C  CB    . GLU B 2 616 ? 28.138  -13.720 64.471  1.00 137.98 ? 593 GLU C CB    1 
ATOM   7179 N  N     . THR B 2 617 ? 29.148  -13.026 67.416  1.00 152.19 ? 594 THR C N     1 
ATOM   7180 C  CA    . THR B 2 617 ? 28.846  -13.314 68.818  1.00 159.76 ? 594 THR C CA    1 
ATOM   7181 C  C     . THR B 2 617 ? 29.249  -12.245 69.837  1.00 150.79 ? 594 THR C C     1 
ATOM   7182 O  O     . THR B 2 617 ? 28.514  -12.009 70.796  1.00 140.89 ? 594 THR C O     1 
ATOM   7183 C  CB    . THR B 2 617 ? 29.462  -14.665 69.270  1.00 212.63 ? 594 THR C CB    1 
ATOM   7184 O  OG1   . THR B 2 617 ? 30.882  -14.532 69.404  1.00 206.39 ? 594 THR C OG1   1 
ATOM   7185 C  CG2   . THR B 2 617 ? 29.152  -15.772 68.271  1.00 217.68 ? 594 THR C CG2   1 
ATOM   7186 N  N     . THR B 2 618 ? 30.405  -11.609 69.654  1.00 148.21 ? 595 THR C N     1 
ATOM   7187 C  CA    . THR B 2 618 ? 30.921  -10.723 70.701  1.00 144.77 ? 595 THR C CA    1 
ATOM   7188 C  C     . THR B 2 618 ? 31.480  -9.360  70.274  1.00 147.52 ? 595 THR C C     1 
ATOM   7189 O  O     . THR B 2 618 ? 31.613  -8.460  71.110  1.00 145.41 ? 595 THR C O     1 
ATOM   7190 C  CB    . THR B 2 618 ? 31.950  -11.449 71.630  1.00 139.58 ? 595 THR C CB    1 
ATOM   7191 O  OG1   . THR B 2 618 ? 33.222  -10.789 71.580  1.00 132.77 ? 595 THR C OG1   1 
ATOM   7192 C  CG2   . THR B 2 618 ? 32.111  -12.910 71.238  1.00 145.32 ? 595 THR C CG2   1 
ATOM   7193 N  N     . MET B 2 619 ? 31.799  -9.197  68.992  1.00 153.97 ? 596 MET C N     1 
ATOM   7194 C  CA    . MET B 2 619 ? 32.377  -7.931  68.530  1.00 154.51 ? 596 MET C CA    1 
ATOM   7195 C  C     . MET B 2 619 ? 31.387  -7.001  67.828  1.00 137.48 ? 596 MET C C     1 
ATOM   7196 O  O     . MET B 2 619 ? 31.583  -5.786  67.787  1.00 141.79 ? 596 MET C O     1 
ATOM   7197 C  CB    . MET B 2 619 ? 33.566  -8.180  67.608  1.00 170.21 ? 596 MET C CB    1 
ATOM   7198 C  CG    . MET B 2 619 ? 34.752  -8.824  68.280  1.00 176.51 ? 596 MET C CG    1 
ATOM   7199 S  SD    . MET B 2 619 ? 36.230  -8.612  67.271  1.00 289.10 ? 596 MET C SD    1 
ATOM   7200 C  CE    . MET B 2 619 ? 36.586  -6.881  67.556  1.00 185.58 ? 596 MET C CE    1 
ATOM   7201 N  N     . ASN B 2 620 ? 30.334  -7.572  67.261  1.00 124.30 ? 597 ASN C N     1 
ATOM   7202 C  CA    . ASN B 2 620 ? 29.372  -6.788  66.499  1.00 126.67 ? 597 ASN C CA    1 
ATOM   7203 C  C     . ASN B 2 620 ? 28.429  -6.035  67.415  1.00 127.08 ? 597 ASN C C     1 
ATOM   7204 O  O     . ASN B 2 620 ? 27.684  -6.652  68.174  1.00 129.34 ? 597 ASN C O     1 
ATOM   7205 C  CB    . ASN B 2 620 ? 28.583  -7.691  65.549  1.00 130.83 ? 597 ASN C CB    1 
ATOM   7206 C  CG    . ASN B 2 620 ? 27.540  -6.935  64.755  1.00 128.56 ? 597 ASN C CG    1 
ATOM   7207 O  OD1   . ASN B 2 620 ? 27.453  -5.708  64.829  1.00 125.67 ? 597 ASN C OD1   1 
ATOM   7208 N  ND2   . ASN B 2 620 ? 26.742  -7.666  63.987  1.00 126.19 ? 597 ASN C ND2   1 
ATOM   7209 N  N     . PRO B 2 621 ? 28.458  -4.697  67.346  1.00 150.20 ? 598 PRO C N     1 
ATOM   7210 C  CA    . PRO B 2 621 ? 27.626  -3.840  68.205  1.00 155.60 ? 598 PRO C CA    1 
ATOM   7211 C  C     . PRO B 2 621 ? 26.127  -4.114  68.058  1.00 142.32 ? 598 PRO C C     1 
ATOM   7212 O  O     . PRO B 2 621 ? 25.338  -3.590  68.835  1.00 137.94 ? 598 PRO C O     1 
ATOM   7213 C  CB    . PRO B 2 621 ? 27.962  -2.425  67.727  1.00 172.90 ? 598 PRO C CB    1 
ATOM   7214 C  CG    . PRO B 2 621 ? 29.322  -2.549  67.116  1.00 176.44 ? 598 PRO C CG    1 
ATOM   7215 C  CD    . PRO B 2 621 ? 29.359  -3.913  66.485  1.00 167.59 ? 598 PRO C CD    1 
ATOM   7216 N  N     . GLU B 2 622 ? 25.750  -4.928  67.074  1.00 144.82 ? 599 GLU C N     1 
ATOM   7217 C  CA    . GLU B 2 622 ? 24.354  -5.312  66.885  1.00 144.46 ? 599 GLU C CA    1 
ATOM   7218 C  C     . GLU B 2 622 ? 24.015  -6.598  67.643  1.00 142.49 ? 599 GLU C C     1 
ATOM   7219 O  O     . GLU B 2 622 ? 22.918  -6.745  68.185  1.00 137.50 ? 599 GLU C O     1 
ATOM   7220 C  CB    . GLU B 2 622 ? 24.055  -5.498  65.393  1.00 140.31 ? 599 GLU C CB    1 
ATOM   7221 N  N     . THR B 2 623 ? 24.970  -7.521  67.684  1.00 139.02 ? 600 THR C N     1 
ATOM   7222 C  CA    . THR B 2 623 ? 24.727  -8.852  68.208  1.00 137.69 ? 600 THR C CA    1 
ATOM   7223 C  C     . THR B 2 623 ? 25.575  -9.180  69.434  1.00 141.19 ? 600 THR C C     1 
ATOM   7224 O  O     . THR B 2 623 ? 25.834  -10.351 69.703  1.00 146.42 ? 600 THR C O     1 
ATOM   7225 C  CB    . THR B 2 623 ? 25.014  -9.915  67.126  1.00 149.06 ? 600 THR C CB    1 
ATOM   7226 N  N     . ARG B 2 624 ? 26.000  -8.163  70.184  1.00 138.86 ? 601 ARG C N     1 
ATOM   7227 C  CA    . ARG B 2 624 ? 26.938  -8.387  71.292  1.00 130.82 ? 601 ARG C CA    1 
ATOM   7228 C  C     . ARG B 2 624 ? 26.421  -7.906  72.646  1.00 134.54 ? 601 ARG C C     1 
ATOM   7229 O  O     . ARG B 2 624 ? 25.510  -7.082  72.714  1.00 140.17 ? 601 ARG C O     1 
ATOM   7230 C  CB    . ARG B 2 624 ? 28.291  -7.724  71.003  1.00 124.55 ? 601 ARG C CB    1 
ATOM   7231 C  CG    . ARG B 2 624 ? 28.312  -6.236  71.290  1.00 140.99 ? 601 ARG C CG    1 
ATOM   7232 C  CD    . ARG B 2 624 ? 29.576  -5.544  70.786  1.00 161.46 ? 601 ARG C CD    1 
ATOM   7233 N  NE    . ARG B 2 624 ? 29.544  -4.121  71.130  1.00 189.55 ? 601 ARG C NE    1 
ATOM   7234 C  CZ    . ARG B 2 624 ? 30.478  -3.226  70.808  1.00 217.44 ? 601 ARG C CZ    1 
ATOM   7235 N  NH1   . ARG B 2 624 ? 31.548  -3.587  70.109  1.00 222.15 ? 601 ARG C NH1   1 
ATOM   7236 N  NH2   . ARG B 2 624 ? 30.335  -1.960  71.185  1.00 233.21 ? 601 ARG C NH2   1 
ATOM   7237 N  N     . THR B 2 625 ? 27.021  -8.422  73.717  1.00 134.35 ? 602 THR C N     1 
ATOM   7238 C  CA    . THR B 2 625 ? 26.721  -7.978  75.079  1.00 138.86 ? 602 THR C CA    1 
ATOM   7239 C  C     . THR B 2 625 ? 27.997  -7.582  75.828  1.00 135.02 ? 602 THR C C     1 
ATOM   7240 O  O     . THR B 2 625 ? 28.868  -8.422  76.044  1.00 139.03 ? 602 THR C O     1 
ATOM   7241 C  CB    . THR B 2 625 ? 25.997  -9.081  75.881  1.00 140.85 ? 602 THR C CB    1 
ATOM   7242 N  N     . LEU B 2 626 ? 28.106  -6.309  76.220  1.00 134.68 ? 603 LEU C N     1 
ATOM   7243 C  CA    . LEU B 2 626 ? 29.284  -5.797  76.938  1.00 144.68 ? 603 LEU C CA    1 
ATOM   7244 C  C     . LEU B 2 626 ? 28.942  -5.340  78.349  1.00 136.90 ? 603 LEU C C     1 
ATOM   7245 O  O     . LEU B 2 626 ? 28.163  -4.405  78.513  1.00 149.56 ? 603 LEU C O     1 
ATOM   7246 C  CB    . LEU B 2 626 ? 29.881  -4.578  76.224  1.00 165.63 ? 603 LEU C CB    1 
ATOM   7247 C  CG    . LEU B 2 626 ? 29.960  -4.513  74.702  1.00 172.21 ? 603 LEU C CG    1 
ATOM   7248 C  CD1   . LEU B 2 626 ? 30.457  -3.141  74.268  1.00 177.87 ? 603 LEU C CD1   1 
ATOM   7249 C  CD2   . LEU B 2 626 ? 30.861  -5.615  74.163  1.00 163.11 ? 603 LEU C CD2   1 
ATOM   7250 N  N     . ILE B 2 627 ? 29.535  -5.960  79.366  1.00 131.73 ? 604 ILE C N     1 
ATOM   7251 C  CA    . ILE B 2 627 ? 29.389  -5.439  80.724  1.00 134.23 ? 604 ILE C CA    1 
ATOM   7252 C  C     . ILE B 2 627 ? 30.085  -4.077  80.791  1.00 132.09 ? 604 ILE C C     1 
ATOM   7253 O  O     . ILE B 2 627 ? 31.242  -3.943  80.388  1.00 126.37 ? 604 ILE C O     1 
ATOM   7254 C  CB    . ILE B 2 627 ? 29.950  -6.408  81.809  1.00 133.19 ? 604 ILE C CB    1 
ATOM   7255 N  N     . ARG B 2 628 ? 29.364  -3.063  81.264  1.00 136.81 ? 605 ARG C N     1 
ATOM   7256 C  CA    . ARG B 2 628 ? 29.919  -1.718  81.382  1.00 135.08 ? 605 ARG C CA    1 
ATOM   7257 C  C     . ARG B 2 628 ? 30.354  -1.453  82.819  1.00 142.47 ? 605 ARG C C     1 
ATOM   7258 O  O     . ARG B 2 628 ? 29.534  -1.430  83.734  1.00 147.10 ? 605 ARG C O     1 
ATOM   7259 C  CB    . ARG B 2 628 ? 28.911  -0.658  80.920  1.00 128.40 ? 605 ARG C CB    1 
ATOM   7260 N  N     . VAL B 2 629 ? 31.656  -1.272  83.009  1.00 164.15 ? 606 VAL C N     1 
ATOM   7261 C  CA    . VAL B 2 629 ? 32.193  -0.995  84.330  1.00 201.38 ? 606 VAL C CA    1 
ATOM   7262 C  C     . VAL B 2 629 ? 31.740  0.375   84.775  1.00 203.13 ? 606 VAL C C     1 
ATOM   7263 O  O     . VAL B 2 629 ? 31.903  1.355   84.045  1.00 214.31 ? 606 VAL C O     1 
ATOM   7264 C  CB    . VAL B 2 629 ? 33.730  -1.026  84.345  1.00 231.74 ? 606 VAL C CB    1 
ATOM   7265 C  CG1   . VAL B 2 629 ? 34.251  -0.478  85.659  1.00 238.55 ? 606 VAL C CG1   1 
ATOM   7266 C  CG2   . VAL B 2 629 ? 34.239  -2.440  84.117  1.00 246.53 ? 606 VAL C CG2   1 
ATOM   7267 N  N     . THR B 2 630 ? 31.161  0.425   85.972  1.00 186.49 ? 607 THR C N     1 
ATOM   7268 C  CA    . THR B 2 630 ? 30.723  1.675   86.592  1.00 171.26 ? 607 THR C CA    1 
ATOM   7269 C  C     . THR B 2 630 ? 31.209  1.746   88.038  1.00 153.07 ? 607 THR C C     1 
ATOM   7270 O  O     . THR B 2 630 ? 30.887  0.880   88.851  1.00 150.40 ? 607 THR C O     1 
ATOM   7271 C  CB    . THR B 2 630 ? 29.182  1.810   86.591  1.00 181.05 ? 607 THR C CB    1 
ATOM   7272 O  OG1   . THR B 2 630 ? 28.609  0.828   87.468  1.00 174.93 ? 607 THR C OG1   1 
ATOM   7273 C  CG2   . THR B 2 630 ? 28.620  1.631   85.186  1.00 193.99 ? 607 THR C CG2   1 
ATOM   7274 N  N     . ILE B 2 631 ? 31.996  2.768   88.351  1.00 148.83 ? 608 ILE C N     1 
ATOM   7275 C  CA    . ILE B 2 631 ? 32.470  2.963   89.711  1.00 155.70 ? 608 ILE C CA    1 
ATOM   7276 C  C     . ILE B 2 631 ? 31.321  3.516   90.572  1.00 164.04 ? 608 ILE C C     1 
ATOM   7277 O  O     . ILE B 2 631 ? 31.049  4.718   90.574  1.00 168.51 ? 608 ILE C O     1 
ATOM   7278 C  CB    . ILE B 2 631 ? 33.706  3.887   89.748  1.00 166.16 ? 608 ILE C CB    1 
ATOM   7279 N  N     . GLU B 2 632 ? 30.640  2.623   91.289  1.00 169.45 ? 609 GLU C N     1 
ATOM   7280 C  CA    . GLU B 2 632 ? 29.418  2.971   92.010  1.00 178.54 ? 609 GLU C CA    1 
ATOM   7281 C  C     . GLU B 2 632 ? 29.695  3.728   93.307  1.00 195.75 ? 609 GLU C C     1 
ATOM   7282 O  O     . GLU B 2 632 ? 29.424  4.929   93.412  1.00 199.55 ? 609 GLU C O     1 
ATOM   7283 C  CB    . GLU B 2 632 ? 28.593  1.713   92.301  1.00 170.68 ? 609 GLU C CB    1 
ATOM   7284 N  N     . ASP B 2 633 ? 30.226  3.014   94.295  1.00 208.83 ? 610 ASP C N     1 
ATOM   7285 C  CA    . ASP B 2 633 ? 30.571  3.597   95.590  1.00 244.94 ? 610 ASP C CA    1 
ATOM   7286 C  C     . ASP B 2 633 ? 32.085  3.718   95.722  1.00 251.51 ? 610 ASP C C     1 
ATOM   7287 O  O     . ASP B 2 633 ? 32.730  2.858   96.320  1.00 252.18 ? 610 ASP C O     1 
ATOM   7288 C  CB    . ASP B 2 633 ? 30.015  2.726   96.720  1.00 273.14 ? 610 ASP C CB    1 
ATOM   7289 C  CG    . ASP B 2 633 ? 30.313  3.290   98.103  1.00 298.24 ? 610 ASP C CG    1 
ATOM   7290 O  OD1   . ASP B 2 633 ? 31.388  3.896   98.299  1.00 297.28 ? 610 ASP C OD1   1 
ATOM   7291 O  OD2   . ASP B 2 633 ? 29.462  3.120   98.999  1.00 316.76 ? 610 ASP C OD2   1 
ATOM   7292 N  N     . LEU B 2 634 ? 32.644  4.789   95.170  1.00 253.90 ? 611 LEU C N     1 
ATOM   7293 C  CA    . LEU B 2 634 ? 34.095  4.980   95.122  1.00 245.89 ? 611 LEU C CA    1 
ATOM   7294 C  C     . LEU B 2 634 ? 34.861  4.389   96.318  1.00 236.66 ? 611 LEU C C     1 
ATOM   7295 O  O     . LEU B 2 634 ? 35.914  3.771   96.137  1.00 230.05 ? 611 LEU C O     1 
ATOM   7296 C  CB    . LEU B 2 634 ? 34.430  6.465   94.943  1.00 246.36 ? 611 LEU C CB    1 
ATOM   7297 C  CG    . LEU B 2 634 ? 35.898  6.896   95.030  1.00 237.11 ? 611 LEU C CG    1 
ATOM   7298 C  CD1   . LEU B 2 634 ? 36.482  6.679   96.439  1.00 226.13 ? 611 LEU C CD1   1 
ATOM   7299 C  CD2   . LEU B 2 634 ? 36.728  6.188   93.979  1.00 237.80 ? 611 LEU C CD2   1 
ATOM   7300 N  N     . ALA B 2 635 ? 34.333  4.571   97.526  1.00 232.73 ? 612 ALA C N     1 
ATOM   7301 C  CA    . ALA B 2 635 ? 35.038  4.168   98.743  1.00 224.72 ? 612 ALA C CA    1 
ATOM   7302 C  C     . ALA B 2 635 ? 35.034  2.654   99.039  1.00 203.52 ? 612 ALA C C     1 
ATOM   7303 O  O     . ALA B 2 635 ? 36.019  2.118   99.549  1.00 190.51 ? 612 ALA C O     1 
ATOM   7304 C  CB    . ALA B 2 635 ? 34.512  4.950   99.938  1.00 239.75 ? 612 ALA C CB    1 
ATOM   7305 N  N     . ARG B 2 636 ? 33.932  1.967   98.745  1.00 197.72 ? 613 ARG C N     1 
ATOM   7306 C  CA    . ARG B 2 636 ? 33.877  0.520   98.962  1.00 190.67 ? 613 ARG C CA    1 
ATOM   7307 C  C     . ARG B 2 636 ? 34.453  -0.196  97.738  1.00 174.02 ? 613 ARG C C     1 
ATOM   7308 O  O     . ARG B 2 636 ? 34.745  -1.401  97.774  1.00 169.26 ? 613 ARG C O     1 
ATOM   7309 C  CB    . ARG B 2 636 ? 32.450  0.046   99.260  1.00 202.49 ? 613 ARG C CB    1 
ATOM   7310 N  N     . ALA B 2 637 ? 34.613  0.561   96.652  1.00 182.50 ? 614 ALA C N     1 
ATOM   7311 C  CA    . ALA B 2 637 ? 35.312  0.086   95.470  1.00 202.61 ? 614 ALA C CA    1 
ATOM   7312 C  C     . ALA B 2 637 ? 36.814  0.170   95.719  1.00 214.42 ? 614 ALA C C     1 
ATOM   7313 O  O     . ALA B 2 637 ? 37.554  -0.741  95.358  1.00 224.52 ? 614 ALA C O     1 
ATOM   7314 C  CB    . ALA B 2 637 ? 34.916  0.901   94.237  1.00 210.91 ? 614 ALA C CB    1 
ATOM   7315 N  N     . GLU B 2 638 ? 37.258  1.254   96.353  1.00 207.61 ? 615 GLU C N     1 
ATOM   7316 C  CA    . GLU B 2 638 ? 38.670  1.431   96.705  1.00 189.18 ? 615 GLU C CA    1 
ATOM   7317 C  C     . GLU B 2 638 ? 39.165  0.382   97.708  1.00 167.02 ? 615 GLU C C     1 
ATOM   7318 O  O     . GLU B 2 638 ? 40.351  0.015   97.717  1.00 160.45 ? 615 GLU C O     1 
ATOM   7319 C  CB    . GLU B 2 638 ? 38.902  2.830   97.276  1.00 203.34 ? 615 GLU C CB    1 
ATOM   7320 C  CG    . GLU B 2 638 ? 40.180  2.974   98.102  1.00 218.23 ? 615 GLU C CG    1 
ATOM   7321 C  CD    . GLU B 2 638 ? 41.427  3.092   97.250  1.00 230.02 ? 615 GLU C CD    1 
ATOM   7322 O  OE1   . GLU B 2 638 ? 41.296  3.264   96.018  1.00 219.88 ? 615 GLU C OE1   1 
ATOM   7323 O  OE2   . GLU B 2 638 ? 42.538  3.020   97.815  1.00 251.28 ? 615 GLU C OE2   1 
ATOM   7324 N  N     . ARG B 2 639 ? 38.254  -0.087  98.558  1.00 166.23 ? 616 ARG C N     1 
ATOM   7325 C  CA    . ARG B 2 639 ? 38.591  -1.106  99.542  1.00 161.64 ? 616 ARG C CA    1 
ATOM   7326 C  C     . ARG B 2 639 ? 38.788  -2.425  98.818  1.00 151.56 ? 616 ARG C C     1 
ATOM   7327 O  O     . ARG B 2 639 ? 39.731  -3.164  99.097  1.00 150.40 ? 616 ARG C O     1 
ATOM   7328 C  CB    . ARG B 2 639 ? 37.508  -1.223  100.627 1.00 161.67 ? 616 ARG C CB    1 
ATOM   7329 N  N     . ARG B 2 640 ? 37.906  -2.711  97.868  1.00 166.82 ? 617 ARG C N     1 
ATOM   7330 C  CA    . ARG B 2 640 ? 38.002  -3.959  97.117  1.00 197.12 ? 617 ARG C CA    1 
ATOM   7331 C  C     . ARG B 2 640 ? 39.288  -4.080  96.292  1.00 216.91 ? 617 ARG C C     1 
ATOM   7332 O  O     . ARG B 2 640 ? 39.996  -5.077  96.416  1.00 225.54 ? 617 ARG C O     1 
ATOM   7333 C  CB    . ARG B 2 640 ? 36.767  -4.200  96.247  1.00 204.94 ? 617 ARG C CB    1 
ATOM   7334 C  CG    . ARG B 2 640 ? 36.755  -5.582  95.637  1.00 206.00 ? 617 ARG C CG    1 
ATOM   7335 C  CD    . ARG B 2 640 ? 35.407  -6.234  95.756  1.00 206.11 ? 617 ARG C CD    1 
ATOM   7336 N  NE    . ARG B 2 640 ? 34.996  -6.310  97.142  1.00 203.49 ? 617 ARG C NE    1 
ATOM   7337 C  CZ    . ARG B 2 640 ? 34.032  -7.104  97.582  1.00 197.97 ? 617 ARG C CZ    1 
ATOM   7338 N  NH1   . ARG B 2 640 ? 33.395  -7.895  96.727  1.00 180.43 ? 617 ARG C NH1   1 
ATOM   7339 N  NH2   . ARG B 2 640 ? 33.715  -7.111  98.876  1.00 212.05 ? 617 ARG C NH2   1 
ATOM   7340 N  N     . VAL B 2 641 ? 39.604  -3.082  95.462  1.00 218.87 ? 618 VAL C N     1 
ATOM   7341 C  CA    . VAL B 2 641 ? 40.836  -3.162  94.669  1.00 204.92 ? 618 VAL C CA    1 
ATOM   7342 C  C     . VAL B 2 641 ? 42.051  -3.283  95.597  1.00 192.00 ? 618 VAL C C     1 
ATOM   7343 O  O     . VAL B 2 641 ? 42.884  -4.181  95.435  1.00 194.51 ? 618 VAL C O     1 
ATOM   7344 C  CB    . VAL B 2 641 ? 41.012  -1.993  93.628  1.00 153.15 ? 618 VAL C CB    1 
ATOM   7345 N  N     . ASN B 2 642 ? 42.128  -2.402  96.589  1.00 177.06 ? 619 ASN C N     1 
ATOM   7346 C  CA    . ASN B 2 642 ? 43.283  -2.346  97.480  1.00 167.67 ? 619 ASN C CA    1 
ATOM   7347 C  C     . ASN B 2 642 ? 43.477  -3.617  98.350  1.00 141.99 ? 619 ASN C C     1 
ATOM   7348 O  O     . ASN B 2 642 ? 44.581  -3.879  98.830  1.00 141.56 ? 619 ASN C O     1 
ATOM   7349 C  CB    . ASN B 2 642 ? 43.265  -1.041  98.304  1.00 169.68 ? 619 ASN C CB    1 
ATOM   7350 N  N     . VAL B 2 643 ? 42.422  -4.420  98.517  1.00 137.23 ? 620 VAL C N     1 
ATOM   7351 C  CA    . VAL B 2 643 ? 42.498  -5.670  99.292  1.00 133.85 ? 620 VAL C CA    1 
ATOM   7352 C  C     . VAL B 2 643 ? 42.823  -6.889  98.436  1.00 130.94 ? 620 VAL C C     1 
ATOM   7353 O  O     . VAL B 2 643 ? 43.535  -7.797  98.874  1.00 129.56 ? 620 VAL C O     1 
ATOM   7354 C  CB    . VAL B 2 643 ? 41.180  -5.969  100.065 1.00 143.20 ? 620 VAL C CB    1 
ATOM   7355 C  CG1   . VAL B 2 643 ? 41.250  -7.336  100.769 1.00 132.06 ? 620 VAL C CG1   1 
ATOM   7356 C  CG2   . VAL B 2 643 ? 40.890  -4.868  101.074 1.00 153.72 ? 620 VAL C CG2   1 
ATOM   7357 N  N     . LEU B 2 644 ? 42.290  -6.912  97.219  1.00 133.61 ? 621 LEU C N     1 
ATOM   7358 C  CA    . LEU B 2 644 ? 42.517  -8.022  96.297  1.00 146.17 ? 621 LEU C CA    1 
ATOM   7359 C  C     . LEU B 2 644 ? 43.853  -7.908  95.590  1.00 164.65 ? 621 LEU C C     1 
ATOM   7360 O  O     . LEU B 2 644 ? 44.460  -8.914  95.245  1.00 167.73 ? 621 LEU C O     1 
ATOM   7361 C  CB    . LEU B 2 644 ? 41.405  -8.095  95.251  1.00 145.86 ? 621 LEU C CB    1 
ATOM   7362 C  CG    . LEU B 2 644 ? 40.017  -8.416  95.788  1.00 149.88 ? 621 LEU C CG    1 
ATOM   7363 C  CD1   . LEU B 2 644 ? 39.032  -8.570  94.639  1.00 149.07 ? 621 LEU C CD1   1 
ATOM   7364 C  CD2   . LEU B 2 644 ? 40.053  -9.666  96.655  1.00 147.45 ? 621 LEU C CD2   1 
ATOM   7365 N  N     . MET B 2 645 ? 44.317  -6.683  95.376  1.00 181.31 ? 622 MET C N     1 
ATOM   7366 C  CA    . MET B 2 645 ? 45.488  -6.483  94.533  1.00 192.08 ? 622 MET C CA    1 
ATOM   7367 C  C     . MET B 2 645 ? 46.681  -5.833  95.250  1.00 208.66 ? 622 MET C C     1 
ATOM   7368 O  O     . MET B 2 645 ? 47.768  -5.728  94.669  1.00 209.20 ? 622 MET C O     1 
ATOM   7369 C  CB    . MET B 2 645 ? 45.096  -5.678  93.295  1.00 186.26 ? 622 MET C CB    1 
ATOM   7370 C  CG    . MET B 2 645 ? 43.774  -6.117  92.643  1.00 180.92 ? 622 MET C CG    1 
ATOM   7371 S  SD    . MET B 2 645 ? 43.725  -7.792  91.940  1.00 209.54 ? 622 MET C SD    1 
ATOM   7372 C  CE    . MET B 2 645 ? 45.185  -7.786  90.882  1.00 105.81 ? 622 MET C CE    1 
ATOM   7373 N  N     . GLY B 2 646 ? 46.482  -5.426  96.509  1.00 220.56 ? 623 GLY C N     1 
ATOM   7374 C  CA    . GLY B 2 646 ? 47.515  -4.751  97.290  1.00 223.58 ? 623 GLY C CA    1 
ATOM   7375 C  C     . GLY B 2 646 ? 48.700  -5.597  97.746  1.00 215.07 ? 623 GLY C C     1 
ATOM   7376 O  O     . GLY B 2 646 ? 48.693  -6.814  97.611  1.00 226.61 ? 623 GLY C O     1 
ATOM   7377 N  N     . ASP B 2 647 ? 49.723  -4.945  98.299  1.00 192.40 ? 624 ASP C N     1 
ATOM   7378 C  CA    . ASP B 2 647 ? 50.927  -5.627  98.780  1.00 177.06 ? 624 ASP C CA    1 
ATOM   7379 C  C     . ASP B 2 647 ? 50.675  -6.614  99.921  1.00 192.04 ? 624 ASP C C     1 
ATOM   7380 O  O     . ASP B 2 647 ? 51.417  -7.583  100.067 1.00 219.41 ? 624 ASP C O     1 
ATOM   7381 C  CB    . ASP B 2 647 ? 51.997  -4.612  99.213  1.00 154.42 ? 624 ASP C CB    1 
ATOM   7382 C  CG    . ASP B 2 647 ? 52.549  -3.810  98.046  1.00 135.64 ? 624 ASP C CG    1 
ATOM   7383 N  N     . LYS B 2 648 ? 49.639  -6.377  100.726 1.00 171.22 ? 625 LYS C N     1 
ATOM   7384 C  CA    . LYS B 2 648 ? 49.435  -7.177  101.946 1.00 152.04 ? 625 LYS C CA    1 
ATOM   7385 C  C     . LYS B 2 648 ? 48.688  -8.502  101.714 1.00 153.88 ? 625 LYS C C     1 
ATOM   7386 O  O     . LYS B 2 648 ? 47.563  -8.515  101.203 1.00 147.69 ? 625 LYS C O     1 
ATOM   7387 C  CB    . LYS B 2 648 ? 48.769  -6.350  103.067 1.00 142.59 ? 625 LYS C CB    1 
ATOM   7388 N  N     . VAL B 2 649 ? 49.320  -9.606  102.115 1.00 162.24 ? 626 VAL C N     1 
ATOM   7389 C  CA    . VAL B 2 649 ? 48.770  -10.933 101.865 1.00 159.29 ? 626 VAL C CA    1 
ATOM   7390 C  C     . VAL B 2 649 ? 47.647  -11.353 102.817 1.00 141.59 ? 626 VAL C C     1 
ATOM   7391 O  O     . VAL B 2 649 ? 46.663  -11.957 102.383 1.00 138.19 ? 626 VAL C O     1 
ATOM   7392 C  CB    . VAL B 2 649 ? 49.866  -12.025 101.865 1.00 169.51 ? 626 VAL C CB    1 
ATOM   7393 C  CG1   . VAL B 2 649 ? 49.237  -13.411 101.934 1.00 170.27 ? 626 VAL C CG1   1 
ATOM   7394 C  CG2   . VAL B 2 649 ? 50.742  -11.901 100.631 1.00 169.17 ? 626 VAL C CG2   1 
ATOM   7395 N  N     . GLU B 2 650 ? 47.792  -11.040 104.106 1.00 132.95 ? 627 GLU C N     1 
ATOM   7396 C  CA    . GLU B 2 650 ? 46.834  -11.498 105.116 1.00 135.76 ? 627 GLU C CA    1 
ATOM   7397 C  C     . GLU B 2 650 ? 45.396  -11.017 104.852 1.00 136.06 ? 627 GLU C C     1 
ATOM   7398 O  O     . GLU B 2 650 ? 44.455  -11.805 104.915 1.00 134.29 ? 627 GLU C O     1 
ATOM   7399 C  CB    . GLU B 2 650 ? 47.312  -11.146 106.534 1.00 130.35 ? 627 GLU C CB    1 
ATOM   7400 N  N     . PRO B 2 651 ? 45.224  -9.725  104.543 1.00 148.38 ? 628 PRO C N     1 
ATOM   7401 C  CA    . PRO B 2 651 ? 43.899  -9.206  104.176 1.00 157.10 ? 628 PRO C CA    1 
ATOM   7402 C  C     . PRO B 2 651 ? 43.232  -10.067 103.097 1.00 157.50 ? 628 PRO C C     1 
ATOM   7403 O  O     . PRO B 2 651 ? 42.165  -10.641 103.333 1.00 163.10 ? 628 PRO C O     1 
ATOM   7404 C  CB    . PRO B 2 651 ? 44.216  -7.817  103.618 1.00 159.45 ? 628 PRO C CB    1 
ATOM   7405 C  CG    . PRO B 2 651 ? 45.473  -7.412  104.313 1.00 162.25 ? 628 PRO C CG    1 
ATOM   7406 C  CD    . PRO B 2 651 ? 46.265  -8.682  104.499 1.00 156.81 ? 628 PRO C CD    1 
ATOM   7407 N  N     . ARG B 2 652 ? 43.872  -10.137 101.926 1.00 153.47 ? 629 ARG C N     1 
ATOM   7408 C  CA    . ARG B 2 652 ? 43.526  -11.078 100.854 1.00 154.82 ? 629 ARG C CA    1 
ATOM   7409 C  C     . ARG B 2 652 ? 43.222  -12.511 101.325 1.00 178.13 ? 629 ARG C C     1 
ATOM   7410 O  O     . ARG B 2 652 ? 42.122  -13.009 101.101 1.00 191.14 ? 629 ARG C O     1 
ATOM   7411 C  CB    . ARG B 2 652 ? 44.654  -11.090 99.818  1.00 129.87 ? 629 ARG C CB    1 
ATOM   7412 C  CG    . ARG B 2 652 ? 44.492  -12.055 98.631  1.00 108.32 ? 629 ARG C CG    1 
ATOM   7413 C  CD    . ARG B 2 652 ? 45.645  -11.847 97.685  1.00 90.48  ? 629 ARG C CD    1 
ATOM   7414 N  NE    . ARG B 2 652 ? 45.818  -10.416 97.472  1.00 98.54  ? 629 ARG C NE    1 
ATOM   7415 C  CZ    . ARG B 2 652 ? 46.974  -9.765  97.549  1.00 120.66 ? 629 ARG C CZ    1 
ATOM   7416 N  NH1   . ARG B 2 652 ? 48.101  -10.407 97.821  1.00 121.19 ? 629 ARG C NH1   1 
ATOM   7417 N  NH2   . ARG B 2 652 ? 46.997  -8.458  97.340  1.00 140.49 ? 629 ARG C NH2   1 
ATOM   7418 N  N     . ARG B 2 653 ? 44.178  -13.176 101.962 1.00 176.72 ? 630 ARG C N     1 
ATOM   7419 C  CA    . ARG B 2 653 ? 43.914  -14.536 102.451 1.00 162.32 ? 630 ARG C CA    1 
ATOM   7420 C  C     . ARG B 2 653 ? 42.574  -14.645 103.172 1.00 145.45 ? 630 ARG C C     1 
ATOM   7421 O  O     . ARG B 2 653 ? 41.829  -15.605 102.966 1.00 140.95 ? 630 ARG C O     1 
ATOM   7422 C  CB    . ARG B 2 653 ? 45.016  -15.056 103.382 1.00 163.09 ? 630 ARG C CB    1 
ATOM   7423 C  CG    . ARG B 2 653 ? 44.628  -16.381 104.037 1.00 164.26 ? 630 ARG C CG    1 
ATOM   7424 C  CD    . ARG B 2 653 ? 45.575  -16.809 105.149 1.00 164.67 ? 630 ARG C CD    1 
ATOM   7425 N  NE    . ARG B 2 653 ? 46.860  -17.259 104.626 1.00 163.48 ? 630 ARG C NE    1 
ATOM   7426 C  CZ    . ARG B 2 653 ? 48.002  -16.591 104.760 1.00 170.97 ? 630 ARG C CZ    1 
ATOM   7427 N  NH1   . ARG B 2 653 ? 48.030  -15.435 105.417 1.00 155.15 ? 630 ARG C NH1   1 
ATOM   7428 N  NH2   . ARG B 2 653 ? 49.123  -17.087 104.243 1.00 192.28 ? 630 ARG C NH2   1 
ATOM   7429 N  N     . LYS B 2 654 ? 42.289  -13.662 104.028 1.00 138.45 ? 631 LYS C N     1 
ATOM   7430 C  CA    . LYS B 2 654 ? 41.057  -13.647 104.813 1.00 155.22 ? 631 LYS C CA    1 
ATOM   7431 C  C     . LYS B 2 654 ? 39.852  -13.370 103.927 1.00 156.32 ? 631 LYS C C     1 
ATOM   7432 O  O     . LYS B 2 654 ? 38.825  -14.033 104.049 1.00 164.60 ? 631 LYS C O     1 
ATOM   7433 C  CB    . LYS B 2 654 ? 41.147  -12.628 105.959 1.00 162.90 ? 631 LYS C CB    1 
ATOM   7434 C  CG    . LYS B 2 654 ? 39.997  -12.677 106.963 1.00 169.90 ? 631 LYS C CG    1 
ATOM   7435 C  CD    . LYS B 2 654 ? 38.838  -11.800 106.521 1.00 174.92 ? 631 LYS C CD    1 
ATOM   7436 N  N     . TRP B 2 655 ? 39.975  -12.398 103.030 1.00 164.78 ? 632 TRP C N     1 
ATOM   7437 C  CA    . TRP B 2 655 ? 38.921  -12.161 102.054 1.00 187.83 ? 632 TRP C CA    1 
ATOM   7438 C  C     . TRP B 2 655 ? 38.582  -13.463 101.337 1.00 207.61 ? 632 TRP C C     1 
ATOM   7439 O  O     . TRP B 2 655 ? 37.411  -13.772 101.131 1.00 196.87 ? 632 TRP C O     1 
ATOM   7440 C  CB    . TRP B 2 655 ? 39.331  -11.092 101.048 1.00 182.47 ? 632 TRP C CB    1 
ATOM   7441 C  CG    . TRP B 2 655 ? 38.192  -10.642 100.184 1.00 177.13 ? 632 TRP C CG    1 
ATOM   7442 C  CD1   . TRP B 2 655 ? 37.400  -9.556  100.385 1.00 181.63 ? 632 TRP C CD1   1 
ATOM   7443 C  CD2   . TRP B 2 655 ? 37.716  -11.265 98.976  1.00 167.81 ? 632 TRP C CD2   1 
ATOM   7444 N  NE1   . TRP B 2 655 ? 36.457  -9.460  99.393  1.00 177.89 ? 632 TRP C NE1   1 
ATOM   7445 C  CE2   . TRP B 2 655 ? 36.630  -10.493 98.513  1.00 167.80 ? 632 TRP C CE2   1 
ATOM   7446 C  CE3   . TRP B 2 655 ? 38.100  -12.392 98.247  1.00 164.76 ? 632 TRP C CE3   1 
ATOM   7447 C  CZ2   . TRP B 2 655 ? 35.928  -10.817 97.345  1.00 162.75 ? 632 TRP C CZ2   1 
ATOM   7448 C  CZ3   . TRP B 2 655 ? 37.398  -12.711 97.092  1.00 164.20 ? 632 TRP C CZ3   1 
ATOM   7449 C  CH2   . TRP B 2 655 ? 36.326  -11.926 96.655  1.00 161.88 ? 632 TRP C CH2   1 
ATOM   7450 N  N     . ILE B 2 656 ? 39.603  -14.235 100.966 1.00 228.78 ? 633 ILE C N     1 
ATOM   7451 C  CA    . ILE B 2 656 ? 39.358  -15.519 100.323 1.00 220.04 ? 633 ILE C CA    1 
ATOM   7452 C  C     . ILE B 2 656 ? 38.693  -16.468 101.309 1.00 189.02 ? 633 ILE C C     1 
ATOM   7453 O  O     . ILE B 2 656 ? 37.603  -16.959 101.042 1.00 195.78 ? 633 ILE C O     1 
ATOM   7454 C  CB    . ILE B 2 656 ? 40.650  -16.164 99.720  1.00 241.90 ? 633 ILE C CB    1 
ATOM   7455 C  CG1   . ILE B 2 656 ? 41.239  -15.283 98.628  1.00 222.64 ? 633 ILE C CG1   1 
ATOM   7456 C  CG2   . ILE B 2 656 ? 40.355  -17.542 99.148  1.00 246.35 ? 633 ILE C CG2   1 
ATOM   7457 C  CD1   . ILE B 2 656 ? 42.735  -15.335 98.575  1.00 207.67 ? 633 ILE C CD1   1 
ATOM   7458 N  N     . GLU B 2 657 ? 39.342  -16.716 102.446 1.00 150.91 ? 634 GLU C N     1 
ATOM   7459 C  CA    . GLU B 2 657 ? 38.776  -17.601 103.473 1.00 146.62 ? 634 GLU C CA    1 
ATOM   7460 C  C     . GLU B 2 657 ? 37.300  -17.281 103.750 1.00 151.33 ? 634 GLU C C     1 
ATOM   7461 O  O     . GLU B 2 657 ? 36.495  -18.189 103.937 1.00 157.69 ? 634 GLU C O     1 
ATOM   7462 C  CB    . GLU B 2 657 ? 39.604  -17.565 104.770 1.00 140.46 ? 634 GLU C CB    1 
ATOM   7463 N  N     . ASP B 2 658 ? 36.947  -15.996 103.734 1.00 151.01 ? 635 ASP C N     1 
ATOM   7464 C  CA    . ASP B 2 658 ? 35.581  -15.553 104.036 1.00 165.07 ? 635 ASP C CA    1 
ATOM   7465 C  C     . ASP B 2 658 ? 34.583  -15.608 102.872 1.00 166.70 ? 635 ASP C C     1 
ATOM   7466 O  O     . ASP B 2 658 ? 33.416  -15.944 103.085 1.00 172.83 ? 635 ASP C O     1 
ATOM   7467 C  CB    . ASP B 2 658 ? 35.571  -14.137 104.644 1.00 175.87 ? 635 ASP C CB    1 
ATOM   7468 C  CG    . ASP B 2 658 ? 35.941  -14.121 106.135 1.00 205.88 ? 635 ASP C CG    1 
ATOM   7469 O  OD1   . ASP B 2 658 ? 35.816  -15.169 106.818 1.00 225.95 ? 635 ASP C OD1   1 
ATOM   7470 O  OD2   . ASP B 2 658 ? 36.355  -13.044 106.623 1.00 211.37 ? 635 ASP C OD2   1 
ATOM   7471 N  N     . ASN B 2 659 ? 35.028  -15.267 101.660 1.00 158.61 ? 636 ASN C N     1 
ATOM   7472 C  CA    . ASN B 2 659 ? 34.113  -15.167 100.512 1.00 169.13 ? 636 ASN C CA    1 
ATOM   7473 C  C     . ASN B 2 659 ? 34.144  -16.335 99.536  1.00 186.15 ? 636 ASN C C     1 
ATOM   7474 O  O     . ASN B 2 659 ? 33.203  -16.518 98.771  1.00 178.68 ? 636 ASN C O     1 
ATOM   7475 C  CB    . ASN B 2 659 ? 34.333  -13.866 99.736  1.00 167.85 ? 636 ASN C CB    1 
ATOM   7476 C  CG    . ASN B 2 659 ? 34.191  -12.638 100.604 1.00 171.39 ? 636 ASN C CG    1 
ATOM   7477 O  OD1   . ASN B 2 659 ? 33.100  -12.319 101.076 1.00 166.91 ? 636 ASN C OD1   1 
ATOM   7478 N  ND2   . ASN B 2 659 ? 35.299  -11.936 100.815 1.00 176.44 ? 636 ASN C ND2   1 
ATOM   7479 N  N     . VAL B 2 660 ? 35.216  -17.118 99.554  1.00 207.87 ? 637 VAL C N     1 
ATOM   7480 C  CA    . VAL B 2 660 ? 35.390  -18.198 98.586  1.00 204.86 ? 637 VAL C CA    1 
ATOM   7481 C  C     . VAL B 2 660 ? 34.863  -19.547 99.083  1.00 183.09 ? 637 VAL C C     1 
ATOM   7482 O  O     . VAL B 2 660 ? 35.394  -20.123 100.029 1.00 171.33 ? 637 VAL C O     1 
ATOM   7483 C  CB    . VAL B 2 660 ? 36.875  -18.319 98.139  1.00 218.59 ? 637 VAL C CB    1 
ATOM   7484 C  CG1   . VAL B 2 660 ? 37.168  -19.699 97.546  1.00 217.53 ? 637 VAL C CG1   1 
ATOM   7485 C  CG2   . VAL B 2 660 ? 37.228  -17.193 97.165  1.00 213.53 ? 637 VAL C CG2   1 
ATOM   7486 N  N     . LYS B 2 661 ? 33.819  -20.045 98.427  1.00 166.03 ? 638 LYS C N     1 
ATOM   7487 C  CA    . LYS B 2 661 ? 33.177  -21.294 98.827  1.00 147.10 ? 638 LYS C CA    1 
ATOM   7488 C  C     . LYS B 2 661 ? 33.880  -22.540 98.269  1.00 137.76 ? 638 LYS C C     1 
ATOM   7489 O  O     . LYS B 2 661 ? 33.629  -22.950 97.135  1.00 144.85 ? 638 LYS C O     1 
ATOM   7490 C  CB    . LYS B 2 661 ? 31.703  -21.276 98.410  1.00 139.52 ? 638 LYS C CB    1 
ATOM   7491 N  N     . PHE B 2 662 ? 34.758  -23.145 99.065  1.00 132.14 ? 639 PHE C N     1 
ATOM   7492 C  CA    . PHE B 2 662 ? 35.490  -24.331 98.619  1.00 128.70 ? 639 PHE C CA    1 
ATOM   7493 C  C     . PHE B 2 662 ? 34.611  -25.582 98.599  1.00 140.74 ? 639 PHE C C     1 
ATOM   7494 O  O     . PHE B 2 662 ? 34.582  -26.315 97.605  1.00 138.12 ? 639 PHE C O     1 
ATOM   7495 C  CB    . PHE B 2 662 ? 36.746  -24.552 99.466  1.00 123.41 ? 639 PHE C CB    1 
ATOM   7496 C  CG    . PHE B 2 662 ? 37.753  -23.444 99.343  1.00 122.28 ? 639 PHE C CG    1 
ATOM   7497 C  CD1   . PHE B 2 662 ? 38.619  -23.395 98.277  1.00 119.13 ? 639 PHE C CD1   1 
ATOM   7498 C  CD2   . PHE B 2 662 ? 37.823  -22.440 100.285 1.00 129.57 ? 639 PHE C CD2   1 
ATOM   7499 C  CE1   . PHE B 2 662 ? 39.542  -22.372 98.155  1.00 126.96 ? 639 PHE C CE1   1 
ATOM   7500 C  CE2   . PHE B 2 662 ? 38.745  -21.418 100.160 1.00 123.82 ? 639 PHE C CE2   1 
ATOM   7501 C  CZ    . PHE B 2 662 ? 39.604  -21.386 99.092  1.00 128.13 ? 639 PHE C CZ    1 
ATOM   7502 N  N     . THR B 2 663 ? 33.899  -25.812 99.702  1.00 161.17 ? 640 THR C N     1 
ATOM   7503 C  CA    . THR B 2 663 ? 32.919  -26.895 99.809  1.00 77.96  ? 640 THR C CA    1 
ATOM   7504 C  C     . THR B 2 663 ? 33.551  -28.186 100.320 1.00 79.05  ? 640 THR C C     1 
ATOM   7505 O  O     . THR B 2 663 ? 34.410  -28.164 101.204 1.00 80.89  ? 640 THR C O     1 
ATOM   7506 C  CB    . THR B 2 663 ? 32.201  -27.162 98.463  1.00 80.72  ? 640 THR C CB    1 
ATOM   7507 C  "C5'" A DC  C 3 5   ? 69.232  -10.982 92.580  0.50 135.77 ? 9   DC  E "C5'" 1 
ATOM   7508 C  "C4'" A DC  C 3 5   ? 68.809  -12.402 92.931  0.50 140.11 ? 9   DC  E "C4'" 1 
ATOM   7509 O  "O4'" A DC  C 3 5   ? 67.881  -12.396 94.050  0.50 141.23 ? 9   DC  E "O4'" 1 
ATOM   7510 C  "C3'" A DC  C 3 5   ? 68.113  -13.186 91.816  0.50 143.11 ? 9   DC  E "C3'" 1 
ATOM   7511 O  "O3'" A DC  C 3 5   ? 68.616  -14.521 91.779  0.50 142.67 ? 9   DC  E "O3'" 1 
ATOM   7512 C  "C2'" A DC  C 3 5   ? 66.647  -13.164 92.240  0.50 142.37 ? 9   DC  E "C2'" 1 
ATOM   7513 C  "C1'" A DC  C 3 5   ? 66.777  -13.229 93.756  0.50 141.86 ? 9   DC  E "C1'" 1 
ATOM   7514 N  N1    A DC  C 3 5   ? 65.594  -12.699 94.488  0.50 141.05 ? 9   DC  E N1    1 
ATOM   7515 C  C2    A DC  C 3 5   ? 65.023  -13.416 95.558  0.50 140.67 ? 9   DC  E C2    1 
ATOM   7516 O  O2    A DC  C 3 5   ? 65.497  -14.511 95.902  0.50 135.34 ? 9   DC  E O2    1 
ATOM   7517 N  N3    A DC  C 3 5   ? 63.949  -12.887 96.204  0.50 146.25 ? 9   DC  E N3    1 
ATOM   7518 C  C4    A DC  C 3 5   ? 63.455  -11.707 95.817  0.50 154.26 ? 9   DC  E C4    1 
ATOM   7519 N  N4    A DC  C 3 5   ? 62.396  -11.227 96.481  0.50 164.24 ? 9   DC  E N4    1 
ATOM   7520 C  C5    A DC  C 3 5   ? 64.023  -10.966 94.733  0.50 149.61 ? 9   DC  E C5    1 
ATOM   7521 C  C6    A DC  C 3 5   ? 65.079  -11.495 94.106  0.50 145.51 ? 9   DC  E C6    1 
ATOM   7522 P  P     A DA  C 3 6   ? 69.083  -15.175 90.386  0.50 139.30 ? 10  DA  E P     1 
ATOM   7523 O  OP1   A DA  C 3 6   ? 70.071  -16.238 90.690  0.50 140.39 ? 10  DA  E OP1   1 
ATOM   7524 O  OP2   A DA  C 3 6   ? 69.446  -14.075 89.465  0.50 138.75 ? 10  DA  E OP2   1 
ATOM   7525 O  "O5'" A DA  C 3 6   ? 67.738  -15.839 89.814  0.50 118.56 ? 10  DA  E "O5'" 1 
ATOM   7526 C  "C5'" A DA  C 3 6   ? 66.657  -16.170 90.697  0.50 117.63 ? 10  DA  E "C5'" 1 
ATOM   7527 C  "C4'" A DA  C 3 6   ? 66.788  -17.531 91.372  0.50 130.53 ? 10  DA  E "C4'" 1 
ATOM   7528 O  "O4'" A DA  C 3 6   ? 66.331  -17.400 92.736  0.50 128.59 ? 10  DA  E "O4'" 1 
ATOM   7529 C  "C3'" A DA  C 3 6   ? 65.924  -18.629 90.752  0.50 137.94 ? 10  DA  E "C3'" 1 
ATOM   7530 O  "O3'" A DA  C 3 6   ? 66.538  -19.908 90.847  0.50 142.88 ? 10  DA  E "O3'" 1 
ATOM   7531 C  "C2'" A DA  C 3 6   ? 64.635  -18.600 91.563  0.50 135.32 ? 10  DA  E "C2'" 1 
ATOM   7532 C  "C1'" A DA  C 3 6   ? 64.965  -17.781 92.816  0.50 130.39 ? 10  DA  E "C1'" 1 
ATOM   7533 N  N9    A DA  C 3 6   ? 64.043  -16.644 92.947  0.50 131.44 ? 10  DA  E N9    1 
ATOM   7534 C  C8    A DA  C 3 6   ? 63.854  -15.600 92.076  0.50 133.13 ? 10  DA  E C8    1 
ATOM   7535 N  N7    A DA  C 3 6   ? 62.939  -14.734 92.446  0.50 133.82 ? 10  DA  E N7    1 
ATOM   7536 C  C5    A DA  C 3 6   ? 62.481  -15.254 93.637  0.50 131.55 ? 10  DA  E C5    1 
ATOM   7537 C  C6    A DA  C 3 6   ? 61.499  -14.809 94.539  0.50 129.59 ? 10  DA  E C6    1 
ATOM   7538 N  N6    A DA  C 3 6   ? 60.787  -13.694 94.350  0.50 138.32 ? 10  DA  E N6    1 
ATOM   7539 N  N1    A DA  C 3 6   ? 61.285  -15.562 95.646  0.50 116.33 ? 10  DA  E N1    1 
ATOM   7540 C  C2    A DA  C 3 6   ? 61.997  -16.683 95.835  0.50 105.49 ? 10  DA  E C2    1 
ATOM   7541 N  N3    A DA  C 3 6   ? 62.944  -17.197 95.055  0.50 112.65 ? 10  DA  E N3    1 
ATOM   7542 C  C4    A DA  C 3 6   ? 63.140  -16.429 93.964  0.50 124.31 ? 10  DA  E C4    1 
ATOM   7543 P  P     A DT  C 3 7   ? 66.085  -21.094 89.867  0.50 127.32 ? 11  DT  E P     1 
ATOM   7544 O  OP1   A DT  C 3 7   ? 67.022  -22.214 90.046  0.50 131.84 ? 11  DT  E OP1   1 
ATOM   7545 O  OP2   A DT  C 3 7   ? 65.852  -20.518 88.519  0.50 120.55 ? 11  DT  E OP2   1 
ATOM   7546 O  "O5'" A DT  C 3 7   ? 64.676  -21.521 90.440  0.50 112.85 ? 11  DT  E "O5'" 1 
ATOM   7547 C  "C5'" A DT  C 3 7   ? 64.687  -22.227 91.661  0.50 111.53 ? 11  DT  E "C5'" 1 
ATOM   7548 C  "C4'" A DT  C 3 7   ? 63.277  -22.501 92.145  0.50 107.20 ? 11  DT  E "C4'" 1 
ATOM   7549 O  "O4'" A DT  C 3 7   ? 62.715  -21.328 92.787  0.50 106.84 ? 11  DT  E "O4'" 1 
ATOM   7550 C  "C3'" A DT  C 3 7   ? 62.309  -22.945 91.047  0.50 105.22 ? 11  DT  E "C3'" 1 
ATOM   7551 O  "O3'" A DT  C 3 7   ? 62.025  -24.284 91.359  0.50 101.20 ? 11  DT  E "O3'" 1 
ATOM   7552 C  "C2'" A DT  C 3 7   ? 61.086  -22.043 91.229  0.50 103.71 ? 11  DT  E "C2'" 1 
ATOM   7553 C  "C1'" A DT  C 3 7   ? 61.330  -21.279 92.548  0.50 104.62 ? 11  DT  E "C1'" 1 
ATOM   7554 N  N1    A DT  C 3 7   ? 60.937  -19.852 92.419  0.50 109.73 ? 11  DT  E N1    1 
ATOM   7555 C  C2    A DT  C 3 7   ? 60.248  -19.187 93.410  0.50 108.34 ? 11  DT  E C2    1 
ATOM   7556 O  O2    A DT  C 3 7   ? 59.921  -19.688 94.476  0.50 109.84 ? 11  DT  E O2    1 
ATOM   7557 N  N3    A DT  C 3 7   ? 59.952  -17.883 93.097  0.50 115.31 ? 11  DT  E N3    1 
ATOM   7558 C  C4    A DT  C 3 7   ? 60.250  -17.190 91.935  0.50 115.29 ? 11  DT  E C4    1 
ATOM   7559 O  O4    A DT  C 3 7   ? 59.920  -16.013 91.781  0.50 118.46 ? 11  DT  E O4    1 
ATOM   7560 C  C5    A DT  C 3 7   ? 60.959  -17.963 90.936  0.50 117.93 ? 11  DT  E C5    1 
ATOM   7561 C  C7    A DT  C 3 7   ? 61.365  -17.392 89.607  0.50 122.46 ? 11  DT  E C7    1 
ATOM   7562 C  C6    A DT  C 3 7   ? 61.252  -19.232 91.231  0.50 112.28 ? 11  DT  E C6    1 
ATOM   7563 P  P     A DG  C 3 8   ? 61.818  -25.366 90.203  0.50 92.67  ? 12  DG  E P     1 
ATOM   7564 O  OP1   A DG  C 3 8   ? 62.065  -26.701 90.791  0.50 87.70  ? 12  DG  E OP1   1 
ATOM   7565 O  OP2   A DG  C 3 8   ? 62.595  -24.937 89.027  0.50 99.29  ? 12  DG  E OP2   1 
ATOM   7566 O  "O5'" A DG  C 3 8   ? 60.278  -25.210 89.835  0.50 76.52  ? 12  DG  E "O5'" 1 
ATOM   7567 C  "C5'" A DG  C 3 8   ? 59.301  -25.609 90.779  0.50 72.93  ? 12  DG  E "C5'" 1 
ATOM   7568 C  "C4'" A DG  C 3 8   ? 57.908  -25.470 90.216  0.50 74.78  ? 12  DG  E "C4'" 1 
ATOM   7569 O  "O4'" A DG  C 3 8   ? 57.567  -24.065 90.241  0.50 75.14  ? 12  DG  E "O4'" 1 
ATOM   7570 C  "C3'" A DG  C 3 8   ? 57.764  -25.890 88.757  0.50 81.72  ? 12  DG  E "C3'" 1 
ATOM   7571 O  "O3'" A DG  C 3 8   ? 56.423  -26.176 88.450  0.50 83.23  ? 12  DG  E "O3'" 1 
ATOM   7572 C  "C2'" A DG  C 3 8   ? 58.147  -24.604 88.035  0.50 78.87  ? 12  DG  E "C2'" 1 
ATOM   7573 C  "C1'" A DG  C 3 8   ? 57.383  -23.616 88.894  0.50 74.92  ? 12  DG  E "C1'" 1 
ATOM   7574 N  N9    A DG  C 3 8   ? 57.836  -22.231 88.840  0.50 72.69  ? 12  DG  E N9    1 
ATOM   7575 C  C8    A DG  C 3 8   ? 59.063  -21.690 88.528  0.50 72.90  ? 12  DG  E C8    1 
ATOM   7576 N  N7    A DG  C 3 8   ? 59.090  -20.385 88.618  0.50 74.97  ? 12  DG  E N7    1 
ATOM   7577 C  C5    A DG  C 3 8   ? 57.802  -20.067 89.030  0.50 77.22  ? 12  DG  E C5    1 
ATOM   7578 C  C6    A DG  C 3 8   ? 57.199  -18.828 89.307  0.50 84.41  ? 12  DG  E C6    1 
ATOM   7579 O  O6    A DG  C 3 8   ? 57.710  -17.711 89.233  0.50 90.37  ? 12  DG  E O6    1 
ATOM   7580 N  N1    A DG  C 3 8   ? 55.867  -18.967 89.691  0.50 80.82  ? 12  DG  E N1    1 
ATOM   7581 C  C2    A DG  C 3 8   ? 55.191  -20.162 89.796  0.50 69.50  ? 12  DG  E C2    1 
ATOM   7582 N  N2    A DG  C 3 8   ? 53.906  -20.134 90.183  0.50 59.14  ? 12  DG  E N2    1 
ATOM   7583 N  N3    A DG  C 3 8   ? 55.746  -21.329 89.538  0.50 69.80  ? 12  DG  E N3    1 
ATOM   7584 C  C4    A DG  C 3 8   ? 57.033  -21.190 89.166  0.50 71.53  ? 12  DG  E C4    1 
ATOM   7585 P  P     A DA  C 3 9   ? 55.886  -27.685 88.502  0.50 85.32  ? 13  DA  E P     1 
ATOM   7586 O  OP1   A DA  C 3 9   ? 56.015  -28.175 89.904  0.50 82.71  ? 13  DA  E OP1   1 
ATOM   7587 O  OP2   A DA  C 3 9   ? 56.497  -28.431 87.385  0.50 87.56  ? 13  DA  E OP2   1 
ATOM   7588 O  "O5'" A DA  C 3 9   ? 54.348  -27.535 88.118  0.50 51.63  ? 13  DA  E "O5'" 1 
ATOM   7589 C  "C5'" A DA  C 3 9   ? 54.038  -27.067 86.849  0.50 50.65  ? 13  DA  E "C5'" 1 
ATOM   7590 C  "C4'" A DA  C 3 9   ? 52.843  -26.149 86.941  0.50 49.01  ? 13  DA  E "C4'" 1 
ATOM   7591 O  "O4'" A DA  C 3 9   ? 53.248  -24.816 87.360  0.50 49.28  ? 13  DA  E "O4'" 1 
ATOM   7592 C  "C3'" A DA  C 3 9   ? 52.101  -25.973 85.626  0.50 44.32  ? 13  DA  E "C3'" 1 
