data_4JVA
# 
_entry.id   4JVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4JVA         
RCSB  RCSB078548   
WWPDB D_1000078548 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1CX4 'Crystal Structure of RIIbeta bound to cAMP'                                                 unspecified 
PDB 4JV4 'Crystal Structure of RIalpha(91-379) bound to HE33, a N6 di-propyl substituted cAMP analog' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4JVA 
_pdbx_database_status.recvd_initial_deposition_date   2013-03-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brown, S.H.J.'  1 
'Cheng, C.Y.'    2 
'Saldanha, A.S.' 3 
'Wu, J.'         4 
'Cottam, H.'     5 
'Sankaran, B.'   6 
'Taylor, S.S.'   7 
# 
_citation.id                        primary 
_citation.title                     
;Implementing Fluorescence Anisotropy Screening and Crystallographic Analysis to Define PKA Isoform-Selective Activation by cAMP Analogs.
;
_citation.journal_abbrev            'Acs Chem.Biol.' 
_citation.journal_volume            8 
_citation.page_first                2164 
_citation.page_last                 2172 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1554-8929 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23978166 
_citation.pdbx_database_id_DOI      10.1021/cb400247t 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brown, S.H.'    1 
primary 'Cheng, C.Y.'    2 
primary 'Saldanha, S.A.' 3 
primary 'Wu, J.'         4 
primary 'Cottam, H.B.'   5 
primary 'Sankaran, B.'   6 
primary 'Taylor, S.S.'   7 
# 
_cell.entry_id           4JVA 
_cell.length_a           54.514 
_cell.length_b           54.514 
_cell.length_c           199.960 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4JVA 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'cAMP-dependent protein kinase type II-beta regulatory subunit' 34157.719 1  ? 'deletion mutant' 
'RIIbeta(108-402) of cAMP-dependent Protein Kinase' ? 
2 non-polymer syn 
'(2R,4aR,6R,7R,7aS)-6-[6-(dipropylamino)-9H-purin-9-yl]tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinine-2,7-diol 2-oxide' 413.365 
2  ? ?                 ?                                                   ? 
3 water       nat water 18.015    71 ? ?                 ?                                                   ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYV
IDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIES
LPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLRGQYFGEL
ALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYV
IDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIES
LPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLRGQYFGEL
ALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   VAL n 
1 3   CYS n 
1 4   ALA n 
1 5   GLU n 
1 6   ALA n 
1 7   TYR n 
1 8   ASN n 
1 9   PRO n 
1 10  ASP n 
1 11  GLU n 
1 12  GLU n 
1 13  GLU n 
1 14  ASP n 
1 15  ASP n 
1 16  ALA n 
1 17  GLU n 
1 18  SER n 
1 19  ARG n 
1 20  ILE n 
1 21  ILE n 
1 22  HIS n 
1 23  PRO n 
1 24  LYS n 
1 25  THR n 
1 26  ASP n 
1 27  ASP n 
1 28  GLN n 
1 29  ARG n 
1 30  ASN n 
1 31  ARG n 
1 32  LEU n 
1 33  GLN n 
1 34  GLU n 
1 35  ALA n 
1 36  CYS n 
1 37  LYS n 
1 38  ASP n 
1 39  ILE n 
1 40  LEU n 
1 41  LEU n 
1 42  PHE n 
1 43  LYS n 
1 44  ASN n 
1 45  LEU n 
1 46  ASP n 
1 47  PRO n 
1 48  GLU n 
1 49  GLN n 
1 50  MET n 
1 51  SER n 
1 52  GLN n 
1 53  VAL n 
1 54  LEU n 
1 55  ASP n 
1 56  ALA n 
1 57  MET n 
1 58  PHE n 
1 59  GLU n 
1 60  LYS n 
1 61  LEU n 
1 62  VAL n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  GLU n 
1 67  HIS n 
1 68  VAL n 
1 69  ILE n 
1 70  ASP n 
1 71  GLN n 
1 72  GLY n 
1 73  ASP n 
1 74  ASP n 
1 75  GLY n 
1 76  ASP n 
1 77  ASN n 
1 78  PHE n 
1 79  TYR n 
1 80  VAL n 
1 81  ILE n 
1 82  ASP n 
1 83  ARG n 
1 84  GLY n 
1 85  THR n 
1 86  PHE n 
1 87  ASP n 
1 88  ILE n 
1 89  TYR n 
1 90  VAL n 
1 91  LYS n 
1 92  CYS n 
1 93  ASP n 
1 94  GLY n 
1 95  VAL n 
1 96  GLY n 
1 97  ARG n 
1 98  CYS n 
1 99  VAL n 
1 100 GLY n 
1 101 ASN n 
1 102 TYR n 
1 103 ASP n 
1 104 ASN n 
1 105 ARG n 
1 106 GLY n 
1 107 SER n 
1 108 PHE n 
1 109 GLY n 
1 110 GLU n 
1 111 LEU n 
1 112 ALA n 
1 113 LEU n 
1 114 MET n 
1 115 TYR n 
1 116 ASN n 
1 117 THR n 
1 118 PRO n 
1 119 ARG n 
1 120 ALA n 
1 121 ALA n 
1 122 THR n 
1 123 ILE n 
1 124 THR n 
1 125 ALA n 
1 126 THR n 
1 127 SER n 
1 128 PRO n 
1 129 GLY n 
1 130 ALA n 
1 131 LEU n 
1 132 TRP n 
1 133 GLY n 
1 134 LEU n 
1 135 ASP n 
1 136 ARG n 
1 137 VAL n 
1 138 THR n 
1 139 PHE n 
1 140 ARG n 
1 141 ARG n 
1 142 ILE n 
1 143 ILE n 
1 144 VAL n 
1 145 LYS n 
1 146 ASN n 
1 147 ASN n 
1 148 ALA n 
1 149 LYS n 
1 150 LYS n 
1 151 ARG n 
1 152 LYS n 
1 153 MET n 
1 154 TYR n 
1 155 GLU n 
1 156 SER n 
1 157 PHE n 
1 158 ILE n 
1 159 GLU n 
1 160 SER n 
1 161 LEU n 
1 162 PRO n 
1 163 PHE n 
1 164 LEU n 
1 165 LYS n 
1 166 SER n 
1 167 LEU n 
1 168 GLU n 
1 169 VAL n 
1 170 SER n 
1 171 GLU n 
1 172 ARG n 
1 173 LEU n 
1 174 LYS n 
1 175 VAL n 
1 176 VAL n 
1 177 ASP n 
1 178 VAL n 
1 179 ILE n 
1 180 GLY n 
1 181 THR n 
1 182 LYS n 
1 183 VAL n 
1 184 TYR n 
1 185 ASN n 
1 186 ASP n 
1 187 GLY n 
1 188 GLU n 
1 189 GLN n 
1 190 ILE n 
1 191 ILE n 
1 192 ALA n 
1 193 GLN n 
1 194 GLY n 
1 195 ASP n 
1 196 SER n 
1 197 ALA n 
1 198 ASP n 
1 199 SER n 
1 200 PHE n 
1 201 PHE n 
1 202 ILE n 
1 203 VAL n 
1 204 GLU n 
1 205 SER n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 ILE n 
1 211 THR n 
1 212 MET n 
1 213 LYS n 
1 214 ARG n 
1 215 LYS n 
1 216 GLY n 
1 217 LYS n 
1 218 SER n 
1 219 ASP n 
1 220 ILE n 
1 221 GLU n 
1 222 GLU n 
1 223 ASN n 
1 224 GLY n 
1 225 ALA n 
1 226 VAL n 
1 227 GLU n 
1 228 ILE n 
1 229 ALA n 
1 230 ARG n 
1 231 CYS n 
1 232 LEU n 
1 233 ARG n 
1 234 GLY n 
1 235 GLN n 
1 236 TYR n 
1 237 PHE n 
1 238 GLY n 
1 239 GLU n 
1 240 LEU n 
1 241 ALA n 
1 242 LEU n 
1 243 VAL n 
1 244 THR n 
1 245 ASN n 
1 246 LYS n 
1 247 PRO n 
1 248 ARG n 
1 249 ALA n 
1 250 ALA n 
1 251 SER n 
1 252 ALA n 
1 253 HIS n 
1 254 ALA n 
1 255 ILE n 
1 256 GLY n 
1 257 THR n 
1 258 VAL n 
1 259 LYS n 
1 260 CYS n 
1 261 LEU n 
1 262 ALA n 
1 263 MET n 
1 264 ASP n 
1 265 VAL n 
1 266 GLN n 
1 267 ALA n 
1 268 PHE n 
1 269 GLU n 
1 270 ARG n 
1 271 LEU n 
1 272 LEU n 
1 273 GLY n 
1 274 PRO n 
1 275 CYS n 
1 276 MET n 
1 277 GLU n 
1 278 ILE n 
1 279 MET n 
1 280 LYS n 
1 281 ARG n 
1 282 ASN n 
1 283 ILE n 
1 284 ALA n 
1 285 THR n 
1 286 TYR n 
1 287 GLU n 
1 288 GLU n 
1 289 GLN n 
1 290 LEU n 
1 291 VAL n 
1 292 ALA n 
1 293 LEU n 
1 294 PHE n 
1 295 GLY n 
1 296 THR n 
1 297 ASN n 
1 298 MET n 
1 299 ASP n 
1 300 ILE n 
1 301 VAL n 
1 302 GLU n 
1 303 PRO n 
1 304 THR n 
1 305 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'brown rat,rat,rats' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Prkar2b 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pRSET 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KAP3_RAT 
_struct_ref.pdbx_db_accession          P12369 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYV
IDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIES
LPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLRGQYFGEL
ALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
;
_struct_ref.pdbx_align_begin           112 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4JVA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 305 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12369 
_struct_ref_seq.db_align_beg                  112 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  416 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       112 
_struct_ref_seq.pdbx_auth_seq_align_end       416 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1OR non-polymer         . 
'(2R,4aR,6R,7R,7aS)-6-[6-(dipropylamino)-9H-purin-9-yl]tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinine-2,7-diol 2-oxide' ? 
'C16 H24 N5 O6 P' 413.365 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4JVA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'vapor diffusion under oil (VDUO)' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;20% PEG 4000, 80 mM Bis-Tris 6.0, and 50 mM MgCl2 using the Oryx crystallization robot (Douglas 
Instruments) in modified microbatch mode, vapor diffusion under oil (VDUO) , temperature 298.0K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-08-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4JVA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.47 
_reflns.number_obs                   15916 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            0.080 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        39.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              25.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.47 
_reflns_shell.d_res_low              2.58 
_reflns_shell.percent_possible_all   88.4 
_reflns_shell.Rmerge_I_obs           0.325 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.5 
_reflns_shell.pdbx_redundancy        19.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4JVA 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     11184 
_refine.ls_number_reflns_all                     15916 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    95.1 
_refine.ls_R_factor_obs                          0.2376 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2376 
_refine.ls_R_factor_R_free                       0.2782 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  490 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -11.351 
_refine.aniso_B[2][2]                            -11.351 
_refine.aniso_B[3][3]                            22.702 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1CX4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ANISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2016 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             71 
_refine_hist.number_atoms_total               2143 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.40  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4JVA 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4JVA 
_struct.title                     'Crystal Structure of RIIbeta(108-402) bound to HE33, a N6 di-propyl substituted cAMP analog' 
_struct.pdbx_descriptor           'cAMP-dependent protein kinase type II-beta regulatory subunit' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4JVA 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            
;cAMP-dependent protein kinase, cyclic nucleotide analogs, isoform selectivity, fluorescence anisotropy, TRANSFERASE-TRANSFERASE INHIBITOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 25  ? LYS A 37  ? THR A 136 LYS A 148 1 ? 13 
HELX_P HELX_P2  2  ILE A 39  ? LYS A 43  ? ILE A 150 LYS A 154 5 ? 5  
HELX_P HELX_P3  3  ASP A 46  ? MET A 57  ? ASP A 157 MET A 168 1 ? 12 
HELX_P HELX_P4  4  GLU A 110 ? ASN A 116 ? GLU A 221 ASN A 227 1 ? 7  
HELX_P HELX_P5  5  ARG A 136 ? GLU A 159 ? ARG A 247 GLU A 270 1 ? 24 
HELX_P HELX_P6  6  SER A 160 ? LYS A 165 ? SER A 271 LYS A 276 5 ? 6  
HELX_P HELX_P7  7  SER A 170 ? LYS A 174 ? SER A 281 LYS A 285 5 ? 5  
HELX_P HELX_P8  8  VAL A 175 ? ILE A 179 ? VAL A 286 ILE A 290 5 ? 5  
HELX_P HELX_P9  9  GLU A 239 ? THR A 244 ? GLU A 350 THR A 355 1 ? 6  
HELX_P HELX_P10 10 VAL A 265 ? LEU A 272 ? VAL A 376 LEU A 383 1 ? 8  
HELX_P HELX_P11 11 CYS A 275 ? ILE A 283 ? CYS A 386 ILE A 394 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 58  ? VAL A 62  ? PHE A 169 VAL A 173 
A 2 GLY A 129 ? ASP A 135 ? GLY A 240 ASP A 246 
A 3 ASN A 77  ? ARG A 83  ? ASN A 188 ARG A 194 
A 4 SER A 107 ? PHE A 108 ? SER A 218 PHE A 219 
B 1 HIS A 67  ? ILE A 69  ? HIS A 178 ILE A 180 
B 2 THR A 122 ? ALA A 125 ? THR A 233 ALA A 236 
B 3 THR A 85  ? CYS A 92  ? THR A 196 CYS A 203 
B 4 VAL A 95  ? ASP A 103 ? VAL A 206 ASP A 214 
C 1 GLY A 180 ? TYR A 184 ? GLY A 291 TYR A 295 
C 2 SER A 251 ? ASP A 264 ? SER A 362 ASP A 375 
C 3 SER A 199 ? MET A 212 ? SER A 310 MET A 323 
C 4 VAL A 226 ? CYS A 231 ? VAL A 337 CYS A 342 
D 1 GLN A 189 ? ILE A 191 ? GLN A 300 ILE A 302 
D 2 SER A 251 ? ASP A 264 ? SER A 362 ASP A 375 
D 3 SER A 199 ? MET A 212 ? SER A 310 MET A 323 
D 4 TYR A 236 ? PHE A 237 ? TYR A 347 PHE A 348 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 62  ? N VAL A 173 O GLY A 129 ? O GLY A 240 
A 2 3 O TRP A 132 ? O TRP A 243 N VAL A 80  ? N VAL A 191 
A 3 4 N TYR A 79  ? N TYR A 190 O PHE A 108 ? O PHE A 219 
B 1 2 N ILE A 69  ? N ILE A 180 O ILE A 123 ? O ILE A 234 
B 2 3 O THR A 122 ? O THR A 233 N TYR A 89  ? N TYR A 200 
B 3 4 N CYS A 92  ? N CYS A 203 O VAL A 95  ? O VAL A 206 
C 1 2 N GLY A 180 ? N GLY A 291 O ALA A 262 ? O ALA A 373 
C 2 3 O LYS A 259 ? O LYS A 370 N GLU A 204 ? N GLU A 315 
C 3 4 N MET A 212 ? N MET A 323 O VAL A 226 ? O VAL A 337 
D 1 2 N ILE A 190 ? N ILE A 301 O ALA A 252 ? O ALA A 363 
D 2 3 O LYS A 259 ? O LYS A 370 N GLU A 204 ? N GLU A 315 
D 3 4 N PHE A 201 ? N PHE A 312 O PHE A 237 ? O PHE A 348 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 1OR A 501' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 1OR A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 ARG A 97  ? ARG A 208 . ? 7_555 ? 
2  AC1 15 VAL A 99  ? VAL A 210 . ? 1_555 ? 
3  AC1 15 TYR A 102 ? TYR A 213 . ? 1_555 ? 
4  AC1 15 PHE A 108 ? PHE A 219 . ? 1_555 ? 
5  AC1 15 GLY A 109 ? GLY A 220 . ? 1_555 ? 
6  AC1 15 GLU A 110 ? GLU A 221 . ? 1_555 ? 
7  AC1 15 LEU A 111 ? LEU A 222 . ? 1_555 ? 
8  AC1 15 ALA A 112 ? ALA A 223 . ? 1_555 ? 
9  AC1 15 ARG A 119 ? ARG A 230 . ? 1_555 ? 
10 AC1 15 ALA A 120 ? ALA A 231 . ? 1_555 ? 
11 AC1 15 ILE A 123 ? ILE A 234 . ? 1_555 ? 
12 AC1 15 GLN A 266 ? GLN A 377 . ? 1_555 ? 
13 AC1 15 GLU A 269 ? GLU A 380 . ? 1_555 ? 
14 AC1 15 ARG A 270 ? ARG A 381 . ? 1_555 ? 
15 AC1 15 HOH D .   ? HOH A 627 . ? 1_555 ? 
16 AC2 15 LYS A 63  ? LYS A 174 . ? 4_454 ? 
17 AC2 15 ILE A 191 ? ILE A 302 . ? 1_555 ? 
18 AC2 15 ILE A 210 ? ILE A 321 . ? 1_555 ? 
19 AC2 15 ILE A 228 ? ILE A 339 . ? 1_555 ? 
20 AC2 15 PHE A 237 ? PHE A 348 . ? 1_555 ? 
21 AC2 15 GLY A 238 ? GLY A 349 . ? 1_555 ? 
22 AC2 15 GLU A 239 ? GLU A 350 . ? 1_555 ? 
23 AC2 15 LEU A 240 ? LEU A 351 . ? 1_555 ? 
24 AC2 15 ALA A 241 ? ALA A 352 . ? 1_555 ? 
25 AC2 15 ARG A 248 ? ARG A 359 . ? 1_555 ? 
26 AC2 15 ALA A 249 ? ALA A 360 . ? 1_555 ? 
27 AC2 15 ALA A 250 ? ALA A 361 . ? 1_555 ? 
28 AC2 15 THR A 285 ? THR A 396 . ? 1_555 ? 
29 AC2 15 TYR A 286 ? TYR A 397 . ? 1_555 ? 
30 AC2 15 HOH D .   ? HOH A 644 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4JVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4JVA 
_atom_sites.fract_transf_matrix[1][1]   0.018344 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018344 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005001 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ALA A 1 16  ? -29.692 28.268 16.036  1.00 71.91 ? 127 ALA A N     1 
ATOM   2    C CA    . ALA A 1 16  ? -29.240 27.669 17.327  1.00 72.86 ? 127 ALA A CA    1 
ATOM   3    C C     . ALA A 1 16  ? -28.096 28.471 17.935  1.00 72.91 ? 127 ALA A C     1 
ATOM   4    O O     . ALA A 1 16  ? -27.317 29.104 17.222  1.00 73.73 ? 127 ALA A O     1 
ATOM   5    C CB    . ALA A 1 16  ? -28.800 26.214 17.112  1.00 73.40 ? 127 ALA A CB    1 
ATOM   6    N N     . GLU A 1 17  ? -27.994 28.433 19.259  1.00 72.90 ? 128 GLU A N     1 
ATOM   7    C CA    . GLU A 1 17  ? -26.949 29.157 19.972  1.00 71.00 ? 128 GLU A CA    1 
ATOM   8    C C     . GLU A 1 17  ? -25.968 28.182 20.614  1.00 70.14 ? 128 GLU A C     1 
ATOM   9    O O     . GLU A 1 17  ? -25.131 28.578 21.431  1.00 70.79 ? 128 GLU A O     1 
ATOM   10   C CB    . GLU A 1 17  ? -27.570 30.053 21.035  1.00 70.93 ? 128 GLU A CB    1 
ATOM   11   N N     . SER A 1 18  ? -26.087 26.906 20.249  1.00 67.62 ? 129 SER A N     1 
ATOM   12   C CA    . SER A 1 18  ? -25.194 25.870 20.763  1.00 64.98 ? 129 SER A CA    1 
ATOM   13   C C     . SER A 1 18  ? -23.939 25.864 19.888  1.00 62.39 ? 129 SER A C     1 
ATOM   14   O O     . SER A 1 18  ? -23.137 24.929 19.920  1.00 61.65 ? 129 SER A O     1 
ATOM   15   C CB    . SER A 1 18  ? -25.869 24.496 20.702  1.00 65.02 ? 129 SER A CB    1 
ATOM   16   O OG    . SER A 1 18  ? -25.063 23.511 21.330  1.00 64.76 ? 129 SER A OG    1 
ATOM   17   N N     . ARG A 1 19  ? -23.788 26.921 19.098  1.00 59.06 ? 130 ARG A N     1 
ATOM   18   C CA    . ARG A 1 19  ? -22.651 27.061 18.208  1.00 54.63 ? 130 ARG A CA    1 
ATOM   19   C C     . ARG A 1 19  ? -21.396 27.343 19.017  1.00 51.05 ? 130 ARG A C     1 
ATOM   20   O O     . ARG A 1 19  ? -21.459 27.959 20.082  1.00 50.80 ? 130 ARG A O     1 
ATOM   21   C CB    . ARG A 1 19  ? -22.895 28.204 17.222  1.00 55.88 ? 130 ARG A CB    1 
ATOM   22   C CG    . ARG A 1 19  ? -24.226 28.118 16.485  1.00 57.73 ? 130 ARG A CG    1 
ATOM   23   C CD    . ARG A 1 19  ? -24.308 29.175 15.393  1.00 60.37 ? 130 ARG A CD    1 
ATOM   24   N NE    . ARG A 1 19  ? -25.586 29.180 14.679  1.00 62.88 ? 130 ARG A NE    1 
ATOM   25   C CZ    . ARG A 1 19  ? -26.217 28.090 14.248  1.00 64.01 ? 130 ARG A CZ    1 
ATOM   26   N NH1   . ARG A 1 19  ? -27.371 28.204 13.598  1.00 62.43 ? 130 ARG A NH1   1 
ATOM   27   N NH2   . ARG A 1 19  ? -25.711 26.885 14.484  1.00 63.95 ? 130 ARG A NH2   1 
ATOM   28   N N     . ILE A 1 20  ? -20.257 26.882 18.511  1.00 46.39 ? 131 ILE A N     1 
ATOM   29   C CA    . ILE A 1 20  ? -18.996 27.107 19.191  1.00 42.08 ? 131 ILE A CA    1 
ATOM   30   C C     . ILE A 1 20  ? -18.430 28.466 18.808  1.00 40.67 ? 131 ILE A C     1 
ATOM   31   O O     . ILE A 1 20  ? -18.434 28.850 17.635  1.00 38.75 ? 131 ILE A O     1 
ATOM   32   C CB    . ILE A 1 20  ? -17.968 26.023 18.851  1.00 41.02 ? 131 ILE A CB    1 
ATOM   33   C CG1   . ILE A 1 20  ? -18.475 24.667 19.334  1.00 38.86 ? 131 ILE A CG1   1 
ATOM   34   C CG2   . ILE A 1 20  ? -16.623 26.372 19.473  1.00 38.68 ? 131 ILE A CG2   1 
ATOM   35   C CD1   . ILE A 1 20  ? -18.872 24.655 20.783  1.00 42.73 ? 131 ILE A CD1   1 
ATOM   36   N N     . ILE A 1 21  ? -17.953 29.197 19.809  1.00 38.09 ? 132 ILE A N     1 
ATOM   37   C CA    . ILE A 1 21  ? -17.402 30.512 19.568  1.00 37.75 ? 132 ILE A CA    1 
ATOM   38   C C     . ILE A 1 21  ? -16.164 30.745 20.396  1.00 35.98 ? 132 ILE A C     1 
ATOM   39   O O     . ILE A 1 21  ? -16.180 30.613 21.609  1.00 35.08 ? 132 ILE A O     1 
ATOM   40   C CB    . ILE A 1 21  ? -18.419 31.622 19.899  1.00 39.41 ? 132 ILE A CB    1 
ATOM   41   C CG1   . ILE A 1 21  ? -19.707 31.402 19.104  1.00 38.14 ? 132 ILE A CG1   1 
ATOM   42   C CG2   . ILE A 1 21  ? -17.815 32.987 19.564  1.00 36.93 ? 132 ILE A CG2   1 
ATOM   43   C CD1   . ILE A 1 21  ? -20.823 32.317 19.508  1.00 40.25 ? 132 ILE A CD1   1 
ATOM   44   N N     . HIS A 1 22  ? -15.085 31.095 19.721  1.00 35.26 ? 133 HIS A N     1 
ATOM   45   C CA    . HIS A 1 22  ? -13.843 31.368 20.395  1.00 37.50 ? 133 HIS A CA    1 
ATOM   46   C C     . HIS A 1 22  ? -13.497 32.811 20.105  1.00 36.84 ? 133 HIS A C     1 
ATOM   47   O O     . HIS A 1 22  ? -13.033 33.141 19.020  1.00 35.74 ? 133 HIS A O     1 
ATOM   48   C CB    . HIS A 1 22  ? -12.748 30.433 19.881  1.00 39.63 ? 133 HIS A CB    1 
ATOM   49   C CG    . HIS A 1 22  ? -12.975 29.000 20.239  1.00 40.72 ? 133 HIS A CG    1 
ATOM   50   N ND1   . HIS A 1 22  ? -12.809 28.520 21.519  1.00 42.57 ? 133 HIS A ND1   1 
ATOM   51   C CD2   . HIS A 1 22  ? -13.383 27.947 19.492  1.00 41.81 ? 133 HIS A CD2   1 
ATOM   52   C CE1   . HIS A 1 22  ? -13.101 27.232 21.547  1.00 43.37 ? 133 HIS A CE1   1 
ATOM   53   N NE2   . HIS A 1 22  ? -13.452 26.859 20.329  1.00 43.46 ? 133 HIS A NE2   1 
ATOM   54   N N     . PRO A 1 23  ? -13.757 33.699 21.071  1.00 37.43 ? 134 PRO A N     1 
ATOM   55   C CA    . PRO A 1 23  ? -13.474 35.129 20.928  1.00 36.58 ? 134 PRO A CA    1 
ATOM   56   C C     . PRO A 1 23  ? -12.038 35.351 20.458  1.00 37.13 ? 134 PRO A C     1 
ATOM   57   O O     . PRO A 1 23  ? -11.111 34.706 20.940  1.00 39.57 ? 134 PRO A O     1 
ATOM   58   C CB    . PRO A 1 23  ? -13.711 35.664 22.332  1.00 35.49 ? 134 PRO A CB    1 
ATOM   59   C CG    . PRO A 1 23  ? -14.826 34.778 22.832  1.00 36.99 ? 134 PRO A CG    1 
ATOM   60   C CD    . PRO A 1 23  ? -14.363 33.405 22.383  1.00 37.02 ? 134 PRO A CD    1 
ATOM   61   N N     . LYS A 1 24  ? -11.864 36.255 19.507  1.00 36.34 ? 135 LYS A N     1 
ATOM   62   C CA    . LYS A 1 24  ? -10.548 36.558 18.981  1.00 37.26 ? 135 LYS A CA    1 
ATOM   63   C C     . LYS A 1 24  ? -10.289 38.066 18.942  1.00 38.26 ? 135 LYS A C     1 
ATOM   64   O O     . LYS A 1 24  ? -11.214 38.879 19.023  1.00 38.06 ? 135 LYS A O     1 
ATOM   65   C CB    . LYS A 1 24  ? -10.401 35.952 17.576  1.00 37.51 ? 135 LYS A CB    1 
ATOM   66   C CG    . LYS A 1 24  ? -10.352 34.420 17.575  1.00 38.25 ? 135 LYS A CG    1 
ATOM   67   C CD    . LYS A 1 24  ? -10.327 33.820 16.170  1.00 34.28 ? 135 LYS A CD    1 
ATOM   68   C CE    . LYS A 1 24  ? -11.729 33.638 15.621  1.00 33.97 ? 135 LYS A CE    1 
ATOM   69   N NZ    . LYS A 1 24  ? -12.507 32.614 16.371  1.00 30.92 ? 135 LYS A NZ    1 
ATOM   70   N N     . THR A 1 25  ? -9.018  38.425 18.837  1.00 39.32 ? 136 THR A N     1 
ATOM   71   C CA    . THR A 1 25  ? -8.608  39.815 18.766  1.00 41.81 ? 136 THR A CA    1 
ATOM   72   C C     . THR A 1 25  ? -8.658  40.206 17.294  1.00 44.11 ? 136 THR A C     1 
ATOM   73   O O     . THR A 1 25  ? -8.691  39.334 16.416  1.00 44.55 ? 136 THR A O     1 
ATOM   74   C CB    . THR A 1 25  ? -7.165  39.985 19.253  1.00 41.48 ? 136 THR A CB    1 
ATOM   75   O OG1   . THR A 1 25  ? -6.296  39.246 18.389  1.00 42.37 ? 136 THR A OG1   1 
ATOM   76   C CG2   . THR A 1 25  ? -7.011  39.465 20.669  1.00 40.81 ? 136 THR A CG2   1 
ATOM   77   N N     . ASP A 1 26  ? -8.658  41.508 17.021  1.00 45.50 ? 137 ASP A N     1 
ATOM   78   C CA    . ASP A 1 26  ? -8.696  41.984 15.645  1.00 47.30 ? 137 ASP A CA    1 
ATOM   79   C C     . ASP A 1 26  ? -7.532  41.390 14.859  1.00 45.29 ? 137 ASP A C     1 
ATOM   80   O O     . ASP A 1 26  ? -7.675  41.048 13.685  1.00 43.68 ? 137 ASP A O     1 
ATOM   81   C CB    . ASP A 1 26  ? -8.632  43.513 15.610  1.00 52.16 ? 137 ASP A CB    1 
ATOM   82   C CG    . ASP A 1 26  ? -9.893  44.167 16.164  1.00 57.26 ? 137 ASP A CG    1 
ATOM   83   O OD1   . ASP A 1 26  ? -9.911  45.414 16.300  1.00 59.32 ? 137 ASP A OD1   1 
ATOM   84   O OD2   . ASP A 1 26  ? -10.870 43.435 16.457  1.00 59.81 ? 137 ASP A OD2   1 
ATOM   85   N N     . ASP A 1 27  ? -6.382  41.263 15.515  1.00 44.23 ? 138 ASP A N     1 
ATOM   86   C CA    . ASP A 1 27  ? -5.198  40.698 14.876  1.00 43.99 ? 138 ASP A CA    1 
ATOM   87   C C     . ASP A 1 27  ? -5.408  39.225 14.539  1.00 42.72 ? 138 ASP A C     1 
ATOM   88   O O     . ASP A 1 27  ? -5.102  38.788 13.429  1.00 42.93 ? 138 ASP A O     1 
ATOM   89   C CB    . ASP A 1 27  ? -3.981  40.838 15.790  1.00 47.20 ? 138 ASP A CB    1 
ATOM   90   C CG    . ASP A 1 27  ? -2.765  40.068 15.275  1.00 49.08 ? 138 ASP A CG    1 
ATOM   91   O OD1   . ASP A 1 27  ? -2.169  39.298 16.067  1.00 49.81 ? 138 ASP A OD1   1 
ATOM   92   O OD2   . ASP A 1 27  ? -2.403  40.235 14.087  1.00 49.71 ? 138 ASP A OD2   1 
ATOM   93   N N     . GLN A 1 28  ? -5.928  38.456 15.492  1.00 41.61 ? 139 GLN A N     1 
ATOM   94   C CA    . GLN A 1 28  ? -6.164  37.036 15.249  1.00 40.04 ? 139 GLN A CA    1 
ATOM   95   C C     . GLN A 1 28  ? -7.082  36.850 14.055  1.00 38.68 ? 139 GLN A C     1 
ATOM   96   O O     . GLN A 1 28  ? -6.814  36.024 13.186  1.00 38.70 ? 139 GLN A O     1 
ATOM   97   C CB    . GLN A 1 28  ? -6.783  36.364 16.477  1.00 39.38 ? 139 GLN A CB    1 
ATOM   98   C CG    . GLN A 1 28  ? -5.822  36.147 17.630  1.00 37.77 ? 139 GLN A CG    1 
ATOM   99   C CD    . GLN A 1 28  ? -6.496  35.479 18.810  1.00 37.11 ? 139 GLN A CD    1 
ATOM   100  O OE1   . GLN A 1 28  ? -7.459  36.007 19.352  1.00 35.19 ? 139 GLN A OE1   1 
ATOM   101  N NE2   . GLN A 1 28  ? -5.992  34.312 19.216  1.00 36.53 ? 139 GLN A NE2   1 
ATOM   102  N N     . ARG A 1 29  ? -8.171  37.611 14.022  1.00 38.63 ? 140 ARG A N     1 
ATOM   103  C CA    . ARG A 1 29  ? -9.116  37.527 12.914  1.00 40.80 ? 140 ARG A CA    1 
ATOM   104  C C     . ARG A 1 29  ? -8.452  37.902 11.593  1.00 40.69 ? 140 ARG A C     1 
ATOM   105  O O     . ARG A 1 29  ? -8.723  37.295 10.566  1.00 41.19 ? 140 ARG A O     1 
ATOM   106  C CB    . ARG A 1 29  ? -10.318 38.433 13.174  1.00 43.06 ? 140 ARG A CB    1 
ATOM   107  C CG    . ARG A 1 29  ? -11.363 37.818 14.104  1.00 45.57 ? 140 ARG A CG    1 
ATOM   108  C CD    . ARG A 1 29  ? -11.740 38.768 15.224  1.00 48.90 ? 140 ARG A CD    1 
ATOM   109  N NE    . ARG A 1 29  ? -12.143 40.074 14.715  1.00 51.42 ? 140 ARG A NE    1 
ATOM   110  C CZ    . ARG A 1 29  ? -12.484 41.099 15.487  1.00 51.35 ? 140 ARG A CZ    1 
ATOM   111  N NH1   . ARG A 1 29  ? -12.476 40.969 16.806  1.00 51.26 ? 140 ARG A NH1   1 
ATOM   112  N NH2   . ARG A 1 29  ? -12.828 42.254 14.936  1.00 52.82 ? 140 ARG A NH2   1 
ATOM   113  N N     . ASN A 1 30  ? -7.576  38.903 11.626  1.00 42.32 ? 141 ASN A N     1 
ATOM   114  C CA    . ASN A 1 30  ? -6.860  39.340 10.435  1.00 41.79 ? 141 ASN A CA    1 
ATOM   115  C C     . ASN A 1 30  ? -6.037  38.187 9.899   1.00 40.73 ? 141 ASN A C     1 
ATOM   116  O O     . ASN A 1 30  ? -6.108  37.859 8.713   1.00 41.45 ? 141 ASN A O     1 
ATOM   117  C CB    . ASN A 1 30  ? -5.916  40.510 10.757  1.00 44.46 ? 141 ASN A CB    1 
ATOM   118  C CG    . ASN A 1 30  ? -6.627  41.851 10.797  1.00 46.31 ? 141 ASN A CG    1 
ATOM   119  O OD1   . ASN A 1 30  ? -7.412  42.179 9.905   1.00 47.89 ? 141 ASN A OD1   1 
ATOM   120  N ND2   . ASN A 1 30  ? -6.339  42.643 11.823  1.00 46.95 ? 141 ASN A ND2   1 
ATOM   121  N N     . ARG A 1 31  ? -5.236  37.586 10.774  1.00 38.42 ? 142 ARG A N     1 
ATOM   122  C CA    . ARG A 1 31  ? -4.409  36.466 10.371  1.00 38.07 ? 142 ARG A CA    1 
ATOM   123  C C     . ARG A 1 31  ? -5.278  35.286 9.983   1.00 38.42 ? 142 ARG A C     1 
ATOM   124  O O     . ARG A 1 31  ? -5.001  34.611 8.996   1.00 40.14 ? 142 ARG A O     1 
ATOM   125  C CB    . ARG A 1 31  ? -3.442  36.096 11.495  1.00 39.45 ? 142 ARG A CB    1 
ATOM   126  C CG    . ARG A 1 31  ? -2.418  37.185 11.736  1.00 38.64 ? 142 ARG A CG    1 
ATOM   127  C CD    . ARG A 1 31  ? -1.372  36.817 12.750  1.00 39.12 ? 142 ARG A CD    1 
ATOM   128  N NE    . ARG A 1 31  ? -1.940  36.627 14.073  1.00 39.86 ? 142 ARG A NE    1 
ATOM   129  C CZ    . ARG A 1 31  ? -2.160  35.435 14.611  1.00 41.37 ? 142 ARG A CZ    1 
ATOM   130  N NH1   . ARG A 1 31  ? -1.845  34.338 13.931  1.00 43.01 ? 142 ARG A NH1   1 
ATOM   131  N NH2   . ARG A 1 31  ? -2.712  35.338 15.810  1.00 36.65 ? 142 ARG A NH2   1 
ATOM   132  N N     . LEU A 1 32  ? -6.337  35.055 10.752  1.00 38.70 ? 143 LEU A N     1 
ATOM   133  C CA    . LEU A 1 32  ? -7.287  33.974 10.489  1.00 38.29 ? 143 LEU A CA    1 
ATOM   134  C C     . LEU A 1 32  ? -7.806  34.147 9.059   1.00 40.34 ? 143 LEU A C     1 
ATOM   135  O O     . LEU A 1 32  ? -7.998  33.178 8.317   1.00 41.96 ? 143 LEU A O     1 
ATOM   136  C CB    . LEU A 1 32  ? -8.469  34.085 11.453  1.00 37.67 ? 143 LEU A CB    1 
ATOM   137  C CG    . LEU A 1 32  ? -9.297  32.851 11.817  1.00 37.32 ? 143 LEU A CG    1 
ATOM   138  C CD1   . LEU A 1 32  ? -10.699 33.283 12.163  1.00 34.22 ? 143 LEU A CD1   1 
ATOM   139  C CD2   . LEU A 1 32  ? -9.335  31.871 10.678  1.00 36.65 ? 143 LEU A CD2   1 
ATOM   140  N N     . GLN A 1 33  ? -8.023  35.406 8.692   1.00 40.50 ? 144 GLN A N     1 