ATOM   7593 O  "O3'" A DA  C 3 9   ? 50.754  -26.009 86.005  0.50 38.23  ? 13  DA  E "O3'" 1 
ATOM   7594 C  "C2'" A DA  C 3 9   ? 52.554  -24.605 85.122  0.50 46.65  ? 13  DA  E "C2'" 1 
ATOM   7595 C  "C1'" A DA  C 3 9   ? 52.830  -23.845 86.414  0.50 50.59  ? 13  DA  E "C1'" 1 
ATOM   7596 N  N9    A DA  C 3 9   ? 53.896  -22.854 86.271  0.50 49.57  ? 13  DA  E N9    1 
ATOM   7597 C  C8    A DA  C 3 9   ? 55.189  -23.057 85.833  0.50 55.26  ? 13  DA  E C8    1 
ATOM   7598 N  N7    A DA  C 3 9   ? 55.942  -21.967 85.817  0.50 55.23  ? 13  DA  E N7    1 
ATOM   7599 C  C5    A DA  C 3 9   ? 55.072  -20.991 86.256  0.50 46.88  ? 13  DA  E C5    1 
ATOM   7600 C  C6    A DA  C 3 9   ? 55.251  -19.620 86.445  0.50 50.83  ? 13  DA  E C6    1 
ATOM   7601 N  N6    A DA  C 3 9   ? 56.418  -19.025 86.200  0.50 50.99  ? 13  DA  E N6    1 
ATOM   7602 N  N1    A DA  C 3 9   ? 54.189  -18.915 86.906  0.50 52.77  ? 13  DA  E N1    1 
ATOM   7603 C  C2    A DA  C 3 9   ? 53.025  -19.540 87.150  0.50 46.59  ? 13  DA  E C2    1 
ATOM   7604 N  N3    A DA  C 3 9   ? 52.742  -20.840 86.995  0.50 40.93  ? 13  DA  E N3    1 
ATOM   7605 C  C4    A DA  C 3 9   ? 53.816  -21.510 86.548  0.50 43.34  ? 13  DA  E C4    1 
ATOM   7606 P  P     A DA  C 3 10  ? 49.597  -25.833 84.913  0.50 57.08  ? 14  DA  E P     1 
ATOM   7607 O  OP1   A DA  C 3 10  ? 48.294  -26.003 85.607  0.50 51.11  ? 14  DA  E OP1   1 
ATOM   7608 O  OP2   A DA  C 3 10  ? 49.941  -26.682 83.735  0.50 63.73  ? 14  DA  E OP2   1 
ATOM   7609 O  "O5'" A DA  C 3 10  ? 49.703  -24.292 84.521  0.50 69.53  ? 14  DA  E "O5'" 1 
ATOM   7610 C  "C5'" A DA  C 3 10  ? 49.211  -23.705 83.305  0.50 71.22  ? 14  DA  E "C5'" 1 
ATOM   7611 C  "C4'" A DA  C 3 10  ? 49.196  -22.194 83.533  0.50 67.01  ? 14  DA  E "C4'" 1 
ATOM   7612 O  "O4'" A DA  C 3 10  ? 50.241  -21.768 84.460  0.50 61.80  ? 14  DA  E "O4'" 1 
ATOM   7613 C  "C3'" A DA  C 3 10  ? 49.409  -21.293 82.335  0.50 67.70  ? 14  DA  E "C3'" 1 
ATOM   7614 O  "O3'" A DA  C 3 10  ? 48.215  -21.270 81.609  0.50 66.95  ? 14  DA  E "O3'" 1 
ATOM   7615 C  "C2'" A DA  C 3 10  ? 49.635  -19.974 83.065  0.50 68.07  ? 14  DA  E "C2'" 1 
ATOM   7616 C  "C1'" A DA  C 3 10  ? 50.553  -20.415 84.207  0.50 61.86  ? 14  DA  E "C1'" 1 
ATOM   7617 N  N9    A DA  C 3 10  ? 51.959  -20.260 83.847  0.50 64.81  ? 14  DA  E N9    1 
ATOM   7618 C  C8    A DA  C 3 10  ? 52.864  -21.205 83.441  0.50 69.50  ? 14  DA  E C8    1 
ATOM   7619 N  N7    A DA  C 3 10  ? 54.053  -20.713 83.169  0.50 69.76  ? 14  DA  E N7    1 
ATOM   7620 C  C5    A DA  C 3 10  ? 53.916  -19.355 83.411  0.50 63.91  ? 14  DA  E C5    1 
ATOM   7621 C  C6    A DA  C 3 10  ? 54.797  -18.252 83.312  0.50 53.15  ? 14  DA  E C6    1 
ATOM   7622 N  N6    A DA  C 3 10  ? 56.078  -18.322 82.942  0.50 50.47  ? 14  DA  E N6    1 
ATOM   7623 N  N1    A DA  C 3 10  ? 54.309  -17.038 83.618  0.50 44.79  ? 14  DA  E N1    1 
ATOM   7624 C  C2    A DA  C 3 10  ? 53.037  -16.928 84.003  0.50 45.15  ? 14  DA  E C2    1 
ATOM   7625 N  N3    A DA  C 3 10  ? 52.118  -17.878 84.129  0.50 49.35  ? 14  DA  E N3    1 
ATOM   7626 C  C4    A DA  C 3 10  ? 52.630  -19.071 83.817  0.50 59.16  ? 14  DA  E C4    1 
ATOM   7627 P  P     A DT  C 3 11  ? 48.230  -21.128 80.009  0.50 43.29  ? 15  DT  E P     1 
ATOM   7628 O  OP1   A DT  C 3 11  ? 46.886  -21.481 79.517  0.50 47.58  ? 15  DT  E OP1   1 
ATOM   7629 O  OP2   A DT  C 3 11  ? 49.431  -21.838 79.499  0.50 49.63  ? 15  DT  E OP2   1 
ATOM   7630 O  "O5'" A DT  C 3 11  ? 48.423  -19.553 79.768  0.50 65.07  ? 15  DT  E "O5'" 1 
ATOM   7631 C  "C5'" A DT  C 3 11  ? 47.558  -18.605 80.403  0.50 68.78  ? 15  DT  E "C5'" 1 
ATOM   7632 C  "C4'" A DT  C 3 11  ? 48.046  -17.168 80.284  0.50 62.18  ? 15  DT  E "C4'" 1 
ATOM   7633 O  "O4'" A DT  C 3 11  ? 49.245  -16.949 81.068  0.50 63.94  ? 15  DT  E "O4'" 1 
ATOM   7634 C  "C3'" A DT  C 3 11  ? 48.398  -16.770 78.869  0.50 59.64  ? 15  DT  E "C3'" 1 
ATOM   7635 O  "O3'" A DT  C 3 11  ? 47.231  -16.197 78.314  0.50 66.50  ? 15  DT  E "O3'" 1 
ATOM   7636 C  "C2'" A DT  C 3 11  ? 49.509  -15.740 79.048  0.50 55.95  ? 15  DT  E "C2'" 1 
ATOM   7637 C  "C1'" A DT  C 3 11  ? 50.182  -16.168 80.342  0.50 62.39  ? 15  DT  E "C1'" 1 
ATOM   7638 N  N1    A DT  C 3 11  ? 51.500  -16.904 80.215  0.50 65.24  ? 15  DT  E N1    1 
ATOM   7639 C  C2    A DT  C 3 11  ? 52.648  -16.157 80.350  0.50 50.31  ? 15  DT  E C2    1 
ATOM   7640 O  O2    A DT  C 3 11  ? 52.605  -14.958 80.538  0.50 44.99  ? 15  DT  E O2    1 
ATOM   7641 N  N3    A DT  C 3 11  ? 53.838  -16.839 80.243  0.50 52.27  ? 15  DT  E N3    1 
ATOM   7642 C  C4    A DT  C 3 11  ? 53.981  -18.201 80.033  0.50 60.04  ? 15  DT  E C4    1 
ATOM   7643 O  O4    A DT  C 3 11  ? 55.090  -18.742 79.954  0.50 49.05  ? 15  DT  E O4    1 
ATOM   7644 C  C5    A DT  C 3 11  ? 52.734  -18.942 79.907  0.50 77.28  ? 15  DT  E C5    1 
ATOM   7645 C  C7    A DT  C 3 11  ? 52.778  -20.428 79.661  0.50 86.08  ? 15  DT  E C7    1 
ATOM   7646 C  C6    A DT  C 3 11  ? 51.568  -18.269 80.001  0.50 74.19  ? 15  DT  E C6    1 
ATOM   7647 P  P     A DA  D 4 1   ? 67.726  -28.245 67.488  0.50 88.40  ? 1   DA  F P     1 
ATOM   7648 O  OP1   A DA  D 4 1   ? 68.139  -27.695 66.169  0.50 87.53  ? 1   DA  F OP1   1 
ATOM   7649 O  OP2   A DA  D 4 1   ? 68.684  -29.049 68.295  0.50 89.64  ? 1   DA  F OP2   1 
ATOM   7650 O  "O5'" A DA  D 4 1   ? 67.115  -27.045 68.366  0.50 83.18  ? 1   DA  F "O5'" 1 
ATOM   7651 C  "C5'" A DA  D 4 1   ? 68.032  -26.285 69.183  0.50 71.07  ? 1   DA  F "C5'" 1 
ATOM   7652 C  "C4'" A DA  D 4 1   ? 67.418  -25.026 69.746  0.50 71.89  ? 1   DA  F "C4'" 1 
ATOM   7653 O  "O4'" A DA  D 4 1   ? 66.700  -24.297 68.714  0.50 85.55  ? 1   DA  F "O4'" 1 
ATOM   7654 C  "C3'" A DA  D 4 1   ? 66.393  -25.273 70.852  0.50 76.00  ? 1   DA  F "C3'" 1 
ATOM   7655 O  "O3'" A DA  D 4 1   ? 66.584  -24.299 71.854  0.50 79.17  ? 1   DA  F "O3'" 1 
ATOM   7656 C  "C2'" A DA  D 4 1   ? 65.069  -25.017 70.140  0.50 80.07  ? 1   DA  F "C2'" 1 
ATOM   7657 C  "C1'" A DA  D 4 1   ? 65.543  -23.797 69.357  0.50 84.64  ? 1   DA  F "C1'" 1 
ATOM   7658 N  N9    A DA  D 4 1   ? 64.545  -23.170 68.474  0.50 88.54  ? 1   DA  F N9    1 
ATOM   7659 C  C8    A DA  D 4 1   ? 63.399  -23.728 67.974  0.50 92.67  ? 1   DA  F C8    1 
ATOM   7660 N  N7    A DA  D 4 1   ? 62.682  -22.911 67.235  0.50 100.48 ? 1   DA  F N7    1 
ATOM   7661 C  C5    A DA  D 4 1   ? 63.406  -21.723 67.254  0.50 106.68 ? 1   DA  F C5    1 
ATOM   7662 C  C6    A DA  D 4 1   ? 63.192  -20.454 66.652  0.50 116.80 ? 1   DA  F C6    1 
ATOM   7663 N  N6    A DA  D 4 1   ? 62.135  -20.157 65.878  0.50 124.22 ? 1   DA  F N6    1 
ATOM   7664 N  N1    A DA  D 4 1   ? 64.117  -19.495 66.884  0.50 112.10 ? 1   DA  F N1    1 
ATOM   7665 C  C2    A DA  D 4 1   ? 65.180  -19.781 67.645  0.50 103.68 ? 1   DA  F C2    1 
ATOM   7666 N  N3    A DA  D 4 1   ? 65.489  -20.928 68.253  0.50 100.58 ? 1   DA  F N3    1 
ATOM   7667 C  C4    A DA  D 4 1   ? 64.552  -21.868 68.020  0.50 96.73  ? 1   DA  F C4    1 
ATOM   7668 P  P     A DG  D 4 2   ? 67.178  -24.710 73.285  0.50 120.45 ? 2   DG  F P     1 
ATOM   7669 O  OP1   A DG  D 4 2   ? 68.200  -25.757 73.074  0.50 122.04 ? 2   DG  F OP1   1 
ATOM   7670 O  OP2   A DG  D 4 2   ? 66.036  -25.033 74.171  0.50 118.80 ? 2   DG  F OP2   1 
ATOM   7671 O  "O5'" A DG  D 4 2   ? 67.900  -23.363 73.778  0.50 120.21 ? 2   DG  F "O5'" 1 
ATOM   7672 C  "C5'" A DG  D 4 2   ? 68.990  -22.827 73.036  0.50 124.10 ? 2   DG  F "C5'" 1 
ATOM   7673 C  "C4'" A DG  D 4 2   ? 68.977  -21.306 72.886  0.50 113.91 ? 2   DG  F "C4'" 1 
ATOM   7674 O  "O4'" A DG  D 4 2   ? 68.017  -20.860 71.888  0.50 100.14 ? 2   DG  F "O4'" 1 
ATOM   7675 C  "C3'" A DG  D 4 2   ? 68.671  -20.473 74.127  0.50 106.00 ? 2   DG  F "C3'" 1 
ATOM   7676 O  "O3'" A DG  D 4 2   ? 69.488  -19.318 74.077  0.50 112.99 ? 2   DG  F "O3'" 1 
ATOM   7677 C  "C2'" A DG  D 4 2   ? 67.207  -20.092 73.928  0.50 99.37  ? 2   DG  F "C2'" 1 
ATOM   7678 C  "C1'" A DG  D 4 2   ? 67.184  -19.843 72.425  0.50 95.11  ? 2   DG  F "C1'" 1 
ATOM   7679 N  N9    A DG  D 4 2   ? 65.867  -19.962 71.790  0.50 93.35  ? 2   DG  F N9    1 
ATOM   7680 C  C8    A DG  D 4 2   ? 65.070  -21.087 71.780  0.50 94.44  ? 2   DG  F C8    1 
ATOM   7681 N  N7    A DG  D 4 2   ? 63.945  -20.939 71.138  0.50 95.43  ? 2   DG  F N7    1 
ATOM   7682 C  C5    A DG  D 4 2   ? 63.991  -19.630 70.682  0.50 101.53 ? 2   DG  F C5    1 
ATOM   7683 C  C6    A DG  D 4 2   ? 63.045  -18.909 69.915  0.50 107.48 ? 2   DG  F C6    1 
ATOM   7684 O  O6    A DG  D 4 2   ? 61.951  -19.302 69.480  0.50 110.74 ? 2   DG  F O6    1 
ATOM   7685 N  N1    A DG  D 4 2   ? 63.473  -17.606 69.660  0.50 101.24 ? 2   DG  F N1    1 
ATOM   7686 C  C2    A DG  D 4 2   ? 64.665  -17.073 70.091  0.50 98.08  ? 2   DG  F C2    1 
ATOM   7687 N  N2    A DG  D 4 2   ? 64.903  -15.798 69.745  0.50 98.18  ? 2   DG  F N2    1 
ATOM   7688 N  N3    A DG  D 4 2   ? 65.560  -17.743 70.810  0.50 94.53  ? 2   DG  F N3    1 
ATOM   7689 C  C4    A DG  D 4 2   ? 65.163  -19.013 71.070  0.50 97.30  ? 2   DG  F C4    1 
ATOM   7690 P  P     A DT  D 4 3   ? 69.896  -18.565 75.430  0.50 108.20 ? 3   DT  F P     1 
ATOM   7691 O  OP1   A DT  D 4 3   ? 71.259  -18.011 75.252  0.50 104.60 ? 3   DT  F OP1   1 
ATOM   7692 O  OP2   A DT  D 4 3   ? 69.584  -19.469 76.560  0.50 103.75 ? 3   DT  F OP2   1 
ATOM   7693 O  "O5'" A DT  D 4 3   ? 68.870  -17.340 75.501  0.50 107.78 ? 3   DT  F "O5'" 1 
ATOM   7694 C  "C5'" A DT  D 4 3   ? 69.078  -16.159 74.744  0.50 100.56 ? 3   DT  F "C5'" 1 
ATOM   7695 C  "C4'" A DT  D 4 3   ? 67.822  -15.315 74.816  0.50 91.43  ? 3   DT  F "C4'" 1 
ATOM   7696 O  "O4'" A DT  D 4 3   ? 66.858  -15.794 73.840  0.50 86.72  ? 3   DT  F "O4'" 1 
ATOM   7697 C  "C3'" A DT  D 4 3   ? 67.023  -15.438 76.109  0.50 92.19  ? 3   DT  F "C3'" 1 
ATOM   7698 O  "O3'" A DT  D 4 3   ? 67.586  -14.766 77.277  0.50 98.53  ? 3   DT  F "O3'" 1 
ATOM   7699 C  "C2'" A DT  D 4 3   ? 65.676  -14.863 75.680  0.50 87.45  ? 3   DT  F "C2'" 1 
ATOM   7700 C  "C1'" A DT  D 4 3   ? 65.576  -15.305 74.219  0.50 90.12  ? 3   DT  F "C1'" 1 
ATOM   7701 N  N1    A DT  D 4 3   ? 64.474  -16.309 73.937  0.50 99.04  ? 3   DT  F N1    1 
ATOM   7702 C  C2    A DT  D 4 3   ? 63.491  -15.951 73.022  0.50 95.24  ? 3   DT  F C2    1 
ATOM   7703 O  O2    A DT  D 4 3   ? 63.483  -14.875 72.448  0.50 86.93  ? 3   DT  F O2    1 
ATOM   7704 N  N3    A DT  D 4 3   ? 62.512  -16.892 72.795  0.50 107.78 ? 3   DT  F N3    1 
ATOM   7705 C  C4    A DT  D 4 3   ? 62.441  -18.140 73.408  0.50 115.42 ? 3   DT  F C4    1 
ATOM   7706 O  O4    A DT  D 4 3   ? 61.545  -18.946 73.166  0.50 112.03 ? 3   DT  F O4    1 
ATOM   7707 C  C5    A DT  D 4 3   ? 63.488  -18.451 74.357  0.50 123.21 ? 3   DT  F C5    1 
ATOM   7708 C  C7    A DT  D 4 3   ? 63.464  -19.788 75.043  0.50 139.13 ? 3   DT  F C7    1 
ATOM   7709 C  C6    A DT  D 4 3   ? 64.446  -17.535 74.585  0.50 115.76 ? 3   DT  F C6    1 
ATOM   7710 P  P     A DC  D 4 4   ? 67.885  -13.184 77.255  0.50 124.69 ? 4   DC  F P     1 
ATOM   7711 O  OP1   A DC  D 4 4   ? 68.238  -12.805 75.866  0.50 127.44 ? 4   DC  F OP1   1 
ATOM   7712 O  OP2   A DC  D 4 4   ? 68.823  -12.889 78.358  0.50 122.22 ? 4   DC  F OP2   1 
ATOM   7713 O  "O5'" A DC  D 4 4   ? 66.471  -12.517 77.629  0.50 75.50  ? 4   DC  F "O5'" 1 
ATOM   7714 C  "C5'" A DC  D 4 4   ? 66.123  -11.260 76.989  0.50 77.12  ? 4   DC  F "C5'" 1 
ATOM   7715 C  "C4'" A DC  D 4 4   ? 64.623  -11.019 76.805  0.50 83.53  ? 4   DC  F "C4'" 1 
ATOM   7716 O  "O4'" A DC  D 4 4   ? 64.017  -12.023 75.944  0.50 81.28  ? 4   DC  F "O4'" 1 
ATOM   7717 C  "C3'" A DC  D 4 4   ? 63.798  -11.097 78.079  0.50 91.74  ? 4   DC  F "C3'" 1 
ATOM   7718 O  "O3'" A DC  D 4 4   ? 63.831  -9.865  78.761  0.50 102.83 ? 4   DC  F "O3'" 1 
ATOM   7719 C  "C2'" A DC  D 4 4   ? 62.391  -11.412 77.580  0.50 86.60  ? 4   DC  F "C2'" 1 
ATOM   7720 C  "C1'" A DC  D 4 4   ? 62.649  -12.206 76.298  0.50 85.01  ? 4   DC  F "C1'" 1 
ATOM   7721 N  N1    A DC  D 4 4   ? 62.305  -13.681 76.378  0.50 86.54  ? 4   DC  F N1    1 
ATOM   7722 C  C2    A DC  D 4 4   ? 61.546  -14.250 75.348  0.50 86.29  ? 4   DC  F C2    1 
ATOM   7723 O  O2    A DC  D 4 4   ? 61.180  -13.544 74.399  0.50 79.27  ? 4   DC  F O2    1 
ATOM   7724 N  N3    A DC  D 4 4   ? 61.240  -15.566 75.410  0.50 100.45 ? 4   DC  F N3    1 
ATOM   7725 C  C4    A DC  D 4 4   ? 61.647  -16.314 76.445  0.50 108.51 ? 4   DC  F C4    1 
ATOM   7726 N  N4    A DC  D 4 4   ? 61.302  -17.609 76.432  0.50 121.64 ? 4   DC  F N4    1 
ATOM   7727 C  C5    A DC  D 4 4   ? 62.423  -15.763 77.511  0.50 99.51  ? 4   DC  F C5    1 
ATOM   7728 C  C6    A DC  D 4 4   ? 62.720  -14.453 77.436  0.50 93.64  ? 4   DC  F C6    1 
ATOM   7729 P  P     A DA  D 4 5   ? 63.683  -9.832  80.362  0.50 116.59 ? 5   DA  F P     1 
ATOM   7730 O  OP1   A DA  D 4 5   ? 64.477  -8.692  80.869  0.50 112.09 ? 5   DA  F OP1   1 
ATOM   7731 O  OP2   A DA  D 4 5   ? 63.926  -11.202 80.876  0.50 115.41 ? 5   DA  F OP2   1 
ATOM   7732 O  "O5'" A DA  D 4 5   ? 62.133  -9.535  80.586  0.50 122.32 ? 5   DA  F "O5'" 1 
ATOM   7733 C  "C5'" A DA  D 4 5   ? 61.377  -8.727  79.688  0.50 119.36 ? 5   DA  F "C5'" 1 
ATOM   7734 C  "C4'" A DA  D 4 5   ? 59.942  -8.799  80.166  0.50 116.00 ? 5   DA  F "C4'" 1 
ATOM   7735 O  "O4'" A DA  D 4 5   ? 59.338  -10.052 79.732  0.50 111.08 ? 5   DA  F "O4'" 1 
ATOM   7736 C  "C3'" A DA  D 4 5   ? 59.858  -8.807  81.694  0.50 120.99 ? 5   DA  F "C3'" 1 
ATOM   7737 O  "O3'" A DA  D 4 5   ? 58.712  -8.134  82.137  0.50 123.55 ? 5   DA  F "O3'" 1 
ATOM   7738 C  "C2'" A DA  D 4 5   ? 59.715  -10.279 82.032  0.50 116.79 ? 5   DA  F "C2'" 1 
ATOM   7739 C  "C1'" A DA  D 4 5   ? 58.804  -10.696 80.878  0.50 106.58 ? 5   DA  F "C1'" 1 
ATOM   7740 N  N9    A DA  D 4 5   ? 58.783  -12.146 80.747  0.50 91.62  ? 5   DA  F N9    1 
ATOM   7741 C  C8    A DA  D 4 5   ? 59.871  -12.967 80.780  0.50 92.38  ? 5   DA  F C8    1 
ATOM   7742 N  N7    A DA  D 4 5   ? 59.577  -14.238 80.667  0.50 88.21  ? 5   DA  F N7    1 
ATOM   7743 C  C5    A DA  D 4 5   ? 58.196  -14.245 80.561  0.50 79.47  ? 5   DA  F C5    1 
ATOM   7744 C  C6    A DA  D 4 5   ? 57.274  -15.299 80.418  0.50 72.44  ? 5   DA  F C6    1 
ATOM   7745 N  N6    A DA  D 4 5   ? 57.661  -16.579 80.353  0.50 78.42  ? 5   DA  F N6    1 
ATOM   7746 N  N1    A DA  D 4 5   ? 55.960  -14.981 80.343  0.50 61.11  ? 5   DA  F N1    1 
ATOM   7747 C  C2    A DA  D 4 5   ? 55.617  -13.685 80.406  0.50 60.36  ? 5   DA  F C2    1 
ATOM   7748 N  N3    A DA  D 4 5   ? 56.392  -12.611 80.543  0.50 65.93  ? 5   DA  F N3    1 
ATOM   7749 C  C4    A DA  D 4 5   ? 57.685  -12.963 80.616  0.50 78.47  ? 5   DA  F C4    1 
ATOM   7750 P  P     A DT  D 4 6   ? 58.754  -7.296  83.500  0.50 86.40  ? 6   DT  F P     1 
ATOM   7751 O  OP1   A DT  D 4 6   ? 58.375  -5.901  83.177  0.50 90.69  ? 6   DT  F OP1   1 
ATOM   7752 O  OP2   A DT  D 4 6   ? 60.028  -7.614  84.188  0.50 99.42  ? 6   DT  F OP2   1 
ATOM   7753 O  "O5'" A DT  D 4 6   ? 57.611  -7.972  84.396  0.50 52.53  ? 6   DT  F "O5'" 1 
ATOM   7754 C  "C5'" A DT  D 4 6   ? 56.258  -7.661  84.120  0.50 53.48  ? 6   DT  F "C5'" 1 
ATOM   7755 C  "C4'" A DT  D 4 6   ? 55.343  -8.875  84.124  0.50 48.77  ? 6   DT  F "C4'" 1 
ATOM   7756 O  "O4'" A DT  D 4 6   ? 55.781  -9.959  83.257  0.50 43.88  ? 6   DT  F "O4'" 1 
ATOM   7757 C  "C3'" A DT  D 4 6   ? 55.193  -9.583  85.453  0.50 45.76  ? 6   DT  F "C3'" 1 
ATOM   7758 O  "O3'" A DT  D 4 6   ? 54.538  -8.719  86.358  0.50 51.02  ? 6   DT  F "O3'" 1 
ATOM   7759 C  "C2'" A DT  D 4 6   ? 54.315  -10.733 84.979  0.50 45.26  ? 6   DT  F "C2'" 1 
ATOM   7760 C  "C1'" A DT  D 4 6   ? 54.948  -11.055 83.614  0.50 49.70  ? 6   DT  F "C1'" 1 
ATOM   7761 N  N1    A DT  D 4 6   ? 55.716  -12.341 83.639  0.50 52.06  ? 6   DT  F N1    1 
ATOM   7762 C  C2    A DT  D 4 6   ? 55.032  -13.523 83.462  0.50 51.54  ? 6   DT  F C2    1 
ATOM   7763 O  O2    A DT  D 4 6   ? 53.835  -13.583 83.266  0.50 46.83  ? 6   DT  F O2    1 
ATOM   7764 N  N3    A DT  D 4 6   ? 55.802  -14.649 83.516  0.50 52.78  ? 6   DT  F N3    1 
ATOM   7765 C  C4    A DT  D 4 6   ? 57.160  -14.713 83.728  0.50 53.17  ? 6   DT  F C4    1 
ATOM   7766 O  O4    A DT  D 4 6   ? 57.766  -15.780 83.747  0.50 52.60  ? 6   DT  F O4    1 
ATOM   7767 C  C5    A DT  D 4 6   ? 57.810  -13.443 83.914  0.50 47.54  ? 6   DT  F C5    1 
ATOM   7768 C  C7    A DT  D 4 6   ? 59.285  -13.391 84.151  0.50 57.25  ? 6   DT  F C7    1 
ATOM   7769 C  C6    A DT  D 4 6   ? 57.070  -12.333 83.864  0.50 47.72  ? 6   DT  F C6    1 
ATOM   7770 P  P     A DT  D 4 7   ? 54.312  -9.159  87.886  0.50 57.94  ? 7   DT  F P     1 
ATOM   7771 O  OP1   A DT  D 4 7   ? 53.643  -8.038  88.586  0.50 70.86  ? 7   DT  F OP1   1 
ATOM   7772 O  OP2   A DT  D 4 7   ? 55.595  -9.700  88.401  0.50 56.81  ? 7   DT  F OP2   1 
ATOM   7773 O  "O5'" A DT  D 4 7   ? 53.266  -10.359 87.779  0.50 42.71  ? 7   DT  F "O5'" 1 
ATOM   7774 C  "C5'" A DT  D 4 7   ? 51.946  -10.176 87.271  0.50 40.70  ? 7   DT  F "C5'" 1 
ATOM   7775 C  "C4'" A DT  D 4 7   ? 51.009  -11.246 87.820  0.50 44.64  ? 7   DT  F "C4'" 1 
ATOM   7776 O  "O4'" A DT  D 4 7   ? 51.322  -12.574 87.301  0.50 48.12  ? 7   DT  F "O4'" 1 
ATOM   7777 C  "C3'" A DT  D 4 7   ? 51.048  -11.383 89.333  0.50 46.89  ? 7   DT  F "C3'" 1 
ATOM   7778 O  "O3'" A DT  D 4 7   ? 49.725  -11.620 89.753  0.50 52.31  ? 7   DT  F "O3'" 1 
ATOM   7779 C  "C2'" A DT  D 4 7   ? 51.979  -12.583 89.556  0.50 52.30  ? 7   DT  F "C2'" 1 
ATOM   7780 C  "C1'" A DT  D 4 7   ? 51.771  -13.461 88.317  0.50 53.01  ? 7   DT  F "C1'" 1 
ATOM   7781 N  N1    A DT  D 4 7   ? 53.012  -14.223 87.843  0.50 61.99  ? 7   DT  F N1    1 
ATOM   7782 C  C2    A DT  D 4 7   ? 52.954  -15.566 87.472  0.50 61.51  ? 7   DT  F C2    1 
ATOM   7783 O  O2    A DT  D 4 7   ? 51.954  -16.262 87.482  0.50 63.33  ? 7   DT  F O2    1 
ATOM   7784 N  N3    A DT  D 4 7   ? 54.147  -16.104 87.057  0.50 57.91  ? 7   DT  F N3    1 
ATOM   7785 C  C4    A DT  D 4 7   ? 55.384  -15.498 86.979  0.50 54.65  ? 7   DT  F C4    1 
ATOM   7786 O  O4    A DT  D 4 7   ? 56.393  -16.103 86.603  0.50 50.95  ? 7   DT  F O4    1 
ATOM   7787 C  C5    A DT  D 4 7   ? 55.388  -14.107 87.379  0.50 59.98  ? 7   DT  F C5    1 
ATOM   7788 C  C7    A DT  D 4 7   ? 56.668  -13.326 87.344  0.50 61.33  ? 7   DT  F C7    1 
ATOM   7789 C  C6    A DT  D 4 7   ? 54.228  -13.555 87.779  0.50 57.54  ? 7   DT  F C6    1 
ATOM   7790 P  P     A DC  D 4 8   ? 49.184  -10.997 91.133  0.50 52.92  ? 8   DC  F P     1 
ATOM   7791 O  OP1   A DC  D 4 8   ? 47.700  -11.010 91.086  0.50 47.91  ? 8   DC  F OP1   1 
ATOM   7792 O  OP2   A DC  D 4 8   ? 49.962  -9.772  91.414  0.50 54.85  ? 8   DC  F OP2   1 
ATOM   7793 O  "O5'" A DC  D 4 8   ? 49.635  -12.057 92.224  0.50 47.99  ? 8   DC  F "O5'" 1 
ATOM   7794 C  "C5'" A DC  D 4 8   ? 48.932  -13.277 92.347  0.50 44.89  ? 8   DC  F "C5'" 1 
ATOM   7795 C  "C4'" A DC  D 4 8   ? 49.848  -14.336 92.933  0.50 44.85  ? 8   DC  F "C4'" 1 
ATOM   7796 O  "O4'" A DC  D 4 8   ? 50.848  -14.697 91.957  0.50 48.46  ? 8   DC  F "O4'" 1 
ATOM   7797 C  "C3'" A DC  D 4 8   ? 50.660  -13.969 94.174  0.50 41.95  ? 8   DC  F "C3'" 1 
ATOM   7798 O  "O3'" A DC  D 4 8   ? 49.756  -14.103 95.254  0.50 45.96  ? 8   DC  F "O3'" 1 
ATOM   7799 C  "C2'" A DC  D 4 8   ? 51.735  -15.052 94.139  0.50 55.00  ? 8   DC  F "C2'" 1 
ATOM   7800 C  "C1'" A DC  D 4 8   ? 51.755  -15.503 92.666  0.50 61.46  ? 8   DC  F "C1'" 1 
ATOM   7801 N  N1    A DC  D 4 8   ? 53.065  -15.381 91.985  0.50 85.24  ? 8   DC  F N1    1 
ATOM   7802 C  C2    A DC  D 4 8   ? 53.459  -16.388 91.096  0.50 91.32  ? 8   DC  F C2    1 
ATOM   7803 O  O2    A DC  D 4 8   ? 52.691  -17.345 90.908  0.50 86.16  ? 8   DC  F O2    1 
ATOM   7804 N  N3    A DC  D 4 8   ? 54.670  -16.281 90.481  0.50 101.36 ? 8   DC  F N3    1 
ATOM   7805 C  C4    A DC  D 4 8   ? 55.451  -15.230 90.738  0.50 107.43 ? 8   DC  F C4    1 
ATOM   7806 N  N4    A DC  D 4 8   ? 56.629  -15.160 90.121  0.50 107.00 ? 8   DC  F N4    1 
ATOM   7807 C  C5    A DC  D 4 8   ? 55.065  -14.202 91.641  0.50 107.72 ? 8   DC  F C5    1 
ATOM   7808 C  C6    A DC  D 4 8   ? 53.875  -14.313 92.238  0.50 100.12 ? 8   DC  F C6    1 
ATOM   7809 P  P     A DA  D 4 9   ? 50.187  -13.728 96.763  0.50 58.12  ? 9   DA  F P     1 
ATOM   7810 O  OP1   A DA  D 4 9   ? 49.002  -13.932 97.619  0.50 45.23  ? 9   DA  F OP1   1 
ATOM   7811 O  OP2   A DA  D 4 9   ? 50.915  -12.431 96.742  0.50 49.86  ? 9   DA  F OP2   1 
ATOM   7812 O  "O5'" A DA  D 4 9   ? 51.287  -14.827 97.125  0.50 63.83  ? 9   DA  F "O5'" 1 
ATOM   7813 C  "C5'" A DA  D 4 9   ? 50.946  -16.168 97.470  0.50 59.48  ? 9   DA  F "C5'" 1 
ATOM   7814 C  "C4'" A DA  D 4 9   ? 52.053  -16.766 98.333  0.50 74.40  ? 9   DA  F "C4'" 1 
ATOM   7815 O  "O4'" A DA  D 4 9   ? 53.289  -16.931 97.596  0.50 80.30  ? 9   DA  F "O4'" 1 
ATOM   7816 C  "C3'" A DA  D 4 9   ? 52.422  -15.937 99.557  0.50 83.16  ? 9   DA  F "C3'" 1 
ATOM   7817 O  "O3'" A DA  D 4 9   ? 52.528  -16.839 100.621 0.50 87.34  ? 9   DA  F "O3'" 1 
ATOM   7818 C  "C2'" A DA  D 4 9   ? 53.760  -15.267 99.241  0.50 91.44  ? 9   DA  F "C2'" 1 
ATOM   7819 C  "C1'" A DA  D 4 9   ? 54.351  -16.178 98.165  0.50 88.92  ? 9   DA  F "C1'" 1 
ATOM   7820 N  N9    A DA  D 4 9   ? 55.032  -15.530 97.040  0.50 99.55  ? 9   DA  F N9    1 
ATOM   7821 C  C8    A DA  D 4 9   ? 54.681  -14.390 96.373  0.50 96.08  ? 9   DA  F C8    1 
ATOM   7822 N  N7    A DA  D 4 9   ? 55.500  -14.091 95.386  0.50 99.90  ? 9   DA  F N7    1 
ATOM   7823 C  C5    A DA  D 4 9   ? 56.444  -15.105 95.393  0.50 105.75 ? 9   DA  F C5    1 
ATOM   7824 C  C6    A DA  D 4 9   ? 57.586  -15.389 94.608  0.50 108.66 ? 9   DA  F C6    1 
ATOM   7825 N  N6    A DA  D 4 9   ? 58.022  -14.655 93.589  0.50 113.99 ? 9   DA  F N6    1 
ATOM   7826 N  N1    A DA  D 4 9   ? 58.295  -16.494 94.904  0.50 109.59 ? 9   DA  F N1    1 
ATOM   7827 C  C2    A DA  D 4 9   ? 57.899  -17.267 95.913  0.50 105.14 ? 9   DA  F C2    1 
ATOM   7828 N  N3    A DA  D 4 9   ? 56.857  -17.101 96.721  0.50 106.04 ? 9   DA  F N3    1 
ATOM   7829 C  C4    A DA  D 4 9   ? 56.162  -15.998 96.407  0.50 99.64  ? 9   DA  F C4    1 
ATOM   7830 P  P     A DT  D 4 10  ? 52.841  -16.302 102.093 0.50 99.93  ? 10  DT  F P     1 
ATOM   7831 O  OP1   A DT  D 4 10  ? 52.257  -17.252 103.063 0.50 103.75 ? 10  DT  F OP1   1 
ATOM   7832 O  OP2   A DT  D 4 10  ? 52.460  -14.871 102.136 0.50 99.00  ? 10  DT  F OP2   1 
ATOM   7833 O  "O5'" A DT  D 4 10  ? 54.431  -16.386 102.181 0.50 118.44 ? 10  DT  F "O5'" 1 
ATOM   7834 C  "C5'" A DT  D 4 10  ? 55.061  -17.652 102.236 0.50 121.36 ? 10  DT  F "C5'" 1 
ATOM   7835 C  "C4'" A DT  D 4 10  ? 56.557  -17.495 102.053 0.50 121.85 ? 10  DT  F "C4'" 1 
ATOM   7836 O  "O4'" A DT  D 4 10  ? 56.786  -16.914 100.755 0.50 126.61 ? 10  DT  F "O4'" 1 
ATOM   7837 C  "C3'" A DT  D 4 10  ? 57.242  -16.514 103.002 0.50 110.76 ? 10  DT  F "C3'" 1 
ATOM   7838 O  "O3'" A DT  D 4 10  ? 57.823  -17.163 104.150 0.50 99.73  ? 10  DT  F "O3'" 1 
ATOM   7839 C  "C2'" A DT  D 4 10  ? 58.309  -15.822 102.142 0.50 118.57 ? 10  DT  F "C2'" 1 
ATOM   7840 C  "C1'" A DT  D 4 10  ? 58.111  -16.440 100.764 0.50 125.50 ? 10  DT  F "C1'" 1 
ATOM   7841 N  N1    A DT  D 4 10  ? 58.302  -15.506 99.609  0.50 119.04 ? 10  DT  F N1    1 
ATOM   7842 C  C2    A DT  D 4 10  ? 59.185  -15.884 98.616  0.50 110.92 ? 10  DT  F C2    1 
ATOM   7843 O  O2    A DT  D 4 10  ? 59.797  -16.937 98.654  0.50 105.72 ? 10  DT  F O2    1 
ATOM   7844 N  N3    A DT  D 4 10  ? 59.325  -14.985 97.589  0.50 112.49 ? 10  DT  F N3    1 
ATOM   7845 C  C4    A DT  D 4 10  ? 58.675  -13.769 97.449  0.50 114.55 ? 10  DT  F C4    1 
ATOM   7846 O  O4    A DT  D 4 10  ? 58.860  -13.028 96.482  0.50 125.73 ? 10  DT  F O4    1 
ATOM   7847 C  C5    A DT  D 4 10  ? 57.763  -13.437 98.522  0.50 107.04 ? 10  DT  F C5    1 
ATOM   7848 C  C7    A DT  D 4 10  ? 57.006  -12.141 98.474  0.50 99.57  ? 10  DT  F C7    1 
ATOM   7849 C  C6    A DT  D 4 10  ? 57.620  -14.304 99.541  0.50 111.66 ? 10  DT  F C6    1 
ATOM   7850 P  P     A DG  D 4 11  ? 58.286  -16.285 105.416 0.50 144.28 ? 11  DG  F P     1 
ATOM   7851 O  OP1   A DG  D 4 11  ? 57.133  -16.193 106.338 0.50 137.11 ? 11  DG  F OP1   1 
ATOM   7852 O  OP2   A DG  D 4 11  ? 58.900  -15.031 104.909 0.50 144.56 ? 11  DG  F OP2   1 
ATOM   7853 O  "O5'" A DG  D 4 11  ? 59.472  -17.146 106.067 0.50 129.23 ? 11  DG  F "O5'" 1 
ATOM   7854 C  "C5'" A DG  D 4 11  ? 60.375  -17.921 105.275 0.50 126.56 ? 11  DG  F "C5'" 1 
ATOM   7855 C  "C4'" A DG  D 4 11  ? 61.727  -17.275 104.985 0.50 125.73 ? 11  DG  F "C4'" 1 
ATOM   7856 O  "O4'" A DG  D 4 11  ? 61.756  -16.820 103.612 0.50 128.72 ? 11  DG  F "O4'" 1 
ATOM   7857 C  "C3'" A DG  D 4 11  ? 62.151  -16.066 105.809 0.50 125.83 ? 11  DG  F "C3'" 1 
ATOM   7858 O  "O3'" A DG  D 4 11  ? 62.886  -16.503 106.951 0.50 127.24 ? 11  DG  F "O3'" 1 
ATOM   7859 C  "C2'" A DG  D 4 11  ? 63.045  -15.273 104.851 0.50 126.11 ? 11  DG  F "C2'" 1 
ATOM   7860 C  "C1'" A DG  D 4 11  ? 62.742  -15.824 103.455 0.50 130.18 ? 11  DG  F "C1'" 1 
ATOM   7861 N  N9    A DG  D 4 11  ? 62.207  -14.837 102.513 0.50 132.23 ? 11  DG  F N9    1 
ATOM   7862 C  C8    A DG  D 4 11  ? 61.268  -13.878 102.818 0.50 136.85 ? 11  DG  F C8    1 
ATOM   7863 N  N7    A DG  D 4 11  ? 60.943  -13.122 101.809 0.50 131.17 ? 11  DG  F N7    1 
ATOM   7864 C  C5    A DG  D 4 11  ? 61.713  -13.605 100.759 0.50 138.95 ? 11  DG  F C5    1 
ATOM   7865 C  C6    A DG  D 4 11  ? 61.771  -13.155 99.419  0.50 144.98 ? 11  DG  F C6    1 
ATOM   7866 O  O6    A DG  D 4 11  ? 61.131  -12.225 98.904  0.50 143.04 ? 11  DG  F O6    1 
ATOM   7867 N  N1    A DG  D 4 11  ? 62.673  -13.904 98.661  0.50 141.44 ? 11  DG  F N1    1 
ATOM   7868 C  C2    A DG  D 4 11  ? 63.422  -14.952 99.150  0.50 153.61 ? 11  DG  F C2    1 
ATOM   7869 N  N2    A DG  D 4 11  ? 64.237  -15.544 98.254  0.50 149.46 ? 11  DG  F N2    1 
ATOM   7870 N  N3    A DG  D 4 11  ? 63.374  -15.383 100.414 0.50 136.13 ? 11  DG  F N3    1 
ATOM   7871 C  C4    A DG  D 4 11  ? 62.499  -14.666 101.166 0.50 132.21 ? 11  DG  F C4    1 
ATOM   7872 C  "C5'" B DC  E 5 5   ? 68.448  -10.093 92.573  0.50 133.60 ? 9   DC  G "C5'" 1 
ATOM   7873 C  "C4'" B DC  E 5 5   ? 68.568  -11.580 92.866  0.50 137.38 ? 9   DC  G "C4'" 1 
ATOM   7874 O  "O4'" B DC  E 5 5   ? 67.911  -11.862 94.126  0.50 140.49 ? 9   DC  G "O4'" 1 
ATOM   7875 C  "C3'" B DC  E 5 5   ? 67.918  -12.513 91.845  0.50 141.07 ? 9   DC  G "C3'" 1 
ATOM   7876 O  "O3'" B DC  E 5 5   ? 68.635  -13.752 91.724  0.50 143.29 ? 9   DC  G "O3'" 1 
ATOM   7877 C  "C2'" B DC  E 5 5   ? 66.535  -12.736 92.439  0.50 141.92 ? 9   DC  G "C2'" 1 
ATOM   7878 C  "C1'" B DC  E 5 5   ? 66.860  -12.784 93.925  0.50 140.49 ? 9   DC  G "C1'" 1 
ATOM   7879 N  N1    B DC  E 5 5   ? 65.705  -12.356 94.739  0.50 140.17 ? 9   DC  G N1    1 
ATOM   7880 C  C2    B DC  E 5 5   ? 65.197  -13.190 95.749  0.50 137.66 ? 9   DC  G C2    1 
ATOM   7881 O  O2    B DC  E 5 5   ? 65.725  -14.292 95.974  0.50 131.90 ? 9   DC  G O2    1 
ATOM   7882 N  N3    B DC  E 5 5   ? 64.128  -12.750 96.461  0.50 144.40 ? 9   DC  G N3    1 
ATOM   7883 C  C4    B DC  E 5 5   ? 63.575  -11.557 96.201  0.50 154.36 ? 9   DC  G C4    1 
ATOM   7884 N  N4    B DC  E 5 5   ? 62.519  -11.174 96.937  0.50 168.82 ? 9   DC  G N4    1 
ATOM   7885 C  C5    B DC  E 5 5   ? 64.083  -10.705 95.172  0.50 151.46 ? 9   DC  G C5    1 
ATOM   7886 C  C6    B DC  E 5 5   ? 65.137  -11.143 94.474  0.50 147.19 ? 9   DC  G C6    1 
ATOM   7887 P  P     B DG  E 5 6   ? 68.427  -14.687 90.429  0.50 140.29 ? 10  DG  G P     1 
ATOM   7888 O  OP1   B DG  E 5 6   ? 69.752  -15.183 90.005  0.50 139.58 ? 10  DG  G OP1   1 
ATOM   7889 O  OP2   B DG  E 5 6   ? 67.561  -13.962 89.470  0.50 134.19 ? 10  DG  G OP2   1 
ATOM   7890 O  "O5'" B DG  E 5 6   ? 67.593  -15.926 90.992  0.50 110.48 ? 10  DG  G "O5'" 1 
ATOM   7891 C  "C5'" B DG  E 5 6   ? 68.182  -16.818 91.930  0.50 108.16 ? 10  DG  G "C5'" 1 
ATOM   7892 C  "C4'" B DG  E 5 6   ? 67.219  -17.960 92.199  0.50 126.11 ? 10  DG  G "C4'" 1 
ATOM   7893 O  "O4'" B DG  E 5 6   ? 66.150  -17.511 93.059  0.50 128.74 ? 10  DG  G "O4'" 1 
ATOM   7894 C  "C3'" B DG  E 5 6   ? 66.565  -18.551 90.952  0.50 138.75 ? 10  DG  G "C3'" 1 
ATOM   7895 O  "O3'" B DG  E 5 6   ? 66.661  -19.961 91.044  0.50 152.85 ? 10  DG  G "O3'" 1 
ATOM   7896 C  "C2'" B DG  E 5 6   ? 65.122  -18.053 90.969  0.50 137.14 ? 10  DG  G "C2'" 1 
ATOM   7897 C  "C1'" B DG  E 5 6   ? 64.895  -17.674 92.427  0.50 131.09 ? 10  DG  G "C1'" 1 
ATOM   7898 N  N9    B DG  E 5 6   ? 64.142  -16.437 92.603  0.50 132.12 ? 10  DG  G N9    1 
ATOM   7899 C  C8    B DG  E 5 6   ? 64.067  -15.354 91.761  0.50 134.22 ? 10  DG  G C8    1 
ATOM   7900 N  N7    B DG  E 5 6   ? 63.298  -14.404 92.220  0.50 134.68 ? 10  DG  G N7    1 
ATOM   7901 C  C5    B DG  E 5 6   ? 62.833  -14.886 93.438  0.50 133.90 ? 10  DG  G C5    1 
ATOM   7902 C  C6    B DG  E 5 6   ? 61.964  -14.310 94.403  0.50 134.83 ? 10  DG  G C6    1 
ATOM   7903 O  O6    B DG  E 5 6   ? 61.397  -13.207 94.379  0.50 142.34 ? 10  DG  G O6    1 
ATOM   7904 N  N1    B DG  E 5 6   ? 61.764  -15.152 95.495  0.50 122.73 ? 10  DG  G N1    1 
ATOM   7905 C  C2    B DG  E 5 6   ? 62.329  -16.399 95.634  0.50 111.25 ? 10  DG  G C2    1 
ATOM   7906 N  N2    B DG  E 5 6   ? 62.024  -17.082 96.749  0.50 97.35  ? 10  DG  G N2    1 
ATOM   7907 N  N3    B DG  E 5 6   ? 63.144  -16.946 94.740  0.50 118.59 ? 10  DG  G N3    1 
ATOM   7908 C  C4    B DG  E 5 6   ? 63.350  -16.137 93.679  0.50 127.53 ? 10  DG  G C4    1 
ATOM   7909 P  P     B DT  E 5 7   ? 66.060  -20.892 89.895  0.50 126.56 ? 11  DT  G P     1 
ATOM   7910 O  OP1   B DT  E 5 7   ? 66.947  -22.064 89.748  0.50 129.68 ? 11  DT  G OP1   1 
ATOM   7911 O  OP2   B DT  E 5 7   ? 65.758  -20.041 88.729  0.50 116.34 ? 11  DT  G OP2   1 
ATOM   7912 O  "O5'" B DT  E 5 7   ? 64.677  -21.373 90.506  0.50 112.74 ? 11  DT  G "O5'" 1 
ATOM   7913 C  "C5'" B DT  E 5 7   ? 64.701  -22.312 91.553  0.50 111.79 ? 11  DT  G "C5'" 1 
ATOM   7914 C  "C4'" B DT  E 5 7   ? 63.358  -22.294 92.239  0.50 107.70 ? 11  DT  G "C4'" 1 
ATOM   7915 O  "O4'" B DT  E 5 7   ? 63.030  -20.941 92.624  0.50 107.64 ? 11  DT  G "O4'" 1 
ATOM   7916 C  "C3'" B DT  E 5 7   ? 62.204  -22.722 91.346  0.50 105.17 ? 11  DT  G "C3'" 1 
ATOM   7917 O  "O3'" B DT  E 5 7   ? 61.962  -24.090 91.595  0.50 104.31 ? 11  DT  G "O3'" 1 
ATOM   7918 C  "C2'" B DT  E 5 7   ? 61.022  -21.871 91.817  0.50 103.99 ? 11  DT  G "C2'" 1 
ATOM   7919 C  "C1'" B DT  E 5 7   ? 61.630  -20.898 92.820  0.50 104.82 ? 11  DT  G "C1'" 1 
ATOM   7920 N  N1    B DT  E 5 7   ? 61.172  -19.497 92.641  0.50 111.94 ? 11  DT  G N1    1 
ATOM   7921 C  C2    B DT  E 5 7   ? 60.376  -18.896 93.604  0.50 111.06 ? 11  DT  G C2    1 
ATOM   7922 O  O2    B DT  E 5 7   ? 59.985  -19.439 94.640  0.50 109.16 ? 11  DT  G O2    1 
ATOM   7923 N  N3    B DT  E 5 7   ? 60.037  -17.604 93.288  0.50 115.25 ? 11  DT  G N3    1 
ATOM   7924 C  C4    B DT  E 5 7   ? 60.383  -16.863 92.176  0.50 116.67 ? 11  DT  G C4    1 
ATOM   7925 O  O4    B DT  E 5 7   ? 60.006  -15.701 92.024  0.50 118.06 ? 11  DT  G O4    1 
ATOM   7926 C  C5    B DT  E 5 7   ? 61.206  -17.569 91.219  0.50 119.13 ? 11  DT  G C5    1 
ATOM   7927 C  C7    B DT  E 5 7   ? 61.661  -16.906 89.957  0.50 122.46 ? 11  DT  G C7    1 
ATOM   7928 C  C6    B DT  E 5 7   ? 61.555  -18.831 91.496  0.50 112.85 ? 11  DT  G C6    1 
ATOM   7929 P  P     B DG  E 5 8   ? 61.696  -25.103 90.384  0.50 91.26  ? 12  DG  G P     1 
ATOM   7930 O  OP1   B DG  E 5 8   ? 61.914  -26.472 90.897  0.50 89.43  ? 12  DG  G OP1   1 
ATOM   7931 O  OP2   B DG  E 5 8   ? 62.435  -24.606 89.201  0.50 95.87  ? 12  DG  G OP2   1 
ATOM   7932 O  "O5'" B DG  E 5 8   ? 60.159  -24.879 90.045  0.50 71.18  ? 12  DG  G "O5'" 1 
ATOM   7933 C  "C5'" B DG  E 5 8   ? 59.180  -25.338 90.929  0.50 73.04  ? 12  DG  G "C5'" 1 
ATOM   7934 C  "C4'" B DG  E 5 8   ? 57.813  -25.141 90.315  0.50 76.12  ? 12  DG  G "C4'" 1 
ATOM   7935 O  "O4'" B DG  E 5 8   ? 57.520  -23.724 90.298  0.50 74.09  ? 12  DG  G "O4'" 1 
ATOM   7936 C  "C3'" B DG  E 5 8   ? 57.705  -25.593 88.866  0.50 79.45  ? 12  DG  G "C3'" 1 
ATOM   7937 O  "O3'" B DG  E 5 8   ? 56.367  -25.840 88.538  0.50 83.45  ? 12  DG  G "O3'" 1 
ATOM   7938 C  "C2'" B DG  E 5 8   ? 58.120  -24.328 88.125  0.50 77.16  ? 12  DG  G "C2'" 1 
ATOM   7939 C  "C1'" B DG  E 5 8   ? 57.319  -23.331 88.947  0.50 73.99  ? 12  DG  G "C1'" 1 
ATOM   7940 N  N9    B DG  E 5 8   ? 57.801  -21.971 88.907  0.50 72.41  ? 12  DG  G N9    1 
ATOM   7941 C  C8    B DG  E 5 8   ? 59.053  -21.540 88.576  0.50 71.86  ? 12  DG  G C8    1 
ATOM   7942 N  N7    B DG  E 5 8   ? 59.176  -20.251 88.668  0.50 74.29  ? 12  DG  G N7    1 
ATOM   7943 C  C5    B DG  E 5 8   ? 57.931  -19.816 89.101  0.50 78.58  ? 12  DG  G C5    1 
ATOM   7944 C  C6    B DG  E 5 8   ? 57.459  -18.515 89.395  0.50 87.75  ? 12  DG  G C6    1 
ATOM   7945 O  O6    B DG  E 5 8   ? 58.069  -17.438 89.325  0.50 90.36  ? 12  DG  G O6    1 
ATOM   7946 N  N1    B DG  E 5 8   ? 56.132  -18.535 89.808  0.50 84.86  ? 12  DG  G N1    1 
ATOM   7947 C  C2    B DG  E 5 8   ? 55.357  -19.653 89.924  0.50 74.35  ? 12  DG  G C2    1 
ATOM   7948 N  N2    B DG  E 5 8   ? 54.100  -19.460 90.346  0.50 64.60  ? 12  DG  G N2    1 
ATOM   7949 N  N3    B DG  E 5 8   ? 55.787  -20.875 89.654  0.50 70.98  ? 12  DG  G N3    1 
ATOM   7950 C  C4    B DG  E 5 8   ? 57.075  -20.870 89.252  0.50 71.84  ? 12  DG  G C4    1 
ATOM   7951 P  P     B DC  E 5 9   ? 55.745  -27.292 88.749  0.50 84.16  ? 13  DC  G P     1 
ATOM   7952 O  OP1   B DC  E 5 9   ? 55.849  -27.616 90.179  0.50 82.94  ? 13  DC  G OP1   1 
ATOM   7953 O  OP2   B DC  E 5 9   ? 56.331  -28.196 87.746  0.50 87.08  ? 13  DC  G OP2   1 
ATOM   7954 O  "O5'" B DC  E 5 9   ? 54.215  -27.096 88.361  0.50 50.91  ? 13  DC  G "O5'" 1 
ATOM   7955 C  "C5'" B DC  E 5 9   ? 53.870  -26.661 87.088  0.50 49.62  ? 13  DC  G "C5'" 1 
ATOM   7956 C  "C4'" B DC  E 5 9   ? 52.817  -25.571 87.136  0.50 48.86  ? 13  DC  G "C4'" 1 
ATOM   7957 O  "O4'" B DC  E 5 9   ? 53.437  -24.298 87.466  0.50 49.30  ? 13  DC  G "O4'" 1 
ATOM   7958 C  "C3'" B DC  E 5 9   ? 52.064  -25.373 85.822  0.50 42.77  ? 13  DC  G "C3'" 1 
ATOM   7959 O  "O3'" B DC  E 5 9   ? 50.668  -25.566 86.129  0.50 33.46  ? 13  DC  G "O3'" 1 
ATOM   7960 C  "C2'" B DC  E 5 9   ? 52.490  -23.985 85.334  0.50 46.96  ? 13  DC  G "C2'" 1 
ATOM   7961 C  "C1'" B DC  E 5 9   ? 52.929  -23.282 86.620  0.50 48.77  ? 13  DC  G "C1'" 1 
ATOM   7962 N  N1    B DC  E 5 9   ? 53.982  -22.163 86.504  0.50 46.65  ? 13  DC  G N1    1 
ATOM   7963 C  C2    B DC  E 5 9   ? 53.622  -20.861 86.876  0.50 41.73  ? 13  DC  G C2    1 
ATOM   7964 O  O2    B DC  E 5 9   ? 52.483  -20.665 87.275  0.50 44.67  ? 13  DC  G O2    1 
ATOM   7965 N  N3    B DC  E 5 9   ? 54.506  -19.844 86.794  0.50 46.37  ? 13  DC  G N3    1 
ATOM   7966 C  C4    B DC  E 5 9   ? 55.744  -20.083 86.362  0.50 51.64  ? 13  DC  G C4    1 
ATOM   7967 N  N4    B DC  E 5 9   ? 56.570  -19.030 86.307  0.50 50.25  ? 13  DC  G N4    1 
ATOM   7968 C  C5    B DC  E 5 9   ? 56.164  -21.400 85.980  0.50 53.35  ? 13  DC  G C5    1 
ATOM   7969 C  C6    B DC  E 5 9   ? 55.259  -22.394 86.067  0.50 53.48  ? 13  DC  G C6    1 
ATOM   7970 P  P     B DA  E 5 10  ? 49.543  -25.331 85.008  0.50 56.97  ? 14  DA  G P     1 
ATOM   7971 O  OP1   B DA  E 5 10  ? 48.241  -25.693 85.590  0.50 51.02  ? 14  DA  G OP1   1 
ATOM   7972 O  OP2   B DA  E 5 10  ? 49.976  -26.024 83.769  0.50 61.73  ? 14  DA  G OP2   1 
ATOM   7973 O  "O5'" B DA  E 5 10  ? 49.583  -23.748 84.785  0.50 72.34  ? 14  DA  G "O5'" 1 
ATOM   7974 C  "C5'" B DA  E 5 10  ? 49.400  -23.136 83.524  0.50 69.95  ? 14  DA  G "C5'" 1 
ATOM   7975 C  "C4'" B DA  E 5 10  ? 49.327  -21.632 83.703  0.50 65.81  ? 14  DA  G "C4'" 1 
ATOM   7976 O  "O4'" B DA  E 5 10  ? 50.351  -21.157 84.620  0.50 60.66  ? 14  DA  G "O4'" 1 
ATOM   7977 C  "C3'" B DA  E 5 10  ? 49.495  -20.779 82.451  0.50 68.15  ? 14  DA  G "C3'" 1 
ATOM   7978 O  "O3'" B DA  E 5 10  ? 48.264  -20.848 81.756  0.50 69.41  ? 14  DA  G "O3'" 1 
ATOM   7979 C  "C2'" B DA  E 5 10  ? 49.695  -19.427 83.113  0.50 68.11  ? 14  DA  G "C2'" 1 
ATOM   7980 C  "C1'" B DA  E 5 10  ? 50.610  -19.801 84.289  0.50 62.95  ? 14  DA  G "C1'" 1 
ATOM   7981 N  N9    B DA  E 5 10  ? 52.016  -19.643 83.936  0.50 62.49  ? 14  DA  G N9    1 
ATOM   7982 C  C8    B DA  E 5 10  ? 52.910  -20.585 83.500  0.50 67.84  ? 14  DA  G C8    1 
ATOM   7983 N  N7    B DA  E 5 10  ? 54.109  -20.105 83.249  0.50 67.21  ? 14  DA  G N7    1 
ATOM   7984 C  C5    B DA  E 5 10  ? 53.979  -18.755 83.519  0.50 59.03  ? 14  DA  G C5    1 
ATOM   7985 C  C6    B DA  E 5 10  ? 54.882  -17.674 83.457  0.50 48.72  ? 14  DA  G C6    1 
ATOM   7986 N  N6    B DA  E 5 10  ? 56.167  -17.779 83.096  0.50 50.11  ? 14  DA  G N6    1 
ATOM   7987 N  N1    B DA  E 5 10  ? 54.406  -16.462 83.806  0.50 43.85  ? 14  DA  G N1    1 
ATOM   7988 C  C2    B DA  E 5 10  ? 53.129  -16.333 84.193  0.50 42.64  ? 14  DA  G C2    1 
ATOM   7989 N  N3    B DA  E 5 10  ? 52.188  -17.266 84.303  0.50 43.63  ? 14  DA  G N3    1 
ATOM   7990 C  C4    B DA  E 5 10  ? 52.692  -18.458 83.945  0.50 54.84  ? 14  DA  G C4    1 
ATOM   7991 P  P     B DT  E 5 11  ? 48.170  -20.473 80.186  0.50 42.75  ? 15  DT  G P     1 
ATOM   7992 O  OP1   B DT  E 5 11  ? 46.779  -20.705 79.763  0.50 35.69  ? 15  DT  G OP1   1 
ATOM   7993 O  OP2   B DT  E 5 11  ? 49.281  -21.150 79.467  0.50 42.59  ? 15  DT  G OP2   1 
ATOM   7994 O  "O5'" B DT  E 5 11  ? 48.456  -18.903 80.154  0.50 72.00  ? 15  DT  G "O5'" 1 
ATOM   7995 C  "C5'" B DT  E 5 11  ? 47.501  -18.002 80.691  0.50 67.09  ? 15  DT  G "C5'" 1 
ATOM   7996 C  "C4'" B DT  E 5 11  ? 48.010  -16.602 80.451  0.50 62.42  ? 15  DT  G "C4'" 1 
ATOM   7997 O  "O4'" B DT  E 5 11  ? 49.202  -16.413 81.238  0.50 64.49  ? 15  DT  G "O4'" 1 
ATOM   7998 C  "C3'" B DT  E 5 11  ? 48.473  -16.389 79.026  0.50 59.93  ? 15  DT  G "C3'" 1 
ATOM   7999 O  "O3'" B DT  E 5 11  ? 47.368  -15.982 78.232  0.50 71.01  ? 15  DT  G "O3'" 1 
ATOM   8000 C  "C2'" B DT  E 5 11  ? 49.490  -15.271 79.179  0.50 57.35  ? 15  DT  G "C2'" 1 
ATOM   8001 C  "C1'" B DT  E 5 11  ? 50.112  -15.595 80.523  0.50 63.18  ? 15  DT  G "C1'" 1 
ATOM   8002 N  N1    B DT  E 5 11  ? 51.446  -16.250 80.399  0.50 59.18  ? 15  DT  G N1    1 
ATOM   8003 C  C2    B DT  E 5 11  ? 52.543  -15.432 80.506  0.50 46.28  ? 15  DT  G C2    1 
ATOM   8004 O  O2    B DT  E 5 11  ? 52.468  -14.223 80.688  0.50 42.87  ? 15  DT  G O2    1 
ATOM   8005 N  N3    B DT  E 5 11  ? 53.739  -16.082 80.379  0.50 49.11  ? 15  DT  G N3    1 
ATOM   8006 C  C4    B DT  E 5 11  ? 53.968  -17.423 80.174  0.50 56.57  ? 15  DT  G C4    1 
ATOM   8007 O  O4    B DT  E 5 11  ? 55.116  -17.860 80.084  0.50 51.70  ? 15  DT  G O4    1 
ATOM   8008 C  C5    B DT  E 5 11  ? 52.765  -18.227 80.079  0.50 70.54  ? 15  DT  G C5    1 
ATOM   8009 C  C7    B DT  E 5 11  ? 52.854  -19.711 79.853  0.50 82.06  ? 15  DT  G C7    1 
ATOM   8010 C  C6    B DT  E 5 11  ? 51.575  -17.607 80.191  0.50 69.88  ? 15  DT  G C6    1 
ATOM   8011 P  P     B DG  F 6 1   ? 67.513  -28.045 67.166  0.50 99.78  ? 1   DG  H P     1 
ATOM   8012 O  OP1   B DG  F 6 1   ? 68.156  -27.782 65.855  0.50 100.02 ? 1   DG  H OP1   1 
ATOM   8013 O  OP2   B DG  F 6 1   ? 68.329  -28.260 68.384  0.50 94.44  ? 1   DG  H OP2   1 
ATOM   8014 O  "O5'" B DG  F 6 1   ? 66.465  -26.876 67.449  0.50 89.81  ? 1   DG  H "O5'" 1 
ATOM   8015 C  "C5'" B DG  F 6 1   ? 66.059  -26.618 68.761  0.50 82.59  ? 1   DG  H "C5'" 1 
ATOM   8016 C  "C4'" B DG  F 6 1   ? 66.683  -25.355 69.325  0.50 74.84  ? 1   DG  H "C4'" 1 
ATOM   8017 O  "O4'" B DG  F 6 1   ? 66.317  -24.207 68.515  0.50 76.96  ? 1   DG  H "O4'" 1 
ATOM   8018 C  "C3'" B DG  F 6 1   ? 66.113  -25.026 70.694  0.50 80.20  ? 1   DG  H "C3'" 1 
ATOM   8019 O  "O3'" B DG  F 6 1   ? 66.991  -24.216 71.461  0.50 88.33  ? 1   DG  H "O3'" 1 
ATOM   8020 C  "C2'" B DG  F 6 1   ? 64.867  -24.241 70.315  0.50 74.92  ? 1   DG  H "C2'" 1 
ATOM   8021 C  "C1'" B DG  F 6 1   ? 65.474  -23.334 69.256  0.50 78.84  ? 1   DG  H "C1'" 1 
ATOM   8022 N  N9    B DG  F 6 1   ? 64.437  -22.687 68.441  0.50 90.63  ? 1   DG  H N9    1 
ATOM   8023 C  C8    B DG  F 6 1   ? 63.247  -23.243 68.025  0.50 95.05  ? 1   DG  H C8    1 
ATOM   8024 N  N7    B DG  F 6 1   ? 62.491  -22.447 67.320  0.50 104.38 ? 1   DG  H N7    1 
ATOM   8025 C  C5    B DG  F 6 1   ? 63.227  -21.275 67.264  0.50 111.19 ? 1   DG  H C5    1 
ATOM   8026 C  C6    B DG  F 6 1   ? 62.910  -20.053 66.634  0.50 120.17 ? 1   DG  H C6    1 
ATOM   8027 O  O6    B DG  F 6 1   ? 61.889  -19.773 65.986  0.50 129.42 ? 1   DG  H O6    1 
ATOM   8028 N  N1    B DG  F 6 1   ? 63.915  -19.109 66.817  0.50 114.57 ? 1   DG  H N1    1 
ATOM   8029 C  C2    B DG  F 6 1   ? 65.077  -19.331 67.514  0.50 102.39 ? 1   DG  H C2    1 
ATOM   8030 N  N2    B DG  F 6 1   ? 65.927  -18.298 67.581  0.50 79.48  ? 1   DG  H N2    1 
ATOM   8031 N  N3    B DG  F 6 1   ? 65.389  -20.472 68.111  0.50 101.97 ? 1   DG  H N3    1 
ATOM   8032 C  C4    B DG  F 6 1   ? 64.419  -21.399 67.948  0.50 101.23 ? 1   DG  H C4    1 
ATOM   8033 P  P     B DA  F 6 2   ? 67.064  -24.399 73.057  0.50 103.48 ? 2   DA  H P     1 
ATOM   8034 O  OP1   B DA  F 6 2   ? 67.864  -25.616 73.337  0.50 111.24 ? 2   DA  H OP1   1 
ATOM   8035 O  OP2   B DA  F 6 2   ? 65.685  -24.323 73.593  0.50 98.99  ? 2   DA  H OP2   1 
ATOM   8036 O  "O5'" B DA  F 6 2   ? 67.850  -23.095 73.537  0.50 128.06 ? 2   DA  H "O5'" 1 
ATOM   8037 C  "C5'" B DA  F 6 2   ? 68.888  -22.608 72.704  0.50 119.87 ? 2   DA  H "C5'" 1 
ATOM   8038 C  "C4'" B DA  F 6 2   ? 69.060  -21.098 72.800  0.50 109.82 ? 2   DA  H "C4'" 1 
ATOM   8039 O  "O4'" B DA  F 6 2   ? 68.165  -20.383 71.904  0.50 97.02  ? 2   DA  H "O4'" 1 
ATOM   8040 C  "C3'" B DA  F 6 2   ? 68.817  -20.492 74.165  0.50 108.64 ? 2   DA  H "C3'" 1 
ATOM   8041 O  "O3'" B DA  F 6 2   ? 69.742  -19.437 74.291  0.50 109.26 ? 2   DA  H "O3'" 1 
ATOM   8042 C  "C2'" B DA  F 6 2   ? 67.378  -19.982 74.061  0.50 102.76 ? 2   DA  H "C2'" 1 
ATOM   8043 C  "C1'" B DA  F 6 2   ? 67.331  -19.487 72.617  0.50 95.74  ? 2   DA  H "C1'" 1 
ATOM   8044 N  N9    B DA  F 6 2   ? 66.016  -19.552 71.970  0.50 94.96  ? 2   DA  H N9    1 
ATOM   8045 C  C8    B DA  F 6 2   ? 65.191  -20.643 71.964  0.50 94.17  ? 2   DA  H C8    1 
ATOM   8046 N  N7    B DA  F 6 2   ? 64.071  -20.468 71.312  0.50 96.48  ? 2   DA  H N7    1 
ATOM   8047 C  C5    B DA  F 6 2   ? 64.166  -19.170 70.843  0.50 99.16  ? 2   DA  H C5    1 
ATOM   8048 C  C6    B DA  F 6 2   ? 63.277  -18.401 70.073  0.50 100.40 ? 2   DA  H C6    1 
ATOM   8049 N  N6    B DA  F 6 2   ? 62.110  -18.889 69.651  0.50 105.62 ? 2   DA  H N6    1 
ATOM   8050 N  N1    B DA  F 6 2   ? 63.633  -17.135 69.762  0.50 99.06  ? 2   DA  H N1    1 
ATOM   8051 C  C2    B DA  F 6 2   ? 64.821  -16.695 70.213  0.50 93.40  ? 2   DA  H C2    1 
ATOM   8052 N  N3    B DA  F 6 2   ? 65.748  -17.325 70.944  0.50 93.81  ? 2   DA  H N3    1 
ATOM   8053 C  C4    B DA  F 6 2   ? 65.356  -18.581 71.233  0.50 96.34  ? 2   DA  H C4    1 
ATOM   8054 P  P     B DC  F 6 3   ? 69.897  -18.671 75.691  0.50 95.65  ? 3   DC  H P     1 
ATOM   8055 O  OP1   B DC  F 6 3   ? 71.244  -18.056 75.726  0.50 97.66  ? 3   DC  H OP1   1 
ATOM   8056 O  OP2   B DC  F 6 3   ? 69.440  -19.591 76.763  0.50 92.38  ? 3   DC  H OP2   1 
ATOM   8057 O  "O5'" B DC  F 6 3   ? 68.827  -17.493 75.587  0.50 105.42 ? 3   DC  H "O5'" 1 
ATOM   8058 C  "C5'" B DC  F 6 3   ? 69.228  -16.260 75.005  0.50 104.02 ? 3   DC  H "C5'" 1 
ATOM   8059 C  "C4'" B DC  F 6 3   ? 68.080  -15.267 75.010  0.50 94.46  ? 3   DC  H "C4'" 1 
ATOM   8060 O  "O4'" B DC  F 6 3   ? 67.100  -15.689 74.036  0.50 87.85  ? 3   DC  H "O4'" 1 
ATOM   8061 C  "C3'" B DC  F 6 3   ? 67.270  -15.173 76.304  0.50 94.53  ? 3   DC  H "C3'" 1 
ATOM   8062 O  "O3'" B DC  F 6 3   ? 67.915  -14.384 77.349  0.50 103.87 ? 3   DC  H "O3'" 1 
ATOM   8063 C  "C2'" B DC  F 6 3   ? 65.958  -14.576 75.800  0.50 88.52  ? 3   DC  H "C2'" 1 
ATOM   8064 C  "C1'" B DC  F 6 3   ? 65.865  -15.079 74.355  0.50 86.53  ? 3   DC  H "C1'" 1 
ATOM   8065 N  N1    B DC  F 6 3   ? 64.758  -16.054 74.099  0.50 94.06  ? 3   DC  H N1    1 
ATOM   8066 C  C2    B DC  F 6 3   ? 63.694  -15.658 73.277  0.50 93.63  ? 3   DC  H C2    1 
ATOM   8067 O  O2    B DC  F 6 3   ? 63.699  -14.519 72.793  0.50 88.46  ? 3   DC  H O2    1 
ATOM   8068 N  N3    B DC  F 6 3   ? 62.688  -16.534 73.033  0.50 102.37 ? 3   DC  H N3    1 
ATOM   8069 C  C4    B DC  F 6 3   ? 62.720  -17.750 73.572  0.50 113.45 ? 3   DC  H C4    1 
ATOM   8070 N  N4    B DC  F 6 3   ? 61.698  -18.561 73.292  0.50 111.35 ? 3   DC  H N4    1 
ATOM   8071 C  C5    B DC  F 6 3   ? 63.792  -18.177 74.413  0.50 119.45 ? 3   DC  H C5    1 
ATOM   8072 C  C6    B DC  F 6 3   ? 64.784  -17.306 74.647  0.50 108.58 ? 3   DC  H C6    1 
ATOM   8073 P  P     B DT  F 6 4   ? 68.106  -12.793 77.181  0.50 120.16 ? 4   DT  H P     1 
ATOM   8074 O  OP1   B DT  F 6 4   ? 68.360  -12.507 75.749  0.50 119.12 ? 4   DT  H OP1   1 
ATOM   8075 O  OP2   B DT  F 6 4   ? 69.094  -12.345 78.186  0.50 117.57 ? 4   DT  H OP2   1 
ATOM   8076 O  "O5'" B DT  F 6 4   ? 66.675  -12.198 77.589  0.50 80.63  ? 4   DT  H "O5'" 1 
ATOM   8077 C  "C5'" B DT  F 6 4   ? 66.270  -10.937 77.048  0.50 76.64  ? 4   DT  H "C5'" 1 
ATOM   8078 C  "C4'" B DT  F 6 4   ? 64.767  -10.817 76.811  0.50 80.93  ? 4   DT  H "C4'" 1 
ATOM   8079 O  "O4'" B DT  F 6 4   ? 64.260  -11.890 75.982  0.50 80.29  ? 4   DT  H "O4'" 1 
ATOM   8080 C  "C3'" B DT  F 6 4   ? 63.882  -10.903 78.038  0.50 92.61  ? 4   DT  H "C3'" 1 
ATOM   8081 O  "O3'" B DT  F 6 4   ? 63.906  -9.669  78.710  0.50 107.08 ? 4   DT  H "O3'" 1 
ATOM   8082 C  "C2'" B DT  F 6 4   ? 62.514  -11.146 77.410  0.50 87.11  ? 4   DT  H "C2'" 1 
ATOM   8083 C  "C1'" B DT  F 6 4   ? 62.858  -11.983 76.180  0.50 82.63  ? 4   DT  H "C1'" 1 
ATOM   8084 N  N1    B DT  F 6 4   ? 62.430  -13.417 76.312  0.50 85.12  ? 4   DT  H N1    1 
ATOM   8085 C  C2    B DT  F 6 4   ? 61.375  -13.856 75.545  0.50 84.43  ? 4   DT  H C2    1 
ATOM   8086 O  O2    B DT  F 6 4   ? 60.778  -13.138 74.760  0.50 78.94  ? 4   DT  H O2    1 
ATOM   8087 N  N3    B DT  F 6 4   ? 61.050  -15.174 75.735  0.50 97.61  ? 4   DT  H N3    1 
ATOM   8088 C  C4    B DT  F 6 4   ? 61.650  -16.077 76.587  0.50 105.38 ? 4   DT  H C4    1 
ATOM   8089 O  O4    B DT  F 6 4   ? 61.277  -17.240 76.678  0.50 117.67 ? 4   DT  H O4    1 
ATOM   8090 C  C5    B DT  F 6 4   ? 62.746  -15.558 77.356  0.50 97.26  ? 4   DT  H C5    1 
ATOM   8091 C  C7    B DT  F 6 4   ? 63.470  -16.454 78.317  0.50 97.15  ? 4   DT  H C7    1 
ATOM   8092 C  C6    B DT  F 6 4   ? 63.077  -14.269 77.189  0.50 89.97  ? 4   DT  H C6    1 
ATOM   8093 P  P     B DA  F 6 5   ? 63.888  -9.628  80.313  0.50 111.51 ? 5   DA  H P     1 
ATOM   8094 O  OP1   B DA  F 6 5   ? 64.995  -8.751  80.756  0.50 107.18 ? 5   DA  H OP1   1 
ATOM   8095 O  OP2   B DA  F 6 5   ? 63.768  -11.018 80.807  0.50 112.59 ? 5   DA  H OP2   1 
ATOM   8096 O  "O5'" B DA  F 6 5   ? 62.492  -8.944  80.648  0.50 119.57 ? 5   DA  H "O5'" 1 
ATOM   8097 C  "C5'" B DA  F 6 5   ? 61.679  -8.425  79.612  0.50 120.56 ? 5   DA  H "C5'" 1 
ATOM   8098 C  "C4'" B DA  F 6 5   ? 60.267  -8.397  80.150  0.50 118.86 ? 5   DA  H "C4'" 1 
ATOM   8099 O  "O4'" B DA  F 6 5   ? 59.590  -9.610  79.759  0.50 113.48 ? 5   DA  H "O4'" 1 
ATOM   8100 C  "C3'" B DA  F 6 5   ? 60.211  -8.327  81.674  0.50 122.78 ? 5   DA  H "C3'" 1 
ATOM   8101 O  "O3'" B DA  F 6 5   ? 59.783  -7.026  82.056  0.50 126.79 ? 5   DA  H "O3'" 1 
ATOM   8102 C  "C2'" B DA  F 6 5   ? 59.223  -9.409  82.113  0.50 120.51 ? 5   DA  H "C2'" 1 
ATOM   8103 C  "C1'" B DA  F 6 5   ? 58.761  -10.064 80.810  0.50 109.49 ? 5   DA  H "C1'" 1 
ATOM   8104 N  N9    B DA  F 6 5   ? 58.764  -11.530 80.796  0.50 97.03  ? 5   DA  H N9    1 
ATOM   8105 C  C8    B DA  F 6 5   ? 59.826  -12.392 80.858  0.50 93.19  ? 5   DA  H C8    1 
ATOM   8106 N  N7    B DA  F 6 5   ? 59.476  -13.658 80.813  0.50 86.78  ? 5   DA  H N7    1 
ATOM   8107 C  C5    B DA  F 6 5   ? 58.093  -13.627 80.711  0.50 78.31  ? 5   DA  H C5    1 
ATOM   8108 C  C6    B DA  F 6 5   ? 57.099  -14.625 80.619  0.50 70.43  ? 5   DA  H C6    1 
ATOM   8109 N  N6    B DA  F 6 5   ? 57.309  -15.951 80.606  0.50 74.77  ? 5   DA  H N6    1 
ATOM   8110 N  N1    B DA  F 6 5   ? 55.829  -14.197 80.526  0.50 61.77  ? 5   DA  H N1    1 
ATOM   8111 C  C2    B DA  F 6 5   ? 55.546  -12.897 80.528  0.50 57.14  ? 5   DA  H C2    1 
ATOM   8112 N  N3    B DA  F 6 5   ? 56.384  -11.881 80.611  0.50 63.36  ? 5   DA  H N3    1 
ATOM   8113 C  C4    B DA  F 6 5   ? 57.646  -12.320 80.697  0.50 78.78  ? 5   DA  H C4    1 
ATOM   8114 P  P     B DT  F 6 6   ? 59.238  -6.754  83.539  0.50 96.00  ? 6   DT  H P     1 
ATOM   8115 O  OP1   B DT  F 6 6   ? 59.039  -5.293  83.692  0.50 91.53  ? 6   DT  H OP1   1 
ATOM   8116 O  OP2   B DT  F 6 6   ? 60.086  -7.514  84.483  0.50 106.85 ? 6   DT  H OP2   1 
ATOM   8117 O  "O5'" B DT  F 6 6   ? 57.806  -7.442  83.536  0.50 65.39  ? 6   DT  H "O5'" 1 
ATOM   8118 C  "C5'" B DT  F 6 6   ? 57.159  -7.618  84.773  0.50 61.72  ? 6   DT  H "C5'" 1 
ATOM   8119 C  "C4'" B DT  F 6 6   ? 55.867  -8.368  84.564  0.50 52.59  ? 6   DT  H "C4'" 1 
ATOM   8120 O  "O4'" B DT  F 6 6   ? 56.056  -9.404  83.580  0.50 50.56  ? 6   DT  H "O4'" 1 
ATOM   8121 C  "C3'" B DT  F 6 6   ? 55.384  -9.135  85.772  0.50 42.63  ? 6   DT  H "C3'" 1 
ATOM   8122 O  "O3'" B DT  F 6 6   ? 54.776  -8.217  86.630  0.50 43.55  ? 6   DT  H "O3'" 1 
ATOM   8123 C  "C2'" B DT  F 6 6   ? 54.356  -10.036 85.110  0.50 39.82  ? 6   DT  H "C2'" 1 
ATOM   8124 C  "C1'" B DT  F 6 6   ? 55.090  -10.397 83.828  0.50 43.35  ? 6   DT  H "C1'" 1 
ATOM   8125 N  N1    B DT  F 6 6   ? 55.791  -11.688 83.882  0.50 48.61  ? 6   DT  H N1    1 
ATOM   8126 C  C2    B DT  F 6 6   ? 55.033  -12.811 83.729  0.50 54.84  ? 6   DT  H C2    1 
ATOM   8127 O  O2    B DT  F 6 6   ? 53.827  -12.767 83.572  0.50 60.18  ? 6   DT  H O2    1 
ATOM   8128 N  N3    B DT  F 6 6   ? 55.736  -13.978 83.768  0.50 51.21  ? 6   DT  H N3    1 
ATOM   8129 C  C4    B DT  F 6 6   ? 57.089  -14.133 83.947  0.50 46.28  ? 6   DT  H C4    1 
ATOM   8130 O  O4    B DT  F 6 6   ? 57.610  -15.241 83.965  0.50 41.47  ? 6   DT  H O4    1 
ATOM   8131 C  C5    B DT  F 6 6   ? 57.828  -12.908 84.103  0.50 49.73  ? 6   DT  H C5    1 
ATOM   8132 C  C7    B DT  F 6 6   ? 59.314  -12.946 84.298  0.50 62.49  ? 6   DT  H C7    1 
ATOM   8133 C  C6    B DT  F 6 6   ? 57.155  -11.750 84.059  0.50 44.12  ? 6   DT  H C6    1 
ATOM   8134 P  P     B DG  F 6 7   ? 54.385  -8.638  88.122  0.50 55.89  ? 7   DG  H P     1 
ATOM   8135 O  OP1   B DG  F 6 7   ? 53.647  -7.508  88.725  0.50 60.16  ? 7   DG  H OP1   1 
ATOM   8136 O  OP2   B DG  F 6 7   ? 55.603  -9.172  88.777  0.50 55.16  ? 7   DG  H OP2   1 
ATOM   8137 O  "O5'" B DG  F 6 7   ? 53.366  -9.847  87.912  0.50 46.07  ? 7   DG  H "O5'" 1 
ATOM   8138 C  "C5'" B DG  F 6 7   ? 52.057  -9.650  87.396  0.50 47.02  ? 7   DG  H "C5'" 1 
ATOM   8139 C  "C4'" B DG  F 6 7   ? 51.110  -10.673 88.002  0.50 47.29  ? 7   DG  H "C4'" 1 
ATOM   8140 O  "O4'" B DG  F 6 7   ? 51.434  -12.019 87.558  0.50 45.50  ? 7   DG  H "O4'" 1 
ATOM   8141 C  "C3'" B DG  F 6 7   ? 51.152  -10.726 89.521  0.50 44.95  ? 7   DG  H "C3'" 1 
ATOM   8142 O  "O3'" B DG  F 6 7   ? 49.870  -11.052 90.009  0.50 46.00  ? 7   DG  H "O3'" 1 
ATOM   8143 C  "C2'" B DG  F 6 7   ? 52.153  -11.835 89.832  0.50 49.84  ? 7   DG  H "C2'" 1 
ATOM   8144 C  "C1'" B DG  F 6 7   ? 52.035  -12.755 88.617  0.50 52.05  ? 7   DG  H "C1'" 1 
ATOM   8145 N  N9    B DG  F 6 7   ? 53.311  -13.293 88.132  0.50 59.20  ? 7   DG  H N9    1 
ATOM   8146 C  C8    B DG  F 6 7   ? 54.510  -12.639 87.903  0.50 62.11  ? 7   DG  H C8    1 
ATOM   8147 N  N7    B DG  F 6 7   ? 55.472  -13.411 87.455  0.50 60.75  ? 7   DG  H N7    1 
ATOM   8148 C  C5    B DG  F 6 7   ? 54.858  -14.657 87.381  0.50 58.61  ? 7   DG  H C5    1 
ATOM   8149 C  C6    B DG  F 6 7   ? 55.385  -15.896 86.958  0.50 54.60  ? 7   DG  H C6    1 
ATOM   8150 O  O6    B DG  F 6 7   ? 56.538  -16.132 86.568  0.50 54.86  ? 7   DG  H O6    1 
ATOM   8151 N  N1    B DG  F 6 7   ? 54.422  -16.906 87.042  0.50 58.27  ? 7   DG  H N1    1 
ATOM   8152 C  C2    B DG  F 6 7   ? 53.114  -16.734 87.483  0.50 66.64  ? 7   DG  H C2    1 
ATOM   8153 N  N2    B DG  F 6 7   ? 52.314  -17.821 87.504  0.50 89.74  ? 7   DG  H N2    1 
ATOM   8154 N  N3    B DG  F 6 7   ? 52.617  -15.570 87.882  0.50 61.26  ? 7   DG  H N3    1 
ATOM   8155 C  C4    B DG  F 6 7   ? 53.540  -14.596 87.793  0.50 59.95  ? 7   DG  H C4    1 
ATOM   8156 P  P     B DC  F 6 8   ? 49.407  -10.529 91.454  0.50 48.85  ? 8   DC  H P     1 
ATOM   8157 O  OP1   B DC  F 6 8   ? 47.929  -10.422 91.451  0.50 40.49  ? 8   DC  H OP1   1 
ATOM   8158 O  OP2   B DC  F 6 8   ? 50.257  -9.362  91.805  0.50 42.03  ? 8   DC  H OP2   1 
ATOM   8159 O  "O5'" B DC  F 6 8   ? 49.830  -11.725 92.433  0.50 51.15  ? 8   DC  H "O5'" 1 
ATOM   8160 C  "C5'" B DC  F 6 8   ? 49.142  -12.983 92.499  0.50 39.81  ? 8   DC  H "C5'" 1 
ATOM   8161 C  "C4'" B DC  F 6 8   ? 50.078  -14.019 93.103  0.50 41.74  ? 8   DC  H "C4'" 1 
ATOM   8162 O  "O4'" B DC  F 6 8   ? 51.084  -14.419 92.138  0.50 51.17  ? 8   DC  H "O4'" 1 
ATOM   8163 C  "C3'" B DC  F 6 8   ? 50.885  -13.537 94.317  0.50 42.37  ? 8   DC  H "C3'" 1 
ATOM   8164 O  "O3'" B DC  F 6 8   ? 50.176  -13.939 95.479  0.50 41.62  ? 8   DC  H "O3'" 1 
ATOM   8165 C  "C2'" B DC  F 6 8   ? 52.242  -14.236 94.193  0.50 53.12  ? 8   DC  H "C2'" 1 
ATOM   8166 C  "C1'" B DC  F 6 8   ? 52.131  -15.008 92.871  0.50 66.35  ? 8   DC  H "C1'" 1 
ATOM   8167 N  N1    B DC  F 6 8   ? 53.397  -14.980 92.110  0.50 91.04  ? 8   DC  H N1    1 
ATOM   8168 C  C2    B DC  F 6 8   ? 53.728  -16.020 91.226  0.50 93.82  ? 8   DC  H C2    1 
ATOM   8169 O  O2    B DC  F 6 8   ? 52.926  -16.949 91.044  0.50 89.31  ? 8   DC  H O2    1 
ATOM   8170 N  N3    B DC  F 6 8   ? 54.913  -15.963 90.574  0.50 103.93 ? 8   DC  H N3    1 
ATOM   8171 C  C4    B DC  F 6 8   ? 55.743  -14.938 90.801  0.50 109.09 ? 8   DC  H C4    1 
ATOM   8172 N  N4    B DC  F 6 8   ? 56.910  -14.900 90.146  0.50 105.56 ? 8   DC  H N4    1 
ATOM   8173 C  C5    B DC  F 6 8   ? 55.420  -13.887 91.709  0.50 111.00 ? 8   DC  H C5    1 
ATOM   8174 C  C6    B DC  F 6 8   ? 54.247  -13.951 92.335  0.50 105.70 ? 8   DC  H C6    1 
ATOM   8175 P  P     B DA  F 6 9   ? 50.468  -13.253 96.899  0.50 55.50  ? 9   DA  H P     1 
ATOM   8176 O  OP1   B DA  F 6 9   ? 49.224  -13.334 97.697  0.50 45.70  ? 9   DA  H OP1   1 
ATOM   8177 O  OP2   B DA  F 6 9   ? 51.140  -11.947 96.658  0.50 53.92  ? 9   DA  H OP2   1 
ATOM   8178 O  "O5'" B DA  F 6 9   ? 51.544  -14.232 97.563  0.50 52.24  ? 9   DA  H "O5'" 1 
ATOM   8179 C  "C5'" B DA  F 6 9   ? 51.160  -15.560 97.889  0.50 58.07  ? 9   DA  H "C5'" 1 
ATOM   8180 C  "C4'" B DA  F 6 9   ? 52.244  -16.283 98.669  0.50 75.62  ? 9   DA  H "C4'" 1 
ATOM   8181 O  "O4'" B DA  F 6 9   ? 53.394  -16.478 97.815  0.50 81.47  ? 9   DA  H "O4'" 1 
ATOM   8182 C  "C3'" B DA  F 6 9   ? 52.749  -15.578 99.928  0.50 87.07  ? 9   DA  H "C3'" 1 
ATOM   8183 O  "O3'" B DA  F 6 9   ? 52.821  -16.535 100.974 0.50 89.78  ? 9   DA  H "O3'" 1 
ATOM   8184 C  "C2'" B DA  F 6 9   ? 54.123  -15.001 99.565  0.50 95.71  ? 9   DA  H "C2'" 1 
ATOM   8185 C  "C1'" B DA  F 6 9   ? 54.551  -15.869 98.374  0.50 91.67  ? 9   DA  H "C1'" 1 
ATOM   8186 N  N9    B DA  F 6 9   ? 55.241  -15.193 97.272  0.50 100.61 ? 9   DA  H N9    1 
ATOM   8187 C  C8    B DA  F 6 9   ? 54.926  -14.017 96.649  0.50 97.20  ? 9   DA  H C8    1 
ATOM   8188 N  N7    B DA  F 6 9   ? 55.747  -13.689 95.669  0.50 98.32  ? 9   DA  H N7    1 
ATOM   8189 C  C5    B DA  F 6 9   ? 56.655  -14.727 95.642  0.50 105.77 ? 9   DA  H C5    1 
ATOM   8190 C  C6    B DA  F 6 9   ? 57.775  -14.998 94.831  0.50 110.77 ? 9   DA  H C6    1 
ATOM   8191 N  N6    B DA  F 6 9   ? 58.210  -14.213 93.832  0.50 115.53 ? 9   DA  H N6    1 
ATOM   8192 N  N1    B DA  F 6 9   ? 58.446  -16.135 95.089  0.50 109.74 ? 9   DA  H N1    1 
ATOM   8193 C  C2    B DA  F 6 9   ? 58.034  -16.942 96.060  0.50 105.98 ? 9   DA  H C2    1 
ATOM   8194 N  N3    B DA  F 6 9   ? 57.003  -16.796 96.884  0.50 107.26 ? 9   DA  H N3    1 
ATOM   8195 C  C4    B DA  F 6 9   ? 56.351  -15.660 96.615  0.50 98.62  ? 9   DA  H C4    1 
ATOM   8196 P  P     B DC  F 6 10  ? 53.224  -16.076 102.458 0.50 102.12 ? 10  DC  H P     1 
ATOM   8197 O  OP1   B DC  F 6 10  ? 52.608  -17.017 103.408 0.50 103.17 ? 10  DC  H OP1   1 
ATOM   8198 O  OP2   B DC  F 6 10  ? 52.958  -14.623 102.582 0.50 97.00  ? 10  DC  H OP2   1 
ATOM   8199 O  "O5'" B DC  F 6 10  ? 54.801  -16.269 102.485 0.50 120.93 ? 10  DC  H "O5'" 1 
ATOM   8200 C  "C5'" B DC  F 6 10  ? 55.373  -17.505 102.118 0.50 120.48 ? 10  DC  H "C5'" 1 
ATOM   8201 C  "C4'" B DC  F 6 10  ? 56.850  -17.270 101.935 0.50 119.40 ? 10  DC  H "C4'" 1 
ATOM   8202 O  "O4'" B DC  F 6 10  ? 57.034  -16.449 100.781 0.50 127.79 ? 10  DC  H "O4'" 1 
ATOM   8203 C  "C3'" B DC  F 6 10  ? 57.468  -16.357 102.970 0.50 109.28 ? 10  DC  H "C3'" 1 
ATOM   8204 O  "O3'" B DC  F 6 10  ? 57.850  -17.115 104.110 0.50 99.90  ? 10  DC  H "O3'" 1 
ATOM   8205 C  "C2'" B DC  F 6 10  ? 58.630  -15.659 102.234 0.50 118.92 ? 10  DC  H "C2'" 1 
ATOM   8206 C  "C1'" B DC  F 6 10  ? 58.394  -16.101 100.796 0.50 120.74 ? 10  DC  H "C1'" 1 
ATOM   8207 N  N1    B DC  F 6 10  ? 58.623  -15.142 99.664  0.50 114.34 ? 10  DC  H N1    1 
ATOM   8208 C  C2    B DC  F 6 10  ? 59.609  -15.485 98.737  0.50 108.62 ? 10  DC  H C2    1 
ATOM   8209 O  O2    B DC  F 6 10  ? 60.244  -16.535 98.920  0.50 104.68 ? 10  DC  H O2    1 
ATOM   8210 N  N3    B DC  F 6 10  ? 59.844  -14.660 97.680  0.50 113.20 ? 10  DC  H N3    1 
ATOM   8211 C  C4    B DC  F 6 10  ? 59.129  -13.542 97.531  0.50 118.10 ? 10  DC  H C4    1 
ATOM   8212 N  N4    B DC  F 6 10  ? 59.416  -12.783 96.467  0.50 129.46 ? 10  DC  H N4    1 
ATOM   8213 C  C5    B DC  F 6 10  ? 58.109  -13.170 98.468  0.50 106.90 ? 10  DC  H C5    1 
ATOM   8214 C  C6    B DC  F 6 10  ? 57.884  -14.000 99.498  0.50 108.43 ? 10  DC  H C6    1 
ATOM   8215 P  P     B DG  F 6 11  ? 58.148  -16.372 105.499 0.50 138.85 ? 11  DG  H P     1 
ATOM   8216 O  OP1   B DG  F 6 11  ? 57.351  -17.042 106.554 0.50 134.28 ? 11  DG  H OP1   1 
ATOM   8217 O  OP2   B DG  F 6 11  ? 57.997  -14.917 105.275 0.50 143.02 ? 11  DG  H OP2   1 
ATOM   8218 O  "O5'" B DG  F 6 11  ? 59.706  -16.624 105.719 0.50 145.00 ? 11  DG  H "O5'" 1 
ATOM   8219 C  "C5'" B DG  F 6 11  ? 60.566  -16.167 104.701 0.50 168.25 ? 11  DG  H "C5'" 1 
ATOM   8220 C  "C4'" B DG  F 6 11  ? 61.990  -16.564 105.007 0.50 131.67 ? 11  DG  H "C4'" 1 
ATOM   8221 O  "O4'" B DG  F 6 11  ? 62.659  -16.726 103.738 0.50 127.21 ? 11  DG  H "O4'" 1 
ATOM   8222 C  "C3'" B DG  F 6 11  ? 62.788  -15.544 105.825 0.50 118.83 ? 11  DG  H "C3'" 1 
ATOM   8223 O  "O3'" B DG  F 6 11  ? 63.378  -16.145 106.993 0.50 107.46 ? 11  DG  H "O3'" 1 
ATOM   8224 C  "C2'" B DG  F 6 11  ? 63.849  -15.014 104.858 0.50 117.78 ? 11  DG  H "C2'" 1 
ATOM   8225 C  "C1'" B DG  F 6 11  ? 63.428  -15.573 103.494 0.50 123.73 ? 11  DG  H "C1'" 1 
ATOM   8226 N  N9    B DG  F 6 11  ? 62.666  -14.617 102.686 0.50 129.24 ? 11  DG  H N9    1 
ATOM   8227 C  C8    B DG  F 6 11  ? 61.702  -13.732 103.119 0.50 128.05 ? 11  DG  H C8    1 
ATOM   8228 N  N7    B DG  F 6 11  ? 61.210  -12.989 102.164 0.50 129.26 ? 11  DG  H N7    1 
ATOM   8229 C  C5    B DG  F 6 11  ? 61.893  -13.405 101.035 0.50 131.67 ? 11  DG  H C5    1 
ATOM   8230 C  C6    B DG  F 6 11  ? 61.785  -12.954 99.703  0.50 138.94 ? 11  DG  H C6    1 
ATOM   8231 O  O6    B DG  F 6 11  ? 61.030  -12.070 99.271  0.50 141.51 ? 11  DG  H O6    1 
ATOM   8232 N  N1    B DG  F 6 11  ? 62.664  -13.645 98.859  0.50 138.61 ? 11  DG  H N1    1 
ATOM   8233 C  C2    B DG  F 6 11  ? 63.541  -14.643 99.246  0.50 139.94 ? 11  DG  H C2    1 
ATOM   8234 N  N2    B DG  F 6 11  ? 64.319  -15.193 98.294  0.50 142.13 ? 11  DG  H N2    1 
ATOM   8235 N  N3    B DG  F 6 11  ? 63.642  -15.066 100.502 0.50 134.11 ? 11  DG  H N3    1 
ATOM   8236 C  C4    B DG  F 6 11  ? 62.795  -14.405 101.334 0.50 133.39 ? 11  DG  H C4    1 
HETATM 8237 MG MG    . MG  G 7 .   ? 57.815  -20.688 78.857  1.00 64.49  ? 501 MG  A MG    1 
HETATM 8238 MG MG    . MG  H 7 .   ? 43.422  -19.876 78.183  1.00 71.62  ? 701 MG  C MG    1 
HETATM 8239 C  C     . LFX I 8 .   ? 55.488  -20.275 76.909  1.00 85.30  ? 101 LFX F C     1 
HETATM 8240 F  F     . LFX I 8 .   ? 59.442  -14.023 77.503  1.00 104.41 ? 101 LFX F F     1 
HETATM 8241 N  N     . LFX I 8 .   ? 57.719  -9.729  76.419  1.00 108.86 ? 101 LFX F N     1 
HETATM 8242 O  O     . LFX I 8 .   ? 54.415  -20.597 76.331  1.00 95.62  ? 101 LFX F O     1 
HETATM 8243 C  C01   . LFX I 8 .   ? 58.645  -11.937 76.125  1.00 118.83 ? 101 LFX F C01   1 
HETATM 8244 N  N01   . LFX I 8 .   ? 57.355  -12.526 76.513  1.00 95.51  ? 101 LFX F N01   1 
HETATM 8245 O  O01   . LFX I 8 .   ? 55.110  -13.924 75.835  1.00 63.80  ? 101 LFX F O01   1 
HETATM 8246 C  C02   . LFX I 8 .   ? 56.389  -11.628 77.154  1.00 80.20  ? 101 LFX F C02   1 
HETATM 8247 N  N02   . LFX I 8 .   ? 54.884  -16.688 76.218  1.00 83.30  ? 101 LFX F N02   1 
HETATM 8248 O  O02   . LFX I 8 .   ? 58.039  -18.995 77.725  1.00 63.20  ? 101 LFX F O02   1 
HETATM 8249 C  C03   . LFX I 8 .   ? 53.717  -15.904 75.721  1.00 73.54  ? 101 LFX F C03   1 
HETATM 8250 O  O03   . LFX I 8 .   ? 56.313  -21.065 77.518  1.00 82.96  ? 101 LFX F O03   1 
HETATM 8251 C  C04   . LFX I 8 .   ? 57.260  -13.921 76.690  1.00 89.41  ? 101 LFX F C04   1 
HETATM 8252 C  C05   . LFX I 8 .   ? 56.061  -16.044 76.557  1.00 81.77  ? 101 LFX F C05   1 
HETATM 8253 C  C06   . LFX I 8 .   ? 56.115  -14.639 76.394  1.00 75.17  ? 101 LFX F C06   1 
HETATM 8254 C  C07   . LFX I 8 .   ? 58.505  -10.558 75.532  1.00 123.40 ? 101 LFX F C07   1 
HETATM 8255 C  C08   . LFX I 8 .   ? 56.377  -10.282 76.457  1.00 86.12  ? 101 LFX F C08   1 
HETATM 8256 C  C09   . LFX I 8 .   ? 53.826  -14.463 76.122  1.00 71.57  ? 101 LFX F C09   1 
HETATM 8257 C  C10   . LFX I 8 .   ? 57.138  -16.793 77.068  1.00 88.33  ? 101 LFX F C10   1 
HETATM 8258 C  C11   . LFX I 8 .   ? 58.310  -14.707 77.196  1.00 100.44 ? 101 LFX F C11   1 
HETATM 8259 C  C12   . LFX I 8 .   ? 54.803  -18.016 76.386  1.00 92.61  ? 101 LFX F C12   1 
HETATM 8260 C  C13   . LFX I 8 .   ? 58.306  -16.069 77.366  1.00 101.31 ? 101 LFX F C13   1 
HETATM 8261 C  C14   . LFX I 8 .   ? 52.396  -16.385 76.316  1.00 73.77  ? 101 LFX F C14   1 
HETATM 8262 C  C15   . LFX I 8 .   ? 57.069  -18.280 77.257  1.00 76.99  ? 101 LFX F C15   1 
HETATM 8263 C  C16   . LFX I 8 .   ? 57.737  -8.327  76.038  1.00 112.50 ? 101 LFX F C16   1 
HETATM 8264 C  C17   . LFX I 8 .   ? 55.806  -18.826 76.868  1.00 85.35  ? 101 LFX F C17   1 
HETATM 8265 H  H01   . LFX I 8 .   ? 59.220  -11.879 76.928  1.00 142.60 ? 101 LFX F H01   1 
HETATM 8266 H  H01A  . LFX I 8 .   ? 59.096  -12.532 75.475  1.00 142.60 ? 101 LFX F H01A  1 
HETATM 8267 H  H02   . LFX I 8 .   ? 55.485  -12.031 77.128  1.00 96.24  ? 101 LFX F H02   1 
HETATM 8268 H  H02A  . LFX I 8 .   ? 56.639  -11.501 78.103  1.00 96.24  ? 101 LFX F H02A  1 
HETATM 8269 H  H03   . LFX I 8 .   ? 53.690  -15.962 74.723  1.00 88.25  ? 101 LFX F H03   1 
HETATM 8270 H  H07   . LFX I 8 .   ? 58.063  -10.615 74.648  1.00 148.07 ? 101 LFX F H07   1 
HETATM 8271 H  H07A  . LFX I 8 .   ? 59.402  -10.159 75.404  1.00 148.07 ? 101 LFX F H07A  1 
HETATM 8272 H  H08   . LFX I 8 .   ? 56.032  -10.384 75.535  1.00 103.34 ? 101 LFX F H08   1 
HETATM 8273 H  H08A  . LFX I 8 .   ? 55.776  -9.664  76.946  1.00 103.34 ? 101 LFX F H08A  1 
HETATM 8274 H  H09   . LFX I 8 .   ? 53.670  -14.390 77.097  1.00 85.89  ? 101 LFX F H09   1 
HETATM 8275 H  H09A  . LFX I 8 .   ? 53.124  -13.935 75.665  1.00 85.89  ? 101 LFX F H09A  1 
HETATM 8276 H  H12   . LFX I 8 .   ? 53.986  -18.436 76.142  1.00 111.13 ? 101 LFX F H12   1 
HETATM 8277 H  H13   . LFX I 8 .   ? 59.064  -16.509 77.731  1.00 121.57 ? 101 LFX F H13   1 
HETATM 8278 H  H14   . LFX I 8 .   ? 52.428  -16.305 77.292  1.00 88.53  ? 101 LFX F H14   1 
HETATM 8279 H  H14A  . LFX I 8 .   ? 51.662  -15.837 75.968  1.00 88.53  ? 101 LFX F H14A  1 
HETATM 8280 H  H14B  . LFX I 8 .   ? 52.250  -17.322 76.070  1.00 88.53  ? 101 LFX F H14B  1 
HETATM 8281 H  H16   . LFX I 8 .   ? 57.360  -8.226  75.139  1.00 135.00 ? 101 LFX F H16   1 
HETATM 8282 H  H16A  . LFX I 8 .   ? 58.661  -7.998  76.044  1.00 135.00 ? 101 LFX F H16A  1 
HETATM 8283 H  H16B  . LFX I 8 .   ? 57.203  -7.808  76.676  1.00 135.00 ? 101 LFX F H16B  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 3   ? 1.8174 1.7724 2.0725 -0.1948 -0.1974 0.0242  3   ASN A N   
2    C CA  . ASN A 3   ? 1.6755 1.6301 1.9404 -0.1804 -0.2001 0.0251  3   ASN A CA  
3    C C   . ASN A 3   ? 1.5732 1.5378 1.8300 -0.1880 -0.1925 0.0094  3   ASN A C   
4    O O   . ASN A 3   ? 1.5084 1.4615 1.7467 -0.1801 -0.2020 0.0180  3   ASN A O   
5    C CB  . ASN A 3   ? 1.6203 1.5858 1.9233 -0.1713 -0.1926 0.0191  3   ASN A CB  
6    N N   . ILE A 4   ? 1.4671 1.4527 1.7367 -0.2035 -0.1756 -0.0132 4   ILE A N   
7    C CA  . ILE A 4   ? 1.3265 1.3242 1.5898 -0.2118 -0.1676 -0.0298 4   ILE A CA  
8    C C   . ILE A 4   ? 1.4003 1.4110 1.6580 -0.2327 -0.1554 -0.0471 4   ILE A C   
9    O O   . ILE A 4   ? 1.4963 1.5160 1.7674 -0.2428 -0.1456 -0.0548 4   ILE A O   
10   C CB  . ILE A 4   ? 1.2301 1.2432 1.5182 -0.2071 -0.1585 -0.0415 4   ILE A CB  
11   N N   . GLN A 5   ? 1.4642 1.4745 1.7027 -0.2380 -0.1564 -0.0528 5   GLN A N   
12   C CA  . GLN A 5   ? 1.6211 1.6429 1.8578 -0.2548 -0.1460 -0.0705 5   GLN A CA  
13   C C   . GLN A 5   ? 1.6667 1.7045 1.9054 -0.2596 -0.1376 -0.0895 5   GLN A C   
14   O O   . GLN A 5   ? 1.6178 1.6477 1.8417 -0.2506 -0.1468 -0.0826 5   GLN A O   
15   C CB  . GLN A 5   ? 1.5670 1.5683 1.7749 -0.2562 -0.1590 -0.0551 5   GLN A CB  
16   N N   . ASN A 6   ? 1.6973 1.7573 1.9525 -0.2745 -0.1202 -0.1130 6   ASN A N   
17   C CA  . ASN A 6   ? 1.6284 1.7067 1.8855 -0.2811 -0.1107 -0.1321 6   ASN A CA  
18   C C   . ASN A 6   ? 1.5736 1.6467 1.8388 -0.2759 -0.1185 -0.1407 6   ASN A C   
19   O O   . ASN A 6   ? 1.6195 1.6799 1.8826 -0.2780 -0.1261 -0.1342 6   ASN A O   
20   C CB  . ASN A 6   ? 1.6189 1.7144 1.8580 -0.3089 -0.0974 -0.1349 6   ASN A CB  
21   C CG  . ASN A 6   ? 1.6233 1.7086 1.8698 -0.3016 -0.1080 -0.1119 6   ASN A CG  
22   O OD1 . ASN A 6   ? 1.6370 1.7214 1.8959 -0.2915 -0.1154 -0.1037 6   ASN A OD1 
23   N ND2 . ASN A 6   ? 1.5654 1.6455 1.8261 -0.2973 -0.1059 -0.1098 6   ASN A ND2 
24   N N   . MET A 7   ? 1.6239 1.7022 1.8874 -0.2708 -0.1209 -0.1478 7   MET A N   
25   C CA  . MET A 7   ? 1.4865 1.5553 1.7503 -0.2672 -0.1340 -0.1493 7   MET A CA  
26   C C   . MET A 7   ? 1.3362 1.4166 1.6377 -0.2583 -0.1362 -0.1664 7   MET A C   
27   O O   . MET A 7   ? 1.2431 1.3481 1.5443 -0.2618 -0.1161 -0.1811 7   MET A O   
28   C CB  . MET A 7   ? 1.7557 1.8016 1.9649 -0.2655 -0.1479 -0.1254 7   MET A CB  
29   N N   . SER A 8   ? 1.5762 1.6384 1.8762 -0.2591 -0.1570 -0.1561 8   SER A N   
30   C CA  . SER A 8   ? 1.5871 1.6343 1.8848 -0.2602 -0.1787 -0.1398 8   SER A CA  
31   C C   . SER A 8   ? 1.4411 1.4954 1.7296 -0.2492 -0.1761 -0.1514 8   SER A C   
32   O O   . SER A 8   ? 1.4532 1.5174 1.7086 -0.2506 -0.1617 -0.1602 8   SER A O   
33   C CB  . SER A 8   ? 1.3557 1.4044 1.6259 -0.2779 -0.1739 -0.1394 8   SER A CB  
34   O OG  . SER A 8   ? 1.3464 1.4010 1.5993 -0.2841 -0.1718 -0.1399 8   SER A OG  
35   N N   . LEU A 9   ? 1.3841 1.4230 1.6565 -0.2538 -0.1940 -0.1288 9   LEU A N   
36   C CA  . LEU A 9   ? 1.6114 1.6538 1.8784 -0.2423 -0.1949 -0.1392 9   LEU A CA  
37   C C   . LEU A 9   ? 1.5238 1.5753 1.7637 -0.2481 -0.1843 -0.1537 9   LEU A C   
38   O O   . LEU A 9   ? 1.5038 1.5617 1.7216 -0.2436 -0.1779 -0.1617 9   LEU A O   
39   C CB  . LEU A 9   ? 2.0634 2.1032 2.2873 -0.2611 -0.1964 -0.1166 9   LEU A CB  
40   C CG  . LEU A 9   ? 2.2934 2.3252 2.4986 -0.2547 -0.2050 -0.1094 9   LEU A CG  
41   C CD1 . LEU A 9   ? 2.4197 2.4744 2.6159 -0.2591 -0.1874 -0.1213 9   LEU A CD1 
42   C CD2 . LEU A 9   ? 2.2574 2.3059 2.5110 -0.2222 -0.1983 -0.1529 9   LEU A CD2 
43   N N   . GLU A 10  ? 1.5910 1.6428 1.8173 -0.2641 -0.1807 -0.1510 10  GLU A N   
44   C CA  . GLU A 10  ? 1.5589 1.6142 1.7547 -0.2729 -0.1742 -0.1587 10  GLU A CA  
45   C C   . GLU A 10  ? 1.5115 1.5622 1.6836 -0.2748 -0.1711 -0.1574 10  GLU A C   
46   O O   . GLU A 10  ? 1.6667 1.7134 1.8026 -0.2790 -0.1709 -0.1561 10  GLU A O   
47   C CB  . GLU A 10  ? 1.5715 1.6353 1.7644 -0.2884 -0.1644 -0.1624 10  GLU A CB  
48   N N   . ASP A 11  ? 1.4777 1.5267 1.6626 -0.2742 -0.1687 -0.1535 11  ASP A N   
49   C CA  . ASP A 11  ? 1.4777 1.5170 1.6268 -0.2802 -0.1666 -0.1434 11  ASP A CA  
50   C C   . ASP A 11  ? 1.5455 1.5767 1.6691 -0.2725 -0.1699 -0.1323 11  ASP A C   
51   O O   . ASP A 11  ? 1.4061 1.4211 1.4845 -0.2769 -0.1749 -0.1180 11  ASP A O   
52   C CB  . ASP A 11  ? 1.8027 1.8413 1.9692 -0.2845 -0.1627 -0.1403 11  ASP A CB  
53   C CG  . ASP A 11  ? 1.8084 1.8503 1.9874 -0.2954 -0.1599 -0.1452 11  ASP A CG  
54   O OD1 . ASP A 11  ? 1.8886 1.9369 2.1041 -0.2939 -0.1602 -0.1491 11  ASP A OD1 
55   O OD2 . ASP A 11  ? 1.8020 1.8378 1.9489 -0.3070 -0.1580 -0.1414 11  ASP A OD2 
56   N N   . ILE A 12  ? 1.3600 1.3995 1.5093 -0.2616 -0.1678 -0.1360 12  ILE A N   
57   C CA  . ILE A 12  ? 1.2744 1.3027 1.3954 -0.2547 -0.1723 -0.1206 12  ILE A CA  
58   C C   . ILE A 12  ? 1.3756 1.3968 1.4663 -0.2533 -0.1783 -0.1176 12  ILE A C   
59   O O   . ILE A 12  ? 1.2823 1.2816 1.3298 -0.2552 -0.1860 -0.0982 12  ILE A O   
60   C CB  . ILE A 12  ? 1.0828 1.1241 1.2329 -0.2449 -0.1664 -0.1261 12  ILE A CB  
61   N N   . MET A 13  ? 1.4224 1.4595 1.5362 -0.2496 -0.1760 -0.1356 13  MET A N   
62   C CA  . MET A 13  ? 1.5947 1.6274 1.6825 -0.2478 -0.1807 -0.1348 13  MET A CA  
63   C C   . MET A 13  ? 1.5261 1.5454 1.5740 -0.2594 -0.1836 -0.1270 13  MET A C   
64   O O   . MET A 13  ? 1.7965 1.8100 1.8180 -0.2593 -0.1869 -0.1245 13  MET A O   
65   C CB  . MET A 13  ? 1.7587 1.8078 1.8802 -0.2412 -0.1802 -0.1537 13  MET A CB  
66   C CG  . MET A 13  ? 1.7872 1.8495 1.9426 -0.2286 -0.1772 -0.1617 13  MET A CG  
67   S SD  . MET A 13  ? 1.9120 1.9773 2.0501 -0.2191 -0.1793 -0.1625 13  MET A SD  
68   C CE  . MET A 13  ? 3.1851 3.2453 3.3199 -0.2216 -0.1887 -0.1694 13  MET A CE  
69   N N   . GLY A 14  ? 1.2729 1.2876 1.3165 -0.2695 -0.1814 -0.1234 14  GLY A N   
70   C CA  . GLY A 14  ? 1.2708 1.2742 1.2774 -0.2818 -0.1823 -0.1169 14  GLY A CA  
71   C C   . GLY A 14  ? 1.3058 1.2839 1.2706 -0.2849 -0.1886 -0.0931 14  GLY A C   
72   O O   . GLY A 14  ? 1.2495 1.2127 1.1763 -0.2890 -0.1926 -0.0834 14  GLY A O   
73   N N   . GLU A 15  ? 1.4921 1.4632 1.4636 -0.2828 -0.1902 -0.0827 15  GLU A N   
74   C CA  . GLU A 15  ? 1.2954 1.2383 1.2282 -0.2842 -0.1986 -0.0569 15  GLU A CA  
75   C C   . GLU A 15  ? 1.4139 1.3399 1.3271 -0.2736 -0.2068 -0.0421 15  GLU A C   
76   O O   . GLU A 15  ? 1.3834 1.2814 1.2592 -0.2743 -0.2151 -0.0198 15  GLU A O   
77   C CB  . GLU A 15  ? 1.1144 1.0543 1.0612 -0.2839 -0.1987 -0.0495 15  GLU A CB  
78   N N   . ARG A 16  ? 1.1567 1.0985 1.0961 -0.2637 -0.2044 -0.0541 16  ARG A N   
79   C CA  . ARG A 16  ? 1.1033 1.0295 1.0269 -0.2531 -0.2117 -0.0408 16  ARG A CA  
80   C C   . ARG A 16  ? 1.4803 1.4023 1.3802 -0.2548 -0.2132 -0.0429 16  ARG A C   
81   O O   . ARG A 16  ? 1.3070 1.2018 1.1714 -0.2541 -0.2209 -0.0235 16  ARG A O   
82   C CB  . ARG A 16  ? 1.1144 1.0573 1.0742 -0.2411 -0.2089 -0.0504 16  ARG A CB  
83   C CG  . ARG A 16  ? 1.2435 1.1876 1.2251 -0.2379 -0.2080 -0.0456 16  ARG A CG  
84   C CD  . ARG A 16  ? 1.3900 1.3018 1.3388 -0.2381 -0.2183 -0.0176 16  ARG A CD  
85   N NE  . ARG A 16  ? 1.4659 1.3776 1.4344 -0.2336 -0.2188 -0.0115 16  ARG A NE  
86   C CZ  . ARG A 16  ? 1.6430 1.5582 1.6183 -0.2414 -0.2160 -0.0123 16  ARG A CZ  
87   N NH1 . ARG A 16  ? 1.3427 1.2610 1.3062 -0.2541 -0.2124 -0.0187 16  ARG A NH1 
88   N NH2 . ARG A 16  ? 2.0727 1.9875 2.0662 -0.2361 -0.2169 -0.0062 16  ARG A NH2 
89   N N   . PHE A 17  ? 1.8161 1.7631 1.7360 -0.2566 -0.2063 -0.0658 17  PHE A N   
90   C CA  . PHE A 17  ? 2.3393 2.2842 2.2390 -0.2569 -0.2078 -0.0689 17  PHE A CA  
91   C C   . PHE A 17  ? 2.3298 2.2567 2.1904 -0.2686 -0.2098 -0.0586 17  PHE A C   
92   O O   . PHE A 17  ? 2.5451 2.4579 2.3777 -0.2686 -0.2138 -0.0512 17  PHE A O   
93   C CB  . PHE A 17  ? 2.4320 2.4060 2.3620 -0.2552 -0.2012 -0.0947 17  PHE A CB  
94   C CG  . PHE A 17  ? 2.4373 2.4105 2.3524 -0.2506 -0.2037 -0.0973 17  PHE A CG  
95   C CD1 . PHE A 17  ? 2.4864 2.4547 2.3748 -0.2589 -0.2037 -0.0983 17  PHE A CD1 
96   C CD2 . PHE A 17  ? 2.1673 2.1438 2.0937 -0.2380 -0.2059 -0.0979 17  PHE A CD2 
97   C CE1 . PHE A 17  ? 2.2582 2.2255 2.1330 -0.2544 -0.2061 -0.1006 17  PHE A CE1 
98   C CE2 . PHE A 17  ? 1.9318 1.9073 1.8445 -0.2334 -0.2084 -0.1000 17  PHE A CE2 
99   C CZ  . PHE A 17  ? 1.9825 1.9535 1.8698 -0.2414 -0.2086 -0.1016 17  PHE A CZ  
100  N N   . GLY A 18  ? 2.1416 2.0687 2.0010 -0.2787 -0.2068 -0.0582 18  GLY A N   
101  C CA  . GLY A 18  ? 1.6454 1.5540 1.4673 -0.2903 -0.2086 -0.0467 18  GLY A CA  
102  C C   . GLY A 18  ? 1.4676 1.3421 1.2568 -0.2877 -0.2179 -0.0197 18  GLY A C   
103  O O   . GLY A 18  ? 1.3932 1.2478 1.1496 -0.2912 -0.2217 -0.0089 18  GLY A O   
104  N N   . ARG A 19  ? 1.2679 1.1346 1.0674 -0.2815 -0.2216 -0.0087 19  ARG A N   
105  C CA  . ARG A 19  ? 1.3191 1.1508 1.0906 -0.2779 -0.2312 0.0184  19  ARG A CA  
106  C C   . ARG A 19  ? 1.2992 1.1143 1.0544 -0.2704 -0.2364 0.0262  19  ARG A C   
107  O O   . ARG A 19  ? 1.2202 1.0056 0.9418 -0.2740 -0.2418 0.0431  19  ARG A O   
108  C CB  . ARG A 19  ? 1.3216 1.1516 1.1133 -0.2696 -0.2343 0.0263  19  ARG A CB  
109  N N   . TYR A 20  ? 1.3344 1.1683 1.1150 -0.2604 -0.2343 0.0130  20  TYR A N   
110  C CA  . TYR A 20  ? 1.3155 1.1371 1.0856 -0.2520 -0.2385 0.0178  20  TYR A CA  
111  C C   . TYR A 20  ? 1.3631 1.1845 1.1123 -0.2589 -0.2368 0.0115  20  TYR A C   
112  O O   . TYR A 20  ? 1.4084 1.2018 1.1295 -0.2590 -0.2423 0.0262  20  TYR A O   
113  C CB  . TYR A 20  ? 1.2739 1.1201 1.0787 -0.2403 -0.2355 0.0027  20  TYR A CB  
114  C CG  . TYR A 20  ? 1.4126 1.2485 1.2100 -0.2307 -0.2395 0.0063  20  TYR A CG  
115  C CD1 . TYR A 20  ? 1.7051 1.5063 1.4849 -0.2236 -0.2478 0.0289  20  TYR A CD1 
116  C CD2 . TYR A 20  ? 1.4545 1.3147 1.2644 -0.2282 -0.2348 -0.0134 20  TYR A CD2 
117  C CE1 . TYR A 20  ? 2.0171 1.8077 1.7918 -0.2146 -0.2511 0.0315  20  TYR A CE1 
118  C CE2 . TYR A 20  ? 1.7542 1.6059 1.5580 -0.2191 -0.2383 -0.0106 20  TYR A CE2 
119  C CZ  . TYR A 20  ? 2.1726 1.9895 1.9590 -0.2124 -0.2463 0.0117  20  TYR A CZ  
120  O OH  . TYR A 20  ? 2.5695 2.3766 2.3509 -0.2034 -0.2495 0.0139  20  TYR A OH  
121  N N   . SER A 21  ? 1.3705 1.2220 1.1350 -0.2645 -0.2290 -0.0108 21  SER A N   
122  C CA  . SER A 21  ? 1.3707 1.2255 1.1176 -0.2710 -0.2268 -0.0189 21  SER A CA  
123  C C   . SER A 21  ? 1.1424 0.9659 0.8494 -0.2808 -0.2309 -0.0003 21  SER A C   
124  O O   . SER A 21  ? 1.0156 0.8202 0.6998 -0.2797 -0.2350 0.0076  21  SER A O   
125  C CB  . SER A 21  ? 1.7161 1.6034 1.4845 -0.2776 -0.2180 -0.0428 21  SER A CB  
126  N N   . LYS A 22  ? 1.0091 0.8266 0.7089 -0.2902 -0.2298 0.0062  22  LYS A N   
127  C CA  . LYS A 22  ? 1.0241 0.8119 0.6879 -0.3002 -0.2334 0.0238  22  LYS A CA  
128  C C   . LYS A 22  ? 1.1776 0.9279 0.8188 -0.2946 -0.2423 0.0459  22  LYS A C   
129  O O   . LYS A 22  ? 1.0587 0.7873 0.6726 -0.3001 -0.2448 0.0541  22  LYS A O   
130  C CB  . LYS A 22  ? 1.3771 1.1618 1.0399 -0.3081 -0.2324 0.0306  22  LYS A CB  
131  C CG  . LYS A 22  ? 1.6960 1.4525 1.3230 -0.3196 -0.2351 0.0471  22  LYS A CG  
132  C CD  . LYS A 22  ? 2.0335 1.7838 1.6586 -0.3256 -0.2355 0.0567  22  LYS A CD  
133  C CE  . LYS A 22  ? 2.2469 1.9705 1.8364 -0.3381 -0.2375 0.0715  22  LYS A CE  
134  N NZ  . LYS A 22  ? 2.3224 2.0431 1.9081 -0.3458 -0.2370 0.0787  22  LYS A NZ  
135  N N   . TYR A 23  ? 1.0737 0.8155 0.7278 -0.2838 -0.2468 0.0550  23  TYR A N   
136  C CA  . TYR A 23  ? 1.1555 0.8579 0.7910 -0.2786 -0.2551 0.0772  23  TYR A CA  
137  C C   . TYR A 23  ? 1.0574 0.7528 0.6877 -0.2719 -0.2572 0.0743  23  TYR A C   
138  O O   . TYR A 23  ? 0.9547 0.6167 0.5610 -0.2738 -0.2623 0.0879  23  TYR A O   
139  C CB  . TYR A 23  ? 1.5475 1.2423 1.1991 -0.2691 -0.2592 0.0881  23  TYR A CB  
140  C CG  . TYR A 23  ? 1.9655 1.6188 1.6028 -0.2626 -0.2675 0.1100  23  TYR A CG  
141  C CD1 . TYR A 23  ? 2.0217 1.6701 1.6679 -0.2510 -0.2700 0.1087  23  TYR A CD1 
142  C CD2 . TYR A 23  ? 2.3074 1.9253 1.9238 -0.2682 -0.2727 0.1313  23  TYR A CD2 
143  C CE1 . TYR A 23  ? 2.0237 1.6322 1.6592 -0.2455 -0.2770 0.1271  23  TYR A CE1 
144  C CE2 . TYR A 23  ? 2.2035 1.7809 1.8098 -0.2630 -0.2798 0.1499  23  TYR A CE2 
145  C CZ  . TYR A 23  ? 1.9917 1.5642 1.6080 -0.2519 -0.2817 0.1471  23  TYR A CZ  
146  O OH  . TYR A 23  ? 1.7356 1.2665 1.3443 -0.2472 -0.2881 0.1633  23  TYR A OH  
147  N N   . ILE A 24  ? 1.0083 0.7351 0.6621 -0.2644 -0.2531 0.0555  24  ILE A N   
148  C CA  . ILE A 24  ? 0.9836 0.7086 0.6362 -0.2564 -0.2548 0.0508  24  ILE A CA  
149  C C   . ILE A 24  ? 1.0786 0.8021 0.7091 -0.2650 -0.2533 0.0453  24  ILE A C   
150  O O   . ILE A 24  ? 1.1720 0.8768 0.7876 -0.2618 -0.2571 0.0500  24  ILE A O   
151  C CB  . ILE A 24  ? 2.0811 1.8413 1.7668 -0.2459 -0.2507 0.0319  24  ILE A CB  
152  C CG1 . ILE A 24  ? 2.2510 2.0049 1.9548 -0.2362 -0.2538 0.0410  24  ILE A CG1 
153  C CG2 . ILE A 24  ? 1.7918 1.5540 1.4762 -0.2380 -0.2519 0.0254  24  ILE A CG2 