ATOM   141  C CA    . GLN A 1 33  ? -8.537  35.790 7.384   1.00 41.70 ? 144 GLN A CA    1 
ATOM   142  C C     . GLN A 1 33  ? -7.571  35.468 6.259   1.00 40.25 ? 144 GLN A C     1 
ATOM   143  O O     . GLN A 1 33  ? -7.970  34.920 5.236   1.00 38.39 ? 144 GLN A O     1 
ATOM   144  C CB    . GLN A 1 33  ? -8.843  37.294 7.384   1.00 45.78 ? 144 GLN A CB    1 
ATOM   145  C CG    . GLN A 1 33  ? -9.805  37.768 6.305   1.00 49.22 ? 144 GLN A CG    1 
ATOM   146  C CD    . GLN A 1 33  ? -10.451 39.094 6.672   1.00 53.34 ? 144 GLN A CD    1 
ATOM   147  O OE1   . GLN A 1 33  ? -10.882 39.286 7.816   1.00 54.54 ? 144 GLN A OE1   1 
ATOM   148  N NE2   . GLN A 1 33  ? -10.534 40.012 5.706   1.00 53.84 ? 144 GLN A NE2   1 
ATOM   149  N N     . GLU A 1 34  ? -6.304  35.828 6.446   1.00 41.06 ? 145 GLU A N     1 
ATOM   150  C CA    . GLU A 1 34  ? -5.282  35.571 5.438   1.00 41.87 ? 145 GLU A CA    1 
ATOM   151  C C     . GLU A 1 34  ? -5.112  34.076 5.262   1.00 40.51 ? 145 GLU A C     1 
ATOM   152  O O     . GLU A 1 34  ? -5.100  33.567 4.150   1.00 42.34 ? 145 GLU A O     1 
ATOM   153  C CB    . GLU A 1 34  ? -3.932  36.174 5.850   1.00 45.27 ? 145 GLU A CB    1 
ATOM   154  C CG    . GLU A 1 34  ? -3.626  37.544 5.258   1.00 50.32 ? 145 GLU A CG    1 
ATOM   155  C CD    . GLU A 1 34  ? -3.622  37.544 3.734   1.00 53.88 ? 145 GLU A CD    1 
ATOM   156  O OE1   . GLU A 1 34  ? -2.821  36.787 3.131   1.00 54.32 ? 145 GLU A OE1   1 
ATOM   157  O OE2   . GLU A 1 34  ? -4.425  38.305 3.141   1.00 54.61 ? 145 GLU A OE2   1 
ATOM   158  N N     . ALA A 1 35  ? -4.989  33.369 6.374   1.00 38.75 ? 146 ALA A N     1 
ATOM   159  C CA    . ALA A 1 35  ? -4.795  31.930 6.324   1.00 36.78 ? 146 ALA A CA    1 
ATOM   160  C C     . ALA A 1 35  ? -5.909  31.193 5.591   1.00 36.13 ? 146 ALA A C     1 
ATOM   161  O O     . ALA A 1 35  ? -5.653  30.188 4.936   1.00 35.36 ? 146 ALA A O     1 
ATOM   162  C CB    . ALA A 1 35  ? -4.645  31.379 7.746   1.00 35.23 ? 146 ALA A CB    1 
ATOM   163  N N     . CYS A 1 36  ? -7.138  31.699 5.681   1.00 37.20 ? 147 CYS A N     1 
ATOM   164  C CA    . CYS A 1 36  ? -8.283  31.033 5.057   1.00 36.93 ? 147 CYS A CA    1 
ATOM   165  C C     . CYS A 1 36  ? -8.647  31.414 3.629   1.00 37.86 ? 147 CYS A C     1 
ATOM   166  O O     . CYS A 1 36  ? -9.384  30.678 2.977   1.00 35.99 ? 147 CYS A O     1 
ATOM   167  C CB    . CYS A 1 36  ? -9.538  31.232 5.914   1.00 37.30 ? 147 CYS A CB    1 
ATOM   168  S SG    . CYS A 1 36  ? -9.524  30.431 7.536   1.00 35.52 ? 147 CYS A SG    1 
ATOM   169  N N     . LYS A 1 37  ? -8.144  32.551 3.146   1.00 39.75 ? 148 LYS A N     1 
ATOM   170  C CA    . LYS A 1 37  ? -8.484  33.040 1.807   1.00 40.29 ? 148 LYS A CA    1 
ATOM   171  C C     . LYS A 1 37  ? -8.483  32.020 0.665   1.00 39.58 ? 148 LYS A C     1 
ATOM   172  O O     . LYS A 1 37  ? -9.313  32.108 -0.240  1.00 38.48 ? 148 LYS A O     1 
ATOM   173  C CB    . LYS A 1 37  ? -7.586  34.235 1.436   1.00 41.35 ? 148 LYS A CB    1 
ATOM   174  C CG    . LYS A 1 37  ? -6.111  33.910 1.314   1.00 45.18 ? 148 LYS A CG    1 
ATOM   175  C CD    . LYS A 1 37  ? -5.245  35.071 1.797   1.00 46.91 ? 148 LYS A CD    1 
ATOM   176  C CE    . LYS A 1 37  ? -5.297  36.254 0.862   1.00 48.55 ? 148 LYS A CE    1 
ATOM   177  N NZ    . LYS A 1 37  ? -4.519  35.981 -0.380  1.00 51.13 ? 148 LYS A NZ    1 
ATOM   178  N N     . ASP A 1 38  ? -7.589  31.039 0.717   1.00 39.92 ? 149 ASP A N     1 
ATOM   179  C CA    . ASP A 1 38  ? -7.502  30.063 -0.365  1.00 41.45 ? 149 ASP A CA    1 
ATOM   180  C C     . ASP A 1 38  ? -7.904  28.619 -0.056  1.00 39.97 ? 149 ASP A C     1 
ATOM   181  O O     . ASP A 1 38  ? -7.677  27.721 -0.872  1.00 39.98 ? 149 ASP A O     1 
ATOM   182  C CB    . ASP A 1 38  ? -6.083  30.087 -0.949  1.00 45.45 ? 149 ASP A CB    1 
ATOM   183  C CG    . ASP A 1 38  ? -5.744  31.423 -1.615  1.00 51.10 ? 149 ASP A CG    1 
ATOM   184  O OD1   . ASP A 1 38  ? -4.589  31.895 -1.465  1.00 53.93 ? 149 ASP A OD1   1 
ATOM   185  O OD2   . ASP A 1 38  ? -6.629  31.999 -2.295  1.00 53.30 ? 149 ASP A OD2   1 
ATOM   186  N N     . ILE A 1 39  ? -8.516  28.385 1.097   1.00 37.95 ? 150 ILE A N     1 
ATOM   187  C CA    . ILE A 1 39  ? -8.914  27.031 1.448   1.00 37.00 ? 150 ILE A CA    1 
ATOM   188  C C     . ILE A 1 39  ? -10.099 26.565 0.614   1.00 36.78 ? 150 ILE A C     1 
ATOM   189  O O     . ILE A 1 39  ? -11.232 26.986 0.813   1.00 37.64 ? 150 ILE A O     1 
ATOM   190  C CB    . ILE A 1 39  ? -9.251  26.908 2.962   1.00 35.97 ? 150 ILE A CB    1 
ATOM   191  C CG1   . ILE A 1 39  ? -8.034  27.302 3.803   1.00 33.49 ? 150 ILE A CG1   1 
ATOM   192  C CG2   . ILE A 1 39  ? -9.632  25.480 3.302   1.00 35.53 ? 150 ILE A CG2   1 
ATOM   193  C CD1   . ILE A 1 39  ? -6.800  26.465 3.545   1.00 31.91 ? 150 ILE A CD1   1 
ATOM   194  N N     . LEU A 1 40  ? -9.815  25.673 -0.324  1.00 38.38 ? 151 LEU A N     1 
ATOM   195  C CA    . LEU A 1 40  ? -10.826 25.120 -1.219  1.00 37.65 ? 151 LEU A CA    1 
ATOM   196  C C     . LEU A 1 40  ? -12.106 24.642 -0.550  1.00 37.54 ? 151 LEU A C     1 
ATOM   197  O O     . LEU A 1 40  ? -13.188 24.781 -1.129  1.00 37.92 ? 151 LEU A O     1 
ATOM   198  C CB    . LEU A 1 40  ? -10.213 23.989 -2.043  1.00 34.36 ? 151 LEU A CB    1 
ATOM   199  C CG    . LEU A 1 40  ? -9.100  24.555 -2.927  1.00 33.79 ? 151 LEU A CG    1 
ATOM   200  C CD1   . LEU A 1 40  ? -8.275  23.454 -3.616  1.00 33.13 ? 151 LEU A CD1   1 
ATOM   201  C CD2   . LEU A 1 40  ? -9.754  25.467 -3.940  1.00 29.46 ? 151 LEU A CD2   1 
ATOM   202  N N     . LEU A 1 41  ? -11.998 24.088 0.655   1.00 37.81 ? 152 LEU A N     1 
ATOM   203  C CA    . LEU A 1 41  ? -13.186 23.614 1.367   1.00 39.34 ? 152 LEU A CA    1 
ATOM   204  C C     . LEU A 1 41  ? -14.182 24.726 1.778   1.00 39.38 ? 152 LEU A C     1 
ATOM   205  O O     . LEU A 1 41  ? -15.351 24.438 2.077   1.00 37.01 ? 152 LEU A O     1 
ATOM   206  C CB    . LEU A 1 41  ? -12.784 22.798 2.607   1.00 38.35 ? 152 LEU A CB    1 
ATOM   207  C CG    . LEU A 1 41  ? -12.719 21.270 2.427   1.00 41.63 ? 152 LEU A CG    1 
ATOM   208  C CD1   . LEU A 1 41  ? -12.493 20.600 3.777   1.00 43.76 ? 152 LEU A CD1   1 
ATOM   209  C CD2   . LEU A 1 41  ? -14.024 20.745 1.841   1.00 42.19 ? 152 LEU A CD2   1 
ATOM   210  N N     . PHE A 1 42  ? -13.724 25.981 1.774   1.00 38.97 ? 153 PHE A N     1 
ATOM   211  C CA    . PHE A 1 42  ? -14.567 27.120 2.149   1.00 40.25 ? 153 PHE A CA    1 
ATOM   212  C C     . PHE A 1 42  ? -15.066 27.918 0.948   1.00 40.45 ? 153 PHE A C     1 
ATOM   213  O O     . PHE A 1 42  ? -15.866 28.851 1.087   1.00 39.80 ? 153 PHE A O     1 
ATOM   214  C CB    . PHE A 1 42  ? -13.804 28.086 3.063   1.00 40.28 ? 153 PHE A CB    1 
ATOM   215  C CG    . PHE A 1 42  ? -13.315 27.470 4.337   1.00 40.81 ? 153 PHE A CG    1 
ATOM   216  C CD1   . PHE A 1 42  ? -13.925 26.337 4.862   1.00 40.94 ? 153 PHE A CD1   1 
ATOM   217  C CD2   . PHE A 1 42  ? -12.267 28.055 5.041   1.00 42.03 ? 153 PHE A CD2   1 
ATOM   218  C CE1   . PHE A 1 42  ? -13.499 25.800 6.071   1.00 42.59 ? 153 PHE A CE1   1 
ATOM   219  C CE2   . PHE A 1 42  ? -11.831 27.525 6.260   1.00 41.11 ? 153 PHE A CE2   1 
ATOM   220  C CZ    . PHE A 1 42  ? -12.446 26.400 6.774   1.00 42.93 ? 153 PHE A CZ    1 
ATOM   221  N N     . LYS A 1 43  ? -14.577 27.559 -0.228  1.00 40.30 ? 154 LYS A N     1 
ATOM   222  C CA    . LYS A 1 43  ? -14.949 28.256 -1.446  1.00 40.18 ? 154 LYS A CA    1 
ATOM   223  C C     . LYS A 1 43  ? -16.430 28.417 -1.770  1.00 41.07 ? 154 LYS A C     1 
ATOM   224  O O     . LYS A 1 43  ? -16.806 29.404 -2.399  1.00 41.18 ? 154 LYS A O     1 
ATOM   225  C CB    . LYS A 1 43  ? -14.258 27.606 -2.642  1.00 37.15 ? 154 LYS A CB    1 
ATOM   226  C CG    . LYS A 1 43  ? -12.849 28.074 -2.815  1.00 36.67 ? 154 LYS A CG    1 
ATOM   227  C CD    . LYS A 1 43  ? -12.773 29.575 -2.666  1.00 35.52 ? 154 LYS A CD    1 
ATOM   228  C CE    . LYS A 1 43  ? -11.342 30.062 -2.746  1.00 37.78 ? 154 LYS A CE    1 
ATOM   229  N NZ    . LYS A 1 43  ? -11.294 31.543 -2.634  1.00 38.97 ? 154 LYS A NZ    1 
ATOM   230  N N     . ASN A 1 44  ? -17.266 27.467 -1.358  1.00 41.96 ? 155 ASN A N     1 
ATOM   231  C CA    . ASN A 1 44  ? -18.695 27.542 -1.679  1.00 42.15 ? 155 ASN A CA    1 
ATOM   232  C C     . ASN A 1 44  ? -19.643 27.977 -0.556  1.00 40.84 ? 155 ASN A C     1 
ATOM   233  O O     . ASN A 1 44  ? -20.853 27.878 -0.703  1.00 42.26 ? 155 ASN A O     1 
ATOM   234  C CB    . ASN A 1 44  ? -19.164 26.187 -2.220  1.00 44.26 ? 155 ASN A CB    1 
ATOM   235  C CG    . ASN A 1 44  ? -18.351 25.717 -3.425  1.00 44.61 ? 155 ASN A CG    1 
ATOM   236  O OD1   . ASN A 1 44  ? -17.130 25.530 -3.337  1.00 43.50 ? 155 ASN A OD1   1 
ATOM   237  N ND2   . ASN A 1 44  ? -19.029 25.517 -4.557  1.00 43.10 ? 155 ASN A ND2   1 
ATOM   238  N N     . LEU A 1 45  ? -19.100 28.461 0.554   1.00 40.02 ? 156 LEU A N     1 
ATOM   239  C CA    . LEU A 1 45  ? -19.908 28.890 1.694   1.00 39.04 ? 156 LEU A CA    1 
ATOM   240  C C     . LEU A 1 45  ? -20.452 30.314 1.575   1.00 40.19 ? 156 LEU A C     1 
ATOM   241  O O     . LEU A 1 45  ? -19.740 31.227 1.147   1.00 40.92 ? 156 LEU A O     1 
ATOM   242  C CB    . LEU A 1 45  ? -19.077 28.812 2.967   1.00 34.36 ? 156 LEU A CB    1 
ATOM   243  C CG    . LEU A 1 45  ? -18.506 27.470 3.398   1.00 35.87 ? 156 LEU A CG    1 
ATOM   244  C CD1   . LEU A 1 45  ? -17.409 27.737 4.410   1.00 34.33 ? 156 LEU A CD1   1 
ATOM   245  C CD2   . LEU A 1 45  ? -19.602 26.574 3.996   1.00 32.70 ? 156 LEU A CD2   1 
ATOM   246  N N     . ASP A 1 46  ? -21.707 30.517 1.958   1.00 41.15 ? 157 ASP A N     1 
ATOM   247  C CA    . ASP A 1 46  ? -22.243 31.866 1.907   1.00 43.65 ? 157 ASP A CA    1 
ATOM   248  C C     . ASP A 1 46  ? -21.678 32.593 3.133   1.00 44.24 ? 157 ASP A C     1 
ATOM   249  O O     . ASP A 1 46  ? -21.228 31.955 4.087   1.00 44.25 ? 157 ASP A O     1 
ATOM   250  C CB    . ASP A 1 46  ? -23.780 31.855 1.884   1.00 44.61 ? 157 ASP A CB    1 
ATOM   251  C CG    . ASP A 1 46  ? -24.390 31.206 3.103   1.00 46.92 ? 157 ASP A CG    1 
ATOM   252  O OD1   . ASP A 1 46  ? -24.260 31.773 4.212   1.00 47.49 ? 157 ASP A OD1   1 
ATOM   253  O OD2   . ASP A 1 46  ? -25.008 30.131 2.950   1.00 47.17 ? 157 ASP A OD2   1 
ATOM   254  N N     . PRO A 1 47  ? -21.685 33.934 3.122   1.00 44.82 ? 158 PRO A N     1 
ATOM   255  C CA    . PRO A 1 47  ? -21.162 34.754 4.223   1.00 45.58 ? 158 PRO A CA    1 
ATOM   256  C C     . PRO A 1 47  ? -21.587 34.311 5.622   1.00 46.64 ? 158 PRO A C     1 
ATOM   257  O O     . PRO A 1 47  ? -20.809 34.363 6.575   1.00 46.95 ? 158 PRO A O     1 
ATOM   258  C CB    . PRO A 1 47  ? -21.684 36.151 3.888   1.00 46.86 ? 158 PRO A CB    1 
ATOM   259  C CG    . PRO A 1 47  ? -21.813 36.126 2.392   1.00 46.16 ? 158 PRO A CG    1 
ATOM   260  C CD    . PRO A 1 47  ? -22.423 34.770 2.159   1.00 44.90 ? 158 PRO A CD    1 
ATOM   261  N N     . GLU A 1 48  ? -22.840 33.892 5.731   1.00 47.55 ? 159 GLU A N     1 
ATOM   262  C CA    . GLU A 1 48  ? -23.416 33.453 6.987   1.00 46.35 ? 159 GLU A CA    1 
ATOM   263  C C     . GLU A 1 48  ? -22.654 32.225 7.478   1.00 45.01 ? 159 GLU A C     1 
ATOM   264  O O     . GLU A 1 48  ? -22.149 32.216 8.602   1.00 45.44 ? 159 GLU A O     1 
ATOM   265  C CB    . GLU A 1 48  ? -24.901 33.138 6.759   1.00 50.30 ? 159 GLU A CB    1 
ATOM   266  C CG    . GLU A 1 48  ? -25.799 33.239 7.984   1.00 53.37 ? 159 GLU A CG    1 
ATOM   267  C CD    . GLU A 1 48  ? -25.687 32.035 8.895   1.00 54.98 ? 159 GLU A CD    1 
ATOM   268  O OE1   . GLU A 1 48  ? -25.805 30.894 8.385   1.00 56.25 ? 159 GLU A OE1   1 
ATOM   269  O OE2   . GLU A 1 48  ? -25.493 32.231 10.115  1.00 54.48 ? 159 GLU A OE2   1 
ATOM   270  N N     . GLN A 1 49  ? -22.561 31.201 6.628   1.00 42.51 ? 160 GLN A N     1 
ATOM   271  C CA    . GLN A 1 49  ? -21.858 29.961 6.961   1.00 39.35 ? 160 GLN A CA    1 
ATOM   272  C C     . GLN A 1 49  ? -20.386 30.208 7.289   1.00 37.88 ? 160 GLN A C     1 
ATOM   273  O O     . GLN A 1 49  ? -19.838 29.608 8.206   1.00 36.82 ? 160 GLN A O     1 
ATOM   274  C CB    . GLN A 1 49  ? -21.909 28.981 5.797   1.00 40.60 ? 160 GLN A CB    1 
ATOM   275  C CG    . GLN A 1 49  ? -23.240 28.800 5.134   1.00 42.55 ? 160 GLN A CG    1 
ATOM   276  C CD    . GLN A 1 49  ? -23.154 27.789 4.007   1.00 47.51 ? 160 GLN A CD    1 
ATOM   277  O OE1   . GLN A 1 49  ? -23.141 26.575 4.243   1.00 50.05 ? 160 GLN A OE1   1 
ATOM   278  N NE2   . GLN A 1 49  ? -23.072 28.281 2.770   1.00 47.72 ? 160 GLN A NE2   1 
ATOM   279  N N     . MET A 1 50  ? -19.745 31.084 6.525   1.00 37.43 ? 161 MET A N     1 
ATOM   280  C CA    . MET A 1 50  ? -18.337 31.401 6.743   1.00 37.20 ? 161 MET A CA    1 
ATOM   281  C C     . MET A 1 50  ? -18.075 32.034 8.103   1.00 36.55 ? 161 MET A C     1 
ATOM   282  O O     . MET A 1 50  ? -17.094 31.697 8.781   1.00 35.77 ? 161 MET A O     1 
ATOM   283  C CB    . MET A 1 50  ? -17.833 32.347 5.651   1.00 39.03 ? 161 MET A CB    1 
ATOM   284  C CG    . MET A 1 50  ? -16.315 32.508 5.612   1.00 39.33 ? 161 MET A CG    1 
ATOM   285  S SD    . MET A 1 50  ? -15.471 30.955 5.170   1.00 42.30 ? 161 MET A SD    1 
ATOM   286  C CE    . MET A 1 50  ? -13.903 31.210 5.915   1.00 35.83 ? 161 MET A CE    1 
ATOM   287  N N     . SER A 1 51  ? -18.945 32.960 8.505   1.00 36.12 ? 162 SER A N     1 
ATOM   288  C CA    . SER A 1 51  ? -18.779 33.630 9.788   1.00 35.36 ? 162 SER A CA    1 
ATOM   289  C C     . SER A 1 51  ? -18.981 32.654 10.941  1.00 33.86 ? 162 SER A C     1 
ATOM   290  O O     . SER A 1 51  ? -18.376 32.800 11.996  1.00 33.35 ? 162 SER A O     1 
ATOM   291  C CB    . SER A 1 51  ? -19.764 34.795 9.922   1.00 37.32 ? 162 SER A CB    1 
ATOM   292  O OG    . SER A 1 51  ? -21.092 34.332 10.117  1.00 39.39 ? 162 SER A OG    1 
ATOM   293  N N     . GLN A 1 52  ? -19.855 31.671 10.758  1.00 33.11 ? 163 GLN A N     1 
ATOM   294  C CA    . GLN A 1 52  ? -20.073 30.691 11.818  1.00 33.00 ? 163 GLN A CA    1 
ATOM   295  C C     . GLN A 1 52  ? -18.779 29.903 12.007  1.00 31.99 ? 163 GLN A C     1 
ATOM   296  O O     . GLN A 1 52  ? -18.349 29.643 13.136  1.00 28.55 ? 163 GLN A O     1 
ATOM   297  C CB    . GLN A 1 52  ? -21.204 29.746 11.449  1.00 33.13 ? 163 GLN A CB    1 
ATOM   298  C CG    . GLN A 1 52  ? -22.559 30.348 11.671  1.00 38.82 ? 163 GLN A CG    1 
ATOM   299  C CD    . GLN A 1 52  ? -23.652 29.306 11.697  1.00 41.20 ? 163 GLN A CD    1 
ATOM   300  O OE1   . GLN A 1 52  ? -23.508 28.255 12.325  1.00 41.17 ? 163 GLN A OE1   1 
ATOM   301  N NE2   . GLN A 1 52  ? -24.762 29.596 11.024  1.00 42.98 ? 163 GLN A NE2   1 
ATOM   302  N N     . VAL A 1 53  ? -18.169 29.552 10.875  1.00 29.94 ? 164 VAL A N     1 
ATOM   303  C CA    . VAL A 1 53  ? -16.918 28.819 10.834  1.00 29.98 ? 164 VAL A CA    1 
ATOM   304  C C     . VAL A 1 53  ? -15.842 29.612 11.566  1.00 30.67 ? 164 VAL A C     1 
ATOM   305  O O     . VAL A 1 53  ? -15.249 29.139 12.541  1.00 30.79 ? 164 VAL A O     1 
ATOM   306  C CB    . VAL A 1 53  ? -16.463 28.607 9.377   1.00 30.10 ? 164 VAL A CB    1 
ATOM   307  C CG1   . VAL A 1 53  ? -15.056 28.074 9.350   1.00 29.92 ? 164 VAL A CG1   1 
ATOM   308  C CG2   . VAL A 1 53  ? -17.407 27.654 8.663   1.00 28.87 ? 164 VAL A CG2   1 
ATOM   309  N N     . LEU A 1 54  ? -15.605 30.833 11.095  1.00 31.88 ? 165 LEU A N     1 
ATOM   310  C CA    . LEU A 1 54  ? -14.593 31.713 11.677  1.00 29.64 ? 165 LEU A CA    1 
ATOM   311  C C     . LEU A 1 54  ? -14.727 31.867 13.191  1.00 29.66 ? 165 LEU A C     1 
ATOM   312  O O     . LEU A 1 54  ? -13.732 31.897 13.913  1.00 28.73 ? 165 LEU A O     1 
ATOM   313  C CB    . LEU A 1 54  ? -14.659 33.070 10.984  1.00 28.26 ? 165 LEU A CB    1 
ATOM   314  C CG    . LEU A 1 54  ? -13.748 33.348 9.780   1.00 29.38 ? 165 LEU A CG    1 
ATOM   315  C CD1   . LEU A 1 54  ? -13.333 32.092 9.053   1.00 24.64 ? 165 LEU A CD1   1 
ATOM   316  C CD2   . LEU A 1 54  ? -14.492 34.297 8.854   1.00 30.76 ? 165 LEU A CD2   1 
ATOM   317  N N     . ASP A 1 55  ? -15.956 31.958 13.678  1.00 30.73 ? 166 ASP A N     1 
ATOM   318  C CA    . ASP A 1 55  ? -16.172 32.084 15.111  1.00 31.23 ? 166 ASP A CA    1 
ATOM   319  C C     . ASP A 1 55  ? -15.708 30.855 15.859  1.00 32.16 ? 166 ASP A C     1 
ATOM   320  O O     . ASP A 1 55  ? -15.241 30.968 16.985  1.00 34.46 ? 166 ASP A O     1 
ATOM   321  C CB    . ASP A 1 55  ? -17.653 32.266 15.442  1.00 34.00 ? 166 ASP A CB    1 
ATOM   322  C CG    . ASP A 1 55  ? -18.178 33.631 15.077  1.00 37.01 ? 166 ASP A CG    1 
ATOM   323  O OD1   . ASP A 1 55  ? -17.473 34.633 15.328  1.00 36.72 ? 166 ASP A OD1   1 
ATOM   324  O OD2   . ASP A 1 55  ? -19.310 33.694 14.549  1.00 42.63 ? 166 ASP A OD2   1 
ATOM   325  N N     . ALA A 1 56  ? -15.861 29.679 15.250  1.00 31.39 ? 167 ALA A N     1 
ATOM   326  C CA    . ALA A 1 56  ? -15.490 28.441 15.922  1.00 32.35 ? 167 ALA A CA    1 
ATOM   327  C C     . ALA A 1 56  ? -13.997 28.119 15.832  1.00 33.47 ? 167 ALA A C     1 
ATOM   328  O O     . ALA A 1 56  ? -13.501 27.207 16.495  1.00 35.01 ? 167 ALA A O     1 
ATOM   329  C CB    . ALA A 1 56  ? -16.339 27.276 15.375  1.00 30.09 ? 167 ALA A CB    1 
ATOM   330  N N     . MET A 1 57  ? -13.281 28.874 15.014  1.00 34.07 ? 168 MET A N     1 
ATOM   331  C CA    . MET A 1 57  ? -11.849 28.672 14.861  1.00 35.08 ? 168 MET A CA    1 
ATOM   332  C C     . MET A 1 57  ? -11.107 29.073 16.132  1.00 33.75 ? 168 MET A C     1 
ATOM   333  O O     . MET A 1 57  ? -11.346 30.149 16.683  1.00 33.41 ? 168 MET A O     1 
ATOM   334  C CB    . MET A 1 57  ? -11.303 29.506 13.696  1.00 34.80 ? 168 MET A CB    1 
ATOM   335  C CG    . MET A 1 57  ? -11.814 29.105 12.330  1.00 41.04 ? 168 MET A CG    1 
ATOM   336  S SD    . MET A 1 57  ? -11.073 27.591 11.698  1.00 47.71 ? 168 MET A SD    1 
ATOM   337  C CE    . MET A 1 57  ? -11.460 27.739 10.002  1.00 42.82 ? 168 MET A CE    1 
ATOM   338  N N     . PHE A 1 58  ? -10.218 28.196 16.593  1.00 32.38 ? 169 PHE A N     1 
ATOM   339  C CA    . PHE A 1 58  ? -9.388  28.470 17.763  1.00 33.30 ? 169 PHE A CA    1 
ATOM   340  C C     . PHE A 1 58  ? -7.940  28.415 17.274  1.00 33.35 ? 169 PHE A C     1 
ATOM   341  O O     . PHE A 1 58  ? -7.654  27.754 16.272  1.00 32.13 ? 169 PHE A O     1 
ATOM   342  C CB    . PHE A 1 58  ? -9.637  27.440 18.876  1.00 32.29 ? 169 PHE A CB    1 
ATOM   343  C CG    . PHE A 1 58  ? -9.321  26.018 18.492  1.00 32.02 ? 169 PHE A CG    1 
ATOM   344  C CD1   . PHE A 1 58  ? -8.005  25.557 18.479  1.00 34.22 ? 169 PHE A CD1   1 
ATOM   345  C CD2   . PHE A 1 58  ? -10.342 25.136 18.145  1.00 32.25 ? 169 PHE A CD2   1 
ATOM   346  C CE1   . PHE A 1 58  ? -7.702  24.230 18.124  1.00 33.71 ? 169 PHE A CE1   1 
ATOM   347  C CE2   . PHE A 1 58  ? -10.057 23.814 17.790  1.00 34.50 ? 169 PHE A CE2   1 
ATOM   348  C CZ    . PHE A 1 58  ? -8.729  23.362 17.780  1.00 33.88 ? 169 PHE A CZ    1 
ATOM   349  N N     . GLU A 1 59  ? -7.043  29.133 17.949  1.00 33.74 ? 170 GLU A N     1 
ATOM   350  C CA    . GLU A 1 59  ? -5.635  29.158 17.557  1.00 35.65 ? 170 GLU A CA    1 
ATOM   351  C C     . GLU A 1 59  ? -4.845  28.115 18.341  1.00 35.82 ? 170 GLU A C     1 
ATOM   352  O O     . GLU A 1 59  ? -5.073  27.922 19.535  1.00 36.12 ? 170 GLU A O     1 
ATOM   353  C CB    . GLU A 1 59  ? -5.044  30.547 17.806  1.00 37.90 ? 170 GLU A CB    1 
ATOM   354  C CG    . GLU A 1 59  ? -3.729  30.807 17.088  1.00 38.96 ? 170 GLU A CG    1 
ATOM   355  C CD    . GLU A 1 59  ? -3.197  32.202 17.336  1.00 41.72 ? 170 GLU A CD    1 
ATOM   356  O OE1   . GLU A 1 59  ? -2.128  32.532 16.769  1.00 44.31 ? 170 GLU A OE1   1 
ATOM   357  O OE2   . GLU A 1 59  ? -3.842  32.968 18.090  1.00 40.42 ? 170 GLU A OE2   1 
ATOM   358  N N     . LYS A 1 60  ? -3.915  27.450 17.670  1.00 36.28 ? 171 LYS A N     1 
ATOM   359  C CA    . LYS A 1 60  ? -3.113  26.411 18.302  1.00 39.32 ? 171 LYS A CA    1 
ATOM   360  C C     . LYS A 1 60  ? -1.678  26.467 17.810  1.00 40.95 ? 171 LYS A C     1 
ATOM   361  O O     . LYS A 1 60  ? -1.406  26.193 16.647  1.00 41.57 ? 171 LYS A O     1 
ATOM   362  C CB    . LYS A 1 60  ? -3.702  25.045 17.978  1.00 40.24 ? 171 LYS A CB    1 
ATOM   363  C CG    . LYS A 1 60  ? -2.870  23.863 18.443  1.00 43.47 ? 171 LYS A CG    1 
ATOM   364  C CD    . LYS A 1 60  ? -3.307  22.587 17.732  1.00 43.46 ? 171 LYS A CD    1 
ATOM   365  C CE    . LYS A 1 60  ? -2.467  21.393 18.147  1.00 44.70 ? 171 LYS A CE    1 
ATOM   366  N NZ    . LYS A 1 60  ? -2.727  21.021 19.565  1.00 48.57 ? 171 LYS A NZ    1 
ATOM   367  N N     . LEU A 1 61  ? -0.760  26.821 18.699  1.00 42.72 ? 172 LEU A N     1 
ATOM   368  C CA    . LEU A 1 61  ? 0.650   26.909 18.342  1.00 43.84 ? 172 LEU A CA    1 
ATOM   369  C C     . LEU A 1 61  ? 1.291   25.520 18.334  1.00 45.10 ? 172 LEU A C     1 
ATOM   370  O O     . LEU A 1 61  ? 0.854   24.631 19.066  1.00 45.15 ? 172 LEU A O     1 
ATOM   371  C CB    . LEU A 1 61  ? 1.365   27.825 19.337  1.00 43.34 ? 172 LEU A CB    1 
ATOM   372  C CG    . LEU A 1 61  ? 0.820   29.262 19.386  1.00 43.91 ? 172 LEU A CG    1 
ATOM   373  C CD1   . LEU A 1 61  ? 1.282   29.955 20.647  1.00 43.55 ? 172 LEU A CD1   1 
ATOM   374  C CD2   . LEU A 1 61  ? 1.271   30.031 18.144  1.00 43.38 ? 172 LEU A CD2   1 
ATOM   375  N N     . VAL A 1 62  ? 2.300   25.329 17.484  1.00 46.73 ? 173 VAL A N     1 
ATOM   376  C CA    . VAL A 1 62  ? 2.997   24.049 17.394  1.00 49.94 ? 173 VAL A CA    1 
ATOM   377  C C     . VAL A 1 62  ? 4.513   24.225 17.408  1.00 53.13 ? 173 VAL A C     1 
ATOM   378  O O     . VAL A 1 62  ? 5.028   25.322 17.176  1.00 54.42 ? 173 VAL A O     1 
ATOM   379  C CB    . VAL A 1 62  ? 2.619   23.265 16.115  1.00 50.20 ? 173 VAL A CB    1 
ATOM   380  C CG1   . VAL A 1 62  ? 1.170   22.829 16.173  1.00 50.31 ? 173 VAL A CG1   1 
ATOM   381  C CG2   . VAL A 1 62  ? 2.883   24.106 14.891  1.00 49.88 ? 173 VAL A CG2   1 
ATOM   382  N N     . LYS A 1 63  ? 5.222   23.136 17.687  1.00 55.10 ? 174 LYS A N     1 
ATOM   383  C CA    . LYS A 1 63  ? 6.676   23.168 17.734  1.00 58.06 ? 174 LYS A CA    1 
ATOM   384  C C     . LYS A 1 63  ? 7.288   22.070 16.880  1.00 58.78 ? 174 LYS A C     1 
ATOM   385  O O     . LYS A 1 63  ? 6.736   20.978 16.743  1.00 57.88 ? 174 LYS A O     1 
ATOM   386  C CB    . LYS A 1 63  ? 7.184   23.008 19.169  1.00 59.22 ? 174 LYS A CB    1 
ATOM   387  C CG    . LYS A 1 63  ? 6.914   24.184 20.082  1.00 59.72 ? 174 LYS A CG    1 
ATOM   388  C CD    . LYS A 1 63  ? 7.469   23.915 21.477  1.00 60.65 ? 174 LYS A CD    1 
ATOM   389  C CE    . LYS A 1 63  ? 6.720   22.792 22.170  1.00 60.94 ? 174 LYS A CE    1 
ATOM   390  N NZ    . LYS A 1 63  ? 5.262   23.104 22.306  1.00 62.99 ? 174 LYS A NZ    1 
ATOM   391  N N     . GLU A 1 64  ? 8.449   22.385 16.324  1.00 60.33 ? 175 GLU A N     1 
ATOM   392  C CA    . GLU A 1 64  ? 9.192   21.472 15.479  1.00 61.27 ? 175 GLU A CA    1 
ATOM   393  C C     . GLU A 1 64  ? 9.242   20.084 16.109  1.00 61.36 ? 175 GLU A C     1 
ATOM   394  O O     . GLU A 1 64  ? 9.719   19.922 17.230  1.00 61.17 ? 175 GLU A O     1 
ATOM   395  C CB    . GLU A 1 64  ? 10.598  22.025 15.295  1.00 62.60 ? 175 GLU A CB    1 
ATOM   396  C CG    . GLU A 1 64  ? 11.414  21.344 14.234  1.00 64.62 ? 175 GLU A CG    1 
ATOM   397  C CD    . GLU A 1 64  ? 12.650  22.144 13.889  1.00 66.39 ? 175 GLU A CD    1 
ATOM   398  O OE1   . GLU A 1 64  ? 13.474  21.643 13.096  1.00 68.87 ? 175 GLU A OE1   1 
ATOM   399  O OE2   . GLU A 1 64  ? 12.792  23.276 14.410  1.00 65.37 ? 175 GLU A OE2   1 
ATOM   400  N N     . GLY A 1 65  ? 8.729   19.092 15.386  1.00 61.74 ? 176 GLY A N     1 
ATOM   401  C CA    . GLY A 1 65  ? 8.728   17.725 15.881  1.00 61.38 ? 176 GLY A CA    1 
ATOM   402  C C     . GLY A 1 65  ? 7.371   17.264 16.377  1.00 61.15 ? 176 GLY A C     1 
ATOM   403  O O     . GLY A 1 65  ? 7.077   16.066 16.418  1.00 60.40 ? 176 GLY A O     1 
ATOM   404  N N     . GLU A 1 66  ? 6.537   18.231 16.736  1.00 61.15 ? 177 GLU A N     1 
ATOM   405  C CA    . GLU A 1 66  ? 5.203   17.969 17.257  1.00 60.51 ? 177 GLU A CA    1 
ATOM   406  C C     . GLU A 1 66  ? 4.333   17.169 16.289  1.00 59.75 ? 177 GLU A C     1 
ATOM   407  O O     . GLU A 1 66  ? 4.238   17.500 15.108  1.00 60.19 ? 177 GLU A O     1 
ATOM   408  C CB    . GLU A 1 66  ? 4.534   19.307 17.592  1.00 62.00 ? 177 GLU A CB    1 
ATOM   409  C CG    . GLU A 1 66  ? 3.421   19.225 18.623  1.00 65.77 ? 177 GLU A CG    1 
ATOM   410  C CD    . GLU A 1 66  ? 2.975   20.596 19.109  1.00 67.81 ? 177 GLU A CD    1 
ATOM   411  O OE1   . GLU A 1 66  ? 3.848   21.389 19.535  1.00 68.91 ? 177 GLU A OE1   1 
ATOM   412  O OE2   . GLU A 1 66  ? 1.756   20.880 19.071  1.00 68.36 ? 177 GLU A OE2   1 
ATOM   413  N N     . HIS A 1 67  ? 3.710   16.105 16.787  1.00 58.20 ? 178 HIS A N     1 
ATOM   414  C CA    . HIS A 1 67  ? 2.831   15.286 15.961  1.00 57.03 ? 178 HIS A CA    1 
ATOM   415  C C     . HIS A 1 67  ? 1.399   15.789 16.095  1.00 56.70 ? 178 HIS A C     1 
ATOM   416  O O     . HIS A 1 67  ? 0.637   15.308 16.943  1.00 57.46 ? 178 HIS A O     1 
ATOM   417  C CB    . HIS A 1 67  ? 2.881   13.812 16.386  1.00 57.06 ? 178 HIS A CB    1 
ATOM   418  C CG    . HIS A 1 67  ? 4.163   13.125 16.041  1.00 57.89 ? 178 HIS A CG    1 
ATOM   419  N ND1   . HIS A 1 67  ? 4.201   11.897 15.416  1.00 56.10 ? 178 HIS A ND1   1 
ATOM   420  C CD2   . HIS A 1 67  ? 5.453   13.500 16.219  1.00 57.40 ? 178 HIS A CD2   1 
ATOM   421  C CE1   . HIS A 1 67  ? 5.461   11.548 15.220  1.00 57.51 ? 178 HIS A CE1   1 
ATOM   422  N NE2   . HIS A 1 67  ? 6.240   12.503 15.696  1.00 57.14 ? 178 HIS A NE2   1 
ATOM   423  N N     . VAL A 1 68  ? 1.033   16.751 15.254  1.00 54.00 ? 179 VAL A N     1 
ATOM   424  C CA    . VAL A 1 68  ? -0.309  17.320 15.287  1.00 51.77 ? 179 VAL A CA    1 
ATOM   425  C C     . VAL A 1 68  ? -1.370  16.251 15.076  1.00 49.83 ? 179 VAL A C     1 
ATOM   426  O O     . VAL A 1 68  ? -2.450  16.314 15.654  1.00 48.24 ? 179 VAL A O     1 
ATOM   427  C CB    . VAL A 1 68  ? -0.480  18.408 14.205  1.00 52.44 ? 179 VAL A CB    1 
ATOM   428  C CG1   . VAL A 1 68  ? -1.856  19.055 14.332  1.00 52.46 ? 179 VAL A CG1   1 
ATOM   429  C CG2   . VAL A 1 68  ? 0.623   19.457 14.341  1.00 51.00 ? 179 VAL A CG2   1 
ATOM   430  N N     . ILE A 1 69  ? -1.048  15.270 14.240  1.00 49.75 ? 180 ILE A N     1 
ATOM   431  C CA    . ILE A 1 69  ? -1.955  14.169 13.941  1.00 48.34 ? 180 ILE A CA    1 
ATOM   432  C C     . ILE A 1 69  ? -1.155  12.879 13.809  1.00 48.62 ? 180 ILE A C     1 
ATOM   433  O O     . ILE A 1 69  ? -0.080  12.870 13.220  1.00 48.74 ? 180 ILE A O     1 
ATOM   434  C CB    . ILE A 1 69  ? -2.723  14.394 12.612  1.00 46.90 ? 180 ILE A CB    1 
ATOM   435  C CG1   . ILE A 1 69  ? -3.770  15.493 12.781  1.00 47.18 ? 180 ILE A CG1   1 
ATOM   436  C CG2   . ILE A 1 69  ? -3.395  13.102 12.174  1.00 48.87 ? 180 ILE A CG2   1 
ATOM   437  C CD1   . ILE A 1 69  ? -4.719  15.642 11.601  1.00 44.29 ? 180 ILE A CD1   1 
ATOM   438  N N     . ASP A 1 70  ? -1.684  11.795 14.368  1.00 49.04 ? 181 ASP A N     1 
ATOM   439  C CA    . ASP A 1 70  ? -1.034  10.492 14.294  1.00 48.20 ? 181 ASP A CA    1 
ATOM   440  C C     . ASP A 1 70  ? -1.963  9.509  13.614  1.00 46.23 ? 181 ASP A C     1 
ATOM   441  O O     . ASP A 1 70  ? -3.105  9.329  14.031  1.00 45.71 ? 181 ASP A O     1 