154  C CD1 . ILE A 24  ? 2.4543 2.1644 2.1367 -0.2360 -0.2614 0.0665  24  ILE A CD1 
155  N N   . ILE A 25  ? 0.9466 0.6882 0.5750 -0.2760 -0.2477 0.0355  25  ILE A N   
156  C CA  . ILE A 25  ? 1.3210 1.0613 0.9282 -0.2851 -0.2458 0.0307  25  ILE A CA  
157  C C   . ILE A 25  ? 1.0156 0.7170 0.5910 -0.2935 -0.2508 0.0505  25  ILE A C   
158  O O   . ILE A 25  ? 1.0300 0.7150 0.5857 -0.2951 -0.2534 0.0533  25  ILE A O   
159  C CB  . ILE A 25  ? 1.5968 1.3677 1.2135 -0.2944 -0.2378 0.0138  25  ILE A CB  
160  C CG1 . ILE A 25  ? 1.8433 1.6515 1.4937 -0.2866 -0.2327 -0.0077 25  ILE A CG1 
161  C CG2 . ILE A 25  ? 1.5336 1.3019 1.1271 -0.3042 -0.2359 0.0096  25  ILE A CG2 
162  C CD1 . ILE A 25  ? 1.9011 1.7386 1.5682 -0.2947 -0.2245 -0.0253 25  ILE A CD1 
163  N N   . GLN A 26  ? 1.0317 0.7184 0.6029 -0.2988 -0.2523 0.0637  26  GLN A N   
164  C CA  . GLN A 26  ? 1.0693 0.7190 0.6119 -0.3079 -0.2567 0.0821  26  GLN A CA  
165  C C   . GLN A 26  ? 1.0959 0.7066 0.6292 -0.3012 -0.2648 0.0998  26  GLN A C   
166  O O   . GLN A 26  ? 1.2073 0.7884 0.7179 -0.3065 -0.2686 0.1090  26  GLN A O   
167  C CB  . GLN A 26  ? 1.0947 0.7422 0.6354 -0.3164 -0.2553 0.0900  26  GLN A CB  
168  C CG  . GLN A 26  ? 1.3070 0.9901 0.8586 -0.3238 -0.2471 0.0728  26  GLN A CG  
169  C CD  . GLN A 26  ? 1.3490 1.0225 0.8886 -0.3351 -0.2462 0.0827  26  GLN A CD  
170  O OE1 . GLN A 26  ? 1.5327 1.1898 1.0730 -0.3331 -0.2503 0.0974  26  GLN A OE1 
171  N NE2 . GLN A 26  ? 1.3560 1.0384 0.8837 -0.3470 -0.2412 0.0751  26  GLN A NE2 
172  N N   . ASP A 27  ? 1.1444 0.7550 0.6966 -0.2898 -0.2672 0.1034  27  ASP A N   
173  C CA  . ASP A 27  ? 1.0882 0.6599 0.6353 -0.2843 -0.2745 0.1221  27  ASP A CA  
174  C C   . ASP A 27  ? 1.0186 0.5891 0.5809 -0.2700 -0.2772 0.1195  27  ASP A C   
175  O O   . ASP A 27  ? 1.0751 0.6242 0.6441 -0.2633 -0.2815 0.1318  27  ASP A O   
176  C CB  . ASP A 27  ? 1.2367 0.8018 0.7911 -0.2848 -0.2758 0.1343  27  ASP A CB  
177  C CG  . ASP A 27  ? 1.4346 0.9875 0.9701 -0.2986 -0.2754 0.1433  27  ASP A CG  
178  O OD1 . ASP A 27  ? 1.5903 1.1047 1.1053 -0.3044 -0.2801 0.1578  27  ASP A OD1 
179  O OD2 . ASP A 27  ? 1.5379 1.1188 1.0803 -0.3037 -0.2702 0.1351  27  ASP A OD2 
180  N N   . ARG A 28  ? 1.1943 0.7876 0.7628 -0.2649 -0.2745 0.1039  28  ARG A N   
181  C CA  . ARG A 28  ? 1.5215 1.1136 1.1036 -0.2512 -0.2769 0.1013  28  ARG A CA  
182  C C   . ARG A 28  ? 1.5076 1.1095 1.0835 -0.2487 -0.2760 0.0890  28  ARG A C   
183  O O   . ARG A 28  ? 1.4337 1.0067 0.9930 -0.2485 -0.2805 0.0956  28  ARG A O   
184  C CB  . ARG A 28  ? 1.5682 1.1913 1.1803 -0.2420 -0.2737 0.0927  28  ARG A CB  
185  C CG  . ARG A 28  ? 1.5801 1.1890 1.2055 -0.2281 -0.2778 0.0982  28  ARG A CG  
186  C CD  . ARG A 28  ? 1.5408 1.1863 1.1963 -0.2176 -0.2739 0.0838  28  ARG A CD  
187  N NE  . ARG A 28  ? 1.4657 1.1182 1.1410 -0.2135 -0.2736 0.0881  28  ARG A NE  
188  C CZ  . ARG A 28  ? 1.3723 0.9982 1.0411 -0.2160 -0.2775 0.1057  28  ARG A CZ  
189  N NH1 . ARG A 28  ? 1.1619 0.7496 0.8052 -0.2233 -0.2819 0.1211  28  ARG A NH1 
190  N NH2 . ARG A 28  ? 1.4935 1.1312 1.1825 -0.2111 -0.2769 0.1072  28  ARG A NH2 
191  N N   . ALA A 29  ? 1.6080 1.2505 1.1978 -0.2473 -0.2701 0.0702  29  ALA A N   
192  C CA  . ALA A 29  ? 1.5867 1.2435 1.1762 -0.2419 -0.2691 0.0572  29  ALA A CA  
193  C C   . ALA A 29  ? 1.4608 1.1129 1.0264 -0.2506 -0.2686 0.0537  29  ALA A C   
194  O O   . ALA A 29  ? 1.5698 1.2248 1.1307 -0.2455 -0.2695 0.0468  29  ALA A O   
195  C CB  . ALA A 29  ? 1.6092 1.3109 1.2252 -0.2365 -0.2629 0.0374  29  ALA A CB  
196  N N   . LEU A 30  ? 1.1858 0.8322 0.7370 -0.2635 -0.2671 0.0579  30  LEU A N   
197  C CA  . LEU A 30  ? 1.0361 0.6835 0.5667 -0.2725 -0.2656 0.0524  30  LEU A CA  
198  C C   . LEU A 30  ? 1.0379 0.6448 0.5417 -0.2804 -0.2707 0.0683  30  LEU A C   
199  O O   . LEU A 30  ? 1.0475 0.6332 0.5464 -0.2861 -0.2728 0.0819  30  LEU A O   
200  C CB  . LEU A 30  ? 1.0180 0.6972 0.5541 -0.2818 -0.2582 0.0396  30  LEU A CB  
201  C CG  . LEU A 30  ? 1.1239 0.8449 0.6879 -0.2751 -0.2525 0.0200  30  LEU A CG  
202  C CD1 . LEU A 30  ? 1.3800 1.1291 0.9521 -0.2848 -0.2451 0.0071  30  LEU A CD1 
203  C CD2 . LEU A 30  ? 1.0731 0.8061 0.6377 -0.2673 -0.2527 0.0084  30  LEU A CD2 
204  N N   . PRO A 31  ? 1.0684 0.6646 0.5553 -0.2805 -0.2730 0.0661  31  PRO A N   
205  C CA  . PRO A 31  ? 1.1574 0.7150 0.6194 -0.2872 -0.2783 0.0787  31  PRO A CA  
206  C C   . PRO A 31  ? 1.3438 0.9012 0.7914 -0.3019 -0.2754 0.0808  31  PRO A C   
207  O O   . PRO A 31  ? 1.4004 0.9893 0.8517 -0.3066 -0.2691 0.0681  31  PRO A O   
208  C CB  . PRO A 31  ? 1.1286 0.6884 0.5800 -0.2829 -0.2795 0.0701  31  PRO A CB  
209  C CG  . PRO A 31  ? 1.1179 0.7219 0.5819 -0.2817 -0.2726 0.0520  31  PRO A CG  
210  C CD  . PRO A 31  ? 1.0784 0.7018 0.5690 -0.2752 -0.2701 0.0496  31  PRO A CD  
211  N N   . ASP A 32  ? 1.6408 1.1626 1.0727 -0.3093 -0.2797 0.0958  32  ASP A N   
212  C CA  . ASP A 32  ? 1.7807 1.2961 1.1943 -0.3236 -0.2780 0.0988  32  ASP A CA  
213  C C   . ASP A 32  ? 1.8594 1.3762 1.2557 -0.3261 -0.2781 0.0905  32  ASP A C   
214  O O   . ASP A 32  ? 1.8341 1.3328 1.2234 -0.3195 -0.2830 0.0918  32  ASP A O   
215  C CB  . ASP A 32  ? 1.9879 1.4621 1.3898 -0.3299 -0.2835 0.1167  32  ASP A CB  
216  C CG  . ASP A 32  ? 2.0430 1.5084 1.4257 -0.3449 -0.2821 0.1208  32  ASP A CG  
217  O OD1 . ASP A 32  ? 1.9981 1.4724 1.3848 -0.3519 -0.2785 0.1244  32  ASP A OD1 
218  O OD2 . ASP A 32  ? 1.8519 1.3016 1.2155 -0.3495 -0.2845 0.1202  32  ASP A OD2 
219  N N   . ILE A 33  ? 1.8694 1.4078 1.2593 -0.3351 -0.2725 0.0817  33  ILE A N   
220  C CA  . ILE A 33  ? 1.8700 1.4137 1.2445 -0.3374 -0.2718 0.0727  33  ILE A CA  
221  C C   . ILE A 33  ? 1.5556 1.0612 0.9057 -0.3423 -0.2780 0.0831  33  ILE A C   
222  O O   . ILE A 33  ? 1.4056 0.9084 0.7442 -0.3395 -0.2799 0.0777  33  ILE A O   
223  C CB  . ILE A 33  ? 1.9496 1.5215 1.3222 -0.3475 -0.2643 0.0619  33  ILE A CB  
224  C CG1 . ILE A 33  ? 2.0558 1.6401 1.4174 -0.3473 -0.2628 0.0500  33  ILE A CG1 
225  C CG2 . ILE A 33  ? 1.8551 1.4082 1.2131 -0.3616 -0.2641 0.0728  33  ILE A CG2 
226  C CD1 . ILE A 33  ? 2.2238 1.8378 1.5860 -0.3563 -0.2549 0.0372  33  ILE A CD1 
227  N N   . ARG A 34  ? 1.5134 0.9898 0.8560 -0.3496 -0.2813 0.0973  34  ARG A N   
228  C CA  . ARG A 34  ? 1.5618 1.0004 0.8831 -0.3549 -0.2875 0.1067  34  ARG A CA  
229  C C   . ARG A 34  ? 1.3871 0.7967 0.7075 -0.3449 -0.2950 0.1121  34  ARG A C   
230  O O   . ARG A 34  ? 1.3528 0.7484 0.6584 -0.3435 -0.2986 0.1100  34  ARG A O   
231  C CB  . ARG A 34  ? 1.4254 0.8428 0.7403 -0.3665 -0.2883 0.1194  34  ARG A CB  
232  C CG  . ARG A 34  ? 1.4502 0.8899 0.7607 -0.3780 -0.2816 0.1149  34  ARG A CG  
233  C CD  . ARG A 34  ? 1.6161 1.0385 0.9245 -0.3877 -0.2820 0.1278  34  ARG A CD  
234  N NE  . ARG A 34  ? 1.9788 1.4086 1.3075 -0.3814 -0.2812 0.1320  34  ARG A NE  
235  C CZ  . ARG A 34  ? 2.2042 1.6202 1.5347 -0.3874 -0.2818 0.1440  34  ARG A CZ  
236  N NH1 . ARG A 34  ? 2.4972 1.8920 1.8103 -0.4000 -0.2830 0.1522  34  ARG A NH1 
237  N NH2 . ARG A 34  ? 2.2895 1.7129 1.6388 -0.3806 -0.2812 0.1479  34  ARG A NH2 
238  N N   . ASP A 35  ? 1.4572 0.8566 0.7929 -0.3382 -0.2974 0.1189  35  ASP A N   
239  C CA  . ASP A 35  ? 1.3146 0.6844 0.6502 -0.3292 -0.3044 0.1236  35  ASP A CA  
240  C C   . ASP A 35  ? 1.2868 0.6763 0.6387 -0.3144 -0.3036 0.1152  35  ASP A C   
241  O O   . ASP A 35  ? 1.3011 0.6702 0.6532 -0.3058 -0.3088 0.1167  35  ASP A O   
242  C CB  . ASP A 35  ? 1.3059 0.6425 0.6453 -0.3318 -0.3089 0.1375  35  ASP A CB  
243  C CG  . ASP A 35  ? 1.3016 0.6542 0.6635 -0.3271 -0.3059 0.1402  35  ASP A CG  
244  O OD1 . ASP A 35  ? 1.3996 0.7867 0.7755 -0.3193 -0.3014 0.1303  35  ASP A OD1 
245  O OD2 . ASP A 35  ? 1.4091 0.7403 0.7749 -0.3313 -0.3081 0.1517  35  ASP A OD2 
246  N N   . GLY A 36  ? 1.2581 0.6872 0.6241 -0.3118 -0.2972 0.1056  36  GLY A N   
247  C CA  . GLY A 36  ? 1.2419 0.6943 0.6243 -0.2985 -0.2957 0.0960  36  GLY A CA  
248  C C   . GLY A 36  ? 1.2110 0.6559 0.6129 -0.2885 -0.2979 0.1015  36  GLY A C   
249  O O   . GLY A 36  ? 1.2038 0.6601 0.6171 -0.2766 -0.2982 0.0949  36  GLY A O   
250  N N   . LEU A 37  ? 1.1927 0.6189 0.5986 -0.2933 -0.2994 0.1133  37  LEU A N   
251  C CA  . LEU A 37  ? 1.1633 0.5791 0.5875 -0.2845 -0.3018 0.1197  37  LEU A CA  
252  C C   . LEU A 37  ? 1.1200 0.5630 0.5638 -0.2840 -0.2967 0.1192  37  LEU A C   
253  O O   . LEU A 37  ? 1.1118 0.5648 0.5525 -0.2940 -0.2932 0.1211  37  LEU A O   
254  C CB  . LEU A 37  ? 1.8018 1.1713 1.2179 -0.2886 -0.3082 0.1338  37  LEU A CB  
255  C CG  . LEU A 37  ? 1.8967 1.2360 1.2939 -0.2890 -0.3139 0.1339  37  LEU A CG  
256  C CD1 . LEU A 37  ? 1.9823 1.2795 1.3684 -0.2980 -0.3193 0.1458  37  LEU A CD1 
257  C CD2 . LEU A 37  ? 3.0420 2.3767 2.4466 -0.2747 -0.3169 0.1285  37  LEU A CD2 
258  N N   . LYS A 38  ? 1.0936 0.5485 0.5578 -0.2721 -0.2964 0.1163  38  LYS A N   
259  C CA  . LYS A 38  ? 1.0761 0.5483 0.5601 -0.2702 -0.2933 0.1186  38  LYS A CA  
260  C C   . LYS A 38  ? 1.0468 0.4820 0.5290 -0.2736 -0.2979 0.1354  38  LYS A C   
261  O O   . LYS A 38  ? 1.0674 0.4651 0.5397 -0.2734 -0.3037 0.1428  38  LYS A O   
262  C CB  . LYS A 38  ? 1.3012 0.7946 0.8076 -0.2559 -0.2921 0.1106  38  LYS A CB  
263  C CG  . LYS A 38  ? 1.5504 1.0798 1.0610 -0.2517 -0.2878 0.0934  38  LYS A CG  
264  C CD  . LYS A 38  ? 1.6852 1.2202 1.2111 -0.2369 -0.2892 0.0881  38  LYS A CD  
265  C CE  . LYS A 38  ? 1.7814 1.3588 1.3172 -0.2326 -0.2839 0.0699  38  LYS A CE  
266  N NZ  . LYS A 38  ? 1.8252 1.4143 1.3804 -0.2184 -0.2842 0.0640  38  LYS A NZ  
267  N N   . PRO A 39  ? 1.1178 0.5629 0.6098 -0.2769 -0.2954 0.1409  39  PRO A N   
268  C CA  . PRO A 39  ? 1.0321 0.4424 0.5229 -0.2802 -0.2996 0.1573  39  PRO A CA  
269  C C   . PRO A 39  ? 1.0093 0.3870 0.5072 -0.2710 -0.3054 0.1635  39  PRO A C   
270  O O   . PRO A 39  ? 1.0264 0.3640 0.5135 -0.2763 -0.3105 0.1731  39  PRO A O   
271  C CB  . PRO A 39  ? 1.0199 0.4564 0.5265 -0.2798 -0.2954 0.1588  39  PRO A CB  
272  C CG  . PRO A 39  ? 1.0311 0.5091 0.5372 -0.2842 -0.2888 0.1440  39  PRO A CG  
273  C CD  . PRO A 39  ? 1.1143 0.6024 0.6184 -0.2783 -0.2885 0.1313  39  PRO A CD  
274  N N   . VAL A 40  ? 0.9915 0.3852 0.5074 -0.2579 -0.3046 0.1568  40  VAL A N   
275  C CA  . VAL A 40  ? 0.9898 0.3534 0.5132 -0.2492 -0.3096 0.1614  40  VAL A CA  
276  C C   . VAL A 40  ? 1.0288 0.3599 0.5351 -0.2512 -0.3146 0.1604  40  VAL A C   
277  O O   . VAL A 40  ? 1.0363 0.3292 0.5418 -0.2511 -0.3197 0.1671  40  VAL A O   
278  C CB  . VAL A 40  ? 1.3385 0.7263 0.8836 -0.2344 -0.3076 0.1529  40  VAL A CB  
279  C CG1 . VAL A 40  ? 1.0662 0.4767 0.6074 -0.2294 -0.3058 0.1385  40  VAL A CG1 
280  C CG2 . VAL A 40  ? 1.7397 1.0946 1.2944 -0.2266 -0.3122 0.1592  40  VAL A CG2 
281  N N   . GLN A 41  ? 1.0550 0.4015 0.5483 -0.2531 -0.3131 0.1510  41  GLN A N   
282  C CA  . GLN A 41  ? 1.4347 0.7526 0.9109 -0.2540 -0.3180 0.1493  41  GLN A CA  
283  C C   . GLN A 41  ? 1.1213 0.4059 0.5792 -0.2675 -0.3217 0.1582  41  GLN A C   
284  O O   . GLN A 41  ? 1.1446 0.3920 0.5956 -0.2682 -0.3275 0.1613  41  GLN A O   
285  C CB  . GLN A 41  ? 1.7444 1.0881 1.2120 -0.2513 -0.3156 0.1370  41  GLN A CB  
286  C CG  . GLN A 41  ? 1.9024 1.2844 1.3881 -0.2400 -0.3111 0.1268  41  GLN A CG  
287  C CD  . GLN A 41  ? 1.8655 1.2791 1.3432 -0.2407 -0.3074 0.1143  41  GLN A CD  
288  O OE1 . GLN A 41  ? 1.9834 1.4091 1.4651 -0.2311 -0.3072 0.1055  41  GLN A OE1 
289  N NE2 . GLN A 41  ? 1.6389 1.0654 1.1052 -0.2522 -0.3042 0.1131  41  GLN A NE2 
290  N N   . ARG A 42  ? 1.1180 0.4162 0.5682 -0.2783 -0.3183 0.1612  42  ARG A N   
291  C CA  . ARG A 42  ? 1.1381 0.4063 0.5723 -0.2916 -0.3213 0.1702  42  ARG A CA  
292  C C   . ARG A 42  ? 1.1252 0.3577 0.5675 -0.2926 -0.3259 0.1809  42  ARG A C   
293  O O   . ARG A 42  ? 1.1525 0.3480 0.5839 -0.2987 -0.3314 0.1846  42  ARG A O   
294  C CB  . ARG A 42  ? 1.2142 0.5054 0.6429 -0.3022 -0.3162 0.1724  42  ARG A CB  
295  C CG  . ARG A 42  ? 1.1772 0.4399 0.5869 -0.3166 -0.3190 0.1804  42  ARG A CG  
296  C CD  . ARG A 42  ? 1.2078 0.4935 0.6100 -0.3276 -0.3136 0.1816  42  ARG A CD  
297  N NE  . ARG A 42  ? 1.2110 0.5328 0.6088 -0.3269 -0.3084 0.1691  42  ARG A NE  
298  C CZ  . ARG A 42  ? 1.1835 0.5450 0.5962 -0.3205 -0.3027 0.1608  42  ARG A CZ  
299  N NH1 . ARG A 42  ? 1.1513 0.5211 0.5834 -0.3137 -0.3017 0.1645  42  ARG A NH1 
300  N NH2 . ARG A 42  ? 1.2922 0.6849 0.7012 -0.3209 -0.2980 0.1480  42  ARG A NH2 
301  N N   . ARG A 43  ? 1.0846 0.3290 0.5466 -0.2868 -0.3236 0.1851  43  ARG A N   
302  C CA  . ARG A 43  ? 1.0694 0.2814 0.5410 -0.2873 -0.3275 0.1948  43  ARG A CA  
303  C C   . ARG A 43  ? 1.0877 0.2697 0.5618 -0.2806 -0.3330 0.1903  43  ARG A C   
304  O O   . ARG A 43  ? 1.1044 0.2483 0.5733 -0.2870 -0.3383 0.1941  43  ARG A O   
305  C CB  . ARG A 43  ? 1.0234 0.2569 0.5158 -0.2808 -0.3238 0.1997  43  ARG A CB  
306  C CG  . ARG A 43  ? 1.0461 0.2935 0.5349 -0.2901 -0.3204 0.2080  43  ARG A CG  
307  C CD  . ARG A 43  ? 1.0180 0.3081 0.5234 -0.2819 -0.3148 0.2055  43  ARG A CD  
308  N NE  . ARG A 43  ? 1.0421 0.3453 0.5437 -0.2902 -0.3119 0.2130  43  ARG A NE  
309  C CZ  . ARG A 43  ? 1.0254 0.3644 0.5401 -0.2852 -0.3076 0.2117  43  ARG A CZ  
310  N NH1 . ARG A 43  ? 1.0764 0.4417 0.6102 -0.2722 -0.3056 0.2029  43  ARG A NH1 
311  N NH2 . ARG A 43  ? 1.0518 0.4006 0.5609 -0.2932 -0.3054 0.2181  43  ARG A NH2 
312  N N   . ILE A 44  ? 1.0862 0.2859 0.5678 -0.2682 -0.3319 0.1810  44  ILE A N   
313  C CA  . ILE A 44  ? 1.7998 0.9740 1.2804 -0.2615 -0.3369 0.1748  44  ILE A CA  
314  C C   . ILE A 44  ? 1.1579 0.3007 0.6168 -0.2702 -0.3423 0.1736  44  ILE A C   
315  O O   . ILE A 44  ? 1.1727 0.2787 0.6306 -0.2726 -0.3479 0.1744  44  ILE A O   
316  C CB  . ILE A 44  ? 1.9791 1.1801 1.4646 -0.2486 -0.3345 0.1642  44  ILE A CB  
317  C CG1 . ILE A 44  ? 2.3770 1.6056 1.8859 -0.2388 -0.3301 0.1641  44  ILE A CG1 
318  C CG2 . ILE A 44  ? 1.8660 1.0395 1.3471 -0.2422 -0.3398 0.1579  44  ILE A CG2 
319  C CD1 . ILE A 44  ? 2.6199 1.8631 2.1382 -0.2248 -0.3293 0.1542  44  ILE A CD1 
320  N N   . LEU A 45  ? 1.1837 0.3413 0.6254 -0.2750 -0.3407 0.1705  45  LEU A N   
321  C CA  . LEU A 45  ? 1.2584 0.3893 0.6787 -0.2824 -0.3456 0.1689  45  LEU A CA  
322  C C   . LEU A 45  ? 1.2381 0.3385 0.6522 -0.2960 -0.3490 0.1776  45  LEU A C   
323  O O   . LEU A 45  ? 1.2709 0.3369 0.6755 -0.2999 -0.3552 0.1764  45  LEU A O   
324  C CB  . LEU A 45  ? 1.3389 0.4940 0.7428 -0.2855 -0.3425 0.1643  45  LEU A CB  
325  C CG  . LEU A 45  ? 1.4818 0.6631 0.8871 -0.2736 -0.3402 0.1541  45  LEU A CG  
326  C CD1 . LEU A 45  ? 1.7457 0.9465 1.1329 -0.2792 -0.3376 0.1496  45  LEU A CD1 
327  C CD2 . LEU A 45  ? 1.3708 0.5255 0.7739 -0.2654 -0.3457 0.1495  45  LEU A CD2 
328  N N   . TYR A 46  ? 1.5178 0.6319 0.9371 -0.3031 -0.3450 0.1857  46  TYR A N   
329  C CA  . TYR A 46  ? 1.7911 0.8787 1.2044 -0.3167 -0.3478 0.1944  46  TYR A CA  
330  C C   . TYR A 46  ? 1.2025 0.2560 0.6279 -0.3162 -0.3529 0.1966  46  TYR A C   
331  O O   . TYR A 46  ? 1.2099 0.2534 0.6621 -0.3582 -0.3747 0.1248  46  TYR A O   
332  C CB  . TYR A 46  ? 2.0885 1.1993 1.5056 -0.3235 -0.3420 0.2032  46  TYR A CB  
333  C CG  . TYR A 46  ? 2.4131 1.4952 1.8245 -0.3374 -0.3450 0.2126  46  TYR A CG  
334  C CD1 . TYR A 46  ? 2.3306 1.4298 1.8084 -0.3827 -0.3643 0.1339  46  TYR A CD1 
335  C CD2 . TYR A 46  ? 2.6171 1.6788 2.0084 -0.3484 -0.3486 0.2118  46  TYR A CD2 
336  C CE1 . TYR A 46  ? 2.2848 1.6837 1.4849 -0.2586 -0.4922 0.1826  46  TYR A CE1 
337  C CE2 . TYR A 46  ? 2.5874 1.6218 1.9739 -0.3616 -0.3518 0.2195  46  TYR A CE2 
338  C CZ  . TYR A 46  ? 2.4126 1.7926 1.5810 -0.2669 -0.4970 0.1845  46  TYR A CZ  
339  O OH  . TYR A 46  ? 2.1487 1.4774 1.5507 -0.2923 -0.3776 0.1414  46  TYR A OH  
340  N N   . SER A 47  ? 1.1656 0.2294 0.6115 -0.3064 -0.3508 0.1970  47  SER A N   
341  C CA  . SER A 47  ? 1.1336 0.2184 0.6293 -0.3348 -0.3708 0.1211  47  SER A CA  
342  C C   . SER A 47  ? 1.1733 0.2335 0.6569 -0.3261 -0.3760 0.1177  47  SER A C   
343  O O   . SER A 47  ? 1.1876 0.2348 0.6672 -0.3256 -0.3818 0.1180  47  SER A O   
344  C CB  . SER A 47  ? 1.0591 0.4841 0.3482 -0.2103 -0.4888 0.1597  47  SER A CB  
345  O OG  . SER A 47  ? 1.0419 0.4722 0.3484 -0.2043 -0.4941 0.1589  47  SER A OG  
346  N N   . MET A 48  ? 1.1635 0.5448 0.4002 -0.2087 -0.4987 0.1525  48  MET A N   
347  C CA  . MET A 48  ? 1.1993 0.5657 0.4252 -0.2030 -0.5053 0.1480  48  MET A CA  
348  C C   . MET A 48  ? 1.2795 0.2815 0.7220 -0.3206 -0.3842 0.1128  48  MET A C   
349  O O   . MET A 48  ? 1.2757 0.6088 0.4598 -0.2074 -0.5200 0.1485  48  MET A O   
350  C CB  . MET A 48  ? 1.2551 0.2682 0.6967 -0.2739 -0.3651 0.1622  48  MET A CB  
351  C CG  . MET A 48  ? 1.1545 0.5532 0.4281 -0.2047 -0.5030 0.1047  48  MET A CG  
352  S SD  . MET A 48  ? 4.3555 3.4194 3.8197 -0.2464 -0.3577 0.1521  48  MET A SD  
353  C CE  . MET A 48  ? 2.0417 1.0707 1.4968 -0.2412 -0.3648 0.1425  48  MET A CE  
354  N N   . ASN A 49  ? 1.2871 0.2870 0.7195 -0.3342 -0.3822 0.1160  49  ASN A N   
355  C CA  . ASN A 49  ? 1.6002 0.5596 0.9859 -0.3171 -0.3743 0.1740  49  ASN A CA  
356  C C   . ASN A 49  ? 1.3020 0.6215 0.4440 -0.2317 -0.5221 0.1609  49  ASN A C   
357  O O   . ASN A 49  ? 1.3666 0.3141 0.7632 -0.3518 -0.3976 0.1207  49  ASN A O   
358  C CB  . ASN A 49  ? 1.8322 0.8167 1.2025 -0.3211 -0.3700 0.1763  49  ASN A CB  
359  C CG  . ASN A 49  ? 2.2740 1.2365 1.6209 -0.3310 -0.3747 0.1753  49  ASN A CG  
360  O OD1 . ASN A 49  ? 2.3247 1.2791 1.6658 -0.3437 -0.3751 0.1817  49  ASN A OD1 
361  N ND2 . ASN A 49  ? 2.5644 1.5178 1.8977 -0.3249 -0.3783 0.1675  49  ASN A ND2 
362  N N   . LYS A 50  ? 1.2817 0.2768 0.7099 -0.3537 -0.3889 0.1231  50  LYS A N   
369  N N   . ASP A 51  ? 1.3476 1.6599 1.5210 0.1841  0.5461  -0.0870 51  ASP A N   
370  C CA  . ASP A 51  ? 1.5932 1.8805 1.7559 0.1867  0.5437  -0.0713 51  ASP A CA  
371  C C   . ASP A 51  ? 1.5241 1.7838 1.6726 0.1887  0.5446  -0.0556 51  ASP A C   
372  O O   . ASP A 51  ? 1.5238 1.7600 1.6619 0.1924  0.5422  -0.0400 51  ASP A O   
373  C CB  . ASP A 51  ? 1.8578 2.1393 2.0201 0.1898  0.5388  -0.0645 51  ASP A CB  
374  C CG  . ASP A 51  ? 1.9613 2.2677 2.1370 0.1885  0.5374  -0.0784 51  ASP A CG  
375  O OD1 . ASP A 51  ? 1.8920 2.2150 2.0750 0.1863  0.5397  -0.0898 51  ASP A OD1 
376  O OD2 . ASP A 51  ? 2.0401 2.3486 2.2186 0.1903  0.5339  -0.0771 51  ASP A OD2 
377  N N   . SER A 52  ? 1.4098 1.6717 1.5574 0.1869  0.5479  -0.0589 52  SER A N   
378  C CA  . SER A 52  ? 1.3143 1.5514 1.4489 0.1889  0.5492  -0.0451 52  SER A CA  
379  C C   . SER A 52  ? 1.2379 1.4516 1.3621 0.1941  0.5456  -0.0280 52  SER A C   
380  O O   . SER A 52  ? 1.2662 1.4548 1.3780 0.1979  0.5451  -0.0125 52  SER A O   
381  C CB  . SER A 52  ? 1.2381 1.4610 1.3660 0.1897  0.5499  -0.0378 52  SER A CB  
382  O OG  . SER A 52  ? 1.2307 1.4731 1.3669 0.1853  0.5534  -0.0523 52  SER A OG  
383  N N   . ASN A 53  ? 1.2491 1.4712 1.3785 0.1949  0.5428  -0.0306 53  ASN A N   
384  C CA  . ASN A 53  ? 1.3090 1.5109 1.4295 0.2002  0.5389  -0.0148 53  ASN A CA  
385  C C   . ASN A 53  ? 1.4285 1.6302 1.5475 0.1997  0.5407  -0.0155 53  ASN A C   
386  O O   . ASN A 53  ? 1.5116 1.7222 1.6353 0.1995  0.5394  -0.0194 53  ASN A O   
387  C CB  . ASN A 53  ? 1.2753 1.4871 1.4026 0.2009  0.5351  -0.0180 53  ASN A CB  
388  C CG  . ASN A 53  ? 1.1916 1.3824 1.3097 0.2070  0.5305  -0.0009 53  ASN A CG  
389  O OD1 . ASN A 53  ? 1.2187 1.3850 1.3241 0.2117  0.5295  0.0153  53  ASN A OD1 
390  N ND2 . ASN A 53  ? 1.1643 1.3648 1.2887 0.2073  0.5275  -0.0045 53  ASN A ND2 
391  N N   . THR A 54  ? 1.3718 1.5631 1.4843 0.1995  0.5437  -0.0115 54  THR A N   
392  C CA  . THR A 54  ? 1.3566 1.5481 1.4676 0.1984  0.5462  -0.0130 54  THR A CA  
393  C C   . THR A 54  ? 1.3277 1.4894 1.4243 0.2047  0.5440  0.0072  54  THR A C   
394  O O   . THR A 54  ? 1.3331 1.4724 1.4197 0.2105  0.5406  0.0236  54  THR A O   
395  C CB  . THR A 54  ? 1.4637 1.6672 1.5787 0.1936  0.5514  -0.0245 54  THR A CB  
396  O OG1 . THR A 54  ? 1.3360 1.5239 1.4435 0.1949  0.5521  -0.0163 54  THR A OG1 
397  C CG2 . THR A 54  ? 1.6855 1.9205 1.8154 0.1883  0.5533  -0.0448 54  THR A CG2 
398  N N   . PHE A 55  ? 1.3474 1.5092 1.4428 0.2040  0.5460  0.0061  55  PHE A N   
399  C CA  . PHE A 55  ? 1.3731 1.5099 1.4563 0.2102  0.5436  0.0239  55  PHE A CA  
400  C C   . PHE A 55  ? 1.4034 1.5133 1.4735 0.2153  0.5430  0.0404  55  PHE A C   
401  O O   . PHE A 55  ? 1.4196 1.5048 1.4782 0.2228  0.5393  0.0590  55  PHE A O   
402  C CB  . PHE A 55  ? 1.3897 1.5342 1.4751 0.2076  0.5465  0.0174  55  PHE A CB  
403  C CG  . PHE A 55  ? 1.4220 1.5625 1.5040 0.2056  0.5509  0.0161  55  PHE A CG  
404  C CD1 . PHE A 55  ? 1.4171 1.5786 1.5082 0.1991  0.5553  -0.0005 55  PHE A CD1 
405  C CD2 . PHE A 55  ? 1.4579 1.5732 1.5274 0.2108  0.5503  0.0320  55  PHE A CD2 
406  C CE1 . PHE A 55  ? 1.4473 1.6047 1.5350 0.1974  0.5593  -0.0013 55  PHE A CE1 
407  C CE2 . PHE A 55  ? 1.4886 1.5999 1.5550 0.2091  0.5543  0.0310  55  PHE A CE2 
408  C CZ  . PHE A 55  ? 1.5028 1.6351 1.5782 0.2021  0.5589  0.0142  55  PHE A CZ  
409  N N   . ASP A 56  ? 1.5907 1.7059 1.6628 0.2117  0.5465  0.0336  56  ASP A N   
410  C CA  . ASP A 56  ? 1.8209 1.9130 1.8818 0.2158  0.5468  0.0470  56  ASP A CA  
411  C C   . ASP A 56  ? 2.0297 2.1093 2.0858 0.2198  0.5436  0.0567  56  ASP A C   
412  O O   . ASP A 56  ? 2.2892 2.3504 2.3364 0.2234  0.5435  0.0675  56  ASP A O   
413  C CB  . ASP A 56  ? 1.7384 1.8420 1.8034 0.2098  0.5526  0.0348  56  ASP A CB  
414  C CG  . ASP A 56  ? 1.5064 1.6376 1.5845 0.2027  0.5551  0.0156  56  ASP A CG  
415  O OD1 . ASP A 56  ? 1.4655 1.6160 1.5533 0.2002  0.5541  0.0051  56  ASP A OD1 
416  O OD2 . ASP A 56  ? 1.4383 1.5719 1.5171 0.2002  0.5579  0.0113  56  ASP A OD2 
417  N N   . LYS A 57  ? 1.8559 1.9459 1.9180 0.2192  0.5409  0.0527  57  LYS A N   
418  C CA  . LYS A 57  ? 1.6958 1.7747 1.7538 0.2230  0.5376  0.0618  57  LYS A CA  
419  C C   . LYS A 57  ? 1.6315 1.6990 1.6850 0.2293  0.5317  0.0744  57  LYS A C   
420  O O   . LYS A 57  ? 1.5139 1.5846 1.5689 0.2300  0.5304  0.0743  57  LYS A O   
421  C CB  . LYS A 57  ? 1.5457 1.6477 1.6151 0.2162  0.5402  0.0447  57  LYS A CB  
422  C CG  . LYS A 57  ? 1.4457 1.5608 1.5199 0.2100  0.5461  0.0316  57  LYS A CG  
423  C CD  . LYS A 57  ? 1.3544 1.4886 1.4380 0.2045  0.5484  0.0174  57  LYS A CD  
424  C CE  . LYS A 57  ? 1.4550 1.6017 1.5429 0.1989  0.5540  0.0050  57  LYS A CE  
425  N NZ  . LYS A 57  ? 1.5242 1.6962 1.6240 0.1930  0.5565  -0.0126 57  LYS A NZ  
426  N N   . SER A 58  ? 1.7027 1.7565 1.7505 0.2341  0.5281  0.0857  58  SER A N   
427  C CA  . SER A 58  ? 1.7543 1.7930 1.7955 0.2415  0.5220  0.1010  58  SER A CA  
428  C C   . SER A 58  ? 1.3147 1.3737 1.3664 0.2378  0.5209  0.0897  58  SER A C   
429  O O   . SER A 58  ? 1.2914 1.3757 1.3558 0.2303  0.5239  0.0710  58  SER A O   
430  C CB  . SER A 58  ? 2.0022 2.0257 2.0369 0.2466  0.5185  0.1130  58  SER A CB  
431  O OG  . SER A 58  ? 2.2007 2.2197 2.2330 0.2453  0.5216  0.1122  58  SER A OG  
432  N N   . TYR A 59  ? 1.3114 1.3593 1.3579 0.2435  0.5164  0.1013  59  TYR A N   
433  C CA  . TYR A 59  ? 1.2787 1.3439 1.3344 0.2408  0.5149  0.0923  59  TYR A CA  
434  C C   . TYR A 59  ? 1.2493 1.3236 1.3106 0.2390  0.5138  0.0871  59  TYR A C   
435  O O   . TYR A 59  ? 1.2548 1.3139 1.3089 0.2429  0.5120  0.0978  59  TYR A O   
436  C CB  . TYR A 59  ? 1.3285 1.3768 1.3758 0.2484  0.5097  0.1085  59  TYR A CB  
437  C CG  . TYR A 59  ? 1.5253 1.5689 1.5692 0.2494  0.5108  0.1110  59  TYR A CG  
438  C CD1 . TYR A 59  ? 1.7198 1.7402 1.7516 0.2554  0.5102  0.1262  59  TYR A CD1 
439  C CD2 . TYR A 59  ? 1.4951 1.5576 1.5483 0.2446  0.5123  0.0984  59  TYR A CD2 
440  C CE1 . TYR A 59  ? 1.7296 1.7453 1.7582 0.2565  0.5112  0.1288  59  TYR A CE1 
441  C CE2 . TYR A 59  ? 1.5079 1.5657 1.5577 0.2457  0.5133  0.1011  59  TYR A CE2 
442  C CZ  . TYR A 59  ? 1.5539 1.5883 1.5915 0.2515  0.5127  0.1163  59  TYR A CZ  
443  O OH  . TYR A 59  ? 1.4703 1.4995 1.5044 0.2528  0.5136  0.1192  59  TYR A OH  
444  N N   . ARG A 60  ? 1.2189 1.3185 1.2936 0.2330  0.5148  0.0702  60  ARG A N   
445  C CA  . ARG A 60  ? 1.2190 1.3302 1.3008 0.2306  0.5139  0.0631  60  ARG A CA  
446  C C   . ARG A 60  ? 1.2826 1.3989 1.3680 0.2323  0.5100  0.0638  60  ARG A C   
447  O O   . ARG A 60  ? 1.1627 1.2867 1.2518 0.2312  0.5101  0.0593  60  ARG A O   
448  C CB  . ARG A 60  ? 1.1776 1.3173 1.2735 0.2217  0.5192  0.0400  60  ARG A CB  
449  C CG  . ARG A 60  ? 1.1458 1.3025 1.2515 0.2184  0.5188  0.0290  60  ARG A CG  
450  C CD  . ARG A 60  ? 1.8037 1.9936 1.9257 0.2102  0.5233  0.0041  60  ARG A CD  
451  N NE  . ARG A 60  ? 1.8192 2.0153 1.9429 0.2064  0.5277  -0.0038 60  ARG A NE  
452  C CZ  . ARG A 60  ? 1.8759 2.0529 1.9890 0.2084  0.5293  0.0068  60  ARG A CZ  
453  N NH1 . ARG A 60  ? 1.7054 1.8547 1.8046 0.2149  0.5266  0.0266  60  ARG A NH1 
454  N NH2 . ARG A 60  ? 2.0885 2.2746 2.2049 0.2042  0.5335  -0.0026 60  ARG A NH2 
455  N N   . LYS A 61  ? 1.2801 1.3907 1.3638 0.2353  0.5063  0.0705  61  LYS A N   
456  C CA  . LYS A 61  ? 1.3984 1.5112 1.4843 0.2376  0.5021  0.0732  61  LYS A CA  
457  C C   . LYS A 61  ? 1.1025 1.2455 1.2045 0.2304  0.5046  0.0516  61  LYS A C   
458  O O   . LYS A 61  ? 1.0884 1.2548 1.2027 0.2239  0.5080  0.0331  61  LYS A O   
459  C CB  . LYS A 61  ? 1.5611 1.6684 1.6454 0.2402  0.4988  0.0794  61  LYS A CB  
460  C CG  . LYS A 61  ? 1.6986 1.8113 1.7869 0.2416  0.4947  0.0799  61  LYS A CG  
461  C CD  . LYS A 61  ? 1.8755 1.9679 1.9526 0.2491  0.4902  0.0982  61  LYS A CD  
462  C CE  . LYS A 61  ? 2.1107 2.1717 2.1708 0.2586  0.4856  0.1229  61  LYS A CE  
463  N NZ  . LYS A 61  ? 2.2965 2.3391 2.3464 0.2666  0.4804  0.1407  61  LYS A NZ  
464  N N   . SER A 62  ? 1.1015 1.2444 1.2035 0.2320  0.5026  0.0540  62  SER A N   
465  C CA  . SER A 62  ? 1.0827 1.2540 1.2000 0.2260  0.5044  0.0341  62  SER A CA  
466  C C   . SER A 62  ? 1.0528 1.2463 1.1832 0.2218  0.5045  0.0190  62  SER A C   
467  O O   . SER A 62  ? 1.0427 1.2629 1.1868 0.2156  0.5079  -0.0013 62  SER A O   
468  C CB  . SER A 62  ? 1.0815 1.2475 1.1963 0.2294  0.5011  0.0411  62  SER A CB  
469  O OG  . SER A 62  ? 1.1081 1.2606 1.2143 0.2318  0.5020  0.0498  62  SER A OG  
470  N N   . ALA A 63  ? 1.1987 1.3814 1.3249 0.2257  0.5004  0.0293  63  ALA A N   
471  C CA  . ALA A 63  ? 1.5258 1.7287 1.6644 0.2223  0.5000  0.0159  63  ALA A CA  
472  C C   . ALA A 63  ? 1.5561 1.7743 1.7023 0.2173  0.5039  0.0021  63  ALA A C   
473  O O   . ALA A 63  ? 1.3932 1.6379 1.5538 0.2126  0.5053  -0.0165 63  ALA A O   
474  C CB  . ALA A 63  ? 1.8159 2.0024 1.9473 0.2277  0.4950  0.0310  63  ALA A CB  
475  N N   . LYS A 64  ? 1.6918 1.8938 1.8282 0.2187  0.5055  0.0112  64  LYS A N   
476  C CA  . LYS A 64  ? 1.6414 1.8583 1.7848 0.2138  0.5094  -0.0022 64  LYS A CA  
477  C C   . LYS A 64  ? 1.2956 1.5391 1.4514 0.2080  0.5135  -0.0223 64  LYS A C   
478  O O   . LYS A 64  ? 1.0516 1.3204 1.2203 0.2039  0.5153  -0.0399 64  LYS A O   
479  C CB  . LYS A 64  ? 1.8287 2.0228 1.9591 0.2164  0.5106  0.0113  64  LYS A CB  
480  C CG  . LYS A 64  ? 1.7097 1.9165 1.8458 0.2116  0.5149  -0.0008 64  LYS A CG  
481  C CD  . LYS A 64  ? 1.4463 1.6270 1.5680 0.2152  0.5153  0.0153  64  LYS A CD  
482  C CE  . LYS A 64  ? 1.0754 1.2660 1.2015 0.2110  0.5190  0.0053  64  LYS A CE  
483  N NZ  . LYS A 64  ? 1.1091 1.2793 1.2234 0.2131  0.5209  0.0166  64  LYS A NZ  
484  N N   . SER A 65  ? 1.0424 1.2804 1.1940 0.2085  0.5147  -0.0192 65  SER A N   
485  C CA  . SER A 65  ? 1.0442 1.3064 1.2065 0.2036  0.5185  -0.0370 65  SER A CA  
486  C C   . SER A 65  ? 1.1389 1.4286 1.3162 0.2013  0.5175  -0.0534 65  SER A C   
487  O O   . SER A 65  ? 1.0556 1.3705 1.2446 0.1979  0.5198  -0.0705 65  SER A O   
488  C CB  . SER A 65  ? 1.0695 1.3201 1.2244 0.2048  0.5196  -0.0300 65  SER A CB  
489  O OG  . SER A 65  ? 1.1002 1.3334 1.2448 0.2057  0.5219  -0.0209 65  SER A OG  
490  N N   . VAL A 66  ? 1.3449 1.6291 1.5212 0.2040  0.5138  -0.0472 66  VAL A N   
491  C CA  . VAL A 66  ? 1.5565 1.8646 1.7462 0.2027  0.5122  -0.0610 66  VAL A CA  
492  C C   . VAL A 66  ? 1.4511 1.7786 1.6516 0.2011  0.5119  -0.0732 66  VAL A C   
493  O O   . VAL A 66  ? 1.5396 1.8946 1.7533 0.1994  0.5128  -0.0902 66  VAL A O   
494  C CB  . VAL A 66  ? 1.8099 2.1046 1.9950 0.2064  0.5079  -0.0493 66  VAL A CB  
495  C CG1 . VAL A 66  ? 2.0544 2.3731 2.2536 0.2053  0.5059  -0.0631 66  VAL A CG1 
496  C CG2 . VAL A 66  ? 1.7329 2.0147 1.9103 0.2081  0.5081  -0.0406 66  VAL A CG2 
497  N N   . GLY A 67  ? 1.3016 1.6144 1.4960 0.2027  0.5104  -0.0635 67  GLY A N   
498  C CA  . GLY A 67  ? 0.9408 1.2696 1.1444 0.2015  0.5098  -0.0735 67  GLY A CA  
499  C C   . GLY A 67  ? 0.9397 1.2892 1.1513 0.1984  0.5137  -0.0886 67  GLY A C   
500  O O   . GLY A 67  ? 0.9225 1.2963 1.1465 0.1978  0.5136  -0.1028 67  GLY A O   
501  N N   . ASN A 68  ? 0.9594 1.2988 1.1637 0.1972  0.5171  -0.0847 68  ASN A N   
502  C CA  . ASN A 68  ? 0.9606 1.3177 1.1713 0.1946  0.5210  -0.0975 68  ASN A CA  
503  C C   . ASN A 68  ? 0.9578 1.3402 1.1794 0.1940  0.5225  -0.1124 68  ASN A C   
504  O O   . ASN A 68  ? 0.9475 1.3512 1.1787 0.1937  0.5243  -0.1252 68  ASN A O   
505  C CB  . ASN A 68  ? 0.9853 1.3246 1.1852 0.1936  0.5242  -0.0891 68  ASN A CB  
506  C CG  . ASN A 68  ? 1.2179 1.5346 1.4076 0.1950  0.5231  -0.0755 68  ASN A CG  
507  O OD1 . ASN A 68  ? 1.2012 1.4917 1.3779 0.1973  0.5225  -0.0591 68  ASN A OD1 
508  N ND2 . ASN A 68  ? 1.3423 1.6687 1.5378 0.1943  0.5226  -0.0814 68  ASN A ND2 
509  N N   . ILE A 69  ? 1.1503 1.5290 1.3699 0.1945  0.5219  -0.1095 69  ILE A N   
510  C CA  . ILE A 69  ? 1.5526 1.9530 1.7815 0.1946  0.5231  -0.1217 69  ILE A CA  
511  C C   . ILE A 69  ? 1.5808 2.0027 1.8220 0.1968  0.5207  -0.1320 69  ILE A C   
512  O O   . ILE A 69  ? 1.6185 2.0611 1.8692 0.1979  0.5228  -0.1439 69  ILE A O   
513  C CB  . ILE A 69  ? 2.0975 2.4871 2.3212 0.1950  0.5220  -0.1148 69  ILE A CB  
514  C CG1 . ILE A 69  ? 2.3824 2.7559 2.5960 0.1936  0.5252  -0.1073 69  ILE A CG1 
515  C CG2 . ILE A 69  ? 2.2980 2.7103 2.5324 0.1961  0.5217  -0.1266 69  ILE A CG2 
516  C CD1 . ILE A 69  ? 2.5425 2.8923 2.7453 0.1951  0.5233  -0.0924 69  ILE A CD1 
517  N N   . MET A 70  ? 1.5655 1.9798 1.8058 0.1980  0.5166  -0.1260 70  MET A N   
518  C CA  . MET A 70  ? 1.4131 1.8448 1.6640 0.2003  0.5139  -0.1340 70  MET A CA  
519  C C   . MET A 70  ? 1.1200 1.5649 1.3776 0.2010  0.5152  -0.1419 70  MET A C   
520  O O   . MET A 70  ? 0.9713 1.4360 1.2395 0.2037  0.5157  -0.1521 70  MET A O   
521  C CB  . MET A 70  ? 1.5736 1.9904 1.8204 0.2011  0.5094  -0.1240 70  MET A CB  
522  C CG  . MET A 70  ? 1.6081 2.0423 1.8657 0.2036  0.5061  -0.1316 70  MET A CG  
523  S SD  . MET A 70  ? 2.7112 3.1252 2.9629 0.2045  0.5011  -0.1183 70  MET A SD  
524  C CE  . MET A 70  ? 2.0649 2.4522 2.3025 0.2038  0.5021  -0.1032 70  MET A CE  
525  N N   . GLY A 71  ? 0.9092 1.3412 1.1601 0.1992  0.5161  -0.1361 71  GLY A N   
526  C CA  . GLY A 71  ? 0.9985 1.4409 1.2551 0.1998  0.5168  -0.1422 71  GLY A CA  
527  C C   . GLY A 71  ? 1.0424 1.4975 1.3035 0.1997  0.5217  -0.1512 71  GLY A C   
528  O O   . GLY A 71  ? 1.1373 1.6046 1.4060 0.2012  0.5231  -0.1584 71  GLY A O   
529  N N   . ASN A 72  ? 0.9699 1.4205 1.2264 0.1979  0.5246  -0.1502 72  ASN A N   
530  C CA  . ASN A 72  ? 1.4095 1.8684 1.6690 0.1973  0.5297  -0.1573 72  ASN A CA  
531  C C   . ASN A 72  ? 1.9125 2.3848 2.1795 0.1989  0.5325  -0.1654 72  ASN A C   
532  O O   . ASN A 72  ? 2.0251 2.5069 2.2995 0.1994  0.5369  -0.1735 72  ASN A O   
533  C CB  . ASN A 72  ? 1.2052 1.6481 1.4539 0.1939  0.5320  -0.1504 72  ASN A CB  
534  C CG  . ASN A 72  ? 1.1267 1.5566 1.3692 0.1926  0.5310  -0.1435 72  ASN A CG  
535  O OD1 . ASN A 72  ? 1.0836 1.5214 1.3317 0.1937  0.5303  -0.1476 72  ASN A OD1 
536  N ND2 . ASN A 72  ? 1.2385 1.6468 1.4693 0.1906  0.5312  -0.1323 72  ASN A ND2 
537  N N   . PHE A 73  ? 2.0073 2.4783 2.2729 0.1995  0.5305  -0.1630 73  PHE A N   
538  C CA  . PHE A 73  ? 2.1880 2.6687 2.4591 0.2006  0.5335  -0.1693 73  PHE A CA  
539  C C   . PHE A 73  ? 2.0031 2.4917 2.2802 0.2035  0.5308  -0.1714 73  PHE A C   
540  O O   . PHE A 73  ? 1.7982 2.2970 2.0844 0.2052  0.5338  -0.1790 73  PHE A O   
541  C CB  . PHE A 73  ? 2.4500 2.9213 2.7126 0.1978  0.5356  -0.1652 73  PHE A CB  
542  C CG  . PHE A 73  ? 2.5117 2.9742 2.7680 0.1949  0.5384  -0.1628 73  PHE A CG  
543  C CD1 . PHE A 73  ? 2.4517 2.8955 2.6966 0.1926  0.5368  -0.1522 73  PHE A CD1 
544  C CD2 . PHE A 73  ? 2.5215 2.9920 2.7835 0.1945  0.5432  -0.1703 73  PHE A CD2 
545  C CE1 . PHE A 73  ? 2.4143 2.8492 2.6533 0.1902  0.5395  -0.1495 73  PHE A CE1 
546  C CE2 . PHE A 73  ? 2.4717 2.9345 2.7280 0.1919  0.5458  -0.1682 73  PHE A CE2 
547  C CZ  . PHE A 73  ? 2.4273 2.8730 2.6720 0.1899  0.5438  -0.1579 73  PHE A CZ  
548  N N   . HIS A 74  ? 2.1877 2.6689 2.4600 0.2036  0.5257  -0.1645 74  HIS A N   
549  C CA  . HIS A 74  ? 2.2596 2.7462 2.5356 0.2058  0.5230  -0.1653 74  HIS A CA  
550  C C   . HIS A 74  ? 2.4024 2.8917 2.6823 0.2080  0.5184  -0.1644 74  HIS A C   
551  O O   . HIS A 74  ? 2.2778 2.7545 2.5513 0.2065  0.5145  -0.1563 74  HIS A O   
552  C CB  . HIS A 74  ? 2.2641 2.7372 2.5307 0.2034  0.5216  -0.1575 74  HIS A CB  
553  C CG  . HIS A 74  ? 2.0265 2.5067 2.2970 0.2052  0.5206  -0.1599 74  HIS A CG  
554  N ND1 . HIS A 74  ? 1.7414 2.2338 2.0184 0.2068  0.5244  -0.1676 74  HIS A ND1 
555  C CD2 . HIS A 74  ? 2.0243 2.4989 2.2926 0.2055  0.5166  -0.1550 74  HIS A CD2 
556  C CE1 . HIS A 74  ? 1.5287 2.0242 1.8074 0.2082  0.5225  -0.1676 74  HIS A CE1 
557  N NE2 . HIS A 74  ? 1.7666 2.2522 2.0402 0.2074  0.5177  -0.1603 74  HIS A NE2 
558  N N   . PRO A 75  ? 2.4968 3.0000 2.7877 0.2115  0.5194  -0.1720 75  PRO A N   
559  C CA  . PRO A 75  ? 2.5816 3.0892 2.8778 0.2141  0.5155  -0.1723 75  PRO A CA  
560  C C   . PRO A 75  ? 2.6071 3.1157 2.9040 0.2157  0.5111  -0.1700 75  PRO A C   
561  O O   . PRO A 75  ? 2.5158 3.0344 2.8220 0.2193  0.5107  -0.1748 75  PRO A O   
562  C CB  . PRO A 75  ? 2.7715 3.2901 3.0801 0.2166  0.5199  -0.1814 75  PRO A CB  
563  C CG  . PRO A 75  ? 2.9266 3.4477 3.2382 0.2158  0.5247  -0.1860 75  PRO A CG  
564  C CD  . PRO A 75  ? 2.7056 3.2180 3.0055 0.2126  0.5251  -0.1805 75  PRO A CD  
565  N N   . HIS A 76  ? 2.4297 2.9254 2.7174 0.2128  0.5084  -0.1623 76  HIS A N   
566  C CA  . HIS A 76  ? 2.0829 2.5768 2.3708 0.2136  0.5044  -0.1593 76  HIS A CA  
567  C C   . HIS A 76  ? 1.6238 2.0959 1.9019 0.2104  0.5010  -0.1476 76  HIS A C   
568  O O   . HIS A 76  ? 1.5313 1.9892 1.8022 0.2081  0.5018  -0.1411 76  HIS A O   
569  C CB  . HIS A 76  ? 2.0553 2.5529 2.3434 0.2140  0.5061  -0.1613 76  HIS A CB  
570  C CG  . HIS A 76  ? 1.9084 2.4215 2.2059 0.2172  0.5106  -0.1707 76  HIS A CG  
571  N ND1 . HIS A 76  ? 1.8373 2.3617 2.1453 0.2213  0.5105  -0.1762 76  HIS A ND1 
572  C CD2 . HIS A 76  ? 1.8233 2.3386 2.1218 0.2163  0.5160  -0.1747 76  HIS A CD2 
573  C CE1 . HIS A 76  ? 1.8980 2.4282 2.2135 0.2220  0.5164  -0.1831 76  HIS A CE1 
574  N NE2 . HIS A 76  ? 1.8076 2.3330 2.1175 0.2191  0.5197  -0.1825 76  HIS A NE2 
575  N N   . GLY A 77  ? 1.3742 1.8409 1.6515 0.2108  0.4978  -0.1434 77  GLY A N   
579  N N   . ASP A 78  ? 1.5732 1.8823 1.6543 -0.3321 -0.0891 -0.2196 78  ASP A N   
580  C CA  . ASP A 78  ? 1.6332 1.9501 1.7076 -0.3318 -0.0823 -0.2199 78  ASP A CA  
581  C C   . ASP A 78  ? 1.2307 1.5580 1.3014 -0.3330 -0.0754 -0.2225 78  ASP A C   
582  O O   . ASP A 78  ? 0.9627 1.2987 1.0311 -0.3310 -0.0688 -0.2244 78  ASP A O   
583  C CB  . ASP A 78  ? 1.7354 2.0480 1.8037 -0.3343 -0.0839 -0.2166 78  ASP A CB  
584  C CG  . ASP A 78  ? 1.5222 1.8299 1.5886 -0.3386 -0.0879 -0.2150 78  ASP A CG  
585  O OD1 . ASP A 78  ? 1.3934 1.7068 1.4543 -0.3414 -0.0839 -0.2156 78  ASP A OD1 
586  O OD2 . ASP A 78  ? 1.4082 1.7061 1.4785 -0.3391 -0.0951 -0.2132 78  ASP A OD2 
587  N N   . SER A 79  ? 1.0085 1.3353 1.0787 -0.3361 -0.0768 -0.2228 79  SER A N   
588  C CA  . SER A 79  ? 0.8247 1.1613 0.8922 -0.3371 -0.0706 -0.2255 79  SER A CA  
589  C C   . SER A 79  ? 0.8173 1.1610 0.8888 -0.3330 -0.0659 -0.2288 79  SER A C   
590  O O   . SER A 79  ? 0.9039 1.2571 0.9714 -0.3321 -0.0587 -0.2307 79  SER A O   
591  C CB  . SER A 79  ? 0.8686 1.2025 0.9379 -0.3400 -0.0739 -0.2258 79  SER A CB  
592  O OG  . SER A 79  ? 1.0003 1.3278 1.0777 -0.3382 -0.0796 -0.2262 79  SER A OG  
593  N N   . SER A 80  ? 0.8784 1.2175 0.9576 -0.3305 -0.0701 -0.2296 80  SER A N   
594  C CA  . SER A 80  ? 1.1290 1.4744 1.2125 -0.3267 -0.0661 -0.2328 80  SER A CA  
595  C C   . SER A 80  ? 1.3866 1.7367 1.4683 -0.3235 -0.0614 -0.2333 80  SER A C   
596  O O   . SER A 80  ? 1.4070 1.7666 1.4876 -0.3216 -0.0547 -0.2361 80  SER A O   
597  C CB  . SER A 80  ? 1.1698 1.5086 1.2620 -0.3248 -0.0720 -0.2331 80  SER A CB  
598  O OG  . SER A 80  ? 1.2147 1.5528 1.3088 -0.3271 -0.0740 -0.2340 80  SER A OG  
599  N N   . ILE A 81  ? 1.6101 1.9537 1.6917 -0.3229 -0.0651 -0.2306 81  ILE A N   
600  C CA  . ILE A 81  ? 1.8107 2.1582 1.8901 -0.3200 -0.0609 -0.2307 81  ILE A CA  
601  C C   . ILE A 81  ? 1.6435 2.0000 1.7148 -0.3216 -0.0536 -0.2313 81  ILE A C   
602  O O   . ILE A 81  ? 1.5650 1.9302 1.6349 -0.3192 -0.0470 -0.2336 81  ILE A O   
603  C CB  . ILE A 81  ? 2.3024 2.6410 2.3823 -0.3196 -0.0662 -0.2274 81  ILE A CB  
604  C CG1 . ILE A 81  ? 2.3668 2.6967 2.4550 -0.3177 -0.0732 -0.2269 81  ILE A CG1 
605  C CG2 . ILE A 81  ? 2.4453 2.7886 2.5220 -0.3171 -0.0613 -0.2275 81  ILE A CG2 
606  C CD1 . ILE A 81  ? 2.4354 2.7546 2.5243 -0.3183 -0.0800 -0.2232 81  ILE A CD1 
607  N N   . TYR A 82  ? 1.2789 1.6333 1.3447 -0.3257 -0.0548 -0.2292 82  TYR A N   
608  C CA  . TYR A 82  ? 1.0047 1.3671 1.0624 -0.3275 -0.0483 -0.2293 82  TYR A CA  
609  C C   . TYR A 82  ? 0.7791 1.1522 0.8359 -0.3272 -0.0415 -0.2330 82  TYR A C   
610  O O   . TYR A 82  ? 0.6787 1.0605 0.7322 -0.3255 -0.0346 -0.2346 82  TYR A O   
611  C CB  . TYR A 82  ? 1.2208 1.5785 1.2730 -0.3321 -0.0512 -0.2263 82  TYR A CB  
612  C CG  . TYR A 82  ? 1.4335 1.7989 1.4771 -0.3342 -0.0447 -0.2261 82  TYR A CG  
613  C CD1 . TYR A 82  ? 1.6451 2.0134 1.6847 -0.3327 -0.0411 -0.2253 82  TYR A CD1 
614  C CD2 . TYR A 82  ? 1.5555 1.9255 1.5949 -0.3376 -0.0421 -0.2268 82  TYR A CD2 
615  C CE1 . TYR A 82  ? 1.7866 2.1622 1.8182 -0.3347 -0.0351 -0.2250 82  TYR A CE1 
616  C CE2 . TYR A 82  ? 1.7025 2.0796 1.7339 -0.3396 -0.0362 -0.2265 82  TYR A CE2 
617  C CZ  . TYR A 82  ? 1.8694 2.2493 1.8970 -0.3381 -0.0327 -0.2256 82  TYR A CZ  
618  O OH  . TYR A 82  ? 2.0385 2.4256 2.0583 -0.3401 -0.0267 -0.2253 82  TYR A OH  
619  N N   . ASP A 83  ? 0.8031 1.1756 0.8630 -0.3286 -0.0434 -0.2342 83  ASP A N   
620  C CA  . ASP A 83  ? 0.9657 1.3480 1.0252 -0.3282 -0.0373 -0.2378 83  ASP A CA  
621  C C   . ASP A 83  ? 0.6924 1.0811 0.7554 -0.3235 -0.0327 -0.2408 83  ASP A C   