ATOM   442  C CB    . ASP A 1 70  ? -0.665  9.982  15.689  1.00 48.34 ? 181 ASP A CB    1 
ATOM   443  C CG    . ASP A 1 70  ? 0.638   10.565 16.187  1.00 51.63 ? 181 ASP A CG    1 
ATOM   444  O OD1   . ASP A 1 70  ? 1.676   10.361 15.516  1.00 53.38 ? 181 ASP A OD1   1 
ATOM   445  O OD2   . ASP A 1 70  ? 0.632   11.230 17.244  1.00 53.58 ? 181 ASP A OD2   1 
ATOM   446  N N     . GLN A 1 71  ? -1.462  8.874  12.565  1.00 45.65 ? 182 GLN A N     1 
ATOM   447  C CA    . GLN A 1 71  ? -2.256  7.920  11.809  1.00 48.36 ? 182 GLN A CA    1 
ATOM   448  C C     . GLN A 1 71  ? -2.933  6.899  12.717  1.00 49.30 ? 182 GLN A C     1 
ATOM   449  O O     . GLN A 1 71  ? -2.333  6.406  13.676  1.00 50.26 ? 182 GLN A O     1 
ATOM   450  C CB    . GLN A 1 71  ? -1.370  7.212  10.790  1.00 48.33 ? 182 GLN A CB    1 
ATOM   451  C CG    . GLN A 1 71  ? -2.132  6.441  9.739   1.00 47.63 ? 182 GLN A CG    1 
ATOM   452  C CD    . GLN A 1 71  ? -1.218  5.923  8.659   1.00 48.70 ? 182 GLN A CD    1 
ATOM   453  O OE1   . GLN A 1 71  ? -0.087  6.396  8.515   1.00 49.04 ? 182 GLN A OE1   1 
ATOM   454  N NE2   . GLN A 1 71  ? -1.701  4.962  7.881   1.00 47.46 ? 182 GLN A NE2   1 
ATOM   455  N N     . GLY A 1 72  ? -4.188  6.586  12.417  1.00 50.19 ? 183 GLY A N     1 
ATOM   456  C CA    . GLY A 1 72  ? -4.911  5.627  13.233  1.00 50.96 ? 183 GLY A CA    1 
ATOM   457  C C     . GLY A 1 72  ? -5.738  6.304  14.303  1.00 51.06 ? 183 GLY A C     1 
ATOM   458  O O     . GLY A 1 72  ? -6.772  5.784  14.711  1.00 51.06 ? 183 GLY A O     1 
ATOM   459  N N     . ASP A 1 73  ? -5.288  7.475  14.749  1.00 52.23 ? 184 ASP A N     1 
ATOM   460  C CA    . ASP A 1 73  ? -5.995  8.244  15.779  1.00 52.79 ? 184 ASP A CA    1 
ATOM   461  C C     . ASP A 1 73  ? -7.421  8.630  15.377  1.00 51.69 ? 184 ASP A C     1 
ATOM   462  O O     . ASP A 1 73  ? -7.850  8.421  14.239  1.00 51.00 ? 184 ASP A O     1 
ATOM   463  C CB    . ASP A 1 73  ? -5.221  9.523  16.109  1.00 54.33 ? 184 ASP A CB    1 
ATOM   464  C CG    . ASP A 1 73  ? -4.165  9.317  17.172  1.00 55.06 ? 184 ASP A CG    1 
ATOM   465  O OD1   . ASP A 1 73  ? -3.433  8.306  17.119  1.00 56.69 ? 184 ASP A OD1   1 
ATOM   466  O OD2   . ASP A 1 73  ? -4.059  10.187 18.062  1.00 56.05 ? 184 ASP A OD2   1 
ATOM   467  N N     . ASP A 1 74  ? -8.142  9.209  16.328  1.00 50.41 ? 185 ASP A N     1 
ATOM   468  C CA    . ASP A 1 74  ? -9.512  9.643  16.104  1.00 49.62 ? 185 ASP A CA    1 
ATOM   469  C C     . ASP A 1 74  ? -9.576  11.063 15.537  1.00 48.26 ? 185 ASP A C     1 
ATOM   470  O O     . ASP A 1 74  ? -8.731  11.916 15.833  1.00 45.79 ? 185 ASP A O     1 
ATOM   471  C CB    . ASP A 1 74  ? -10.302 9.574  17.417  1.00 52.49 ? 185 ASP A CB    1 
ATOM   472  C CG    . ASP A 1 74  ? -10.730 8.157  17.772  1.00 54.04 ? 185 ASP A CG    1 
ATOM   473  O OD1   . ASP A 1 74  ? -11.584 7.595  17.039  1.00 52.71 ? 185 ASP A OD1   1 
ATOM   474  O OD2   . ASP A 1 74  ? -10.213 7.613  18.781  1.00 53.06 ? 185 ASP A OD2   1 
ATOM   475  N N     . GLY A 1 75  ? -10.593 11.306 14.718  1.00 47.32 ? 186 GLY A N     1 
ATOM   476  C CA    . GLY A 1 75  ? -10.758 12.611 14.113  1.00 46.75 ? 186 GLY A CA    1 
ATOM   477  C C     . GLY A 1 75  ? -11.430 13.602 15.039  1.00 45.78 ? 186 GLY A C     1 
ATOM   478  O O     . GLY A 1 75  ? -12.607 13.450 15.369  1.00 46.45 ? 186 GLY A O     1 
ATOM   479  N N     . ASP A 1 76  ? -10.686 14.620 15.458  1.00 44.13 ? 187 ASP A N     1 
ATOM   480  C CA    . ASP A 1 76  ? -11.241 15.627 16.343  1.00 43.97 ? 187 ASP A CA    1 
ATOM   481  C C     . ASP A 1 76  ? -11.409 17.000 15.696  1.00 43.13 ? 187 ASP A C     1 
ATOM   482  O O     . ASP A 1 76  ? -12.481 17.598 15.790  1.00 43.50 ? 187 ASP A O     1 
ATOM   483  C CB    . ASP A 1 76  ? -10.403 15.729 17.630  1.00 46.15 ? 187 ASP A CB    1 
ATOM   484  C CG    . ASP A 1 76  ? -8.914  15.918 17.366  1.00 49.53 ? 187 ASP A CG    1 
ATOM   485  O OD1   . ASP A 1 76  ? -8.421  15.496 16.302  1.00 51.77 ? 187 ASP A OD1   1 
ATOM   486  O OD2   . ASP A 1 76  ? -8.222  16.477 18.245  1.00 52.30 ? 187 ASP A OD2   1 
ATOM   487  N N     . ASN A 1 77  ? -10.375 17.489 15.019  1.00 40.73 ? 188 ASN A N     1 
ATOM   488  C CA    . ASN A 1 77  ? -10.450 18.801 14.400  1.00 37.72 ? 188 ASN A CA    1 
ATOM   489  C C     . ASN A 1 77  ? -9.927  18.866 12.987  1.00 39.42 ? 188 ASN A C     1 
ATOM   490  O O     . ASN A 1 77  ? -9.186  17.987 12.520  1.00 40.19 ? 188 ASN A O     1 
ATOM   491  C CB    . ASN A 1 77  ? -9.649  19.819 15.196  1.00 35.72 ? 188 ASN A CB    1 
ATOM   492  C CG    . ASN A 1 77  ? -9.905  19.732 16.658  1.00 35.90 ? 188 ASN A CG    1 
ATOM   493  O OD1   . ASN A 1 77  ? -11.055 19.667 17.086  1.00 38.62 ? 188 ASN A OD1   1 
ATOM   494  N ND2   . ASN A 1 77  ? -8.836  19.740 17.453  1.00 34.93 ? 188 ASN A ND2   1 
ATOM   495  N N     . PHE A 1 78  ? -10.321 19.944 12.319  1.00 38.26 ? 189 PHE A N     1 
ATOM   496  C CA    . PHE A 1 78  ? -9.867  20.233 10.980  1.00 35.95 ? 189 PHE A CA    1 
ATOM   497  C C     . PHE A 1 78  ? -8.879  21.374 11.200  1.00 35.60 ? 189 PHE A C     1 
ATOM   498  O O     . PHE A 1 78  ? -9.111  22.254 12.043  1.00 35.37 ? 189 PHE A O     1 
ATOM   499  C CB    . PHE A 1 78  ? -11.012 20.714 10.102  1.00 36.31 ? 189 PHE A CB    1 
ATOM   500  C CG    . PHE A 1 78  ? -10.558 21.249 8.778   1.00 38.07 ? 189 PHE A CG    1 
ATOM   501  C CD1   . PHE A 1 78  ? -10.005 20.401 7.823   1.00 38.83 ? 189 PHE A CD1   1 
ATOM   502  C CD2   . PHE A 1 78  ? -10.647 22.609 8.497   1.00 38.45 ? 189 PHE A CD2   1 
ATOM   503  C CE1   . PHE A 1 78  ? -9.548  20.902 6.614   1.00 40.60 ? 189 PHE A CE1   1 
ATOM   504  C CE2   . PHE A 1 78  ? -10.194 23.121 7.289   1.00 37.34 ? 189 PHE A CE2   1 
ATOM   505  C CZ    . PHE A 1 78  ? -9.644  22.273 6.347   1.00 39.27 ? 189 PHE A CZ    1 
ATOM   506  N N     . TYR A 1 79  ? -7.777  21.365 10.459  1.00 33.97 ? 190 TYR A N     1 
ATOM   507  C CA    . TYR A 1 79  ? -6.775  22.411 10.607  1.00 32.60 ? 190 TYR A CA    1 
ATOM   508  C C     . TYR A 1 79  ? -6.520  23.193 9.327   1.00 32.47 ? 190 TYR A C     1 
ATOM   509  O O     . TYR A 1 79  ? -6.640  22.674 8.221   1.00 32.58 ? 190 TYR A O     1 
ATOM   510  C CB    . TYR A 1 79  ? -5.444  21.816 11.084  1.00 32.81 ? 190 TYR A CB    1 
ATOM   511  C CG    . TYR A 1 79  ? -5.506  21.199 12.455  1.00 33.13 ? 190 TYR A CG    1 
ATOM   512  C CD1   . TYR A 1 79  ? -5.524  21.993 13.599  1.00 31.53 ? 190 TYR A CD1   1 
ATOM   513  C CD2   . TYR A 1 79  ? -5.594  19.813 12.606  1.00 34.02 ? 190 TYR A CD2   1 
ATOM   514  C CE1   . TYR A 1 79  ? -5.632  21.421 14.856  1.00 34.84 ? 190 TYR A CE1   1 
ATOM   515  C CE2   . TYR A 1 79  ? -5.703  19.232 13.858  1.00 33.59 ? 190 TYR A CE2   1 
ATOM   516  C CZ    . TYR A 1 79  ? -5.723  20.037 14.976  1.00 33.64 ? 190 TYR A CZ    1 
ATOM   517  O OH    . TYR A 1 79  ? -5.859  19.462 16.213  1.00 36.15 ? 190 TYR A OH    1 
ATOM   518  N N     . VAL A 1 80  ? -6.152  24.453 9.515   1.00 31.92 ? 191 VAL A N     1 
ATOM   519  C CA    . VAL A 1 80  ? -5.820  25.367 8.441   1.00 30.31 ? 191 VAL A CA    1 
ATOM   520  C C     . VAL A 1 80  ? -4.511  25.938 8.941   1.00 32.30 ? 191 VAL A C     1 
ATOM   521  O O     . VAL A 1 80  ? -4.413  26.311 10.110  1.00 32.20 ? 191 VAL A O     1 
ATOM   522  C CB    . VAL A 1 80  ? -6.877  26.491 8.298   1.00 27.39 ? 191 VAL A CB    1 
ATOM   523  C CG1   . VAL A 1 80  ? -6.333  27.606 7.434   1.00 25.32 ? 191 VAL A CG1   1 
ATOM   524  C CG2   . VAL A 1 80  ? -8.150  25.926 7.701   1.00 22.49 ? 191 VAL A CG2   1 
ATOM   525  N N     . ILE A 1 81  ? -3.508  25.991 8.071   1.00 34.68 ? 192 ILE A N     1 
ATOM   526  C CA    . ILE A 1 81  ? -2.188  26.477 8.458   1.00 38.36 ? 192 ILE A CA    1 
ATOM   527  C C     . ILE A 1 81  ? -2.035  27.986 8.462   1.00 40.28 ? 192 ILE A C     1 
ATOM   528  O O     . ILE A 1 81  ? -2.365  28.654 7.488   1.00 43.20 ? 192 ILE A O     1 
ATOM   529  C CB    . ILE A 1 81  ? -1.099  25.881 7.540   1.00 37.27 ? 192 ILE A CB    1 
ATOM   530  C CG1   . ILE A 1 81  ? -1.111  24.358 7.654   1.00 39.54 ? 192 ILE A CG1   1 
ATOM   531  C CG2   . ILE A 1 81  ? 0.267   26.401 7.933   1.00 38.47 ? 192 ILE A CG2   1 
ATOM   532  C CD1   . ILE A 1 81  ? -0.130  23.659 6.728   1.00 39.13 ? 192 ILE A CD1   1 
ATOM   533  N N     . ASP A 1 82  ? -1.533  28.526 9.564   1.00 42.61 ? 193 ASP A N     1 
ATOM   534  C CA    . ASP A 1 82  ? -1.310  29.962 9.648   1.00 45.26 ? 193 ASP A CA    1 
ATOM   535  C C     . ASP A 1 82  ? 0.143   30.235 9.285   1.00 46.41 ? 193 ASP A C     1 
ATOM   536  O O     . ASP A 1 82  ? 0.468   31.253 8.667   1.00 45.08 ? 193 ASP A O     1 
ATOM   537  C CB    . ASP A 1 82  ? -1.605  30.488 11.054  1.00 45.89 ? 193 ASP A CB    1 
ATOM   538  C CG    . ASP A 1 82  ? -1.478  31.999 11.140  1.00 49.78 ? 193 ASP A CG    1 
ATOM   539  O OD1   . ASP A 1 82  ? -0.332  32.501 11.164  1.00 53.05 ? 193 ASP A OD1   1 
ATOM   540  O OD2   . ASP A 1 82  ? -2.520  32.690 11.164  1.00 50.08 ? 193 ASP A OD2   1 
ATOM   541  N N     . ARG A 1 83  ? 1.011   29.305 9.674   1.00 48.87 ? 194 ARG A N     1 
ATOM   542  C CA    . ARG A 1 83  ? 2.437   29.401 9.395   1.00 50.79 ? 194 ARG A CA    1 
ATOM   543  C C     . ARG A 1 83  ? 3.134   28.114 9.795   1.00 52.16 ? 194 ARG A C     1 
ATOM   544  O O     . ARG A 1 83  ? 2.507   27.202 10.334  1.00 52.11 ? 194 ARG A O     1 
ATOM   545  C CB    . ARG A 1 83  ? 3.059   30.573 10.145  1.00 51.66 ? 194 ARG A CB    1 
ATOM   546  C CG    . ARG A 1 83  ? 2.881   30.528 11.648  1.00 54.71 ? 194 ARG A CG    1 
ATOM   547  C CD    . ARG A 1 83  ? 3.680   31.647 12.301  1.00 57.17 ? 194 ARG A CD    1 
ATOM   548  N NE    . ARG A 1 83  ? 3.509   31.702 13.750  1.00 59.79 ? 194 ARG A NE    1 
ATOM   549  C CZ    . ARG A 1 83  ? 2.460   32.238 14.368  1.00 60.29 ? 194 ARG A CZ    1 
ATOM   550  N NH1   . ARG A 1 83  ? 1.471   32.777 13.665  1.00 61.58 ? 194 ARG A NH1   1 
ATOM   551  N NH2   . ARG A 1 83  ? 2.403   32.239 15.694  1.00 60.23 ? 194 ARG A NH2   1 
ATOM   552  N N     . GLY A 1 84  ? 4.433   28.046 9.515   1.00 53.06 ? 195 GLY A N     1 
ATOM   553  C CA    . GLY A 1 84  ? 5.213   26.867 9.841   1.00 52.86 ? 195 GLY A CA    1 
ATOM   554  C C     . GLY A 1 84  ? 5.165   25.803 8.756   1.00 52.17 ? 195 GLY A C     1 
ATOM   555  O O     . GLY A 1 84  ? 4.211   25.735 7.981   1.00 50.48 ? 195 GLY A O     1 
ATOM   556  N N     . THR A 1 85  ? 6.204   24.971 8.712   1.00 52.77 ? 196 THR A N     1 
ATOM   557  C CA    . THR A 1 85  ? 6.310   23.891 7.734   1.00 52.16 ? 196 THR A CA    1 
ATOM   558  C C     . THR A 1 85  ? 5.870   22.569 8.356   1.00 51.75 ? 196 THR A C     1 
ATOM   559  O O     . THR A 1 85  ? 5.933   22.394 9.567   1.00 51.74 ? 196 THR A O     1 
ATOM   560  C CB    . THR A 1 85  ? 7.758   23.752 7.232   1.00 52.38 ? 196 THR A CB    1 
ATOM   561  O OG1   . THR A 1 85  ? 8.631   23.549 8.351   1.00 53.75 ? 196 THR A OG1   1 
ATOM   562  C CG2   . THR A 1 85  ? 8.188   25.013 6.489   1.00 50.86 ? 196 THR A CG2   1 
ATOM   563  N N     . PHE A 1 86  ? 5.408   21.646 7.523   1.00 52.13 ? 197 PHE A N     1 
ATOM   564  C CA    . PHE A 1 86  ? 4.947   20.349 7.997   1.00 52.26 ? 197 PHE A CA    1 
ATOM   565  C C     . PHE A 1 86  ? 5.345   19.233 7.058   1.00 52.94 ? 197 PHE A C     1 
ATOM   566  O O     . PHE A 1 86  ? 5.686   19.478 5.899   1.00 53.51 ? 197 PHE A O     1 
ATOM   567  C CB    . PHE A 1 86  ? 3.429   20.337 8.123   1.00 51.34 ? 197 PHE A CB    1 
ATOM   568  C CG    . PHE A 1 86  ? 2.911   21.226 9.199   1.00 53.63 ? 197 PHE A CG    1 
ATOM   569  C CD1   . PHE A 1 86  ? 2.946   22.614 9.051   1.00 51.76 ? 197 PHE A CD1   1 
ATOM   570  C CD2   . PHE A 1 86  ? 2.411   20.678 10.387  1.00 52.22 ? 197 PHE A CD2   1 
ATOM   571  C CE1   . PHE A 1 86  ? 2.496   23.445 10.072  1.00 52.20 ? 197 PHE A CE1   1 
ATOM   572  C CE2   . PHE A 1 86  ? 1.959   21.501 11.411  1.00 50.67 ? 197 PHE A CE2   1 
ATOM   573  C CZ    . PHE A 1 86  ? 2.002   22.889 11.256  1.00 50.19 ? 197 PHE A CZ    1 
ATOM   574  N N     . ASP A 1 87  ? 5.281   18.006 7.566   1.00 52.58 ? 198 ASP A N     1 
ATOM   575  C CA    . ASP A 1 87  ? 5.611   16.821 6.788   1.00 53.62 ? 198 ASP A CA    1 
ATOM   576  C C     . ASP A 1 87  ? 4.469   15.817 6.892   1.00 53.38 ? 198 ASP A C     1 
ATOM   577  O O     . ASP A 1 87  ? 3.811   15.710 7.931   1.00 53.99 ? 198 ASP A O     1 
ATOM   578  C CB    . ASP A 1 87  ? 6.913   16.194 7.294   1.00 56.03 ? 198 ASP A CB    1 
ATOM   579  C CG    . ASP A 1 87  ? 8.129   16.660 6.508   1.00 59.66 ? 198 ASP A CG    1 
ATOM   580  O OD1   . ASP A 1 87  ? 8.250   17.884 6.252   1.00 60.71 ? 198 ASP A OD1   1 
ATOM   581  O OD2   . ASP A 1 87  ? 8.970   15.797 6.155   1.00 60.64 ? 198 ASP A OD2   1 
ATOM   582  N N     . ILE A 1 88  ? 4.236   15.082 5.810   1.00 52.39 ? 199 ILE A N     1 
ATOM   583  C CA    . ILE A 1 88  ? 3.164   14.099 5.775   1.00 51.37 ? 199 ILE A CA    1 
ATOM   584  C C     . ILE A 1 88  ? 3.755   12.697 5.772   1.00 52.55 ? 199 ILE A C     1 
ATOM   585  O O     . ILE A 1 88  ? 4.635   12.389 4.967   1.00 51.90 ? 199 ILE A O     1 
ATOM   586  C CB    . ILE A 1 88  ? 2.281   14.301 4.515   1.00 49.87 ? 199 ILE A CB    1 
ATOM   587  C CG1   . ILE A 1 88  ? 1.832   15.768 4.438   1.00 47.99 ? 199 ILE A CG1   1 
ATOM   588  C CG2   . ILE A 1 88  ? 1.088   13.340 4.548   1.00 45.55 ? 199 ILE A CG2   1 
ATOM   589  C CD1   . ILE A 1 88  ? 1.106   16.145 3.165   1.00 46.33 ? 199 ILE A CD1   1 
ATOM   590  N N     . TYR A 1 89  ? 3.268   11.853 6.680   1.00 54.18 ? 200 TYR A N     1 
ATOM   591  C CA    . TYR A 1 89  ? 3.755   10.484 6.793   1.00 55.37 ? 200 TYR A CA    1 
ATOM   592  C C     . TYR A 1 89  ? 2.673   9.415  6.740   1.00 55.98 ? 200 TYR A C     1 
ATOM   593  O O     . TYR A 1 89  ? 1.623   9.535  7.378   1.00 55.00 ? 200 TYR A O     1 
ATOM   594  C CB    . TYR A 1 89  ? 4.553   10.303 8.090   1.00 56.24 ? 200 TYR A CB    1 
ATOM   595  C CG    . TYR A 1 89  ? 5.945   10.901 8.053   1.00 58.24 ? 200 TYR A CG    1 
ATOM   596  C CD1   . TYR A 1 89  ? 6.166   12.240 8.394   1.00 58.26 ? 200 TYR A CD1   1 
ATOM   597  C CD2   . TYR A 1 89  ? 7.040   10.133 7.645   1.00 59.03 ? 200 TYR A CD2   1 
ATOM   598  C CE1   . TYR A 1 89  ? 7.445   12.797 8.330   1.00 58.77 ? 200 TYR A CE1   1 
ATOM   599  C CE2   . TYR A 1 89  ? 8.317   10.679 7.574   1.00 58.98 ? 200 TYR A CE2   1 
ATOM   600  C CZ    . TYR A 1 89  ? 8.512   12.009 7.917   1.00 59.44 ? 200 TYR A CZ    1 
ATOM   601  O OH    . TYR A 1 89  ? 9.777   12.544 7.848   1.00 59.69 ? 200 TYR A OH    1 
ATOM   602  N N     . VAL A 1 90  ? 2.947   8.370  5.963   1.00 57.18 ? 201 VAL A N     1 
ATOM   603  C CA    . VAL A 1 90  ? 2.043   7.234  5.829   1.00 58.59 ? 201 VAL A CA    1 
ATOM   604  C C     . VAL A 1 90  ? 2.852   5.947  6.059   1.00 60.32 ? 201 VAL A C     1 
ATOM   605  O O     . VAL A 1 90  ? 4.041   5.872  5.719   1.00 59.26 ? 201 VAL A O     1 
ATOM   606  C CB    . VAL A 1 90  ? 1.391   7.178  4.428   1.00 58.04 ? 201 VAL A CB    1 
ATOM   607  C CG1   . VAL A 1 90  ? 0.421   6.005  4.357   1.00 57.67 ? 201 VAL A CG1   1 
ATOM   608  C CG2   . VAL A 1 90  ? 0.657   8.481  4.138   1.00 58.21 ? 201 VAL A CG2   1 
ATOM   609  N N     . LYS A 1 91  ? 2.211   4.940  6.643   1.00 61.48 ? 202 LYS A N     1 
ATOM   610  C CA    . LYS A 1 91  ? 2.890   3.684  6.913   1.00 63.43 ? 202 LYS A CA    1 
ATOM   611  C C     . LYS A 1 91  ? 2.654   2.670  5.796   1.00 64.84 ? 202 LYS A C     1 
ATOM   612  O O     . LYS A 1 91  ? 1.514   2.319  5.482   1.00 65.16 ? 202 LYS A O     1 
ATOM   613  C CB    . LYS A 1 91  ? 2.427   3.117  8.253   1.00 63.69 ? 202 LYS A CB    1 
ATOM   614  C CG    . LYS A 1 91  ? 0.938   2.810  8.324   1.00 64.44 ? 202 LYS A CG    1 
ATOM   615  C CD    . LYS A 1 91  ? 0.587   2.183  9.661   1.00 65.65 ? 202 LYS A CD    1 
ATOM   616  C CE    . LYS A 1 91  ? 1.454   0.958  9.937   1.00 66.93 ? 202 LYS A CE    1 
ATOM   617  N NZ    . LYS A 1 91  ? 1.216   0.386  11.293  1.00 67.34 ? 202 LYS A NZ    1 
ATOM   618  N N     . CYS A 1 92  ? 3.745   2.213  5.193   1.00 65.87 ? 203 CYS A N     1 
ATOM   619  C CA    . CYS A 1 92  ? 3.674   1.247  4.108   1.00 67.74 ? 203 CYS A CA    1 
ATOM   620  C C     . CYS A 1 92  ? 4.152   -0.120 4.589   1.00 68.41 ? 203 CYS A C     1 
ATOM   621  O O     . CYS A 1 92  ? 5.347   -0.427 4.548   1.00 69.12 ? 203 CYS A O     1 
ATOM   622  C CB    . CYS A 1 92  ? 4.525   1.726  2.921   1.00 67.25 ? 203 CYS A CB    1 
ATOM   623  N N     . ASP A 1 93  ? 3.208   -0.931 5.054   1.00 68.89 ? 204 ASP A N     1 
ATOM   624  C CA    . ASP A 1 93  ? 3.509   -2.273 5.540   1.00 69.15 ? 204 ASP A CA    1 
ATOM   625  C C     . ASP A 1 93  ? 4.181   -2.231 6.907   1.00 68.07 ? 204 ASP A C     1 
ATOM   626  O O     . ASP A 1 93  ? 4.753   -3.223 7.352   1.00 68.34 ? 204 ASP A O     1 
ATOM   627  C CB    . ASP A 1 93  ? 4.410   -3.002 4.537   1.00 70.46 ? 204 ASP A CB    1 
ATOM   628  C CG    . ASP A 1 93  ? 3.934   -2.834 3.104   1.00 72.05 ? 204 ASP A CG    1 
ATOM   629  O OD1   . ASP A 1 93  ? 2.900   -3.439 2.745   1.00 73.62 ? 204 ASP A OD1   1 
ATOM   630  O OD2   . ASP A 1 93  ? 4.587   -2.084 2.341   1.00 70.93 ? 204 ASP A OD2   1 
ATOM   631  N N     . GLY A 1 94  ? 4.110   -1.081 7.570   1.00 67.03 ? 205 GLY A N     1 
ATOM   632  C CA    . GLY A 1 94  ? 4.706   -0.950 8.888   1.00 64.94 ? 205 GLY A CA    1 
ATOM   633  C C     . GLY A 1 94  ? 5.791   0.104  8.963   1.00 64.41 ? 205 GLY A C     1 
ATOM   634  O O     . GLY A 1 94  ? 6.262   0.443  10.047  1.00 63.33 ? 205 GLY A O     1 
ATOM   635  N N     . VAL A 1 95  ? 6.196   0.615  7.805   1.00 65.18 ? 206 VAL A N     1 
ATOM   636  C CA    . VAL A 1 95  ? 7.232   1.639  7.727   1.00 65.70 ? 206 VAL A CA    1 
ATOM   637  C C     . VAL A 1 95  ? 6.596   2.925  7.211   1.00 66.98 ? 206 VAL A C     1 
ATOM   638  O O     . VAL A 1 95  ? 5.907   2.920  6.192   1.00 67.71 ? 206 VAL A O     1 
ATOM   639  C CB    . VAL A 1 95  ? 8.372   1.205  6.772   1.00 65.18 ? 206 VAL A CB    1 
ATOM   640  C CG1   . VAL A 1 95  ? 7.814   0.928  5.387   1.00 66.68 ? 206 VAL A CG1   1 
ATOM   641  C CG2   . VAL A 1 95  ? 9.438   2.280  6.705   1.00 64.92 ? 206 VAL A CG2   1 
ATOM   642  N N     . GLY A 1 96  ? 6.820   4.024  7.919   1.00 67.56 ? 207 GLY A N     1 
ATOM   643  C CA    . GLY A 1 96  ? 6.238   5.283  7.502   1.00 68.80 ? 207 GLY A CA    1 
ATOM   644  C C     . GLY A 1 96  ? 7.207   6.140  6.722   1.00 70.10 ? 207 GLY A C     1 
ATOM   645  O O     . GLY A 1 96  ? 8.375   6.259  7.096   1.00 71.45 ? 207 GLY A O     1 
ATOM   646  N N     . ARG A 1 97  ? 6.730   6.734  5.632   1.00 70.14 ? 208 ARG A N     1 
ATOM   647  C CA    . ARG A 1 97  ? 7.577   7.594  4.812   1.00 69.27 ? 208 ARG A CA    1 
ATOM   648  C C     . ARG A 1 97  ? 6.946   8.956  4.566   1.00 68.03 ? 208 ARG A C     1 
ATOM   649  O O     . ARG A 1 97  ? 5.720   9.101  4.585   1.00 67.50 ? 208 ARG A O     1 
ATOM   650  C CB    . ARG A 1 97  ? 7.888   6.929  3.466   1.00 69.38 ? 208 ARG A CB    1 
ATOM   651  C CG    . ARG A 1 97  ? 8.786   5.708  3.578   1.00 70.30 ? 208 ARG A CG    1 
ATOM   652  C CD    . ARG A 1 97  ? 9.378   5.314  2.233   1.00 69.66 ? 208 ARG A CD    1 
ATOM   653  N NE    . ARG A 1 97  ? 10.384  4.266  2.376   1.00 70.15 ? 208 ARG A NE    1 
ATOM   654  C CZ    . ARG A 1 97  ? 10.111  3.002  2.680   1.00 71.40 ? 208 ARG A CZ    1 
ATOM   655  N NH1   . ARG A 1 97  ? 8.855   2.614  2.872   1.00 72.30 ? 208 ARG A NH1   1 
ATOM   656  N NH2   . ARG A 1 97  ? 11.095  2.126  2.800   1.00 70.83 ? 208 ARG A NH2   1 
ATOM   657  N N     . CYS A 1 98  ? 7.803   9.950  4.352   1.00 66.60 ? 209 CYS A N     1 
ATOM   658  C CA    . CYS A 1 98  ? 7.371   11.310 4.082   1.00 64.72 ? 209 CYS A CA    1 
ATOM   659  C C     . CYS A 1 98  ? 6.819   11.312 2.671   1.00 63.79 ? 209 CYS A C     1 
ATOM   660  O O     . CYS A 1 98  ? 7.575   11.315 1.699   1.00 65.63 ? 209 CYS A O     1 
ATOM   661  C CB    . CYS A 1 98  ? 8.558   12.263 4.180   1.00 65.14 ? 209 CYS A CB    1 
ATOM   662  S SG    . CYS A 1 98  ? 8.176   13.981 3.816   1.00 66.44 ? 209 CYS A SG    1 
ATOM   663  N N     . VAL A 1 99  ? 5.496   11.300 2.567   1.00 61.49 ? 210 VAL A N     1 
ATOM   664  C CA    . VAL A 1 99  ? 4.818   11.272 1.284   1.00 59.05 ? 210 VAL A CA    1 
ATOM   665  C C     . VAL A 1 99  ? 4.461   12.655 0.744   1.00 58.51 ? 210 VAL A C     1 
ATOM   666  O O     . VAL A 1 99  ? 3.658   12.776 -0.181  1.00 58.80 ? 210 VAL A O     1 
ATOM   667  C CB    . VAL A 1 99  ? 3.537   10.441 1.389   1.00 59.96 ? 210 VAL A CB    1 
ATOM   668  C CG1   . VAL A 1 99  ? 3.883   8.961  1.465   1.00 59.06 ? 210 VAL A CG1   1 
ATOM   669  C CG2   . VAL A 1 99  ? 2.760   10.863 2.628   1.00 58.92 ? 210 VAL A CG2   1 
ATOM   670  N N     . GLY A 1 100 ? 5.066   13.691 1.313   1.00 56.71 ? 211 GLY A N     1 
ATOM   671  C CA    . GLY A 1 100 ? 4.788   15.043 0.870   1.00 54.55 ? 211 GLY A CA    1 
ATOM   672  C C     . GLY A 1 100 ? 4.937   16.024 2.014   1.00 52.56 ? 211 GLY A C     1 
ATOM   673  O O     . GLY A 1 100 ? 5.676   15.759 2.954   1.00 53.25 ? 211 GLY A O     1 
ATOM   674  N N     . ASN A 1 101 ? 4.249   17.157 1.941   1.00 51.22 ? 212 ASN A N     1 
ATOM   675  C CA    . ASN A 1 101 ? 4.322   18.144 3.010   1.00 49.97 ? 212 ASN A CA    1 
ATOM   676  C C     . ASN A 1 101 ? 3.565   19.432 2.693   1.00 49.02 ? 212 ASN A C     1 
ATOM   677  O O     . ASN A 1 101 ? 3.121   19.641 1.564   1.00 50.96 ? 212 ASN A O     1 
ATOM   678  C CB    . ASN A 1 101 ? 5.776   18.491 3.299   1.00 49.16 ? 212 ASN A CB    1 
ATOM   679  C CG    . ASN A 1 101 ? 6.276   19.624 2.446   1.00 48.43 ? 212 ASN A CG    1 
ATOM   680  O OD1   . ASN A 1 101 ? 6.323   19.515 1.217   1.00 46.82 ? 212 ASN A OD1   1 
ATOM   681  N ND2   . ASN A 1 101 ? 6.651   20.732 3.091   1.00 46.53 ? 212 ASN A ND2   1 
ATOM   682  N N     . TYR A 1 102 ? 3.436   20.291 3.701   1.00 47.68 ? 213 TYR A N     1 
ATOM   683  C CA    . TYR A 1 102 ? 2.753   21.582 3.578   1.00 46.35 ? 213 TYR A CA    1 
ATOM   684  C C     . TYR A 1 102 ? 3.762   22.667 3.895   1.00 46.75 ? 213 TYR A C     1 
ATOM   685  O O     . TYR A 1 102 ? 4.647   22.460 4.723   1.00 47.01 ? 213 TYR A O     1 
ATOM   686  C CB    . TYR A 1 102 ? 1.597   21.681 4.575   1.00 41.69 ? 213 TYR A CB    1 
ATOM   687  C CG    . TYR A 1 102 ? 0.490   20.688 4.341   1.00 37.40 ? 213 TYR A CG    1 
ATOM   688  C CD1   . TYR A 1 102 ? -0.474  20.903 3.366   1.00 35.84 ? 213 TYR A CD1   1 
ATOM   689  C CD2   . TYR A 1 102 ? 0.418   19.521 5.087   1.00 37.07 ? 213 TYR A CD2   1 
ATOM   690  C CE1   . TYR A 1 102 ? -1.490  19.970 3.137   1.00 35.59 ? 213 TYR A CE1   1 
ATOM   691  C CE2   . TYR A 1 102 ? -0.586  18.585 4.868   1.00 36.85 ? 213 TYR A CE2   1 
ATOM   692  C CZ    . TYR A 1 102 ? -1.535  18.808 3.892   1.00 35.19 ? 213 TYR A CZ    1 
ATOM   693  O OH    . TYR A 1 102 ? -2.503  17.843 3.662   1.00 35.34 ? 213 TYR A OH    1 
ATOM   694  N N     . ASP A 1 103 ? 3.620   23.829 3.264   1.00 48.06 ? 214 ASP A N     1 
ATOM   695  C CA    . ASP A 1 103 ? 4.566   24.916 3.487   1.00 49.75 ? 214 ASP A CA    1 
ATOM   696  C C     . ASP A 1 103 ? 3.942   26.274 3.779   1.00 51.02 ? 214 ASP A C     1 
ATOM   697  O O     . ASP A 1 103 ? 3.646   27.046 2.864   1.00 51.41 ? 214 ASP A O     1 
ATOM   698  C CB    . ASP A 1 103 ? 5.494   25.038 2.274   1.00 50.89 ? 214 ASP A CB    1 
ATOM   699  C CG    . ASP A 1 103 ? 6.481   26.189 2.393   1.00 51.72 ? 214 ASP A CG    1 
ATOM   700  O OD1   . ASP A 1 103 ? 7.286   26.365 1.458   1.00 51.71 ? 214 ASP A OD1   1 
ATOM   701  O OD2   . ASP A 1 103 ? 6.459   26.919 3.409   1.00 53.34 ? 214 ASP A OD2   1 
ATOM   702  N N     . ASN A 1 104 ? 3.752   26.567 5.060   1.00 50.77 ? 215 ASN A N     1 
ATOM   703  C CA    . ASN A 1 104 ? 3.205   27.853 5.461   1.00 49.87 ? 215 ASN A CA    1 
ATOM   704  C C     . ASN A 1 104 ? 1.785   28.151 4.987   1.00 48.26 ? 215 ASN A C     1 
ATOM   705  O O     . ASN A 1 104 ? 1.333   29.292 5.071   1.00 49.26 ? 215 ASN A O     1 
ATOM   706  C CB    . ASN A 1 104 ? 4.154   28.962 5.000   1.00 50.84 ? 215 ASN A CB    1 
ATOM   707  C CG    . ASN A 1 104 ? 5.328   29.151 5.945   1.00 53.16 ? 215 ASN A CG    1 
ATOM   708  O OD1   . ASN A 1 104 ? 5.266   29.962 6.870   1.00 53.63 ? 215 ASN A OD1   1 
ATOM   709  N ND2   . ASN A 1 104 ? 6.396   28.386 5.731   1.00 53.50 ? 215 ASN A ND2   1 
ATOM   710  N N     . ARG A 1 105 ? 1.085   27.138 4.489   1.00 46.10 ? 216 ARG A N     1 
ATOM   711  C CA    . ARG A 1 105 ? -0.291  27.324 4.038   1.00 44.92 ? 216 ARG A CA    1 
ATOM   712  C C     . ARG A 1 105 ? -0.926  26.010 3.610   1.00 42.12 ? 216 ARG A C     1 
ATOM   713  O O     . ARG A 1 105 ? -0.232  25.078 3.209   1.00 42.44 ? 216 ARG A O     1 
ATOM   714  C CB    . ARG A 1 105 ? -0.351  28.350 2.896   1.00 48.24 ? 216 ARG A CB    1 
ATOM   715  C CG    . ARG A 1 105 ? 0.274   27.910 1.576   1.00 52.31 ? 216 ARG A CG    1 
ATOM   716  C CD    . ARG A 1 105 ? -0.706  27.123 0.714   1.00 56.61 ? 216 ARG A CD    1 
ATOM   717  N NE    . ARG A 1 105 ? -1.362  27.936 -0.313  1.00 59.23 ? 216 ARG A NE    1 
ATOM   718  C CZ    . ARG A 1 105 ? -2.206  28.938 -0.075  1.00 61.29 ? 216 ARG A CZ    1 
ATOM   719  N NH1   . ARG A 1 105 ? -2.740  29.606 -1.093  1.00 62.28 ? 216 ARG A NH1   1 
ATOM   720  N NH2   . ARG A 1 105 ? -2.520  29.277 1.170   1.00 61.77 ? 216 ARG A NH2   1 
ATOM   721  N N     . GLY A 1 106 ? -2.249  25.942 3.708   1.00 39.53 ? 217 GLY A N     1 
ATOM   722  C CA    . GLY A 1 106 ? -2.971  24.735 3.338   1.00 37.00 ? 217 GLY A CA    1 
ATOM   723  C C     . GLY A 1 106 ? -3.848  24.251 4.480   1.00 35.77 ? 217 GLY A C     1 
ATOM   724  O O     . GLY A 1 106 ? -3.881  24.851 5.547   1.00 35.38 ? 217 GLY A O     1 
ATOM   725  N N     . SER A 1 107 ? -4.556  23.153 4.276   1.00 35.98 ? 218 SER A N     1 
ATOM   726  C CA    . SER A 1 107 ? -5.424  22.633 5.323   1.00 35.63 ? 218 SER A CA    1 
ATOM   727  C C     . SER A 1 107 ? -5.354  21.113 5.369   1.00 35.02 ? 218 SER A C     1 
ATOM   728  O O     . SER A 1 107 ? -5.095  20.475 4.346   1.00 35.79 ? 218 SER A O     1 
ATOM   729  C CB    . SER A 1 107 ? -6.862  23.069 5.053   1.00 35.89 ? 218 SER A CB    1 
ATOM   730  O OG    . SER A 1 107 ? -7.335  22.484 3.850   1.00 36.32 ? 218 SER A OG    1 
ATOM   731  N N     . PHE A 1 108 ? -5.598  20.532 6.544   1.00 34.08 ? 219 PHE A N     1 
ATOM   732  C CA    . PHE A 1 108 ? -5.553  19.079 6.698   1.00 33.06 ? 219 PHE A CA    1 
ATOM   733  C C     . PHE A 1 108 ? -6.310  18.590 7.924   1.00 34.03 ? 219 PHE A C     1 
ATOM   734  O O     . PHE A 1 108 ? -6.516  19.335 8.887   1.00 34.44 ? 219 PHE A O     1 
ATOM   735  C CB    . PHE A 1 108 ? -4.097  18.599 6.767   1.00 30.58 ? 219 PHE A CB    1 
ATOM   736  C CG    . PHE A 1 108 ? -3.337  19.127 7.953   1.00 27.50 ? 219 PHE A CG    1 
ATOM   737  C CD1   . PHE A 1 108 ? -3.568  18.626 9.229   1.00 29.13 ? 219 PHE A CD1   1 
ATOM   738  C CD2   . PHE A 1 108 ? -2.412  20.147 7.801   1.00 26.68 ? 219 PHE A CD2   1 
ATOM   739  C CE1   . PHE A 1 108 ? -2.891  19.140 10.337  1.00 26.65 ? 219 PHE A CE1   1 
ATOM   740  C CE2   . PHE A 1 108 ? -1.734  20.663 8.899   1.00 23.80 ? 219 PHE A CE2   1 
ATOM   741  C CZ    . PHE A 1 108 ? -1.979  20.157 10.170  1.00 23.95 ? 219 PHE A CZ    1 
ATOM   742  N N     . GLY A 1 109 ? -6.717  17.327 7.879   1.00 33.95 ? 220 GLY A N     1 
ATOM   743  C CA    . GLY A 1 109 ? -7.453  16.737 8.976   1.00 33.63 ? 220 GLY A CA    1 
ATOM   744  C C     . GLY A 1 109 ? -8.937  16.728 8.704   1.00 35.01 ? 220 GLY A C     1 
ATOM   745  O O     . GLY A 1 109 ? -9.737  16.665 9.630   1.00 36.86 ? 220 GLY A O     1 
ATOM   746  N N     . GLU A 1 110 ? -9.317  16.776 7.432   1.00 36.28 ? 221 GLU A N     1 
ATOM   747  C CA    . GLU A 1 110 ? -10.733 16.800 7.076   1.00 37.33 ? 221 GLU A CA    1 
ATOM   748  C C     . GLU A 1 110 ? -11.351 15.430 6.800   1.00 38.23 ? 221 GLU A C     1 
ATOM   749  O O     . GLU A 1 110 ? -12.568 15.243 6.962   1.00 34.72 ? 221 GLU A O     1 
ATOM   750  C CB    . GLU A 1 110 ? -10.942 17.690 5.850   1.00 40.08 ? 221 GLU A CB    1 
ATOM   751  C CG    . GLU A 1 110 ? -10.438 17.111 4.511   1.00 38.25 ? 221 GLU A CG    1 
ATOM   752  C CD    . GLU A 1 110 ? -8.923  17.161 4.360   1.00 40.13 ? 221 GLU A CD    1 
ATOM   753  O OE1   . GLU A 1 110 ? -8.315  18.174 4.761   1.00 43.48 ? 221 GLU A OE1   1 
ATOM   754  O OE2   . GLU A 1 110 ? -8.336  16.198 3.823   1.00 39.84 ? 221 GLU A OE2   1 
ATOM   755  N N     . LEU A 1 111 ? -10.514 14.479 6.380   1.00 37.83 ? 222 LEU A N     1 
ATOM   756  C CA    . LEU A 1 111 ? -10.979 13.136 6.054   1.00 38.60 ? 222 LEU A CA    1 
ATOM   757  C C     . LEU A 1 111 ? -11.636 12.408 7.224   1.00 38.85 ? 222 LEU A C     1 
ATOM   758  O O     . LEU A 1 111 ? -12.663 11.754 7.057   1.00 39.69 ? 222 LEU A O     1 
ATOM   759  C CB    . LEU A 1 111 ? -9.814  12.305 5.523   1.00 41.99 ? 222 LEU A CB    1 
ATOM   760  C CG    . LEU A 1 111 ? -9.081  12.845 4.292   1.00 42.99 ? 222 LEU A CG    1 
ATOM   761  C CD1   . LEU A 1 111 ? -7.899  11.949 3.955   1.00 40.84 ? 222 LEU A CD1   1 
ATOM   762  C CD2   . LEU A 1 111 ? -10.051 12.920 3.132   1.00 42.86 ? 222 LEU A CD2   1 
ATOM   763  N N     . ALA A 1 112 ? -11.037 12.525 8.403   1.00 39.51 ? 223 ALA A N     1 
ATOM   764  C CA    . ALA A 1 112 ? -11.545 11.882 9.612   1.00 40.35 ? 223 ALA A CA    1 
ATOM   765  C C     . ALA A 1 112 ? -12.941 12.361 9.954   1.00 41.15 ? 223 ALA A C     1 
ATOM   766  O O     . ALA A 1 112 ? -13.816 11.557 10.279  1.00 40.24 ? 223 ALA A O     1 
ATOM   767  C CB    . ALA A 1 112 ? -10.609 12.160 10.788  1.00 40.38 ? 223 ALA A CB    1 
ATOM   768  N N     . LEU A 1 113 ? -13.138 13.677 9.875   1.00 41.70 ? 224 LEU A N     1 
ATOM   769  C CA    . LEU A 1 113 ? -14.421 14.296 10.199  1.00 42.59 ? 224 LEU A CA    1 
ATOM   770  C C     . LEU A 1 113 ? -15.468 14.109 9.099   1.00 44.50 ? 224 LEU A C     1 
ATOM   771  O O     . LEU A 1 113 ? -16.660 13.958 9.385   1.00 45.17 ? 224 LEU A O     1 
ATOM   772  C CB    . LEU A 1 113 ? -14.220 15.785 10.479  1.00 41.49 ? 224 LEU A CB    1 
ATOM   773  C CG    . LEU A 1 113 ? -12.863 16.222 11.041  1.00 41.08 ? 224 LEU A CG    1 
ATOM   774  C CD1   . LEU A 1 113 ? -13.039 17.588 11.691  1.00 40.30 ? 224 LEU A CD1   1 
ATOM   775  C CD2   . LEU A 1 113 ? -12.328 15.222 12.070  1.00 40.42 ? 224 LEU A CD2   1 
ATOM   776  N N     . MET A 1 114 ? -15.024 14.126 7.845   1.00 45.64 ? 225 MET A N     1 
ATOM   777  C CA    . MET A 1 114 ? -15.932 13.930 6.717   1.00 47.46 ? 225 MET A CA    1 
ATOM   778  C C     . MET A 1 114 ? -16.435 12.500 6.628   1.00 48.32 ? 225 MET A C     1 
ATOM   779  O O     . MET A 1 114 ? -17.624 12.257 6.420   1.00 48.10 ? 225 MET A O     1 
ATOM   780  C CB    . MET A 1 114 ? -15.248 14.242 5.383   1.00 46.65 ? 225 MET A CB    1 
ATOM   781  C CG    . MET A 1 114 ? -15.180 15.702 5.012   1.00 48.97 ? 225 MET A CG    1 
ATOM   782  S SD    . MET A 1 114 ? -14.833 15.927 3.253   1.00 49.91 ? 225 MET A SD    1 
ATOM   783  C CE    . MET A 1 114 ? -13.056 15.628 3.203   1.00 47.77 ? 225 MET A CE    1 
ATOM   784  N N     . TYR A 1 115 ? -15.516 11.556 6.788   1.00 49.47 ? 226 TYR A N     1 
ATOM   785  C CA    . TYR A 1 115 ? -15.847 10.148 6.652   1.00 51.99 ? 226 TYR A CA    1 
ATOM   786  C C     . TYR A 1 115 ? -15.788 9.308  7.923   1.00 53.54 ? 226 TYR A C     1 
ATOM   787  O O     . TYR A 1 115 ? -15.737 8.079  7.851   1.00 54.11 ? 226 TYR A O     1 
ATOM   788  C CB    . TYR A 1 115 ? -14.926 9.538  5.595   1.00 51.55 ? 226 TYR A CB    1 
ATOM   789  C CG    . TYR A 1 115 ? -14.866 10.355 4.327   1.00 50.47 ? 226 TYR A CG    1 
ATOM   790  C CD1   . TYR A 1 115 ? -16.018 10.597 3.582   1.00 49.40 ? 226 TYR A CD1   1 
ATOM   791  C CD2   . TYR A 1 115 ? -13.659 10.887 3.868   1.00 51.15 ? 226 TYR A CD2   1 
ATOM   792  C CE1   . TYR A 1 115 ? -15.975 11.343 2.412   1.00 50.09 ? 226 TYR A CE1   1 
ATOM   793  C CE2   . TYR A 1 115 ? -13.603 11.642 2.693   1.00 51.29 ? 226 TYR A CE2   1 
ATOM   794  C CZ    . TYR A 1 115 ? -14.770 11.861 1.971   1.00 51.66 ? 226 TYR A CZ    1 
ATOM   795  O OH    . TYR A 1 115 ? -14.737 12.582 0.797   1.00 54.15 ? 226 TYR A OH    1 
ATOM   796  N N     . ASN A 1 116 ? -15.800 9.961  9.080   1.00 54.01 ? 227 ASN A N     1 
ATOM   797  C CA    . ASN A 1 116 ? -15.739 9.250  10.348  1.00 53.52 ? 227 ASN A CA    1 
ATOM   798  C C     . ASN A 1 116 ? -14.799 8.047  10.323  1.00 53.00 ? 227 ASN A C     1 
ATOM   799  O O     . ASN A 1 116 ? -15.200 6.947  10.677  1.00 53.30 ? 227 ASN A O     1 
ATOM   800  C CB    . ASN A 1 116 ? -17.134 8.789  10.757  1.00 55.66 ? 227 ASN A CB    1 
ATOM   801  C CG    . ASN A 1 116 ? -18.090 9.943  10.956  1.00 57.80 ? 227 ASN A CG    1 
ATOM   802  O OD1   . ASN A 1 116 ? -17.730 10.964 11.544  1.00 59.52 ? 227 ASN A OD1   1 
ATOM   803  N ND2   . ASN A 1 116 ? -19.321 9.787  10.479  1.00 59.07 ? 227 ASN A ND2   1 
ATOM   804  N N     . THR A 1 117 ? -13.554 8.262  9.901   1.00 52.56 ? 228 THR A N     1 
ATOM   805  C CA    . THR A 1 117 ? -12.554 7.196  9.846   1.00 51.39 ? 228 THR A CA    1 
ATOM   806  C C     . THR A 1 117 ? -11.318 7.630  10.620  1.00 50.65 ? 228 THR A C     1 
ATOM   807  O O     . THR A 1 117 ? -11.112 8.815  10.868  1.00 51.78 ? 228 THR A O     1 
ATOM   808  C CB    . THR A 1 117 ? -12.103 6.879  8.398   1.00 52.44 ? 228 THR A CB    1 
ATOM   809  O OG1   . THR A 1 117 ? -11.456 8.028  7.831   1.00 51.67 ? 228 THR A OG1   1 
ATOM   810  C CG2   . THR A 1 117 ? -13.289 6.472  7.540   1.00 51.34 ? 228 THR A CG2   1 
ATOM   811  N N     . PRO A 1 118 ? -10.466 6.675  11.002  1.00 49.70 ? 229 PRO A N     1 
ATOM   812  C CA    . PRO A 1 118 ? -9.272  7.067  11.749  1.00 49.64 ? 229 PRO A CA    1 
ATOM   813  C C     . PRO A 1 118 ? -8.401  7.999  10.925  1.00 49.60 ? 229 PRO A C     1 
ATOM   814  O O     . PRO A 1 118 ? -8.472  7.990  9.697   1.00 49.79 ? 229 PRO A O     1 
ATOM   815  C CB    . PRO A 1 118 ? -8.580  5.733  12.007  1.00 49.42 ? 229 PRO A CB    1 
ATOM   816  C CG    . PRO A 1 118 ? -9.719  4.747  11.997  1.00 48.45 ? 229 PRO A CG    1 
ATOM   817  C CD    . PRO A 1 118 ? -10.532 5.214  10.840  1.00 48.79 ? 229 PRO A CD    1 
ATOM   818  N N     . ARG A 1 119 ? -7.590  8.809  11.598  1.00 49.92 ? 230 ARG A N     1 
ATOM   819  C CA    . ARG A 1 119 ? -6.676  9.698  10.896  1.00 49.25 ? 230 ARG A CA    1 
ATOM   820  C C     . ARG A 1 119 ? -5.934  8.796  9.912   1.00 48.93 ? 230 ARG A C     1 
ATOM   821  O O     . ARG A 1 119 ? -5.408  7.749  10.295  1.00 49.77 ? 230 ARG A O     1 
ATOM   822  C CB    . ARG A 1 119 ? -5.673  10.332 11.865  1.00 50.56 ? 230 ARG A CB    1 
ATOM   823  C CG    . ARG A 1 119 ? -6.260  11.339 12.852  1.00 51.28 ? 230 ARG A CG    1 
ATOM   824  C CD    . ARG A 1 119 ? -6.962  12.491 12.148  1.00 52.38 ? 230 ARG A CD    1 
ATOM   825  N NE    . ARG A 1 119 ? -7.113  13.671 13.005  1.00 51.99 ? 230 ARG A NE    1 
ATOM   826  C CZ    . ARG A 1 119 ? -7.838  14.740 12.680  1.00 50.29 ? 230 ARG A CZ    1 
ATOM   827  N NH1   . ARG A 1 119 ? -8.487  14.781 11.522  1.00 47.44 ? 230 ARG A NH1   1 
ATOM   828  N NH2   . ARG A 1 119 ? -7.909  15.773 13.509  1.00 49.75 ? 230 ARG A NH2   1 
ATOM   829  N N     . ALA A 1 120 ? -5.907  9.199  8.646   1.00 47.36 ? 231 ALA A N     1 
ATOM   830  C CA    . ALA A 1 120 ? -5.266  8.418  7.603   1.00 43.44 ? 231 ALA A CA    1 
ATOM   831  C C     . ALA A 1 120 ? -3.855  8.887  7.325   1.00 42.44 ? 231 ALA A C     1 
ATOM   832  O O     . ALA A 1 120 ? -3.336  8.700  6.227   1.00 45.52 ? 231 ALA A O     1 
ATOM   833  C CB    . ALA A 1 120 ? -6.090  8.484  6.331   1.00 41.72 ? 231 ALA A CB    1 
ATOM   834  N N     . ALA A 1 121 ? -3.218  9.505  8.303   1.00 39.73 ? 232 ALA A N     1 
ATOM   835  C CA    . ALA A 1 121 ? -1.857  9.950  8.079   1.00 38.72 ? 232 ALA A CA    1 
ATOM   836  C C     . ALA A 1 121 ? -1.317  10.589 9.330   1.00 38.41 ? 232 ALA A C     1 
ATOM   837  O O     . ALA A 1 121 ? -2.010  10.685 10.332  1.00 39.99 ? 232 ALA A O     1 
ATOM   838  C CB    . ALA A 1 121 ? -1.798  10.935 6.910   1.00 34.89 ? 232 ALA A CB    1 
ATOM   839  N N     . THR A 1 122 ? -0.067  11.016 9.269   1.00 38.40 ? 233 THR A N     1 
ATOM   840  C CA    . THR A 1 122 ? 0.566   11.649 10.402  1.00 39.16 ? 233 THR A CA    1 
ATOM   841  C C     . THR A 1 122 ? 1.088   12.993 9.923   1.00 40.58 ? 233 THR A C     1 
ATOM   842  O O     . THR A 1 122 ? 1.723   13.096 8.867   1.00 40.33 ? 233 THR A O     1 
ATOM   843  C CB    . THR A 1 122 ? 1.728   10.760 10.971  1.00 40.40 ? 233 THR A CB    1 
ATOM   844  O OG1   . THR A 1 122 ? 1.168   9.673  11.722  1.00 37.79 ? 233 THR A OG1   1 
ATOM   845  C CG2   . THR A 1 122 ? 2.666   11.569 11.871  1.00 38.44 ? 233 THR A CG2   1 
ATOM   846  N N     . ILE A 1 123 ? 0.783   14.030 10.692  1.00 40.42 ? 234 ILE A N     1 
ATOM   847  C CA    . ILE A 1 123 ? 1.218   15.370 10.357  1.00 39.99 ? 234 ILE A CA    1 
ATOM   848  C C     . ILE A 1 123 ? 2.056   15.822 11.532  1.00 40.30 ? 234 ILE A C     1 
ATOM   849  O O     . ILE A 1 123 ? 1.636   15.686 12.678  1.00 41.26 ? 234 ILE A O     1 
ATOM   850  C CB    . ILE A 1 123 ? 0.013   16.308 10.182  1.00 38.90 ? 234 ILE A CB    1 
ATOM   851  C CG1   . ILE A 1 123 ? -1.017  15.657 9.246   1.00 38.84 ? 234 ILE A CG1   1 
ATOM   852  C CG2   . ILE A 1 123 ? 0.486   17.658 9.657   1.00 36.92 ? 234 ILE A CG2   1 
ATOM   853  C CD1   . ILE A 1 123 ? -0.534  15.414 7.812   1.00 38.68 ? 234 ILE A CD1   1 
ATOM   854  N N     . THR A 1 124 ? 3.236   16.355 11.246  1.00 40.65 ? 235 THR A N     1 
ATOM   855  C CA    . THR A 1 124 ? 4.146   16.795 12.291  1.00 42.15 ? 235 THR A CA    1 
ATOM   856  C C     . THR A 1 124 ? 4.866   18.051 11.847  1.00 43.00 ? 235 THR A C     1 
ATOM   857  O O     . THR A 1 124 ? 5.366   18.117 10.730  1.00 44.98 ? 235 THR A O     1 
ATOM   858  C CB    . THR A 1 124 ? 5.205   15.683 12.607  1.00 44.04 ? 235 THR A CB    1 
ATOM   859  O OG1   . THR A 1 124 ? 6.532   16.192 12.389  1.00 44.12 ? 235 THR A OG1   1 
ATOM   860  C CG2   . THR A 1 124 ? 4.983   14.455 11.714  1.00 40.65 ? 235 THR A CG2   1 
ATOM   861  N N     . ALA A 1 125 ? 4.922   19.047 12.719  1.00 43.67 ? 236 ALA A N     1 
ATOM   862  C CA    . ALA A 1 125 ? 5.598   20.293 12.380  1.00 46.18 ? 236 ALA A CA    1 
ATOM   863  C C     . ALA A 1 125 ? 7.086   20.042 12.135  1.00 47.12 ? 236 ALA A C     1 
ATOM   864  O O     . ALA A 1 125 ? 7.750   19.354 12.904  1.00 48.52 ? 236 ALA A O     1 
ATOM   865  C CB    . ALA A 1 125 ? 5.408   21.325 13.505  1.00 43.72 ? 236 ALA A CB    1 
ATOM   866  N N     . THR A 1 126 ? 7.593   20.586 11.040  1.00 48.55 ? 237 THR A N     1 
ATOM   867  C CA    . THR A 1 126 ? 8.993   20.445 10.689  1.00 49.02 ? 237 THR A CA    1 
ATOM   868  C C     . THR A 1 126 ? 9.598   21.819 10.917  1.00 50.52 ? 237 THR A C     1 
ATOM   869  O O     . THR A 1 126 ? 10.494  22.269 10.198  1.00 50.97 ? 237 THR A O     1 
ATOM   870  C CB    . THR A 1 126 ? 9.146   20.038 9.228   1.00 50.38 ? 237 THR A CB    1 
ATOM   871  O OG1   . THR A 1 126 ? 8.655   21.089 8.380   1.00 51.28 ? 237 THR A OG1   1 
ATOM   872  C CG2   . THR A 1 126 ? 8.352   18.762 8.965   1.00 49.97 ? 237 THR A CG2   1 
ATOM   873  N N     . SER A 1 127 ? 9.066   22.481 11.937  1.00 50.65 ? 238 SER A N     1 
ATOM   874  C CA    . SER A 1 127 ? 9.493   23.808 12.344  1.00 51.29 ? 238 SER A CA    1 
ATOM   875  C C     . SER A 1 127 ? 8.378   24.325 13.228  1.00 51.22 ? 238 SER A C     1 
ATOM   876  O O     . SER A 1 127 ? 7.267   23.806 13.202  1.00 52.71 ? 238 SER A O     1 
ATOM   877  C CB    . SER A 1 127 ? 9.631   24.737 11.141  1.00 51.11 ? 238 SER A CB    1 
ATOM   878  O OG    . SER A 1 127 ? 8.362   25.226 10.741  1.00 51.08 ? 238 SER A OG    1 
ATOM   879  N N     . PRO A 1 128 ? 8.656   25.349 14.031  1.00 51.42 ? 239 PRO A N     1 
ATOM   880  C CA    . PRO A 1 128 ? 7.598   25.876 14.892  1.00 51.87 ? 239 PRO A CA    1 
ATOM   881  C C     . PRO A 1 128 ? 6.512   26.521 14.024  1.00 52.27 ? 239 PRO A C     1 
ATOM   882  O O     . PRO A 1 128 ? 6.823   27.241 13.077  1.00 52.99 ? 239 PRO A O     1 
ATOM   883  C CB    . PRO A 1 128 ? 8.340   26.886 15.756  1.00 52.59 ? 239 PRO A CB    1 
ATOM   884  C CG    . PRO A 1 128 ? 9.432   27.370 14.840  1.00 52.57 ? 239 PRO A CG    1 
ATOM   885  C CD    . PRO A 1 128 ? 9.908   26.107 14.188  1.00 51.35 ? 239 PRO A CD    1 
ATOM   886  N N     . GLY A 1 129 ? 5.246   26.254 14.333  1.00 51.01 ? 240 GLY A N     1 
ATOM   887  C CA    . GLY A 1 129 ? 4.169   26.831 13.545  1.00 48.60 ? 240 GLY A CA    1 
ATOM   888  C C     . GLY A 1 129 ? 2.931   27.241 14.331  1.00 47.28 ? 240 GLY A C     1 
ATOM   889  O O     . GLY A 1 129 ? 2.950   27.333 15.559  1.00 48.85 ? 240 GLY A O     1 
ATOM   890  N N     . ALA A 1 130 ? 1.847   27.492 13.608  1.00 44.76 ? 241 ALA A N     1 
ATOM   891  C CA    . ALA A 1 130 ? 0.578   27.893 14.201  1.00 41.71 ? 241 ALA A CA    1 
ATOM   892  C C     . ALA A 1 130 ? -0.532  27.339 13.326  1.00 39.78 ? 241 ALA A C     1 
ATOM   893  O O     . ALA A 1 130 ? -0.343  27.149 12.130  1.00 40.59 ? 241 ALA A O     1 
ATOM   894  C CB    . ALA A 1 130 ? 0.481   29.403 14.266  1.00 40.18 ? 241 ALA A CB    1 
ATOM   895  N N     . LEU A 1 131 ? -1.688  27.083 13.925  1.00 37.96 ? 242 LEU A N     1 
ATOM   896  C CA    . LEU A 1 131 ? -2.825  26.536 13.196  1.00 34.76 ? 242 LEU A CA    1 
ATOM   897  C C     . LEU A 1 131 ? -4.147  27.076 13.706  1.00 34.34 ? 242 LEU A C     1 
ATOM   898  O O     . LEU A 1 131 ? -4.255  27.527 14.847  1.00 34.38 ? 242 LEU A O     1 
ATOM   899  C CB    . LEU A 1 131 ? -2.851  25.020 13.329  1.00 32.61 ? 242 LEU A CB    1 
ATOM   900  C CG    . LEU A 1 131 ? -1.676  24.205 12.802  1.00 30.47 ? 242 LEU A CG    1 
ATOM   901  C CD1   . LEU A 1 131 ? -1.713  22.853 13.458  1.00 27.31 ? 242 LEU A CD1   1 
ATOM   902  C CD2   . LEU A 1 131 ? -1.752  24.075 11.291  1.00 29.72 ? 242 LEU A CD2   1 
ATOM   903  N N     . TRP A 1 132 ? -5.153  27.021 12.846  1.00 34.76 ? 243 TRP A N     1 
ATOM   904  C CA    . TRP A 1 132 ? -6.495  27.458 13.200  1.00 33.98 ? 243 TRP A CA    1 
ATOM   905  C C     . TRP A 1 132 ? -7.326  26.198 13.108  1.00 34.08 ? 243 TRP A C     1 
ATOM   906  O O     . TRP A 1 132 ? -7.510  25.649 12.024  1.00 34.78 ? 243 TRP A O     1 
ATOM   907  C CB    . TRP A 1 132 ? -7.010  28.509 12.212  1.00 33.30 ? 243 TRP A CB    1 
ATOM   908  C CG    . TRP A 1 132 ? -6.184  29.766 12.206  1.00 31.04 ? 243 TRP A CG    1 
ATOM   909  C CD1   . TRP A 1 132 ? -5.232  30.114 11.295  1.00 30.60 ? 243 TRP A CD1   1 
ATOM   910  C CD2   . TRP A 1 132 ? -6.200  30.807 13.191  1.00 29.42 ? 243 TRP A CD2   1 
ATOM   911  N NE1   . TRP A 1 132 ? -4.646  31.308 11.649  1.00 30.61 ? 243 TRP A NE1   1 
ATOM   912  C CE2   . TRP A 1 132 ? -5.220  31.757 12.810  1.00 30.42 ? 243 TRP A CE2   1 
ATOM   913  C CE3   . TRP A 1 132 ? -6.942  31.028 14.359  1.00 29.90 ? 243 TRP A CE3   1 
ATOM   914  C CZ2   . TRP A 1 132 ? -4.960  32.921 13.558  1.00 29.38 ? 243 TRP A CZ2   1 
ATOM   915  C CZ3   . TRP A 1 132 ? -6.681  32.192 15.113  1.00 31.65 ? 243 TRP A CZ3   1 
ATOM   916  C CH2   . TRP A 1 132 ? -5.696  33.121 14.701  1.00 30.32 ? 243 TRP A CH2   1 
ATOM   917  N N     . GLY A 1 133 ? -7.812  25.732 14.252  1.00 34.30 ? 244 GLY A N     1 
ATOM   918  C CA    . GLY A 1 133 ? -8.588  24.509 14.276  1.00 33.41 ? 244 GLY A CA    1 
ATOM   919  C C     . GLY A 1 133 ? -10.082 24.696 14.284  1.00 33.75 ? 244 GLY A C     1 
ATOM   920  O O     . GLY A 1 133 ? -10.591 25.731 14.722  1.00 33.15 ? 244 GLY A O     1 
ATOM   921  N N     . LEU A 1 134 ? -10.781 23.671 13.801  1.00 32.98 ? 245 LEU A N     1 
ATOM   922  C CA    . LEU A 1 134 ? -12.234 23.679 13.724  1.00 31.40 ? 245 LEU A CA    1 
ATOM   923  C C     . LEU A 1 134 ? -12.758 22.337 14.202  1.00 32.65 ? 245 LEU A C     1 
ATOM   924  O O     . LEU A 1 134 ? -12.537 21.302 13.565  1.00 32.43 ? 245 LEU A O     1 
ATOM   925  C CB    . LEU A 1 134 ? -12.681 23.932 12.279  1.00 29.59 ? 245 LEU A CB    1 
ATOM   926  C CG    . LEU A 1 134 ? -14.188 23.926 12.008  1.00 29.62 ? 245 LEU A CG    1 
ATOM   927  C CD1   . LEU A 1 134 ? -14.863 25.052 12.791  1.00 30.32 ? 245 LEU A CD1   1 
ATOM   928  C CD2   . LEU A 1 134 ? -14.435 24.098 10.527  1.00 28.60 ? 245 LEU A CD2   1 
ATOM   929  N N     . ASP A 1 135 ? -13.454 22.359 15.330  1.00 34.73 ? 246 ASP A N     1 
ATOM   930  C CA    . ASP A 1 135 ? -14.016 21.150 15.916  1.00 36.84 ? 246 ASP A CA    1 
ATOM   931  C C     . ASP A 1 135 ? -14.791 20.391 14.862  1.00 37.01 ? 246 ASP A C     1 
ATOM   932  O O     . ASP A 1 135 ? -15.105 20.934 13.813  1.00 39.15 ? 246 ASP A O     1 
ATOM   933  C CB    . ASP A 1 135 ? -14.939 21.528 17.071  1.00 38.89 ? 246 ASP A CB    1 
ATOM   934  C CG    . ASP A 1 135 ? -16.090 22.408 16.624  1.00 41.44 ? 246 ASP A CG    1 
ATOM   935  O OD1   . ASP A 1 135 ? -17.168 21.873 16.272  1.00 43.89 ? 246 ASP A OD1   1 
ATOM   936  O OD2   . ASP A 1 135 ? -15.905 23.639 16.608  1.00 40.96 ? 246 ASP A OD2   1 
ATOM   937  N N     . ARG A 1 136 ? -15.129 19.140 15.150  1.00 38.83 ? 247 ARG A N     1 
ATOM   938  C CA    . ARG A 1 136 ? -15.853 18.328 14.185  1.00 38.01 ? 247 ARG A CA    1 
ATOM   939  C C     . ARG A 1 136 ? -17.355 18.587 14.142  1.00 36.51 ? 247 ARG A C     1 
ATOM   940  O O     . ARG A 1 136 ? -17.988 18.350 13.115  1.00 34.93 ? 247 ARG A O     1 
ATOM   941  C CB    . ARG A 1 136 ? -15.583 16.848 14.453  1.00 40.17 ? 247 ARG A CB    1 
ATOM   942  C CG    . ARG A 1 136 ? -16.315 16.275 15.626  1.00 45.06 ? 247 ARG A CG    1 
ATOM   943  C CD    . ARG A 1 136 ? -15.685 14.943 16.081  1.00 52.28 ? 247 ARG A CD    1 
ATOM   944  N NE    . ARG A 1 136 ? -15.430 14.006 14.986  1.00 53.96 ? 247 ARG A NE    1 
ATOM   945  C CZ    . ARG A 1 136 ? -16.369 13.485 14.202  1.00 55.44 ? 247 ARG A CZ    1 
ATOM   946  N NH1   . ARG A 1 136 ? -17.648 13.804 14.383  1.00 55.73 ? 247 ARG A NH1   1 
ATOM   947  N NH2   . ARG A 1 136 ? -16.025 12.642 13.233  1.00 54.17 ? 247 ARG A NH2   1 
ATOM   948  N N     . VAL A 1 137 ? -17.929 19.079 15.240  1.00 35.18 ? 248 VAL A N     1 
ATOM   949  C CA    . VAL A 1 137 ? -19.371 19.336 15.272  1.00 35.04 ? 248 VAL A CA    1 
ATOM   950  C C     . VAL A 1 137 ? -19.699 20.453 14.301  1.00 34.39 ? 248 VAL A C     1 
ATOM   951  O O     . VAL A 1 137 ? -20.653 20.370 13.518  1.00 34.12 ? 248 VAL A O     1 
ATOM   952  C CB    . VAL A 1 137 ? -19.870 19.736 16.694  1.00 36.22 ? 248 VAL A CB    1 
ATOM   953  C CG1   . VAL A 1 137 ? -21.376 19.953 16.658  1.00 35.25 ? 248 VAL A CG1   1 
ATOM   954  C CG2   . VAL A 1 137 ? -19.526 18.634 17.728  1.00 30.65 ? 248 VAL A CG2   1 
ATOM   955  N N     . THR A 1 138 ? -18.884 21.497 14.349  1.00 34.86 ? 249 THR A N     1 
ATOM   956  C CA    . THR A 1 138 ? -19.044 22.643 13.470  1.00 34.40 ? 249 THR A CA    1 
ATOM   957  C C     . THR A 1 138 ? -18.740 22.217 12.040  1.00 35.50 ? 249 THR A C     1 
ATOM   958  O O     . THR A 1 138 ? -19.472 22.550 11.108  1.00 37.45 ? 249 THR A O     1 
ATOM   959  C CB    . THR A 1 138 ? -18.066 23.754 13.838  1.00 33.44 ? 249 THR A CB    1 
ATOM   960  O OG1   . THR A 1 138 ? -18.168 24.039 15.237  1.00 34.65 ? 249 THR A OG1   1 
ATOM   961  C CG2   . THR A 1 138 ? -18.372 25.007 13.047  1.00 34.07 ? 249 THR A CG2   1 
ATOM   962  N N     . PHE A 1 139 ? -17.652 21.470 11.876  1.00 36.11 ? 250 PHE A N     1 
ATOM   963  C CA    . PHE A 1 139 ? -17.227 21.019 10.562  1.00 35.83 ? 250 PHE A CA    1 
ATOM   964  C C     . PHE A 1 139 ? -18.305 20.199 9.868   1.00 36.72 ? 250 PHE A C     1 
ATOM   965  O O     . PHE A 1 139 ? -18.617 20.423 8.700   1.00 37.07 ? 250 PHE A O     1 
ATOM   966  C CB    . PHE A 1 139 ? -15.944 20.194 10.681  1.00 35.05 ? 250 PHE A CB    1 
ATOM   967  C CG    . PHE A 1 139 ? -15.384 19.763 9.358   1.00 34.43 ? 250 PHE A CG    1 
ATOM   968  C CD1   . PHE A 1 139 ? -14.482 20.567 8.677   1.00 36.52 ? 250 PHE A CD1   1 
ATOM   969  C CD2   . PHE A 1 139 ? -15.806 18.582 8.763   1.00 36.17 ? 250 PHE A CD2   1 
ATOM   970  C CE1   . PHE A 1 139 ? -14.009 20.206 7.415   1.00 35.90 ? 250 PHE A CE1   1 
ATOM   971  C CE2   . PHE A 1 139 ? -15.340 18.206 7.495   1.00 36.95 ? 250 PHE A CE2   1 
ATOM   972  C CZ    . PHE A 1 139 ? -14.443 19.019 6.823   1.00 37.06 ? 250 PHE A CZ    1 
ATOM   973  N N     . ARG A 1 140 ? -18.874 19.244 10.588  1.00 38.36 ? 251 ARG A N     1 
ATOM   974  C CA    . ARG A 1 140 ? -19.901 18.392 10.014  1.00 40.83 ? 251 ARG A CA    1 
ATOM   975  C C     . ARG A 1 140 ? -21.193 19.159 9.821   1.00 41.51 ? 251 ARG A C     1 
ATOM   976  O O     . ARG A 1 140 ? -21.934 18.947 8.853   1.00 40.15 ? 251 ARG A O     1 
ATOM   977  C CB    . ARG A 1 140 ? -20.134 17.182 10.909  1.00 41.89 ? 251 ARG A CB    1 
ATOM   978  C CG    . ARG A 1 140 ? -18.974 16.201 10.914  1.00 46.53 ? 251 ARG A CG    1 
ATOM   979  C CD    . ARG A 1 140 ? -19.365 14.936 11.664  1.00 50.73 ? 251 ARG A CD    1 
ATOM   980  N NE    . ARG A 1 140 ? -20.524 14.300 11.041  1.00 53.32 ? 251 ARG A NE    1 
ATOM   981  C CZ    . ARG A 1 140 ? -20.504 13.748 9.831   1.00 54.67 ? 251 ARG A CZ    1 
ATOM   982  N NH1   . ARG A 1 140 ? -19.379 13.752 9.127   1.00 55.99 ? 251 ARG A NH1   1 
ATOM   983  N NH2   . ARG A 1 140 ? -21.607 13.216 9.317   1.00 53.29 ? 251 ARG A NH2   1 
ATOM   984  N N     . ARG A 1 141 ? -21.449 20.072 10.745  1.00 42.33 ? 252 ARG A N     1 
ATOM   985  C CA    . ARG A 1 141 ? -22.647 20.875 10.686  1.00 41.97 ? 252 ARG A CA    1 
ATOM   986  C C     . ARG A 1 141 ? -22.660 21.755 9.446   1.00 41.84 ? 252 ARG A C     1 
ATOM   987  O O     . ARG A 1 141 ? -23.677 21.847 8.770   1.00 42.59 ? 252 ARG A O     1 
ATOM   988  C CB    . ARG A 1 141 ? -22.744 21.733 11.950  1.00 43.70 ? 252 ARG A CB    1 
ATOM   989  C CG    . ARG A 1 141 ? -24.009 22.575 12.052  1.00 44.73 ? 252 ARG A CG    1 
ATOM   990  C CD    . ARG A 1 141 ? -24.201 23.087 13.471  1.00 44.57 ? 252 ARG A CD    1 
ATOM   991  N NE    . ARG A 1 141 ? -23.250 24.136 13.817  1.00 43.61 ? 252 ARG A NE    1 
ATOM   992  C CZ    . ARG A 1 141 ? -23.334 25.382 13.365  1.00 45.50 ? 252 ARG A CZ    1 
ATOM   993  N NH1   . ARG A 1 141 ? -24.329 25.719 12.554  1.00 43.64 ? 252 ARG A NH1   1 
ATOM   994  N NH2   . ARG A 1 141 ? -22.427 26.287 13.723  1.00 44.92 ? 252 ARG A NH2   1 
ATOM   995  N N     . ILE A 1 142 ? -21.529 22.382 9.128   1.00 41.50 ? 253 ILE A N     1 
ATOM   996  C CA    . ILE A 1 142 ? -21.476 23.281 7.974   1.00 42.71 ? 253 ILE A CA    1 
ATOM   997  C C     . ILE A 1 142 ? -20.770 22.808 6.702   1.00 43.36 ? 253 ILE A C     1 
ATOM   998  O O     . ILE A 1 142 ? -21.319 22.943 5.598   1.00 43.28 ? 253 ILE A O     1 
ATOM   999  C CB    . ILE A 1 142 ? -20.855 24.630 8.365   1.00 43.48 ? 253 ILE A CB    1 
ATOM   1000 C CG1   . ILE A 1 142 ? -21.745 25.331 9.392   1.00 44.18 ? 253 ILE A CG1   1 
ATOM   1001 C CG2   . ILE A 1 142 ? -20.700 25.511 7.130   1.00 45.29 ? 253 ILE A CG2   1 
ATOM   1002 C CD1   . ILE A 1 142 ? -21.195 26.654 9.899   1.00 42.47 ? 253 ILE A CD1   1 
ATOM   1003 N N     . ILE A 1 143 ? -19.558 22.275 6.842   1.00 42.50 ? 254 ILE A N     1 
ATOM   1004 C CA    . ILE A 1 143 ? -18.817 21.824 5.673   1.00 41.71 ? 254 ILE A CA    1 
ATOM   1005 C C     . ILE A 1 143 ? -19.452 20.617 5.010   1.00 41.33 ? 254 ILE A C     1 
ATOM   1006 O O     . ILE A 1 143 ? -19.590 20.583 3.788   1.00 41.51 ? 254 ILE A O     1 
ATOM   1007 C CB    . ILE A 1 143 ? -17.355 21.476 6.002   1.00 40.93 ? 254 ILE A CB    1 
ATOM   1008 C CG1   . ILE A 1 143 ? -16.696 22.607 6.797   1.00 40.83 ? 254 ILE A CG1   1 
ATOM   1009 C CG2   . ILE A 1 143 ? -16.592 21.257 4.713   1.00 41.05 ? 254 ILE A CG2   1 
ATOM   1010 C CD1   . ILE A 1 143 ? -16.762 23.979 6.134   1.00 39.95 ? 254 ILE A CD1   1 
ATOM   1011 N N     . VAL A 1 144 ? -19.837 19.625 5.802   1.00 42.10 ? 255 VAL A N     1 
ATOM   1012 C CA    . VAL A 1 144 ? -20.452 18.432 5.229   1.00 43.26 ? 255 VAL A CA    1 
ATOM   1013 C C     . VAL A 1 144 ? -21.805 18.779 4.634   1.00 44.48 ? 255 VAL A C     1 
ATOM   1014 O O     . VAL A 1 144 ? -22.206 18.209 3.619   1.00 44.99 ? 255 VAL A O     1 
ATOM   1015 C CB    . VAL A 1 144 ? -20.631 17.319 6.263   1.00 42.77 ? 255 VAL A CB    1 
ATOM   1016 C CG1   . VAL A 1 144 ? -21.323 16.141 5.614   1.00 42.60 ? 255 VAL A CG1   1 
ATOM   1017 C CG2   . VAL A 1 144 ? -19.274 16.893 6.815   1.00 41.98 ? 255 VAL A CG2   1 
ATOM   1018 N N     . LYS A 1 145 ? -22.514 19.710 5.264   1.00 45.37 ? 256 LYS A N     1 
ATOM   1019 C CA    . LYS A 1 145 ? -23.800 20.138 4.726   1.00 46.90 ? 256 LYS A CA    1 
ATOM   1020 C C     . LYS A 1 145 ? -23.486 20.749 3.368   1.00 47.38 ? 256 LYS A C     1 
ATOM   1021 O O     . LYS A 1 145 ? -24.117 20.438 2.353   1.00 48.39 ? 256 LYS A O     1 
ATOM   1022 C CB    . LYS A 1 145 ? -24.431 21.207 5.609   1.00 49.63 ? 256 LYS A CB    1 
ATOM   1023 C CG    . LYS A 1 145 ? -25.653 21.834 4.979   1.00 51.94 ? 256 LYS A CG    1 
ATOM   1024 C CD    . LYS A 1 145 ? -25.809 23.302 5.341   1.00 53.34 ? 256 LYS A CD    1 
ATOM   1025 C CE    . LYS A 1 145 ? -26.975 23.906 4.560   1.00 54.82 ? 256 LYS A CE    1 
ATOM   1026 N NZ    . LYS A 1 145 ? -27.112 25.383 4.726   1.00 56.17 ? 256 LYS A NZ    1 
ATOM   1027 N N     . ASN A 1 146 ? -22.488 21.627 3.369   1.00 46.62 ? 257 ASN A N     1 
ATOM   1028 C CA    . ASN A 1 146 ? -22.040 22.299 2.163   1.00 44.90 ? 257 ASN A CA    1 
ATOM   1029 C C     . ASN A 1 146 ? -21.781 21.292 1.039   1.00 44.53 ? 257 ASN A C     1 
ATOM   1030 O O     . ASN A 1 146 ? -22.134 21.542 -0.110  1.00 44.98 ? 257 ASN A O     1 
ATOM   1031 C CB    . ASN A 1 146 ? -20.757 23.077 2.457   1.00 45.90 ? 257 ASN A CB    1 
ATOM   1032 C CG    . ASN A 1 146 ? -20.352 23.996 1.316   1.00 47.27 ? 257 ASN A CG    1 
ATOM   1033 O OD1   . ASN A 1 146 ? -19.163 24.236 1.090   1.00 47.78 ? 257 ASN A OD1   1 
ATOM   1034 N ND2   . ASN A 1 146 ? -21.340 24.529 0.603   1.00 45.34 ? 257 ASN A ND2   1 
ATOM   1035 N N     . ASN A 1 147 ? -21.159 20.158 1.358   1.00 44.25 ? 258 ASN A N     1 
ATOM   1036 C CA    . ASN A 1 147 ? -20.879 19.153 0.327   1.00 44.76 ? 258 ASN A CA    1 
ATOM   1037 C C     . ASN A 1 147 ? -22.162 18.601 -0.293  1.00 43.61 ? 258 ASN A C     1 
ATOM   1038 O O     . ASN A 1 147 ? -22.166 18.162 -1.437  1.00 44.04 ? 258 ASN A O     1 
ATOM   1039 C CB    . ASN A 1 147 ? -20.054 17.990 0.893   1.00 45.63 ? 258 ASN A CB    1 
ATOM   1040 C CG    . ASN A 1 147 ? -18.697 18.426 1.394   1.00 46.70 ? 258 ASN A CG    1 
ATOM   1041 O OD1   . ASN A 1 147 ? -18.030 19.262 0.785   1.00 49.36 ? 258 ASN A OD1   1 
ATOM   1042 N ND2   . ASN A 1 147 ? -18.271 17.848 2.506   1.00 48.85 ? 258 ASN A ND2   1 
ATOM   1043 N N     . ALA A 1 148 ? -23.252 18.618 0.463   1.00 44.21 ? 259 ALA A N     1 
ATOM   1044 C CA    . ALA A 1 148 ? -24.526 18.134 -0.059  1.00 44.50 ? 259 ALA A CA    1 