622  O O   . ASP A 83  ? 0.7291 1.1279 0.7893 -0.3226 -0.0254 -0.2434 83  ASP A O   
623  C CB  . ASP A 83  ? 1.2242 1.6037 1.2877 -0.3299 -0.0410 -0.2386 83  ASP A CB  
624  C CG  . ASP A 83  ? 1.3638 1.7392 1.4231 -0.3347 -0.0441 -0.2363 83  ASP A CG  
625  O OD1 . ASP A 83  ? 1.2760 1.6520 1.3286 -0.3369 -0.0425 -0.2342 83  ASP A OD1 
626  O OD2 . ASP A 83  ? 1.4974 1.8690 1.5600 -0.3364 -0.0481 -0.2365 83  ASP A OD2 
627  N N   . ALA A 84  ? 0.7720 1.1547 0.8414 -0.3204 -0.0369 -0.2405 84  ALA A N   
628  C CA  . ALA A 84  ? 1.0297 1.4177 1.1027 -0.3158 -0.0330 -0.2431 84  ALA A CA  
629  C C   . ALA A 84  ? 0.9601 1.3539 1.0276 -0.3144 -0.0272 -0.2430 84  ALA A C   
630  O O   . ALA A 84  ? 0.7745 1.1777 0.8412 -0.3120 -0.0203 -0.2460 84  ALA A O   
631  C CB  . ALA A 84  ? 1.3604 1.7399 1.4411 -0.3131 -0.0393 -0.2424 84  ALA A CB  
632  N N   . MET A 85  ? 1.1973 1.5857 1.2612 -0.3159 -0.0299 -0.2396 85  MET A N   
633  C CA  . MET A 85  ? 1.4617 1.8547 1.5200 -0.3151 -0.0251 -0.2390 85  MET A CA  
634  C C   . MET A 85  ? 1.2492 1.6524 1.3004 -0.3171 -0.0177 -0.2404 85  MET A C   
635  O O   . MET A 85  ? 1.2438 1.6555 1.2923 -0.3150 -0.0109 -0.2422 85  MET A O   
636  C CB  . MET A 85  ? 1.8036 2.1876 1.8595 -0.3169 -0.0305 -0.2348 85  MET A CB  
637  C CG  . MET A 85  ? 1.9080 2.2951 1.9580 -0.3164 -0.0265 -0.2335 85  MET A CG  
638  S SD  . MET A 85  ? 2.3807 2.7561 2.4288 -0.3185 -0.0337 -0.2285 85  MET A SD  
639  N N   . VAL A 86  ? 1.1100 1.5123 1.1583 -0.3212 -0.0190 -0.2396 86  VAL A N   
640  C CA  . VAL A 86  ? 0.9973 1.4087 1.0391 -0.3234 -0.0125 -0.2407 86  VAL A CA  
641  C C   . VAL A 86  ? 0.6575 1.0789 0.7014 -0.3208 -0.0062 -0.2451 86  VAL A C   
642  O O   . VAL A 86  ? 0.9805 1.4115 1.0201 -0.3200 0.0012  -0.2469 86  VAL A O   
643  C CB  . VAL A 86  ? 0.9789 1.3866 1.0182 -0.3283 -0.0160 -0.2391 86  VAL A CB  
644  C CG1 . VAL A 86  ? 0.9954 1.4130 1.0305 -0.3301 -0.0097 -0.2415 86  VAL A CG1 
645  C CG2 . VAL A 86  ? 1.0377 1.4387 1.0720 -0.3313 -0.0196 -0.2350 86  VAL A CG2 
646  N N   . ARG A 87  ? 0.6663 1.0855 0.7170 -0.3193 -0.0090 -0.2470 87  ARG A N   
647  C CA  . ARG A 87  ? 0.6666 1.0948 0.7195 -0.3169 -0.0033 -0.2511 87  ARG A CA  
648  C C   . ARG A 87  ? 0.6578 1.0924 0.7107 -0.3126 0.0023  -0.2530 87  ARG A C   
649  O O   . ARG A 87  ? 0.6519 1.0967 0.7014 -0.3118 0.0097  -0.2555 87  ARG A O   
650  C CB  . ARG A 87  ? 0.6773 1.1015 0.7381 -0.3156 -0.0076 -0.2527 87  ARG A CB  
651  C CG  . ARG A 87  ? 0.7779 1.2117 0.8406 -0.3135 -0.0016 -0.2571 87  ARG A CG  
652  C CD  . ARG A 87  ? 0.6891 1.1189 0.7592 -0.3126 -0.0058 -0.2586 87  ARG A CD  
653  N NE  . ARG A 87  ? 0.7432 1.1822 0.8145 -0.3111 -0.0001 -0.2627 87  ARG A NE  
654  C CZ  . ARG A 87  ? 0.8098 1.2551 0.8837 -0.3068 0.0047  -0.2658 87  ARG A CZ  
655  N NH1 . ARG A 87  ? 0.8980 1.3415 0.9735 -0.3036 0.0045  -0.2653 87  ARG A NH1 
656  N NH2 . ARG A 87  ? 0.7733 1.2267 0.8482 -0.3056 0.0096  -0.2695 87  ARG A NH2 
657  N N   . MET A 88  ? 0.6568 1.0854 0.7133 -0.3100 -0.0012 -0.2517 88  MET A N   
658  C CA  . MET A 88  ? 0.6485 1.0824 0.7051 -0.3059 0.0037  -0.2532 88  MET A CA  
659  C C   . MET A 88  ? 0.6374 1.0781 0.6860 -0.3069 0.0097  -0.2526 88  MET A C   
660  O O   . MET A 88  ? 0.7362 1.1818 0.7840 -0.3038 0.0142  -0.2537 88  MET A O   
661  C CB  . MET A 88  ? 0.6493 1.0747 0.7106 -0.3034 -0.0018 -0.2513 88  MET A CB  
662  C CG  . MET A 88  ? 0.9976 1.4153 1.0672 -0.3020 -0.0083 -0.2515 88  MET A CG  
663  S SD  . MET A 88  ? 2.3606 2.7698 2.4345 -0.2988 -0.0134 -0.2492 88  MET A SD  
664  C CE  . MET A 88  ? 1.7950 2.1909 1.8698 -0.3027 -0.0232 -0.2449 88  MET A CE  
665  N N   . SER A 89  ? 0.7878 1.2286 0.8304 -0.3113 0.0098  -0.2506 89  SER A N   
666  C CA  . SER A 89  ? 1.1175 1.5646 1.1523 -0.3126 0.0154  -0.2498 89  SER A CA  
667  C C   . SER A 89  ? 1.4186 1.8757 1.4489 -0.3144 0.0219  -0.2521 89  SER A C   
668  O O   . SER A 89  ? 1.3705 1.8349 1.3945 -0.3150 0.0279  -0.2523 89  SER A O   
669  C CB  . SER A 89  ? 1.3561 1.7956 1.3865 -0.3162 0.0107  -0.2454 89  SER A CB  
670  O OG  . SER A 89  ? 1.5080 1.9479 1.5345 -0.3207 0.0103  -0.2446 89  SER A OG  
671  N N   . GLN A 90  ? 1.7030 2.1602 1.7363 -0.3154 0.0205  -0.2538 90  GLN A N   
672  C CA  . GLN A 90  ? 1.7222 2.1884 1.7517 -0.3172 0.0263  -0.2560 90  GLN A CA  
673  C C   . GLN A 90  ? 1.4100 1.8864 1.4410 -0.3132 0.0335  -0.2603 90  GLN A C   
674  O O   . GLN A 90  ? 1.3377 1.8133 1.3752 -0.3100 0.0324  -0.2626 90  GLN A O   
675  C CB  . GLN A 90  ? 1.8877 2.3498 1.9195 -0.3201 0.0219  -0.2560 90  GLN A CB  
676  C CG  . GLN A 90  ? 1.8993 2.3502 1.9310 -0.3233 0.0140  -0.2520 90  GLN A CG  
677  C CD  . GLN A 90  ? 1.8018 2.2483 1.8364 -0.3259 0.0093  -0.2519 90  GLN A CD  
678  O OE1 . GLN A 90  ? 1.7339 2.1777 1.7753 -0.3239 0.0064  -0.2536 90  GLN A OE1 
679  N NE2 . GLN A 90  ? 1.7508 2.1963 1.7802 -0.3304 0.0084  -0.2500 90  GLN A NE2 
680  N N   . ASN A 91  ? 1.2908 1.7766 1.3157 -0.3134 0.0408  -0.2614 91  ASN A N   
681  C CA  . ASN A 91  ? 1.1967 1.6924 1.2224 -0.3094 0.0481  -0.2653 91  ASN A CA  
682  C C   . ASN A 91  ? 1.0236 1.5267 1.0503 -0.3094 0.0522  -0.2690 91  ASN A C   
683  O O   . ASN A 91  ? 0.7932 1.3049 0.8205 -0.3062 0.0584  -0.2725 91  ASN A O   
684  C CB  . ASN A 91  ? 1.2539 1.7564 1.2730 -0.3091 0.0544  -0.2648 91  ASN A CB  
685  C CG  . ASN A 91  ? 1.2916 1.8007 1.3033 -0.3130 0.0589  -0.2645 91  ASN A CG  
686  O OD1 . ASN A 91  ? 1.0769 1.5940 1.0835 -0.3125 0.0653  -0.2651 91  ASN A OD1 
687  N ND2 . ASN A 91  ? 1.2488 1.7548 1.2599 -0.3167 0.0556  -0.2636 91  ASN A ND2 
688  N N   . TRP A 92  ? 1.2547 1.7543 1.2816 -0.3129 0.0485  -0.2682 92  TRP A N   
689  C CA  . TRP A 92  ? 1.4506 1.9555 1.4793 -0.3130 0.0509  -0.2714 92  TRP A CA  
690  C C   . TRP A 92  ? 1.3040 1.8021 1.3409 -0.3114 0.0451  -0.2723 92  TRP A C   
691  O O   . TRP A 92  ? 1.2614 1.7627 1.3010 -0.3112 0.0462  -0.2750 92  TRP A O   
692  C CB  . TRP A 92  ? 1.3633 1.8695 1.3866 -0.3180 0.0512  -0.2701 92  TRP A CB  
693  C CG  . TRP A 92  ? 1.2722 1.7675 1.2960 -0.3217 0.0430  -0.2663 92  TRP A CG  
694  C CD1 . TRP A 92  ? 1.1421 1.6312 1.1703 -0.3232 0.0374  -0.2662 92  TRP A CD1 
695  C CD2 . TRP A 92  ? 1.2902 1.7794 1.3099 -0.3243 0.0396  -0.2622 92  TRP A CD2 
696  N NE1 . TRP A 92  ? 1.0977 1.5774 1.1248 -0.3266 0.0308  -0.2622 92  TRP A NE1 
697  C CE2 . TRP A 92  ? 1.1888 1.6683 1.2107 -0.3273 0.0320  -0.2597 92  TRP A CE2 
698  C CE3 . TRP A 92  ? 1.4087 1.8996 1.4231 -0.3244 0.0423  -0.2603 92  TRP A CE3 
699  C CZ2 . TRP A 92  ? 1.3702 1.8417 1.3892 -0.3302 0.0270  -0.2556 92  TRP A CZ2 
700  C CZ3 . TRP A 92  ? 1.4620 1.9451 1.4735 -0.3273 0.0374  -0.2561 92  TRP A CZ3 
701  C CH2 . TRP A 92  ? 1.4014 1.8747 1.4151 -0.3302 0.0298  -0.2538 92  TRP A CH2 
702  N N   . LYS A 93  ? 1.2103 1.6989 1.2512 -0.3105 0.0387  -0.2699 93  LYS A N   
703  C CA  . LYS A 93  ? 1.1576 1.6395 1.2067 -0.3085 0.0331  -0.2706 93  LYS A CA  
704  C C   . LYS A 93  ? 1.1397 1.6219 1.1931 -0.3034 0.0342  -0.2720 93  LYS A C   
705  O O   . LYS A 93  ? 1.2518 1.7341 1.3116 -0.3004 0.0337  -0.2746 93  LYS A O   
706  C CB  . LYS A 93  ? 0.8127 1.2827 0.8637 -0.3116 0.0242  -0.2668 93  LYS A CB  
707  C CG  . LYS A 93  ? 0.6956 1.1646 0.7419 -0.3168 0.0228  -0.2651 93  LYS A CG  
708  C CD  . LYS A 93  ? 0.6770 1.1405 0.7282 -0.3184 0.0173  -0.2653 93  LYS A CD  
709  N N   . ASN A 94  ? 1.1224 1.6051 1.1724 -0.3025 0.0360  -0.2705 94  ASN A N   
710  C CA  . ASN A 94  ? 0.8454 1.3290 0.8990 -0.2977 0.0375  -0.2718 94  ASN A CA  
711  C C   . ASN A 94  ? 0.7633 1.2581 0.8129 -0.2951 0.0465  -0.2745 94  ASN A C   
712  O O   . ASN A 94  ? 0.7125 1.2114 0.7552 -0.2971 0.0501  -0.2733 94  ASN A O   
713  C CB  . ASN A 94  ? 0.8906 1.3648 0.9449 -0.2976 0.0318  -0.2681 94  ASN A CB  
714  C CG  . ASN A 94  ? 0.9360 1.3993 0.9966 -0.2982 0.0231  -0.2663 94  ASN A CG  
715  O OD1 . ASN A 94  ? 0.6964 1.1523 0.7556 -0.3019 0.0176  -0.2630 94  ASN A OD1 
716  N ND2 . ASN A 94  ? 1.2340 1.6962 1.3017 -0.2945 0.0220  -0.2685 94  ASN A ND2 
717  N N   . ARG A 95  ? 0.6273 1.1270 0.6814 -0.2908 0.0499  -0.2783 95  ARG A N   
718  C CA  . ARG A 95  ? 0.6185 1.1291 0.6695 -0.2879 0.0585  -0.2814 95  ARG A CA  
719  C C   . ARG A 95  ? 0.6092 1.1190 0.6573 -0.2867 0.0595  -0.2794 95  ARG A C   
720  O O   . ARG A 95  ? 0.6002 1.1178 0.6426 -0.2865 0.0659  -0.2800 95  ARG A O   
721  C CB  . ARG A 95  ? 0.7390 1.2536 0.7962 -0.2832 0.0611  -0.2857 95  ARG A CB  
722  C CG  . ARG A 95  ? 0.7760 1.3016 0.8306 -0.2797 0.0699  -0.2892 95  ARG A CG  
723  C CD  . ARG A 95  ? 0.7484 1.2832 0.7972 -0.2821 0.0760  -0.2909 95  ARG A CD  
724  N NE  . ARG A 95  ? 0.6013 1.1469 0.6470 -0.2791 0.0846  -0.2941 95  ARG A NE  
725  C CZ  . ARG A 95  ? 0.5914 1.1405 0.6320 -0.2788 0.0883  -0.2930 95  ARG A CZ  
726  N NH1 . ARG A 95  ? 0.5890 1.1315 0.6269 -0.2814 0.0842  -0.2887 95  ARG A NH1 
727  N NH2 . ARG A 95  ? 0.5839 1.1430 0.6218 -0.2760 0.0963  -0.2961 95  ARG A NH2 
728  N N   . GLU A 96  ? 0.6581 1.1584 0.7100 -0.2858 0.0531  -0.2768 96  GLU A N   
729  C CA  . GLU A 96  ? 0.6970 1.1951 0.7467 -0.2848 0.0530  -0.2745 96  GLU A CA  
730  C C   . GLU A 96  ? 0.6075 1.0938 0.6575 -0.2878 0.0445  -0.2698 96  GLU A C   
731  O O   . GLU A 96  ? 0.6138 1.0920 0.6696 -0.2860 0.0388  -0.2687 96  GLU A O   
732  C CB  . GLU A 96  ? 0.8335 1.3328 0.8884 -0.2794 0.0544  -0.2768 96  GLU A CB  
733  C CG  . GLU A 96  ? 0.7569 1.2619 0.8078 -0.2771 0.0601  -0.2772 96  GLU A CG  
734  C CD  . GLU A 96  ? 0.8252 1.3426 0.8713 -0.2766 0.0691  -0.2804 96  GLU A CD  
735  O OE1 . GLU A 96  ? 0.8319 1.3547 0.8810 -0.2743 0.0724  -0.2843 96  GLU A OE1 
736  O OE2 . GLU A 96  ? 0.8613 1.3830 0.9008 -0.2783 0.0729  -0.2791 96  GLU A OE2 
737  N N   . ILE A 97  ? 0.6054 1.0904 0.6493 -0.2922 0.0438  -0.2669 97  ILE A N   
738  C CA  . ILE A 97  ? 0.7052 1.1790 0.7494 -0.2952 0.0357  -0.2625 97  ILE A CA  
739  C C   . ILE A 97  ? 0.6069 1.0736 0.6530 -0.2932 0.0318  -0.2601 97  ILE A C   
740  O O   . ILE A 97  ? 0.5980 1.0691 0.6417 -0.2910 0.0361  -0.2604 97  ILE A O   
741  C CB  . ILE A 97  ? 0.6070 1.0806 0.6438 -0.3001 0.0358  -0.2597 97  ILE A CB  
742  C CG1 . ILE A 97  ? 0.5954 1.0732 0.6260 -0.3000 0.0403  -0.2584 97  ILE A CG1 
743  C CG2 . ILE A 97  ? 0.6103 1.0902 0.6448 -0.3026 0.0392  -0.2617 97  ILE A CG2 
744  C CD1 . ILE A 97  ? 0.8454 1.3232 0.8685 -0.3049 0.0405  -0.2555 97  ILE A CD1 
745  N N   . LEU A 98  ? 0.6146 1.0704 0.6651 -0.2941 0.0237  -0.2577 98  LEU A N   
746  C CA  . LEU A 98  ? 0.6136 1.0616 0.6669 -0.2922 0.0189  -0.2553 98  LEU A CA  
747  C C   . LEU A 98  ? 0.6123 1.0525 0.6614 -0.2958 0.0140  -0.2507 98  LEU A C   
748  O O   . LEU A 98  ? 0.6893 1.1232 0.7395 -0.2948 0.0104  -0.2483 98  LEU A O   
749  C CB  . LEU A 98  ? 0.8497 1.2906 0.9114 -0.2902 0.0130  -0.2558 98  LEU A CB  
750  C CG  . LEU A 98  ? 1.2614 1.7089 1.3278 -0.2868 0.0169  -0.2603 98  LEU A CG  
751  C CD1 . LEU A 98  ? 1.8785 2.3185 1.9529 -0.2860 0.0104  -0.2605 98  LEU A CD1 
752  C CD2 . LEU A 98  ? 1.1249 1.5784 1.1916 -0.2823 0.0224  -0.2624 98  LEU A CD2 
753  N N   . VAL A 99  ? 0.6137 1.0542 0.6583 -0.3002 0.0138  -0.2494 99  VAL A N   
754  C CA  . VAL A 99  ? 0.8342 1.2678 0.8744 -0.3038 0.0095  -0.2452 99  VAL A CA  
755  C C   . VAL A 99  ? 0.7410 1.1822 0.7730 -0.3068 0.0153  -0.2451 99  VAL A C   
756  O O   . VAL A 99  ? 0.6982 1.1459 0.7290 -0.3080 0.0190  -0.2474 99  VAL A O   
757  C CB  . VAL A 99  ? 1.2339 1.6577 1.2773 -0.3066 0.0015  -0.2433 99  VAL A CB  
758  C CG1 . VAL A 99  ? 1.5687 1.9862 1.6071 -0.3105 -0.0024 -0.2392 99  VAL A CG1 
759  C CG2 . VAL A 99  ? 1.2850 1.7011 1.3364 -0.3037 -0.0044 -0.2432 99  VAL A CG2 
760  N N   . GLU A 100 ? 0.5974 1.0382 0.6240 -0.3078 0.0164  -0.2425 100 GLU A N   
761  C CA  . GLU A 100 ? 0.6781 1.1243 0.6965 -0.3112 0.0208  -0.2415 100 GLU A CA  
762  C C   . GLU A 100 ? 0.6803 1.1177 0.6958 -0.3156 0.0146  -0.2375 100 GLU A C   
763  O O   . GLU A 100 ? 0.6802 1.1089 0.6968 -0.3157 0.0091  -0.2346 100 GLU A O   
764  C CB  . GLU A 100 ? 0.5791 1.0312 0.5929 -0.3096 0.0264  -0.2413 100 GLU A CB  
765  C CG  . GLU A 100 ? 0.6438 1.1046 0.6602 -0.3051 0.0326  -0.2451 100 GLU A CG  
766  C CD  . GLU A 100 ? 0.7873 1.2542 0.7986 -0.3037 0.0385  -0.2448 100 GLU A CD  
767  O OE1 . GLU A 100 ? 0.9652 1.4427 0.9749 -0.3019 0.0460  -0.2479 100 GLU A OE1 
768  O OE2 . GLU A 100 ? 0.7121 1.1736 0.7211 -0.3044 0.0358  -0.2415 100 GLU A OE2 
769  N N   . MET A 101 ? 0.7228 1.1627 0.7346 -0.3194 0.0157  -0.2374 101 MET A N   
770  C CA  . MET A 101 ? 1.0649 1.4969 1.0741 -0.3237 0.0100  -0.2341 101 MET A CA  
771  C C   . MET A 101 ? 0.9238 1.3617 0.9245 -0.3272 0.0148  -0.2329 101 MET A C   
772  O O   . MET A 101 ? 0.5911 1.0386 0.5891 -0.3275 0.0211  -0.2354 101 MET A O   
773  C CB  . MET A 101 ? 1.3157 1.7437 1.3296 -0.3251 0.0055  -0.2350 101 MET A CB  
774  C CG  . MET A 101 ? 1.4668 1.8862 1.4787 -0.3295 -0.0007 -0.2317 101 MET A CG  
775  S SD  . MET A 101 ? 4.5518 4.9639 4.5708 -0.3305 -0.0078 -0.2323 101 MET A SD  
776  C CE  . MET A 101 ? 2.1035 2.5096 2.1310 -0.3256 -0.0119 -0.2329 101 MET A CE  
777  N N   . HIS A 102 ? 1.1677 1.5997 1.1641 -0.3297 0.0117  -0.2292 102 HIS A N   
778  C CA  . HIS A 102 ? 1.4348 1.8706 1.4229 -0.3334 0.0151  -0.2274 102 HIS A CA  
779  C C   . HIS A 102 ? 1.4111 1.8419 1.3978 -0.3378 0.0108  -0.2258 102 HIS A C   
780  O O   . HIS A 102 ? 1.4552 1.8756 1.4442 -0.3390 0.0034  -0.2234 102 HIS A O   
781  C CB  . HIS A 102 ? 1.6988 2.1303 1.6830 -0.3337 0.0138  -0.2240 102 HIS A CB  
782  C CG  . HIS A 102 ? 1.7378 2.1785 1.7174 -0.3323 0.0214  -0.2247 102 HIS A CG  
783  N ND1 . HIS A 102 ? 1.7580 2.1970 1.7324 -0.3332 0.0218  -0.2217 102 HIS A ND1 
784  C CD2 . HIS A 102 ? 1.7187 2.1704 1.6978 -0.3300 0.0289  -0.2280 102 HIS A CD2 
785  C CE1 . HIS A 102 ? 1.6833 2.1319 1.6544 -0.3315 0.0293  -0.2231 102 HIS A CE1 
786  N NE2 . HIS A 102 ? 1.6884 2.1449 1.6623 -0.3296 0.0337  -0.2270 102 HIS A NE2 
787  N N   . GLY A 103 ? 1.4882 1.9263 1.4708 -0.3402 0.0154  -0.2271 103 GLY A N   
788  C CA  . GLY A 103 ? 1.5653 1.9997 1.5460 -0.3445 0.0120  -0.2258 103 GLY A CA  
789  C C   . GLY A 103 ? 1.6955 2.1341 1.6795 -0.3447 0.0132  -0.2289 103 GLY A C   
790  O O   . GLY A 103 ? 1.5840 2.0292 1.5713 -0.3415 0.0173  -0.2323 103 GLY A O   
791  N N   . ASN A 104 ? 1.9250 2.3597 1.9081 -0.3483 0.0096  -0.2279 104 ASN A N   
792  C CA  . ASN A 104 ? 1.7322 2.1695 1.7186 -0.3488 0.0098  -0.2306 104 ASN A CA  
793  C C   . ASN A 104 ? 1.4578 1.8901 1.4532 -0.3454 0.0053  -0.2322 104 ASN A C   
794  O O   . ASN A 104 ? 1.5380 1.9602 1.5371 -0.3461 -0.0021 -0.2303 104 ASN A O   
795  C CB  . ASN A 104 ? 1.6415 2.0748 1.6249 -0.3536 0.0064  -0.2287 104 ASN A CB  
796  C CG  . ASN A 104 ? 1.3280 1.7640 1.3147 -0.3542 0.0065  -0.2313 104 ASN A CG  
797  O OD1 . ASN A 104 ? 1.1147 1.5557 1.1059 -0.3511 0.0093  -0.2347 104 ASN A OD1 
798  N ND2 . ASN A 104 ? 1.1170 1.5496 1.1013 -0.3583 0.0036  -0.2299 104 ASN A ND2 
799  N N   . ASN A 105 ? 1.1567 1.5960 1.1555 -0.3418 0.0098  -0.2357 105 ASN A N   
800  C CA  . ASN A 105 ? 0.9069 1.3424 0.9142 -0.3386 0.0062  -0.2376 105 ASN A CA  
801  C C   . ASN A 105 ? 0.7206 1.1619 0.7304 -0.3386 0.0087  -0.2409 105 ASN A C   
802  O O   . ASN A 105 ? 0.7000 1.1435 0.7154 -0.3352 0.0097  -0.2437 105 ASN A O   
803  C CB  . ASN A 105 ? 0.7719 1.2099 0.7823 -0.3338 0.0087  -0.2390 105 ASN A CB  
804  C CG  . ASN A 105 ? 0.7254 1.1759 0.7326 -0.3320 0.0179  -0.2420 105 ASN A CG  
805  O OD1 . ASN A 105 ? 0.6257 1.0826 0.6263 -0.3346 0.0226  -0.2418 105 ASN A OD1 
806  N ND2 . ASN A 105 ? 0.8312 1.2855 0.8432 -0.3275 0.0204  -0.2448 105 ASN A ND2 
807  N N   . GLY A 106 ? 0.8083 1.2519 0.8136 -0.3426 0.0098  -0.2405 106 GLY A N   
808  C CA  . GLY A 106 ? 0.9101 1.3592 0.9171 -0.3431 0.0123  -0.2435 106 GLY A CA  
809  C C   . GLY A 106 ? 1.1832 1.6451 1.1860 -0.3423 0.0213  -0.2463 106 GLY A C   
810  O O   . GLY A 106 ? 1.1273 1.5941 1.1252 -0.3417 0.0261  -0.2458 106 GLY A O   
811  N N   . SER A 107 ? 1.3665 1.8336 1.3713 -0.3421 0.0238  -0.2494 107 SER A N   
817  N N   . MET A 108 ? 0.8915 0.9324 1.2033 0.0657  0.1496  0.1624  108 MET A N   
818  C CA  . MET A 108 ? 0.9837 1.0327 1.2892 0.0667  0.1519  0.1615  108 MET A CA  
819  C C   . MET A 108 ? 1.0402 1.0929 1.3377 0.0650  0.1477  0.1567  108 MET A C   
820  O O   . MET A 108 ? 0.7005 0.7586 0.9939 0.0648  0.1497  0.1540  108 MET A O   
821  C CB  . MET A 108 ? 1.1396 1.1946 1.4405 0.0697  0.1525  0.1677  108 MET A CB  
822  C CG  . MET A 108 ? 1.2124 1.2657 1.5204 0.0716  0.1580  0.1721  108 MET A CG  
823  S SD  . MET A 108 ? 4.6415 4.7035 4.9433 0.0748  0.1601  0.1779  108 MET A SD  
824  C CE  . MET A 108 ? 2.1986 2.2673 2.4950 0.0735  0.1637  0.1731  108 MET A CE  
825  N N   . ASP A 109 ? 1.1916 1.2414 1.4867 0.0637  0.1420  0.1555  109 ASP A N   
826  C CA  . ASP A 109 ? 1.2774 1.3302 1.5652 0.0620  0.1378  0.1506  109 ASP A CA  
827  C C   . ASP A 109 ? 1.4295 1.4783 1.7217 0.0592  0.1390  0.1439  109 ASP A C   
828  O O   . ASP A 109 ? 1.5486 1.5989 1.8360 0.0575  0.1358  0.1391  109 ASP A O   
829  C CB  . ASP A 109 ? 1.1100 1.1612 1.3933 0.0613  0.1313  0.1516  109 ASP A CB  
830  C CG  . ASP A 109 ? 1.0866 1.1433 1.3627 0.0638  0.1291  0.1574  109 ASP A CG  
831  O OD1 . ASP A 109 ? 1.2113 1.2743 1.4841 0.0660  0.1317  0.1597  109 ASP A OD1 
832  O OD2 . ASP A 109 ? 0.7637 0.8183 1.0371 0.0634  0.1247  0.1597  109 ASP A OD2 
833  N N   . GLY A 110 ? 1.3977 1.4411 1.6992 0.0589  0.1436  0.1436  110 GLY A N   
834  C CA  . GLY A 110 ? 1.4908 1.5294 1.7971 0.0563  0.1449  0.1376  110 GLY A CA  
835  C C   . GLY A 110 ? 1.4207 1.4538 1.7274 0.0537  0.1399  0.1336  110 GLY A C   
836  O O   . GLY A 110 ? 1.3084 1.3411 1.6140 0.0517  0.1391  0.1278  110 GLY A O   
837  N N   . ASP A 111 ? 1.4913 1.5202 1.7993 0.0535  0.1365  0.1364  111 ASP A N   
838  C CA  . ASP A 111 ? 1.2941 1.3166 1.6040 0.0506  0.1326  0.1323  111 ASP A CA  
839  C C   . ASP A 111 ? 0.9104 0.9241 1.2313 0.0491  0.1357  0.1305  111 ASP A C   
840  O O   . ASP A 111 ? 0.9734 0.9841 1.3009 0.0504  0.1393  0.1344  111 ASP A O   
841  C CB  . ASP A 111 ? 2.2949 2.3168 2.6003 0.0501  0.1270  0.1346  111 ASP A CB  
842  C CG  . ASP A 111 ? 2.2387 2.2630 2.5430 0.0527  0.1273  0.1420  111 ASP A CG  
843  O OD1 . ASP A 111 ? 2.2075 2.2360 2.5040 0.0533  0.1233  0.1442  111 ASP A OD1 
844  O OD2 . ASP A 111 ? 2.3002 2.3219 2.6114 0.0541  0.1316  0.1455  111 ASP A OD2 
845  N N   . PRO A 112 ? 0.6003 0.6098 0.9229 0.0463  0.1342  0.1244  112 PRO A N   
846  C CA  . PRO A 112 ? 0.4819 0.4829 0.8144 0.0447  0.1370  0.1219  112 PRO A CA  
847  C C   . PRO A 112 ? 0.4043 0.3994 0.7436 0.0450  0.1375  0.1265  112 PRO A C   
848  O O   . PRO A 112 ? 0.4659 0.4602 0.8023 0.0446  0.1333  0.1287  112 PRO A O   
849  C CB  . PRO A 112 ? 0.4922 0.4892 0.8233 0.0415  0.1327  0.1159  112 PRO A CB  
850  C CG  . PRO A 112 ? 0.6180 0.6227 0.9386 0.0416  0.1291  0.1142  112 PRO A CG  
851  C CD  . PRO A 112 ? 0.5154 0.5270 0.8305 0.0445  0.1290  0.1201  112 PRO A CD  
852  N N   . PRO A 113 ? 0.3577 0.3487 0.7056 0.0459  0.1426  0.1281  113 PRO A N   
853  C CA  . PRO A 113 ? 0.4411 0.4246 0.7973 0.0457  0.1433  0.1313  113 PRO A CA  
854  C C   . PRO A 113 ? 0.4121 0.3877 0.7716 0.0422  0.1397  0.1272  113 PRO A C   
855  O O   . PRO A 113 ? 0.3468 0.3216 0.7047 0.0401  0.1383  0.1214  113 PRO A O   
856  C CB  . PRO A 113 ? 0.3677 0.3487 0.7321 0.0467  0.1498  0.1315  113 PRO A CB  
857  C CG  . PRO A 113 ? 0.3792 0.3687 0.7379 0.0486  0.1527  0.1314  113 PRO A CG  
858  C CD  . PRO A 113 ? 0.3731 0.3671 0.7230 0.0471  0.1482  0.1272  113 PRO A CD  
859  N N   . ALA A 114 ? 0.4341 0.4043 0.7981 0.0415  0.1382  0.1302  114 ALA A N   
860  C CA  . ALA A 114 ? 0.4247 0.3866 0.7930 0.0380  0.1355  0.1263  114 ALA A CA  
861  C C   . ALA A 114 ? 0.4056 0.3617 0.7821 0.0370  0.1394  0.1222  114 ALA A C   
862  O O   . ALA A 114 ? 0.4668 0.4233 0.8478 0.0391  0.1446  0.1241  114 ALA A O   
863  C CB  . ALA A 114 ? 0.4215 0.3785 0.7944 0.0375  0.1341  0.1307  114 ALA A CB  
864  N N   . ALA A 115 ? 0.4595 0.4102 0.8375 0.0338  0.1370  0.1165  115 ALA A N   
865  C CA  . ALA A 115 ? 0.3362 0.2805 0.7221 0.0326  0.1404  0.1125  115 ALA A CA  
866  C C   . ALA A 115 ? 0.3379 0.2750 0.7339 0.0328  0.1432  0.1156  115 ALA A C   
867  O O   . ALA A 115 ? 0.3298 0.2652 0.7269 0.0328  0.1414  0.1197  115 ALA A O   
868  C CB  . ALA A 115 ? 0.3293 0.2692 0.7146 0.0292  0.1370  0.1060  115 ALA A CB  
869  N N   . MET A 116 ? 0.4337 0.3667 0.8370 0.0330  0.1479  0.1137  116 MET A N   
870  C CA  . MET A 116 ? 0.3596 0.2863 0.7727 0.0336  0.1513  0.1169  116 MET A CA  
871  C C   . MET A 116 ? 0.4236 0.3415 0.8422 0.0309  0.1483  0.1164  116 MET A C   
872  O O   . MET A 116 ? 0.5265 0.4386 0.9536 0.0312  0.1508  0.1189  116 MET A O   
873  C CB  . MET A 116 ? 0.5467 0.4706 0.9662 0.0341  0.1567  0.1143  116 MET A CB  
874  C CG  . MET A 116 ? 0.7569 0.6750 1.1787 0.0310  0.1555  0.1075  116 MET A CG  
875  S SD  . MET A 116 ? 3.7697 3.6825 4.2007 0.0311  0.1618  0.1047  116 MET A SD  
876  C CE  . MET A 116 ? 2.0135 1.9178 2.4471 0.0267  0.1582  0.0973  116 MET A CE  
877  N N   . ARG A 117 ? 0.4621 0.3791 0.8762 0.0280  0.1430  0.1131  117 ARG A N   
878  C CA  A ARG A 117 ? 0.4261 0.3353 0.8447 0.0251  0.1399  0.1126  117 ARG A CA  
879  C CA  B ARG A 117 ? 0.4257 0.3350 0.8443 0.0251  0.1399  0.1126  117 ARG A CA  
880  C C   . ARG A 117 ? 0.4338 0.3454 0.8501 0.0259  0.1377  0.1187  117 ARG A C   
881  O O   . ARG A 117 ? 0.4570 0.3625 0.8790 0.0244  0.1368  0.1204  117 ARG A O   
882  C CB  A ARG A 117 ? 0.3783 0.2849 0.7938 0.0215  0.1353  0.1062  117 ARG A CB  
883  C CB  B ARG A 117 ? 0.3740 0.2807 0.7892 0.0215  0.1352  0.1063  117 ARG A CB  
884  C CG  A ARG A 117 ? 0.3486 0.2623 0.7530 0.0212  0.1306  0.1056  117 ARG A CG  
885  C CG  B ARG A 117 ? 0.3541 0.2682 0.7582 0.0214  0.1306  0.1059  117 ARG A CG  
886  C CD  A ARG A 117 ? 0.3760 0.2868 0.7776 0.0178  0.1267  0.0987  117 ARG A CD  
887  C CD  B ARG A 117 ? 0.3233 0.2333 0.7254 0.0174  0.1253  0.1011  117 ARG A CD  
888  N NE  A ARG A 117 ? 0.3580 0.2731 0.7552 0.0186  0.1279  0.0948  117 ARG A NE  
889  N NE  B ARG A 117 ? 0.2753 0.1803 0.6811 0.0156  0.1230  0.1036  117 ARG A NE  
890  C CZ  A ARG A 117 ? 0.4157 0.3381 0.8032 0.0189  0.1251  0.0933  117 ARG A CZ  
891  C CZ  B ARG A 117 ? 0.3372 0.2383 0.7421 0.0120  0.1186  0.1002  117 ARG A CZ  
892  N NH1 A ARG A 117 ? 0.4135 0.3395 0.7945 0.0186  0.1207  0.0952  117 ARG A NH1 
893  N NH1 B ARG A 117 ? 0.2599 0.1610 0.6602 0.0101  0.1158  0.0941  117 ARG A NH1 
894  N NH2 A ARG A 117 ? 0.5163 0.4424 0.9006 0.0195  0.1265  0.0898  117 ARG A NH2 
895  N NH2 B ARG A 117 ? 0.2538 0.1508 0.6622 0.0104  0.1169  0.1028  117 ARG A NH2 
896  N N   . TYR A 118 ? 0.4630 0.3836 0.8710 0.0284  0.1370  0.1219  118 TYR A N   
897  C CA  . TYR A 118 ? 0.7353 0.6589 1.1400 0.0293  0.1349  0.1277  118 TYR A CA  
898  C C   . TYR A 118 ? 1.0623 0.9869 1.4714 0.0326  0.1391  0.1342  118 TYR A C   
899  O O   . TYR A 118 ? 1.3575 1.2789 1.7704 0.0323  0.1386  0.1384  118 TYR A O   
900  C CB  . TYR A 118 ? 0.8353 0.7679 1.2284 0.0301  0.1314  0.1281  118 TYR A CB  
901  C CG  . TYR A 118 ? 0.6247 0.5569 1.0127 0.0270  0.1268  0.1219  118 TYR A CG  
902  C CD1 . TYR A 118 ? 0.5466 0.4741 0.9349 0.0237  0.1225  0.1205  118 TYR A CD1 
903  C CD2 . TYR A 118 ? 0.5587 0.4950 0.9414 0.0273  0.1268  0.1175  118 TYR A CD2 
904  C CE1 . TYR A 118 ? 0.3525 0.2797 0.7360 0.0209  0.1183  0.1147  118 TYR A CE1 
905  C CE2 . TYR A 118 ? 0.4440 0.3800 0.8221 0.0246  0.1227  0.1119  118 TYR A CE2 
906  C CZ  . TYR A 118 ? 0.3942 0.3256 0.7726 0.0215  0.1185  0.1105  118 TYR A CZ  
907  O OH  . TYR A 118 ? 0.5237 0.4548 0.8974 0.0190  0.1145  0.1046  118 TYR A OH  
908  N N   . THR A 119 ? 0.8107 0.7397 1.2196 0.0355  0.1434  0.1349  119 THR A N   
909  C CA  . THR A 119 ? 0.5587 0.4906 0.9698 0.0391  0.1474  0.1411  119 THR A CA  
910  C C   . THR A 119 ? 0.4590 0.3832 0.8814 0.0394  0.1514  0.1425  119 THR A C   
911  O O   . THR A 119 ? 0.3365 0.2535 0.7652 0.0371  0.1519  0.1382  119 THR A O   
912  C CB  . THR A 119 ? 0.5340 0.4736 0.9405 0.0420  0.1507  0.1408  119 THR A CB  
913  O OG1 . THR A 119 ? 0.4740 0.4103 0.8862 0.0416  0.1547  0.1366  119 THR A OG1 
914  C CG2 . THR A 119 ? 0.5657 0.5123 0.9614 0.0414  0.1467  0.1383  119 THR A CG2 
915  N N   . GLU A 120 ? 0.4149 0.3405 0.8399 0.0423  0.1543  0.1486  120 GLU A N   
916  C CA  . GLU A 120 ? 0.5971 0.5167 1.0327 0.0433  0.1589  0.1504  120 GLU A CA  
917  C C   . GLU A 120 ? 0.4432 0.3682 0.8794 0.0477  0.1639  0.1551  120 GLU A C   
918  O O   . GLU A 120 ? 0.3618 0.2945 0.7907 0.0498  0.1633  0.1585  120 GLU A O   
919  C CB  . GLU A 120 ? 0.7952 0.7076 1.2365 0.0415  0.1568  0.1529  120 GLU A CB  
920  C CG  . GLU A 120 ? 0.9747 0.8907 1.4095 0.0412  0.1525  0.1574  120 GLU A CG  
921  C CD  . GLU A 120 ? 1.0825 0.9913 1.5233 0.0389  0.1507  0.1598  120 GLU A CD  
922  O OE1 . GLU A 120 ? 1.0396 0.9510 1.4778 0.0397  0.1493  0.1653  120 GLU A OE1 
923  O OE2 . GLU A 120 ? 1.1921 1.0929 1.6402 0.0362  0.1507  0.1563  120 GLU A OE2 
924  N N   . ALA A 121 ? 0.3717 0.2927 0.8165 0.0488  0.1690  0.1550  121 ALA A N   
925  C CA  . ALA A 121 ? 0.3853 0.3119 0.8305 0.0525  0.1743  0.1578  121 ALA A CA  
926  C C   . ALA A 121 ? 0.4776 0.3991 0.9331 0.0542  0.1792  0.1605  121 ALA A C   
927  O O   . ALA A 121 ? 0.3894 0.3024 0.8526 0.0524  0.1789  0.1593  121 ALA A O   
928  C CB  . ALA A 121 ? 0.4809 0.4117 0.9227 0.0523  0.1765  0.1530  121 ALA A CB  
929  N N   . ARG A 122 ? 0.4039 0.3309 0.8593 0.0576  0.1836  0.1642  122 ARG A N   
930  C CA  . ARG A 122 ? 0.4136 0.3373 0.8784 0.0596  0.1891  0.1665  122 ARG A CA  
931  C C   . ARG A 122 ? 0.5658 0.4981 1.0273 0.0627  0.1939  0.1685  122 ARG A C   
932  O O   . ARG A 122 ? 0.4267 0.3668 0.8791 0.0634  0.1923  0.1693  122 ARG A O   
933  C CB  . ARG A 122 ? 0.4065 0.3264 0.8755 0.0607  0.1879  0.1720  122 ARG A CB  
934  C CG  . ARG A 122 ? 0.4021 0.3292 0.8633 0.0628  0.1856  0.1774  122 ARG A CG  
935  C CD  . ARG A 122 ? 0.4183 0.3420 0.8841 0.0642  0.1851  0.1833  122 ARG A CD  
936  N NE  . ARG A 122 ? 0.5553 0.4852 1.0132 0.0658  0.1822  0.1883  122 ARG A NE  
937  C CZ  . ARG A 122 ? 0.7358 0.6632 1.1948 0.0659  0.1797  0.1932  122 ARG A CZ  
938  N NH1 . ARG A 122 ? 1.0462 0.9649 1.5138 0.0645  0.1797  0.1935  122 ARG A NH1 
939  N NH2 . ARG A 122 ? 0.7699 0.7033 1.2212 0.0674  0.1772  0.1976  122 ARG A NH2 
940  N N   . LEU A 123 ? 0.7867 0.7176 1.2555 0.0643  0.1998  0.1693  123 LEU A N   
941  C CA  . LEU A 123 ? 0.9316 0.8704 1.3981 0.0669  0.2049  0.1715  123 LEU A CA  
942  C C   . LEU A 123 ? 0.8231 0.7671 1.2859 0.0697  0.2040  0.1781  123 LEU A C   
943  O O   . LEU A 123 ? 0.6171 0.5569 1.0831 0.0703  0.2015  0.1816  123 LEU A O   
944  C CB  . LEU A 123 ? 1.1101 1.0456 1.5858 0.0676  0.2114  0.1709  123 LEU A CB  
945  C CG  . LEU A 123 ? 1.1835 1.1143 1.6629 0.0651  0.2130  0.1645  123 LEU A CG  
946  C CD1 . LEU A 123 ? 0.9621 0.8891 1.4511 0.0659  0.2193  0.1644  123 LEU A CD1 
947  C CD2 . LEU A 123 ? 1.5374 1.4746 2.0086 0.0639  0.2133  0.1607  123 LEU A CD2 
948  N N   . SER A 124 ? 0.7092 0.6623 1.1652 0.0714  0.2062  0.1798  124 SER A N   
949  C CA  . SER A 124 ? 0.5461 0.5046 0.9989 0.0743  0.2062  0.1860  124 SER A CA  
950  C C   . SER A 124 ? 0.6696 0.6266 1.1308 0.0764  0.2120  0.1892  124 SER A C   
951  O O   . SER A 124 ? 0.7758 0.7294 1.2435 0.0757  0.2164  0.1863  124 SER A O   
952  C CB  . SER A 124 ? 0.4624 0.4310 0.9050 0.0751  0.2068  0.1865  124 SER A CB  
953  O OG  . SER A 124 ? 0.4782 0.4502 0.9219 0.0751  0.2132  0.1848  124 SER A OG  
954  N N   . GLU A 125 ? 0.7855 0.7451 1.2466 0.0791  0.2121  0.1951  125 GLU A N   
955  C CA  . GLU A 125 ? 0.8436 0.8029 1.3121 0.0813  0.2180  0.1981  125 GLU A CA  
956  C C   . GLU A 125 ? 0.5007 0.4659 0.9675 0.0812  0.2245  0.1965  125 GLU A C   
957  O O   . GLU A 125 ? 0.5022 0.4646 0.9765 0.0811  0.2297  0.1954  125 GLU A O   
958  C CB  . GLU A 125 ? 1.3884 1.3504 1.8564 0.0843  0.2172  0.2047  125 GLU A CB  
959  C CG  . GLU A 125 ? 1.8454 1.8049 2.3230 0.0863  0.2222  0.2076  125 GLU A CG  
960  C CD  . GLU A 125 ? 1.9064 1.8682 2.3839 0.0894  0.2212  0.2141  125 GLU A CD  
961  O OE1 . GLU A 125 ? 1.9377 1.9041 2.4070 0.0900  0.2170  0.2164  125 GLU A OE1 
962  O OE2 . GLU A 125 ? 2.0242 1.9835 2.5099 0.0912  0.2246  0.2169  125 GLU A OE2 
963  N N   . ILE A 126 ? 0.4958 0.4691 0.9527 0.0810  0.2242  0.1963  126 ILE A N   
964  C CA  . ILE A 126 ? 0.5122 0.4911 0.9670 0.0806  0.2304  0.1952  126 ILE A CA  
965  C C   . ILE A 126 ? 0.5296 0.5043 0.9883 0.0780  0.2331  0.1894  126 ILE A C   
966  O O   . ILE A 126 ? 0.5330 0.5083 0.9954 0.0777  0.2395  0.1889  126 ILE A O   
967  C CB  . ILE A 126 ? 0.5152 0.5035 0.9584 0.0806  0.2297  0.1961  126 ILE A CB  
968  C CG1 . ILE A 126 ? 0.8128 0.8071 1.2546 0.0816  0.2363  0.1993  126 ILE A CG1 
969  C CG2 . ILE A 126 ? 0.5158 0.5055 0.9534 0.0780  0.2281  0.1904  126 ILE A CG2 
970  C CD1 . ILE A 126 ? 0.9086 0.9116 1.3395 0.0807  0.2374  0.1989  126 ILE A CD1 
971  N N   . ALA A 127 ? 0.5093 0.4798 0.9672 0.0761  0.2284  0.1851  127 ALA A N   
972  C CA  . ALA A 127 ? 0.5137 0.4792 0.9759 0.0737  0.2301  0.1794  127 ALA A CA  
973  C C   . ALA A 127 ? 0.5188 0.4773 0.9926 0.0741  0.2342  0.1796  127 ALA A C   
974  O O   . ALA A 127 ? 0.5288 0.4850 1.0066 0.0727  0.2385  0.1762  127 ALA A O   
975  C CB  . ALA A 127 ? 0.5959 0.5571 1.0561 0.0716  0.2238  0.1753  127 ALA A CB  
976  N N   . GLY A 128 ? 0.6068 0.5618 1.0860 0.0760  0.2328  0.1837  128 GLY A N   
977  C CA  . GLY A 128 ? 0.5171 0.4664 1.0070 0.0768  0.2369  0.1848  128 GLY A CA  
978  C C   . GLY A 128 ? 0.5344 0.4884 1.0255 0.0774  0.2445  0.1859  128 GLY A C   
979  O O   . GLY A 128 ? 0.5429 0.4927 1.0416 0.0769  0.2490  0.1842  128 GLY A O   
980  N N   . TYR A 129 ? 0.6374 0.5999 1.1205 0.0783  0.2460  0.1888  129 TYR A N   
981  C CA  . TYR A 129 ? 0.6133 0.5806 1.0963 0.0784  0.2532  0.1903  129 TYR A CA  
982  C C   . TYR A 129 ? 0.5683 0.5366 1.0489 0.0758  0.2567  0.1854  129 TYR A C   
983  O O   . TYR A 129 ? 0.5827 0.5522 1.0657 0.0752  0.2631  0.1857  129 TYR A O   
984  C CB  . TYR A 129 ? 0.8460 0.8216 1.3213 0.0800  0.2538  0.1953  129 TYR A CB  
985  C CG  . TYR A 129 ? 1.1969 1.1712 1.6774 0.0827  0.2534  0.2007  129 TYR A CG  
986  C CD1 . TYR A 129 ? 1.8039 1.7807 2.2872 0.0837  0.2594  0.2044  129 TYR A CD1 
987  C CD2 . TYR A 129 ? 1.0351 1.0050 1.5178 0.0840  0.2472  0.2020  129 TYR A CD2 
988  C CE1 . TYR A 129 ? 1.8573 1.8329 2.3456 0.0863  0.2592  0.2093  129 TYR A CE1 
989  C CE2 . TYR A 129 ? 1.1790 1.1476 1.6668 0.0866  0.2469  0.2069  129 TYR A CE2 
990  C CZ  . TYR A 129 ? 1.5806 1.5523 2.0713 0.0879  0.2529  0.2105  129 TYR A CZ  
991  O OH  . TYR A 129 ? 1.5939 1.5645 2.0897 0.0905  0.2527  0.2154  129 TYR A OH  
992  N N   . LEU A 130 ? 0.5620 0.5298 1.0379 0.0740  0.2526  0.1810  130 LEU A N   
993  C CA  . LEU A 130 ? 0.6770 0.6447 1.1519 0.0715  0.2557  0.1760  130 LEU A CA  
994  C C   . LEU A 130 ? 0.6482 0.6076 1.1337 0.0708  0.2581  0.1730  130 LEU A C   
995  O O   . LEU A 130 ? 0.5860 0.5449 1.0727 0.0691  0.2625  0.1699  130 LEU A O   
996  C CB  . LEU A 130 ? 0.8452 0.8146 1.3125 0.0698  0.2506  0.1718  130 LEU A CB  
997  C CG  . LEU A 130 ? 1.1920 1.1707 1.6477 0.0695  0.2505  0.1726  130 LEU A CG  
998  C CD1 . LEU A 130 ? 1.4724 1.4521 1.9212 0.0682  0.2443  0.1689  130 LEU A CD1 
999  C CD2 . LEU A 130 ? 0.9063 0.8889 1.3596 0.0681  0.2573  0.1717  130 LEU A CD2 
1000 N N   . LEU A 131 ? 0.8104 0.7629 1.3033 0.0718  0.2549  0.1739  131 LEU A N   
1008 N N   . GLN A 132 ? 0.9052 0.9384 0.6845 -0.2947 0.3254  -0.1427 132 GLN A N   
1009 C CA  . GLN A 132 ? 0.9485 0.9718 0.7205 -0.3007 0.3254  -0.1491 132 GLN A CA  
1010 C C   . GLN A 132 ? 0.8785 0.8890 0.6482 -0.3082 0.3304  -0.1595 132 GLN A C   
1011 O O   . GLN A 132 ? 0.9922 0.9889 0.7579 -0.3151 0.3344  -0.1664 132 GLN A O   
1012 C CB  . GLN A 132 ? 1.1723 1.1814 0.9323 -0.3075 0.3243  -0.1521 132 GLN A CB  
1013 C CG  . GLN A 132 ? 1.5172 1.5201 1.2706 -0.3116 0.3228  -0.1556 132 GLN A CG  
1014 C CD  . GLN A 132 ? 1.9779 1.9627 1.7182 -0.3204 0.3229  -0.1608 132 GLN A CD  
1015 O OE1 . GLN A 132 ? 2.3162 2.3036 2.0530 -0.3188 0.3190  -0.1566 132 GLN A OE1 
1016 N NE2 . GLN A 132 ? 1.9838 1.9499 1.7169 -0.3298 0.3272  -0.1699 132 GLN A NE2 
1017 N N   . ASP A 133 ? 0.8643 0.8801 0.6372 -0.3066 0.3299  -0.1603 133 ASP A N   
1018 C CA  . ASP A 133 ? 1.2180 1.2223 0.9888 -0.3137 0.3341  -0.1700 133 ASP A CA  
1019 C C   . ASP A 133 ? 0.9848 0.9937 0.7639 -0.3115 0.3375  -0.1710 133 ASP A C   
1020 O O   . ASP A 133 ? 0.8848 0.8824 0.6617 -0.3181 0.3415  -0.1797 133 ASP A O   
1021 C CB  . ASP A 133 ? 1.6137 1.5937 1.3713 -0.3263 0.3370  -0.1805 133 ASP A CB  
1022 C CG  . ASP A 133 ? 1.9112 1.8849 1.6605 -0.3299 0.3344  -0.1817 133 ASP A CG  
1023 O OD1 . ASP A 133 ? 1.6361 1.6195 1.3889 -0.3258 0.3320  -0.1788 133 ASP A OD1 
1024 O OD2 . ASP A 133 ? 2.3616 2.3206 2.1007 -0.3368 0.3346  -0.1855 133 ASP A OD2 
1025 N N   . ILE A 134 ? 0.9657 0.9911 0.7544 -0.3022 0.3359  -0.1620 134 ILE A N   
1026 C CA  . ILE A 134 ? 1.2817 1.3128 1.0790 -0.2993 0.3390  -0.1621 134 ILE A CA  
1027 C C   . ILE A 134 ? 0.9547 0.9911 0.7574 -0.2979 0.3401  -0.1644 134 ILE A C   
1028 O O   . ILE A 134 ? 0.9750 1.0109 0.7825 -0.2985 0.3435  -0.1678 134 ILE A O   
1029 C CB  . ILE A 134 ? 1.7071 1.7572 1.5149 -0.2885 0.3366  -0.1510 134 ILE A CB  
1030 C CG1 . ILE A 134 ? 2.0422 2.0942 1.8571 -0.2874 0.3404  -0.1525 134 ILE A CG1 
1031 C CG2 . ILE A 134 ? 1.9336 2.0039 1.7495 -0.2783 0.3321  -0.1417 134 ILE A CG2 
1032 C CD1 . ILE A 134 ? 2.0626 2.1178 1.8804 -0.2845 0.3406  -0.1477 134 ILE A CD1 
1033 N N   . GLU A 135 ? 0.8806 0.9222 0.6826 -0.2960 0.3371  -0.1626 135 GLU A N   
1034 C CA  . GLU A 135 ? 0.8543 0.9023 0.6615 -0.2941 0.3376  -0.1640 135 GLU A CA  
1035 C C   . GLU A 135 ? 0.8748 0.9042 0.6740 -0.3050 0.3413  -0.1758 135 GLU A C   
1036 O O   . GLU A 135 ? 0.8788 0.9108 0.6811 -0.3050 0.3421  -0.1785 135 GLU A O   
1037 C CB  . GLU A 135 ? 0.8402 0.9026 0.6506 -0.2868 0.3327  -0.1566 135 GLU A CB  
1038 C CG  . GLU A 135 ? 0.8595 0.9104 0.6596 -0.2934 0.3314  -0.1611 135 GLU A CG  
1039 C CD  . GLU A 135 ? 1.0007 1.0512 0.7957 -0.2924 0.3280  -0.1563 135 GLU A CD  
1040 O OE1 . GLU A 135 ? 0.9001 0.9533 0.6967 -0.2898 0.3277  -0.1520 135 GLU A OE1 
1041 O OE2 . GLU A 135 ? 1.0724 1.1198 0.8616 -0.2944 0.3256  -0.1568 135 GLU A OE2 
1042 N N   . LYS A 136 ? 0.8882 0.8987 0.6769 -0.3143 0.3433  -0.1827 136 LYS A N   
1043 C CA  . LYS A 136 ? 0.9086 0.9000 0.6882 -0.3254 0.3463  -0.1938 136 LYS A CA  
1044 C C   . LYS A 136 ? 0.9271 0.9040 0.7047 -0.3330 0.3518  -0.2027 136 LYS A C   
1045 O O   . LYS A 136 ? 0.9464 0.9043 0.7151 -0.3433 0.3548  -0.2122 136 LYS A O   
1046 C CB  . LYS A 136 ? 0.9254 0.9047 0.6939 -0.3313 0.3446  -0.1959 136 LYS A CB  
1047 C CG  . LYS A 136 ? 1.0701 1.0569 0.8382 -0.3282 0.3407  -0.1924 136 LYS A CG  
1048 C CD  . LYS A 136 ? 1.1806 1.1646 0.9416 -0.3287 0.3372  -0.1890 136 LYS A CD  
1049 C CE  . LYS A 136 ? 1.2315 1.2196 0.9908 -0.3275 0.3341  -0.1874 136 LYS A CE  
1050 N NZ  . LYS A 136 ? 1.2788 1.2508 1.0259 -0.3357 0.3335  -0.1919 136 LYS A NZ  
1051 N N   . LYS A 137 ? 0.9217 0.9077 0.7078 -0.3277 0.3532  -0.1995 137 LYS A N   
1052 C CA  . LYS A 137 ? 1.0552 1.0292 0.8407 -0.3339 0.3584  -0.2073 137 LYS A CA  
1053 C C   . LYS A 137 ? 1.6138 1.5681 1.3884 -0.3430 0.3606  -0.2136 137 LYS A C   
1054 O O   . LYS A 137 ? 1.4407 1.3769 1.2086 -0.3529 0.3645  -0.2237 137 LYS A O   
1055 C CB  . LYS A 137 ? 0.9527 0.9210 0.7388 -0.3387 0.3615  -0.2149 137 LYS A CB  
1056 C CG  . LYS A 137 ? 1.1342 1.1228 0.9324 -0.3290 0.3599  -0.2086 137 LYS A CG  
1057 C CD  . LYS A 137 ? 1.0875 1.0715 0.8875 -0.3332 0.3632  -0.2159 137 LYS A CD  
1058 N N   . THR A 138 ? 2.0508 2.0095 1.8242 -0.3394 0.3578  -0.2072 138 THR A N   
1059 C CA  . THR A 138 ? 2.6232 2.5653 2.3863 -0.3468 0.3589  -0.2116 138 THR A CA  
1060 C C   . THR A 138 ? 2.8431 2.7828 2.6083 -0.3467 0.3616  -0.2117 138 THR A C   
1061 O O   . THR A 138 ? 3.0544 2.9780 2.8112 -0.3542 0.3637  -0.2173 138 THR A O   
1062 C CB  . THR A 138 ? 2.8257 2.7735 2.5854 -0.3431 0.3540  -0.2043 138 THR A CB  
1063 O OG1 . THR A 138 ? 2.9053 2.8747 2.6754 -0.3313 0.3506  -0.1929 138 THR A OG1 
1064 C CG2 . THR A 138 ? 2.8102 2.7563 2.5652 -0.3451 0.3515  -0.2054 138 THR A CG2 
1065 N N   . VAL A 139 ? 2.6228 2.5786 2.3995 -0.3383 0.3615  -0.2057 139 VAL A N   
1066 C CA  . VAL A 139 ? 2.1514 2.1084 1.9318 -0.3363 0.3635  -0.2039 139 VAL A CA  
1067 C C   . VAL A 139 ? 2.1906 2.1546 1.9806 -0.3333 0.3664  -0.2048 139 VAL A C   
1068 O O   . VAL A 139 ? 1.8907 1.8658 1.6870 -0.3287 0.3652  -0.2023 139 VAL A O   
1069 C CB  . VAL A 139 ? 1.6019 1.5759 1.3878 -0.3266 0.3591  -0.1920 139 VAL A CB  
1070 C CG1 . VAL A 139 ? 1.0479 1.0332 0.8439 -0.3200 0.3603  -0.1869 139 VAL A CG1 
1071 C CG2 . VAL A 139 ? 1.7384 1.7018 1.5145 -0.3310 0.3578  -0.1925 139 VAL A CG2 
1072 N N   . PRO A 140 ? 2.1798 2.1371 1.9708 -0.3360 0.3703  -0.2084 140 PRO A N   
1073 C CA  . PRO A 140 ? 2.0221 1.9844 1.8218 -0.3337 0.3735  -0.2097 140 PRO A CA  
1074 C C   . PRO A 140 ? 1.4861 1.4720 1.2988 -0.3213 0.3708  -0.1981 140 PRO A C   
1075 O O   . PRO A 140 ? 1.2949 1.2887 1.1101 -0.3160 0.3686  -0.1907 140 PRO A O   
1076 C CB  . PRO A 140 ? 2.3356 2.2832 2.1312 -0.3401 0.3778  -0.2159 140 PRO A CB  
1077 C CG  . PRO A 140 ? 2.4777 2.4103 2.2613 -0.3470 0.3771  -0.2193 140 PRO A CG  
1078 C CD  . PRO A 140 ? 2.3870 2.3312 2.1705 -0.3413 0.3717  -0.2112 140 PRO A CD  
1079 N N   . PHE A 141 ? 1.2333 1.2299 1.0543 -0.3169 0.3710  -0.1968 141 PHE A N   
1080 C CA  . PHE A 141 ? 1.1582 1.1773 0.9918 -0.3051 0.3686  -0.1861 141 PHE A CA  
1081 C C   . PHE A 141 ? 1.0337 1.0557 0.8754 -0.3036 0.3723  -0.1875 141 PHE A C   
1082 O O   . PHE A 141 ? 1.2379 1.2477 1.0771 -0.3105 0.3765  -0.1968 141 PHE A O   
1083 C CB  . PHE A 141 ? 1.0244 1.0561 0.8620 -0.2999 0.3652  -0.1820 141 PHE A CB  
1084 C CG  . PHE A 141 ? 1.1776 1.2173 1.0131 -0.2955 0.3600  -0.1747 141 PHE A CG  
1085 C CD1 . PHE A 141 ? 1.2189 1.2445 1.0429 -0.3027 0.3593  -0.1795 141 PHE A CD1 
1086 C CD2 . PHE A 141 ? 1.4447 1.5059 1.2897 -0.2841 0.3559  -0.1630 141 PHE A CD2 
1087 C CE1 . PHE A 141 ? 1.4427 1.4757 1.2647 -0.2987 0.3545  -0.1728 141 PHE A CE1 
1088 C CE2 . PHE A 141 ? 1.6808 1.7493 1.5239 -0.2800 0.3511  -0.1563 141 PHE A CE2 
1089 C CZ  . PHE A 141 ? 1.6749 1.7293 1.5064 -0.2873 0.3504  -0.1612 141 PHE A CZ  
1090 N N   . ALA A 142 ? 0.9854 1.0234 0.8369 -0.2945 0.3709  -0.1782 142 ALA A N   
1091 C CA  . ALA A 142 ? 1.2053 1.2488 1.0658 -0.2915 0.3740  -0.1779 142 ALA A CA  