ATOM   1045 C C     . ALA A 1 148 ? -24.931 19.015 -1.232  1.00 43.79 ? 259 ALA A C     1 
ATOM   1046 O O     . ALA A 1 148 ? -25.448 18.537 -2.236  1.00 43.26 ? 259 ALA A O     1 
ATOM   1047 C CB    . ALA A 1 148 ? -25.596 18.192 1.026   1.00 45.77 ? 259 ALA A CB    1 
ATOM   1048 N N     . LYS A 1 149 ? -24.680 20.312 -1.076  1.00 45.08 ? 260 LYS A N     1 
ATOM   1049 C CA    . LYS A 1 149 ? -24.990 21.323 -2.080  1.00 44.35 ? 260 LYS A CA    1 
ATOM   1050 C C     . LYS A 1 149 ? -24.078 21.168 -3.291  1.00 43.80 ? 260 LYS A C     1 
ATOM   1051 O O     . LYS A 1 149 ? -24.531 21.222 -4.431  1.00 42.77 ? 260 LYS A O     1 
ATOM   1052 C CB    . LYS A 1 149 ? -24.798 22.724 -1.484  1.00 43.76 ? 260 LYS A CB    1 
ATOM   1053 C CG    . LYS A 1 149 ? -25.055 23.852 -2.472  1.00 45.01 ? 260 LYS A CG    1 
ATOM   1054 C CD    . LYS A 1 149 ? -24.147 25.059 -2.234  1.00 44.50 ? 260 LYS A CD    1 
ATOM   1055 C CE    . LYS A 1 149 ? -24.435 25.767 -0.924  1.00 46.53 ? 260 LYS A CE    1 
ATOM   1056 N NZ    . LYS A 1 149 ? -23.561 26.974 -0.747  1.00 45.39 ? 260 LYS A NZ    1 
ATOM   1057 N N     . LYS A 1 150 ? -22.788 20.985 -3.033  1.00 44.21 ? 261 LYS A N     1 
ATOM   1058 C CA    . LYS A 1 150 ? -21.822 20.833 -4.109  1.00 45.99 ? 261 LYS A CA    1 
ATOM   1059 C C     . LYS A 1 150 ? -22.102 19.584 -4.921  1.00 46.97 ? 261 LYS A C     1 
ATOM   1060 O O     . LYS A 1 150 ? -21.984 19.602 -6.142  1.00 45.75 ? 261 LYS A O     1 
ATOM   1061 C CB    . LYS A 1 150 ? -20.400 20.795 -3.549  1.00 46.00 ? 261 LYS A CB    1 
ATOM   1062 C CG    . LYS A 1 150 ? -19.895 22.171 -3.086  1.00 47.77 ? 261 LYS A CG    1 
ATOM   1063 C CD    . LYS A 1 150 ? -18.865 22.073 -1.943  1.00 48.28 ? 261 LYS A CD    1 
ATOM   1064 C CE    . LYS A 1 150 ? -17.679 21.177 -2.300  1.00 46.97 ? 261 LYS A CE    1 
ATOM   1065 N NZ    . LYS A 1 150 ? -16.714 21.074 -1.174  1.00 46.45 ? 261 LYS A NZ    1 
ATOM   1066 N N     . ARG A 1 151 ? -22.485 18.503 -4.247  1.00 49.20 ? 262 ARG A N     1 
ATOM   1067 C CA    . ARG A 1 151 ? -22.772 17.269 -4.958  1.00 51.99 ? 262 ARG A CA    1 
ATOM   1068 C C     . ARG A 1 151 ? -23.870 17.504 -5.966  1.00 52.67 ? 262 ARG A C     1 
ATOM   1069 O O     . ARG A 1 151 ? -23.763 17.069 -7.110  1.00 54.71 ? 262 ARG A O     1 
ATOM   1070 C CB    . ARG A 1 151 ? -23.179 16.149 -4.002  1.00 52.97 ? 262 ARG A CB    1 
ATOM   1071 C CG    . ARG A 1 151 ? -22.048 15.670 -3.105  1.00 57.68 ? 262 ARG A CG    1 
ATOM   1072 C CD    . ARG A 1 151 ? -22.410 14.369 -2.394  1.00 60.12 ? 262 ARG A CD    1 
ATOM   1073 N NE    . ARG A 1 151 ? -22.024 13.190 -3.166  1.00 61.48 ? 262 ARG A NE    1 
ATOM   1074 C CZ    . ARG A 1 151 ? -20.803 12.667 -3.159  1.00 62.28 ? 262 ARG A CZ    1 
ATOM   1075 N NH1   . ARG A 1 151 ? -19.854 13.218 -2.417  1.00 63.51 ? 262 ARG A NH1   1 
ATOM   1076 N NH2   . ARG A 1 151 ? -20.528 11.598 -3.895  1.00 62.61 ? 262 ARG A NH2   1 
ATOM   1077 N N     . LYS A 1 152 ? -24.927 18.195 -5.556  1.00 52.93 ? 263 LYS A N     1 
ATOM   1078 C CA    . LYS A 1 152 ? -26.011 18.465 -6.484  1.00 53.27 ? 263 LYS A CA    1 
ATOM   1079 C C     . LYS A 1 152 ? -25.398 19.116 -7.699  1.00 52.85 ? 263 LYS A C     1 
ATOM   1080 O O     . LYS A 1 152 ? -25.340 18.526 -8.773  1.00 53.55 ? 263 LYS A O     1 
ATOM   1081 C CB    . LYS A 1 152 ? -27.030 19.420 -5.880  1.00 54.46 ? 263 LYS A CB    1 
ATOM   1082 C CG    . LYS A 1 152 ? -27.884 18.810 -4.801  1.00 58.18 ? 263 LYS A CG    1 
ATOM   1083 C CD    . LYS A 1 152 ? -28.775 19.870 -4.162  1.00 59.94 ? 263 LYS A CD    1 
ATOM   1084 C CE    . LYS A 1 152 ? -29.606 19.283 -3.034  1.00 61.36 ? 263 LYS A CE    1 
ATOM   1085 N NZ    . LYS A 1 152 ? -28.760 18.594 -2.011  1.00 63.03 ? 263 LYS A NZ    1 
ATOM   1086 N N     . MET A 1 153 ? -24.920 20.336 -7.496  1.00 52.03 ? 264 MET A N     1 
ATOM   1087 C CA    . MET A 1 153 ? -24.304 21.131 -8.541  1.00 51.08 ? 264 MET A CA    1 
ATOM   1088 C C     . MET A 1 153 ? -23.338 20.437 -9.483  1.00 49.99 ? 264 MET A C     1 
ATOM   1089 O O     . MET A 1 153 ? -23.416 20.629 -10.689 1.00 49.33 ? 264 MET A O     1 
ATOM   1090 C CB    . MET A 1 153 ? -23.562 22.315 -7.929  1.00 52.54 ? 264 MET A CB    1 
ATOM   1091 C CG    . MET A 1 153 ? -24.447 23.384 -7.355  1.00 54.75 ? 264 MET A CG    1 
ATOM   1092 S SD    . MET A 1 153 ? -23.507 24.891 -7.093  1.00 58.37 ? 264 MET A SD    1 
ATOM   1093 C CE    . MET A 1 153 ? -23.041 24.689 -5.360  1.00 52.92 ? 264 MET A CE    1 
ATOM   1094 N N     . TYR A 1 154 ? -22.428 19.633 -8.946  1.00 49.16 ? 265 TYR A N     1 
ATOM   1095 C CA    . TYR A 1 154 ? -21.419 19.012 -9.797  1.00 49.12 ? 265 TYR A CA    1 
ATOM   1096 C C     . TYR A 1 154 ? -21.358 17.502 -9.912  1.00 49.09 ? 265 TYR A C     1 
ATOM   1097 O O     . TYR A 1 154 ? -20.432 16.979 -10.526 1.00 48.52 ? 265 TYR A O     1 
ATOM   1098 C CB    . TYR A 1 154 ? -20.034 19.514 -9.373  1.00 46.78 ? 265 TYR A CB    1 
ATOM   1099 C CG    . TYR A 1 154 ? -19.960 21.011 -9.217  1.00 43.43 ? 265 TYR A CG    1 
ATOM   1100 C CD1   . TYR A 1 154 ? -19.682 21.585 -7.983  1.00 43.07 ? 265 TYR A CD1   1 
ATOM   1101 C CD2   . TYR A 1 154 ? -20.189 21.855 -10.301 1.00 42.76 ? 265 TYR A CD2   1 
ATOM   1102 C CE1   . TYR A 1 154 ? -19.633 22.960 -7.828  1.00 42.76 ? 265 TYR A CE1   1 
ATOM   1103 C CE2   . TYR A 1 154 ? -20.144 23.231 -10.159 1.00 41.51 ? 265 TYR A CE2   1 
ATOM   1104 C CZ    . TYR A 1 154 ? -19.864 23.778 -8.922  1.00 42.71 ? 265 TYR A CZ    1 
ATOM   1105 O OH    . TYR A 1 154 ? -19.801 25.145 -8.776  1.00 44.37 ? 265 TYR A OH    1 
ATOM   1106 N N     . GLU A 1 155 ? -22.321 16.791 -9.345  1.00 51.73 ? 266 GLU A N     1 
ATOM   1107 C CA    . GLU A 1 155 ? -22.262 15.336 -9.423  1.00 54.85 ? 266 GLU A CA    1 
ATOM   1108 C C     . GLU A 1 155 ? -22.359 14.779 -10.846 1.00 54.13 ? 266 GLU A C     1 
ATOM   1109 O O     . GLU A 1 155 ? -21.558 13.929 -11.244 1.00 53.11 ? 266 GLU A O     1 
ATOM   1110 C CB    . GLU A 1 155 ? -23.338 14.696 -8.544  1.00 57.23 ? 266 GLU A CB    1 
ATOM   1111 C CG    . GLU A 1 155 ? -23.063 13.231 -8.301  1.00 61.22 ? 266 GLU A CG    1 
ATOM   1112 C CD    . GLU A 1 155 ? -21.658 13.016 -7.770  1.00 63.81 ? 266 GLU A CD    1 
ATOM   1113 O OE1   . GLU A 1 155 ? -21.187 11.857 -7.745  1.00 65.71 ? 266 GLU A OE1   1 
ATOM   1114 O OE2   . GLU A 1 155 ? -21.026 14.019 -7.371  1.00 65.11 ? 266 GLU A OE2   1 
ATOM   1115 N N     . SER A 1 156 ? -23.337 15.246 -11.611 1.00 53.28 ? 267 SER A N     1 
ATOM   1116 C CA    . SER A 1 156 ? -23.485 14.773 -12.979 1.00 53.85 ? 267 SER A CA    1 
ATOM   1117 C C     . SER A 1 156 ? -22.198 15.106 -13.729 1.00 54.01 ? 267 SER A C     1 
ATOM   1118 O O     . SER A 1 156 ? -21.530 14.221 -14.276 1.00 54.15 ? 267 SER A O     1 
ATOM   1119 C CB    . SER A 1 156 ? -24.662 15.476 -13.650 1.00 54.90 ? 267 SER A CB    1 
ATOM   1120 O OG    . SER A 1 156 ? -25.798 15.470 -12.803 1.00 57.87 ? 267 SER A OG    1 
ATOM   1121 N N     . PHE A 1 157 ? -21.859 16.394 -13.729 1.00 51.80 ? 268 PHE A N     1 
ATOM   1122 C CA    . PHE A 1 157 ? -20.669 16.904 -14.396 1.00 50.20 ? 268 PHE A CA    1 
ATOM   1123 C C     . PHE A 1 157 ? -19.416 16.071 -14.146 1.00 50.42 ? 268 PHE A C     1 
ATOM   1124 O O     . PHE A 1 157 ? -18.783 15.588 -15.079 1.00 49.23 ? 268 PHE A O     1 
ATOM   1125 C CB    . PHE A 1 157 ? -20.405 18.341 -13.947 1.00 48.69 ? 268 PHE A CB    1 
ATOM   1126 C CG    . PHE A 1 157 ? -19.185 18.957 -14.572 1.00 46.87 ? 268 PHE A CG    1 
ATOM   1127 C CD1   . PHE A 1 157 ? -19.092 19.097 -15.956 1.00 46.17 ? 268 PHE A CD1   1 
ATOM   1128 C CD2   . PHE A 1 157 ? -18.130 19.397 -13.779 1.00 44.58 ? 268 PHE A CD2   1 
ATOM   1129 C CE1   . PHE A 1 157 ? -17.970 19.666 -16.535 1.00 44.39 ? 268 PHE A CE1   1 
ATOM   1130 C CE2   . PHE A 1 157 ? -17.009 19.965 -14.347 1.00 42.61 ? 268 PHE A CE2   1 
ATOM   1131 C CZ    . PHE A 1 157 ? -16.929 20.101 -15.729 1.00 44.58 ? 268 PHE A CZ    1 
ATOM   1132 N N     . ILE A 1 158 ? -19.048 15.924 -12.881 1.00 51.85 ? 269 ILE A N     1 
ATOM   1133 C CA    . ILE A 1 158 ? -17.860 15.157 -12.521 1.00 54.18 ? 269 ILE A CA    1 
ATOM   1134 C C     . ILE A 1 158 ? -17.945 13.724 -13.034 1.00 55.37 ? 269 ILE A C     1 
ATOM   1135 O O     . ILE A 1 158 ? -16.952 13.141 -13.463 1.00 54.90 ? 269 ILE A O     1 
ATOM   1136 C CB    . ILE A 1 158 ? -17.670 15.146 -10.993 1.00 53.77 ? 269 ILE A CB    1 
ATOM   1137 C CG1   . ILE A 1 158 ? -17.356 16.568 -10.517 1.00 54.20 ? 269 ILE A CG1   1 
ATOM   1138 C CG2   . ILE A 1 158 ? -16.568 14.173 -10.601 1.00 51.33 ? 269 ILE A CG2   1 
ATOM   1139 C CD1   . ILE A 1 158 ? -17.417 16.747 -9.016  1.00 56.54 ? 269 ILE A CD1   1 
ATOM   1140 N N     . GLU A 1 159 ? -19.150 13.171 -12.992 1.00 57.53 ? 270 GLU A N     1 
ATOM   1141 C CA    . GLU A 1 159 ? -19.392 11.810 -13.439 1.00 58.52 ? 270 GLU A CA    1 
ATOM   1142 C C     . GLU A 1 159 ? -19.461 11.712 -14.953 1.00 57.67 ? 270 GLU A C     1 
ATOM   1143 O O     . GLU A 1 159 ? -19.871 10.692 -15.491 1.00 58.04 ? 270 GLU A O     1 
ATOM   1144 C CB    . GLU A 1 159 ? -20.696 11.299 -12.838 1.00 59.52 ? 270 GLU A CB    1 
ATOM   1145 C CG    . GLU A 1 159 ? -20.669 11.193 -11.330 1.00 63.53 ? 270 GLU A CG    1 
ATOM   1146 C CD    . GLU A 1 159 ? -22.014 10.793 -10.752 1.00 66.73 ? 270 GLU A CD    1 
ATOM   1147 O OE1   . GLU A 1 159 ? -22.093 10.575 -9.523  1.00 67.35 ? 270 GLU A OE1   1 
ATOM   1148 O OE2   . GLU A 1 159 ? -22.996 10.699 -11.526 1.00 69.17 ? 270 GLU A OE2   1 
ATOM   1149 N N     . SER A 1 160 ? -19.062 12.773 -15.643 1.00 57.63 ? 271 SER A N     1 
ATOM   1150 C CA    . SER A 1 160 ? -19.099 12.775 -17.101 1.00 56.07 ? 271 SER A CA    1 
ATOM   1151 C C     . SER A 1 160 ? -17.722 13.094 -17.644 1.00 56.27 ? 271 SER A C     1 
ATOM   1152 O O     . SER A 1 160 ? -17.543 13.275 -18.847 1.00 56.81 ? 271 SER A O     1 
ATOM   1153 C CB    . SER A 1 160 ? -20.080 13.825 -17.608 1.00 54.11 ? 271 SER A CB    1 
ATOM   1154 O OG    . SER A 1 160 ? -19.493 15.108 -17.534 1.00 51.94 ? 271 SER A OG    1 
ATOM   1155 N N     . LEU A 1 161 ? -16.748 13.173 -16.749 1.00 57.21 ? 272 LEU A N     1 
ATOM   1156 C CA    . LEU A 1 161 ? -15.387 13.484 -17.147 1.00 57.87 ? 272 LEU A CA    1 
ATOM   1157 C C     . LEU A 1 161 ? -14.654 12.184 -17.445 1.00 58.12 ? 272 LEU A C     1 
ATOM   1158 O O     . LEU A 1 161 ? -14.352 11.412 -16.541 1.00 58.17 ? 272 LEU A O     1 
ATOM   1159 C CB    . LEU A 1 161 ? -14.693 14.254 -16.031 1.00 57.54 ? 272 LEU A CB    1 
ATOM   1160 C CG    . LEU A 1 161 ? -15.461 15.489 -15.550 1.00 57.21 ? 272 LEU A CG    1 
ATOM   1161 C CD1   . LEU A 1 161 ? -14.807 16.043 -14.287 1.00 56.23 ? 272 LEU A CD1   1 
ATOM   1162 C CD2   . LEU A 1 161 ? -15.506 16.529 -16.653 1.00 54.71 ? 272 LEU A CD2   1 
ATOM   1163 N N     . PRO A 1 162 ? -14.355 11.936 -18.730 1.00 59.25 ? 273 PRO A N     1 
ATOM   1164 C CA    . PRO A 1 162 ? -13.662 10.741 -19.220 1.00 58.75 ? 273 PRO A CA    1 
ATOM   1165 C C     . PRO A 1 162 ? -12.419 10.298 -18.463 1.00 57.84 ? 273 PRO A C     1 
ATOM   1166 O O     . PRO A 1 162 ? -12.246 9.110  -18.196 1.00 56.89 ? 273 PRO A O     1 
ATOM   1167 C CB    . PRO A 1 162 ? -13.364 11.089 -20.681 1.00 58.71 ? 273 PRO A CB    1 
ATOM   1168 C CG    . PRO A 1 162 ? -13.311 12.583 -20.683 1.00 59.42 ? 273 PRO A CG    1 
ATOM   1169 C CD    . PRO A 1 162 ? -14.493 12.921 -19.817 1.00 59.72 ? 273 PRO A CD    1 
ATOM   1170 N N     . PHE A 1 163 ? -11.554 11.240 -18.115 1.00 57.59 ? 274 PHE A N     1 
ATOM   1171 C CA    . PHE A 1 163 ? -10.339 10.881 -17.403 1.00 59.09 ? 274 PHE A CA    1 
ATOM   1172 C C     . PHE A 1 163 ? -10.628 10.336 -16.010 1.00 60.32 ? 274 PHE A C     1 
ATOM   1173 O O     . PHE A 1 163 ? -9.740  9.810  -15.344 1.00 61.48 ? 274 PHE A O     1 
ATOM   1174 C CB    . PHE A 1 163 ? -9.396  12.085 -17.329 1.00 59.53 ? 274 PHE A CB    1 
ATOM   1175 C CG    . PHE A 1 163 ? -10.001 13.297 -16.679 1.00 61.80 ? 274 PHE A CG    1 
ATOM   1176 C CD1   . PHE A 1 163 ? -9.775  13.568 -15.329 1.00 61.60 ? 274 PHE A CD1   1 
ATOM   1177 C CD2   . PHE A 1 163 ? -10.789 14.174 -17.416 1.00 61.78 ? 274 PHE A CD2   1 
ATOM   1178 C CE1   . PHE A 1 163 ? -10.321 14.696 -14.724 1.00 61.05 ? 274 PHE A CE1   1 
ATOM   1179 C CE2   . PHE A 1 163 ? -11.343 15.307 -16.819 1.00 62.67 ? 274 PHE A CE2   1 
ATOM   1180 C CZ    . PHE A 1 163 ? -11.107 15.569 -15.469 1.00 61.70 ? 274 PHE A CZ    1 
ATOM   1181 N N     . LEU A 1 164 ? -11.876 10.442 -15.572 1.00 61.26 ? 275 LEU A N     1 
ATOM   1182 C CA    . LEU A 1 164 ? -12.234 9.953  -14.250 1.00 61.64 ? 275 LEU A CA    1 
ATOM   1183 C C     . LEU A 1 164 ? -12.941 8.609  -14.285 1.00 61.71 ? 275 LEU A C     1 
ATOM   1184 O O     . LEU A 1 164 ? -13.514 8.183  -13.287 1.00 61.81 ? 275 LEU A O     1 
ATOM   1185 C CB    . LEU A 1 164 ? -13.105 10.980 -13.523 1.00 61.73 ? 275 LEU A CB    1 
ATOM   1186 C CG    . LEU A 1 164 ? -12.405 12.291 -13.154 1.00 61.61 ? 275 LEU A CG    1 
ATOM   1187 C CD1   . LEU A 1 164 ? -13.274 13.083 -12.191 1.00 61.24 ? 275 LEU A CD1   1 
ATOM   1188 C CD2   . LEU A 1 164 ? -11.064 11.992 -12.502 1.00 61.44 ? 275 LEU A CD2   1 
ATOM   1189 N N     . LYS A 1 165 ? -12.898 7.943  -15.434 1.00 62.34 ? 276 LYS A N     1 
ATOM   1190 C CA    . LYS A 1 165 ? -13.530 6.636  -15.582 1.00 61.80 ? 276 LYS A CA    1 
ATOM   1191 C C     . LYS A 1 165 ? -12.742 5.621  -14.771 1.00 62.34 ? 276 LYS A C     1 
ATOM   1192 O O     . LYS A 1 165 ? -13.309 4.698  -14.186 1.00 62.11 ? 276 LYS A O     1 
ATOM   1193 C CB    . LYS A 1 165 ? -13.548 6.226  -17.050 1.00 60.94 ? 276 LYS A CB    1 
ATOM   1194 N N     . SER A 1 166 ? -11.425 5.813  -14.739 1.00 63.08 ? 277 SER A N     1 
ATOM   1195 C CA    . SER A 1 166 ? -10.519 4.927  -14.024 1.00 63.95 ? 277 SER A CA    1 
ATOM   1196 C C     . SER A 1 166 ? -10.486 5.170  -12.523 1.00 65.73 ? 277 SER A C     1 
ATOM   1197 O O     . SER A 1 166 ? -9.448  5.522  -11.967 1.00 67.39 ? 277 SER A O     1 
ATOM   1198 C CB    . SER A 1 166 ? -9.106  5.067  -14.587 1.00 63.12 ? 277 SER A CB    1 
ATOM   1199 O OG    . SER A 1 166 ? -8.672  6.412  -14.531 1.00 63.31 ? 277 SER A OG    1 
ATOM   1200 N N     . LEU A 1 167 ? -11.625 4.972  -11.873 1.00 66.65 ? 278 LEU A N     1 
ATOM   1201 C CA    . LEU A 1 167 ? -11.743 5.150  -10.431 1.00 68.10 ? 278 LEU A CA    1 
ATOM   1202 C C     . LEU A 1 167 ? -12.940 4.340  -9.963  1.00 68.91 ? 278 LEU A C     1 
ATOM   1203 O O     . LEU A 1 167 ? -13.970 4.319  -10.637 1.00 69.40 ? 278 LEU A O     1 
ATOM   1204 C CB    . LEU A 1 167 ? -11.984 6.623  -10.072 1.00 68.50 ? 278 LEU A CB    1 
ATOM   1205 C CG    . LEU A 1 167 ? -10.889 7.686  -10.175 1.00 67.18 ? 278 LEU A CG    1 
ATOM   1206 C CD1   . LEU A 1 167 ? -11.470 9.013  -9.732  1.00 66.43 ? 278 LEU A CD1   1 
ATOM   1207 C CD2   . LEU A 1 167 ? -9.706  7.320  -9.299  1.00 68.06 ? 278 LEU A CD2   1 
ATOM   1208 N N     . GLU A 1 168 ? -12.813 3.674  -8.818  1.00 69.56 ? 279 GLU A N     1 
ATOM   1209 C CA    . GLU A 1 168 ? -13.929 2.894  -8.295  1.00 70.29 ? 279 GLU A CA    1 
ATOM   1210 C C     . GLU A 1 168 ? -15.108 3.849  -8.118  1.00 69.82 ? 279 GLU A C     1 
ATOM   1211 O O     . GLU A 1 168 ? -14.935 4.978  -7.664  1.00 69.81 ? 279 GLU A O     1 
ATOM   1212 C CB    . GLU A 1 168 ? -13.555 2.254  -6.958  1.00 70.58 ? 279 GLU A CB    1 
ATOM   1213 N N     . VAL A 1 169 ? -16.298 3.398  -8.495  1.00 69.99 ? 280 VAL A N     1 
ATOM   1214 C CA    . VAL A 1 169 ? -17.503 4.217  -8.383  1.00 70.19 ? 280 VAL A CA    1 
ATOM   1215 C C     . VAL A 1 169 ? -17.533 4.968  -7.060  1.00 69.88 ? 280 VAL A C     1 
ATOM   1216 O O     . VAL A 1 169 ? -18.037 6.094  -6.979  1.00 70.18 ? 280 VAL A O     1 
ATOM   1217 C CB    . VAL A 1 169 ? -18.749 3.334  -8.511  1.00 69.53 ? 280 VAL A CB    1 
ATOM   1218 N N     . SER A 1 170 ? -16.980 4.333  -6.030  1.00 69.77 ? 281 SER A N     1 
ATOM   1219 C CA    . SER A 1 170 ? -16.931 4.902  -4.689  1.00 68.84 ? 281 SER A CA    1 
ATOM   1220 C C     . SER A 1 170 ? -15.902 6.018  -4.586  1.00 67.53 ? 281 SER A C     1 
ATOM   1221 O O     . SER A 1 170 ? -16.152 7.050  -3.974  1.00 67.19 ? 281 SER A O     1 
ATOM   1222 C CB    . SER A 1 170 ? -16.614 3.805  -3.675  1.00 68.57 ? 281 SER A CB    1 
ATOM   1223 N N     . GLU A 1 171 ? -14.739 5.804  -5.184  1.00 67.12 ? 282 GLU A N     1 
ATOM   1224 C CA    . GLU A 1 171 ? -13.679 6.797  -5.143  1.00 66.90 ? 282 GLU A CA    1 
ATOM   1225 C C     . GLU A 1 171 ? -14.108 8.079  -5.846  1.00 65.35 ? 282 GLU A C     1 
ATOM   1226 O O     . GLU A 1 171 ? -13.839 9.177  -5.367  1.00 65.23 ? 282 GLU A O     1 
ATOM   1227 C CB    . GLU A 1 171 ? -12.413 6.241  -5.800  1.00 68.46 ? 282 GLU A CB    1 
ATOM   1228 C CG    . GLU A 1 171 ? -11.127 6.562  -5.048  1.00 70.73 ? 282 GLU A CG    1 
ATOM   1229 C CD    . GLU A 1 171 ? -11.074 5.912  -3.673  1.00 72.48 ? 282 GLU A CD    1 
ATOM   1230 O OE1   . GLU A 1 171 ? -11.885 6.280  -2.793  1.00 73.21 ? 282 GLU A OE1   1 
ATOM   1231 O OE2   . GLU A 1 171 ? -10.220 5.022  -3.473  1.00 73.91 ? 282 GLU A OE2   1 
ATOM   1232 N N     . ARG A 1 172 ? -14.783 7.939  -6.981  1.00 64.09 ? 283 ARG A N     1 
ATOM   1233 C CA    . ARG A 1 172 ? -15.235 9.100  -7.733  1.00 62.88 ? 283 ARG A CA    1 
ATOM   1234 C C     . ARG A 1 172 ? -16.236 9.944  -6.968  1.00 62.47 ? 283 ARG A C     1 
ATOM   1235 O O     . ARG A 1 172 ? -16.455 11.107 -7.302  1.00 62.14 ? 283 ARG A O     1 
ATOM   1236 C CB    . ARG A 1 172 ? -15.857 8.681  -9.062  1.00 63.35 ? 283 ARG A CB    1 
ATOM   1237 C CG    . ARG A 1 172 ? -14.958 8.942  -10.259 1.00 64.57 ? 283 ARG A CG    1 
ATOM   1238 C CD    . ARG A 1 172 ? -15.768 9.180  -11.526 1.00 63.85 ? 283 ARG A CD    1 
ATOM   1239 N NE    . ARG A 1 172 ? -16.657 8.067  -11.836 1.00 63.51 ? 283 ARG A NE    1 
ATOM   1240 C CZ    . ARG A 1 172 ? -16.254 6.811  -11.988 1.00 65.24 ? 283 ARG A CZ    1 
ATOM   1241 N NH1   . ARG A 1 172 ? -17.136 5.864  -12.272 1.00 66.42 ? 283 ARG A NH1   1 
ATOM   1242 N NH2   . ARG A 1 172 ? -14.970 6.497  -11.853 1.00 66.10 ? 283 ARG A NH2   1 
ATOM   1243 N N     . LEU A 1 173 ? -16.851 9.355  -5.947  1.00 62.39 ? 284 LEU A N     1 
ATOM   1244 C CA    . LEU A 1 173 ? -17.833 10.068 -5.138  1.00 61.30 ? 284 LEU A CA    1 
ATOM   1245 C C     . LEU A 1 173 ? -17.170 11.057 -4.186  1.00 60.48 ? 284 LEU A C     1 
ATOM   1246 O O     . LEU A 1 173 ? -17.687 12.153 -3.958  1.00 61.29 ? 284 LEU A O     1 
ATOM   1247 C CB    . LEU A 1 173 ? -18.663 9.080  -4.320  1.00 62.07 ? 284 LEU A CB    1 
ATOM   1248 C CG    . LEU A 1 173 ? -19.443 7.992  -5.057  1.00 61.70 ? 284 LEU A CG    1 
ATOM   1249 C CD1   . LEU A 1 173 ? -20.186 7.156  -4.028  1.00 60.67 ? 284 LEU A CD1   1 
ATOM   1250 C CD2   . LEU A 1 173 ? -20.418 8.622  -6.049  1.00 61.68 ? 284 LEU A CD2   1 
ATOM   1251 N N     . LYS A 1 174 ? -16.027 10.667 -3.631  1.00 58.82 ? 285 LYS A N     1 
ATOM   1252 C CA    . LYS A 1 174 ? -15.311 11.514 -2.684  1.00 57.59 ? 285 LYS A CA    1 
ATOM   1253 C C     . LYS A 1 174 ? -14.554 12.653 -3.339  1.00 55.26 ? 285 LYS A C     1 
ATOM   1254 O O     . LYS A 1 174 ? -13.956 13.485 -2.651  1.00 55.86 ? 285 LYS A O     1 
ATOM   1255 C CB    . LYS A 1 174 ? -14.319 10.682 -1.875  1.00 60.48 ? 285 LYS A CB    1 
ATOM   1256 C CG    . LYS A 1 174 ? -14.926 9.482  -1.178  1.00 63.54 ? 285 LYS A CG    1 
ATOM   1257 C CD    . LYS A 1 174 ? -13.905 8.833  -0.252  1.00 66.40 ? 285 LYS A CD    1 
ATOM   1258 C CE    . LYS A 1 174 ? -14.425 7.518  0.311   1.00 67.19 ? 285 LYS A CE    1 
ATOM   1259 N NZ    . LYS A 1 174 ? -14.713 6.558  -0.792  1.00 68.11 ? 285 LYS A NZ    1 
ATOM   1260 N N     . VAL A 1 175 ? -14.560 12.690 -4.665  1.00 52.33 ? 286 VAL A N     1 
ATOM   1261 C CA    . VAL A 1 175 ? -13.843 13.737 -5.382  1.00 50.17 ? 286 VAL A CA    1 
ATOM   1262 C C     . VAL A 1 175 ? -14.414 15.136 -5.164  1.00 48.63 ? 286 VAL A C     1 
ATOM   1263 O O     . VAL A 1 175 ? -13.674 16.077 -4.880  1.00 48.97 ? 286 VAL A O     1 
ATOM   1264 C CB    . VAL A 1 175 ? -13.808 13.439 -6.899  1.00 49.72 ? 286 VAL A CB    1 
ATOM   1265 C CG1   . VAL A 1 175 ? -13.359 14.672 -7.678  1.00 45.21 ? 286 VAL A CG1   1 
ATOM   1266 C CG2   . VAL A 1 175 ? -12.866 12.276 -7.161  1.00 51.14 ? 286 VAL A CG2   1 
ATOM   1267 N N     . VAL A 1 176 ? -15.727 15.261 -5.305  1.00 45.90 ? 287 VAL A N     1 
ATOM   1268 C CA    . VAL A 1 176 ? -16.423 16.528 -5.155  1.00 43.85 ? 287 VAL A CA    1 
ATOM   1269 C C     . VAL A 1 176 ? -16.347 17.023 -3.712  1.00 43.56 ? 287 VAL A C     1 
ATOM   1270 O O     . VAL A 1 176 ? -16.380 18.227 -3.457  1.00 43.93 ? 287 VAL A O     1 
ATOM   1271 C CB    . VAL A 1 176 ? -17.900 16.371 -5.576  1.00 43.11 ? 287 VAL A CB    1 
ATOM   1272 C CG1   . VAL A 1 176 ? -18.611 15.413 -4.625  1.00 43.82 ? 287 VAL A CG1   1 
ATOM   1273 C CG2   . VAL A 1 176 ? -18.591 17.712 -5.595  1.00 43.95 ? 287 VAL A CG2   1 
ATOM   1274 N N     . ASP A 1 177 ? -16.240 16.086 -2.773  1.00 41.45 ? 288 ASP A N     1 
ATOM   1275 C CA    . ASP A 1 177 ? -16.160 16.418 -1.361  1.00 40.32 ? 288 ASP A CA    1 
ATOM   1276 C C     . ASP A 1 177 ? -14.984 17.325 -1.071  1.00 39.27 ? 288 ASP A C     1 
ATOM   1277 O O     . ASP A 1 177 ? -14.993 18.049 -0.084  1.00 39.54 ? 288 ASP A O     1 
ATOM   1278 C CB    . ASP A 1 177 ? -16.007 15.154 -0.511  1.00 41.44 ? 288 ASP A CB    1 
ATOM   1279 C CG    . ASP A 1 177 ? -17.312 14.397 -0.333  1.00 42.58 ? 288 ASP A CG    1 
ATOM   1280 O OD1   . ASP A 1 177 ? -17.259 13.229 0.106   1.00 42.36 ? 288 ASP A OD1   1 
ATOM   1281 O OD2   . ASP A 1 177 ? -18.388 14.961 -0.619  1.00 43.79 ? 288 ASP A OD2   1 
ATOM   1282 N N     . VAL A 1 178 ? -13.963 17.286 -1.921  1.00 38.61 ? 289 VAL A N     1 
ATOM   1283 C CA    . VAL A 1 178 ? -12.785 18.105 -1.677  1.00 36.79 ? 289 VAL A CA    1 
ATOM   1284 C C     . VAL A 1 178 ? -12.393 19.092 -2.769  1.00 37.32 ? 289 VAL A C     1 
ATOM   1285 O O     . VAL A 1 178 ? -11.319 19.697 -2.705  1.00 37.86 ? 289 VAL A O     1 
ATOM   1286 C CB    . VAL A 1 178 ? -11.564 17.228 -1.328  1.00 36.66 ? 289 VAL A CB    1 
ATOM   1287 C CG1   . VAL A 1 178 ? -11.810 16.511 -0.001  1.00 34.01 ? 289 VAL A CG1   1 
ATOM   1288 C CG2   . VAL A 1 178 ? -11.292 16.236 -2.442  1.00 37.04 ? 289 VAL A CG2   1 
ATOM   1289 N N     . ILE A 1 179 ? -13.241 19.257 -3.777  1.00 35.61 ? 290 ILE A N     1 
ATOM   1290 C CA    . ILE A 1 179 ? -12.940 20.248 -4.797  1.00 36.92 ? 290 ILE A CA    1 
ATOM   1291 C C     . ILE A 1 179 ? -13.526 21.570 -4.284  1.00 37.52 ? 290 ILE A C     1 
ATOM   1292 O O     . ILE A 1 179 ? -14.385 21.578 -3.399  1.00 36.73 ? 290 ILE A O     1 
ATOM   1293 C CB    . ILE A 1 179 ? -13.582 19.917 -6.180  1.00 35.99 ? 290 ILE A CB    1 
ATOM   1294 C CG1   . ILE A 1 179 ? -15.077 19.663 -6.025  1.00 36.46 ? 290 ILE A CG1   1 
ATOM   1295 C CG2   . ILE A 1 179 ? -12.892 18.738 -6.818  1.00 33.80 ? 290 ILE A CG2   1 
ATOM   1296 C CD1   . ILE A 1 179 ? -15.907 20.912 -5.874  1.00 35.01 ? 290 ILE A CD1   1 
ATOM   1297 N N     . GLY A 1 180 ? -13.055 22.680 -4.837  1.00 37.22 ? 291 GLY A N     1 
ATOM   1298 C CA    . GLY A 1 180 ? -13.561 23.977 -4.438  1.00 37.10 ? 291 GLY A CA    1 
ATOM   1299 C C     . GLY A 1 180 ? -13.764 24.802 -5.693  1.00 37.42 ? 291 GLY A C     1 
ATOM   1300 O O     . GLY A 1 180 ? -12.987 24.680 -6.638  1.00 37.60 ? 291 GLY A O     1 
ATOM   1301 N N     . THR A 1 181 ? -14.794 25.644 -5.723  1.00 37.48 ? 292 THR A N     1 
ATOM   1302 C CA    . THR A 1 181 ? -15.043 26.459 -6.911  1.00 36.69 ? 292 THR A CA    1 
ATOM   1303 C C     . THR A 1 181 ? -14.299 27.788 -6.897  1.00 35.24 ? 292 THR A C     1 
ATOM   1304 O O     . THR A 1 181 ? -14.371 28.549 -5.939  1.00 34.14 ? 292 THR A O     1 
ATOM   1305 C CB    . THR A 1 181 ? -16.553 26.731 -7.101  1.00 35.88 ? 292 THR A CB    1 
ATOM   1306 O OG1   . THR A 1 181 ? -17.230 25.498 -7.374  1.00 36.97 ? 292 THR A OG1   1 
ATOM   1307 C CG2   . THR A 1 181 ? -16.782 27.680 -8.256  1.00 35.09 ? 292 THR A CG2   1 
ATOM   1308 N N     . LYS A 1 182 ? -13.573 28.049 -7.976  1.00 36.50 ? 293 LYS A N     1 
ATOM   1309 C CA    . LYS A 1 182 ? -12.832 29.283 -8.119  1.00 35.73 ? 293 LYS A CA    1 
ATOM   1310 C C     . LYS A 1 182 ? -13.393 30.048 -9.300  1.00 36.32 ? 293 LYS A C     1 
ATOM   1311 O O     . LYS A 1 182 ? -13.536 29.494 -10.393 1.00 35.24 ? 293 LYS A O     1 
ATOM   1312 C CB    . LYS A 1 182 ? -11.352 28.993 -8.352  1.00 37.12 ? 293 LYS A CB    1 
ATOM   1313 C CG    . LYS A 1 182 ? -10.660 28.354 -7.163  1.00 40.09 ? 293 LYS A CG    1 
ATOM   1314 C CD    . LYS A 1 182 ? -9.379  29.097 -6.803  1.00 42.79 ? 293 LYS A CD    1 
ATOM   1315 C CE    . LYS A 1 182 ? -9.641  30.563 -6.488  1.00 45.27 ? 293 LYS A CE    1 
ATOM   1316 N NZ    . LYS A 1 182 ? -8.386  31.376 -6.338  1.00 46.51 ? 293 LYS A NZ    1 
ATOM   1317 N N     . VAL A 1 183 ? -13.725 31.317 -9.068  1.00 37.26 ? 294 VAL A N     1 
ATOM   1318 C CA    . VAL A 1 183 ? -14.255 32.176 -10.124 1.00 38.44 ? 294 VAL A CA    1 
ATOM   1319 C C     . VAL A 1 183 ? -13.156 33.133 -10.565 1.00 37.55 ? 294 VAL A C     1 
ATOM   1320 O O     . VAL A 1 183 ? -12.382 33.631 -9.740  1.00 35.22 ? 294 VAL A O     1 
ATOM   1321 C CB    . VAL A 1 183 ? -15.503 33.033 -9.660  1.00 40.78 ? 294 VAL A CB    1 
ATOM   1322 C CG1   . VAL A 1 183 ? -16.486 32.164 -8.885  1.00 39.52 ? 294 VAL A CG1   1 
ATOM   1323 C CG2   . VAL A 1 183 ? -15.058 34.254 -8.839  1.00 38.92 ? 294 VAL A CG2   1 
ATOM   1324 N N     . TYR A 1 184 ? -13.102 33.387 -11.866 1.00 37.36 ? 295 TYR A N     1 
ATOM   1325 C CA    . TYR A 1 184 ? -12.101 34.279 -12.431 1.00 38.78 ? 295 TYR A CA    1 
ATOM   1326 C C     . TYR A 1 184 ? -12.749 35.200 -13.453 1.00 40.18 ? 295 TYR A C     1 
ATOM   1327 O O     . TYR A 1 184 ? -13.620 34.779 -14.222 1.00 39.28 ? 295 TYR A O     1 
ATOM   1328 C CB    . TYR A 1 184 ? -11.005 33.470 -13.134 1.00 37.55 ? 295 TYR A CB    1 
ATOM   1329 C CG    . TYR A 1 184 ? -10.242 32.519 -12.245 1.00 36.96 ? 295 TYR A CG    1 
ATOM   1330 C CD1   . TYR A 1 184 ? -9.189  32.969 -11.446 1.00 37.08 ? 295 TYR A CD1   1 
ATOM   1331 C CD2   . TYR A 1 184 ? -10.571 31.162 -12.203 1.00 37.10 ? 295 TYR A CD2   1 
ATOM   1332 C CE1   . TYR A 1 184 ? -8.468  32.084 -10.623 1.00 36.85 ? 295 TYR A CE1   1 
ATOM   1333 C CE2   . TYR A 1 184 ? -9.866  30.266 -11.383 1.00 38.23 ? 295 TYR A CE2   1 
ATOM   1334 C CZ    . TYR A 1 184 ? -8.811  30.730 -10.597 1.00 39.04 ? 295 TYR A CZ    1 
ATOM   1335 O OH    . TYR A 1 184 ? -8.087  29.836 -9.822  1.00 37.49 ? 295 TYR A OH    1 
ATOM   1336 N N     . ASN A 1 185 ? -12.312 36.453 -13.478 1.00 41.77 ? 296 ASN A N     1 
ATOM   1337 C CA    . ASN A 1 185 ? -12.846 37.402 -14.446 1.00 44.97 ? 296 ASN A CA    1 
ATOM   1338 C C     . ASN A 1 185 ? -11.985 37.353 -15.701 1.00 47.33 ? 296 ASN A C     1 
ATOM   1339 O O     . ASN A 1 185 ? -10.934 36.704 -15.715 1.00 49.58 ? 296 ASN A O     1 
ATOM   1340 C CB    . ASN A 1 185 ? -12.856 38.813 -13.861 1.00 44.75 ? 296 ASN A CB    1 
ATOM   1341 C CG    . ASN A 1 185 ? -13.757 38.924 -12.649 1.00 44.58 ? 296 ASN A CG    1 
ATOM   1342 O OD1   . ASN A 1 185 ? -14.945 38.568 -12.701 1.00 42.08 ? 296 ASN A OD1   1 
ATOM   1343 N ND2   . ASN A 1 185 ? -13.201 39.412 -11.548 1.00 44.35 ? 296 ASN A ND2   1 
ATOM   1344 N N     . ASP A 1 186 ? -12.428 38.030 -16.754 1.00 48.92 ? 297 ASP A N     1 
ATOM   1345 C CA    . ASP A 1 186 ? -11.688 38.036 -18.007 1.00 48.31 ? 297 ASP A CA    1 
ATOM   1346 C C     . ASP A 1 186 ? -10.340 38.721 -17.838 1.00 48.71 ? 297 ASP A C     1 