1092 C C   . ALA A 142 ? 1.0066 1.0733 0.8795 -0.2800 0.3709  -0.1674 142 ALA A C   
1093 O O   . ALA A 142 ? 1.1267 1.2057 1.0015 -0.2736 0.3663  -0.1594 142 ALA A O   
1094 C CB  . ALA A 142 ? 1.6702 1.7092 1.5309 -0.2924 0.3761  -0.1773 142 ALA A CB  
1095 N N   . TRP A 143 ? 1.0547 1.1271 0.9359 -0.2772 0.3735  -0.1674 143 TRP A N   
1096 C CA  . TRP A 143 ? 1.1397 1.2338 1.0331 -0.2662 0.3710  -0.1573 143 TRP A CA  
1097 C C   . TRP A 143 ? 1.2177 1.3236 1.1168 -0.2587 0.3687  -0.1471 143 TRP A C   
1098 O O   . TRP A 143 ? 1.2458 1.3435 1.1425 -0.2620 0.3708  -0.1490 143 TRP A O   
1099 C CB  . TRP A 143 ? 1.2987 1.3946 1.1990 -0.2659 0.3746  -0.1608 143 TRP A CB  
1100 C CG  . TRP A 143 ? 1.3893 1.4790 1.2862 -0.2707 0.3757  -0.1682 143 TRP A CG  
1101 C CD1 . TRP A 143 ? 1.3671 1.4391 1.2578 -0.2805 0.3801  -0.1800 143 TRP A CD1 
1102 C CD2 . TRP A 143 ? 1.4579 1.5587 1.3573 -0.2660 0.3723  -0.1643 143 TRP A CD2 
1103 N NE1 . TRP A 143 ? 1.3598 1.4315 1.2491 -0.2823 0.3796  -0.1837 143 TRP A NE1 
1104 C CE2 . TRP A 143 ? 1.4333 1.5226 1.3279 -0.2734 0.3749  -0.1743 143 TRP A CE2 
1105 C CE3 . TRP A 143 ? 1.5513 1.6706 1.4566 -0.2563 0.3673  -0.1535 143 TRP A CE3 
1106 C CZ2 . TRP A 143 ? 1.5380 1.6338 1.4335 -0.2714 0.3726  -0.1736 143 TRP A CZ2 
1107 C CZ3 . TRP A 143 ? 1.6163 1.7419 1.5224 -0.2542 0.3652  -0.1529 143 TRP A CZ3 
1108 C CH2 . TRP A 143 ? 1.6141 1.7281 1.5153 -0.2617 0.3678  -0.1629 143 TRP A CH2 
1109 N N   . ASN A 144 ? 1.3816 1.5067 1.2882 -0.2488 0.3643  -0.1362 144 ASN A N   
1110 C CA  . ASN A 144 ? 1.7270 1.8653 1.6405 -0.2409 0.3619  -0.1254 144 ASN A CA  
1111 C C   . ASN A 144 ? 1.8578 2.0018 1.7807 -0.2376 0.3648  -0.1237 144 ASN A C   
1112 O O   . ASN A 144 ? 1.9685 2.1088 1.8933 -0.2402 0.3681  -0.1296 144 ASN A O   
1113 C CB  . ASN A 144 ? 2.0350 2.1922 1.9544 -0.2310 0.3564  -0.1142 144 ASN A CB  
1114 C CG  . ASN A 144 ? 2.4144 2.5829 2.3409 -0.2260 0.3558  -0.1123 144 ASN A CG  
1115 O OD1 . ASN A 144 ? 2.5083 2.6717 2.4362 -0.2294 0.3594  -0.1188 144 ASN A OD1 
1116 N ND2 . ASN A 144 ? 2.6160 2.7998 2.5470 -0.2178 0.3512  -0.1033 144 ASN A ND2 
1117 N N   . PHE A 145 ? 1.8810 2.0333 1.8093 -0.2323 0.3638  -0.1158 145 PHE A N   
1118 C CA  . PHE A 145 ? 1.9349 2.0954 1.8732 -0.2277 0.3660  -0.1120 145 PHE A CA  
1119 C C   . PHE A 145 ? 1.8262 1.9974 1.7730 -0.2230 0.3664  -0.1107 145 PHE A C   
1120 O O   . PHE A 145 ? 1.7161 1.8884 1.6689 -0.2226 0.3696  -0.1122 145 PHE A O   
1121 C CB  . PHE A 145 ? 2.0343 2.2097 1.9800 -0.2191 0.3627  -0.0997 145 PHE A CB  
1122 C CG  . PHE A 145 ? 2.0270 2.2213 1.9795 -0.2092 0.3578  -0.0889 145 PHE A CG  
1123 C CD1 . PHE A 145 ? 2.0031 2.2130 1.9668 -0.2013 0.3574  -0.0826 145 PHE A CD1 
1124 C CD2 . PHE A 145 ? 1.9434 2.1398 1.8910 -0.2079 0.3536  -0.0851 145 PHE A CD2 
1125 C CE1 . PHE A 145 ? 1.8701 2.0969 1.8401 -0.1922 0.3529  -0.0726 145 PHE A CE1 
1126 C CE2 . PHE A 145 ? 1.8061 2.0194 1.7600 -0.1988 0.3492  -0.0752 145 PHE A CE2 
1127 C CZ  . PHE A 145 ? 1.7685 1.9969 1.7336 -0.1909 0.3489  -0.0690 145 PHE A CZ  
1128 N N   . ASP A 146 ? 1.7714 1.9502 1.7183 -0.2197 0.3631  -0.1080 146 ASP A N   
1129 C CA  . ASP A 146 ? 1.5415 1.7351 1.4977 -0.2126 0.3621  -0.1032 146 ASP A CA  
1130 C C   . ASP A 146 ? 1.3472 1.5319 1.3001 -0.2185 0.3649  -0.1131 146 ASP A C   
1131 O O   . ASP A 146 ? 1.2535 1.4481 1.2136 -0.2140 0.3650  -0.1111 146 ASP A O   
1132 C CB  . ASP A 146 ? 1.4460 1.6542 1.4047 -0.2046 0.3565  -0.0933 146 ASP A CB  
1133 C CG  . ASP A 146 ? 1.3849 1.6081 1.3521 -0.1972 0.3549  -0.0881 146 ASP A CG  
1134 O OD1 . ASP A 146 ? 1.3910 1.6310 1.3671 -0.1876 0.3520  -0.0769 146 ASP A OD1 
1135 O OD2 . ASP A 146 ? 1.3541 1.5721 1.3189 -0.2011 0.3566  -0.0953 146 ASP A OD2 
1136 N N   . ASP A 147 ? 1.3117 1.4775 1.2536 -0.2288 0.3672  -0.1239 147 ASP A N   
1137 C CA  . ASP A 147 ? 1.2081 1.3642 1.1454 -0.2351 0.3694  -0.1336 147 ASP A CA  
1138 C C   . ASP A 147 ? 1.0915 1.2582 1.0304 -0.2305 0.3658  -0.1299 147 ASP A C   
1139 O O   . ASP A 147 ? 0.9825 1.1464 0.9210 -0.2333 0.3673  -0.1356 147 ASP A O   
1140 C CB  . ASP A 147 ? 1.2698 1.4225 1.2118 -0.2374 0.3741  -0.1391 147 ASP A CB  
1141 C CG  . ASP A 147 ? 1.3879 1.5201 1.3222 -0.2477 0.3788  -0.1497 147 ASP A CG  
1142 O OD1 . ASP A 147 ? 1.4737 1.6045 1.4103 -0.2473 0.3805  -0.1481 147 ASP A OD1 
1143 O OD2 . ASP A 147 ? 1.5011 1.6184 1.4271 -0.2563 0.3809  -0.1597 147 ASP A OD2 
1144 N N   . THR A 148 ? 1.0955 1.2740 1.0361 -0.2237 0.3610  -0.1204 148 THR A N   
1145 C CA  . THR A 148 ? 1.0550 1.2438 0.9968 -0.2188 0.3571  -0.1160 148 THR A CA  
1146 C C   . THR A 148 ? 1.0722 1.2507 1.0031 -0.2245 0.3552  -0.1203 148 THR A C   
1147 O O   . THR A 148 ? 0.9667 1.1471 0.8959 -0.2245 0.3536  -0.1217 148 THR A O   
1148 C CB  . THR A 148 ? 0.9914 1.2004 0.9423 -0.2072 0.3528  -0.1023 148 THR A CB  
1149 O OG1 . THR A 148 ? 1.0343 1.2500 0.9836 -0.2038 0.3487  -0.0986 148 THR A OG1 
1150 C CG2 . THR A 148 ? 1.0903 1.2987 1.0399 -0.2061 0.3516  -0.0974 148 THR A CG2 
1151 N N   . GLU A 149 ? 1.3400 1.5080 1.2638 -0.2292 0.3554  -0.1222 149 GLU A N   
1152 C CA  . GLU A 149 ? 1.6561 1.8158 1.5700 -0.2336 0.3531  -0.1246 149 GLU A CA  
1153 C C   . GLU A 149 ? 1.6210 1.7607 1.5243 -0.2437 0.3558  -0.1329 149 GLU A C   
1154 O O   . GLU A 149 ? 1.9754 2.1111 1.8796 -0.2449 0.3581  -0.1333 149 GLU A O   
1155 C CB  . GLU A 149 ? 1.8984 2.0728 1.8157 -0.2249 0.3479  -0.1129 149 GLU A CB  
1156 C CG  . GLU A 149 ? 2.0381 2.2093 1.9478 -0.2269 0.3446  -0.1135 149 GLU A CG  
1157 C CD  . GLU A 149 ? 2.1154 2.3012 2.0289 -0.2181 0.3396  -0.1019 149 GLU A CD  
1158 O OE1 . GLU A 149 ? 2.2815 2.4829 2.2052 -0.2090 0.3382  -0.0926 149 GLU A OE1 
1159 O OE2 . GLU A 149 ? 2.0092 2.1903 1.9153 -0.2203 0.3370  -0.1020 149 GLU A OE2 
1160 N N   . LYS A 150 ? 1.1177 1.2450 1.0109 -0.2508 0.3555  -0.1395 150 LYS A N   
1161 C CA  . LYS A 150 ? 0.9004 1.0082 0.7827 -0.2604 0.3577  -0.1474 150 LYS A CA  
1162 C C   . LYS A 150 ? 0.8589 0.9693 0.7380 -0.2580 0.3542  -0.1408 150 LYS A C   
1163 O O   . LYS A 150 ? 0.8757 0.9981 0.7568 -0.2516 0.3497  -0.1332 150 LYS A O   
1164 C CB  . LYS A 150 ? 0.8951 0.9869 0.7676 -0.2700 0.3594  -0.1581 150 LYS A CB  
1165 C CG  . LYS A 150 ? 0.8825 0.9652 0.7555 -0.2758 0.3641  -0.1674 150 LYS A CG  
1166 N N   . GLU A 151 ? 0.8348 0.9341 0.7091 -0.2627 0.3562  -0.1437 151 GLU A N   
1167 C CA  . GLU A 151 ? 0.8272 0.9251 0.6964 -0.2625 0.3534  -0.1395 151 GLU A CA  
1168 C C   . GLU A 151 ? 0.8443 0.9194 0.7007 -0.2741 0.3562  -0.1498 151 GLU A C   
1169 O O   . GLU A 151 ? 0.8613 0.9226 0.7144 -0.2814 0.3607  -0.1591 151 GLU A O   
1170 C CB  . GLU A 151 ? 1.0526 1.1623 0.9297 -0.2552 0.3524  -0.1304 151 GLU A CB  
1171 C CG  . GLU A 151 ? 1.1109 1.2143 0.9907 -0.2581 0.3572  -0.1346 151 GLU A CG  
1172 C CD  . GLU A 151 ? 1.3268 1.4403 1.2134 -0.2517 0.3563  -0.1259 151 GLU A CD  
1173 O OE1 . GLU A 151 ? 1.0592 1.1733 0.9516 -0.2512 0.3595  -0.1268 151 GLU A OE1 
1174 O OE2 . GLU A 151 ? 1.4973 1.6179 1.3837 -0.2475 0.3524  -0.1183 151 GLU A OE2 
1175 N N   . PRO A 152 ? 1.0776 1.1486 0.9266 -0.2758 0.3533  -0.1482 152 PRO A N   
1176 C CA  . PRO A 152 ? 0.8572 0.9063 0.6937 -0.2867 0.3558  -0.1578 152 PRO A CA  
1177 C C   . PRO A 152 ? 0.8608 0.9039 0.6970 -0.2886 0.3584  -0.1585 152 PRO A C   
1178 O O   . PRO A 152 ? 0.8618 0.9184 0.7050 -0.2809 0.3563  -0.1492 152 PRO A O   
1179 C CB  . PRO A 152 ? 1.4427 1.4926 1.2730 -0.2862 0.3514  -0.1540 152 PRO A CB  
1180 C CG  . PRO A 152 ? 1.5085 1.5800 1.3487 -0.2745 0.3472  -0.1410 152 PRO A CG  
1181 C CD  . PRO A 152 ? 1.3583 1.4435 1.2097 -0.2680 0.3479  -0.1378 152 PRO A CD  
1182 N N   . THR A 153 ? 0.8810 0.9044 0.7094 -0.2986 0.3629  -0.1691 153 THR A N   
1183 C CA  . THR A 153 ? 0.8866 0.9021 0.7132 -0.3014 0.3656  -0.1707 153 THR A CA  
1184 C C   . THR A 153 ? 0.8863 0.8931 0.7035 -0.3051 0.3637  -0.1704 153 THR A C   
1185 O O   . THR A 153 ? 0.8851 0.8899 0.7022 -0.3050 0.3645  -0.1686 153 THR A O   
1186 C CB  . THR A 153 ? 0.9100 0.9074 0.7320 -0.3108 0.3713  -0.1825 153 THR A CB  
1187 O OG1 . THR A 153 ? 1.0413 1.0220 0.8523 -0.3200 0.3722  -0.1917 153 THR A OG1 
1188 C CG2 . THR A 153 ? 1.0249 1.0308 0.8568 -0.3071 0.3735  -0.1826 153 THR A CG2 
1189 N N   . VAL A 154 ? 0.9858 0.9870 0.7951 -0.3084 0.3613  -0.1724 154 VAL A N   
1190 C CA  . VAL A 154 ? 1.1199 1.1146 0.9204 -0.3111 0.3588  -0.1712 154 VAL A CA  
1191 C C   . VAL A 154 ? 0.8780 0.8777 0.6758 -0.3093 0.3546  -0.1684 154 VAL A C   
1192 O O   . VAL A 154 ? 0.8835 0.8822 0.6813 -0.3110 0.3551  -0.1722 154 VAL A O   
1193 C CB  . VAL A 154 ? 1.5331 1.5029 1.3209 -0.3234 0.3626  -0.1827 154 VAL A CB  
1194 C CG1 . VAL A 154 ? 1.6446 1.6010 1.4277 -0.3313 0.3660  -0.1933 154 VAL A CG1 
1195 C CG2 . VAL A 154 ? 1.4388 1.4012 1.2165 -0.3268 0.3597  -0.1822 154 VAL A CG2 
1196 N N   . LEU A 155 ? 0.8752 0.8800 0.6706 -0.3062 0.3505  -0.1618 155 LEU A N   
1197 C CA  . LEU A 155 ? 0.8714 0.8800 0.6637 -0.3050 0.3465  -0.1595 155 LEU A CA  
1198 C C   . LEU A 155 ? 0.9107 0.8986 0.6889 -0.3158 0.3474  -0.1686 155 LEU A C   
1199 O O   . LEU A 155 ? 0.9416 0.9132 0.7117 -0.3234 0.3501  -0.1750 155 LEU A O   
1200 C CB  . LEU A 155 ? 0.8483 0.8743 0.6458 -0.2955 0.3413  -0.1472 155 LEU A CB  
1201 C CG  . LEU A 155 ? 1.5685 1.6159 1.3802 -0.2844 0.3400  -0.1374 155 LEU A CG  
1202 C CD1 . LEU A 155 ? 1.6667 1.7306 1.4830 -0.2755 0.3346  -0.1256 155 LEU A CD1 
1203 C CD2 . LEU A 155 ? 1.5543 1.6093 1.3727 -0.2815 0.3408  -0.1383 155 LEU A CD2 
1204 N N   . PRO A 156 ? 0.9100 0.8982 0.6852 -0.3165 0.3452  -0.1694 156 PRO A N   
1205 C CA  . PRO A 156 ? 0.9459 0.9154 0.7080 -0.3263 0.3456  -0.1774 156 PRO A CA  
1206 C C   . PRO A 156 ? 0.9689 0.9306 0.7226 -0.3293 0.3439  -0.1763 156 PRO A C   
1207 O O   . PRO A 156 ? 1.0048 0.9471 0.7470 -0.3391 0.3457  -0.1846 156 PRO A O   
1208 C CB  . PRO A 156 ? 0.9304 0.9084 0.6939 -0.3230 0.3423  -0.1746 156 PRO A CB  
1209 C CG  . PRO A 156 ? 0.8965 0.8895 0.6719 -0.3161 0.3429  -0.1713 156 PRO A CG  
1210 C CD  . PRO A 156 ? 0.8774 0.8816 0.6612 -0.3093 0.3431  -0.1646 156 PRO A CD  
1211 N N   . ALA A 157 ? 0.9489 0.9253 0.7082 -0.3211 0.3404  -0.1661 157 ALA A N   
1212 C CA  . ALA A 157 ? 0.9684 0.9390 0.7207 -0.3230 0.3387  -0.1642 157 ALA A CA  
1213 C C   . ALA A 157 ? 0.9998 0.9555 0.7394 -0.3308 0.3375  -0.1694 157 ALA A C   
1214 O O   . ALA A 157 ? 1.0344 0.9712 0.7639 -0.3400 0.3401  -0.1773 157 ALA A O   
1215 C CB  . ALA A 157 ? 0.9861 0.9466 0.7364 -0.3273 0.3425  -0.1682 157 ALA A CB  
1216 N N   . ALA A 158 ? 0.9877 0.9519 0.7278 -0.3270 0.3334  -0.1646 158 ALA A N   
1217 C CA  . ALA A 158 ? 1.0873 1.0394 0.8161 -0.3332 0.3317  -0.1681 158 ALA A CA  
1218 C C   . ALA A 158 ? 1.0297 0.9791 0.7529 -0.3336 0.3293  -0.1644 158 ALA A C   
1219 O O   . ALA A 158 ? 1.0521 0.9920 0.7659 -0.3385 0.3276  -0.1666 158 ALA A O   
1220 C CB  . ALA A 158 ? 1.2043 1.1675 0.9361 -0.3284 0.3281  -0.1638 158 ALA A CB  
1221 N N   . PHE A 159 ? 1.0168 0.9750 0.7459 -0.3284 0.3290  -0.1586 159 PHE A N   
1222 C CA  . PHE A 159 ? 1.2363 1.1870 0.9586 -0.3313 0.3283  -0.1578 159 PHE A CA  
1223 C C   . PHE A 159 ? 1.1282 1.0771 0.8540 -0.3316 0.3318  -0.1590 159 PHE A C   
1224 O O   . PHE A 159 ? 1.0688 1.0288 0.8049 -0.3261 0.3332  -0.1564 159 PHE A O   
1225 C CB  . PHE A 159 ? 1.6903 1.6560 1.4157 -0.3234 0.3227  -0.1469 159 PHE A CB  
1226 C CG  . PHE A 159 ? 2.1484 2.1355 1.8871 -0.3123 0.3209  -0.1363 159 PHE A CG  
1227 C CD1 . PHE A 159 ? 2.2367 2.2422 1.9858 -0.3034 0.3185  -0.1295 159 PHE A CD1 
1228 C CD2 . PHE A 159 ? 2.4279 2.4166 2.1687 -0.3107 0.3215  -0.1332 159 PHE A CD2 
1229 C CE1 . PHE A 159 ? 2.3109 2.3358 2.0724 -0.2932 0.3169  -0.1196 159 PHE A CE1 
1230 C CE2 . PHE A 159 ? 2.4826 2.4909 2.2359 -0.3006 0.3199  -0.1233 159 PHE A CE2 
1231 C CZ  . PHE A 159 ? 2.4027 2.4289 2.1663 -0.2918 0.3176  -0.1165 159 PHE A CZ  
1232 N N   . PRO A 160 ? 1.4658 1.4000 1.1827 -0.3382 0.3333  -0.1633 160 PRO A N   
1233 C CA  . PRO A 160 ? 1.5866 1.5149 1.3042 -0.3404 0.3371  -0.1661 160 PRO A CA  
1234 C C   . PRO A 160 ? 1.0512 0.9975 0.7791 -0.3308 0.3349  -0.1553 160 PRO A C   
1235 O O   . PRO A 160 ? 1.0631 1.0070 0.7876 -0.3314 0.3340  -0.1529 160 PRO A O   
1236 C CB  . PRO A 160 ? 1.8833 1.7900 1.5867 -0.3507 0.3384  -0.1736 160 PRO A CB  
1237 C CG  . PRO A 160 ? 2.0356 1.9358 1.7308 -0.3546 0.3359  -0.1758 160 PRO A CG  
1238 C CD  . PRO A 160 ? 1.8493 1.7702 1.5538 -0.3447 0.3316  -0.1664 160 PRO A CD  
1239 N N   . ASN A 161 ? 1.0149 0.9791 0.7553 -0.3222 0.3343  -0.1491 161 ASN A N   
1240 C CA  . ASN A 161 ? 0.9837 0.9676 0.7355 -0.3119 0.3318  -0.1378 161 ASN A CA  
1241 C C   . ASN A 161 ? 0.9907 0.9717 0.7439 -0.3126 0.3344  -0.1376 161 ASN A C   
1242 O O   . ASN A 161 ? 0.9762 0.9692 0.7348 -0.3062 0.3318  -0.1287 161 ASN A O   
1243 C CB  . ASN A 161 ? 1.8702 1.8718 1.6344 -0.3035 0.3311  -0.1326 161 ASN A CB  
1244 C CG  . ASN A 161 ? 2.3242 2.3469 2.1011 -0.2925 0.3286  -0.1207 161 ASN A CG  
1245 O OD1 . ASN A 161 ? 2.6789 2.7134 2.4583 -0.2864 0.3241  -0.1119 161 ASN A OD1 
1246 N ND2 . ASN A 161 ? 2.4170 2.4446 2.2020 -0.2899 0.3316  -0.1203 161 ASN A ND2 
1247 N N   . LEU A 162 ? 1.0141 0.9788 0.7622 -0.3205 0.3394  -0.1474 162 LEU A N   
1248 C CA  . LEU A 162 ? 1.0215 0.9828 0.7710 -0.3215 0.3423  -0.1480 162 LEU A CA  
1249 C C   . LEU A 162 ? 1.0380 0.9961 0.7815 -0.3225 0.3400  -0.1447 162 LEU A C   
1250 O O   . LEU A 162 ? 1.0251 0.9930 0.7749 -0.3172 0.3391  -0.1376 162 LEU A O   
1251 C CB  . LEU A 162 ? 1.0503 0.9915 0.7930 -0.3313 0.3481  -0.1604 162 LEU A CB  
1252 C CG  . LEU A 162 ? 1.0480 0.9885 0.7962 -0.3310 0.3522  -0.1619 162 LEU A CG  
1253 C CD1 . LEU A 162 ? 1.2665 1.1848 1.0031 -0.3414 0.3560  -0.1718 162 LEU A CD1 
1254 C CD2 . LEU A 162 ? 1.0214 0.9799 0.7799 -0.3216 0.3499  -0.1506 162 LEU A CD2 
1255 N N   . LEU A 163 ? 1.5181 1.4623 1.2494 -0.3295 0.3389  -0.1496 163 LEU A N   
1256 C CA  . LEU A 163 ? 1.7069 1.6461 1.4310 -0.3316 0.3367  -0.1475 163 LEU A CA  
1257 C C   . LEU A 163 ? 1.4578 1.4136 1.1862 -0.3236 0.3308  -0.1366 163 LEU A C   
1258 O O   . LEU A 163 ? 1.3007 1.2621 1.0298 -0.3205 0.3284  -0.1302 163 LEU A O   
1259 C CB  . LEU A 163 ? 2.3307 2.2461 2.0389 -0.3433 0.3383  -0.1582 163 LEU A CB  
1260 C CG  . LEU A 163 ? 3.0021 2.8974 2.7032 -0.3528 0.3441  -0.1697 163 LEU A CG  
1261 C CD1 . LEU A 163 ? 3.3105 3.1844 2.9968 -0.3634 0.3450  -0.1794 163 LEU A CD1 
1262 C CD2 . LEU A 163 ? 3.2554 3.1492 2.9572 -0.3527 0.3457  -0.1683 163 LEU A CD2 
1263 N N   . VAL A 164 ? 1.4872 1.4506 1.2183 -0.3205 0.3285  -0.1348 164 VAL A N   
1264 C CA  . VAL A 164 ? 1.5707 1.5494 1.3056 -0.3130 0.3229  -0.1248 164 VAL A CA  
1265 C C   . VAL A 164 ? 1.5216 1.5219 1.2700 -0.3020 0.3207  -0.1130 164 VAL A C   
1266 O O   . VAL A 164 ? 1.4480 1.4549 1.1969 -0.2985 0.3173  -0.1058 164 VAL A O   
1267 C CB  . VAL A 164 ? 1.6802 1.6636 1.4160 -0.3114 0.3210  -0.1250 164 VAL A CB  
1268 C CG1 . VAL A 164 ? 1.7495 1.7519 1.4921 -0.3019 0.3154  -0.1135 164 VAL A CG1 
1269 C CG2 . VAL A 164 ? 1.7086 1.6716 1.4303 -0.3218 0.3220  -0.1349 164 VAL A CG2 
1270 N N   . ASN A 165 ? 1.5240 1.5348 1.2832 -0.2968 0.3225  -0.1110 165 ASN A N   
1271 C CA  . ASN A 165 ? 1.4101 1.4416 1.1829 -0.2862 0.3207  -0.0997 165 ASN A CA  
1272 C C   . ASN A 165 ? 1.1628 1.1937 0.9395 -0.2860 0.3236  -0.0991 165 ASN A C   
1273 O O   . ASN A 165 ? 1.0546 1.0996 0.8396 -0.2787 0.3214  -0.0895 165 ASN A O   
1274 C CB  . ASN A 165 ? 1.5409 1.5888 1.3253 -0.2782 0.3198  -0.0948 165 ASN A CB  
1275 C CG  . ASN A 165 ? 1.6825 1.7411 1.4681 -0.2730 0.3149  -0.0886 165 ASN A CG  
1276 O OD1 . ASN A 165 ? 1.5351 1.5986 1.3194 -0.2704 0.3111  -0.0823 165 ASN A OD1 
1277 N ND2 . ASN A 165 ? 1.9357 1.9972 1.7233 -0.2720 0.3149  -0.0907 165 ASN A ND2 
1278 N N   . GLY A 166 ? 0.9571 0.9715 0.7280 -0.2942 0.3286  -0.1093 166 GLY A N   
1279 C CA  . GLY A 166 ? 0.9620 0.9738 0.7355 -0.2949 0.3317  -0.1098 166 GLY A CA  
1280 C C   . GLY A 166 ? 1.1606 1.1838 0.9466 -0.2892 0.3341  -0.1073 166 GLY A C   
1281 O O   . GLY A 166 ? 1.1260 1.1550 0.9166 -0.2867 0.3342  -0.1077 166 GLY A O   
1282 N N   . SER A 167 ? 1.2447 1.2708 1.0360 -0.2874 0.3360  -0.1047 167 SER A N   
1283 C CA  . SER A 167 ? 1.0653 1.1002 0.8678 -0.2829 0.3387  -0.1031 167 SER A CA  
1284 C C   . SER A 167 ? 0.9365 0.9723 0.7426 -0.2820 0.3405  -0.1003 167 SER A C   
1285 O O   . SER A 167 ? 1.0312 1.0532 0.8282 -0.2884 0.3418  -0.1049 167 SER A O   
1286 C CB  . SER A 167 ? 0.9976 1.0188 0.7959 -0.2899 0.3434  -0.1146 167 SER A CB  
1287 O OG  . SER A 167 ? 0.8989 0.9302 0.7086 -0.2848 0.3456  -0.1126 167 SER A OG  
1288 N N   . THR A 168 ? 0.9921 1.0440 0.8116 -0.2739 0.3407  -0.0929 168 THR A N   
1289 C CA  . THR A 168 ? 0.8807 0.9360 0.7061 -0.2718 0.3425  -0.0894 168 THR A CA  
1290 C C   . THR A 168 ? 0.9647 1.0368 0.8046 -0.2635 0.3430  -0.0833 168 THR A C   
1291 O O   . THR A 168 ? 0.9110 0.9986 0.7580 -0.2560 0.3394  -0.0756 168 THR A O   
1292 C CB  . THR A 168 ? 0.8718 0.9367 0.6991 -0.2669 0.3383  -0.0793 168 THR A CB  
1293 O OG1 . THR A 168 ? 0.8851 0.9664 0.7259 -0.2586 0.3379  -0.0699 168 THR A OG1 
1294 C CG2 . THR A 168 ? 0.8585 0.9335 0.6859 -0.2622 0.3329  -0.0728 168 THR A CG2 
1295 N N   . GLY A 169 ? 1.3183 1.3879 1.1630 -0.2645 0.3474  -0.0866 169 GLY A N   
1296 C CA  . GLY A 169 ? 1.5815 1.6317 1.4180 -0.2738 0.3524  -0.0975 169 GLY A CA  
1297 C C   . GLY A 169 ? 1.6097 1.6618 1.4531 -0.2724 0.3556  -0.0960 169 GLY A C   
1298 O O   . GLY A 169 ? 1.3376 1.3787 1.1746 -0.2774 0.3571  -0.0991 169 GLY A O   
1299 N N   . ILE A 170 ? 1.8394 1.9045 1.6953 -0.2660 0.3567  -0.0916 170 ILE A N   
1300 C CA  . ILE A 170 ? 1.8553 1.9186 1.7166 -0.2665 0.3608  -0.0928 170 ILE A CA  
1301 C C   . ILE A 170 ? 1.9701 2.0350 1.8385 -0.2657 0.3646  -0.0966 170 ILE A C   
1302 O O   . ILE A 170 ? 1.7347 1.8168 1.6146 -0.2575 0.3629  -0.0890 170 ILE A O   
1303 C CB  . ILE A 170 ? 1.5753 1.6559 1.4478 -0.2579 0.3584  -0.0805 170 ILE A CB  
1304 C CG1 . ILE A 170 ? 1.3276 1.4110 1.1958 -0.2567 0.3540  -0.0743 170 ILE A CG1 
1305 C CG2 . ILE A 170 ? 1.4076 1.4839 1.2840 -0.2597 0.3629  -0.0828 170 ILE A CG2 
1306 C CD1 . ILE A 170 ? 1.1803 1.2827 1.0606 -0.2474 0.3511  -0.0610 170 ILE A CD1 
1307 N N   . SER A 171 ? 2.3088 2.3562 2.1708 -0.2739 0.3697  -0.1081 171 SER A N   
1308 C CA  . SER A 171 ? 2.4308 2.4802 2.3001 -0.2729 0.3734  -0.1114 171 SER A CA  
1309 C C   . SER A 171 ? 2.3050 2.3506 2.1786 -0.2741 0.3777  -0.1134 171 SER A C   
1310 O O   . SER A 171 ? 2.0888 2.1438 1.9688 -0.2693 0.3766  -0.1053 171 SER A O   
1311 C CB  . SER A 171 ? 2.5093 2.5451 2.3709 -0.2797 0.3758  -0.1225 171 SER A CB  
1312 O OG  . SER A 171 ? 2.4950 2.5087 2.3457 -0.2900 0.3803  -0.1344 171 SER A OG  
1313 N N   . ALA A 172 ? 2.3151 2.3477 2.1859 -0.2802 0.3827  -0.1237 172 ALA A N   
1314 C CA  . ALA A 172 ? 2.1880 2.2138 2.0613 -0.2827 0.3875  -0.1276 172 ALA A CA  
1315 C C   . ALA A 172 ? 1.9524 1.9534 1.8114 -0.2942 0.3914  -0.1405 172 ALA A C   
1316 O O   . ALA A 172 ? 2.1558 2.1445 2.0067 -0.3004 0.3928  -0.1494 172 ALA A O   
1317 C CB  . ALA A 172 ? 2.3508 2.3829 2.2340 -0.2797 0.3903  -0.1285 172 ALA A CB  
1318 N N   . GLY A 173 ? 1.5116 1.5051 1.3672 -0.2971 0.3930  -0.1414 173 GLY A N   
1319 C CA  . GLY A 173 ? 1.3159 1.2861 1.1576 -0.3078 0.3965  -0.1531 173 GLY A CA  
1320 C C   . GLY A 173 ? 1.2685 1.2299 1.0977 -0.3124 0.3935  -0.1555 173 GLY A C   
1321 O O   . GLY A 173 ? 1.2781 1.2208 1.0952 -0.3210 0.3956  -0.1642 173 GLY A O   
1322 N N   . TYR A 174 ? 1.2878 1.2627 1.1200 -0.3067 0.3884  -0.1480 174 TYR A N   
1323 C CA  . TYR A 174 ? 1.4333 1.4012 1.2543 -0.3105 0.3852  -0.1495 174 TYR A CA  
1324 C C   . TYR A 174 ? 1.3889 1.3762 1.2161 -0.3017 0.3791  -0.1370 174 TYR A C   
1325 O O   . TYR A 174 ? 1.3763 1.3815 1.2153 -0.2934 0.3772  -0.1291 174 TYR A O   
1326 C CB  . TYR A 174 ? 1.7267 1.6827 1.5399 -0.3166 0.3865  -0.1590 174 TYR A CB  
1327 C CG  . TYR A 174 ? 2.1237 2.0600 1.9305 -0.3257 0.3924  -0.1720 174 TYR A CG  
1328 C CD1 . TYR A 174 ? 2.3348 2.2495 2.1270 -0.3358 0.3944  -0.1822 174 TYR A CD1 
1329 C CD2 . TYR A 174 ? 2.2538 2.1933 2.0691 -0.3240 0.3959  -0.1742 174 TYR A CD2 
1330 C CE1 . TYR A 174 ? 2.3980 2.2948 2.1844 -0.3440 0.3998  -0.1940 174 TYR A CE1 
1331 C CE2 . TYR A 174 ? 2.3117 2.2334 2.1212 -0.3322 0.4013  -0.1860 174 TYR A CE2 
1332 C CZ  . TYR A 174 ? 2.2817 2.1821 2.0769 -0.3422 0.4032  -0.1959 174 TYR A CZ  
1333 O OH  . TYR A 174 ? 2.1102 1.9929 1.9000 -0.3503 0.4086  -0.2076 174 TYR A OH  
1334 N N   . ALA A 175 ? 1.4372 1.4203 1.2560 -0.3039 0.3760  -0.1355 175 ALA A N   
1335 C CA  . ALA A 175 ? 1.4658 1.4641 1.2876 -0.2971 0.3701  -0.1252 175 ALA A CA  
1336 C C   . ALA A 175 ? 1.3126 1.2986 1.1213 -0.3034 0.3683  -0.1310 175 ALA A C   
1337 O O   . ALA A 175 ? 1.1587 1.1249 0.9563 -0.3128 0.3716  -0.1423 175 ALA A O   
1338 C CB  . ALA A 175 ? 1.6265 1.6331 1.4516 -0.2929 0.3676  -0.1162 175 ALA A CB  
1339 N N   . THR A 176 ? 1.3074 1.3049 1.1174 -0.2984 0.3631  -0.1235 176 THR A N   
1340 C CA  . THR A 176 ? 1.1792 1.1653 0.9768 -0.3042 0.3611  -0.1285 176 THR A CA  
1341 C C   . THR A 176 ? 1.0598 1.0567 0.8574 -0.2993 0.3555  -0.1189 176 THR A C   
1342 O O   . THR A 176 ? 1.0435 1.0600 0.8520 -0.2899 0.3520  -0.1082 176 THR A O   
1343 C CB  . THR A 176 ? 1.0683 1.0528 0.8647 -0.3055 0.3613  -0.1332 176 THR A CB  
1344 O OG1 . THR A 176 ? 1.0224 0.9934 0.8057 -0.3123 0.3599  -0.1391 176 THR A OG1 
1345 C CG2 . THR A 176 ? 1.0938 1.1011 0.9024 -0.2949 0.3572  -0.1224 176 THR A CG2 
1346 N N   . ASP A 177 ? 1.0122 0.9958 0.7974 -0.3057 0.3545  -0.1230 177 ASP A N   
1347 C CA  . ASP A 177 ? 1.0033 0.9948 0.7867 -0.3022 0.3490  -0.1153 177 ASP A CA  
1348 C C   . ASP A 177 ? 1.0609 1.0357 0.8297 -0.3105 0.3484  -0.1233 177 ASP A C   
1349 O O   . ASP A 177 ? 1.2570 1.2136 1.0145 -0.3191 0.3508  -0.1312 177 ASP A O   
1350 C CB  . ASP A 177 ? 1.0058 1.0015 0.7908 -0.2999 0.3477  -0.1088 177 ASP A CB  
1351 C CG  . ASP A 177 ? 1.0859 1.1049 0.8863 -0.2887 0.3451  -0.0960 177 ASP A CG  
1352 O OD1 . ASP A 177 ? 1.1024 1.1355 0.9073 -0.2822 0.3404  -0.0878 177 ASP A OD1 
1353 O OD2 . ASP A 177 ? 1.0898 1.1129 0.8978 -0.2864 0.3477  -0.0941 177 ASP A OD2 
1354 N N   . ILE A 178 ? 1.0211 1.0021 0.7903 -0.3080 0.3453  -0.1212 178 ILE A N   
1355 C CA  . ILE A 178 ? 1.0467 1.0138 0.8031 -0.3151 0.3442  -0.1279 178 ILE A CA  
1356 C C   . ILE A 178 ? 1.0303 1.0110 0.7887 -0.3089 0.3382  -0.1183 178 ILE A C   
1357 O O   . ILE A 178 ? 0.9974 0.9956 0.7660 -0.3006 0.3357  -0.1107 178 ILE A O   
1358 C CB  . ILE A 178 ? 1.1242 1.0858 0.8795 -0.3182 0.3464  -0.1353 178 ILE A CB  
1359 C CG1 . ILE A 178 ? 1.3697 1.3181 1.1235 -0.3242 0.3524  -0.1449 178 ILE A CG1 
1360 C CG2 . ILE A 178 ? 1.1352 1.0849 0.8785 -0.3244 0.3446  -0.1407 178 ILE A CG2 
1361 C CD1 . ILE A 178 ? 1.4879 1.4312 1.2413 -0.3272 0.3547  -0.1521 178 ILE A CD1 
1362 N N   . PRO A 179 ? 1.0528 1.0259 0.8017 -0.3126 0.3359  -0.1184 179 PRO A N   
1363 C CA  . PRO A 179 ? 1.0348 1.0224 0.7869 -0.3059 0.3301  -0.1085 179 PRO A CA  
1364 C C   . PRO A 179 ? 1.0382 1.0223 0.7848 -0.3080 0.3282  -0.1117 179 PRO A C   
1365 O O   . PRO A 179 ? 1.0588 1.0275 0.7976 -0.3156 0.3313  -0.1220 179 PRO A O   
1366 C CB  . PRO A 179 ? 1.0594 1.0392 0.8032 -0.3095 0.3286  -0.1078 179 PRO A CB  
1367 C CG  . PRO A 179 ? 1.0990 1.0546 0.8296 -0.3211 0.3330  -0.1208 179 PRO A CG  
1368 C CD  . PRO A 179 ? 1.0924 1.0457 0.8284 -0.3220 0.3380  -0.1261 179 PRO A CD  
1369 N N   . PRO A 180 ? 1.0187 1.0170 0.7693 -0.3013 0.3231  -0.1030 180 PRO A N   
1370 C CA  . PRO A 180 ? 1.4552 1.4533 1.2019 -0.3019 0.3206  -0.1042 180 PRO A CA  
1371 C C   . PRO A 180 ? 1.4442 1.4251 1.1761 -0.3104 0.3196  -0.1102 180 PRO A C   
1372 O O   . PRO A 180 ? 1.4083 1.3837 1.1350 -0.3129 0.3190  -0.1095 180 PRO A O   
1373 C CB  . PRO A 180 ? 1.5214 1.5416 1.2783 -0.2910 0.3153  -0.0913 180 PRO A CB  
1374 C CG  . PRO A 180 ? 1.4771 1.5085 1.2429 -0.2851 0.3151  -0.0835 180 PRO A CG  
1375 C CD  . PRO A 180 ? 0.9978 1.0130 0.7567 -0.2928 0.3193  -0.0910 180 PRO A CD  
1376 N N   . HIS A 181 ? 1.4849 1.4582 1.2104 -0.3145 0.3193  -0.1157 181 HIS A N   
1377 C CA  . HIS A 181 ? 1.4161 1.3735 1.1278 -0.3225 0.3183  -0.1213 181 HIS A CA  
1378 C C   . HIS A 181 ? 1.4294 1.3936 1.1410 -0.3196 0.3143  -0.1182 181 HIS A C   
1379 O O   . HIS A 181 ? 1.5156 1.4930 1.2363 -0.3133 0.3135  -0.1144 181 HIS A O   
1380 C CB  . HIS A 181 ? 1.2680 1.2028 0.9692 -0.3336 0.3233  -0.1347 181 HIS A CB  
1381 C CG  . HIS A 181 ? 1.1970 1.1229 0.8970 -0.3373 0.3275  -0.1389 181 HIS A CG  
1382 N ND1 . HIS A 181 ? 1.2292 1.1628 0.9394 -0.3334 0.3305  -0.1379 181 HIS A ND1 
1383 C CD2 . HIS A 181 ? 1.2214 1.1313 0.9113 -0.3447 0.3293  -0.1444 181 HIS A CD2 
1384 C CE1 . HIS A 181 ? 1.3309 1.2535 1.0373 -0.3382 0.3340  -0.1426 181 HIS A CE1 
1385 N NE2 . HIS A 181 ? 1.3364 1.2446 1.0305 -0.3451 0.3333  -0.1466 181 HIS A NE2 
1386 N N   . ASN A 182 ? 1.3246 1.2791 1.0255 -0.3245 0.3120  -0.1201 182 ASN A N   
1394 N N   . LEU A 183 ? 2.4561 1.5506 1.3172 -0.0942 -0.4605 -0.5979 183 LEU A N   
1395 C CA  . LEU A 183 ? 2.4525 1.5465 1.3117 -0.0917 -0.4560 -0.5987 183 LEU A CA  
1396 C C   . LEU A 183 ? 2.4793 1.5729 1.3357 -0.0924 -0.4553 -0.5994 183 LEU A C   
1397 O O   . LEU A 183 ? 2.5417 1.6349 1.3979 -0.0929 -0.4538 -0.6013 183 LEU A O   
1398 C CB  . LEU A 183 ? 2.4274 1.5215 1.2849 -0.0877 -0.4527 -0.5969 183 LEU A CB  
1399 C CG  . LEU A 183 ? 2.5663 1.6601 1.4222 -0.0841 -0.4477 -0.5971 183 LEU A CG  
1400 C CD1 . LEU A 183 ? 2.4872 1.5807 1.3394 -0.0825 -0.4453 -0.5965 183 LEU A CD1 
1401 C CD2 . LEU A 183 ? 2.7941 1.8876 1.6517 -0.0846 -0.4463 -0.5994 183 LEU A CD2 
1402 N N   . ALA A 184 ? 2.4905 1.5842 1.3448 -0.0924 -0.4564 -0.5979 184 ALA A N   
1403 C CA  . ALA A 184 ? 2.5518 1.6450 1.4033 -0.0930 -0.4559 -0.5984 184 ALA A CA  
1404 C C   . ALA A 184 ? 2.6292 1.7221 1.4821 -0.0967 -0.4586 -0.6004 184 ALA A C   
1405 O O   . ALA A 184 ? 2.6587 1.7511 1.5103 -0.0970 -0.4570 -0.6019 184 ALA A O   
1406 C CB  . ALA A 184 ? 2.6348 1.7281 1.4840 -0.0927 -0.4572 -0.5964 184 ALA A CB  
1407 N N   . GLU A 185 ? 2.5624 1.6557 1.4182 -0.0994 -0.4628 -0.6005 185 GLU A N   
1408 C CA  . GLU A 185 ? 2.6733 1.7664 1.5307 -0.1029 -0.4656 -0.6024 185 GLU A CA  
1409 C C   . GLU A 185 ? 2.5637 1.6566 1.4225 -0.1031 -0.4637 -0.6047 185 GLU A C   
1410 O O   . GLU A 185 ? 2.5933 1.6858 1.4513 -0.1044 -0.4633 -0.6063 185 GLU A O   
1411 C CB  . GLU A 185 ? 2.9253 2.0189 1.7856 -0.1058 -0.4705 -0.6020 185 GLU A CB  
1412 C CG  . GLU A 185 ? 3.0060 2.0998 1.8650 -0.1065 -0.4731 -0.6002 185 GLU A CG  
1413 C CD  . GLU A 185 ? 2.8550 1.9494 1.7171 -0.1091 -0.4778 -0.5996 185 GLU A CD  
1414 O OE1 . GLU A 185 ? 2.7358 1.8303 1.6009 -0.1109 -0.4795 -0.6008 185 GLU A OE1 
1415 O OE2 . GLU A 185 ? 2.7788 1.8737 1.6401 -0.1094 -0.4798 -0.5979 185 GLU A OE2 
1416 N N   . VAL A 186 ? 2.6138 1.7070 1.4747 -0.1017 -0.4624 -0.6048 186 VAL A N   
1417 C CA  . VAL A 186 ? 2.8265 1.9196 1.6887 -0.1017 -0.4605 -0.6069 186 VAL A CA  
1418 C C   . VAL A 186 ? 2.6799 1.7727 1.5394 -0.0998 -0.4563 -0.6078 186 VAL A C   
1419 O O   . VAL A 186 ? 2.6704 1.7631 1.5304 -0.1008 -0.4554 -0.6099 186 VAL A O   
1420 C CB  . VAL A 186 ? 3.2334 2.3268 2.0980 -0.1001 -0.4595 -0.6067 186 VAL A CB  
1421 C CG1 . VAL A 186 ? 3.5505 2.6438 2.4162 -0.0997 -0.4570 -0.6089 186 VAL A CG1 
1422 C CG2 . VAL A 186 ? 3.2527 2.3463 2.1204 -0.1023 -0.4638 -0.6062 186 VAL A CG2 
1423 N N   . ILE A 187 ? 2.5335 1.6261 1.3901 -0.0969 -0.4536 -0.6061 187 ILE A N   
1424 C CA  . ILE A 187 ? 2.5380 1.6303 1.3918 -0.0948 -0.4495 -0.6067 187 ILE A CA  
1425 C C   . ILE A 187 ? 2.5707 1.6624 1.4223 -0.0968 -0.4503 -0.6075 187 ILE A C   
1426 O O   . ILE A 187 ? 2.5825 1.6740 1.4331 -0.0967 -0.4479 -0.6092 187 ILE A O   
1427 C CB  . ILE A 187 ? 2.5969 1.6891 1.4484 -0.0910 -0.4464 -0.6045 187 ILE A CB  
1428 C CG1 . ILE A 187 ? 2.8806 1.9731 1.7338 -0.0886 -0.4441 -0.6044 187 ILE A CG1 
1429 C CG2 . ILE A 187 ? 2.5289 1.6206 1.3769 -0.0892 -0.4429 -0.6046 187 ILE A CG2 
1430 C CD1 . ILE A 187 ? 3.1379 2.2303 1.9890 -0.0849 -0.4412 -0.6023 187 ILE A CD1 
1431 N N   . ASP A 188 ? 2.5856 1.6772 1.4367 -0.0986 -0.4537 -0.6065 188 ASP A N   
1432 C CA  . ASP A 188 ? 2.6174 1.7085 1.4667 -0.1008 -0.4551 -0.6073 188 ASP A CA  
1433 C C   . ASP A 188 ? 2.6333 1.7243 1.4846 -0.1035 -0.4562 -0.6099 188 ASP A C   
1434 O O   . ASP A 188 ? 2.6526 1.7432 1.5022 -0.1040 -0.4547 -0.6114 188 ASP A O   
1435 C CB  . ASP A 188 ? 2.7742 1.8652 1.6231 -0.1024 -0.4590 -0.6058 188 ASP A CB  
1436 C CG  . ASP A 188 ? 2.8620 1.9530 1.7081 -0.0997 -0.4575 -0.6033 188 ASP A CG  
1437 O OD1 . ASP A 188 ? 2.7597 1.8503 1.6034 -0.0968 -0.4534 -0.6031 188 ASP A OD1 
1438 O OD2 . ASP A 188 ? 3.0263 2.1176 1.8726 -0.1004 -0.4604 -0.6017 188 ASP A OD2 
1439 N N   . ALA A 189 ? 2.6247 1.7162 1.4795 -0.1052 -0.4588 -0.6105 189 ALA A N   
1440 C CA  . ALA A 189 ? 2.6369 1.7286 1.4941 -0.1077 -0.4599 -0.6130 189 ALA A CA  
1441 C C   . ALA A 189 ? 2.6311 1.7228 1.4879 -0.1061 -0.4557 -0.6147 189 ALA A C   
1442 O O   . ALA A 189 ? 2.6514 1.7430 1.5079 -0.1076 -0.4552 -0.6168 189 ALA A O   
1443 C CB  . ALA A 189 ? 3.7246 2.8167 2.5856 -0.1095 -0.4634 -0.6131 189 ALA A CB  
1444 N N   . ALA A 190 ? 2.6036 1.6956 1.4605 -0.1030 -0.4527 -0.6140 190 ALA A N   
1445 C CA  . ALA A 190 ? 2.5962 1.6884 1.4531 -0.1014 -0.4487 -0.6156 190 ALA A CA  
1446 C C   . ALA A 190 ? 2.6146 1.7063 1.4680 -0.1006 -0.4459 -0.6161 190 ALA A C   
1447 O O   . ALA A 190 ? 2.6259 1.7177 1.4792 -0.1012 -0.4441 -0.6182 190 ALA A O   
1448 C CB  . ALA A 190 ? 2.8499 1.9424 1.7074 -0.0981 -0.4460 -0.6144 190 ALA A CB  
1449 N N   . VAL A 191 ? 2.6174 1.7087 1.4680 -0.0993 -0.4456 -0.6141 191 VAL A N   
1450 C CA  . VAL A 191 ? 2.6347 1.7253 1.4817 -0.0985 -0.4430 -0.6143 191 VAL A CA  
1451 C C   . VAL A 191 ? 2.6965 1.7868 1.5431 -0.1017 -0.4450 -0.6161 191 VAL A C   
1452 O O   . VAL A 191 ? 2.7537 1.8437 1.5986 -0.1016 -0.4426 -0.6176 191 VAL A O   
1453 C CB  . VAL A 191 ? 2.6317 1.7218 1.4757 -0.0965 -0.4425 -0.6118 191 VAL A CB  
1454 C CG1 . VAL A 191 ? 2.6566 1.7459 1.4969 -0.0964 -0.4409 -0.6121 191 VAL A CG1 
1455 C CG2 . VAL A 191 ? 3.0576 2.1479 1.9014 -0.0928 -0.4393 -0.6104 191 VAL A CG2 
1456 N N   . TYR A 192 ? 2.8383 1.9285 1.6863 -0.1045 -0.4494 -0.6159 192 TYR A N   
1457 C CA  . TYR A 192 ? 3.3891 2.4789 2.2366 -0.1076 -0.4515 -0.6176 192 TYR A CA  
1458 C C   . TYR A 192 ? 3.3961 2.4864 2.2457 -0.1088 -0.4505 -0.6204 192 TYR A C   
1459 O O   . TYR A 192 ? 3.4948 2.5848 2.3429 -0.1096 -0.4491 -0.6221 192 TYR A O   
1460 C CB  . TYR A 192 ? 3.9212 3.0109 2.7702 -0.1105 -0.4566 -0.6170 192 TYR A CB  
1461 C CG  . TYR A 192 ? 4.1964 3.2856 3.0447 -0.1136 -0.4588 -0.6185 192 TYR A CG  
1462 C CD1 . TYR A 192 ? 4.1598 3.2492 3.0107 -0.1163 -0.4610 -0.6206 192 TYR A CD1 
1463 C CD2 . TYR A 192 ? 4.1902 3.2784 3.0349 -0.1137 -0.4588 -0.6179 192 TYR A CD2 
1464 C CE1 . TYR A 192 ? 3.9236 3.0125 2.7739 -0.1191 -0.4631 -0.6221 192 TYR A CE1 
1465 C CE2 . TYR A 192 ? 3.9585 3.0461 2.8024 -0.1165 -0.4609 -0.6193 192 TYR A CE2 
1466 C CZ  . TYR A 192 ? 3.6787 2.7667 2.5255 -0.1192 -0.4630 -0.6214 192 TYR A CZ  
1467 O OH  . TYR A 192 ? 3.3096 2.3969 2.1554 -0.1220 -0.4651 -0.6228 192 TYR A OH  
1468 N N   . MET A 193 ? 3.2205 2.3115 2.0735 -0.1089 -0.4511 -0.6208 193 MET A N   
1469 C CA  . MET A 193 ? 3.0412 2.1328 1.8964 -0.1099 -0.4503 -0.6234 193 MET A CA  
1470 C C   . MET A 193 ? 2.6940 1.7858 1.5478 -0.1077 -0.4454 -0.6246 193 MET A C   
1471 O O   . MET A 193 ? 2.7839 1.8760 1.6384 -0.1089 -0.4444 -0.6270 193 MET A O   
1472 C CB  . MET A 193 ? 2.9213 2.0135 1.7803 -0.1101 -0.4520 -0.6233 193 MET A CB  
1473 C CG  . MET A 193 ? 2.8868 1.9797 1.7485 -0.1112 -0.4514 -0.6259 193 MET A CG  
1474 S SD  . MET A 193 ? 2.7878 1.8810 1.6537 -0.1135 -0.4560 -0.6260 193 MET A SD  
1475 C CE  . MET A 193 ? 2.7006 1.7946 1.5690 -0.1128 -0.4533 -0.6285 193 MET A CE  
1476 N N   . ILE A 194 ? 2.6765 1.7681 1.5283 -0.1045 -0.4423 -0.6229 194 ILE A N   
1477 C CA  . ILE A 194 ? 2.6729 1.7647 1.5233 -0.1024 -0.4378 -0.6239 194 ILE A CA  
1478 C C   . ILE A 194 ? 2.7047 1.7959 1.5523 -0.1038 -0.4371 -0.6252 194 ILE A C   
1479 O O   . ILE A 194 ? 2.7125 1.8041 1.5600 -0.1038 -0.4346 -0.6272 194 ILE A O   
1480 C CB  . ILE A 194 ? 3.4141 2.5057 2.2626 -0.0985 -0.4347 -0.6217 194 ILE A CB  
1481 C CG1 . ILE A 194 ? 3.6015 2.6937 2.4528 -0.0970 -0.4348 -0.6208 194 ILE A CG1 
1482 C CG2 . ILE A 194 ? 3.9725 3.0641 2.8187 -0.0964 -0.4299 -0.6225 194 ILE A CG2 
1483 C CD1 . ILE A 194 ? 3.8138 2.9058 2.6635 -0.0935 -0.4325 -0.6184 194 ILE A CD1 
1484 N N   . ASP A 195 ? 2.7230 1.8134 1.5685 -0.1049 -0.4395 -0.6239 195 ASP A N   
1485 C CA  . ASP A 195 ? 2.8033 1.8929 1.6458 -0.1062 -0.4391 -0.6248 195 ASP A CA  
1486 C C   . ASP A 195 ? 2.9317 2.0214 1.7758 -0.1099 -0.4419 -0.6271 195 ASP A C   
1487 O O   . ASP A 195 ? 2.9933 2.0828 1.8361 -0.1110 -0.4407 -0.6289 195 ASP A O   
1488 C CB  . ASP A 195 ? 2.9153 2.0039 1.7549 -0.1058 -0.4405 -0.6225 195 ASP A CB  
1489 C CG  . ASP A 195 ? 2.9763 2.0644 1.8130 -0.1022 -0.4369 -0.6207 195 ASP A CG  
1490 O OD1 . ASP A 195 ? 2.8491 1.9374 1.6850 -0.1005 -0.4330 -0.6216 195 ASP A OD1 
1491 O OD2 . ASP A 195 ? 3.0151 2.1027 1.8503 -0.1012 -0.4380 -0.6183 195 ASP A OD2 
1492 N N   . HIS A 196 ? 2.9259 2.0160 1.7729 -0.1117 -0.4457 -0.6269 196 HIS A N   
1493 C CA  . HIS A 196 ? 3.2128 2.3030 2.0616 -0.1152 -0.4490 -0.6287 196 HIS A CA  
1494 C C   . HIS A 196 ? 3.2429 2.3341 2.0959 -0.1160 -0.4502 -0.6299 196 HIS A C   
1495 O O   . HIS A 196 ? 3.4333 2.5245 2.2885 -0.1173 -0.4538 -0.6290 196 HIS A O   
1496 C CB  . HIS A 196 ? 3.3745 2.4638 2.2225 -0.1171 -0.4532 -0.6272 196 HIS A CB  
1497 C CG  . HIS A 196 ? 3.2124 2.3007 2.0563 -0.1163 -0.4524 -0.6259 196 HIS A CG  
1498 N ND1 . HIS A 196 ? 3.0692 2.1571 1.9113 -0.1138 -0.4514 -0.6234 196 HIS A ND1 
1499 C CD2 . HIS A 196 ? 3.0552 2.1426 1.8965 -0.1177 -0.4524 -0.6269 196 HIS A CD2 
1500 C CE1 . HIS A 196 ? 2.9872 2.0741 1.8256 -0.1136 -0.4509 -0.6228 196 HIS A CE1 
1501 N NE2 . HIS A 196 ? 2.9579 2.0444 1.7958 -0.1159 -0.4514 -0.6249 196 HIS A NE2 
1502 N N   . PRO A 197 ? 3.0142 2.1062 1.8684 -0.1154 -0.4473 -0.6319 197 PRO A N   
1503 C CA  . PRO A 197 ? 2.9171 2.0100 1.7751 -0.1155 -0.4476 -0.6330 197 PRO A CA  
1504 C C   . PRO A 197 ? 2.9722 2.0653 1.8331 -0.1189 -0.4520 -0.6341 197 PRO A C   
1505 O O   . PRO A 197 ? 3.0136 2.1071 1.8775 -0.1191 -0.4539 -0.6338 197 PRO A O   
1506 C CB  . PRO A 197 ? 2.7560 1.8496 1.6140 -0.1147 -0.4437 -0.6353 197 PRO A CB  
1507 C CG  . PRO A 197 ? 2.7652 1.8583 1.6193 -0.1130 -0.4405 -0.6347 197 PRO A CG  
1508 C CD  . PRO A 197 ? 2.7854 1.8774 1.6372 -0.1144 -0.4434 -0.6333 197 PRO A CD  
1509 N N   . THR A 198 ? 3.0397 2.1323 1.8994 -0.1214 -0.4538 -0.6353 198 THR A N   
1510 C CA  . THR A 198 ? 3.0105 2.1032 1.8727 -0.1247 -0.4580 -0.6365 198 THR A CA  
1511 C C   . THR A 198 ? 2.9852 2.0772 1.8475 -0.1261 -0.4623 -0.6344 198 THR A C   
1512 O O   . THR A 198 ? 3.0504 2.1422 1.9137 -0.1290 -0.4659 -0.6352 198 THR A O   
1513 C CB  . THR A 198 ? 3.0626 2.1552 1.9236 -0.1270 -0.4580 -0.6388 198 THR A CB  
1514 O OG1 . THR A 198 ? 3.2946 2.3862 2.1517 -0.1266 -0.4575 -0.6376 198 THR A OG1 
1515 C CG2 . THR A 198 ? 2.9332 2.0267 1.7944 -0.1261 -0.4540 -0.6412 198 THR A CG2 
1516 N N   . ALA A 199 ? 3.0086 2.1003 1.8699 -0.1239 -0.4619 -0.6318 199 ALA A N   
1517 C CA  . ALA A 199 ? 2.9661 2.0572 1.8271 -0.1250 -0.4658 -0.6297 199 ALA A CA  
1518 C C   . ALA A 199 ? 2.9264 2.0178 1.7911 -0.1273 -0.4701 -0.6299 199 ALA A C   
1519 O O   . ALA A 199 ? 2.8405 1.9326 1.7081 -0.1269 -0.4698 -0.6305 199 ALA A O   
1520 C CB  . ALA A 199 ? 3.1304 2.2214 1.9898 -0.1222 -0.4643 -0.6270 199 ALA A CB  
1521 N N   . LYS A 200 ? 3.0022 2.0931 1.8669 -0.1297 -0.4742 -0.6292 200 LYS A N   
1522 C CA  . LYS A 200 ? 2.9368 2.0279 1.8049 -0.1321 -0.4786 -0.6293 200 LYS A CA  
1523 C C   . LYS A 200 ? 2.8200 1.9111 1.6889 -0.1311 -0.4805 -0.6266 200 LYS A C   
1524 O O   . LYS A 200 ? 2.8178 1.9086 1.6841 -0.1294 -0.4794 -0.6247 200 LYS A O   
1525 C CB  . LYS A 200 ? 2.9006 1.9911 1.7683 -0.1353 -0.4821 -0.6302 200 LYS A CB  
1526 N N   . ILE A 201 ? 3.0609 2.1523 1.9333 -0.1323 -0.4833 -0.6265 201 ILE A N   
1527 C CA  . ILE A 201 ? 3.3350 2.4266 2.2084 -0.1316 -0.4853 -0.6240 201 ILE A CA  
1528 C C   . ILE A 201 ? 3.1982 2.2893 2.0696 -0.1323 -0.4876 -0.6221 201 ILE A C   
1529 O O   . ILE A 201 ? 3.0594 2.1506 1.9294 -0.1302 -0.4866 -0.6200 201 ILE A O   
1530 C CB  . ILE A 201 ? 3.6412 2.7331 2.5187 -0.1334 -0.4888 -0.6242 201 ILE A CB  
1531 C CG1 . ILE A 201 ? 3.4064 2.4988 2.2858 -0.1317 -0.4862 -0.6252 201 ILE A CG1 
1532 C CG2 . ILE A 201 ? 3.9536 3.0456 2.8320 -0.1333 -0.4916 -0.6217 201 ILE A CG2 
1533 C CD1 . ILE A 201 ? 3.2253 2.3178 2.1051 -0.1323 -0.4844 -0.6280 201 ILE A CD1 
1534 N N   . ASP A 202 ? 3.2622 2.3528 2.1335 -0.1351 -0.4909 -0.6229 202 ASP A N   
1535 C CA  . ASP A 202 ? 3.4107 2.5009 2.2802 -0.1360 -0.4934 -0.6212 202 ASP A CA  
1536 C C   . ASP A 202 ? 3.1893 2.2792 2.0550 -0.1333 -0.4900 -0.6198 202 ASP A C   
1537 O O   . ASP A 202 ? 3.1173 2.2072 1.9820 -0.1325 -0.4911 -0.6176 202 ASP A O   
1538 C CB  . ASP A 202 ? 3.7771 2.8667 2.6460 -0.1390 -0.4961 -0.6226 202 ASP A CB  
1539 C CG  . ASP A 202 ? 3.8881 2.9777 2.7606 -0.1421 -0.5008 -0.6233 202 ASP A CG  
1540 O OD1 . ASP A 202 ? 3.9077 2.9979 2.7829 -0.1421 -0.5024 -0.6224 202 ASP A OD1 
1541 O OD2 . ASP A 202 ? 3.8763 2.9655 2.7488 -0.1447 -0.5029 -0.6248 202 ASP A OD2 
1542 N N   . LYS A 203 ? 2.8205 1.9102 1.6841 -0.1318 -0.4859 -0.6210 203 LYS A N   
1543 C CA  . LYS A 203 ? 2.8185 1.9079 1.6784 -0.1292 -0.4825 -0.6199 203 LYS A CA  
1544 C C   . LYS A 203 ? 2.8177 1.9077 1.6778 -0.1259 -0.4798 -0.6183 203 LYS A C   
1545 O O   . LYS A 203 ? 2.7773 1.8671 1.6353 -0.1241 -0.4789 -0.6163 203 LYS A O   
1546 C CB  . LYS A 203 ? 2.8345 1.9235 1.6922 -0.1288 -0.4791 -0.6219 203 LYS A CB  
1547 C CG  . LYS A 203 ? 2.8314 1.9199 1.6853 -0.1259 -0.4751 -0.6210 203 LYS A CG  
1548 C CD  . LYS A 203 ? 2.8724 1.9601 1.7234 -0.1264 -0.4768 -0.6194 203 LYS A CD  
1549 C CE  . LYS A 203 ? 3.0922 2.1794 1.9394 -0.1234 -0.4728 -0.6184 203 LYS A CE  
1550 N NZ  . LYS A 203 ? 3.2022 2.2884 2.0462 -0.1239 -0.4742 -0.6172 203 LYS A NZ  
1551 N N   . LEU A 204 ? 2.7642 1.8547 1.6268 -0.1252 -0.4784 -0.6192 204 LEU A N   
1552 C CA  . LEU A 204 ? 2.8037 1.8947 1.6669 -0.1223 -0.4762 -0.6177 204 LEU A CA  
1553 C C   . LEU A 204 ? 2.7208 1.8120 1.5848 -0.1225 -0.4792 -0.6153 204 LEU A C   
1554 O O   . LEU A 204 ? 2.7024 1.7938 1.5651 -0.1199 -0.4775 -0.6135 204 LEU A O   
1555 C CB  . LEU A 204 ? 3.2157 2.3073 2.0819 -0.1219 -0.4749 -0.6191 204 LEU A CB  
1556 C CG  . LEU A 204 ? 3.7214 2.8130 2.5867 -0.1213 -0.4713 -0.6214 204 LEU A CG  
1557 C CD1 . LEU A 204 ? 3.8637 2.9559 2.7322 -0.1218 -0.4711 -0.6232 204 LEU A CD1 