ATOM   1347 O O     . ASP A 1 186 ? -10.232 39.749 -17.163 1.00 48.65 ? 297 ASP A O     1 
ATOM   1348 C CB    . ASP A 1 186 ? -12.504 38.730 -19.092 1.00 47.68 ? 297 ASP A CB    1 
ATOM   1349 C CG    . ASP A 1 186 ? -11.828 38.677 -20.441 1.00 47.99 ? 297 ASP A CG    1 
ATOM   1350 O OD1   . ASP A 1 186 ? -10.975 39.547 -20.708 1.00 48.09 ? 297 ASP A OD1   1 
ATOM   1351 O OD2   . ASP A 1 186 ? -12.143 37.759 -21.231 1.00 47.01 ? 297 ASP A OD2   1 
ATOM   1352 N N     . GLY A 1 187 ? -9.312  38.135 -18.449 1.00 48.76 ? 298 GLY A N     1 
ATOM   1353 C CA    . GLY A 1 187 ? -7.970  38.681 -18.345 1.00 47.47 ? 298 GLY A CA    1 
ATOM   1354 C C     . GLY A 1 187 ? -7.291  38.270 -17.048 1.00 48.18 ? 298 GLY A C     1 
ATOM   1355 O O     . GLY A 1 187 ? -6.083  38.468 -16.880 1.00 48.84 ? 298 GLY A O     1 
ATOM   1356 N N     . GLU A 1 188 ? -8.055  37.686 -16.123 1.00 46.89 ? 299 GLU A N     1 
ATOM   1357 C CA    . GLU A 1 188 ? -7.498  37.280 -14.836 1.00 45.19 ? 299 GLU A CA    1 
ATOM   1358 C C     . GLU A 1 188 ? -6.585  36.055 -14.917 1.00 43.74 ? 299 GLU A C     1 
ATOM   1359 O O     . GLU A 1 188 ? -6.919  35.046 -15.539 1.00 43.00 ? 299 GLU A O     1 
ATOM   1360 C CB    . GLU A 1 188 ? -8.617  37.028 -13.827 1.00 44.64 ? 299 GLU A CB    1 
ATOM   1361 C CG    . GLU A 1 188 ? -8.078  36.783 -12.428 1.00 48.37 ? 299 GLU A CG    1 
ATOM   1362 C CD    . GLU A 1 188 ? -9.160  36.699 -11.363 1.00 49.53 ? 299 GLU A CD    1 
ATOM   1363 O OE1   . GLU A 1 188 ? -8.796  36.528 -10.176 1.00 50.62 ? 299 GLU A OE1   1 
ATOM   1364 O OE2   . GLU A 1 188 ? -10.364 36.804 -11.703 1.00 49.66 ? 299 GLU A OE2   1 
ATOM   1365 N N     . GLN A 1 189 ? -5.423  36.156 -14.285 1.00 43.25 ? 300 GLN A N     1 
ATOM   1366 C CA    . GLN A 1 189 ? -4.458  35.067 -14.294 1.00 42.57 ? 300 GLN A CA    1 
ATOM   1367 C C     . GLN A 1 189 ? -4.855  33.976 -13.325 1.00 41.23 ? 300 GLN A C     1 
ATOM   1368 O O     . GLN A 1 189 ? -5.192  34.245 -12.177 1.00 41.79 ? 300 GLN A O     1 
ATOM   1369 C CB    . GLN A 1 189 ? -3.068  35.567 -13.921 1.00 43.24 ? 300 GLN A CB    1 
ATOM   1370 C CG    . GLN A 1 189 ? -2.058  34.446 -13.848 1.00 47.13 ? 300 GLN A CG    1 
ATOM   1371 C CD    . GLN A 1 189 ? -0.670  34.927 -13.517 1.00 48.92 ? 300 GLN A CD    1 
ATOM   1372 O OE1   . GLN A 1 189 ? -0.407  35.366 -12.402 1.00 50.64 ? 300 GLN A OE1   1 
ATOM   1373 N NE2   . GLN A 1 189 ? 0.231   34.850 -14.490 1.00 51.91 ? 300 GLN A NE2   1 
ATOM   1374 N N     . ILE A 1 190 ? -4.807  32.738 -13.794 1.00 40.21 ? 301 ILE A N     1 
ATOM   1375 C CA    . ILE A 1 190 ? -5.160  31.602 -12.965 1.00 37.86 ? 301 ILE A CA    1 
ATOM   1376 C C     . ILE A 1 190 ? -3.878  31.038 -12.363 1.00 38.60 ? 301 ILE A C     1 
ATOM   1377 O O     . ILE A 1 190 ? -3.808  30.818 -11.159 1.00 39.11 ? 301 ILE A O     1 
ATOM   1378 C CB    . ILE A 1 190 ? -5.927  30.567 -13.794 1.00 35.91 ? 301 ILE A CB    1 
ATOM   1379 C CG1   . ILE A 1 190 ? -7.241  31.200 -14.275 1.00 35.46 ? 301 ILE A CG1   1 
ATOM   1380 C CG2   . ILE A 1 190 ? -6.186  29.324 -12.986 1.00 35.45 ? 301 ILE A CG2   1 
ATOM   1381 C CD1   . ILE A 1 190 ? -8.104  30.316 -15.153 1.00 30.68 ? 301 ILE A CD1   1 
ATOM   1382 N N     . ILE A 1 191 ? -2.862  30.811 -13.194 1.00 39.93 ? 302 ILE A N     1 
ATOM   1383 C CA    . ILE A 1 191 ? -1.566  30.336 -12.705 1.00 40.44 ? 302 ILE A CA    1 
ATOM   1384 C C     . ILE A 1 191 ? -0.508  31.028 -13.539 1.00 41.64 ? 302 ILE A C     1 
ATOM   1385 O O     . ILE A 1 191 ? -0.777  31.412 -14.679 1.00 42.49 ? 302 ILE A O     1 
ATOM   1386 C CB    . ILE A 1 191 ? -1.366  28.796 -12.830 1.00 40.37 ? 302 ILE A CB    1 
ATOM   1387 C CG1   . ILE A 1 191 ? -1.447  28.359 -14.288 1.00 39.87 ? 302 ILE A CG1   1 
ATOM   1388 C CG2   . ILE A 1 191 ? -2.370  28.060 -11.955 1.00 41.29 ? 302 ILE A CG2   1 
ATOM   1389 C CD1   . ILE A 1 191 ? -1.437  26.840 -14.467 1.00 37.60 ? 302 ILE A CD1   1 
ATOM   1390 N N     . ALA A 1 192 ? 0.680   31.203 -12.965 1.00 41.86 ? 303 ALA A N     1 
ATOM   1391 C CA    . ALA A 1 192 ? 1.780   31.866 -13.655 1.00 42.56 ? 303 ALA A CA    1 
ATOM   1392 C C     . ALA A 1 192 ? 2.926   30.908 -13.868 1.00 44.37 ? 303 ALA A C     1 
ATOM   1393 O O     . ALA A 1 192 ? 3.390   30.260 -12.938 1.00 45.79 ? 303 ALA A O     1 
ATOM   1394 C CB    . ALA A 1 192 ? 2.252   33.059 -12.858 1.00 42.10 ? 303 ALA A CB    1 
ATOM   1395 N N     . GLN A 1 193 ? 3.385   30.819 -15.106 1.00 46.28 ? 304 GLN A N     1 
ATOM   1396 C CA    . GLN A 1 193 ? 4.486   29.939 -15.437 1.00 46.44 ? 304 GLN A CA    1 
ATOM   1397 C C     . GLN A 1 193 ? 5.732   30.193 -14.594 1.00 47.46 ? 304 GLN A C     1 
ATOM   1398 O O     . GLN A 1 193 ? 6.154   31.335 -14.395 1.00 46.72 ? 304 GLN A O     1 
ATOM   1399 C CB    . GLN A 1 193 ? 4.822   30.086 -16.908 1.00 46.68 ? 304 GLN A CB    1 
ATOM   1400 C CG    . GLN A 1 193 ? 6.233   29.713 -17.229 1.00 45.31 ? 304 GLN A CG    1 
ATOM   1401 C CD    . GLN A 1 193 ? 6.433   29.540 -18.695 1.00 46.36 ? 304 GLN A CD    1 
ATOM   1402 O OE1   . GLN A 1 193 ? 6.021   28.531 -19.275 1.00 47.33 ? 304 GLN A OE1   1 
ATOM   1403 N NE2   . GLN A 1 193 ? 7.051   30.530 -19.321 1.00 46.85 ? 304 GLN A NE2   1 
ATOM   1404 N N     . GLY A 1 194 ? 6.333   29.110 -14.122 1.00 48.88 ? 305 GLY A N     1 
ATOM   1405 C CA    . GLY A 1 194 ? 7.519   29.230 -13.299 1.00 51.22 ? 305 GLY A CA    1 
ATOM   1406 C C     . GLY A 1 194 ? 7.171   28.955 -11.850 1.00 52.53 ? 305 GLY A C     1 
ATOM   1407 O O     . GLY A 1 194 ? 7.802   28.116 -11.190 1.00 53.48 ? 305 GLY A O     1 
ATOM   1408 N N     . ASP A 1 195 ? 6.153   29.662 -11.363 1.00 52.06 ? 306 ASP A N     1 
ATOM   1409 C CA    . ASP A 1 195 ? 5.678   29.522 -9.992  1.00 51.94 ? 306 ASP A CA    1 
ATOM   1410 C C     . ASP A 1 195 ? 5.573   28.081 -9.532  1.00 51.43 ? 306 ASP A C     1 
ATOM   1411 O O     . ASP A 1 195 ? 5.498   27.151 -10.339 1.00 50.50 ? 306 ASP A O     1 
ATOM   1412 C CB    . ASP A 1 195 ? 4.300   30.172 -9.833  1.00 53.14 ? 306 ASP A CB    1 
ATOM   1413 C CG    . ASP A 1 195 ? 4.349   31.680 -9.950  1.00 55.75 ? 306 ASP A CG    1 
ATOM   1414 O OD1   . ASP A 1 195 ? 5.447   32.221 -10.216 1.00 57.72 ? 306 ASP A OD1   1 
ATOM   1415 O OD2   . ASP A 1 195 ? 3.290   32.323 -9.775  1.00 56.68 ? 306 ASP A OD2   1 
ATOM   1416 N N     . SER A 1 196 ? 5.558   27.912 -8.216  1.00 51.36 ? 307 SER A N     1 
ATOM   1417 C CA    . SER A 1 196 ? 5.426   26.599 -7.613  1.00 51.09 ? 307 SER A CA    1 
ATOM   1418 C C     . SER A 1 196 ? 3.949   26.275 -7.704  1.00 50.45 ? 307 SER A C     1 
ATOM   1419 O O     . SER A 1 196 ? 3.110   27.169 -7.584  1.00 50.32 ? 307 SER A O     1 
ATOM   1420 C CB    . SER A 1 196 ? 5.863   26.650 -6.154  1.00 51.83 ? 307 SER A CB    1 
ATOM   1421 O OG    . SER A 1 196 ? 5.207   27.719 -5.497  1.00 52.74 ? 307 SER A OG    1 
ATOM   1422 N N     . ALA A 1 197 ? 3.645   24.998 -7.911  1.00 49.44 ? 308 ALA A N     1 
ATOM   1423 C CA    . ALA A 1 197 ? 2.278   24.519 -8.056  1.00 48.42 ? 308 ALA A CA    1 
ATOM   1424 C C     . ALA A 1 197 ? 1.766   23.717 -6.868  1.00 49.50 ? 308 ALA A C     1 
ATOM   1425 O O     . ALA A 1 197 ? 2.452   22.831 -6.355  1.00 51.68 ? 308 ALA A O     1 
ATOM   1426 C CB    . ALA A 1 197 ? 2.181   23.674 -9.299  1.00 47.06 ? 308 ALA A CB    1 
ATOM   1427 N N     . ASP A 1 198 ? 0.548   24.014 -6.436  1.00 49.45 ? 309 ASP A N     1 
ATOM   1428 C CA    . ASP A 1 198 ? -0.044  23.281 -5.322  1.00 49.81 ? 309 ASP A CA    1 
ATOM   1429 C C     . ASP A 1 198 ? -1.521  23.021 -5.578  1.00 47.16 ? 309 ASP A C     1 
ATOM   1430 O O     . ASP A 1 198 ? -2.285  22.760 -4.647  1.00 47.55 ? 309 ASP A O     1 
ATOM   1431 C CB    . ASP A 1 198 ? 0.135   24.058 -4.015  1.00 52.17 ? 309 ASP A CB    1 
ATOM   1432 C CG    . ASP A 1 198 ? -0.048  25.553 -4.198  1.00 57.73 ? 309 ASP A CG    1 
ATOM   1433 O OD1   . ASP A 1 198 ? -1.170  25.994 -4.557  1.00 56.80 ? 309 ASP A OD1   1 
ATOM   1434 O OD2   . ASP A 1 198 ? 0.947   26.288 -3.988  1.00 60.75 ? 309 ASP A OD2   1 
ATOM   1435 N N     . SER A 1 199 ? -1.918  23.072 -6.845  1.00 43.66 ? 310 SER A N     1 
ATOM   1436 C CA    . SER A 1 199 ? -3.313  22.860 -7.170  1.00 40.56 ? 310 SER A CA    1 
ATOM   1437 C C     . SER A 1 199 ? -3.568  22.392 -8.606  1.00 38.41 ? 310 SER A C     1 
ATOM   1438 O O     . SER A 1 199 ? -2.847  22.754 -9.538  1.00 36.32 ? 310 SER A O     1 
ATOM   1439 C CB    . SER A 1 199 ? -4.085  24.148 -6.887  1.00 40.63 ? 310 SER A CB    1 
ATOM   1440 O OG    . SER A 1 199 ? -5.430  23.872 -6.570  1.00 39.87 ? 310 SER A OG    1 
ATOM   1441 N N     . PHE A 1 200 ? -4.615  21.580 -8.748  1.00 35.76 ? 311 PHE A N     1 
ATOM   1442 C CA    . PHE A 1 200 ? -5.058  21.001 -10.010 1.00 32.30 ? 311 PHE A CA    1 
ATOM   1443 C C     . PHE A 1 200 ? -6.400  21.651 -10.382 1.00 33.91 ? 311 PHE A C     1 
ATOM   1444 O O     . PHE A 1 200 ? -7.286  21.783 -9.534  1.00 32.94 ? 311 PHE A O     1 
ATOM   1445 C CB    . PHE A 1 200 ? -5.223  19.495 -9.807  1.00 29.25 ? 311 PHE A CB    1 
ATOM   1446 C CG    . PHE A 1 200 ? -5.867  18.772 -10.960 1.00 24.72 ? 311 PHE A CG    1 
ATOM   1447 C CD1   . PHE A 1 200 ? -5.311  18.816 -12.227 1.00 22.64 ? 311 PHE A CD1   1 
ATOM   1448 C CD2   . PHE A 1 200 ? -7.024  18.023 -10.757 1.00 22.98 ? 311 PHE A CD2   1 
ATOM   1449 C CE1   . PHE A 1 200 ? -5.896  18.125 -13.285 1.00 25.86 ? 311 PHE A CE1   1 
ATOM   1450 C CE2   . PHE A 1 200 ? -7.623  17.326 -11.803 1.00 23.61 ? 311 PHE A CE2   1 
ATOM   1451 C CZ    . PHE A 1 200 ? -7.059  17.374 -13.073 1.00 25.99 ? 311 PHE A CZ    1 
ATOM   1452 N N     . PHE A 1 201 ? -6.554  22.043 -11.647 1.00 34.30 ? 312 PHE A N     1 
ATOM   1453 C CA    . PHE A 1 201 ? -7.784  22.690 -12.098 1.00 35.50 ? 312 PHE A CA    1 
ATOM   1454 C C     . PHE A 1 201 ? -8.604  21.905 -13.142 1.00 36.61 ? 312 PHE A C     1 
ATOM   1455 O O     . PHE A 1 201 ? -8.039  21.162 -13.952 1.00 36.32 ? 312 PHE A O     1 
ATOM   1456 C CB    . PHE A 1 201 ? -7.444  24.059 -12.682 1.00 36.15 ? 312 PHE A CB    1 
ATOM   1457 C CG    . PHE A 1 201 ? -6.672  24.950 -11.748 1.00 35.39 ? 312 PHE A CG    1 
ATOM   1458 C CD1   . PHE A 1 201 ? -5.323  24.712 -11.490 1.00 34.56 ? 312 PHE A CD1   1 
ATOM   1459 C CD2   . PHE A 1 201 ? -7.295  26.028 -11.124 1.00 32.49 ? 312 PHE A CD2   1 
ATOM   1460 C CE1   . PHE A 1 201 ? -4.605  25.536 -10.623 1.00 32.89 ? 312 PHE A CE1   1 
ATOM   1461 C CE2   . PHE A 1 201 ? -6.582  26.856 -10.256 1.00 34.14 ? 312 PHE A CE2   1 
ATOM   1462 C CZ    . PHE A 1 201 ? -5.236  26.611 -10.005 1.00 31.21 ? 312 PHE A CZ    1 
ATOM   1463 N N     . ILE A 1 202 ? -9.930  22.093 -13.113 1.00 37.09 ? 313 ILE A N     1 
ATOM   1464 C CA    . ILE A 1 202 ? -10.872 21.460 -14.062 1.00 38.32 ? 313 ILE A CA    1 
ATOM   1465 C C     . ILE A 1 202 ? -11.923 22.498 -14.476 1.00 39.76 ? 313 ILE A C     1 
ATOM   1466 O O     . ILE A 1 202 ? -12.839 22.799 -13.705 1.00 38.39 ? 313 ILE A O     1 
ATOM   1467 C CB    . ILE A 1 202 ? -11.683 20.301 -13.445 1.00 37.67 ? 313 ILE A CB    1 
ATOM   1468 C CG1   . ILE A 1 202 ? -10.769 19.167 -12.990 1.00 37.28 ? 313 ILE A CG1   1 
ATOM   1469 C CG2   . ILE A 1 202 ? -12.720 19.818 -14.456 1.00 36.85 ? 313 ILE A CG2   1 
ATOM   1470 C CD1   . ILE A 1 202 ? -11.516 18.098 -12.208 1.00 33.80 ? 313 ILE A CD1   1 
ATOM   1471 N N     . VAL A 1 203 ? -11.804 23.032 -15.688 1.00 40.05 ? 314 VAL A N     1 
ATOM   1472 C CA    . VAL A 1 203 ? -12.745 24.042 -16.157 1.00 38.62 ? 314 VAL A CA    1 
ATOM   1473 C C     . VAL A 1 203 ? -14.189 23.561 -16.092 1.00 38.80 ? 314 VAL A C     1 
ATOM   1474 O O     . VAL A 1 203 ? -14.529 22.482 -16.584 1.00 38.83 ? 314 VAL A O     1 
ATOM   1475 C CB    . VAL A 1 203 ? -12.425 24.461 -17.600 1.00 38.82 ? 314 VAL A CB    1 
ATOM   1476 C CG1   . VAL A 1 203 ? -13.340 25.604 -18.026 1.00 36.44 ? 314 VAL A CG1   1 
ATOM   1477 C CG2   . VAL A 1 203 ? -10.964 24.860 -17.705 1.00 36.21 ? 314 VAL A CG2   1 
ATOM   1478 N N     . GLU A 1 204 ? -15.044 24.365 -15.477 1.00 38.95 ? 315 GLU A N     1 
ATOM   1479 C CA    . GLU A 1 204 ? -16.447 24.004 -15.379 1.00 40.04 ? 315 GLU A CA    1 
ATOM   1480 C C     . GLU A 1 204 ? -17.261 24.901 -16.323 1.00 38.99 ? 315 GLU A C     1 
ATOM   1481 O O     . GLU A 1 204 ? -18.247 24.467 -16.915 1.00 38.06 ? 315 GLU A O     1 
ATOM   1482 C CB    . GLU A 1 204 ? -16.911 24.143 -13.934 1.00 41.46 ? 315 GLU A CB    1 
ATOM   1483 C CG    . GLU A 1 204 ? -18.280 23.548 -13.657 1.00 45.87 ? 315 GLU A CG    1 
ATOM   1484 C CD    . GLU A 1 204 ? -19.374 24.590 -13.698 1.00 48.27 ? 315 GLU A CD    1 
ATOM   1485 O OE1   . GLU A 1 204 ? -19.101 25.734 -13.261 1.00 50.34 ? 315 GLU A OE1   1 
ATOM   1486 O OE2   . GLU A 1 204 ? -20.498 24.265 -14.147 1.00 47.52 ? 315 GLU A OE2   1 
ATOM   1487 N N     . SER A 1 205 ? -16.831 26.148 -16.477 1.00 38.07 ? 316 SER A N     1 
ATOM   1488 C CA    . SER A 1 205 ? -17.508 27.076 -17.375 1.00 38.51 ? 316 SER A CA    1 
ATOM   1489 C C     . SER A 1 205 ? -16.548 28.174 -17.797 1.00 36.27 ? 316 SER A C     1 
ATOM   1490 O O     . SER A 1 205 ? -15.708 28.612 -17.018 1.00 36.73 ? 316 SER A O     1 
ATOM   1491 C CB    . SER A 1 205 ? -18.736 27.698 -16.704 1.00 41.07 ? 316 SER A CB    1 
ATOM   1492 O OG    . SER A 1 205 ? -18.359 28.624 -15.694 1.00 45.79 ? 316 SER A OG    1 
ATOM   1493 N N     . GLY A 1 206 ? -16.680 28.621 -19.036 1.00 34.87 ? 317 GLY A N     1 
ATOM   1494 C CA    . GLY A 1 206 ? -15.799 29.655 -19.527 1.00 34.05 ? 317 GLY A CA    1 
ATOM   1495 C C     . GLY A 1 206 ? -14.695 29.013 -20.345 1.00 34.90 ? 317 GLY A C     1 
ATOM   1496 O O     . GLY A 1 206 ? -14.796 27.846 -20.753 1.00 32.69 ? 317 GLY A O     1 
ATOM   1497 N N     . GLU A 1 207 ? -13.631 29.774 -20.574 1.00 34.60 ? 318 GLU A N     1 
ATOM   1498 C CA    . GLU A 1 207 ? -12.508 29.295 -21.359 1.00 34.84 ? 318 GLU A CA    1 
ATOM   1499 C C     . GLU A 1 207 ? -11.200 29.747 -20.738 1.00 36.06 ? 318 GLU A C     1 
ATOM   1500 O O     . GLU A 1 207 ? -11.080 30.881 -20.238 1.00 34.31 ? 318 GLU A O     1 
ATOM   1501 C CB    . GLU A 1 207 ? -12.604 29.820 -22.783 1.00 32.71 ? 318 GLU A CB    1 
ATOM   1502 N N     . VAL A 1 208 ? -10.222 28.843 -20.774 1.00 37.00 ? 319 VAL A N     1 
ATOM   1503 C CA    . VAL A 1 208 ? -8.907  29.123 -20.228 1.00 36.00 ? 319 VAL A CA    1 
ATOM   1504 C C     . VAL A 1 208 ? -7.849  29.082 -21.329 1.00 36.93 ? 319 VAL A C     1 
ATOM   1505 O O     . VAL A 1 208 ? -7.733  28.104 -22.079 1.00 34.72 ? 319 VAL A O     1 
ATOM   1506 C CB    . VAL A 1 208 ? -8.532  28.117 -19.136 1.00 34.54 ? 319 VAL A CB    1 
ATOM   1507 C CG1   . VAL A 1 208 ? -7.263  28.575 -18.441 1.00 31.55 ? 319 VAL A CG1   1 
ATOM   1508 C CG2   . VAL A 1 208 ? -9.679  27.981 -18.141 1.00 31.12 ? 319 VAL A CG2   1 
ATOM   1509 N N     . ARG A 1 209 ? -7.100  30.171 -21.427 1.00 37.64 ? 320 ARG A N     1 
ATOM   1510 C CA    . ARG A 1 209 ? -6.042  30.296 -22.411 1.00 39.89 ? 320 ARG A CA    1 
ATOM   1511 C C     . ARG A 1 209 ? -4.717  29.960 -21.729 1.00 39.90 ? 320 ARG A C     1 
ATOM   1512 O O     . ARG A 1 209 ? -4.369  30.528 -20.686 1.00 39.57 ? 320 ARG A O     1 
ATOM   1513 C CB    . ARG A 1 209 ? -6.028  31.721 -22.970 1.00 41.56 ? 320 ARG A CB    1 
ATOM   1514 C CG    . ARG A 1 209 ? -4.874  32.029 -23.892 1.00 48.28 ? 320 ARG A CG    1 
ATOM   1515 C CD    . ARG A 1 209 ? -5.082  33.352 -24.639 1.00 51.57 ? 320 ARG A CD    1 
ATOM   1516 N NE    . ARG A 1 209 ? -5.648  34.404 -23.794 1.00 56.21 ? 320 ARG A NE    1 
ATOM   1517 C CZ    . ARG A 1 209 ? -5.127  34.820 -22.641 1.00 58.90 ? 320 ARG A CZ    1 
ATOM   1518 N NH1   . ARG A 1 209 ? -4.011  34.274 -22.171 1.00 60.71 ? 320 ARG A NH1   1 
ATOM   1519 N NH2   . ARG A 1 209 ? -5.725  35.790 -21.954 1.00 59.40 ? 320 ARG A NH2   1 
ATOM   1520 N N     . ILE A 1 210 ? -3.999  29.009 -22.314 1.00 39.54 ? 321 ILE A N     1 
ATOM   1521 C CA    . ILE A 1 210 ? -2.716  28.562 -21.804 1.00 38.07 ? 321 ILE A CA    1 
ATOM   1522 C C     . ILE A 1 210 ? -1.652  29.159 -22.713 1.00 38.50 ? 321 ILE A C     1 
ATOM   1523 O O     . ILE A 1 210 ? -1.705  28.975 -23.921 1.00 38.31 ? 321 ILE A O     1 
ATOM   1524 C CB    . ILE A 1 210 ? -2.624  27.039 -21.875 1.00 38.47 ? 321 ILE A CB    1 
ATOM   1525 C CG1   . ILE A 1 210 ? -3.843  26.420 -21.180 1.00 37.66 ? 321 ILE A CG1   1 
ATOM   1526 C CG2   . ILE A 1 210 ? -1.301  26.558 -21.271 1.00 38.69 ? 321 ILE A CG2   1 
ATOM   1527 C CD1   . ILE A 1 210 ? -3.877  26.605 -19.688 1.00 36.32 ? 321 ILE A CD1   1 
ATOM   1528 N N     . THR A 1 211 ? -0.689  29.873 -22.143 1.00 40.52 ? 322 THR A N     1 
ATOM   1529 C CA    . THR A 1 211 ? 0.368   30.490 -22.947 1.00 42.40 ? 322 THR A CA    1 
ATOM   1530 C C     . THR A 1 211 ? 1.755   30.197 -22.386 1.00 43.87 ? 322 THR A C     1 
ATOM   1531 O O     . THR A 1 211 ? 1.889   29.770 -21.244 1.00 45.53 ? 322 THR A O     1 
ATOM   1532 C CB    . THR A 1 211 ? 0.204   32.015 -23.000 1.00 40.23 ? 322 THR A CB    1 
ATOM   1533 O OG1   . THR A 1 211 ? 0.295   32.539 -21.671 1.00 40.95 ? 322 THR A OG1   1 
ATOM   1534 C CG2   . THR A 1 211 ? -1.135  32.392 -23.589 1.00 39.20 ? 322 THR A CG2   1 
ATOM   1535 N N     . MET A 1 212 ? 2.782   30.438 -23.195 1.00 46.87 ? 323 MET A N     1 
ATOM   1536 C CA    . MET A 1 212 ? 4.167   30.216 -22.784 1.00 50.59 ? 323 MET A CA    1 
ATOM   1537 C C     . MET A 1 212 ? 5.063   31.392 -23.120 1.00 51.91 ? 323 MET A C     1 
ATOM   1538 O O     . MET A 1 212 ? 4.904   32.021 -24.162 1.00 52.36 ? 323 MET A O     1 
ATOM   1539 C CB    . MET A 1 212 ? 4.744   28.973 -23.454 1.00 51.06 ? 323 MET A CB    1 
ATOM   1540 C CG    . MET A 1 212 ? 4.300   27.675 -22.834 1.00 53.57 ? 323 MET A CG    1 
ATOM   1541 S SD    . MET A 1 212 ? 5.162   26.296 -23.587 1.00 54.59 ? 323 MET A SD    1 
ATOM   1542 C CE    . MET A 1 212 ? 6.712   26.399 -22.759 1.00 51.81 ? 323 MET A CE    1 
ATOM   1543 N N     . LYS A 1 213 ? 6.012   31.676 -22.232 1.00 54.36 ? 324 LYS A N     1 
ATOM   1544 C CA    . LYS A 1 213 ? 6.960   32.768 -22.430 1.00 56.66 ? 324 LYS A CA    1 
ATOM   1545 C C     . LYS A 1 213 ? 8.404   32.258 -22.374 1.00 58.77 ? 324 LYS A C     1 
ATOM   1546 O O     . LYS A 1 213 ? 8.659   31.053 -22.483 1.00 57.89 ? 324 LYS A O     1 
ATOM   1547 C CB    . LYS A 1 213 ? 6.745   33.844 -21.375 1.00 55.65 ? 324 LYS A CB    1 
ATOM   1548 N N     . ARG A 1 214 ? 9.337   33.195 -22.206 1.00 61.95 ? 325 ARG A N     1 
ATOM   1549 C CA    . ARG A 1 214 ? 10.772  32.910 -22.133 1.00 62.97 ? 325 ARG A CA    1 
ATOM   1550 C C     . ARG A 1 214 ? 11.407  33.821 -21.068 1.00 64.63 ? 325 ARG A C     1 
ATOM   1551 O O     . ARG A 1 214 ? 10.898  34.910 -20.806 1.00 63.95 ? 325 ARG A O     1 
ATOM   1552 C CB    . ARG A 1 214 ? 11.418  33.144 -23.509 1.00 62.96 ? 325 ARG A CB    1 
ATOM   1553 C CG    . ARG A 1 214 ? 10.784  32.326 -24.636 1.00 63.64 ? 325 ARG A CG    1 
ATOM   1554 C CD    . ARG A 1 214 ? 11.819  31.901 -25.667 1.00 66.83 ? 325 ARG A CD    1 
ATOM   1555 N NE    . ARG A 1 214 ? 12.991  31.289 -25.036 1.00 70.85 ? 325 ARG A NE    1 
ATOM   1556 C CZ    . ARG A 1 214 ? 12.980  30.157 -24.327 1.00 72.14 ? 325 ARG A CZ    1 
ATOM   1557 N NH1   . ARG A 1 214 ? 11.854  29.476 -24.144 1.00 71.91 ? 325 ARG A NH1   1 
ATOM   1558 N NH2   . ARG A 1 214 ? 14.105  29.710 -23.780 1.00 72.81 ? 325 ARG A NH2   1 
ATOM   1559 N N     . LYS A 1 215 ? 12.517  33.370 -20.475 1.00 67.42 ? 326 LYS A N     1 
ATOM   1560 C CA    . LYS A 1 215 ? 13.253  34.075 -19.404 1.00 69.75 ? 326 LYS A CA    1 
ATOM   1561 C C     . LYS A 1 215 ? 13.405  35.620 -19.393 1.00 71.33 ? 326 LYS A C     1 
ATOM   1562 O O     . LYS A 1 215 ? 14.501  36.158 -19.616 1.00 71.37 ? 326 LYS A O     1 
ATOM   1563 C CB    . LYS A 1 215 ? 14.626  33.439 -19.259 1.00 69.96 ? 326 LYS A CB    1 
ATOM   1564 N N     . GLY A 1 216 ? 12.315  36.322 -19.083 1.00 71.93 ? 327 GLY A N     1 
ATOM   1565 C CA    . GLY A 1 216 ? 12.314  37.786 -19.016 1.00 72.46 ? 327 GLY A CA    1 
ATOM   1566 C C     . GLY A 1 216 ? 11.121  38.248 -18.174 1.00 72.72 ? 327 GLY A C     1 
ATOM   1567 O O     . GLY A 1 216 ? 10.585  37.474 -17.371 1.00 73.22 ? 327 GLY A O     1 
ATOM   1568 N N     . LYS A 1 217 ? 10.709  39.502 -18.344 1.00 72.88 ? 328 LYS A N     1 
ATOM   1569 C CA    . LYS A 1 217 ? 9.569   40.027 -17.589 1.00 72.51 ? 328 LYS A CA    1 
ATOM   1570 C C     . LYS A 1 217 ? 8.480   40.527 -18.532 1.00 71.68 ? 328 LYS A C     1 
ATOM   1571 O O     . LYS A 1 217 ? 8.761   40.881 -19.677 1.00 71.54 ? 328 LYS A O     1 
ATOM   1572 C CB    . LYS A 1 217 ? 10.021  41.156 -16.657 1.00 71.69 ? 328 LYS A CB    1 
ATOM   1573 N N     . ALA A 1 225 ? 4.870   36.062 -25.767 1.00 51.64 ? 336 ALA A N     1 
ATOM   1574 C CA    . ALA A 1 225 ? 3.992   35.021 -25.230 1.00 51.95 ? 336 ALA A CA    1 
ATOM   1575 C C     . ALA A 1 225 ? 3.290   34.241 -26.338 1.00 51.98 ? 336 ALA A C     1 
ATOM   1576 O O     . ALA A 1 225 ? 2.485   34.802 -27.094 1.00 52.70 ? 336 ALA A O     1 
ATOM   1577 C CB    . ALA A 1 225 ? 2.953   35.635 -24.299 1.00 51.63 ? 336 ALA A CB    1 
ATOM   1578 N N     . VAL A 1 226 ? 3.598   32.946 -26.406 1.00 49.86 ? 337 VAL A N     1 
ATOM   1579 C CA    . VAL A 1 226 ? 3.033   32.024 -27.387 1.00 46.41 ? 337 VAL A CA    1 
ATOM   1580 C C     . VAL A 1 226 ? 1.855   31.210 -26.828 1.00 45.71 ? 337 VAL A C     1 
ATOM   1581 O O     . VAL A 1 226 ? 2.007   30.510 -25.828 1.00 45.09 ? 337 VAL A O     1 
ATOM   1582 C CB    . VAL A 1 226 ? 4.118   31.054 -27.847 1.00 45.29 ? 337 VAL A CB    1 
ATOM   1583 C CG1   . VAL A 1 226 ? 3.555   30.038 -28.827 1.00 41.66 ? 337 VAL A CG1   1 
ATOM   1584 C CG2   . VAL A 1 226 ? 5.248   31.850 -28.459 1.00 46.92 ? 337 VAL A CG2   1 
ATOM   1585 N N     . GLU A 1 227 ? 0.691   31.295 -27.468 1.00 43.32 ? 338 GLU A N     1 
ATOM   1586 C CA    . GLU A 1 227 ? -0.460  30.536 -26.992 1.00 43.76 ? 338 GLU A CA    1 
ATOM   1587 C C     . GLU A 1 227 ? -0.324  29.073 -27.380 1.00 42.67 ? 338 GLU A C     1 
ATOM   1588 O O     . GLU A 1 227 ? -0.090  28.760 -28.547 1.00 41.89 ? 338 GLU A O     1 
ATOM   1589 C CB    . GLU A 1 227 ? -1.767  31.062 -27.571 1.00 45.03 ? 338 GLU A CB    1 
ATOM   1590 C CG    . GLU A 1 227 ? -2.954  30.250 -27.066 1.00 48.00 ? 338 GLU A CG    1 
ATOM   1591 C CD    . GLU A 1 227 ? -4.219  30.513 -27.839 1.00 50.02 ? 338 GLU A CD    1 
ATOM   1592 O OE1   . GLU A 1 227 ? -4.651  31.689 -27.883 1.00 50.65 ? 338 GLU A OE1   1 
ATOM   1593 O OE2   . GLU A 1 227 ? -4.775  29.539 -28.401 1.00 50.86 ? 338 GLU A OE2   1 
ATOM   1594 N N     . ILE A 1 228 ? -0.498  28.171 -26.421 1.00 41.20 ? 339 ILE A N     1 
ATOM   1595 C CA    . ILE A 1 228 ? -0.337  26.763 -26.739 1.00 42.50 ? 339 ILE A CA    1 
ATOM   1596 C C     . ILE A 1 228 ? -1.547  25.851 -26.537 1.00 43.28 ? 339 ILE A C     1 
ATOM   1597 O O     . ILE A 1 228 ? -1.512  24.679 -26.925 1.00 44.79 ? 339 ILE A O     1 
ATOM   1598 C CB    . ILE A 1 228 ? 0.891   26.180 -25.992 1.00 42.04 ? 339 ILE A CB    1 
ATOM   1599 C CG1   . ILE A 1 228 ? 0.667   26.211 -24.480 1.00 40.24 ? 339 ILE A CG1   1 
ATOM   1600 C CG2   . ILE A 1 228 ? 2.137   26.994 -26.352 1.00 40.96 ? 339 ILE A CG2   1 
ATOM   1601 C CD1   . ILE A 1 228 ? 1.847   25.697 -23.684 1.00 37.71 ? 339 ILE A CD1   1 
ATOM   1602 N N     . ALA A 1 229 ? -2.614  26.378 -25.946 1.00 43.53 ? 340 ALA A N     1 
ATOM   1603 C CA    . ALA A 1 229 ? -3.825  25.586 -25.735 1.00 43.68 ? 340 ALA A CA    1 
ATOM   1604 C C     . ALA A 1 229 ? -5.009  26.426 -25.262 1.00 44.27 ? 340 ALA A C     1 
ATOM   1605 O O     . ALA A 1 229 ? -4.860  27.588 -24.902 1.00 44.02 ? 340 ALA A O     1 
ATOM   1606 C CB    . ALA A 1 229 ? -3.550  24.477 -24.734 1.00 40.46 ? 340 ALA A CB    1 
ATOM   1607 N N     . ARG A 1 230 ? -6.192  25.825 -25.306 1.00 46.94 ? 341 ARG A N     1 
ATOM   1608 C CA    . ARG A 1 230 ? -7.434  26.448 -24.837 1.00 48.98 ? 341 ARG A CA    1 
ATOM   1609 C C     . ARG A 1 230 ? -8.175  25.329 -24.129 1.00 48.91 ? 341 ARG A C     1 
ATOM   1610 O O     . ARG A 1 230 ? -8.331  24.239 -24.683 1.00 49.77 ? 341 ARG A O     1 
ATOM   1611 C CB    . ARG A 1 230 ? -8.304  26.952 -25.992 1.00 50.28 ? 341 ARG A CB    1 
ATOM   1612 C CG    . ARG A 1 230 ? -7.793  28.202 -26.688 1.00 53.26 ? 341 ARG A CG    1 
ATOM   1613 C CD    . ARG A 1 230 ? -7.800  29.411 -25.767 1.00 56.02 ? 341 ARG A CD    1 
ATOM   1614 N NE    . ARG A 1 230 ? -7.429  30.623 -26.494 1.00 59.64 ? 341 ARG A NE    1 
ATOM   1615 C CZ    . ARG A 1 230 ? -8.161  31.164 -27.462 1.00 60.62 ? 341 ARG A CZ    1 
ATOM   1616 N NH1   . ARG A 1 230 ? -7.744  32.262 -28.080 1.00 61.74 ? 341 ARG A NH1   1 
ATOM   1617 N NH2   . ARG A 1 230 ? -9.322  30.618 -27.801 1.00 61.01 ? 341 ARG A NH2   1 
ATOM   1618 N N     . CYS A 1 231 ? -8.615  25.583 -22.905 1.00 48.02 ? 342 CYS A N     1 
ATOM   1619 C CA    . CYS A 1 231 ? -9.334  24.569 -22.154 1.00 47.03 ? 342 CYS A CA    1 
ATOM   1620 C C     . CYS A 1 231 ? -10.798 24.946 -21.967 1.00 45.92 ? 342 CYS A C     1 
ATOM   1621 O O     . CYS A 1 231 ? -11.125 26.047 -21.521 1.00 46.82 ? 342 CYS A O     1 
ATOM   1622 C CB    . CYS A 1 231 ? -8.654  24.355 -20.801 1.00 48.14 ? 342 CYS A CB    1 
ATOM   1623 S SG    . CYS A 1 231 ? -6.921  23.877 -20.950 1.00 46.37 ? 342 CYS A SG    1 
ATOM   1624 N N     . LEU A 1 232 ? -11.673 24.019 -22.320 1.00 45.06 ? 343 LEU A N     1 
ATOM   1625 C CA    . LEU A 1 232 ? -13.108 24.229 -22.212 1.00 44.85 ? 343 LEU A CA    1 
ATOM   1626 C C     . LEU A 1 232 ? -13.694 23.370 -21.091 1.00 44.34 ? 343 LEU A C     1 
ATOM   1627 O O     . LEU A 1 232 ? -13.004 22.528 -20.521 1.00 44.65 ? 343 LEU A O     1 
ATOM   1628 C CB    . LEU A 1 232 ? -13.771 23.891 -23.554 1.00 44.51 ? 343 LEU A CB    1 
ATOM   1629 C CG    . LEU A 1 232 ? -13.863 24.967 -24.653 1.00 45.37 ? 343 LEU A CG    1 
ATOM   1630 C CD1   . LEU A 1 232 ? -12.765 26.016 -24.524 1.00 45.13 ? 343 LEU A CD1   1 
ATOM   1631 C CD2   . LEU A 1 232 ? -13.800 24.282 -26.010 1.00 44.53 ? 343 LEU A CD2   1 
ATOM   1632 N N     . ARG A 1 233 ? -14.960 23.607 -20.766 1.00 44.23 ? 344 ARG A N     1 
ATOM   1633 C CA    . ARG A 1 233 ? -15.639 22.850 -19.725 1.00 43.87 ? 344 ARG A CA    1 
ATOM   1634 C C     . ARG A 1 233 ? -15.295 21.377 -19.895 1.00 42.88 ? 344 ARG A C     1 
ATOM   1635 O O     . ARG A 1 233 ? -15.405 20.835 -20.984 1.00 42.59 ? 344 ARG A O     1 
ATOM   1636 C CB    . ARG A 1 233 ? -17.153 23.063 -19.840 1.00 44.60 ? 344 ARG A CB    1 
ATOM   1637 C CG    . ARG A 1 233 ? -18.051 22.211 -18.905 1.00 45.80 ? 344 ARG A CG    1 
ATOM   1638 C CD    . ARG A 1 233 ? -19.526 22.640 -19.089 1.00 46.13 ? 344 ARG A CD    1 
ATOM   1639 N NE    . ARG A 1 233 ? -20.511 21.806 -18.399 1.00 48.16 ? 344 ARG A NE    1 
ATOM   1640 C CZ    . ARG A 1 233 ? -20.747 21.835 -17.087 1.00 49.13 ? 344 ARG A CZ    1 
ATOM   1641 N NH1   . ARG A 1 233 ? -20.071 22.652 -16.293 1.00 49.71 ? 344 ARG A NH1   1 
ATOM   1642 N NH2   . ARG A 1 233 ? -21.682 21.056 -16.567 1.00 50.93 ? 344 ARG A NH2   1 
ATOM   1643 N N     . GLY A 1 234 ? -14.848 20.740 -18.822 1.00 42.68 ? 345 GLY A N     1 
ATOM   1644 C CA    . GLY A 1 234 ? -14.521 19.331 -18.903 1.00 42.72 ? 345 GLY A CA    1 
ATOM   1645 C C     . GLY A 1 234 ? -13.046 19.025 -19.048 1.00 42.80 ? 345 GLY A C     1 
ATOM   1646 O O     . GLY A 1 234 ? -12.631 17.883 -18.832 1.00 42.83 ? 345 GLY A O     1 
ATOM   1647 N N     . GLN A 1 235 ? -12.254 20.034 -19.411 1.00 42.49 ? 346 GLN A N     1 
ATOM   1648 C CA    . GLN A 1 235 ? -10.810 19.857 -19.588 1.00 42.89 ? 346 GLN A CA    1 
ATOM   1649 C C     . GLN A 1 235 ? -10.007 20.340 -18.391 1.00 42.78 ? 346 GLN A C     1 
ATOM   1650 O O     . GLN A 1 235 ? -10.280 21.400 -17.822 1.00 42.56 ? 346 GLN A O     1 
ATOM   1651 C CB    . GLN A 1 235 ? -10.329 20.598 -20.829 1.00 42.21 ? 346 GLN A CB    1 
ATOM   1652 C CG    . GLN A 1 235 ? -10.983 20.126 -22.100 1.00 44.78 ? 346 GLN A CG    1 
ATOM   1653 C CD    . GLN A 1 235 ? -10.422 20.811 -23.316 1.00 44.98 ? 346 GLN A CD    1 
ATOM   1654 O OE1   . GLN A 1 235 ? -10.530 22.024 -23.466 1.00 47.50 ? 346 GLN A OE1   1 
ATOM   1655 N NE2   . GLN A 1 235 ? -9.809  20.037 -24.191 1.00 47.93 ? 346 GLN A NE2   1 
ATOM   1656 N N     . TYR A 1 236 ? -8.996  19.560 -18.030 1.00 42.50 ? 347 TYR A N     1 
ATOM   1657 C CA    . TYR A 1 236 ? -8.146  19.879 -16.895 1.00 41.59 ? 347 TYR A CA    1 
ATOM   1658 C C     . TYR A 1 236 ? -6.809  20.506 -17.287 1.00 40.52 ? 347 TYR A C     1 
ATOM   1659 O O     . TYR A 1 236 ? -6.355  20.375 -18.421 1.00 39.67 ? 347 TYR A O     1 
ATOM   1660 C CB    . TYR A 1 236 ? -7.888  18.605 -16.089 1.00 43.05 ? 347 TYR A CB    1 
ATOM   1661 C CG    . TYR A 1 236 ? -7.054  17.559 -16.807 1.00 42.83 ? 347 TYR A CG    1 
ATOM   1662 C CD1   . TYR A 1 236 ? -5.698  17.773 -17.064 1.00 44.53 ? 347 TYR A CD1   1 
ATOM   1663 C CD2   . TYR A 1 236 ? -7.613  16.352 -17.209 1.00 42.65 ? 347 TYR A CD2   1 
ATOM   1664 C CE1   . TYR A 1 236 ? -4.921  16.814 -17.703 1.00 45.27 ? 347 TYR A CE1   1 
ATOM   1665 C CE2   . TYR A 1 236 ? -6.842  15.383 -17.848 1.00 44.56 ? 347 TYR A CE2   1 
ATOM   1666 C CZ    . TYR A 1 236 ? -5.497  15.620 -18.091 1.00 44.90 ? 347 TYR A CZ    1 
ATOM   1667 O OH    . TYR A 1 236 ? -4.721  14.668 -18.720 1.00 46.35 ? 347 TYR A OH    1 
ATOM   1668 N N     . PHE A 1 237 ? -6.184  21.188 -16.333 1.00 39.89 ? 348 PHE A N     1 
ATOM   1669 C CA    . PHE A 1 237 ? -4.880  21.795 -16.550 1.00 39.55 ? 348 PHE A CA    1 
ATOM   1670 C C     . PHE A 1 237 ? -4.178  22.038 -15.213 1.00 39.70 ? 348 PHE A C     1 
ATOM   1671 O O     . PHE A 1 237 ? -4.806  21.993 -14.159 1.00 39.72 ? 348 PHE A O     1 
ATOM   1672 C CB    . PHE A 1 237 ? -4.996  23.095 -17.352 1.00 39.09 ? 348 PHE A CB    1 
ATOM   1673 C CG    . PHE A 1 237 ? -5.718  24.195 -16.639 1.00 38.93 ? 348 PHE A CG    1 
ATOM   1674 C CD1   . PHE A 1 237 ? -7.105  24.277 -16.682 1.00 36.67 ? 348 PHE A CD1   1 
ATOM   1675 C CD2   . PHE A 1 237 ? -5.005  25.153 -15.911 1.00 38.32 ? 348 PHE A CD2   1 
ATOM   1676 C CE1   . PHE A 1 237 ? -7.781  25.297 -16.008 1.00 36.79 ? 348 PHE A CE1   1 
ATOM   1677 C CE2   . PHE A 1 237 ? -5.674  26.182 -15.231 1.00 39.21 ? 348 PHE A CE2   1 
ATOM   1678 C CZ    . PHE A 1 237 ? -7.072  26.250 -15.282 1.00 36.15 ? 348 PHE A CZ    1 
ATOM   1679 N N     . GLY A 1 238 ? -2.875  22.283 -15.258 1.00 40.73 ? 349 GLY A N     1 
ATOM   1680 C CA    . GLY A 1 238 ? -2.126  22.494 -14.034 1.00 43.06 ? 349 GLY A CA    1 
ATOM   1681 C C     . GLY A 1 238 ? -1.718  21.178 -13.377 1.00 45.26 ? 349 GLY A C     1 
ATOM   1682 O O     . GLY A 1 238 ? -1.180  21.174 -12.275 1.00 46.25 ? 349 GLY A O     1 
ATOM   1683 N N     . GLU A 1 239 ? -1.964  20.057 -14.048 1.00 46.76 ? 350 GLU A N     1 
ATOM   1684 C CA    . GLU A 1 239 ? -1.615  18.753 -13.497 1.00 49.36 ? 350 GLU A CA    1 
ATOM   1685 C C     . GLU A 1 239 ? -0.204  18.311 -13.862 1.00 50.91 ? 350 GLU A C     1 
ATOM   1686 O O     . GLU A 1 239 ? 0.359   17.417 -13.230 1.00 51.26 ? 350 GLU A O     1 
ATOM   1687 C CB    . GLU A 1 239 ? -2.595  17.694 -13.984 1.00 49.46 ? 350 GLU A CB    1 
ATOM   1688 C CG    . GLU A 1 239 ? -2.274  17.112 -15.351 1.00 53.30 ? 350 GLU A CG    1 
ATOM   1689 C CD    . GLU A 1 239 ? -2.183  18.157 -16.457 1.00 54.33 ? 350 GLU A CD    1 
ATOM   1690 O OE1   . GLU A 1 239 ? -2.924  19.162 -16.405 1.00 53.95 ? 350 GLU A OE1   1 
ATOM   1691 O OE2   . GLU A 1 239 ? -1.378  17.954 -17.392 1.00 54.11 ? 350 GLU A OE2   1 
ATOM   1692 N N     . LEU A 1 240 ? 0.367   18.934 -14.883 1.00 52.64 ? 351 LEU A N     1 
ATOM   1693 C CA    . LEU A 1 240 ? 1.708   18.571 -15.321 1.00 53.11 ? 351 LEU A CA    1 
ATOM   1694 C C     . LEU A 1 240 ? 2.736   18.759 -14.217 1.00 52.44 ? 351 LEU A C     1 
ATOM   1695 O O     . LEU A 1 240 ? 3.510   17.853 -13.937 1.00 53.71 ? 351 LEU A O     1 
ATOM   1696 C CB    . LEU A 1 240 ? 2.106   19.395 -16.549 1.00 54.31 ? 351 LEU A CB    1 
ATOM   1697 C CG    . LEU A 1 240 ? 3.464   19.141 -17.216 1.00 55.77 ? 351 LEU A CG    1 
ATOM   1698 C CD1   . LEU A 1 240 ? 3.610   17.676 -17.626 1.00 55.01 ? 351 LEU A CD1   1 
ATOM   1699 C CD2   . LEU A 1 240 ? 3.581   20.047 -18.442 1.00 56.96 ? 351 LEU A CD2   1 
ATOM   1700 N N     . ALA A 1 241 ? 2.735   19.929 -13.586 1.00 51.29 ? 352 ALA A N     1 
ATOM   1701 C CA    . ALA A 1 241 ? 3.689   20.233 -12.522 1.00 49.21 ? 352 ALA A CA    1 
ATOM   1702 C C     . ALA A 1 241 ? 3.477   19.412 -11.263 1.00 48.63 ? 352 ALA A C     1 
ATOM   1703 O O     . ALA A 1 241 ? 4.358   19.351 -10.414 1.00 49.19 ? 352 ALA A O     1 
ATOM   1704 C CB    . ALA A 1 241 ? 3.636   21.713 -12.177 1.00 48.58 ? 352 ALA A CB    1 
ATOM   1705 N N     . LEU A 1 242 ? 2.313   18.789 -11.132 1.00 48.26 ? 353 LEU A N     1 
ATOM   1706 C CA    . LEU A 1 242 ? 2.030   17.981 -9.950  1.00 49.15 ? 353 LEU A CA    1 
ATOM   1707 C C     . LEU A 1 242 ? 2.658   16.605 -10.117 1.00 50.85 ? 353 LEU A C     1 
ATOM   1708 O O     . LEU A 1 242 ? 3.185   16.023 -9.172  1.00 50.40 ? 353 LEU A O     1 
ATOM   1709 C CB    . LEU A 1 242 ? 0.514   17.826 -9.742  1.00 47.33 ? 353 LEU A CB    1 
ATOM   1710 C CG    . LEU A 1 242 ? -0.318  19.084 -9.471  1.00 44.33 ? 353 LEU A CG    1 
ATOM   1711 C CD1   . LEU A 1 242 ? -1.741  18.688 -9.142  1.00 42.96 ? 353 LEU A CD1   1 
ATOM   1712 C CD2   . LEU A 1 242 ? 0.282   19.859 -8.330  1.00 42.43 ? 353 LEU A CD2   1 
ATOM   1713 N N     . VAL A 1 243 ? 2.588   16.090 -11.338 1.00 52.74 ? 354 VAL A N     1 
ATOM   1714 C CA    . VAL A 1 243 ? 3.142   14.789 -11.658 1.00 53.49 ? 354 VAL A CA    1 
ATOM   1715 C C     . VAL A 1 243 ? 4.656   14.884 -11.771 1.00 54.41 ? 354 VAL A C     1 
ATOM   1716 O O     . VAL A 1 243 ? 5.385   14.280 -10.988 1.00 55.30 ? 354 VAL A O     1 
ATOM   1717 C CB    . VAL A 1 243 ? 2.580   14.281 -12.979 1.00 53.66 ? 354 VAL A CB    1 
ATOM   1718 C CG1   . VAL A 1 243 ? 3.177   12.922 -13.303 1.00 55.51 ? 354 VAL A CG1   1 
ATOM   1719 C CG2   . VAL A 1 243 ? 1.065   14.206 -12.893 1.00 53.03 ? 354 VAL A CG2   1 
ATOM   1720 N N     . THR A 1 244 ? 5.122   15.652 -12.748 1.00 54.75 ? 355 THR A N     1 
ATOM   1721 C CA    . THR A 1 244 ? 6.547   15.834 -12.964 1.00 54.73 ? 355 THR A CA    1 
ATOM   1722 C C     . THR A 1 244 ? 7.205   16.476 -11.751 1.00 56.31 ? 355 THR A C     1 
ATOM   1723 O O     . THR A 1 244 ? 8.406   16.721 -11.751 1.00 57.48 ? 355 THR A O     1 
ATOM   1724 C CB    . THR A 1 244 ? 6.821   16.729 -14.174 1.00 52.93 ? 355 THR A CB    1 
ATOM   1725 O OG1   . THR A 1 244 ? 6.413   18.070 -13.878 1.00 53.59 ? 355 THR A OG1   1 
ATOM   1726 C CG2   . THR A 1 244 ? 6.058   16.228 -15.376 1.00 53.46 ? 355 THR A CG2   1 
ATOM   1727 N N     . ASN A 1 245 ? 6.425   16.761 -10.718 1.00 58.26 ? 356 ASN A N     1 
ATOM   1728 C CA    . ASN A 1 245 ? 7.007   17.371 -9.533  1.00 60.49 ? 356 ASN A CA    1 
ATOM   1729 C C     . ASN A 1 245 ? 7.902   18.515 -10.013 1.00 59.78 ? 356 ASN A C     1 
ATOM   1730 O O     . ASN A 1 245 ? 9.032   18.672 -9.564  1.00 60.67 ? 356 ASN A O     1 
ATOM   1731 C CB    . ASN A 1 245 ? 7.822   16.313 -8.779  1.00 64.31 ? 356 ASN A CB    1 
ATOM   1732 C CG    . ASN A 1 245 ? 8.502   16.857 -7.537  1.00 67.31 ? 356 ASN A CG    1 
ATOM   1733 O OD1   . ASN A 1 245 ? 9.177   16.116 -6.817  1.00 68.80 ? 356 ASN A OD1   1 
ATOM   1734 N ND2   . ASN A 1 245 ? 8.332   18.151 -7.276  1.00 70.39 ? 356 ASN A ND2   1 
ATOM   1735 N N     . LYS A 1 246 ? 7.383   19.302 -10.947 1.00 59.48 ? 357 LYS A N     1 
ATOM   1736 C CA    . LYS A 1 246 ? 8.115   20.432 -11.511 1.00 58.50 ? 357 LYS A CA    1 
ATOM   1737 C C     . LYS A 1 246 ? 7.325   21.725 -11.340 1.00 56.64 ? 357 LYS A C     1 
ATOM   1738 O O     . LYS A 1 246 ? 6.172   21.705 -10.898 1.00 57.39 ? 357 LYS A O     1 
ATOM   1739 C CB    . LYS A 1 246 ? 8.357   20.194 -12.999 1.00 59.90 ? 357 LYS A CB    1 
ATOM   1740 C CG    . LYS A 1 246 ? 9.282   19.035 -13.302 1.00 61.51 ? 357 LYS A CG    1 
ATOM   1741 C CD    . LYS A 1 246 ? 10.681  19.335 -12.811 1.00 63.85 ? 357 LYS A CD    1 
ATOM   1742 C CE    . LYS A 1 246 ? 11.239  20.593 -13.467 1.00 64.21 ? 357 LYS A CE    1 
ATOM   1743 N NZ    . LYS A 1 246 ? 12.625  20.881 -12.995 1.00 65.66 ? 357 LYS A NZ    1 
ATOM   1744 N N     . PRO A 1 247 ? 7.936   22.871 -11.683 1.00 54.07 ? 358 PRO A N     1 
ATOM   1745 C CA    . PRO A 1 247 ? 7.242   24.161 -11.557 1.00 52.22 ? 358 PRO A CA    1 
ATOM   1746 C C     . PRO A 1 247 ? 6.246   24.360 -12.713 1.00 50.59 ? 358 PRO A C     1 
ATOM   1747 O O     . PRO A 1 247 ? 6.180   23.541 -13.644 1.00 49.93 ? 358 PRO A O     1 
ATOM   1748 C CB    . PRO A 1 247 ? 8.382   25.185 -11.605 1.00 53.04 ? 358 PRO A CB    1 
ATOM   1749 C CG    . PRO A 1 247 ? 9.614   24.379 -11.260 1.00 53.49 ? 358 PRO A CG    1 
ATOM   1750 C CD    . PRO A 1 247 ? 9.366   23.073 -11.956 1.00 52.01 ? 358 PRO A CD    1 
ATOM   1751 N N     . ARG A 1 248 ? 5.480   25.449 -12.656 1.00 47.84 ? 359 ARG A N     1 
ATOM   1752 C CA    . ARG A 1 248 ? 4.497   25.740 -13.698 1.00 43.84 ? 359 ARG A CA    1 
ATOM   1753 C C     . ARG A 1 248 ? 5.167   25.858 -15.050 1.00 41.19 ? 359 ARG A C     1 
ATOM   1754 O O     . ARG A 1 248 ? 6.014   26.717 -15.249 1.00 40.73 ? 359 ARG A O     1 
ATOM   1755 C CB    . ARG A 1 248 ? 3.736   27.032 -13.384 1.00 42.21 ? 359 ARG A CB    1 
ATOM   1756 C CG    . ARG A 1 248 ? 2.793   26.914 -12.204 1.00 38.76 ? 359 ARG A CG    1 
ATOM   1757 C CD    . ARG A 1 248 ? 1.864   25.692 -12.349 1.00 37.55 ? 359 ARG A CD    1 
ATOM   1758 N NE    . ARG A 1 248 ? 0.864   25.631 -11.281 1.00 32.76 ? 359 ARG A NE    1 
ATOM   1759 C CZ    . ARG A 1 248 ? 0.002   24.633 -11.110 1.00 31.09 ? 359 ARG A CZ    1 
ATOM   1760 N NH1   . ARG A 1 248 ? 0.010   23.592 -11.931 1.00 28.64 ? 359 ARG A NH1   1 
ATOM   1761 N NH2   . ARG A 1 248 ? -0.879  24.684 -10.120 1.00 31.02 ? 359 ARG A NH2   1 
ATOM   1762 N N     . ALA A 1 249 ? 4.771   24.989 -15.975 1.00 40.79 ? 360 ALA A N     1 
ATOM   1763 C CA    . ALA A 1 249 ? 5.335   24.967 -17.317 1.00 41.08 ? 360 ALA A CA    1 
ATOM   1764 C C     . ALA A 1 249 ? 4.624   25.882 -18.289 1.00 42.17 ? 360 ALA A C     1 
ATOM   1765 O O     . ALA A 1 249 ? 4.931   25.857 -19.487 1.00 42.65 ? 360 ALA A O     1 
ATOM   1766 C CB    . ALA A 1 249 ? 5.318   23.555 -17.867 1.00 42.54 ? 360 ALA A CB    1 
ATOM   1767 N N     . ALA A 1 250 ? 3.674   26.673 -17.789 1.00 41.80 ? 361 ALA A N     1 
ATOM   1768 C CA    . ALA A 1 250 ? 2.916   27.610 -18.628 1.00 40.93 ? 361 ALA A CA    1 
ATOM   1769 C C     . ALA A 1 250 ? 1.910   28.396 -17.799 1.00 40.12 ? 361 ALA A C     1 
ATOM   1770 O O     . ALA A 1 250 ? 1.456   27.925 -16.752 1.00 39.20 ? 361 ALA A O     1 
ATOM   1771 C CB    . ALA A 1 250 ? 2.187   26.853 -19.756 1.00 37.58 ? 361 ALA A CB    1 
ATOM   1772 N N     . SER A 1 251 ? 1.571   29.596 -18.268 1.00 39.84 ? 362 SER A N     1 
ATOM   1773 C CA    . SER A 1 251 ? 0.598   30.447 -17.580 1.00 38.89 ? 362 SER A CA    1 
ATOM   1774 C C     . SER A 1 251 ? -0.810  30.140 -18.075 1.00 38.95 ? 362 SER A C     1 
ATOM   1775 O O     . SER A 1 251 ? -0.995  29.651 -19.191 1.00 39.75 ? 362 SER A O     1 
ATOM   1776 C CB    . SER A 1 251 ? 0.877   31.930 -17.841 1.00 37.89 ? 362 SER A CB    1 
ATOM   1777 O OG    . SER A 1 251 ? 2.054   32.382 -17.196 1.00 40.87 ? 362 SER A OG    1 
ATOM   1778 N N     . ALA A 1 252 ? -1.799  30.433 -17.240 1.00 37.90 ? 363 ALA A N     1 
ATOM   1779 C CA    . ALA A 1 252 ? -3.193  30.229 -17.608 1.00 39.10 ? 363 ALA A CA    1 
ATOM   1780 C C     . ALA A 1 252 ? -3.974  31.512 -17.319 1.00 39.10 ? 363 ALA A C     1 
ATOM   1781 O O     . ALA A 1 252 ? -3.859  32.095 -16.240 1.00 38.67 ? 363 ALA A O     1 
ATOM   1782 C CB    . ALA A 1 252 ? -3.795  29.054 -16.824 1.00 37.18 ? 363 ALA A CB    1 
ATOM   1783 N N     . HIS A 1 253 ? -4.763  31.960 -18.286 1.00 38.87 ? 364 HIS A N     1 
ATOM   1784 C CA    . HIS A 1 253 ? -5.559  33.163 -18.086 1.00 38.04 ? 364 HIS A CA    1 
ATOM   1785 C C     . HIS A 1 253 ? -7.017  32.911 -18.426 1.00 37.16 ? 364 HIS A C     1 
ATOM   1786 O O     . HIS A 1 253 ? -7.336  32.093 -19.289 1.00 33.66 ? 364 HIS A O     1 
ATOM   1787 C CB    . HIS A 1 253 ? -5.020  34.327 -18.926 1.00 37.44 ? 364 HIS A CB    1 
ATOM   1788 C CG    . HIS A 1 253 ? -3.749  34.909 -18.397 1.00 40.00 ? 364 HIS A CG    1 
ATOM   1789 N ND1   . HIS A 1 253 ? -2.533  34.269 -18.507 1.00 41.96 ? 364 HIS A ND1   1 
ATOM   1790 C CD2   . HIS A 1 253 ? -3.509  36.060 -17.727 1.00 39.48 ? 364 HIS A CD2   1 
ATOM   1791 C CE1   . HIS A 1 253 ? -1.598  35.001 -17.928 1.00 40.66 ? 364 HIS A CE1   1 
ATOM   1792 N NE2   . HIS A 1 253 ? -2.164  36.093 -17.446 1.00 39.74 ? 364 HIS A NE2   1 
ATOM   1793 N N     . ALA A 1 254 ? -7.894  33.631 -17.738 1.00 38.63 ? 365 ALA A N     1 
ATOM   1794 C CA    . ALA A 1 254 ? -9.324  33.501 -17.943 1.00 40.04 ? 365 ALA A CA    1 
ATOM   1795 C C     . ALA A 1 254 ? -9.765  34.323 -19.136 1.00 42.86 ? 365 ALA A C     1 
ATOM   1796 O O     . ALA A 1 254 ? -9.350  35.475 -19.296 1.00 44.04 ? 365 ALA A O     1 
ATOM   1797 C CB    . ALA A 1 254 ? -10.067 33.959 -16.695 1.00 38.98 ? 365 ALA A CB    1 
ATOM   1798 N N     . ILE A 1 255 ? -10.584 33.722 -19.991 1.00 44.76 ? 366 ILE A N     1 
ATOM   1799 C CA    . ILE A 1 255 ? -11.112 34.432 -21.148 1.00 47.12 ? 366 ILE A CA    1 
ATOM   1800 C C     . ILE A 1 255 ? -12.584 34.622 -20.838 1.00 48.42 ? 366 ILE A C     1 
ATOM   1801 O O     . ILE A 1 255 ? -13.410 33.753 -21.128 1.00 49.33 ? 366 ILE A O     1 
ATOM   1802 C CB    . ILE A 1 255 ? -10.993 33.619 -22.438 1.00 47.95 ? 366 ILE A CB    1 
ATOM   1803 C CG1   . ILE A 1 255 ? -9.521  33.370 -22.776 1.00 46.86 ? 366 ILE A CG1   1 
ATOM   1804 C CG2   . ILE A 1 255 ? -11.690 34.374 -23.578 1.00 48.40 ? 366 ILE A CG2   1 
ATOM   1805 C CD1   . ILE A 1 255 ? -9.330  32.495 -24.007 1.00 47.00 ? 366 ILE A CD1   1 
ATOM   1806 N N     . GLY A 1 256 ? -12.913 35.759 -20.243 1.00 49.38 ? 367 GLY A N     1 
ATOM   1807 C CA    . GLY A 1 256 ? -14.291 35.993 -19.867 1.00 49.67 ? 367 GLY A CA    1 
ATOM   1808 C C     . GLY A 1 256 ? -14.431 35.298 -18.530 1.00 49.09 ? 367 GLY A C     1 
ATOM   1809 O O     . GLY A 1 256 ? -13.459 34.726 -18.041 1.00 50.16 ? 367 GLY A O     1 
ATOM   1810 N N     . THR A 1 257 ? -15.618 35.319 -17.938 1.00 48.23 ? 368 THR A N     1 
ATOM   1811 C CA    . THR A 1 257 ? -15.797 34.680 -16.644 1.00 45.66 ? 368 THR A CA    1 
ATOM   1812 C C     . THR A 1 257 ? -15.535 33.190 -16.721 1.00 43.93 ? 368 THR A C     1 
ATOM   1813 O O     . THR A 1 257 ? -16.081 32.484 -17.564 1.00 45.00 ? 368 THR A O     1 
ATOM   1814 C CB    . THR A 1 257 ? -17.200 34.936 -16.073 1.00 44.01 ? 368 THR A CB    1 
ATOM   1815 O OG1   . THR A 1 257 ? -17.422 36.347 -16.013 1.00 45.51 ? 368 THR A OG1   1 
ATOM   1816 C CG2   . THR A 1 257 ? -17.312 34.380 -14.652 1.00 42.07 ? 368 THR A CG2   1 
ATOM   1817 N N     . VAL A 1 258 ? -14.676 32.724 -15.828 1.00 41.24 ? 369 VAL A N     1 
ATOM   1818 C CA    . VAL A 1 258 ? -14.312 31.327 -15.785 1.00 38.11 ? 369 VAL A CA    1 
ATOM   1819 C C     . VAL A 1 258 ? -14.597 30.769 -14.406 1.00 38.04 ? 369 VAL A C     1 
ATOM   1820 O O     . VAL A 1 258 ? -14.433 31.449 -13.401 1.00 36.93 ? 369 VAL A O     1 
ATOM   1821 C CB    . VAL A 1 258 ? -12.807 31.139 -16.095 1.00 36.68 ? 369 VAL A CB    1 
ATOM   1822 C CG1   . VAL A 1 258 ? -12.369 29.726 -15.756 1.00 35.18 ? 369 VAL A CG1   1 
ATOM   1823 C CG2   . VAL A 1 258 ? -12.541 31.415 -17.550 1.00 35.76 ? 369 VAL A CG2   1 
ATOM   1824 N N     . LYS A 1 259 ? -15.052 29.525 -14.375 1.00 39.85 ? 370 LYS A N     1 
ATOM   1825 C CA    . LYS A 1 259 ? -15.317 28.847 -13.126 1.00 42.70 ? 370 LYS A CA    1 
ATOM   1826 C C     . LYS A 1 259 ? -14.630 27.489 -13.203 1.00 42.34 ? 370 LYS A C     1 
ATOM   1827 O O     . LYS A 1 259 ? -14.946 26.668 -14.065 1.00 42.88 ? 370 LYS A O     1 
ATOM   1828 C CB    . LYS A 1 259 ? -16.829 28.719 -12.889 1.00 43.22 ? 370 LYS A CB    1 
ATOM   1829 C CG    . LYS A 1 259 ? -17.434 30.047 -12.424 1.00 46.24 ? 370 LYS A CG    1 
ATOM   1830 C CD    . LYS A 1 259 ? -18.909 29.949 -12.023 1.00 48.37 ? 370 LYS A CD    1 
ATOM   1831 C CE    . LYS A 1 259 ? -19.845 30.238 -13.196 1.00 48.94 ? 370 LYS A CE    1 
ATOM   1832 N NZ    . LYS A 1 259 ? -21.252 30.485 -12.746 1.00 48.50 ? 370 LYS A NZ    1 
ATOM   1833 N N     . CYS A 1 260 ? -13.656 27.291 -12.316 1.00 42.49 ? 371 CYS A N     1 
ATOM   1834 C CA    . CYS A 1 260 ? -12.882 26.052 -12.242 1.00 40.82 ? 371 CYS A CA    1 
ATOM   1835 C C     . CYS A 1 260 ? -13.192 25.316 -10.939 1.00 39.85 ? 371 CYS A C     1 
ATOM   1836 O O     . CYS A 1 260 ? -13.401 25.937 -9.905  1.00 38.77 ? 371 CYS A O     1 
ATOM   1837 C CB    . CYS A 1 260 ? -11.369 26.345 -12.251 1.00 41.22 ? 371 CYS A CB    1 
ATOM   1838 S SG    . CYS A 1 260 ? -10.613 27.092 -13.744 1.00 40.92 ? 371 CYS A SG    1 
ATOM   1839 N N     . LEU A 1 261 ? -13.218 23.989 -11.002 1.00 40.62 ? 372 LEU A N     1 
ATOM   1840 C CA    . LEU A 1 261 ? -13.426 23.159 -9.824  1.00 39.43 ? 372 LEU A CA    1 
ATOM   1841 C C     . LEU A 1 261 ? -12.010 22.666 -9.493  1.00 40.06 ? 372 LEU A C     1 
ATOM   1842 O O     . LEU A 1 261 ? -11.479 21.812 -10.200 1.00 41.32 ? 372 LEU A O     1 
ATOM   1843 C CB    . LEU A 1 261 ? -14.326 21.976 -10.165 1.00 40.12 ? 372 LEU A CB    1 
ATOM   1844 C CG    . LEU A 1 261 ? -15.718 22.274 -10.730 1.00 41.21 ? 372 LEU A CG    1 
ATOM   1845 C CD1   . LEU A 1 261 ? -16.470 20.961 -10.872 1.00 42.02 ? 372 LEU A CD1   1 
ATOM   1846 C CD2   . LEU A 1 261 ? -16.491 23.215 -9.811  1.00 41.36 ? 372 LEU A CD2   1 
ATOM   1847 N N     . ALA A 1 262 ? -11.404 23.205 -8.434  1.00 38.84 ? 373 ALA A N     1 
ATOM   1848 C CA    . ALA A 1 262 ? -10.031 22.853 -8.056  1.00 38.18 ? 373 ALA A CA    1 
ATOM   1849 C C     . ALA A 1 262 ? -9.831  21.920 -6.855  1.00 38.94 ? 373 ALA A C     1 
ATOM   1850 O O     . ALA A 1 262 ? -10.775 21.605 -6.124  1.00 39.90 ? 373 ALA A O     1 
ATOM   1851 C CB    . ALA A 1 262 ? -9.231  24.132 -7.835  1.00 35.28 ? 373 ALA A CB    1 
ATOM   1852 N N     . MET A 1 263 ? -8.584  21.482 -6.667  1.00 38.46 ? 374 MET A N     1 
ATOM   1853 C CA    . MET A 1 263 ? -8.215  20.606 -5.557  1.00 38.05 ? 374 MET A CA    1 
ATOM   1854 C C     . MET A 1 263 ? -6.714  20.693 -5.342  1.00 36.81 ? 374 MET A C     1 
ATOM   1855 O O     . MET A 1 263 ? -5.973  20.902 -6.294  1.00 36.24 ? 374 MET A O     1 
ATOM   1856 C CB    . MET A 1 263 ? -8.591  19.155 -5.854  1.00 40.08 ? 374 MET A CB    1 
ATOM   1857 C CG    . MET A 1 263 ? -7.651  18.435 -6.820  1.00 42.82 ? 374 MET A CG    1 
ATOM   1858 S SD    . MET A 1 263 ? -8.039  16.666 -6.953  1.00 43.16 ? 374 MET A SD    1 
ATOM   1859 C CE    . MET A 1 263 ? -9.793  16.757 -7.393  1.00 43.26 ? 374 MET A CE    1 
ATOM   1860 N N     . ASP A 1 264 ? -6.263  20.541 -4.096  1.00 37.08 ? 375 ASP A N     1 
ATOM   1861 C CA    . ASP A 1 264 ? -4.836  20.604 -3.813  1.00 37.61 ? 375 ASP A CA    1 
ATOM   1862 C C     . ASP A 1 264 ? -4.129  19.300 -4.205  1.00 38.37 ? 375 ASP A C     1 
ATOM   1863 O O     . ASP A 1 264 ? -4.767  18.250 -4.395  1.00 35.31 ? 375 ASP A O     1 
ATOM   1864 C CB    . ASP A 1 264 ? -4.572  20.915 -2.328  1.00 39.13 ? 375 ASP A CB    1 
ATOM   1865 C CG    . ASP A 1 264 ? -5.185  19.885 -1.381  1.00 41.14 ? 375 ASP A CG    1 
ATOM   1866 O OD1   . ASP A 1 264 ? -5.275  18.699 -1.755  1.00 43.78 ? 375 ASP A OD1   1 
ATOM   1867 O OD2   . ASP A 1 264 ? -5.560  20.252 -0.243  1.00 42.37 ? 375 ASP A OD2   1 
ATOM   1868 N N     . VAL A 1 265 ? -2.807  19.371 -4.324  1.00 38.75 ? 376 VAL A N     1 
ATOM   1869 C CA    . VAL A 1 265 ? -2.026  18.203 -4.696  1.00 40.62 ? 376 VAL A CA    1 
ATOM   1870 C C     . VAL A 1 265 ? -2.273  16.971 -3.814  1.00 40.81 ? 376 VAL A C     1 
ATOM   1871 O O     . VAL A 1 265 ? -2.419  15.863 -4.341  1.00 40.35 ? 376 VAL A O     1 
ATOM   1872 C CB    . VAL A 1 265 ? -0.523  18.524 -4.704  1.00 41.01 ? 376 VAL A CB    1 
ATOM   1873 C CG1   . VAL A 1 265 ? -0.102  19.135 -3.376  1.00 40.87 ? 376 VAL A CG1   1 
ATOM   1874 C CG2   . VAL A 1 265 ? 0.253   17.264 -4.986  1.00 40.73 ? 376 VAL A CG2   1 
ATOM   1875 N N     . GLN A 1 266 ? -2.325  17.154 -2.489  1.00 39.97 ? 377 GLN A N     1 
ATOM   1876 C CA    . GLN A 1 266 ? -2.559  16.030 -1.570  1.00 39.06 ? 377 GLN A CA    1 
ATOM   1877 C C     . GLN A 1 266 ? -3.803  15.288 -1.999  1.00 39.64 ? 377 GLN A C     1 
ATOM   1878 O O     . GLN A 1 266 ? -3.840  14.065 -2.015  1.00 42.60 ? 377 GLN A O     1 
ATOM   1879 C CB    . GLN A 1 266 ? -2.760  16.500 -0.124  1.00 39.61 ? 377 GLN A CB    1 
ATOM   1880 C CG    . GLN A 1 266 ? -1.552  17.157 0.538   1.00 36.56 ? 377 GLN A CG    1 
ATOM   1881 C CD    . GLN A 1 266 ? -1.184  18.442 -0.130  1.00 37.02 ? 377 GLN A CD    1 
ATOM   1882 O OE1   . GLN A 1 266 ? -1.923  18.928 -0.982  1.00 42.07 ? 377 GLN A OE1   1 
ATOM   1883 N NE2   . GLN A 1 266 ? -0.049  19.014 0.248   1.00 35.44 ? 377 GLN A NE2   1 
ATOM   1884 N N     . ALA A 1 267 ? -4.836  16.044 -2.334  1.00 39.68 ? 378 ALA A N     1 
ATOM   1885 C CA    . ALA A 1 267 ? -6.084  15.464 -2.784  1.00 38.56 ? 378 ALA A CA    1 
ATOM   1886 C C     . ALA A 1 267 ? -5.826  14.778 -4.124  1.00 39.20 ? 378 ALA A C     1 
ATOM   1887 O O     . ALA A 1 267 ? -6.311  13.671 -4.378  1.00 38.92 ? 378 ALA A O     1 
ATOM   1888 C CB    . ALA A 1 267 ? -7.132  16.567 -2.944  1.00 35.69 ? 378 ALA A CB    1 
ATOM   1889 N N     . PHE A 1 268 ? -5.066  15.459 -4.979  1.00 40.93 ? 379 PHE A N     1 
ATOM   1890 C CA    . PHE A 1 268 ? -4.718  14.959 -6.312  1.00 42.43 ? 379 PHE A CA    1 
ATOM   1891 C C     . PHE A 1 268 ? -4.144  13.555 -6.185  1.00 43.55 ? 379 PHE A C     1 
ATOM   1892 O O     . PHE A 1 268 ? -4.768  12.568 -6.594  1.00 42.23 ? 379 PHE A O     1 
ATOM   1893 C CB    . PHE A 1 268 ? -3.682  15.895 -6.951  1.00 42.27 ? 379 PHE A CB    1 
ATOM   1894 C CG    . PHE A 1 268 ? -3.280  15.515 -8.353  1.00 43.15 ? 379 PHE A CG    1 
ATOM   1895 C CD1   . PHE A 1 268 ? -4.223  15.464 -9.379  1.00 43.45 ? 379 PHE A CD1   1 
ATOM   1896 C CD2   . PHE A 1 268 ? -1.940  15.244 -8.660  1.00 42.74 ? 379 PHE A CD2   1 
ATOM   1897 C CE1   . PHE A 1 268 ? -3.835  15.147 -10.697 1.00 43.11 ? 379 PHE A CE1   1 
ATOM   1898 C CE2   . PHE A 1 268 ? -1.543  14.930 -9.967  1.00 40.96 ? 379 PHE A CE2   1 
ATOM   1899 C CZ    . PHE A 1 268 ? -2.490  14.882 -10.987 1.00 41.01 ? 379 PHE A CZ    1 
ATOM   1900 N N     . GLU A 1 269 ? -2.959  13.482 -5.586  1.00 44.78 ? 380 GLU A N     1 
ATOM   1901 C CA    . GLU A 1 269 ? -2.256  12.223 -5.378  1.00 46.41 ? 380 GLU A CA    1 
ATOM   1902 C C     . GLU A 1 269 ? -3.066  11.196 -4.590  1.00 47.49 ? 380 GLU A C     1 
ATOM   1903 O O     . GLU A 1 269 ? -2.878  9.986  -4.757  1.00 49.92 ? 380 GLU A O     1 
ATOM   1904 C CB    . GLU A 1 269 ? -0.942  12.495 -4.657  1.00 44.89 ? 380 GLU A CB    1 
ATOM   1905 C CG    . GLU A 1 269 ? -0.161  13.624 -5.308  1.00 46.97 ? 380 GLU A CG    1 
ATOM   1906 C CD    . GLU A 1 269 ? 1.212   13.839 -4.701  1.00 47.43 ? 380 GLU A CD    1 
ATOM   1907 O OE1   . GLU A 1 269 ? 1.354   13.769 -3.465  1.00 49.16 ? 380 GLU A OE1   1 
ATOM   1908 O OE2   . GLU A 1 269 ? 2.153   14.099 -5.470  1.00 48.83 ? 380 GLU A OE2   1 
ATOM   1909 N N     . ARG A 1 270 ? -3.983  11.664 -3.753  1.00 44.99 ? 381 ARG A N     1 
ATOM   1910 C CA    . ARG A 1 270 ? -4.765  10.746 -2.948  1.00 44.85 ? 381 ARG A CA    1 
ATOM   1911 C C     . ARG A 1 270 ? -5.881  10.047 -3.696  1.00 46.23 ? 381 ARG A C     1 
ATOM   1912 O O     . ARG A 1 270 ? -6.172  8.871  -3.441  1.00 46.28 ? 381 ARG A O     1 
ATOM   1913 C CB    . ARG A 1 270 ? -5.338  11.478 -1.738  1.00 41.76 ? 381 ARG A CB    1 
ATOM   1914 C CG    . ARG A 1 270 ? -6.176  10.620 -0.817  1.00 37.56 ? 381 ARG A CG    1 
ATOM   1915 C CD    . ARG A 1 270 ? -6.563  11.424 0.417   1.00 38.56 ? 381 ARG A CD    1 
ATOM   1916 N NE    . ARG A 1 270 ? -7.520  12.480 0.113   1.00 37.17 ? 381 ARG A NE    1 
ATOM   1917 C CZ    . ARG A 1 270 ? -8.803  12.252 -0.144  1.00 38.77 ? 381 ARG A CZ    1 
ATOM   1918 N NH1   . ARG A 1 270 ? -9.622  13.260 -0.419  1.00 39.17 ? 381 ARG A NH1   1 
ATOM   1919 N NH2   . ARG A 1 270 ? -9.269  11.009 -0.111  1.00 40.70 ? 381 ARG A NH2   1 
ATOM   1920 N N     . LEU A 1 271 ? -6.491  10.756 -4.637  1.00 47.69 ? 382 LEU A N     1 
ATOM   1921 C CA    . LEU A 1 271 ? -7.604  10.195 -5.390  1.00 48.32 ? 382 LEU A CA    1 
ATOM   1922 C C     . LEU A 1 271 ? -7.329  9.937  -6.862  1.00 49.40 ? 382 LEU A C     1 
ATOM   1923 O O     . LEU A 1 271 ? -7.937  9.054  -7.467  1.00 50.06 ? 382 LEU A O     1 
ATOM   1924 C CB    . LEU A 1 271 ? -8.800  11.139 -5.295  1.00 48.98 ? 382 LEU A CB    1 
ATOM   1925 C CG    . LEU A 1 271 ? -9.284  11.507 -3.900  1.00 49.28 ? 382 LEU A CG    1 
ATOM   1926 C CD1   . LEU A 1 271 ? -9.578  13.000 -3.864  1.00 48.68 ? 382 LEU A CD1   1 
ATOM   1927 C CD2   . LEU A 1 271 ? -10.515 10.673 -3.540  1.00 49.10 ? 382 LEU A CD2   1 
ATOM   1928 N N     . LEU A 1 272 ? -6.415  10.701 -7.442  1.00 51.34 ? 383 LEU A N     1 
ATOM   1929 C CA    . LEU A 1 272 ? -6.149  10.572 -8.868  1.00 53.51 ? 383 LEU A CA    1 
ATOM   1930 C C     . LEU A 1 272 ? -5.051  9.618  -9.332  1.00 55.41 ? 383 LEU A C     1 
ATOM   1931 O O     . LEU A 1 272 ? -4.783  9.530  -10.531 1.00 55.55 ? 383 LEU A O     1 
ATOM   1932 C CB    . LEU A 1 272 ? -5.918  11.970 -9.460  1.00 52.18 ? 383 LEU A CB    1 
ATOM   1933 C CG    . LEU A 1 272 ? -7.044  12.983 -9.197  1.00 50.26 ? 383 LEU A CG    1 
ATOM   1934 C CD1   . LEU A 1 272 ? -6.920  14.110 -10.185 1.00 48.26 ? 383 LEU A CD1   1 
ATOM   1935 C CD2   . LEU A 1 272 ? -8.421  12.328 -9.348  1.00 48.51 ? 383 LEU A CD2   1 
ATOM   1936 N N     . GLY A 1 273 ? -4.423  8.904  -8.400  1.00 57.52 ? 384 GLY A N     1 
ATOM   1937 C CA    . GLY A 1 273 ? -3.382  7.958  -8.777  1.00 56.96 ? 384 GLY A CA    1 
ATOM   1938 C C     . GLY A 1 273 ? -3.806  7.147  -9.991  1.00 57.28 ? 384 GLY A C     1 
ATOM   1939 O O     . GLY A 1 273 ? -3.034  7.017  -10.946 1.00 58.15 ? 384 GLY A O     1 
ATOM   1940 N N     . PRO A 1 274 ? -5.033  6.592  -9.987  1.00 56.30 ? 385 PRO A N     1 
ATOM   1941 C CA    . PRO A 1 274 ? -5.583  5.789  -11.083 1.00 56.83 ? 385 PRO A CA    1 
ATOM   1942 C C     . PRO A 1 274 ? -5.746  6.547  -12.404 1.00 58.13 ? 385 PRO A C     1 
ATOM   1943 O O     . PRO A 1 274 ? -6.248  5.992  -13.380 1.00 58.70 ? 385 PRO A O     1 
ATOM   1944 C CB    . PRO A 1 274 ? -6.928  5.335  -10.528 1.00 55.27 ? 385 PRO A CB    1 
ATOM   1945 C CG    . PRO A 1 274 ? -6.665  5.230  -9.076  1.00 55.03 ? 385 PRO A CG    1 
ATOM   1946 C CD    . PRO A 1 274 ? -5.909  6.500  -8.807  1.00 55.86 ? 385 PRO A CD    1 
ATOM   1947 N N     . CYS A 1 275 ? -5.323  7.808  -12.438 1.00 59.13 ? 386 CYS A N     1 
ATOM   1948 C CA    . CYS A 1 275 ? -5.449  8.624  -13.644 1.00 60.16 ? 386 CYS A CA    1 
ATOM   1949 C C     . CYS A 1 275 ? -4.102  9.003  -14.255 1.00 60.89 ? 386 CYS A C     1 