1558 C CD2 . LEU A 204 ? 3.9235 3.0150 2.7858 -0.1179 -0.4666 -0.6206 204 LEU A CD2 
1559 N N   . MET A 205 ? 2.7334 1.8247 1.5996 -0.1255 -0.4839 -0.6154 205 MET A N   
1560 C CA  . MET A 205 ? 2.7235 1.8151 1.5908 -0.1259 -0.4870 -0.6133 205 MET A CA  
1561 C C   . MET A 205 ? 2.7340 1.8253 1.5982 -0.1253 -0.4874 -0.6115 205 MET A C   
1562 O O   . MET A 205 ? 2.7626 1.8543 1.6274 -0.1254 -0.4897 -0.6096 205 MET A O   
1563 C CB  . MET A 205 ? 2.8579 1.9497 1.7287 -0.1292 -0.4919 -0.6138 205 MET A CB  
1564 C CG  . MET A 205 ? 2.9517 2.0438 1.8258 -0.1294 -0.4917 -0.6151 205 MET A CG  
1565 S SD  . MET A 205 ? 4.6058 3.6980 3.4840 -0.1332 -0.4974 -0.6158 205 MET A SD  
1566 C CE  . MET A 205 ? 2.9775 2.0700 1.8559 -0.1337 -0.5008 -0.6130 205 MET A CE  
1567 N N   . GLU A 206 ? 2.7519 1.8426 1.6129 -0.1247 -0.4852 -0.6120 206 GLU A N   
1568 C CA  . GLU A 206 ? 2.8378 1.9281 1.6955 -0.1238 -0.4851 -0.6103 206 GLU A CA  
1569 C C   . GLU A 206 ? 2.8359 1.9266 1.6922 -0.1200 -0.4814 -0.6087 206 GLU A C   
1570 O O   . GLU A 206 ? 2.8882 1.9788 1.7424 -0.1188 -0.4813 -0.6068 206 GLU A O   
1571 C CB  . GLU A 206 ? 3.2052 2.2946 2.0598 -0.1244 -0.4841 -0.6114 206 GLU A CB  
1572 C CG  . GLU A 206 ? 3.6578 2.7468 2.5136 -0.1280 -0.4876 -0.6131 206 GLU A CG  
1573 C CD  . GLU A 206 ? 3.9847 3.0726 2.8371 -0.1286 -0.4869 -0.6139 206 GLU A CD  
1574 O OE1 . GLU A 206 ? 4.1297 3.2172 2.9791 -0.1263 -0.4829 -0.6139 206 GLU A OE1 
1575 O OE2 . GLU A 206 ? 4.0425 3.1299 2.8951 -0.1315 -0.4904 -0.6146 206 GLU A OE2 
1576 N N   . PHE A 207 ? 2.7135 1.8045 1.5709 -0.1183 -0.4784 -0.6094 207 PHE A N   
1577 C CA  . PHE A 207 ? 2.7016 1.7929 1.5578 -0.1147 -0.4746 -0.6081 207 PHE A CA  
1578 C C   . PHE A 207 ? 2.6985 1.7905 1.5576 -0.1140 -0.4754 -0.6072 207 PHE A C   
1579 O O   . PHE A 207 ? 2.6401 1.7325 1.4984 -0.1117 -0.4742 -0.6053 207 PHE A O   
1580 C CB  . PHE A 207 ? 2.7781 1.8691 1.6331 -0.1129 -0.4701 -0.6097 207 PHE A CB  
1581 C CG  . PHE A 207 ? 3.0708 2.1609 1.9226 -0.1133 -0.4688 -0.6106 207 PHE A CG  
1582 C CD1 . PHE A 207 ? 3.1373 2.2272 1.9898 -0.1156 -0.4694 -0.6130 207 PHE A CD1 
1583 C CD2 . PHE A 207 ? 3.3365 2.4262 2.1847 -0.1113 -0.4668 -0.6092 207 PHE A CD2 
1584 C CE1 . PHE A 207 ? 3.3194 2.4085 2.1690 -0.1160 -0.4682 -0.6139 207 PHE A CE1 
1585 C CE2 . PHE A 207 ? 3.5117 2.6005 2.3570 -0.1117 -0.4656 -0.6101 207 PHE A CE2 
1586 C CZ  . PHE A 207 ? 3.4911 2.5796 2.3370 -0.1140 -0.4663 -0.6124 207 PHE A CZ  
1587 N N   . LEU A 208 ? 2.7386 1.8308 1.6010 -0.1161 -0.4776 -0.6085 208 LEU A N   
1588 C CA  . LEU A 208 ? 3.0056 2.0985 1.8713 -0.1158 -0.4785 -0.6080 208 LEU A CA  
1589 C C   . LEU A 208 ? 2.7762 1.8693 1.6448 -0.1193 -0.4838 -0.6082 208 LEU A C   
1590 O O   . LEU A 208 ? 2.7277 1.8206 1.5986 -0.1213 -0.4853 -0.6099 208 LEU A O   
1591 C CB  . LEU A 208 ? 3.5757 2.6685 2.4428 -0.1151 -0.4759 -0.6099 208 LEU A CB  
1592 C CG  . LEU A 208 ? 3.9464 3.0396 2.8152 -0.1127 -0.4738 -0.6095 208 LEU A CG  
1593 C CD1 . LEU A 208 ? 4.3016 3.3949 3.1737 -0.1145 -0.4750 -0.6115 208 LEU A CD1 
1594 C CD2 . LEU A 208 ? 3.7828 2.8764 2.6523 -0.1117 -0.4751 -0.6072 208 LEU A CD2 
1595 N N   . PRO A 209 ? 2.6466 1.7399 1.5149 -0.1201 -0.4866 -0.6063 209 PRO A N   
1596 C CA  . PRO A 209 ? 2.6600 1.7535 1.5308 -0.1235 -0.4917 -0.6064 209 PRO A CA  
1597 C C   . PRO A 209 ? 2.6510 1.7449 1.5256 -0.1244 -0.4938 -0.6064 209 PRO A C   
1598 O O   . PRO A 209 ? 2.6894 1.7834 1.5666 -0.1274 -0.4978 -0.6070 209 PRO A O   
1599 C CB  . PRO A 209 ? 2.6647 1.7585 1.5340 -0.1235 -0.4935 -0.6043 209 PRO A CB  
1600 C CG  . PRO A 209 ? 2.6568 1.7505 1.5225 -0.1200 -0.4892 -0.6033 209 PRO A CG  
1601 C CD  . PRO A 209 ? 2.6377 1.7313 1.5035 -0.1177 -0.4851 -0.6042 209 PRO A CD  
1602 N N   . GLY A 210 ? 2.8532 1.9474 1.7283 -0.1218 -0.4910 -0.6058 210 GLY A N   
1603 C CA  . GLY A 210 ? 3.0085 2.1030 1.8871 -0.1225 -0.4928 -0.6057 210 GLY A CA  
1604 C C   . GLY A 210 ? 3.0476 2.1424 1.9259 -0.1193 -0.4902 -0.6042 210 GLY A C   
1605 O O   . GLY A 210 ? 2.7943 1.8892 1.6697 -0.1166 -0.4871 -0.6031 210 GLY A O   
1606 N N   . PRO A 211 ? 3.3489 2.4439 2.2301 -0.1196 -0.4915 -0.6041 211 PRO A N   
1607 C CA  . PRO A 211 ? 3.2515 2.3467 2.1329 -0.1168 -0.4891 -0.6028 211 PRO A CA  
1608 C C   . PRO A 211 ? 3.0290 2.1248 1.9084 -0.1154 -0.4890 -0.6005 211 PRO A C   
1609 O O   . PRO A 211 ? 3.0331 2.1292 1.9120 -0.1172 -0.4917 -0.5998 211 PRO A O   
1610 C CB  . PRO A 211 ? 3.4848 2.5801 2.3700 -0.1186 -0.4923 -0.6029 211 PRO A CB  
1611 C CG  . PRO A 211 ? 3.6897 2.7846 2.5767 -0.1218 -0.4950 -0.6049 211 PRO A CG  
1612 C CD  . PRO A 211 ? 3.6561 2.7510 2.5408 -0.1230 -0.4958 -0.6050 211 PRO A CD  
1613 N N   . ASP A 212 ? 2.9274 2.0234 1.8058 -0.1121 -0.4858 -0.5993 212 ASP A N   
1614 C CA  . ASP A 212 ? 2.9913 2.0878 1.8680 -0.1105 -0.4855 -0.5970 212 ASP A CA  
1615 C C   . ASP A 212 ? 3.2850 2.3818 2.1631 -0.1087 -0.4846 -0.5959 212 ASP A C   
1616 O O   . ASP A 212 ? 3.5552 2.6518 2.4321 -0.1055 -0.4807 -0.5957 212 ASP A O   
1617 C CB  . ASP A 212 ? 2.8358 1.9322 1.7086 -0.1079 -0.4816 -0.5966 212 ASP A CB  
1618 C CG  . ASP A 212 ? 2.4775 1.5746 1.3484 -0.1064 -0.4815 -0.5944 212 ASP A CG  
1619 O OD1 . ASP A 212 ? 2.4824 1.5802 1.3546 -0.1084 -0.4853 -0.5934 212 ASP A OD1 
1620 O OD2 . ASP A 212 ? 2.4694 1.5664 1.3374 -0.1032 -0.4777 -0.5936 212 ASP A OD2 
1621 N N   . PHE A 213 ? 3.2474 2.3446 2.1281 -0.1107 -0.4883 -0.5952 213 PHE A N   
1622 C CA  . PHE A 213 ? 3.2541 2.3515 2.1362 -0.1093 -0.4879 -0.5942 213 PHE A CA  
1623 C C   . PHE A 213 ? 3.3250 2.4230 2.2048 -0.1064 -0.4857 -0.5921 213 PHE A C   
1624 O O   . PHE A 213 ? 3.4562 2.5549 2.3344 -0.1068 -0.4868 -0.5911 213 PHE A O   
1625 C CB  . PHE A 213 ? 3.2853 2.3830 2.1708 -0.1124 -0.4927 -0.5940 213 PHE A CB  
1626 C CG  . PHE A 213 ? 3.4684 2.5655 2.3565 -0.1151 -0.4950 -0.5959 213 PHE A CG  
1627 C CD1 . PHE A 213 ? 3.5369 2.6333 2.4261 -0.1141 -0.4930 -0.5973 213 PHE A CD1 
1628 C CD2 . PHE A 213 ? 3.7079 2.8052 2.5975 -0.1187 -0.4993 -0.5964 213 PHE A CD2 
1629 C CE1 . PHE A 213 ? 3.7426 2.8384 2.6342 -0.1166 -0.4951 -0.5991 213 PHE A CE1 
1630 C CE2 . PHE A 213 ? 3.9163 3.0130 2.8083 -0.1212 -0.5015 -0.5982 213 PHE A CE2 
1631 C CZ  . PHE A 213 ? 3.9230 3.0190 2.8160 -0.1202 -0.4994 -0.5996 213 PHE A CZ  
1632 N N   . PRO A 214 ? 3.2212 2.3190 2.1007 -0.1034 -0.4826 -0.5916 214 PRO A N   
1633 C CA  . PRO A 214 ? 3.1566 2.2549 2.0342 -0.1004 -0.4804 -0.5896 214 PRO A CA  
1634 C C   . PRO A 214 ? 3.2643 2.3636 2.1432 -0.1021 -0.4841 -0.5881 214 PRO A C   
1635 O O   . PRO A 214 ? 3.1554 2.2555 2.0324 -0.1010 -0.4837 -0.5865 214 PRO A O   
1636 C CB  . PRO A 214 ? 2.9961 2.0938 1.8743 -0.0978 -0.4775 -0.5897 214 PRO A CB  
1637 C CG  . PRO A 214 ? 3.0020 2.0989 1.8831 -0.1000 -0.4792 -0.5916 214 PRO A CG  
1638 C CD  . PRO A 214 ? 3.1263 2.2232 2.0072 -0.1025 -0.4808 -0.5930 214 PRO A CD  
1639 N N   . THR A 215 ? 3.4564 2.5557 2.3387 -0.1050 -0.4878 -0.5886 215 THR A N   
1640 C CA  . THR A 215 ? 3.4473 2.5476 2.3314 -0.1074 -0.4919 -0.5874 215 THR A CA  
1641 C C   . THR A 215 ? 3.3010 2.4019 2.1850 -0.1103 -0.4954 -0.5874 215 THR A C   
1642 O O   . THR A 215 ? 3.2755 2.3774 2.1610 -0.1123 -0.4989 -0.5865 215 THR A O   
1643 C CB  . THR A 215 ? 3.2153 2.3152 2.1031 -0.1093 -0.4946 -0.5880 215 THR A CB  
1644 O OG1 . THR A 215 ? 3.0748 2.1736 1.9638 -0.1107 -0.4949 -0.5900 215 THR A OG1 
1645 C CG2 . THR A 215 ? 3.3118 2.4114 2.1996 -0.1065 -0.4921 -0.5871 215 THR A CG2 
1646 N N   . GLY A 216 ? 3.1536 2.2541 2.0359 -0.1105 -0.4943 -0.5885 216 GLY A N   
1647 C CA  . GLY A 216 ? 3.0327 2.1337 1.9144 -0.1129 -0.4971 -0.5886 216 GLY A CA  
1648 C C   . GLY A 216 ? 2.8437 1.9447 1.7287 -0.1170 -0.5020 -0.5894 216 GLY A C   
1649 O O   . GLY A 216 ? 2.6405 1.7407 1.5272 -0.1183 -0.5026 -0.5911 216 GLY A O   
1650 N N   . ALA A 217 ? 2.8443 1.9464 1.7300 -0.1192 -0.5057 -0.5884 217 ALA A N   
1655 N N   . ILE A 218 ? 2.1055 3.0866 2.0671 -0.8945 0.5063  -0.5658 218 ILE A N   
1656 C CA  . ILE A 218 ? 2.1525 3.1026 2.0800 -0.8950 0.5002  -0.5664 218 ILE A CA  
1657 C C   . ILE A 218 ? 2.2912 3.2221 2.2063 -0.8827 0.4924  -0.5819 218 ILE A C   
1658 O O   . ILE A 218 ? 2.3155 3.2301 2.2033 -0.8701 0.4753  -0.5818 218 ILE A O   
1659 C CB  . ILE A 218 ? 1.9892 2.9067 1.8525 -0.8936 0.4792  -0.5453 218 ILE A CB  
1660 C CG1 . ILE A 218 ? 1.7008 2.6388 1.5758 -0.9061 0.4869  -0.5289 218 ILE A CG1 
1661 C CG2 . ILE A 218 ? 2.0679 2.9505 1.8939 -0.8939 0.4690  -0.5458 218 ILE A CG2 
1662 C CD1 . ILE A 218 ? 1.6665 2.5799 1.4816 -0.9031 0.4643  -0.5061 218 ILE A CD1 
1663 N N   . ILE A 219 ? 2.3412 3.2739 2.2780 -0.8871 0.5039  -0.5954 219 ILE A N   
1664 C CA  . ILE A 219 ? 2.4818 3.3960 2.4068 -0.8767 0.4966  -0.6098 219 ILE A CA  
1665 C C   . ILE A 219 ? 2.3615 3.2362 2.2381 -0.8762 0.4822  -0.6057 219 ILE A C   
1666 O O   . ILE A 219 ? 2.2311 3.1065 2.1139 -0.8866 0.4925  -0.6038 219 ILE A O   
1667 C CB  . ILE A 219 ? 2.7489 3.6917 2.7309 -0.8813 0.5172  -0.6286 219 ILE A CB  
1668 C CG1 . ILE A 219 ? 2.9149 3.8979 2.9499 -0.8855 0.5304  -0.6320 219 ILE A CG1 
1669 C CG2 . ILE A 219 ? 2.8130 3.7396 2.7834 -0.8693 0.5089  -0.6430 219 ILE A CG2 
1670 C CD1 . ILE A 219 ? 2.9937 4.0031 3.0836 -0.8902 0.5462  -0.6504 219 ILE A CD1 
1671 N N   . GLN A 220 ? 2.4558 3.2949 2.2854 -0.8648 0.4563  -0.6040 220 GLN A N   
1672 C CA  . GLN A 220 ? 2.6117 3.4099 2.3937 -0.8644 0.4369  -0.5996 220 GLN A CA  
1673 C C   . GLN A 220 ? 2.5156 3.2971 2.2944 -0.8557 0.4296  -0.6164 220 GLN A C   
1674 O O   . GLN A 220 ? 2.4622 3.2388 2.2385 -0.8453 0.4180  -0.6231 220 GLN A O   
1675 C CB  . GLN A 220 ? 2.8716 3.6362 2.5988 -0.8609 0.4051  -0.5816 220 GLN A CB  
1676 C CG  . GLN A 220 ? 2.9547 3.7293 2.6738 -0.8692 0.4067  -0.5619 220 GLN A CG  
1677 C CD  . GLN A 220 ? 3.0721 3.8196 2.7457 -0.8645 0.3737  -0.5455 220 GLN A CD  
1678 O OE1 . GLN A 220 ? 3.2364 3.9572 2.8875 -0.8555 0.3490  -0.5497 220 GLN A OE1 
1679 N NE2 . GLN A 220 ? 2.9828 3.7371 2.6445 -0.8714 0.3715  -0.5264 220 GLN A NE2 
1680 N N   . GLY A 221 ? 2.4420 3.2148 2.2212 -0.8602 0.4362  -0.6233 221 GLY A N   
1681 C CA  . GLY A 221 ? 2.3089 3.0612 2.0783 -0.8524 0.4263  -0.6374 221 GLY A CA  
1682 C C   . GLY A 221 ? 2.1284 2.8992 1.9336 -0.8575 0.4496  -0.6521 221 GLY A C   
1683 O O   . GLY A 221 ? 2.1585 2.9462 1.9940 -0.8527 0.4588  -0.6674 221 GLY A O   
1684 N N   . ARG A 222 ? 2.2011 2.9680 2.0022 -0.8675 0.4580  -0.6470 222 ARG A N   
1685 C CA  . ARG A 222 ? 2.1836 2.9657 2.0169 -0.8742 0.4790  -0.6594 222 ARG A CA  
1686 C C   . ARG A 222 ? 2.1653 2.9364 1.9983 -0.8655 0.4735  -0.6758 222 ARG A C   
1687 O O   . ARG A 222 ? 2.2583 3.0554 2.1335 -0.8678 0.4925  -0.6895 222 ARG A O   
1688 C CB  . ARG A 222 ? 2.2702 3.0364 2.0833 -0.8840 0.4805  -0.6505 222 ARG A CB  
1689 C CG  . ARG A 222 ? 2.3320 3.1292 2.1839 -0.8984 0.5056  -0.6464 222 ARG A CG  
1690 C CD  . ARG A 222 ? 2.4759 3.2884 2.3321 -0.9015 0.5059  -0.6325 222 ARG A CD  
1691 N NE  . ARG A 222 ? 2.5210 3.3650 2.4217 -0.9162 0.5287  -0.6304 222 ARG A NE  
1692 C CZ  . ARG A 222 ? 2.4989 3.3397 2.3898 -0.9266 0.5310  -0.6168 222 ARG A CZ  
1693 N NH1 . ARG A 222 ? 2.4793 3.2880 2.3160 -0.9240 0.5127  -0.6032 222 ARG A NH1 
1694 N NH2 . ARG A 222 ? 2.4097 3.2782 2.3458 -0.9407 0.5494  -0.6168 222 ARG A NH2 
1695 N N   . ASP A 223 ? 2.1887 2.9209 1.9753 -0.8565 0.4462  -0.6743 223 ASP A N   
1696 C CA  . ASP A 223 ? 2.4532 3.1705 2.2352 -0.8490 0.4387  -0.6891 223 ASP A CA  
1697 C C   . ASP A 223 ? 2.3654 3.0991 2.1713 -0.8395 0.4396  -0.7014 223 ASP A C   
1698 O O   . ASP A 223 ? 2.3477 3.0906 2.1752 -0.8368 0.4477  -0.7164 223 ASP A O   
1699 C CB  . ASP A 223 ? 2.7541 3.4221 2.4794 -0.8440 0.4065  -0.6832 223 ASP A CB  
1700 C CG  . ASP A 223 ? 3.0614 3.7107 2.7546 -0.8518 0.3970  -0.6652 223 ASP A CG  
1701 O OD1 . ASP A 223 ? 3.1685 3.8184 2.8506 -0.8522 0.3886  -0.6521 223 ASP A OD1 
1702 O OD2 . ASP A 223 ? 3.1213 3.7560 2.8007 -0.8577 0.3979  -0.6638 223 ASP A OD2 
1703 N N   . GLU A 224 ? 2.2898 3.0265 2.0906 -0.8345 0.4301  -0.6945 224 GLU A N   
1704 C CA  . GLU A 224 ? 2.1759 2.9330 2.0034 -0.8264 0.4333  -0.7047 224 GLU A CA  
1705 C C   . GLU A 224 ? 2.1225 2.9295 2.0115 -0.8336 0.4656  -0.7127 224 GLU A C   
1706 O O   . GLU A 224 ? 2.0514 2.8786 1.9723 -0.8298 0.4745  -0.7268 224 GLU A O   
1707 C CB  . GLU A 224 ? 2.1921 2.9375 1.9959 -0.8200 0.4138  -0.6938 224 GLU A CB  
1708 C CG  . GLU A 224 ? 2.2959 2.9919 2.0450 -0.8126 0.3776  -0.6888 224 GLU A CG  
1709 C CD  . GLU A 224 ? 2.4987 3.1830 2.2476 -0.8022 0.3666  -0.7041 224 GLU A CD  
1710 O OE1 . GLU A 224 ? 2.4218 3.1358 2.2071 -0.7977 0.3808  -0.7149 224 GLU A OE1 
1711 O OE2 . GLU A 224 ? 2.5857 3.2318 2.2991 -0.7991 0.3432  -0.7050 224 GLU A OE2 
1712 N N   . ILE A 225 ? 2.3822 3.2086 2.2893 -0.8451 0.4819  -0.7038 225 ILE A N   
1713 C CA  . ILE A 225 ? 2.6459 3.5151 2.6117 -0.8548 0.5096  -0.7115 225 ILE A CA  
1714 C C   . ILE A 225 ? 2.6925 3.5647 2.6762 -0.8573 0.5192  -0.7262 225 ILE A C   
1715 O O   . ILE A 225 ? 2.9379 3.8367 2.9620 -0.8573 0.5312  -0.7391 225 ILE A O   
1716 C CB  . ILE A 225 ? 2.8299 3.7141 2.8100 -0.8686 0.5231  -0.6996 225 ILE A CB  
1717 C CG1 . ILE A 225 ? 2.8172 3.7032 2.7843 -0.8665 0.5151  -0.6855 225 ILE A CG1 
1718 C CG2 . ILE A 225 ? 2.9479 3.8714 2.9893 -0.8808 0.5481  -0.7088 225 ILE A CG2 
1719 C CD1 . ILE A 225 ? 2.7762 3.6819 2.7643 -0.8804 0.5291  -0.6744 225 ILE A CD1 
1720 N N   . LYS A 226 ? 2.3968 3.2413 2.3497 -0.8594 0.5131  -0.7239 226 LYS A N   
1721 C CA  . LYS A 226 ? 2.1352 2.9782 2.0989 -0.8613 0.5203  -0.7369 226 LYS A CA  
1722 C C   . LYS A 226 ? 2.0647 2.9023 2.0265 -0.8490 0.5103  -0.7501 226 LYS A C   
1723 O O   . LYS A 226 ? 2.0429 2.9011 2.0390 -0.8508 0.5233  -0.7637 226 LYS A O   
1724 C CB  . LYS A 226 ? 2.1382 2.9473 2.0616 -0.8639 0.5111  -0.7309 226 LYS A CB  
1725 C CG  . LYS A 226 ? 2.1614 2.9663 2.0921 -0.8662 0.5179  -0.7433 226 LYS A CG  
1726 N N   . LYS A 227 ? 2.0910 2.9003 2.0131 -0.8373 0.4861  -0.7459 227 LYS A N   
1727 C CA  . LYS A 227 ? 2.1438 2.9421 2.0585 -0.8254 0.4729  -0.7576 227 LYS A CA  
1728 C C   . LYS A 227 ? 2.1011 2.9402 2.0659 -0.8247 0.4892  -0.7673 227 LYS A C   
1729 O O   . LYS A 227 ? 2.1492 3.0003 2.1367 -0.8222 0.4954  -0.7815 227 LYS A O   
1730 C CB  . LYS A 227 ? 2.2001 2.9591 2.0639 -0.8145 0.4415  -0.7501 227 LYS A CB  
1731 C CG  . LYS A 227 ? 2.2852 3.0308 2.1410 -0.8022 0.4256  -0.7620 227 LYS A CG  
1732 C CD  . LYS A 227 ? 2.3179 3.0191 2.1212 -0.7932 0.3905  -0.7539 227 LYS A CD  
1733 N N   . ALA A 228 ? 2.0464 2.9076 2.0298 -0.8277 0.4964  -0.7594 228 ALA A N   
1734 C CA  . ALA A 228 ? 2.4965 3.3971 2.5283 -0.8279 0.5107  -0.7673 228 ALA A CA  
1735 C C   . ALA A 228 ? 2.5588 3.4931 2.6416 -0.8399 0.5350  -0.7770 228 ALA A C   
1736 O O   . ALA A 228 ? 2.3769 3.3348 2.4942 -0.8386 0.5428  -0.7894 228 ALA A O   
1737 C CB  . ALA A 228 ? 2.5263 3.4417 2.5653 -0.8291 0.5118  -0.7558 228 ALA A CB  
1738 N N   . TYR A 229 ? 2.8759 3.8115 2.9635 -0.8522 0.5459  -0.7715 229 TYR A N   
1739 C CA  . TYR A 229 ? 2.9870 3.9505 3.1211 -0.8647 0.5665  -0.7807 229 TYR A CA  
1740 C C   . TYR A 229 ? 2.5242 3.4804 2.6579 -0.8610 0.5662  -0.7947 229 TYR A C   
1741 O O   . TYR A 229 ? 2.3976 3.3793 2.5725 -0.8688 0.5811  -0.8053 229 TYR A O   
1742 C CB  . TYR A 229 ? 3.3732 4.3380 3.5127 -0.8792 0.5773  -0.7717 229 TYR A CB  
1743 C CG  . TYR A 229 ? 3.4512 4.4353 3.6105 -0.8868 0.5832  -0.7613 229 TYR A CG  
1744 C CD1 . TYR A 229 ? 3.4807 4.4856 3.6608 -0.8822 0.5823  -0.7622 229 TYR A CD1 
1745 C CD2 . TYR A 229 ? 3.3311 4.3120 3.4883 -0.8987 0.5890  -0.7505 229 TYR A CD2 
1746 C CE1 . TYR A 229 ? 3.3290 4.3510 3.5273 -0.8893 0.5868  -0.7526 229 TYR A CE1 
1747 C CE2 . TYR A 229 ? 3.1738 4.1716 3.3495 -0.9061 0.5932  -0.7410 229 TYR A CE2 
1748 C CZ  . TYR A 229 ? 3.1066 4.1247 3.3026 -0.9013 0.5919  -0.7421 229 TYR A CZ  
1749 O OH  . TYR A 229 ? 2.8625 3.8968 3.0769 -0.9088 0.5950  -0.7328 229 TYR A OH  
1750 N N   . GLU A 230 ? 2.2091 3.1296 2.2962 -0.8497 0.5478  -0.7947 230 GLU A N   
1751 C CA  . GLU A 230 ? 2.2039 3.1144 2.2868 -0.8457 0.5455  -0.8075 230 GLU A CA  
1752 C C   . GLU A 230 ? 2.2313 3.1483 2.3224 -0.8343 0.5383  -0.8184 230 GLU A C   
1753 O O   . GLU A 230 ? 2.3208 3.2509 2.4352 -0.8347 0.5455  -0.8315 230 GLU A O   
1754 C CB  . GLU A 230 ? 2.3437 3.2099 2.3723 -0.8402 0.5275  -0.8028 230 GLU A CB  
1755 C CG  . GLU A 230 ? 2.6968 3.5551 2.7190 -0.8514 0.5360  -0.7972 230 GLU A CG  
1756 C CD  . GLU A 230 ? 3.1791 3.9923 3.1442 -0.8459 0.5150  -0.7894 230 GLU A CD  
1757 O OE1 . GLU A 230 ? 3.4012 4.1896 3.3312 -0.8353 0.4929  -0.7846 230 GLU A OE1 
1758 O OE2 . GLU A 230 ? 3.3029 4.1048 3.2585 -0.8529 0.5194  -0.7881 230 GLU A OE2 
1759 N N   . THR A 231 ? 2.1142 3.0209 2.1850 -0.8242 0.5234  -0.8129 231 THR A N   
1760 C CA  . THR A 231 ? 2.1799 3.0828 2.2468 -0.8114 0.5112  -0.8221 231 THR A CA  
1761 C C   . THR A 231 ? 2.1840 3.1169 2.2819 -0.8093 0.5166  -0.8225 231 THR A C   
1762 O O   . THR A 231 ? 2.2214 3.1614 2.3292 -0.8007 0.5119  -0.8318 231 THR A O   
1763 C CB  . THR A 231 ? 2.2254 3.0817 2.2341 -0.7996 0.4826  -0.8162 231 THR A CB  
1764 O OG1 . THR A 231 ? 2.3837 3.2326 2.3741 -0.7986 0.4744  -0.8021 231 THR A OG1 
1765 C CG2 . THR A 231 ? 2.2501 3.0749 2.2257 -0.8023 0.4753  -0.8140 231 THR A CG2 
1766 N N   . GLY A 232 ? 2.1743 3.1238 2.2865 -0.8169 0.5257  -0.8120 232 GLY A N   
1767 C CA  . GLY A 232 ? 2.2401 3.2169 2.3799 -0.8154 0.5300  -0.8106 232 GLY A CA  
1768 C C   . GLY A 232 ? 2.2887 3.2418 2.3903 -0.8039 0.5098  -0.8013 232 GLY A C   
1769 O O   . GLY A 232 ? 2.1685 3.1416 2.2886 -0.8018 0.5119  -0.7989 232 GLY A O   
1770 N N   . LYS A 233 ? 2.4252 3.3348 2.4738 -0.7967 0.4886  -0.7964 233 LYS A N   
1771 C CA  . LYS A 233 ? 2.4646 3.3473 2.4734 -0.7875 0.4665  -0.7861 233 LYS A CA  
1772 C C   . LYS A 233 ? 2.2035 3.0574 2.1727 -0.7921 0.4569  -0.7711 233 LYS A C   
1773 O O   . LYS A 233 ? 2.3040 3.1440 2.2611 -0.7979 0.4589  -0.7710 233 LYS A O   
1774 C CB  . LYS A 233 ? 2.7913 3.6438 2.7698 -0.7743 0.4432  -0.7932 233 LYS A CB  
1775 C CG  . LYS A 233 ? 2.7697 3.6469 2.7801 -0.7672 0.4475  -0.8055 233 LYS A CG  
1776 C CD  . LYS A 233 ? 2.5961 3.4405 2.5693 -0.7536 0.4194  -0.8052 233 LYS A CD  
1777 C CE  . LYS A 233 ? 2.4678 3.3292 2.4662 -0.7457 0.4209  -0.8196 233 LYS A CE  
1778 N NZ  . LYS A 233 ? 2.5742 3.4566 2.5908 -0.7406 0.4217  -0.8177 233 LYS A NZ  
1779 N N   . GLY A 234 ? 2.1073 2.9526 2.0566 -0.7900 0.4461  -0.7582 234 GLY A N   
1780 C CA  . GLY A 234 ? 2.1315 2.9502 2.0424 -0.7946 0.4352  -0.7425 234 GLY A CA  
1781 C C   . GLY A 234 ? 2.1857 3.0043 2.0842 -0.7932 0.4270  -0.7286 234 GLY A C   
1782 O O   . GLY A 234 ? 2.1385 2.9911 2.0724 -0.7939 0.4413  -0.7295 234 GLY A O   
1783 N N   . ARG A 235 ? 2.2463 3.0263 2.0947 -0.7919 0.4027  -0.7153 235 ARG A N   
1784 C CA  . ARG A 235 ? 2.1890 2.9640 2.0193 -0.7909 0.3911  -0.7005 235 ARG A CA  
1785 C C   . ARG A 235 ? 2.1101 2.8840 1.9294 -0.8020 0.3973  -0.6860 235 ARG A C   
1786 O O   . ARG A 235 ? 2.1481 2.8941 1.9373 -0.8056 0.3868  -0.6816 235 ARG A O   
1787 C CB  . ARG A 235 ? 2.2803 3.0097 2.0612 -0.7818 0.3538  -0.6956 235 ARG A CB  
1788 C CG  . ARG A 235 ? 2.1968 2.9145 1.9532 -0.7805 0.3354  -0.6795 235 ARG A CG  
1789 N N   . VAL A 236 ? 2.0150 2.8206 1.8607 -0.8077 0.4147  -0.6787 236 VAL A N   
1790 C CA  . VAL A 236 ? 1.9904 2.7995 1.8303 -0.8188 0.4226  -0.6647 236 VAL A CA  
1791 C C   . VAL A 236 ? 2.0765 2.8814 1.8958 -0.8174 0.4095  -0.6485 236 VAL A C   
1792 O O   . VAL A 236 ? 2.1762 2.9875 2.0014 -0.8094 0.4032  -0.6509 236 VAL A O   
1793 C CB  . VAL A 236 ? 2.5790 3.4336 2.4762 -0.8295 0.4570  -0.6710 236 VAL A CB  
1794 C CG1 . VAL A 236 ? 2.6309 3.5172 2.5554 -0.8340 0.4691  -0.6627 236 VAL A CG1 
1795 C CG2 . VAL A 236 ? 2.4574 3.3054 2.3504 -0.8403 0.4659  -0.6680 236 VAL A CG2 
1796 N N   . VAL A 237 ? 1.9690 2.7626 1.7634 -0.8251 0.4042  -0.6318 237 VAL A N   
1797 C CA  . VAL A 237 ? 1.9323 2.7265 1.7110 -0.8249 0.3937  -0.6158 237 VAL A CA  
1798 C C   . VAL A 237 ? 1.8966 2.7336 1.7157 -0.8338 0.4215  -0.6108 237 VAL A C   
1799 O O   . VAL A 237 ? 1.9565 2.8087 1.7960 -0.8442 0.4407  -0.6109 237 VAL A O   
1800 C CB  . VAL A 237 ? 2.0085 2.7611 1.7300 -0.8276 0.3636  -0.5973 237 VAL A CB  
1801 C CG1 . VAL A 237 ? 1.9911 2.7501 1.7012 -0.8297 0.3561  -0.5793 237 VAL A CG1 
1802 C CG2 . VAL A 237 ? 2.1572 2.8669 1.8413 -0.8193 0.3301  -0.6004 237 VAL A CG2 
1803 N N   . VAL A 238 ? 2.0197 2.8760 1.8522 -0.8304 0.4229  -0.6066 238 VAL A N   
1804 C CA  . VAL A 238 ? 2.3797 3.2764 2.2518 -0.8395 0.4466  -0.6012 238 VAL A CA  
1805 C C   . VAL A 238 ? 2.1159 3.0046 1.9571 -0.8398 0.4322  -0.5810 238 VAL A C   
1806 O O   . VAL A 238 ? 1.9040 2.7797 1.7236 -0.8306 0.4133  -0.5774 238 VAL A O   
1807 C CB  . VAL A 238 ? 3.0487 3.9857 2.9781 -0.8374 0.4661  -0.6154 238 VAL A CB  
1808 C CG1 . VAL A 238 ? 3.1265 4.1038 3.1010 -0.8494 0.4876  -0.6099 238 VAL A CG1 
1809 C CG2 . VAL A 238 ? 3.4041 4.3479 3.3621 -0.8370 0.4773  -0.6348 238 VAL A CG2 
1810 N N   . ARG A 239 ? 2.1244 3.0205 1.9631 -0.8509 0.4397  -0.5673 239 ARG A N   
1811 C CA  . ARG A 239 ? 2.1599 3.0425 1.9597 -0.8522 0.4221  -0.5455 239 ARG A CA  
1812 C C   . ARG A 239 ? 1.7733 2.6929 1.6040 -0.8623 0.4422  -0.5352 239 ARG A C   
1813 O O   . ARG A 239 ? 1.5681 2.5112 1.4361 -0.8736 0.4642  -0.5390 239 ARG A O   
1814 C CB  . ARG A 239 ? 2.5931 3.4342 2.3386 -0.8556 0.3989  -0.5327 239 ARG A CB  
1815 C CG  . ARG A 239 ? 2.8929 3.7257 2.6039 -0.8609 0.3831  -0.5078 239 ARG A CG  
1816 C CD  . ARG A 239 ? 3.1779 3.9751 2.8429 -0.8672 0.3618  -0.4944 239 ARG A CD  
1817 N NE  . ARG A 239 ? 3.5035 4.2563 3.1288 -0.8607 0.3263  -0.4947 239 ARG A NE  
1818 C CZ  . ARG A 239 ? 3.7875 4.5042 3.3697 -0.8658 0.2975  -0.4805 239 ARG A CZ  
1819 N NH1 . ARG A 239 ? 3.8029 4.5233 3.3735 -0.8766 0.3016  -0.4648 239 ARG A NH1 
1820 N NH2 . ARG A 239 ? 3.9918 4.6695 3.5448 -0.8611 0.2638  -0.4814 239 ARG A NH2 
1821 N N   . SER A 240 ? 1.6128 2.5358 1.4280 -0.8592 0.4318  -0.5215 240 SER A N   
1822 C CA  . SER A 240 ? 1.5382 2.4978 1.3844 -0.8681 0.4491  -0.5117 240 SER A CA  
1823 C C   . SER A 240 ? 1.5158 2.4741 1.3513 -0.8813 0.4533  -0.4976 240 SER A C   
1824 O O   . SER A 240 ? 1.5691 2.4918 1.3521 -0.8811 0.4333  -0.4863 240 SER A O   
1825 C CB  . SER A 240 ? 1.5525 2.5111 1.3747 -0.8610 0.4336  -0.4978 240 SER A CB  
1826 O OG  . SER A 240 ? 1.5602 2.5232 1.3977 -0.8495 0.4315  -0.5115 240 SER A OG  
1827 N N   . LYS A 241 ? 1.4373 2.4336 1.3265 -0.8945 0.4763  -0.4988 241 LYS A N   
1828 C CA  . LYS A 241 ? 1.4052 2.4060 1.2902 -0.9084 0.4797  -0.4832 241 LYS A CA  
1829 C C   . LYS A 241 ? 1.4787 2.4766 1.3235 -0.9064 0.4653  -0.4588 241 LYS A C   
1830 O O   . LYS A 241 ? 1.6014 2.6224 1.4661 -0.9036 0.4681  -0.4564 241 LYS A O   
1831 C CB  . LYS A 241 ? 1.3194 2.3594 1.2816 -0.9264 0.5006  -0.4929 241 LYS A CB  
1832 C CG  . LYS A 241 ? 1.4013 2.4439 1.3643 -0.9433 0.5008  -0.4785 241 LYS A CG  
1833 C CD  . LYS A 241 ? 1.3249 2.3951 1.3664 -0.9654 0.5088  -0.4915 241 LYS A CD  
1834 N N   . THR A 242 ? 1.5790 2.5483 1.3669 -0.9082 0.4483  -0.4398 242 THR A N   
1835 C CA  . THR A 242 ? 1.7284 2.6876 1.4667 -0.9059 0.4278  -0.4139 242 THR A CA  
1836 C C   . THR A 242 ? 1.7452 2.7056 1.4631 -0.9183 0.4269  -0.3924 242 THR A C   
1837 O O   . THR A 242 ? 1.8922 2.8362 1.5995 -0.9245 0.4267  -0.3935 242 THR A O   
1838 C CB  . THR A 242 ? 1.8617 2.7738 1.5373 -0.8940 0.3897  -0.4073 242 THR A CB  
1839 O OG1 . THR A 242 ? 1.8922 2.7700 1.5452 -0.8946 0.3774  -0.4139 242 THR A OG1 
1840 C CG2 . THR A 242 ? 1.8280 2.7436 1.5209 -0.8818 0.3880  -0.4225 242 THR A CG2 
1841 N N   . GLU A 243 ? 1.6607 2.6420 1.3736 -0.9217 0.4267  -0.3726 243 GLU A N   
1842 C CA  . GLU A 243 ? 1.7148 2.6970 1.3996 -0.9317 0.4221  -0.3481 243 GLU A CA  
1843 C C   . GLU A 243 ? 1.7309 2.6900 1.3457 -0.9230 0.3883  -0.3212 243 GLU A C   
1844 O O   . GLU A 243 ? 1.7532 2.7062 1.3609 -0.9126 0.3752  -0.3239 243 GLU A O   
1845 C CB  . GLU A 243 ? 1.7364 2.7702 1.4926 -0.9482 0.4479  -0.3474 243 GLU A CB  
1846 N N   . ILE A 244 ? 1.8986 2.8439 1.4649 -0.9283 0.3694  -0.2946 244 ILE A N   
1847 C CA  . ILE A 244 ? 2.2295 3.1579 1.7396 -0.9239 0.3306  -0.2649 244 ILE A CA  
1848 C C   . ILE A 244 ? 2.1681 3.1259 1.6617 -0.9264 0.3423  -0.2426 244 ILE A C   
1849 O O   . ILE A 244 ? 2.0692 3.0456 1.5779 -0.9349 0.3682  -0.2432 244 ILE A O   
1850 C CB  . ILE A 244 ? 2.5864 3.4694 2.0519 -0.9281 0.2840  -0.2478 244 ILE A CB  
1851 C CG1 . ILE A 244 ? 2.4661 3.3194 1.9432 -0.9244 0.2765  -0.2722 244 ILE A CG1 
1852 C CG2 . ILE A 244 ? 2.9128 3.7829 2.3453 -0.9276 0.2375  -0.2163 244 ILE A CG2 
1853 C CD1 . ILE A 244 ? 2.2343 3.0932 1.7412 -0.9272 0.3110  -0.2980 244 ILE A CD1 
1854 N N   . GLU A 245 ? 2.2147 3.1771 1.6774 -0.9183 0.3224  -0.2235 245 GLU A N   
1855 C CA  . GLU A 245 ? 2.1989 3.1816 1.6184 -0.9126 0.3263  -0.2037 245 GLU A CA  
1856 C C   . GLU A 245 ? 2.1088 3.0685 1.4707 -0.9100 0.2643  -0.1675 245 GLU A C   
1857 O O   . GLU A 245 ? 2.1032 3.0547 1.4759 -0.9091 0.2356  -0.1576 245 GLU A O   
1858 C CB  . GLU A 245 ? 2.2663 3.2861 1.7091 -0.9029 0.3629  -0.2176 245 GLU A CB  
1859 C CG  . GLU A 245 ? 2.2629 3.3303 1.8284 -0.9208 0.4186  -0.2445 245 GLU A CG  
1860 C CD  . GLU A 245 ? 2.2546 3.3749 1.9020 -0.9264 0.4454  -0.2526 245 GLU A CD  
1861 O OE1 . GLU A 245 ? 2.3443 3.4462 1.8989 -0.8997 0.4318  -0.2435 245 GLU A OE1 
1862 O OE2 . GLU A 245 ? 2.1414 3.3193 1.9839 -0.9720 0.4459  -0.2769 245 GLU A OE2 
1863 N N   . LYS A 246 ? 2.0113 2.9647 1.3238 -0.9104 0.2400  -0.1470 246 LYS A N   
1864 C CA  . LYS A 246 ? 2.0268 2.9705 1.3226 -0.9156 0.1772  -0.1053 246 LYS A CA  
1865 C C   . LYS A 246 ? 2.1369 3.0986 1.4079 -0.9013 0.1474  -0.0936 246 LYS A C   
1866 O O   . LYS A 246 ? 2.2524 3.2319 1.4765 -0.9001 0.1180  -0.0985 246 LYS A O   
1867 C CB  . LYS A 246 ? 2.0308 2.9651 1.3033 -0.9240 0.1545  -0.0861 246 LYS A CB  
1868 C CG  . LYS A 246 ? 2.1262 3.0375 1.4239 -0.9393 0.1676  -0.0936 246 LYS A CG  
1869 C CD  . LYS A 246 ? 2.1847 3.0907 1.4541 -0.9448 0.1606  -0.0832 246 LYS A CD  
1870 N N   . LEU A 247 ? 2.1344 3.1013 1.4338 -0.9004 0.1423  -0.0864 247 LEU A N   
1871 C CA  . LEU A 247 ? 2.0928 3.0786 1.3856 -0.8894 0.1096  -0.0705 247 LEU A CA  
1872 C C   . LEU A 247 ? 2.2420 3.2424 1.5467 -0.9014 0.0545  -0.0190 247 LEU A C   
1873 O O   . LEU A 247 ? 2.2400 3.2241 1.5585 -0.9143 0.0406  0.0061  247 LEU A O   
1874 C CB  . LEU A 247 ? 2.0108 2.9977 1.3370 -0.8901 0.1149  -0.0679 247 LEU A CB  
1875 C CG  . LEU A 247 ? 2.0568 3.0431 1.3954 -0.8830 0.1684  -0.1120 247 LEU A CG  
1876 N N   . LYS A 248 ? 2.3004 3.3341 1.6147 -0.8968 0.0222  -0.0021 248 LYS A N   
1877 C CA  . LYS A 248 ? 2.3282 3.3864 1.6769 -0.9071 -0.0224 0.0549  248 LYS A CA  
1878 C C   . LYS A 248 ? 2.3611 3.4019 1.7362 -0.9176 -0.0389 0.0975  248 LYS A C   
1879 O O   . LYS A 248 ? 2.3685 3.3863 1.7512 -0.9150 -0.0242 0.0821  248 LYS A O   
1880 C CB  . LYS A 248 ? 2.2551 3.3539 1.6471 -0.8943 -0.0450 0.0679  248 LYS A CB  
1881 N N   . GLY A 249 ? 2.4971 3.5501 1.8921 -0.9302 -0.0737 0.1480  249 GLY A N   
1882 C CA  . GLY A 249 ? 2.7569 3.7921 2.1805 -0.9389 -0.0994 0.1865  249 GLY A CA  
1883 C C   . GLY A 249 ? 2.9103 3.9042 2.3262 -0.9529 -0.0950 0.1721  249 GLY A C   
1884 O O   . GLY A 249 ? 3.1748 4.1532 2.6075 -0.9608 -0.1133 0.1850  249 GLY A O   
1885 N N   . GLY A 250 ? 2.6672 3.6436 2.0603 -0.9553 -0.0737 0.1438  250 GLY A N   
1886 C CA  . GLY A 250 ? 2.5584 3.4976 1.9495 -0.9683 -0.0754 0.1318  250 GLY A CA  
1887 C C   . GLY A 250 ? 2.4853 3.3997 1.8775 -0.9640 -0.0534 0.0877  250 GLY A C   
1888 O O   . GLY A 250 ? 2.5005 3.3827 1.8945 -0.9719 -0.0621 0.0763  250 GLY A O   
1889 N N   . LYS A 251 ? 2.3944 3.3239 1.7860 -0.9501 -0.0272 0.0627  251 LYS A N   
1890 C CA  . LYS A 251 ? 2.5421 3.4538 1.9390 -0.9436 -0.0040 0.0209  251 LYS A CA  
1891 C C   . LYS A 251 ? 2.9903 3.8988 2.3719 -0.9369 0.0440  -0.0238 251 LYS A C   
1892 O O   . LYS A 251 ? 2.9536 3.8806 2.3151 -0.9322 0.0652  -0.0272 251 LYS A O   
1893 C CB  . LYS A 251 ? 2.3581 3.2897 1.7657 -0.9323 0.0013  0.0182  251 LYS A CB  
1894 C CG  . LYS A 251 ? 2.3054 3.2465 1.7324 -0.9377 -0.0416 0.0642  251 LYS A CG  
1895 C CD  . LYS A 251 ? 2.1618 3.1242 1.5977 -0.9251 -0.0326 0.0590  251 LYS A CD  
1896 N N   . GLU A 252 ? 3.3899 4.2750 2.7808 -0.9354 0.0594  -0.0581 252 GLU A N   
1897 C CA  . GLU A 252 ? 2.0570 2.9443 1.4463 -0.9286 0.1091  -0.1001 252 GLU A CA  
1898 C C   . GLU A 252 ? 1.8713 2.7686 1.2796 -0.9161 0.1401  -0.1332 252 GLU A C   
1899 O O   . GLU A 252 ? 1.7150 2.6124 1.1327 -0.9122 0.1208  -0.1258 252 GLU A O   
1900 C CB  . GLU A 252 ? 2.1708 3.0270 1.5599 -0.9362 0.1062  -0.1141 252 GLU A CB  
1901 C CG  . GLU A 252 ? 2.2361 3.0902 1.6063 -0.9468 0.0958  -0.0919 252 GLU A CG  
1902 C CD  . GLU A 252 ? 2.2332 3.0604 1.6018 -0.9522 0.1036  -0.1123 252 GLU A CD  
1903 O OE1 . GLU A 252 ? 2.2037 3.0038 1.5813 -0.9506 0.0936  -0.1303 252 GLU A OE1 
1904 O OE2 . GLU A 252 ? 2.2251 3.0578 1.5810 -0.9569 0.1188  -0.1102 252 GLU A OE2 
1905 N N   . GLN A 253 ? 2.9457 3.8542 2.3659 -0.9106 0.1891  -0.1682 253 GLN A N   
1906 C CA  . GLN A 253 ? 2.5910 3.5163 2.0399 -0.8997 0.2236  -0.1991 253 GLN A CA  
1907 C C   . GLN A 253 ? 2.1166 3.0427 1.5962 -0.8995 0.2626  -0.2351 253 GLN A C   
1908 O O   . GLN A 253 ? 1.8871 2.8273 1.3729 -0.9047 0.2908  -0.2404 253 GLN A O   
1909 C CB  . GLN A 253 ? 2.5006 3.4633 1.9438 -0.8919 0.2497  -0.1953 253 GLN A CB  
1910 C CG  . GLN A 253 ? 2.2008 3.1933 1.6866 -0.8844 0.3010  -0.2285 253 GLN A CG  
1911 C CD  . GLN A 253 ? 1.8845 2.9070 1.3563 -0.8740 0.3160  -0.2225 253 GLN A CD  
1912 O OE1 . GLN A 253 ? 1.7121 2.7262 1.1530 -0.8685 0.2791  -0.2009 253 GLN A OE1 
1913 N NE2 . GLN A 253 ? 1.8032 2.8639 1.3068 -0.8728 0.3685  -0.2405 253 GLN A NE2 
1914 N N   . ILE A 254 ? 1.9375 2.8489 1.4385 -0.8937 0.2615  -0.2584 254 ILE A N   
1915 C CA  . ILE A 254 ? 1.8632 2.7764 1.3986 -0.8922 0.2935  -0.2918 254 ILE A CA  
1916 C C   . ILE A 254 ? 1.7424 2.6996 1.3308 -0.8875 0.3394  -0.3139 254 ILE A C   
1917 O O   . ILE A 254 ? 1.6586 2.6259 1.2580 -0.8792 0.3388  -0.3181 254 ILE A O   
1918 C CB  . ILE A 254 ? 1.9889 2.8671 1.5222 -0.8865 0.2695  -0.3067 254 ILE A CB  
1919 C CG1 . ILE A 254 ? 2.0744 2.9108 1.5684 -0.8934 0.2204  -0.2848 254 ILE A CG1 
1920 C CG2 . ILE A 254 ? 2.0149 2.8964 1.5821 -0.8839 0.3002  -0.3392 254 ILE A CG2 
1921 C CD1 . ILE A 254 ? 2.1255 2.9291 1.6161 -0.8876 0.1910  -0.2944 254 ILE A CD1 
1922 N N   . VAL A 255 ? 1.7400 2.7253 1.3710 -0.8951 0.3767  -0.3273 255 VAL A N   
1923 C CA  . VAL A 255 ? 1.6154 2.6479 1.3205 -0.8972 0.4144  -0.3468 255 VAL A CA  
1924 C C   . VAL A 255 ? 1.4321 2.4684 1.1910 -0.8991 0.4322  -0.3777 255 VAL A C   
1925 O O   . VAL A 255 ? 1.3020 2.3369 1.0786 -0.9088 0.4417  -0.3846 255 VAL A O   
1926 C CB  . VAL A 255 ? 1.5818 2.6578 1.3283 -0.9123 0.4379  -0.3365 255 VAL A CB  
1927 C CG1 . VAL A 255 ? 1.4609 2.5877 1.3120 -0.9233 0.4603  -0.3572 255 VAL A CG1 
1928 C CG2 . VAL A 255 ? 1.6313 2.7026 1.3090 -0.9066 0.4217  -0.3033 255 VAL A CG2 
1929 N N   . ILE A 256 ? 1.3757 2.4172 1.1593 -0.8894 0.4352  -0.3956 256 ILE A N   
1930 C CA  . ILE A 256 ? 1.1786 2.2261 1.0112 -0.8889 0.4501  -0.4241 256 ILE A CA  
1931 C C   . ILE A 256 ? 1.0011 2.0991 0.9253 -0.9032 0.4757  -0.4381 256 ILE A C   
1932 O O   . ILE A 256 ? 0.9735 2.1022 0.9286 -0.9074 0.4791  -0.4320 256 ILE A O   
1933 C CB  . ILE A 256 ? 1.1408 2.1706 0.9581 -0.8728 0.4372  -0.4353 256 ILE A CB  
1934 C CG1 . ILE A 256 ? 1.2671 2.2433 1.0089 -0.8651 0.3998  -0.4230 256 ILE A CG1 
1935 C CG2 . ILE A 256 ? 1.1684 2.2095 1.0371 -0.8714 0.4537  -0.4633 256 ILE A CG2 
1936 C CD1 . ILE A 256 ? 1.3478 2.3048 1.0712 -0.8522 0.3777  -0.4268 256 ILE A CD1 
1937 N N   . THR A 257 ? 0.9760 2.0804 0.9468 -0.9130 0.4870  -0.4570 257 THR A N   
1938 C CA  . THR A 257 ? 0.9310 2.0736 0.9926 -0.9320 0.4962  -0.4727 257 THR A CA  
1939 C C   . THR A 257 ? 0.9247 2.0703 1.0289 -0.9316 0.5052  -0.4996 257 THR A C   
1940 O O   . THR A 257 ? 0.8538 2.0227 1.0268 -0.9459 0.5055  -0.5158 257 THR A O   
1941 C CB  . THR A 257 ? 0.9429 2.0927 1.0342 -0.9558 0.4904  -0.4676 257 THR A CB  
1942 O OG1 . THR A 257 ? 1.0480 2.1717 1.1095 -0.9556 0.4950  -0.4691 257 THR A OG1 
1943 C CG2 . THR A 257 ? 0.8898 2.0463 0.9529 -0.9597 0.4799  -0.4404 257 THR A CG2 
1944 N N   . GLU A 258 ? 1.1275 2.2451 1.1891 -0.9165 0.5067  -0.5055 258 GLU A N   
1945 C CA  . GLU A 258 ? 1.2928 2.4141 1.3883 -0.9130 0.5149  -0.5291 258 GLU A CA  
1946 C C   . GLU A 258 ? 1.1863 2.2786 1.2269 -0.8917 0.5061  -0.5306 258 GLU A C   
1947 O O   . GLU A 258 ? 0.9814 2.0384 0.9583 -0.8846 0.4923  -0.5191 258 GLU A O   
1948 C CB  . GLU A 258 ? 1.6014 2.7157 1.7168 -0.9246 0.5219  -0.5401 258 GLU A CB  
1949 C CG  . GLU A 258 ? 1.6197 2.7522 1.7883 -0.9483 0.5219  -0.5422 258 GLU A CG  
1950 C CD  . GLU A 258 ? 1.4950 2.6130 1.6707 -0.9588 0.5266  -0.5507 258 GLU A CD  
1951 O OE1 . GLU A 258 ? 1.5471 2.6519 1.7090 -0.9497 0.5340  -0.5610 258 GLU A OE1 
1952 O OE2 . GLU A 258 ? 1.5050 2.6226 1.6995 -0.9767 0.5202  -0.5481 258 GLU A OE2 
1953 N N   . ILE A 259 ? 1.1634 2.2678 1.2291 -0.8831 0.5091  -0.5451 259 ILE A N   
1954 C CA  . ILE A 259 ? 1.3214 2.3965 1.3417 -0.8649 0.4959  -0.5492 259 ILE A CA  
1955 C C   . ILE A 259 ? 0.9621 2.0363 1.0070 -0.8622 0.5029  -0.5707 259 ILE A C   
1956 O O   . ILE A 259 ? 0.9100 2.0071 1.0066 -0.8742 0.5182  -0.5819 259 ILE A O   
1957 C CB  . ILE A 259 ? 1.5225 2.6055 1.5371 -0.8538 0.4885  -0.5456 259 ILE A CB  
1958 C CG1 . ILE A 259 ? 1.5077 2.6341 1.5947 -0.8580 0.5046  -0.5601 259 ILE A CG1 
1959 C CG2 . ILE A 259 ? 1.6608 2.7407 1.6419 -0.8555 0.4793  -0.5224 259 ILE A CG2 
1960 C CD1 . ILE A 259 ? 1.5542 2.6866 1.6353 -0.8451 0.4979  -0.5595 259 ILE A CD1 
1961 N N   . PRO A 260 ? 1.0221 2.0668 1.0286 -0.8475 0.4881  -0.5763 260 PRO A N   
1962 C CA  . PRO A 260 ? 1.0305 2.0700 1.0517 -0.8434 0.4918  -0.5954 260 PRO A CA  
1963 C C   . PRO A 260 ? 0.9739 2.0500 1.0546 -0.8431 0.5060  -0.6111 260 PRO A C   
1964 O O   . PRO A 260 ? 0.9650 2.0578 1.0581 -0.8382 0.5049  -0.6091 260 PRO A O   
1965 C CB  . PRO A 260 ? 1.1510 2.1472 1.1129 -0.8286 0.4658  -0.5940 260 PRO A CB  
1966 C CG  . PRO A 260 ? 1.1942 2.1658 1.1044 -0.8288 0.4470  -0.5724 260 PRO A CG  
1967 C CD  . PRO A 260 ? 1.0942 2.1019 1.0354 -0.8364 0.4619  -0.5628 260 PRO A CD  
1968 N N   . TYR A 261 ? 1.0721 2.1595 1.1884 -0.8487 0.5181  -0.6265 261 TYR A N   
1969 C CA  . TYR A 261 ? 1.1957 2.3150 1.3680 -0.8499 0.5295  -0.6428 261 TYR A CA  
1970 C C   . TYR A 261 ? 1.3103 2.4256 1.4702 -0.8335 0.5199  -0.6484 261 TYR A C   
1971 O O   . TYR A 261 ? 1.5011 2.5817 1.6118 -0.8210 0.5039  -0.6479 261 TYR A O   
1972 C CB  . TYR A 261 ? 1.3904 2.5090 1.5826 -0.8554 0.5381  -0.6574 261 TYR A CB  
1973 C CG  . TYR A 261 ? 1.5603 2.7108 1.8111 -0.8598 0.5495  -0.6742 261 TYR A CG  
1974 C CD1 . TYR A 261 ? 1.8810 3.0652 2.1871 -0.8744 0.5585  -0.6759 261 TYR A CD1 
1975 C CD2 . TYR A 261 ? 1.5786 2.7239 1.8296 -0.8508 0.5488  -0.6886 261 TYR A CD2 
1976 C CE1 . TYR A 261 ? 1.7096 2.9202 2.0676 -0.8799 0.5660  -0.6914 261 TYR A CE1 
1977 C CE2 . TYR A 261 ? 1.8049 2.9799 2.1089 -0.8556 0.5587  -0.7036 261 TYR A CE2 
1978 C CZ  . TYR A 261 ? 1.6955 2.9028 2.0521 -0.8703 0.5671  -0.7047 261 TYR A CZ  
1979 O OH  . TYR A 261 ? 1.9554 3.1890 2.3617 -0.8761 0.5741  -0.7194 261 TYR A OH  
1980 N N   . GLU A 262 ? 1.3034 2.4530 1.5099 -0.8350 0.5277  -0.6541 262 GLU A N   
1981 C CA  . GLU A 262 ? 1.4613 2.6149 1.6677 -0.8210 0.5213  -0.6606 262 GLU A CA  
1982 C C   . GLU A 262 ? 1.3576 2.4910 1.5168 -0.8096 0.5053  -0.6465 262 GLU A C   
1983 O O   . GLU A 262 ? 0.9552 2.0799 1.1001 -0.7964 0.4950  -0.6509 262 GLU A O   
1984 C CB  . GLU A 262 ? 1.7440 2.8805 1.9387 -0.8108 0.5161  -0.6753 262 GLU A CB  
1985 C CG  . GLU A 262 ? 1.6262 2.7857 1.8701 -0.8199 0.5312  -0.6912 262 GLU A CG  
1986 C CD  . GLU A 262 ? 1.4172 2.5569 1.6437 -0.8096 0.5249  -0.7043 262 GLU A CD  
1987 O OE1 . GLU A 262 ? 1.3888 2.5275 1.6116 -0.7973 0.5173  -0.7108 262 GLU A OE1 
1988 O OE2 . GLU A 262 ? 1.4577 2.5824 1.6742 -0.8139 0.5269  -0.7081 262 GLU A OE2 
1989 N N   . ILE A 263 ? 1.3234 2.4482 1.4578 -0.8152 0.5019  -0.6294 263 ILE A N   
1990 C CA  . ILE A 263 ? 1.2370 2.3397 1.3224 -0.8058 0.4843  -0.6143 263 ILE A CA  
1991 C C   . ILE A 263 ? 1.0109 2.1475 1.1270 -0.8100 0.4925  -0.6062 263 ILE A C   
1992 O O   . ILE A 263 ? 0.8707 2.0329 1.0211 -0.8244 0.5052  -0.6013 263 ILE A O   
1993 C CB  . ILE A 263 ? 1.7197 2.7836 1.7451 -0.8076 0.4690  -0.5982 263 ILE A CB  
1994 C CG1 . ILE A 263 ? 1.8995 2.9234 1.8873 -0.8012 0.4536  -0.6055 263 ILE A CG1 
1995 C CG2 . ILE A 263 ? 1.7026 2.7478 1.6826 -0.8016 0.4499  -0.5803 263 ILE A CG2 
1996 C CD1 . ILE A 263 ? 2.0446 3.0459 2.0092 -0.7866 0.4339  -0.6124 263 ILE A CD1 
1997 N N   . ASN A 264 ? 0.9387 2.0743 1.0437 -0.7983 0.4833  -0.6053 264 ASN A N   
1998 C CA  . ASN A 264 ? 0.8951 2.0603 1.0240 -0.8001 0.4887  -0.5973 264 ASN A CA  
1999 C C   . ASN A 264 ? 1.0222 2.1728 1.1090 -0.8035 0.4801  -0.5748 264 ASN A C   
2000 O O   . ASN A 264 ? 0.9863 2.0985 1.0111 -0.7942 0.4584  -0.5639 264 ASN A O   
2001 C CB  . ASN A 264 ? 0.9257 2.0880 1.0474 -0.7851 0.4793  -0.6031 264 ASN A CB  
2002 C CG  . ASN A 264 ? 0.9765 2.1713 1.1263 -0.7856 0.4853  -0.5968 264 ASN A CG  
2003 O OD1 . ASN A 264 ? 1.1639 2.3595 1.2955 -0.7894 0.4827  -0.5797 264 ASN A OD1 
2004 N ND2 . ASN A 264 ? 0.8732 2.0952 1.0670 -0.7817 0.4924  -0.6104 264 ASN A ND2 
2005 N N   . LYS A 265 ? 1.0979 2.2773 1.2195 -0.8185 0.4934  -0.5676 265 LYS A N   
2006 C CA  . LYS A 265 ? 1.1557 2.3244 1.2398 -0.8233 0.4869  -0.5455 265 LYS A CA  
2007 C C   . LYS A 265 ? 1.1718 2.3240 1.2080 -0.8109 0.4703  -0.5314 265 LYS A C   
2008 O O   . LYS A 265 ? 1.1877 2.3013 1.1583 -0.8065 0.4495  -0.5161 265 LYS A O   
2009 C CB  . LYS A 265 ? 1.0570 2.2662 1.1991 -0.8424 0.5011  -0.5414 265 LYS A CB  
2010 C CG  . LYS A 265 ? 0.9275 2.1301 1.0344 -0.8485 0.4954  -0.5175 265 LYS A CG  
2011 C CD  . LYS A 265 ? 0.7787 2.0194 0.9528 -0.8716 0.5028  -0.5163 265 LYS A CD  
2012 C CE  . LYS A 265 ? 0.6765 1.9550 0.9056 -0.8772 0.5018  -0.5188 265 LYS A CE  
2013 N N   . ALA A 266 ? 1.1760 2.3563 1.2465 -0.8065 0.4763  -0.5366 266 ALA A N   
2014 C CA  . ALA A 266 ? 1.2515 2.4218 1.2845 -0.7958 0.4623  -0.5236 266 ALA A CA  
2015 C C   . ALA A 266 ? 1.1444 2.2636 1.1129 -0.7817 0.4332  -0.5222 266 ALA A C   
2016 O O   . ALA A 266 ? 1.0555 2.1482 0.9718 -0.7777 0.4104  -0.5045 266 ALA A O   
2017 C CB  . ALA A 266 ? 1.4196 2.6328 1.5102 -0.7946 0.4757  -0.5322 266 ALA A CB  
2018 N N   . ASN A 267 ? 1.0945 2.2000 1.0701 -0.7760 0.4305  -0.5403 267 ASN A N   
2019 C CA  . ASN A 267 ? 1.1779 2.2341 1.1007 -0.7655 0.3992  -0.5405 267 ASN A CA  
2020 C C   . ASN A 267 ? 1.3092 2.3231 1.1775 -0.7710 0.3765  -0.5261 267 ASN A C   
2021 O O   . ASN A 267 ? 1.2418 2.2144 1.0591 -0.7678 0.3419  -0.5137 267 ASN A O   
2022 C CB  . ASN A 267 ? 1.2333 2.2877 1.1798 -0.7588 0.4028  -0.5634 267 ASN A CB  
2023 C CG  . ASN A 267 ? 1.3330 2.4266 1.3317 -0.7529 0.4199  -0.5772 267 ASN A CG  
2024 O OD1 . ASN A 267 ? 1.3849 2.4961 1.4232 -0.7517 0.4331  -0.5957 267 ASN A OD1 
2025 N ND2 . ASN A 267 ? 1.3810 2.4890 1.3802 -0.7498 0.4186  -0.5675 267 ASN A ND2 
2026 N N   . LEU A 268 ? 1.5733 2.5988 1.4568 -0.7811 0.3941  -0.5269 268 LEU A N   
2027 C CA  . LEU A 268 ? 2.0323 3.0217 1.8699 -0.7873 0.3758  -0.5145 268 LEU A CA  
2028 C C   . LEU A 268 ? 2.1229 3.1032 1.9227 -0.7915 0.3590  -0.4885 268 LEU A C   
2029 O O   . LEU A 268 ? 2.3789 3.3175 2.1272 -0.7929 0.3245  -0.4730 268 LEU A O   
2030 C CB  . LEU A 268 ? 2.2860 3.2957 2.1552 -0.7976 0.4019  -0.5217 268 LEU A CB  
2031 C CG  . LEU A 268 ? 2.6010 3.5780 2.4359 -0.8040 0.3905  -0.5166 268 LEU A CG  
2032 C CD1 . LEU A 268 ? 2.7043 3.6961 2.5383 -0.8163 0.4018  -0.5004 268 LEU A CD1 
2033 C CD2 . LEU A 268 ? 2.7494 3.6718 2.5234 -0.7990 0.3492  -0.5077 268 LEU A CD2 
2034 N N   . VAL A 269 ? 1.7841 2.8046 1.6128 -0.7945 0.3809  -0.4826 269 VAL A N   
2035 C CA  . VAL A 269 ? 1.4604 2.4764 1.2539 -0.7987 0.3670  -0.4567 269 VAL A CA  
2036 C C   . VAL A 269 ? 1.4519 2.4367 1.2052 -0.7910 0.3304  -0.4455 269 VAL A C   
2037 O O   . VAL A 269 ? 1.6119 2.5692 1.3199 -0.7955 0.2990  -0.4218 269 VAL A O   
2038 C CB  . VAL A 269 ? 1.0931 2.1604 0.9283 -0.8035 0.3978  -0.4527 269 VAL A CB  
2039 C CG1 . VAL A 269 ? 1.1204 2.1805 0.9125 -0.8035 0.3788  -0.4258 269 VAL A CG1 
2040 C CG2 . VAL A 269 ? 1.0400 2.1325 0.9110 -0.8168 0.4238  -0.4557 269 VAL A CG2 
2041 N N   . LYS A 270 ? 1.2295 2.2193 1.0037 -0.7808 0.3322  -0.4615 270 LYS A N   
2042 C CA  . LYS A 270 ? 1.2841 2.2471 1.0287 -0.7740 0.2980  -0.4527 270 LYS A CA  
2043 C C   . LYS A 270 ? 1.3827 2.2927 1.0875 -0.7752 0.2572  -0.4481 270 LYS A C   
2044 O O   . LYS A 270 ? 1.4678 2.3489 1.1383 -0.7782 0.2189  -0.4275 270 LYS A O   
2045 C CB  . LYS A 270 ? 1.2498 2.2354 1.0304 -0.7628 0.3129  -0.4715 270 LYS A CB  
2046 C CG  . LYS A 270 ? 1.3115 2.2640 1.0659 -0.7551 0.2766  -0.4682 270 LYS A CG  
2047 C CD  . LYS A 270 ? 1.3203 2.2762 1.0574 -0.7549 0.2601  -0.4468 270 LYS A CD  
2048 N N   . LYS A 271 ? 1.3759 2.2748 1.0894 -0.7740 0.2641  -0.4662 271 LYS A N   
2049 C CA  . LYS A 271 ? 1.4993 2.3495 1.1785 -0.7755 0.2270  -0.4632 271 LYS A CA  
2050 C C   . LYS A 271 ? 1.7240 2.5503 1.3669 -0.7878 0.2022  -0.4384 271 LYS A C   
2051 O O   . LYS A 271 ? 1.5675 2.3544 1.1795 -0.7914 0.1598  -0.4245 271 LYS A O   
2052 C CB  . LYS A 271 ? 1.4488 2.2953 1.1460 -0.7712 0.2421  -0.4881 271 LYS A CB  
2053 C CG  . LYS A 271 ? 1.5396 2.3371 1.2023 -0.7737 0.2067  -0.4856 271 LYS A CG  
2054 C CD  . LYS A 271 ? 1.6947 2.4896 1.3751 -0.7683 0.2217  -0.5105 271 LYS A CD  
2055 C CE  . LYS A 271 ? 1.7512 2.5840 1.4668 -0.7718 0.2654  -0.5221 271 LYS A CE  
2056 N NZ  . LYS A 271 ? 2.0823 2.9154 1.8185 -0.7673 0.2789  -0.5448 271 LYS A NZ  
2057 N N   . ILE A 272 ? 2.0797 2.9313 1.7298 -0.7949 0.2276  -0.4319 272 ILE A N   
2058 C CA  . ILE A 272 ? 2.5194 3.3535 2.1377 -0.8069 0.2071  -0.4076 272 ILE A CA  
2059 C C   . ILE A 272 ? 2.8142 3.6436 2.4116 -0.8108 0.1773  -0.3794 272 ILE A C   
2060 O O   . ILE A 272 ? 2.9605 3.7620 2.5296 -0.8197 0.1394  -0.3560 272 ILE A O   
2061 C CB  . ILE A 272 ? 2.5396 3.4047 2.1725 -0.8136 0.2431  -0.4072 272 ILE A CB  
2062 C CG1 . ILE A 272 ? 2.6302 3.4998 2.2867 -0.8126 0.2697  -0.4318 272 ILE A CG1 
2063 C CG2 . ILE A 272 ? 2.5181 3.3670 2.1165 -0.8256 0.2196  -0.3789 272 ILE A CG2 
2064 C CD1 . ILE A 272 ? 2.6506 3.5567 2.3349 -0.8196 0.3089  -0.4346 272 ILE A CD1 
2065 N N   . ASP A 273 ? 2.7933 3.6522 2.4086 -0.8048 0.1936  -0.3803 273 ASP A N   
2066 C CA  . ASP A 273 ? 2.6374 3.4940 2.2366 -0.8073 0.1651  -0.3540 273 ASP A CA  
2067 C C   . ASP A 273 ? 2.7953 3.6163 2.3826 -0.8048 0.1222  -0.3501 273 ASP A C   
2068 O O   . ASP A 273 ? 2.9554 3.7614 2.5261 -0.8115 0.0843  -0.3227 273 ASP A O   
2069 C CB  . ASP A 273 ? 2.1738 3.0729 1.7960 -0.8007 0.1965  -0.3577 273 ASP A CB  
2070 C CG  . ASP A 273 ? 1.7968 2.6976 1.4019 -0.8040 0.1691  -0.3277 273 ASP A CG  
2071 O OD1 . ASP A 273 ? 1.7004 2.6021 1.2864 -0.8139 0.1559  -0.3011 273 ASP A OD1 
2072 O OD2 . ASP A 273 ? 1.6600 2.5630 1.2729 -0.7967 0.1606  -0.3298 273 ASP A OD2 
2073 N N   . ASP A 274 ? 2.6266 3.4357 2.2254 -0.7957 0.1276  -0.3761 274 ASP A N   
2074 C CA  . ASP A 274 ? 2.3529 3.1271 1.9413 -0.7928 0.0884  -0.3752 274 ASP A CA  
2075 C C   . ASP A 274 ? 2.2608 2.9974 1.8231 -0.8041 0.0482  -0.3564 274 ASP A C   
2076 O O   . ASP A 274 ? 2.3214 3.0341 1.8721 -0.8087 0.0062  -0.3374 274 ASP A O   
2077 C CB  . ASP A 274 ? 2.1296 2.8997 1.7349 -0.7810 0.1045  -0.4073 274 ASP A CB  
2078 C CG  . ASP A 274 ? 2.0871 2.8843 1.7177 -0.7695 0.1252  -0.4212 274 ASP A CG  
2079 O OD1 . ASP A 274 ? 2.1773 2.9966 1.8117 -0.7701 0.1292  -0.4073 274 ASP A OD1 
2080 O OD2 . ASP A 274 ? 2.1196 2.9170 1.7672 -0.7597 0.1377  -0.4456 274 ASP A OD2 
2081 N N   . VAL A 275 ? 2.0826 2.8161 1.6390 -0.8090 0.0621  -0.3615 275 VAL A N   
2082 C CA  . VAL A 275 ? 2.0891 2.7916 1.6226 -0.8205 0.0287  -0.3434 275 VAL A CA  
2083 C C   . VAL A 275 ? 2.2704 2.9766 1.7931 -0.8323 0.0018  -0.3065 275 VAL A C   
2084 O O   . VAL A 275 ? 2.3070 2.9867 1.8173 -0.8410 -0.0400 -0.2855 275 VAL A O   
2085 C CB  . VAL A 275 ? 1.9635 2.6679 1.4940 -0.8240 0.0531  -0.3542 275 VAL A CB  
2086 C CG1 . VAL A 275 ? 2.0988 2.7828 1.6065 -0.8385 0.0230  -0.3274 275 VAL A CG1 
2087 C CG2 . VAL A 275 ? 1.8278 2.5160 1.3644 -0.8154 0.0625  -0.3837 275 VAL A CG2 
2088 N N   . ARG A 276 ? 2.4099 3.1511 1.9401 -0.8330 0.0257  -0.2975 276 ARG A N   
2089 C CA  . ARG A 276 ? 2.5180 3.2666 2.0401 -0.8440 0.0010  -0.2603 276 ARG A CA  
2090 C C   . ARG A 276 ? 2.5335 3.2765 2.0607 -0.8432 -0.0315 -0.2437 276 ARG A C   
2091 O O   . ARG A 276 ? 2.3910 3.1199 1.9120 -0.8540 -0.0715 -0.2129 276 ARG A O   
2092 C CB  . ARG A 276 ? 2.4706 3.2585 1.9974 -0.8447 0.0358  -0.2545 276 ARG A CB  
2093 C CG  . ARG A 276 ? 2.4505 3.2500 1.9707 -0.8550 0.0107  -0.2142 276 ARG A CG  
2094 C CD  . ARG A 276 ? 2.3390 3.1798 1.8667 -0.8504 0.0430  -0.2114 276 ARG A CD  
2095 N NE  . ARG A 276 ? 2.2839 3.1378 1.8271 -0.8383 0.0570  -0.2284 276 ARG A NE  
2096 C CZ  . ARG A 276 ? 2.2857 3.1501 1.8333 -0.8376 0.0386  -0.2081 276 ARG A CZ  
2097 N NH1 . ARG A 276 ? 2.1337 2.9988 1.6745 -0.8486 0.0056  -0.1685 276 ARG A NH1 
2098 N NH2 . ARG A 276 ? 2.4350 3.3109 1.9966 -0.8261 0.0535  -0.2260 276 ARG A NH2 
2099 N N   . VAL A 277 ? 2.6289 3.3849 2.1701 -0.8310 -0.0138 -0.2630 277 VAL A N   
2106 N N   . ASN A 278 ? 1.6344 2.3224 2.5873 -0.3489 0.1259  -0.6281 278 ASN A N   
2107 C CA  . ASN A 278 ? 1.6165 2.2982 2.5877 -0.3468 0.1080  -0.6481 278 ASN A CA  
2108 C C   . ASN A 278 ? 1.5609 2.2296 2.5295 -0.3511 0.1005  -0.6482 278 ASN A C   
2109 O O   . ASN A 278 ? 1.5655 2.2240 2.5468 -0.3500 0.0838  -0.6617 278 ASN A O   
2110 C CB  . ASN A 278 ? 1.6835 2.3846 2.6576 -0.3347 0.1109  -0.6793 278 ASN A CB  
2111 C CG  . ASN A 278 ? 1.7876 2.4967 2.7730 -0.3303 0.1094  -0.6836 278 ASN A CG  
2112 O OD1 . ASN A 278 ? 1.6947 2.3903 2.6955 -0.3351 0.0960  -0.6727 278 ASN A OD1 
2113 N ND2 . ASN A 278 ? 1.9528 2.6835 2.9299 -0.3211 0.1230  -0.6993 278 ASN A ND2 
2114 N N   . ASN A 279 ? 1.5205 2.1882 2.4713 -0.3555 0.1123  -0.6330 279 ASN A N   
2115 C CA  . ASN A 279 ? 1.4964 2.1536 2.4423 -0.3593 0.1077  -0.6327 279 ASN A CA  
2116 C C   . ASN A 279 ? 1.5536 2.2171 2.5040 -0.3515 0.1017  -0.6629 279 ASN A C   
2117 O O   . ASN A 279 ? 1.4920 2.1402 2.4501 -0.3541 0.0863  -0.6667 279 ASN A O   
2118 C CB  . ASN A 279 ? 1.4336 2.0657 2.3890 -0.3701 0.0916  -0.6113 279 ASN A CB  
2119 C CG  . ASN A 279 ? 1.4743 2.0980 2.4142 -0.3777 0.0987  -0.5876 279 ASN A CG  
2120 O OD1 . ASN A 279 ? 1.5827 2.2085 2.5116 -0.3804 0.1097  -0.5670 279 ASN A OD1 
2121 N ND2 . ASN A 279 ? 1.3638 1.9773 2.3018 -0.3807 0.0919  -0.5901 279 ASN A ND2 
2122 N N   . LYS A 280 ? 1.6110 2.2962 2.5551 -0.3415 0.1137  -0.6837 280 LYS A N   
2123 C CA  . LYS A 280 ? 1.5886 2.2824 2.5347 -0.3327 0.1100  -0.7124 280 LYS A CA  
2124 C C   . LYS A 280 ? 1.4004 2.0905 2.3341 -0.3353 0.1138  -0.7114 280 LYS A C   
2125 O O   . LYS A 280 ? 1.4098 2.0950 2.3478 -0.3323 0.1033  -0.7269 280 LYS A O   
2126 C CB  . LYS A 280 ? 1.6822 2.4013 2.6216 -0.3219 0.1246  -0.7323 280 LYS A CB  
2127 C CG  . LYS A 280 ? 1.7699 2.4949 2.7198 -0.3190 0.1231  -0.7329 280 LYS A CG  
2128 C CD  . LYS A 280 ? 1.8930 2.6137 2.8622 -0.3131 0.1039  -0.7523 280 LYS A CD  
2129 C CE  . LYS A 280 ? 1.9307 2.6628 2.8967 -0.3026 0.1035  -0.7810 280 LYS A CE  
2130 N NZ  . LYS A 280 ? 1.9825 2.7060 2.9643 -0.2960 0.0826  -0.7986 280 LYS A NZ  
2131 N N   . VAL A 281 ? 1.3604 2.0518 2.2773 -0.3403 0.1287  -0.6927 281 VAL A N   
2132 C CA  . VAL A 281 ? 1.3244 2.0089 2.2292 -0.3449 0.1319  -0.6851 281 VAL A CA  
2133 C C   . VAL A 281 ? 1.2895 1.9593 2.1882 -0.3553 0.1335  -0.6525 281 VAL A C   
2134 O O   . VAL A 281 ? 1.3303 2.0022 2.2263 -0.3565 0.1398  -0.6385 281 VAL A O   
2135 C CB  . VAL A 281 ? 1.2275 1.9305 2.1124 -0.3380 0.1507  -0.6986 281 VAL A CB  
2136 C CG1 . VAL A 281 ? 1.1834 1.8944 2.0500 -0.3376 0.1687  -0.6853 281 VAL A CG1 
2137 C CG2 . VAL A 281 ? 1.2424 1.9375 2.1179 -0.3420 0.1511  -0.6943 281 VAL A CG2 
2138 N N   . ALA A 282 ? 1.2798 1.9342 2.1761 -0.3624 0.1272  -0.6401 282 ALA A N   
2139 C CA  . ALA A 282 ? 1.2663 1.9052 2.1579 -0.3722 0.1263  -0.6089 282 ALA A CA  
2140 C C   . ALA A 282 ? 1.2285 1.8734 2.0960 -0.3722 0.1444  -0.5962 282 ALA A C   
2141 O O   . ALA A 282 ? 1.2476 1.9026 2.1026 -0.3672 0.1540  -0.6102 282 ALA A O   
2142 C CB  . ALA A 282 ? 1.3066 1.9247 2.2069 -0.3800 0.1095  -0.6011 282 ALA A CB  
2143 N N   . GLY A 283 ? 1.2108 1.8485 2.0709 -0.3771 0.1483  -0.5696 283 GLY A N   
2144 C CA  . GLY A 283 ? 1.1777 1.8170 2.0135 -0.3768 0.1628  -0.5552 283 GLY A CA  
2145 C C   . GLY A 283 ? 1.2160 1.8594 2.0381 -0.3744 0.1740  -0.5399 283 GLY A C   
2146 O O   . GLY A 283 ? 1.2149 1.8503 2.0208 -0.3772 0.1791  -0.5175 283 GLY A O   
2147 N N   . ILE A 284 ? 1.2025 1.8574 2.0299 -0.3689 0.1773  -0.5516 284 ILE A N   
2148 C CA  . ILE A 284 ? 1.2950 1.9544 2.1056 -0.3651 0.1890  -0.5398 284 ILE A CA  
2149 C C   . ILE A 284 ? 1.2809 1.9278 2.0963 -0.3715 0.1831  -0.5101 284 ILE A C   
2150 O O   . ILE A 284 ? 1.4467 2.0896 2.2829 -0.3753 0.1720  -0.5080 284 ILE A O   
2151 C CB  . ILE A 284 ? 1.0745 1.7518 1.8840 -0.3558 0.1970  -0.5631 284 ILE A CB  
2152 N N   . ALA A 285 ? 1.2248 1.8646 2.0198 -0.3725 0.1899  -0.4871 285 ALA A N   
2153 C CA  . ALA A 285 ? 1.2455 1.8732 2.0416 -0.3780 0.1849  -0.4570 285 ALA A CA  
2154 C C   . ALA A 285 ? 1.3082 1.9424 2.1014 -0.3735 0.1902  -0.4528 285 ALA A C   
2155 O O   . ALA A 285 ? 1.2144 1.8449 2.0232 -0.3772 0.1825  -0.4434 285 ALA A O   
2156 C CB  . ALA A 285 ? 1.2059 1.8234 1.9815 -0.3798 0.1887  -0.4342 285 ALA A CB  
2157 N N   . GLU A 286 ? 1.4885 2.1313 2.2607 -0.3655 0.2030  -0.4599 286 GLU A N   
2158 C CA  . GLU A 286 ? 1.6104 2.2591 2.3772 -0.3604 0.2084  -0.4570 286 GLU A CA  
2159 C C   . GLU A 286 ? 1.4476 2.1080 2.1953 -0.3512 0.2204  -0.4773 286 GLU A C   
2160 O O   . GLU A 286 ? 1.2990 1.9584 2.0286 -0.3487 0.2263  -0.4824 286 GLU A O   
2161 C CB  . GLU A 286 ? 1.8097 2.4470 2.5637 -0.3622 0.2088  -0.4242 286 GLU A CB  
2162 C CG  . GLU A 286 ? 1.9484 2.5895 2.6968 -0.3575 0.2131  -0.4173 286 GLU A CG  
2163 C CD  . GLU A 286 ? 2.0315 2.6618 2.7620 -0.3569 0.2146  -0.3867 286 GLU A CD  
2164 O OE1 . GLU A 286 ? 1.9956 2.6164 2.7169 -0.3595 0.2131  -0.3729 286 GLU A OE1 
2165 O OE2 . GLU A 286 ? 2.1150 2.7463 2.8410 -0.3536 0.2168  -0.3764 286 GLU A OE2 
2166 N N   . VAL A 287 ? 1.4512 2.1217 2.2027 -0.3462 0.2233  -0.4891 287 VAL A N   
2167 C CA  . VAL A 287 ? 1.4309 2.1099 2.1611 -0.3376 0.2338  -0.5040 287 VAL A CA  
2168 C C   . VAL A 287 ? 1.4980 2.1716 2.2103 -0.3345 0.2382  -0.4830 287 VAL A C   
2169 O O   . VAL A 287 ? 1.5339 2.2057 2.2579 -0.3365 0.2341  -0.4690 287 VAL A O   
2170 C CB  . VAL A 287 ? 1.3374 2.0323 2.0814 -0.3329 0.2342  -0.5350 287 VAL A CB  
2171 C CG1 . VAL A 287 ? 1.2058 1.9078 1.9253 -0.3247 0.2441  -0.5506 287 VAL A CG1 
2172 C CG2 . VAL A 287 ? 1.3854 2.0848 2.1491 -0.3356 0.2278  -0.5544 287 VAL A CG2 
2173 N N   . ARG A 288 ? 1.5042 2.1740 2.1880 -0.3294 0.2455  -0.4804 288 ARG A N   
2174 C CA  . ARG A 288 ? 1.4726 2.1341 2.1370 -0.3262 0.2482  -0.4575 288 ARG A CA  
2175 C C   . ARG A 288 ? 1.3236 1.9881 1.9629 -0.3188 0.2555  -0.4712 288 ARG A C   
2176 O O   . ARG A 288 ? 1.2496 1.9125 1.8728 -0.3187 0.2600  -0.4820 288 ARG A O   
2177 C CB  . ARG A 288 ? 1.5806 2.2299 2.2354 -0.3310 0.2485  -0.4372 288 ARG A CB  
2178 C CG  . ARG A 288 ? 1.7514 2.3946 2.4093 -0.3352 0.2482  -0.4152 288 ARG A CG  
2179 C CD  . ARG A 288 ? 1.9903 2.6239 2.6382 -0.3408 0.2509  -0.4030 288 ARG A CD  
2180 N NE  . ARG A 288 ? 2.1832 2.8128 2.8420 -0.3450 0.2442  -0.4008 288 ARG A NE  
2181 C CZ  . ARG A 288 ? 2.1878 2.8142 2.8341 -0.3461 0.2479  -0.4069 288 ARG A CZ  
2182 N NH1 . ARG A 288 ? 2.1048 2.7310 2.7268 -0.3436 0.2577  -0.4158 288 ARG A NH1 
2183 N NH2 . ARG A 288 ? 2.2179 2.8406 2.8757 -0.3500 0.2409  -0.4042 288 ARG A NH2 
2184 N N   . ASP A 289 ? 1.2251 1.8951 1.8620 -0.3144 0.2576  -0.4757 289 ASP A N   
2185 C CA  . ASP A 289 ? 0.9846 1.6576 1.5976 -0.3104 0.2652  -0.4921 289 ASP A CA  
2186 C C   . ASP A 289 ? 0.8506 1.5157 1.4459 -0.3143 0.2713  -0.4805 289 ASP A C   
2187 O O   . ASP A 289 ? 0.8363 1.4990 1.4372 -0.3159 0.2710  -0.4645 289 ASP A O   
2188 C CB  . ASP A 289 ? 0.8486 1.5304 1.4655 -0.3045 0.2645  -0.5017 289 ASP A CB  
2189 C CG  . ASP A 289 ? 0.8036 1.4885 1.3965 -0.3010 0.2701  -0.5210 289 ASP A CG  
2190 O OD1 . ASP A 289 ? 0.8108 1.5032 1.4051 -0.2960 0.2693  -0.5315 289 ASP A OD1 
2191 O OD2 . ASP A 289 ? 0.7431 1.4228 1.3161 -0.3037 0.2744  -0.5255 289 ASP A OD2 
2192 N N   . GLU A 290 ? 0.8567 1.5176 1.4311 -0.3159 0.2760  -0.4882 290 GLU A N   
2193 C CA  . GLU A 290 ? 1.0443 1.6971 1.6018 -0.3198 0.2808  -0.4776 290 GLU A CA  
2194 C C   . GLU A 290 ? 0.7340 1.3875 1.2670 -0.3183 0.2855  -0.4918 290 GLU A C   
2195 O O   . GLU A 290 ? 0.7693 1.4162 1.2849 -0.3216 0.2890  -0.4878 290 GLU A O   
2196 C CB  . GLU A 290 ? 1.6469 2.2920 2.2014 -0.3247 0.2811  -0.4700 290 GLU A CB  
2197 C CG  . GLU A 290 ? 2.0757 2.7174 2.6527 -0.3283 0.2758  -0.4500 290 GLU A CG  
2198 C CD  . GLU A 290 ? 2.2700 2.9050 2.8468 -0.3330 0.2748  -0.4440 290 GLU A CD  
2199 O OE1 . GLU A 290 ? 2.3918 3.0243 2.9499 -0.3334 0.2792  -0.4542 290 GLU A OE1 
2200 O OE2 . GLU A 290 ? 2.2405 2.8724 2.8361 -0.3367 0.2689  -0.4288 290 GLU A OE2 
2201 N N   . SER A 291 ? 0.6970 1.3585 1.2292 -0.3137 0.2845  -0.5081 291 SER A N   
2202 C CA  . SER A 291 ? 0.6973 1.3600 1.2079 -0.3131 0.2871  -0.5221 291 SER A CA  
2203 C C   . SER A 291 ? 0.8864 1.5465 1.3908 -0.3140 0.2894  -0.5103 291 SER A C   
2204 O O   . SER A 291 ? 0.8817 1.5449 1.4001 -0.3118 0.2882  -0.5010 291 SER A O   
2205 C CB  . SER A 291 ? 0.6738 1.3461 1.1869 -0.3082 0.2845  -0.5413 291 SER A CB  
2206 O OG  . SER A 291 ? 0.6940 1.3707 1.2217 -0.3057 0.2812  -0.5487 291 SER A OG  
2207 N N   . ASP A 292 ? 1.0095 1.6641 1.4935 -0.3174 0.2922  -0.5106 292 ASP A N   
2208 C CA  . ASP A 292 ? 1.1833 1.8361 1.6591 -0.3180 0.2941  -0.5027 292 ASP A CA  
2209 C C   . ASP A 292 ? 1.2546 1.9117 1.7141 -0.3174 0.2936  -0.5202 292 ASP A C   
2210 O O   . ASP A 292 ? 1.2818 1.9440 1.7387 -0.3162 0.2914  -0.5378 292 ASP A O   
2211 C CB  . ASP A 292 ? 1.5230 2.1662 1.9902 -0.3225 0.2967  -0.4868 292 ASP A CB  
2212 C CG  . ASP A 292 ? 1.8805 2.5186 2.3300 -0.3262 0.2977  -0.4949 292 ASP A CG  
2213 O OD1 . ASP A 292 ? 1.9364 2.5783 2.3768 -0.3259 0.2965  -0.5137 292 ASP A OD1 
2214 O OD2 . ASP A 292 ? 2.0755 2.7059 2.5205 -0.3297 0.2994  -0.4825 292 ASP A OD2 
2215 N N   . ARG A 293 ? 1.4086 2.0638 1.8578 -0.3186 0.2951  -0.5149 293 ARG A N   
2216 C CA  . ARG A 293 ? 1.6170 2.2766 2.0523 -0.3187 0.2938  -0.5292 293 ARG A CA  
2217 C C   . ARG A 293 ? 1.7424 2.4008 2.1614 -0.3226 0.2925  -0.5440 293 ARG A C   
2218 O O   . ARG A 293 ? 2.2028 2.8668 2.6133 -0.3231 0.2898  -0.5590 293 ARG A O   
2219 C CB  . ARG A 293 ? 1.8231 2.4802 2.2510 -0.3197 0.2956  -0.5187 293 ARG A CB  
2220 C CG  . ARG A 293 ? 1.6284 2.2774 2.0391 -0.3247 0.2972  -0.5137 293 ARG A CG  
2221 C CD  . ARG A 293 ? 1.5638 2.2088 1.9735 -0.3249 0.2995  -0.4970 293 ARG A CD  
2222 N NE  . ARG A 293 ? 1.4703 2.1081 1.8870 -0.3262 0.3016  -0.4790 293 ARG A NE  
2223 C CZ  . ARG A 293 ? 1.3592 1.9978 1.7945 -0.3241 0.3015  -0.4691 293 ARG A CZ  
2224 N NH1 . ARG A 293 ? 1.3669 2.0130 1.8155 -0.3202 0.2997  -0.4760 293 ARG A NH1 
2225 N NH2 . ARG A 293 ? 1.2576 1.8897 1.6988 -0.3261 0.3026  -0.4523 293 ARG A NH2 
2226 N N   . ASP A 294 ? 1.4460 2.0975 1.8614 -0.3256 0.2939  -0.5395 294 ASP A N   
2227 C CA  . ASP A 294 ? 1.1318 1.7816 1.5321 -0.3297 0.2926  -0.5523 294 ASP A CA  
2228 C C   . ASP A 294 ? 1.0127 1.6604 1.4183 -0.3300 0.2925  -0.5551 294 ASP A C   
2229 O O   . ASP A 294 ? 1.0402 1.6806 1.4386 -0.3335 0.2942  -0.5496 294 ASP A O   
2230 C CB  . ASP A 294 ? 1.3757 2.0183 1.7594 -0.3343 0.2941  -0.5456 294 ASP A CB  
2231 C CG  . ASP A 294 ? 1.3074 1.9417 1.6952 -0.3348 0.2976  -0.5247 294 ASP A CG  
2232 O OD1 . ASP A 294 ? 1.5497 2.1772 1.9251 -0.3386 0.2988  -0.5193 294 ASP A OD1 
2233 O OD2 . ASP A 294 ? 1.4670 2.1020 1.8713 -0.3317 0.2986  -0.5136 294 ASP A OD2 
2234 N N   . GLY A 295 ? 0.9223 1.5766 1.3408 -0.3263 0.2905  -0.5640 295 GLY A N   
2235 C CA  . GLY A 295 ? 0.8942 1.5476 1.3193 -0.3261 0.2901  -0.5676 295 GLY A CA  
2236 C C   . GLY A 295 ? 0.8327 1.4920 1.2790 -0.3208 0.2887  -0.5675 295 GLY A C   
2237 O O   . GLY A 295 ? 0.9052 1.5653 1.3650 -0.3183 0.2894  -0.5544 295 GLY A O   
2238 N N   . LEU A 296 ? 0.7711 1.4351 1.2211 -0.3193 0.2861  -0.5824 296 LEU A N   
2239 C CA  . LEU A 296 ? 0.7042 1.3738 1.1750 -0.3144 0.2841  -0.5835 296 LEU A CA  
2240 C C   . LEU A 296 ? 0.6926 1.3572 1.1724 -0.3157 0.2849  -0.5748 296 LEU A C   
2241 O O   . LEU A 296 ? 0.6896 1.3510 1.1595 -0.3184 0.2853  -0.5817 296 LEU A O   
2242 C CB  . LEU A 296 ? 0.7451 1.4236 1.2156 -0.3115 0.2801  -0.6055 296 LEU A CB  
2243 C CG  . LEU A 296 ? 0.9168 1.6029 1.4086 -0.3053 0.2771  -0.6096 296 LEU A CG  
2244 C CD1 . LEU A 296 ? 1.0672 1.7628 1.5564 -0.3026 0.2728  -0.6306 296 LEU A CD1 
2245 C CD2 . LEU A 296 ? 0.8935 1.5774 1.3965 -0.3050 0.2767  -0.6071 296 LEU A CD2 
2246 N N   . ARG A 297 ? 0.7006 1.3646 1.1998 -0.3143 0.2845  -0.5588 297 ARG A N   
2247 C CA  . ARG A 297 ? 0.7202 1.3798 1.2303 -0.3163 0.2840  -0.5486 297 ARG A CA  
2248 C C   . ARG A 297 ? 0.7700 1.4333 1.3072 -0.3140 0.2799  -0.5381 297 ARG A C   
2249 O O   . ARG A 297 ? 0.7828 1.4452 1.3300 -0.3145 0.2794  -0.5226 297 ARG A O   
2250 C CB  . ARG A 297 ? 0.8700 1.5198 1.3707 -0.3217 0.2872  -0.5320 297 ARG A CB  
2251 C CG  . ARG A 297 ? 1.1299 1.7754 1.6482 -0.3241 0.2854  -0.5141 297 ARG A CG  
2252 C CD  . ARG A 297 ? 1.3594 1.9953 1.8670 -0.3293 0.2884  -0.4995 297 ARG A CD  
2253 N NE  . ARG A 297 ? 1.5216 2.1536 2.0222 -0.3319 0.2890  -0.5043 297 ARG A NE  
2254 C CZ  . ARG A 297 ? 1.6540 2.2820 2.1668 -0.3347 0.2869  -0.4923 297 ARG A CZ  
2255 N NH1 . ARG A 297 ? 1.8252 2.4524 2.3584 -0.3360 0.2833  -0.4745 297 ARG A NH1 
2256 N NH2 . ARG A 297 ? 1.5794 2.2042 2.0844 -0.3368 0.2879  -0.4979 297 ARG A NH2 
2257 N N   . ILE A 298 ? 0.7576 1.4251 1.3074 -0.3120 0.2763  -0.5465 298 ILE A N   
2258 C CA  . ILE A 298 ? 0.7783 1.4487 1.3555 -0.3111 0.2703  -0.5365 298 ILE A CA  
2259 C C   . ILE A 298 ? 0.7972 1.4617 1.3827 -0.3157 0.2679  -0.5264 298 ILE A C   
2260 O O   . ILE A 298 ? 0.8016 1.4653 1.3785 -0.3160 0.2691  -0.5372 298 ILE A O   
2261 C CB  . ILE A 298 ? 0.7917 1.4750 1.3821 -0.3072 0.2681  -0.5604 298 ILE A CB  
2262 C CG1 . ILE A 298 ? 0.7713 1.4594 1.3516 -0.3019 0.2692  -0.5692 298 ILE A CG1 
2263 C CG2 . ILE A 298 ? 0.8227 1.5139 1.4462 -0.3110 0.2646  -0.5628 298 ILE A CG2 
2264 C CD1 . ILE A 298 ? 0.8554 1.5587 1.4436 -0.2995 0.2694  -0.6024 298 ILE A CD1 
2265 N N   . ALA A 299 ? 0.8085 1.4685 1.4106 -0.3197 0.2639  -0.5054 299 ALA A N   
2266 C CA  . ALA A 299 ? 0.8281 1.4817 1.4400 -0.3250 0.2599  -0.4936 299 ALA A CA  
2267 C C   . ALA A 299 ? 0.8606 1.5224 1.5033 -0.3286 0.2538  -0.5029 299 ALA A C   
2268 O O   . ALA A 299 ? 0.8878 1.5527 1.5482 -0.3301 0.2502  -0.4978 299 ALA A O   
2269 N N   . ILE A 300 ? 0.8834 1.5493 1.5332 -0.3307 0.2532  -0.5199 300 ILE A N   
2270 C CA  . ILE A 300 ? 0.9952 1.6671 1.6751 -0.3356 0.2464  -0.5298 300 ILE A CA  
2271 C C   . ILE A 300 ? 1.0680 1.7282 1.7523 -0.3425 0.2410  -0.5116 300 ILE A C   
2272 O O   . ILE A 300 ? 1.1399 1.7997 1.8197 -0.3433 0.2420  -0.5209 300 ILE A O   
2273 C CB  . ILE A 300 ? 1.1461 1.8316 1.8325 -0.3323 0.2482  -0.5638 300 ILE A CB  
2274 C CG1 . ILE A 300 ? 1.1182 1.8151 1.7989 -0.3252 0.2530  -0.5827 300 ILE A CG1 
2275 C CG2 . ILE A 300 ? 1.2889 1.9786 2.0070 -0.3368 0.2388  -0.5730 300 ILE A CG2 
2276 C CD1 . ILE A 300 ? 1.1121 1.8230 1.7986 -0.3211 0.2543  -0.6162 300 ILE A CD1 
2277 N N   . GLU A 301 ? 1.1001 1.7507 1.7925 -0.3473 0.2351  -0.4853 301 GLU A N   
2278 C CA  . GLU A 301 ? 1.2454 1.8837 1.9419 -0.3543 0.2286  -0.4651 301 GLU A CA  
2279 C C   . GLU A 301 ? 1.6600 2.2998 2.3821 -0.3603 0.2195  -0.4771 301 GLU A C   
2280 O O   . GLU A 301 ? 1.7416 2.3868 2.4856 -0.3618 0.2135  -0.4867 301 GLU A O   
2281 C CB  . GLU A 301 ? 1.1940 1.8218 1.8920 -0.3574 0.2239  -0.4341 301 GLU A CB  
2282 C CG  . GLU A 301 ? 1.3128 1.9267 2.0086 -0.3632 0.2182  -0.4097 301 GLU A CG  
2283 C CD  . GLU A 301 ? 1.3949 2.0003 2.0899 -0.3657 0.2155  -0.3818 301 GLU A CD  
2284 O OE1 . GLU A 301 ? 1.5056 2.1049 2.2191 -0.3720 0.2045  -0.3674 301 GLU A OE1 
2285 O OE2 . GLU A 301 ? 1.3118 1.9182 1.9892 -0.3634 0.2264  -0.3805 301 GLU A OE2 
2286 N N   . LEU A 302 ? 1.9868 2.6209 2.7061 -0.3636 0.2176  -0.4763 302 LEU A N   
2287 C CA  . LEU A 302 ? 2.2182 2.8516 2.9601 -0.3692 0.2077  -0.4871 302 LEU A CA  
2288 C C   . LEU A 302 ? 2.2141 2.8317 2.9660 -0.3783 0.1964  -0.4616 302 LEU A C   
2289 O O   . LEU A 302 ? 2.0969 2.7050 2.8351 -0.3797 0.1979  -0.4369 302 LEU A O   
2290 C CB  . LEU A 302 ? 2.2190 2.8579 2.9532 -0.3666 0.2123  -0.5078 302 LEU A CB  
2291 C CG  . LEU A 302 ? 1.9529 2.6077 2.6789 -0.3579 0.2220  -0.5349 302 LEU A CG  
2292 C CD1 . LEU A 302 ? 1.8704 2.5292 2.5802 -0.3544 0.2291  -0.5504 302 LEU A CD1 
2293 C CD2 . LEU A 302 ? 1.7972 2.4624 2.5482 -0.3567 0.2156  -0.5564 302 LEU A CD2 
2294 N N   . LYS A 303 ? 2.2025 2.8166 2.9782 -0.3841 0.1840  -0.4676 303 LYS A N   
2295 C CA  . LYS A 303 ? 1.9902 2.5880 2.7758 -0.3933 0.1715  -0.4459 303 LYS A CA  
2296 C C   . LYS A 303 ? 1.8781 2.4688 2.6531 -0.3958 0.1717  -0.4413 303 LYS A C   
2297 O O   . LYS A 303 ? 1.9305 2.5293 2.6966 -0.3912 0.1789  -0.4602 303 LYS A O   
2298 C CB  . LYS A 303 ? 1.8271 2.4207 2.6395 -0.3984 0.1566  -0.4558 303 LYS A CB  
2299 C CG  . LYS A 303 ? 1.6026 2.1987 2.4285 -0.3982 0.1527  -0.4539 303 LYS A CG  
2300 C CD  . LYS A 303 ? 1.4637 2.0569 2.3147 -0.4009 0.1382  -0.4705 303 LYS A CD  
2301 C CE  . LYS A 303 ? 1.4034 1.9963 2.2691 -0.4017 0.1323  -0.4666 303 LYS A CE  
2302 N NZ  . LYS A 303 ? 1.4395 2.0302 2.3277 -0.4022 0.1184  -0.4870 303 LYS A NZ  
2303 N N   . LYS A 304 ? 1.7383 2.3138 2.5140 -0.4030 0.1635  -0.4162 304 LYS A N   
2304 C CA  . LYS A 304 ? 1.7623 2.3296 2.5308 -0.4064 0.1614  -0.4104 304 LYS A CA  
2305 C C   . LYS A 304 ? 1.8495 2.4176 2.6320 -0.4084 0.1541  -0.4334 304 LYS A C   
2306 O O   . LYS A 304 ? 1.9954 2.5591 2.7980 -0.4124 0.1421  -0.4398 304 LYS A O   
2307 C CB  . LYS A 304 ? 1.8047 2.3553 2.5748 -0.4143 0.1515  -0.3799 304 LYS A CB  
2308 N N   . ASP A 305 ? 1.7753 2.3479 2.5466 -0.4054 0.1607  -0.4458 305 ASP A N   
2309 C CA  . ASP A 305 ? 1.7738 2.3469 2.5570 -0.4066 0.1537  -0.4672 305 ASP A CA  
2310 C C   . ASP A 305 ? 1.7155 2.3023 2.5106 -0.4009 0.1544  -0.4947 305 ASP A C   
2311 O O   . ASP A 305 ? 1.8813 2.4646 2.6950 -0.4030 0.1420  -0.5075 305 ASP A O   
2312 C CB  . ASP A 305 ? 1.8769 2.4320 2.6756 -0.4162 0.1359  -0.4544 305 ASP A CB  
2313 N N   . ALA A 306 ? 1.5964 2.1976 2.3796 -0.3931 0.1683  -0.5034 306 ALA A N   
2314 C CA  . ALA A 306 ? 1.6087 2.2251 2.4003 -0.3864 0.1711  -0.5302 306 ALA A CA  
2315 C C   . ALA A 306 ? 1.6885 2.3178 2.4669 -0.3794 0.1821  -0.5528 306 ALA A C   
2316 O O   . ALA A 306 ? 1.4291 2.0602 2.1853 -0.3768 0.1939  -0.5467 306 ALA A O   
2317 C CB  . ALA A 306 ? 1.5840 2.2072 2.3714 -0.3826 0.1783  -0.5246 306 ALA A CB  
2318 N N   . ASN A 307 ? 2.0495 2.6870 2.8411 -0.3760 0.1773  -0.5788 307 ASN A N   
2326 N N   . THR A 308 ? 2.9763 2.4154 3.8738 -0.2893 -0.4448 0.2405  308 THR A N   
2327 C CA  . THR A 308 ? 2.9260 2.3656 3.8162 -0.2922 -0.4374 0.2325  308 THR A CA  
2328 C C   . THR A 308 ? 2.6042 2.0429 3.4838 -0.2936 -0.4461 0.2209  308 THR A C   
2329 O O   . THR A 308 ? 2.5024 1.9388 3.3754 -0.2945 -0.4452 0.2134  308 THR A O   
2330 C CB  . THR A 308 ? 2.1961 1.6426 3.0886 -0.2957 -0.4205 0.2343  308 THR A CB  
2331 O OG1 . THR A 308 ? 2.2562 1.7081 3.1425 -0.2993 -0.4185 0.2269  308 THR A OG1 
2332 C CG2 . THR A 308 ? 2.3099 1.7594 3.2125 -0.2945 -0.4148 0.2454  308 THR A CG2 
2333 N N   . GLU A 309 ? 2.3513 1.7918 3.2290 -0.2935 -0.4546 0.2189  309 GLU A N   
2334 C CA  . GLU A 309 ? 2.2899 1.7295 3.1570 -0.2946 -0.4629 0.2077  309 GLU A CA  
2335 C C   . GLU A 309 ? 2.3231 1.7548 3.1862 -0.2913 -0.4757 0.2044  309 GLU A C   
2336 O O   . GLU A 309 ? 2.3026 1.7323 3.1565 -0.2922 -0.4789 0.1945  309 GLU A O   
2337 C CB  . GLU A 309 ? 2.2433 1.6865 3.1090 -0.2952 -0.4690 0.2067  309 GLU A CB  
2338 N N   . LEU A 310 ? 2.5470 1.9744 3.4168 -0.2874 -0.4830 0.2124  310 LEU A N   
2339 C CA  . LEU A 310 ? 2.9120 2.3316 3.7782 -0.2839 -0.4956 0.2099  310 LEU A CA  
2340 C C   . LEU A 310 ? 2.8064 2.2222 3.6697 -0.2841 -0.4900 0.2066  310 LEU A C   
2341 O O   . LEU A 310 ? 2.6640 2.0758 3.5185 -0.2837 -0.4968 0.1976  310 LEU A O   
2342 C CB  . LEU A 310 ? 3.2912 2.7073 4.1658 -0.2798 -0.5036 0.2196  310 LEU A CB  
2343 N N   . VAL A 311 ? 2.8139 2.2312 3.6842 -0.2847 -0.4774 0.2137  311 VAL A N   
2344 C CA  . VAL A 311 ? 2.7553 2.1692 3.6238 -0.2849 -0.4708 0.2116  311 VAL A CA  
2345 C C   . VAL A 311 ? 2.9009 2.3172 3.7597 -0.2885 -0.4669 0.1997  311 VAL A C   
2346 O O   . VAL A 311 ? 3.0257 2.4370 3.8778 -0.2877 -0.4713 0.1925  311 VAL A O   
2347 C CB  . VAL A 311 ? 2.5160 1.9324 3.3935 -0.2853 -0.4563 0.2212  311 VAL A CB  
2348 C CG1 . VAL A 311 ? 2.4124 1.8272 3.2868 -0.2867 -0.4470 0.2174  311 VAL A CG1 
2349 C CG2 . VAL A 311 ? 2.4413 1.8538 3.3275 -0.2812 -0.4604 0.2320  311 VAL A CG2 
2350 N N   . LEU A 312 ? 2.8548 2.2787 3.7127 -0.2923 -0.4589 0.1974  312 LEU A N   
2351 C CA  . LEU A 312 ? 2.7154 2.1428 3.5646 -0.2961 -0.4539 0.1861  312 LEU A CA  
2352 C C   . LEU A 312 ? 2.6389 2.0628 3.4775 -0.2952 -0.4674 0.1749  312 LEU A C   
2353 O O   . LEU A 312 ? 2.7693 2.1908 3.6009 -0.2958 -0.4681 0.1662  312 LEU A O   
2354 C CB  . LEU A 312 ? 2.5679 2.0040 3.4177 -0.3000 -0.4447 0.1857  312 LEU A CB  
2355 C CG  . LEU A 312 ? 2.3999 1.8405 3.2428 -0.3042 -0.4352 0.1760  312 LEU A CG  
2356 C CD1 . LEU A 312 ? 2.3573 1.7950 3.2020 -0.3041 -0.4271 0.1769  312 LEU A CD1 
2357 C CD2 . LEU A 312 ? 2.2900 1.7392 3.1348 -0.3079 -0.4240 0.1774  312 LEU A CD2 
2358 N N   . ASN A 313 ? 2.3333 1.7572 3.1706 -0.2939 -0.4781 0.1749  313 ASN A N   
2359 C CA  . ASN A 313 ? 2.0489 1.4695 2.8761 -0.2926 -0.4918 0.1648  313 ASN A CA  
2360 C C   . ASN A 313 ? 2.0023 1.4145 2.8264 -0.2891 -0.5005 0.1625  313 ASN A C   
2361 O O   . ASN A 313 ? 1.9498 1.3599 2.7637 -0.2893 -0.5058 0.1512  313 ASN A O   
2362 C CB  . ASN A 313 ? 2.0901 1.5112 2.9181 -0.2909 -0.5022 0.1677  313 ASN A CB  
2363 C CG  . ASN A 313 ? 2.0730 1.5016 2.8968 -0.2945 -0.4984 0.1626  313 ASN A CG  
2364 O OD1 . ASN A 313 ? 1.9206 1.3551 2.7442 -0.2983 -0.4858 0.1605  313 ASN A OD1 
2365 N ND2 . ASN A 313 ? 2.2167 1.6449 3.0370 -0.2931 -0.5095 0.1607  313 ASN A ND2 
2366 N N   . TYR A 314 ? 2.1786 1.5859 3.0110 -0.2859 -0.5018 0.1727  314 TYR A N   
2367 C CA  . TYR A 314 ? 2.3820 1.7807 3.2117 -0.2823 -0.5099 0.1713  314 TYR A CA  
2368 C C   . TYR A 314 ? 2.6988 2.0965 3.5242 -0.2840 -0.5019 0.1648  314 TYR A C   
2369 O O   . TYR A 314 ? 2.7938 2.1865 3.6106 -0.2826 -0.5097 0.1558  314 TYR A O   
2370 C CB  . TYR A 314 ? 2.2309 1.6252 3.0707 -0.2786 -0.5117 0.1839  314 TYR A CB  
2371 C CG  . TYR A 314 ? 2.0911 1.4764 2.9281 -0.2749 -0.5193 0.1826  314 TYR A CG  
2372 C CD1 . TYR A 314 ? 2.0770 1.4594 2.9159 -0.2748 -0.5105 0.1843  314 TYR A CD1 
2373 C CD2 . TYR A 314 ? 2.0675 1.4471 2.8994 -0.2714 -0.5354 0.1792  314 TYR A CD2 
2374 C CE1 . TYR A 314 ? 2.0749 1.4486 2.9106 -0.2712 -0.5175 0.1829  314 TYR A CE1 
2375 C CE2 . TYR A 314 ? 2.0970 1.4680 2.9257 -0.2678 -0.5425 0.1777  314 TYR A CE2 
2376 C CZ  . TYR A 314 ? 2.1349 1.5030 2.9655 -0.2677 -0.5335 0.1796  314 TYR A CZ  
2377 O OH  . TYR A 314 ? 2.2671 1.6263 3.0941 -0.2641 -0.5406 0.1780  314 TYR A OH  
2378 N N   . LEU A 315 ? 2.8203 2.2226 3.6514 -0.2869 -0.4866 0.1692  315 LEU A N   
2379 C CA  . LEU A 315 ? 2.8486 2.2508 3.6762 -0.2888 -0.4778 0.1634  315 LEU A CA  
2380 C C   . LEU A 315 ? 2.7335 2.1393 3.5496 -0.2918 -0.4797 0.1486  315 LEU A C   
2381 O O   . LEU A 315 ? 2.6369 2.0399 3.4463 -0.2919 -0.4808 0.1398  315 LEU A O   
2382 C CB  . LEU A 315 ? 2.8767 2.2840 3.7126 -0.2914 -0.4606 0.1711  315 LEU A CB  
2383 C CG  . LEU A 315 ? 2.8507 2.2542 3.6970 -0.2884 -0.4570 0.1846  315 LEU A CG  
2384 C CD1 . LEU A 315 ? 2.8202 2.2300 3.6740 -0.2910 -0.4400 0.1919  315 LEU A CD1 
2385 C CD2 . LEU A 315 ? 2.8102 2.2047 3.6550 -0.2849 -0.4616 0.1845  315 LEU A CD2 
2386 N N   . PHE A 316 ? 2.6616 2.0738 3.4754 -0.2942 -0.4803 0.1456  316 PHE A N   
2387 C CA  . PHE A 316 ? 2.5086 1.9251 3.3112 -0.2970 -0.4818 0.1313  316 PHE A CA  
2388 C C   . PHE A 316 ? 2.3761 1.7864 3.1685 -0.2940 -0.4968 0.1216  316 PHE A C   
2389 O O   . PHE A 316 ? 2.2082 1.6199 2.9909 -0.2954 -0.4973 0.1088  316 PHE A O   
2390 C CB  . PHE A 316 ? 2.5409 1.9647 3.3422 -0.2996 -0.4807 0.1303  316 PHE A CB  
2391 C CG  . PHE A 316 ? 2.7219 2.1538 3.5282 -0.3039 -0.4646 0.1334  316 PHE A CG  
2392 C CD1 . PHE A 316 ? 2.8985 2.3355 3.7095 -0.3052 -0.4614 0.1395  316 PHE A CD1 
2393 C CD2 . PHE A 316 ? 2.8189 2.2533 3.6249 -0.3067 -0.4528 0.1299  316 PHE A CD2 
2394 C CE1 . PHE A 316 ? 3.0420 2.4862 3.8569 -0.3090 -0.4468 0.1422  316 PHE A CE1 
2395 C CE2 . PHE A 316 ? 2.9597 2.4018 3.7699 -0.3106 -0.4381 0.1327  316 PHE A CE2 
2396 C CZ  . PHE A 316 ? 3.0562 2.5031 3.8706 -0.3117 -0.4350 0.1388  316 PHE A CZ  
2397 N N   . LYS A 317 ? 2.4515 1.8555 3.2458 -0.2897 -0.5090 0.1272  317 LYS A N   
2398 C CA  . LYS A 317 ? 2.4809 1.8793 3.2654 -0.2864 -0.5244 0.1185  317 LYS A CA  
2399 C C   . LYS A 317 ? 2.6431 2.0332 3.4265 -0.2833 -0.5280 0.1178  317 LYS A C   
2400 O O   . LYS A 317 ? 2.5089 1.8962 3.2817 -0.2822 -0.5351 0.1061  317 LYS A O   
2401 C CB  . LYS A 317 ? 2.3416 1.7377 3.1281 -0.2834 -0.5364 0.1243  317 LYS A CB  
2402 C CG  . LYS A 317 ? 2.4513 1.8400 3.2298 -0.2789 -0.5534 0.1186  317 LYS A CG  
2403 C CD  . LYS A 317 ? 3.0130 2.4020 3.7914 -0.2770 -0.5644 0.1214  317 LYS A CD  
2404 C CE  . LYS A 317 ? 3.3025 2.6830 4.0800 -0.2717 -0.5794 0.1240  317 LYS A CE  
2405 N NZ  . LYS A 317 ? 3.5632 2.9403 4.3268 -0.2694 -0.5917 0.1110  317 LYS A NZ  
2406 N N   . TYR A 318 ? 2.8058 2.1922 3.5997 -0.2818 -0.5226 0.1299  318 TYR A N   
2407 C CA  . TYR A 318 ? 2.6095 1.9870 3.4031 -0.2783 -0.5266 0.1310  318 TYR A CA  
2408 C C   . TYR A 318 ? 2.3385 1.7158 3.1337 -0.2801 -0.5141 0.1301  318 TYR A C   
2409 O O   . TYR A 318 ? 2.1110 1.4808 2.9064 -0.2772 -0.5159 0.1316  318 TYR A O   
2410 C CB  . TYR A 318 ? 2.4979 1.8701 3.3008 -0.2743 -0.5317 0.1445  318 TYR A CB  
2411 C CG  . TYR A 318 ? 2.3002 1.6697 3.0990 -0.2713 -0.5474 0.1428  318 TYR A CG  
2412 C CD1 . TYR A 318 ? 2.2190 1.5807 3.0099 -0.2674 -0.5606 0.1367  318 TYR A CD1 
2413 C CD2 . TYR A 318 ? 2.2051 1.5799 3.0074 -0.2723 -0.5492 0.1469  318 TYR A CD2 
2414 C CE1 . TYR A 318 ? 2.2096 1.5689 2.9963 -0.2647 -0.5749 0.1349  318 TYR A CE1 
2415 C CE2 . TYR A 318 ? 2.1835 1.5559 2.9820 -0.2696 -0.5636 0.1453  318 TYR A CE2 
2416 C CZ  . TYR A 318 ? 2.2597 1.6245 3.0504 -0.2658 -0.5764 0.1393  318 TYR A CZ  
2417 O OH  . TYR A 318 ? 2.3887 1.7512 3.1752 -0.2629 -0.5908 0.1376  318 TYR A OH  
2418 N N   . THR A 319 ? 2.2815 1.6670 3.0777 -0.2848 -0.5013 0.1278  319 THR A N   
2419 C CA  . THR A 319 ? 2.1886 1.5749 2.9841 -0.2869 -0.4903 0.1239  319 THR A CA  
2420 C C   . THR A 319 ? 2.1194 1.5135 2.9063 -0.2913 -0.4862 0.1102  319 THR A C   
2421 O O   . THR A 319 ? 2.1189 1.5167 2.8987 -0.2921 -0.4936 0.1025  319 THR A O   
2422 C CB  . THR A 319 ? 1.9493 1.3377 2.7569 -0.2882 -0.4750 0.1368  319 THR A CB  
2423 O OG1 . THR A 319 ? 1.9348 1.3328 2.7462 -0.2924 -0.4652 0.1391  319 THR A OG1 
2424 C CG2 . THR A 319 ? 1.9924 1.3747 2.8085 -0.2840 -0.4787 0.1503  319 THR A CG2 
2425 N N   . ASP A 320 ? 2.2995 1.6961 3.0867 -0.2940 -0.4747 0.1069  320 ASP A N   
2426 C CA  . ASP A 320 ? 2.5411 1.9459 3.3210 -0.2983 -0.4689 0.0941  320 ASP A CA  
2427 C C   . ASP A 320 ? 2.3134 1.7273 3.1005 -0.3027 -0.4544 0.1002  320 ASP A C   
2428 O O   . ASP A 320 ? 2.2156 1.6373 2.9990 -0.3069 -0.4460 0.0919  320 ASP A O   
2429 C CB  . ASP A 320 ? 2.9029 2.3054 3.6781 -0.2986 -0.4654 0.0854  320 ASP A CB  
2430 C CG  . ASP A 320 ? 3.0367 2.4324 3.8009 -0.2948 -0.4805 0.0744  320 ASP A CG  
2431 O OD1 . ASP A 320 ? 2.9748 2.3693 3.7336 -0.2927 -0.4929 0.0715  320 ASP A OD1 
2432 O OD2 . ASP A 320 ? 3.1264 2.5180 3.8869 -0.2938 -0.4800 0.0683  320 ASP A OD2 
2433 N N   . LEU A 321 ? 2.1400 1.5533 2.9370 -0.3017 -0.4516 0.1143  321 LEU A N   
2434 C CA  . LEU A 321 ? 1.9366 1.3586 2.7393 -0.3054 -0.4403 0.1197  321 LEU A CA  
2435 C C   . LEU A 321 ? 1.8304 1.2592 2.6242 -0.3082 -0.4440 0.1085  321 LEU A C   
2436 O O   . LEU A 321 ? 1.8117 1.2490 2.6062 -0.3123 -0.4338 0.1072  321 LEU A O   
2437 C CB  . LEU A 321 ? 1.9086 1.3288 2.7210 -0.3031 -0.4414 0.1343  321 LEU A CB  
2438 C CG  . LEU A 321 ? 1.9573 1.3826 2.7796 -0.3052 -0.4258 0.1450  321 LEU A CG  
2439 C CD1 . LEU A 321 ? 2.0626 1.4944 2.8876 -0.3069 -0.4243 0.1489  321 LEU A CD1 
2440 C CD2 . LEU A 321 ? 1.8890 1.3192 2.7097 -0.3091 -0.4123 0.1394  321 LEU A CD2 
2441 N N   . GLN A 322 ? 1.8293 1.2542 2.6144 -0.3057 -0.4588 0.1004  322 GLN A N   
2442 C CA  . GLN A 322 ? 1.8048 1.2350 2.5795 -0.3074 -0.4643 0.0881  322 GLN A CA  
2443 C C   . GLN A 322 ? 1.8016 1.2267 2.5653 -0.3045 -0.4775 0.0763  322 GLN A C   
2444 O O   . GLN A 322 ? 1.8988 1.3154 2.6632 -0.3000 -0.4886 0.0806  322 GLN A O   
2445 C CB  . GLN A 322 ? 2.2829 1.7147 3.0594 -0.3067 -0.4702 0.0936  322 GLN A CB  
2446 C CG  . GLN A 322 ? 2.6198 2.0559 3.3842 -0.3076 -0.4779 0.0808  322 GLN A CG  
2447 C CD  . GLN A 322 ? 3.0381 2.4754 3.8043 -0.3068 -0.4838 0.0864  322 GLN A CD  
2448 O OE1 . GLN A 322 ? 2.9706 2.4102 3.7463 -0.3079 -0.4768 0.0974  322 GLN A OE1 
2449 N NE2 . GLN A 322 ? 3.3798 2.8156 4.1366 -0.3047 -0.4968 0.0786  322 GLN A NE2 
2450 N N   . ILE A 323 ? 1.7732 1.2040 2.5263 -0.3069 -0.4765 0.0614  323 ILE A N   
2451 C CA  . ILE A 323 ? 2.0881 1.5163 2.8286 -0.3046 -0.4876 0.0473  323 ILE A CA  
2452 C C   . ILE A 323 ? 1.8345 1.2703 2.5631 -0.3061 -0.4917 0.0341  323 ILE A C   
2453 O O   . ILE A 323 ? 1.7733 1.2170 2.5030 -0.3098 -0.4838 0.0343  323 ILE A O   
2454 C CB  . ILE A 323 ? 2.5896 2.0188 3.3272 -0.3059 -0.4807 0.0389  323 ILE A CB  
2455 C CG1 . ILE A 323 ? 2.9944 2.4352 3.7279 -0.3111 -0.4694 0.0293  323 ILE A CG1 
2456 C CG2 . ILE A 323 ? 2.6339 2.0571 3.3833 -0.3052 -0.4730 0.0514  323 ILE A CG2 
2457 C CD1 . ILE A 323 ? 3.2326 2.6756 3.9633 -0.3127 -0.4622 0.0203  323 ILE A CD1 
2458 N N   . ASN A 324 ? 1.8582 1.2916 2.5747 -0.3030 -0.5039 0.0224  324 ASN A N   
2459 C CA  . ASN A 324 ? 1.9030 1.3441 2.6059 -0.3040 -0.5072 0.0071  324 ASN A CA  
2460 C C   . ASN A 324 ? 2.1112 1.5580 2.8068 -0.3061 -0.5005 -0.0067 324 ASN A C   
2461 O O   . ASN A 324 ? 2.0600 1.5017 2.7550 -0.3041 -0.5023 -0.0090 324 ASN A O   
2462 C CB  . ASN A 324 ? 1.7877 1.2239 2.4802 -0.2990 -0.5239 0.0008  324 ASN A CB  
2463 C CG  . ASN A 324 ? 1.7766 1.2066 2.4760 -0.2964 -0.5321 0.0139  324 ASN A CG  
2464 O OD1 . ASN A 324 ? 1.7679 1.2007 2.4752 -0.2987 -0.5266 0.0232  324 ASN A OD1 
2465 N ND2 . ASN A 324 ? 1.7928 1.2146 2.4888 -0.2914 -0.5454 0.0141  324 ASN A ND2 
2466 N N   . TYR A 325 ? 2.3943 1.8517 3.0841 -0.3099 -0.4929 -0.0160 325 TYR A N   
2467 C CA  . TYR A 325 ? 2.5666 2.0306 3.2480 -0.3115 -0.4877 -0.0309 325 TYR A CA  
2468 C C   . TYR A 325 ? 2.1609 1.6310 2.8251 -0.3099 -0.4956 -0.0477 325 TYR A C   
2469 O O   . TYR A 325 ? 1.8851 1.3610 2.5455 -0.3114 -0.4952 -0.0496 325 TYR A O   
2470 C CB  . TYR A 325 ? 2.9140 2.3863 3.6017 -0.3173 -0.4708 -0.0296 325 TYR A CB  
2471 C CG  . TYR A 325 ? 2.8145 2.2948 3.4932 -0.3189 -0.4655 -0.0458 325 TYR A CG  
2472 C CD1 . TYR A 325 ? 2.4682 1.9582 3.1336 -0.3198 -0.4663 -0.0609 325 TYR A CD1 
2473 C CD2 . TYR A 325 ? 2.7357 2.2136 3.4186 -0.3191 -0.4599 -0.0464 325 TYR A CD2 
2474 C CE1 . TYR A 325 ? 2.1033 1.6013 2.7597 -0.3209 -0.4615 -0.0765 325 TYR A CE1 
2475 C CE2 . TYR A 325 ? 2.3596 1.8451 3.0341 -0.3203 -0.4553 -0.0620 325 TYR A CE2 
2476 C CZ  . TYR A 325 ? 2.0350 1.5308 2.6961 -0.3211 -0.4562 -0.0772 325 TYR A CZ  
2477 O OH  . TYR A 325 ? 1.5330 1.0372 2.1853 -0.3219 -0.4517 -0.0931 325 TYR A OH  
2478 N N   . ASN A 326 ? 2.0621 1.5313 2.7158 -0.3066 -0.5024 -0.0601 326 ASN A N   
2479 C CA  . ASN A 326 ? 1.8726 1.3480 2.5085 -0.3041 -0.5102 -0.0770 326 ASN A CA  
2480 C C   . ASN A 326 ? 1.6580 1.1448 2.2842 -0.3063 -0.5021 -0.0934 326 ASN A C   
2481 O O   . ASN A 326 ? 1.6977 1.1842 2.3226 -0.3056 -0.4998 -0.0994 326 ASN A O   
2482 C CB  . ASN A 326 ? 1.8470 1.3146 2.4749 -0.2978 -0.5249 -0.0813 326 ASN A CB  
2483 C CG  . ASN A 326 ? 1.8304 1.2888 2.4633 -0.2949 -0.5354 -0.0690 326 ASN A CG  
2484 O OD1 . ASN A 326 ? 2.0600 1.5205 2.6849 -0.2932 -0.5426 -0.0725 326 ASN A OD1 
2485 N ND2 . ASN A 326 ? 1.9158 1.3641 2.5618 -0.2942 -0.5361 -0.0546 326 ASN A ND2 
2486 N N   . PHE A 327 ? 1.6061 1.1029 2.2252 -0.3087 -0.4978 -0.1006 327 PHE A N   
2487 C CA  . PHE A 327 ? 1.6198 1.1284 2.2265 -0.3098 -0.4921 -0.1181 327 PHE A CA  
2488 C C   . PHE A 327 ? 1.5684 1.0773 2.1585 -0.3038 -0.5036 -0.1326 327 PHE A C   
2489 O O   . PHE A 327 ? 1.5874 1.0912 2.1717 -0.2996 -0.5156 -0.1317 327 PHE A O   
2490 C CB  . PHE A 327 ? 1.7575 1.2757 2.3585 -0.3129 -0.4870 -0.1225 327 PHE A CB  
2491 C CG  . PHE A 327 ? 2.0562 1.5773 2.6704 -0.3190 -0.4738 -0.1120 327 PHE A CG  
2492 C CD1 . PHE A 327 ? 2.1221 1.6537 2.7351 -0.3233 -0.46