ATOM   1950 O O     . CYS A 1 275 ? -4.019  9.288  -15.449 1.00 59.66 ? 386 CYS A O     1 
ATOM   1951 C CB    . CYS A 1 275 ? -6.234  9.907  -13.333 1.00 60.27 ? 386 CYS A CB    1 
ATOM   1952 S SG    . CYS A 1 275 ? -7.948  9.664  -12.762 1.00 62.66 ? 386 CYS A SG    1 
ATOM   1953 N N     . MET A 1 276 ? -3.058  9.005  -13.426 1.00 63.08 ? 387 MET A N     1 
ATOM   1954 C CA    . MET A 1 276 ? -1.702  9.365  -13.846 1.00 63.89 ? 387 MET A CA    1 
ATOM   1955 C C     . MET A 1 276 ? -1.235  8.687  -15.134 1.00 65.58 ? 387 MET A C     1 
ATOM   1956 O O     . MET A 1 276 ? -0.390  9.227  -15.846 1.00 65.85 ? 387 MET A O     1 
ATOM   1957 C CB    . MET A 1 276 ? -0.720  9.074  -12.718 1.00 62.22 ? 387 MET A CB    1 
ATOM   1958 N N     . GLU A 1 277 ? -1.778  7.508  -15.434 1.00 67.12 ? 388 GLU A N     1 
ATOM   1959 C CA    . GLU A 1 277 ? -1.402  6.789  -16.650 1.00 67.99 ? 388 GLU A CA    1 
ATOM   1960 C C     . GLU A 1 277 ? -2.012  7.464  -17.878 1.00 68.82 ? 388 GLU A C     1 
ATOM   1961 O O     . GLU A 1 277 ? -1.292  7.994  -18.728 1.00 69.55 ? 388 GLU A O     1 
ATOM   1962 C CB    . GLU A 1 277 ? -1.858  5.335  -16.565 1.00 67.51 ? 388 GLU A CB    1 
ATOM   1963 N N     . ILE A 1 278 ? -3.339  7.444  -17.970 1.00 69.55 ? 389 ILE A N     1 
ATOM   1964 C CA    . ILE A 1 278 ? -4.037  8.064  -19.096 1.00 69.48 ? 389 ILE A CA    1 
ATOM   1965 C C     . ILE A 1 278 ? -3.580  9.509  -19.271 1.00 70.31 ? 389 ILE A C     1 
ATOM   1966 O O     . ILE A 1 278 ? -3.758  10.107 -20.333 1.00 70.59 ? 389 ILE A O     1 
ATOM   1967 C CB    . ILE A 1 278 ? -5.535  8.019  -18.866 1.00 68.63 ? 389 ILE A CB    1 
ATOM   1968 N N     . MET A 1 279 ? -2.993  10.065 -18.216 1.00 71.39 ? 390 MET A N     1 
ATOM   1969 C CA    . MET A 1 279 ? -2.503  11.435 -18.242 1.00 71.67 ? 390 MET A CA    1 
ATOM   1970 C C     . MET A 1 279 ? -1.057  11.438 -18.701 1.00 71.72 ? 390 MET A C     1 
ATOM   1971 O O     . MET A 1 279 ? -0.724  12.084 -19.689 1.00 72.15 ? 390 MET A O     1 
ATOM   1972 C CB    . MET A 1 279 ? -2.623  12.067 -16.855 1.00 72.19 ? 390 MET A CB    1 
ATOM   1973 N N     . LYS A 1 280 ? -0.204  10.706 -17.984 1.00 72.52 ? 391 LYS A N     1 
ATOM   1974 C CA    . LYS A 1 280 ? 1.219   10.614 -18.326 1.00 73.38 ? 391 LYS A CA    1 
ATOM   1975 C C     . LYS A 1 280 ? 1.372   10.349 -19.822 1.00 73.81 ? 391 LYS A C     1 
ATOM   1976 O O     . LYS A 1 280 ? 2.297   10.853 -20.470 1.00 72.52 ? 391 LYS A O     1 
ATOM   1977 C CB    . LYS A 1 280 ? 1.885   9.497  -17.522 1.00 71.76 ? 391 LYS A CB    1 
ATOM   1978 N N     . ARG A 1 281 ? 0.447   9.560  -20.361 1.00 74.71 ? 392 ARG A N     1 
ATOM   1979 C CA    . ARG A 1 281 ? 0.450   9.225  -21.778 1.00 75.95 ? 392 ARG A CA    1 
ATOM   1980 C C     . ARG A 1 281 ? 0.027   10.452 -22.581 1.00 75.62 ? 392 ARG A C     1 
ATOM   1981 O O     . ARG A 1 281 ? 0.801   10.981 -23.381 1.00 75.36 ? 392 ARG A O     1 
ATOM   1982 C CB    . ARG A 1 281 ? -0.510  8.056  -22.042 1.00 76.44 ? 392 ARG A CB    1 
ATOM   1983 N N     . ASN A 1 282 ? -1.202  10.902 -22.350 1.00 75.73 ? 393 ASN A N     1 
ATOM   1984 C CA    . ASN A 1 282 ? -1.740  12.066 -23.041 1.00 75.76 ? 393 ASN A CA    1 
ATOM   1985 C C     . ASN A 1 282 ? -0.929  13.319 -22.708 1.00 76.01 ? 393 ASN A C     1 
ATOM   1986 O O     . ASN A 1 282 ? -1.214  14.409 -23.208 1.00 76.15 ? 393 ASN A O     1 
ATOM   1987 C CB    . ASN A 1 282 ? -3.201  12.266 -22.661 1.00 75.11 ? 393 ASN A CB    1 
ATOM   1988 N N     . ILE A 1 283 ? 0.079   13.160 -21.856 1.00 76.03 ? 394 ILE A N     1 
ATOM   1989 C CA    . ILE A 1 283 ? 0.937   14.278 -21.477 1.00 76.42 ? 394 ILE A CA    1 
ATOM   1990 C C     . ILE A 1 283 ? 2.078   14.333 -22.476 1.00 76.78 ? 394 ILE A C     1 
ATOM   1991 O O     . ILE A 1 283 ? 2.851   15.288 -22.506 1.00 76.71 ? 394 ILE A O     1 
ATOM   1992 C CB    . ILE A 1 283 ? 1.482   14.079 -20.069 1.00 76.36 ? 394 ILE A CB    1 
ATOM   1993 N N     . ALA A 1 284 ? 2.180   13.287 -23.291 1.00 77.69 ? 395 ALA A N     1 
ATOM   1994 C CA    . ALA A 1 284 ? 3.217   13.206 -24.311 1.00 78.18 ? 395 ALA A CA    1 
ATOM   1995 C C     . ALA A 1 284 ? 2.844   14.199 -25.402 1.00 78.57 ? 395 ALA A C     1 
ATOM   1996 O O     . ALA A 1 284 ? 3.702   14.682 -26.143 1.00 78.01 ? 395 ALA A O     1 
ATOM   1997 C CB    . ALA A 1 284 ? 3.284   11.793 -24.880 1.00 77.52 ? 395 ALA A CB    1 
ATOM   1998 N N     . THR A 1 285 ? 1.550   14.505 -25.471 1.00 78.95 ? 396 THR A N     1 
ATOM   1999 C CA    . THR A 1 285 ? 1.004   15.437 -26.451 1.00 78.93 ? 396 THR A CA    1 
ATOM   2000 C C     . THR A 1 285 ? 1.357   16.879 -26.079 1.00 78.67 ? 396 THR A C     1 
ATOM   2001 O O     . THR A 1 285 ? 0.695   17.826 -26.505 1.00 78.51 ? 396 THR A O     1 
ATOM   2002 C CB    . THR A 1 285 ? -0.538  15.299 -26.537 1.00 80.12 ? 396 THR A CB    1 
ATOM   2003 O OG1   . THR A 1 285 ? -0.896  13.910 -26.536 1.00 80.53 ? 396 THR A OG1   1 
ATOM   2004 C CG2   . THR A 1 285 ? -1.068  15.943 -27.819 1.00 79.45 ? 396 THR A CG2   1 
ATOM   2005 N N     . TYR A 1 286 ? 2.402   17.039 -25.275 1.00 78.28 ? 397 TYR A N     1 
ATOM   2006 C CA    . TYR A 1 286 ? 2.851   18.359 -24.855 1.00 76.81 ? 397 TYR A CA    1 
ATOM   2007 C C     . TYR A 1 286 ? 4.143   18.738 -25.561 1.00 76.82 ? 397 TYR A C     1 
ATOM   2008 O O     . TYR A 1 286 ? 5.061   19.274 -24.944 1.00 76.93 ? 397 TYR A O     1 
ATOM   2009 C CB    . TYR A 1 286 ? 3.064   18.395 -23.340 1.00 75.77 ? 397 TYR A CB    1 
ATOM   2010 C CG    . TYR A 1 286 ? 1.792   18.510 -22.527 1.00 74.70 ? 397 TYR A CG    1 
ATOM   2011 C CD1   . TYR A 1 286 ? 0.567   18.088 -23.043 1.00 73.86 ? 397 TYR A CD1   1 
ATOM   2012 C CD2   . TYR A 1 286 ? 1.822   19.009 -21.225 1.00 73.77 ? 397 TYR A CD2   1 
ATOM   2013 C CE1   . TYR A 1 286 ? -0.597  18.159 -22.285 1.00 73.58 ? 397 TYR A CE1   1 
ATOM   2014 C CE2   . TYR A 1 286 ? 0.664   19.081 -20.456 1.00 73.82 ? 397 TYR A CE2   1 
ATOM   2015 C CZ    . TYR A 1 286 ? -0.543  18.655 -20.993 1.00 74.03 ? 397 TYR A CZ    1 
ATOM   2016 O OH    . TYR A 1 286 ? -1.695  18.723 -20.240 1.00 72.95 ? 397 TYR A OH    1 
HETATM 2017 P P     . 1OR B 2 .   ? -7.439  12.682 8.071   1.00 42.60 ? 501 1OR A P     1 
HETATM 2018 O O1P   . 1OR B 2 .   ? -8.642  12.872 8.902   1.00 41.27 ? 501 1OR A O1P   1 
HETATM 2019 O O2P   . 1OR B 2 .   ? -7.425  11.254 7.667   1.00 41.18 ? 501 1OR A O2P   1 
HETATM 2020 C "C5'" . 1OR B 2 .   ? -4.820  13.062 8.391   1.00 41.73 ? 501 1OR A "C5'" 1 
HETATM 2021 O "O5'" . 1OR B 2 .   ? -6.145  13.110 8.893   1.00 38.58 ? 501 1OR A "O5'" 1 
HETATM 2022 C "C4'" . 1OR B 2 .   ? -4.832  14.108 7.293   1.00 42.63 ? 501 1OR A "C4'" 1 
HETATM 2023 O "O4'" . 1OR B 2 .   ? -3.587  14.266 6.550   1.00 43.66 ? 501 1OR A "O4'" 1 
HETATM 2024 C "C3'" . 1OR B 2 .   ? -5.927  13.770 6.291   1.00 43.31 ? 501 1OR A "C3'" 1 
HETATM 2025 O "O3'" . 1OR B 2 .   ? -7.243  13.697 6.839   1.00 42.83 ? 501 1OR A "O3'" 1 
HETATM 2026 C "C2'" . 1OR B 2 .   ? -5.532  14.701 5.148   1.00 43.85 ? 501 1OR A "C2'" 1 
HETATM 2027 O "O2'" . 1OR B 2 .   ? -5.973  16.040 5.185   1.00 43.11 ? 501 1OR A "O2'" 1 
HETATM 2028 C "C1'" . 1OR B 2 .   ? -4.004  14.687 5.210   1.00 46.04 ? 501 1OR A "C1'" 1 
HETATM 2029 N N1    . 1OR B 2 .   ? -3.853  10.270 2.097   1.00 48.35 ? 501 1OR A N1    1 
HETATM 2030 C C2    . 1OR B 2 .   ? -4.680  10.462 3.156   1.00 50.17 ? 501 1OR A C2    1 
HETATM 2031 N N3    . 1OR B 2 .   ? -4.640  11.600 3.866   1.00 48.12 ? 501 1OR A N3    1 
HETATM 2032 C C4    . 1OR B 2 .   ? -3.770  12.645 3.578   1.00 45.71 ? 501 1OR A C4    1 
HETATM 2033 C C5    . 1OR B 2 .   ? -2.893  12.449 2.456   1.00 45.57 ? 501 1OR A C5    1 
HETATM 2034 C C6    . 1OR B 2 .   ? -2.940  11.226 1.702   1.00 47.27 ? 501 1OR A C6    1 
HETATM 2035 N N7    . 1OR B 2 .   ? -2.137  13.608 2.369   1.00 46.76 ? 501 1OR A N7    1 
HETATM 2036 C C8    . 1OR B 2 .   ? -2.488  14.434 3.318   1.00 45.92 ? 501 1OR A C8    1 
HETATM 2037 N N9    . 1OR B 2 .   ? -3.486  13.893 4.086   1.00 45.32 ? 501 1OR A N9    1 
HETATM 2038 N N6    . 1OR B 2 .   ? -2.116  10.996 0.635   1.00 46.86 ? 501 1OR A N6    1 
HETATM 2039 C C26   . 1OR B 2 .   ? -0.820  11.702 0.455   1.00 43.51 ? 501 1OR A C26   1 
HETATM 2040 C C27   . 1OR B 2 .   ? -0.852  12.903 -0.470  1.00 42.01 ? 501 1OR A C27   1 
HETATM 2041 C C28   . 1OR B 2 .   ? 0.557   13.446 -0.468  1.00 38.63 ? 501 1OR A C28   1 
HETATM 2042 C C23   . 1OR B 2 .   ? -2.468  9.985  -0.355  1.00 46.80 ? 501 1OR A C23   1 
HETATM 2043 C C24   . 1OR B 2 .   ? -1.749  8.654  0.047   1.00 49.86 ? 501 1OR A C24   1 
HETATM 2044 C C25   . 1OR B 2 .   ? -2.698  7.520  0.463   1.00 49.76 ? 501 1OR A C25   1 
HETATM 2045 P P     . 1OR C 2 .   ? 1.418   22.998 -15.383 1.00 40.61 ? 502 1OR A P     1 
HETATM 2046 O O1P   . 1OR C 2 .   ? 1.445   22.729 -13.918 1.00 39.33 ? 502 1OR A O1P   1 
HETATM 2047 O O2P   . 1OR C 2 .   ? 2.818   23.017 -15.894 1.00 40.46 ? 502 1OR A O2P   1 
HETATM 2048 C "C5'" . 1OR C 2 .   ? 0.497   24.928 -16.974 1.00 38.69 ? 502 1OR A "C5'" 1 
HETATM 2049 O "O5'" . 1OR C 2 .   ? 0.693   24.386 -15.675 1.00 40.18 ? 502 1OR A "O5'" 1 
HETATM 2050 C "C4'" . 1OR C 2 .   ? -0.478  23.943 -17.572 1.00 38.66 ? 502 1OR A "C4'" 1 
HETATM 2051 O "O4'" . 1OR C 2 .   ? -0.869  24.216 -18.935 1.00 40.42 ? 502 1OR A "O4'" 1 
HETATM 2052 C "C3'" . 1OR C 2 .   ? 0.117   22.544 -17.542 1.00 38.82 ? 502 1OR A "C3'" 1 
HETATM 2053 O "O3'" . 1OR C 2 .   ? 0.439   22.062 -16.239 1.00 38.77 ? 502 1OR A "O3'" 1 
HETATM 2054 C "C2'" . 1OR C 2 .   ? -0.836  21.831 -18.486 1.00 38.77 ? 502 1OR A "C2'" 1 
HETATM 2055 O "O2'" . 1OR C 2 .   ? -2.034  21.330 -17.932 1.00 37.37 ? 502 1OR A "O2'" 1 
HETATM 2056 C "C1'" . 1OR C 2 .   ? -1.166  22.916 -19.511 1.00 39.85 ? 502 1OR A "C1'" 1 
HETATM 2057 N N1    . 1OR C 2 .   ? 3.232   22.287 -22.551 1.00 48.08 ? 502 1OR A N1    1 
HETATM 2058 C C2    . 1OR C 2 .   ? 3.223   22.495 -21.209 1.00 45.20 ? 502 1OR A C2    1 
HETATM 2059 N N3    . 1OR C 2 .   ? 2.067   22.633 -20.545 1.00 45.09 ? 502 1OR A N3    1 
HETATM 2060 C C4    . 1OR C 2 .   ? 0.815   22.568 -21.167 1.00 44.90 ? 502 1OR A C4    1 
HETATM 2061 C C5    . 1OR C 2 .   ? 0.815   22.342 -22.591 1.00 47.57 ? 502 1OR A C5    1 
HETATM 2062 C C6    . 1OR C 2 .   ? 2.064   22.202 -23.288 1.00 49.69 ? 502 1OR A C6    1 
HETATM 2063 N N7    . 1OR C 2 .   ? -0.523  22.316 -22.975 1.00 45.86 ? 502 1OR A N7    1 
HETATM 2064 C C8    . 1OR C 2 .   ? -1.279  22.509 -21.919 1.00 42.57 ? 502 1OR A C8    1 
HETATM 2065 N N9    . 1OR C 2 .   ? -0.504  22.671 -20.793 1.00 41.38 ? 502 1OR A N9    1 
HETATM 2066 N N6    . 1OR C 2 .   ? 2.103   22.010 -24.626 1.00 53.36 ? 502 1OR A N6    1 
HETATM 2067 C C26   . 1OR C 2 .   ? 1.202   21.072 -25.316 1.00 56.15 ? 502 1OR A C26   1 
HETATM 2068 C C27   . 1OR C 2 .   ? 0.136   21.728 -26.172 1.00 55.13 ? 502 1OR A C27   1 
HETATM 2069 C C28   . 1OR C 2 .   ? -0.641  20.577 -26.757 1.00 58.09 ? 502 1OR A C28   1 
HETATM 2070 C C23   . 1OR C 2 .   ? 3.039   22.796 -25.453 1.00 56.27 ? 502 1OR A C23   1 
HETATM 2071 C C24   . 1OR C 2 .   ? 4.342   21.976 -25.712 1.00 55.73 ? 502 1OR A C24   1 
HETATM 2072 C C25   . 1OR C 2 .   ? 5.634   22.705 -25.318 1.00 55.51 ? 502 1OR A C25   1 
HETATM 2073 O O     . HOH D 3 .   ? -19.831 29.375 15.351  1.00 30.31 ? 601 HOH A O     1 
HETATM 2074 O O     . HOH D 3 .   ? -28.462 22.276 15.791  1.00 45.26 ? 602 HOH A O     1 
HETATM 2075 O O     . HOH D 3 .   ? -20.793 24.484 15.943  1.00 37.72 ? 603 HOH A O     1 
HETATM 2076 O O     . HOH D 3 .   ? -12.003 30.973 23.714  1.00 32.92 ? 604 HOH A O     1 
HETATM 2077 O O     . HOH D 3 .   ? -14.381 35.775 15.048  1.00 42.71 ? 605 HOH A O     1 
HETATM 2078 O O     . HOH D 3 .   ? -11.254 37.832 23.367  1.00 38.87 ? 606 HOH A O     1 
HETATM 2079 O O     . HOH D 3 .   ? 6.639   33.784 -12.082 1.00 40.83 ? 607 HOH A O     1 
HETATM 2080 O O     . HOH D 3 .   ? 1.338   29.111 -6.052  1.00 47.31 ? 608 HOH A O     1 
HETATM 2081 O O     . HOH D 3 .   ? -2.379  34.300 8.737   1.00 41.34 ? 609 HOH A O     1 
HETATM 2082 O O     . HOH D 3 .   ? -6.075  5.631  -5.466  1.00 38.57 ? 610 HOH A O     1 
HETATM 2083 O O     . HOH D 3 .   ? -18.373 16.476 -19.528 1.00 43.10 ? 611 HOH A O     1 
HETATM 2084 O O     . HOH D 3 .   ? -18.751 12.734 -7.296  1.00 46.17 ? 612 HOH A O     1 
HETATM 2085 O O     . HOH D 3 .   ? -2.556  32.464 -20.647 1.00 35.91 ? 613 HOH A O     1 
HETATM 2086 O O     . HOH D 3 .   ? -13.497 24.533 16.995  1.00 43.20 ? 614 HOH A O     1 
HETATM 2087 O O     . HOH D 3 .   ? -8.191  30.846 20.151  1.00 44.46 ? 615 HOH A O     1 
HETATM 2088 O O     . HOH D 3 .   ? -4.020  12.322 16.065  1.00 44.36 ? 616 HOH A O     1 
HETATM 2089 O O     . HOH D 3 .   ? -11.733 11.965 19.811  1.00 50.82 ? 617 HOH A O     1 
HETATM 2090 O O     . HOH D 3 .   ? -13.290 24.805 25.196  1.00 48.70 ? 618 HOH A O     1 
HETATM 2091 O O     . HOH D 3 .   ? -7.948  20.378 20.860  1.00 52.64 ? 619 HOH A O     1 
HETATM 2092 O O     . HOH D 3 .   ? 2.824   17.487 -0.813  1.00 39.96 ? 620 HOH A O     1 
HETATM 2093 O O     . HOH D 3 .   ? -16.995 18.348 27.708  1.00 46.29 ? 621 HOH A O     1 
HETATM 2094 O O     . HOH D 3 .   ? -14.152 36.562 17.398  1.00 35.55 ? 622 HOH A O     1 
HETATM 2095 O O     . HOH D 3 .   ? -0.125  18.985 19.408  1.00 45.22 ? 623 HOH A O     1 
HETATM 2096 O O     . HOH D 3 .   ? -5.962  6.051  19.090  1.00 45.09 ? 624 HOH A O     1 
HETATM 2097 O O     . HOH D 3 .   ? -1.622  2.993  5.261   1.00 52.58 ? 625 HOH A O     1 
HETATM 2098 O O     . HOH D 3 .   ? -25.758 16.143 -9.923  1.00 50.38 ? 626 HOH A O     1 
HETATM 2099 O O     . HOH D 3 .   ? -9.270  9.418  7.751   1.00 29.46 ? 627 HOH A O     1 
HETATM 2100 O O     . HOH D 3 .   ? -9.788  22.395 1.929   1.00 44.26 ? 628 HOH A O     1 
HETATM 2101 O O     . HOH D 3 .   ? -4.389  22.402 1.346   1.00 40.22 ? 629 HOH A O     1 
HETATM 2102 O O     . HOH D 3 .   ? -8.043  21.999 -0.187  1.00 45.36 ? 630 HOH A O     1 
HETATM 2103 O O     . HOH D 3 .   ? -6.282  13.566 16.077  1.00 37.38 ? 631 HOH A O     1 
HETATM 2104 O O     . HOH D 3 .   ? -12.326 20.208 19.624  1.00 30.88 ? 632 HOH A O     1 
HETATM 2105 O O     . HOH D 3 .   ? -5.598  31.056 -9.210  1.00 32.02 ? 633 HOH A O     1 
HETATM 2106 O O     . HOH D 3 .   ? -15.670 23.635 -1.175  1.00 39.55 ? 634 HOH A O     1 
HETATM 2107 O O     . HOH D 3 .   ? -17.523 20.495 23.771  1.00 44.27 ? 635 HOH A O     1 
HETATM 2108 O O     . HOH D 3 .   ? -17.507 22.005 1.339   1.00 42.44 ? 636 HOH A O     1 
HETATM 2109 O O     . HOH D 3 .   ? -7.874  37.444 -1.226  1.00 43.73 ? 637 HOH A O     1 
HETATM 2110 O O     . HOH D 3 .   ? -16.752 13.397 -6.258  1.00 54.89 ? 638 HOH A O     1 
HETATM 2111 O O     . HOH D 3 .   ? -8.096  17.819 -20.694 1.00 46.38 ? 639 HOH A O     1 
HETATM 2112 O O     . HOH D 3 .   ? -13.923 41.830 6.472   1.00 53.27 ? 640 HOH A O     1 
HETATM 2113 O O     . HOH D 3 .   ? -12.107 32.517 -6.369  1.00 40.31 ? 641 HOH A O     1 
HETATM 2114 O O     . HOH D 3 .   ? -1.191  26.518 -7.818  1.00 37.70 ? 642 HOH A O     1 
HETATM 2115 O O     . HOH D 3 .   ? -19.867 26.849 -10.790 1.00 41.44 ? 643 HOH A O     1 
HETATM 2116 O O     . HOH D 3 .   ? 4.776   21.136 -15.258 1.00 39.45 ? 644 HOH A O     1 
HETATM 2117 O O     . HOH D 3 .   ? -8.594  19.721 -2.453  1.00 37.20 ? 645 HOH A O     1 
HETATM 2118 O O     . HOH D 3 .   ? -5.701  14.574 0.666   1.00 43.36 ? 646 HOH A O     1 
HETATM 2119 O O     . HOH D 3 .   ? -4.506  7.663  -5.946  1.00 44.30 ? 647 HOH A O     1 
HETATM 2120 O O     . HOH D 3 .   ? -3.937  39.054 19.286  1.00 51.37 ? 648 HOH A O     1 
HETATM 2121 O O     . HOH D 3 .   ? -0.296  38.175 1.449   1.00 44.10 ? 649 HOH A O     1 
HETATM 2122 O O     . HOH D 3 .   ? -13.153 14.155 18.158  1.00 52.63 ? 650 HOH A O     1 
HETATM 2123 O O     . HOH D 3 .   ? -1.399  39.208 -1.678  1.00 54.04 ? 651 HOH A O     1 
HETATM 2124 O O     . HOH D 3 .   ? -14.485 36.429 12.714  1.00 33.35 ? 652 HOH A O     1 
HETATM 2125 O O     . HOH D 3 .   ? -8.794  36.743 22.949  1.00 39.24 ? 653 HOH A O     1 
HETATM 2126 O O     . HOH D 3 .   ? -6.460  39.231 6.143   1.00 33.95 ? 654 HOH A O     1 
HETATM 2127 O O     . HOH D 3 .   ? -5.006  41.054 1.742   1.00 38.97 ? 655 HOH A O     1 
HETATM 2128 O O     . HOH D 3 .   ? -2.294  21.284 0.004   1.00 51.22 ? 656 HOH A O     1 
HETATM 2129 O O     . HOH D 3 .   ? -10.510 34.056 4.740   1.00 44.40 ? 657 HOH A O     1 
HETATM 2130 O O     . HOH D 3 .   ? -0.844  36.533 8.553   1.00 48.22 ? 658 HOH A O     1 
HETATM 2131 O O     . HOH D 3 .   ? -3.220  42.171 12.739  1.00 46.27 ? 659 HOH A O     1 
HETATM 2132 O O     . HOH D 3 .   ? -16.650 31.831 0.793   1.00 37.41 ? 660 HOH A O     1 
HETATM 2133 O O     . HOH D 3 .   ? -18.356 35.407 6.380   1.00 45.77 ? 661 HOH A O     1 
HETATM 2134 O O     . HOH D 3 .   ? -27.669 31.526 11.876  1.00 50.76 ? 662 HOH A O     1 
HETATM 2135 O O     . HOH D 3 .   ? -25.208 28.407 7.362   1.00 41.03 ? 663 HOH A O     1 
HETATM 2136 O O     . HOH D 3 .   ? -18.791 27.989 22.595  1.00 39.41 ? 664 HOH A O     1 
HETATM 2137 O O     . HOH D 3 .   ? -20.748 25.779 23.437  1.00 45.69 ? 665 HOH A O     1 
HETATM 2138 O O     . HOH D 3 .   ? -13.688 24.398 19.674  1.00 44.37 ? 666 HOH A O     1 
HETATM 2139 O O     . HOH D 3 .   ? -12.021 29.904 26.114  1.00 36.24 ? 667 HOH A O     1 
HETATM 2140 O O     . HOH D 3 .   ? -11.119 40.422 22.541  1.00 43.10 ? 668 HOH A O     1 
HETATM 2141 O O     . HOH D 3 .   ? -3.431  4.697  -13.538 1.00 54.04 ? 669 HOH A O     1 
HETATM 2142 O O     . HOH D 3 .   ? -2.074  39.242 21.837  1.00 45.20 ? 670 HOH A O     1 
HETATM 2143 O O     . HOH D 3 .   ? -27.994 22.220 21.725  1.00 44.12 ? 671 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   112 ?   ?   ?   A . n 
A 1 2   VAL 2   113 ?   ?   ?   A . n 
A 1 3   CYS 3   114 ?   ?   ?   A . n 
A 1 4   ALA 4   115 ?   ?   ?   A . n 
A 1 5   GLU 5   116 ?   ?   ?   A . n 
A 1 6   ALA 6   117 ?   ?   ?   A . n 
A 1 7   TYR 7   118 ?   ?   ?   A . n 
A 1 8   ASN 8   119 ?   ?   ?   A . n 
A 1 9   PRO 9   120 ?   ?   ?   A . n 
A 1 10  ASP 10  121 ?   ?   ?   A . n 
A 1 11  GLU 11  122 ?   ?   ?   A . n 
A 1 12  GLU 12  123 ?   ?   ?   A . n 
A 1 13  GLU 13  124 ?   ?   ?   A . n 
A 1 14  ASP 14  125 ?   ?   ?   A . n 
A 1 15  ASP 15  126 ?   ?   ?   A . n 
A 1 16  ALA 16  127 127 ALA ALA A . n 
A 1 17  GLU 17  128 128 GLU ALA A . n 
A 1 18  SER 18  129 129 SER SER A . n 
A 1 19  ARG 19  130 130 ARG ARG A . n 
A 1 20  ILE 20  131 131 ILE ILE A . n 
A 1 21  ILE 21  132 132 ILE ILE A . n 
A 1 22  HIS 22  133 133 HIS HIS A . n 
A 1 23  PRO 23  134 134 PRO PRO A . n 
A 1 24  LYS 24  135 135 LYS LYS A . n 
A 1 25  THR 25  136 136 THR THR A . n 
A 1 26  ASP 26  137 137 ASP ASP A . n 
A 1 27  ASP 27  138 138 ASP ASP A . n 
A 1 28  GLN 28  139 139 GLN GLN A . n 
A 1 29  ARG 29  140 140 ARG ARG A . n 
A 1 30  ASN 30  141 141 ASN ASN A . n 
A 1 31  ARG 31  142 142 ARG ARG A . n 
A 1 32  LEU 32  143 143 LEU LEU A . n 
A 1 33  GLN 33  144 144 GLN GLN A . n 
A 1 34  GLU 34  145 145 GLU GLU A . n 
A 1 35  ALA 35  146 146 ALA ALA A . n 
A 1 36  CYS 36  147 147 CYS CYS A . n 
A 1 37  LYS 37  148 148 LYS LYS A . n 
A 1 38  ASP 38  149 149 ASP ASP A . n 
A 1 39  ILE 39  150 150 ILE ILE A . n 
A 1 40  LEU 40  151 151 LEU LEU A . n 
A 1 41  LEU 41  152 152 LEU LEU A . n 
A 1 42  PHE 42  153 153 PHE PHE A . n 
A 1 43  LYS 43  154 154 LYS LYS A . n 
A 1 44  ASN 44  155 155 ASN ASN A . n 
A 1 45  LEU 45  156 156 LEU LEU A . n 
A 1 46  ASP 46  157 157 ASP ASP A . n 
A 1 47  PRO 47  158 158 PRO PRO A . n 
A 1 48  GLU 48  159 159 GLU GLU A . n 
A 1 49  GLN 49  160 160 GLN GLN A . n 
A 1 50  MET 50  161 161 MET MET A . n 
A 1 51  SER 51  162 162 SER SER A . n 
A 1 52  GLN 52  163 163 GLN GLN A . n 
A 1 53  VAL 53  164 164 VAL VAL A . n 
A 1 54  LEU 54  165 165 LEU LEU A . n 
A 1 55  ASP 55  166 166 ASP ASP A . n 
A 1 56  ALA 56  167 167 ALA ALA A . n 
A 1 57  MET 57  168 168 MET MET A . n 
A 1 58  PHE 58  169 169 PHE PHE A . n 
A 1 59  GLU 59  170 170 GLU GLU A . n 
A 1 60  LYS 60  171 171 LYS LYS A . n 
A 1 61  LEU 61  172 172 LEU LEU A . n 
A 1 62  VAL 62  173 173 VAL VAL A . n 
A 1 63  LYS 63  174 174 LYS LYS A . n 
A 1 64  GLU 64  175 175 GLU GLU A . n 
A 1 65  GLY 65  176 176 GLY GLY A . n 
A 1 66  GLU 66  177 177 GLU GLU A . n 
A 1 67  HIS 67  178 178 HIS HIS A . n 
A 1 68  VAL 68  179 179 VAL VAL A . n 
A 1 69  ILE 69  180 180 ILE ILE A . n 
A 1 70  ASP 70  181 181 ASP ASP A . n 
A 1 71  GLN 71  182 182 GLN GLN A . n 
A 1 72  GLY 72  183 183 GLY GLY A . n 
A 1 73  ASP 73  184 184 ASP ASP A . n 
A 1 74  ASP 74  185 185 ASP ASP A . n 
A 1 75  GLY 75  186 186 GLY GLY A . n 
A 1 76  ASP 76  187 187 ASP ASP A . n 
A 1 77  ASN 77  188 188 ASN ASN A . n 
A 1 78  PHE 78  189 189 PHE PHE A . n 
A 1 79  TYR 79  190 190 TYR TYR A . n 
A 1 80  VAL 80  191 191 VAL VAL A . n 
A 1 81  ILE 81  192 192 ILE ILE A . n 
A 1 82  ASP 82  193 193 ASP ASP A . n 
A 1 83  ARG 83  194 194 ARG ARG A . n 
A 1 84  GLY 84  195 195 GLY GLY A . n 
A 1 85  THR 85  196 196 THR THR A . n 
A 1 86  PHE 86  197 197 PHE PHE A . n 
A 1 87  ASP 87  198 198 ASP ASP A . n 
A 1 88  ILE 88  199 199 ILE ILE A . n 
A 1 89  TYR 89  200 200 TYR TYR A . n 
A 1 90  VAL 90  201 201 VAL VAL A . n 
A 1 91  LYS 91  202 202 LYS LYS A . n 
A 1 92  CYS 92  203 203 CYS ALA A . n 
A 1 93  ASP 93  204 204 ASP ASP A . n 
A 1 94  GLY 94  205 205 GLY GLY A . n 
A 1 95  VAL 95  206 206 VAL VAL A . n 
A 1 96  GLY 96  207 207 GLY GLY A . n 
A 1 97  ARG 97  208 208 ARG ARG A . n 
A 1 98  CYS 98  209 209 CYS CYS A . n 
A 1 99  VAL 99  210 210 VAL VAL A . n 
A 1 100 GLY 100 211 211 GLY GLY A . n 
A 1 101 ASN 101 212 212 ASN ASN A . n 
A 1 102 TYR 102 213 213 TYR TYR A . n 
A 1 103 ASP 103 214 214 ASP ASP A . n 
A 1 104 ASN 104 215 215 ASN ASN A . n 
A 1 105 ARG 105 216 216 ARG ARG A . n 
A 1 106 GLY 106 217 217 GLY GLY A . n 
A 1 107 SER 107 218 218 SER SER A . n 
A 1 108 PHE 108 219 219 PHE PHE A . n 
A 1 109 GLY 109 220 220 GLY GLY A . n 
A 1 110 GLU 110 221 221 GLU GLU A . n 
A 1 111 LEU 111 222 222 LEU LEU A . n 
A 1 112 ALA 112 223 223 ALA ALA A . n 
A 1 113 LEU 113 224 224 LEU LEU A . n 
A 1 114 MET 114 225 225 MET MET A . n 
A 1 115 TYR 115 226 226 TYR TYR A . n 
A 1 116 ASN 116 227 227 ASN ASN A . n 
A 1 117 THR 117 228 228 THR THR A . n 
A 1 118 PRO 118 229 229 PRO PRO A . n 
A 1 119 ARG 119 230 230 ARG ARG A . n 
A 1 120 ALA 120 231 231 ALA ALA A . n 
A 1 121 ALA 121 232 232 ALA ALA A . n 
A 1 122 THR 122 233 233 THR THR A . n 
A 1 123 ILE 123 234 234 ILE ILE A . n 
A 1 124 THR 124 235 235 THR THR A . n 
A 1 125 ALA 125 236 236 ALA ALA A . n 
A 1 126 THR 126 237 237 THR THR A . n 
A 1 127 SER 127 238 238 SER SER A . n 
A 1 128 PRO 128 239 239 PRO PRO A . n 
A 1 129 GLY 129 240 240 GLY GLY A . n 
A 1 130 ALA 130 241 241 ALA ALA A . n 
A 1 131 LEU 131 242 242 LEU LEU A . n 
A 1 132 TRP 132 243 243 TRP TRP A . n 
A 1 133 GLY 133 244 244 GLY GLY A . n 
A 1 134 LEU 134 245 245 LEU LEU A . n 
A 1 135 ASP 135 246 246 ASP ASP A . n 
A 1 136 ARG 136 247 247 ARG ARG A . n 
A 1 137 VAL 137 248 248 VAL VAL A . n 
A 1 138 THR 138 249 249 THR THR A . n 
A 1 139 PHE 139 250 250 PHE PHE A . n 
A 1 140 ARG 140 251 251 ARG ARG A . n 
A 1 141 ARG 141 252 252 ARG ARG A . n 
A 1 142 ILE 142 253 253 ILE ILE A . n 
A 1 143 ILE 143 254 254 ILE ILE A . n 
A 1 144 VAL 144 255 255 VAL VAL A . n 
A 1 145 LYS 145 256 256 LYS LYS A . n 
A 1 146 ASN 146 257 257 ASN ASN A . n 
A 1 147 ASN 147 258 258 ASN ASN A . n 
A 1 148 ALA 148 259 259 ALA ALA A . n 
A 1 149 LYS 149 260 260 LYS LYS A . n 
A 1 150 LYS 150 261 261 LYS LYS A . n 
A 1 151 ARG 151 262 262 ARG ARG A . n 
A 1 152 LYS 152 263 263 LYS LYS A . n 
A 1 153 MET 153 264 264 MET MET A . n 
A 1 154 TYR 154 265 265 TYR TYR A . n 
A 1 155 GLU 155 266 266 GLU GLU A . n 
A 1 156 SER 156 267 267 SER SER A . n 
A 1 157 PHE 157 268 268 PHE PHE A . n 
A 1 158 ILE 158 269 269 ILE ILE A . n 
A 1 159 GLU 159 270 270 GLU GLU A . n 
A 1 160 SER 160 271 271 SER SER A . n 
A 1 161 LEU 161 272 272 LEU LEU A . n 
A 1 162 PRO 162 273 273 PRO PRO A . n 
A 1 163 PHE 163 274 274 PHE PHE A . n 
A 1 164 LEU 164 275 275 LEU LEU A . n 
A 1 165 LYS 165 276 276 LYS ALA A . n 
A 1 166 SER 166 277 277 SER SER A . n 
A 1 167 LEU 167 278 278 LEU LEU A . n 
A 1 168 GLU 168 279 279 GLU ALA A . n 
A 1 169 VAL 169 280 280 VAL ALA A . n 
A 1 170 SER 170 281 281 SER ALA A . n 
A 1 171 GLU 171 282 282 GLU GLU A . n 
A 1 172 ARG 172 283 283 ARG ARG A . n 
A 1 173 LEU 173 284 284 LEU LEU A . n 
A 1 174 LYS 174 285 285 LYS LYS A . n 
A 1 175 VAL 175 286 286 VAL VAL A . n 
A 1 176 VAL 176 287 287 VAL VAL A . n 
A 1 177 ASP 177 288 288 ASP ASP A . n 
A 1 178 VAL 178 289 289 VAL VAL A . n 
A 1 179 ILE 179 290 290 ILE ILE A . n 
A 1 180 GLY 180 291 291 GLY GLY A . n 
A 1 181 THR 181 292 292 THR THR A . n 
A 1 182 LYS 182 293 293 LYS LYS A . n 
A 1 183 VAL 183 294 294 VAL VAL A . n 
A 1 184 TYR 184 295 295 TYR TYR A . n 
A 1 185 ASN 185 296 296 ASN ASN A . n 
A 1 186 ASP 186 297 297 ASP ASP A . n 
A 1 187 GLY 187 298 298 GLY GLY A . n 
A 1 188 GLU 188 299 299 GLU GLU A . n 
A 1 189 GLN 189 300 300 GLN GLN A . n 
A 1 190 ILE 190 301 301 ILE ILE A . n 
A 1 191 ILE 191 302 302 ILE ILE A . n 
A 1 192 ALA 192 303 303 ALA ALA A . n 
A 1 193 GLN 193 304 304 GLN GLN A . n 
A 1 194 GLY 194 305 305 GLY GLY A . n 
A 1 195 ASP 195 306 306 ASP ASP A . n 
A 1 196 SER 196 307 307 SER SER A . n 
A 1 197 ALA 197 308 308 ALA ALA A . n 
A 1 198 ASP 198 309 309 ASP ASP A . n 
A 1 199 SER 199 310 310 SER SER A . n 
A 1 200 PHE 200 311 311 PHE PHE A . n 
A 1 201 PHE 201 312 312 PHE PHE A . n 
A 1 202 ILE 202 313 313 ILE ILE A . n 
A 1 203 VAL 203 314 314 VAL VAL A . n 
A 1 204 GLU 204 315 315 GLU GLU A . n 
A 1 205 SER 205 316 316 SER SER A . n 
A 1 206 GLY 206 317 317 GLY GLY A . n 
A 1 207 GLU 207 318 318 GLU ALA A . n 
A 1 208 VAL 208 319 319 VAL VAL A . n 
A 1 209 ARG 209 320 320 ARG ARG A . n 
A 1 210 ILE 210 321 321 ILE ILE A . n 
A 1 211 THR 211 322 322 THR THR A . n 
A 1 212 MET 212 323 323 MET MET A . n 
A 1 213 LYS 213 324 324 LYS ALA A . n 
A 1 214 ARG 214 325 325 ARG ARG A . n 
A 1 215 LYS 215 326 326 LYS ALA A . n 
A 1 216 GLY 216 327 327 GLY ALA A . n 
A 1 217 LYS 217 328 328 LYS ALA A . n 
A 1 218 SER 218 329 ?   ?   ?   A . n 
A 1 219 ASP 219 330 ?   ?   ?   A . n 
A 1 220 ILE 220 331 ?   ?   ?   A . n 
A 1 221 GLU 221 332 ?   ?   ?   A . n 
A 1 222 GLU 222 333 ?   ?   ?   A . n 
A 1 223 ASN 223 334 ?   ?   ?   A . n 
A 1 224 GLY 224 335 ?   ?   ?   A . n 
A 1 225 ALA 225 336 336 ALA ALA A . n 
A 1 226 VAL 226 337 337 VAL VAL A . n 
A 1 227 GLU 227 338 338 GLU GLU A . n 
A 1 228 ILE 228 339 339 ILE ILE A . n 
A 1 229 ALA 229 340 340 ALA ALA A . n 
A 1 230 ARG 230 341 341 ARG ARG A . n 
A 1 231 CYS 231 342 342 CYS CYS A . n 
A 1 232 LEU 232 343 343 LEU LEU A . n 
A 1 233 ARG 233 344 344 ARG ARG A . n 
A 1 234 GLY 234 345 345 GLY GLY A . n 
A 1 235 GLN 235 346 346 GLN GLN A . n 
A 1 236 TYR 236 347 347 TYR TYR A . n 
A 1 237 PHE 237 348 348 PHE PHE A . n 
A 1 238 GLY 238 349 349 GLY GLY A . n 
A 1 239 GLU 239 350 350 GLU GLU A . n 
A 1 240 LEU 240 351 351 LEU LEU A . n 
A 1 241 ALA 241 352 352 ALA ALA A . n 
A 1 242 LEU 242 353 353 LEU LEU A . n 
A 1 243 VAL 243 354 354 VAL VAL A . n 
A 1 244 THR 244 355 355 THR THR A . n 
A 1 245 ASN 245 356 356 ASN ASN A . n 
A 1 246 LYS 246 357 357 LYS LYS A . n 
A 1 247 PRO 247 358 358 PRO PRO A . n 
A 1 248 ARG 248 359 359 ARG ARG A . n 
A 1 249 ALA 249 360 360 ALA ALA A . n 
A 1 250 ALA 250 361 361 ALA ALA A . n 
A 1 251 SER 251 362 362 SER SER A . n 
A 1 252 ALA 252 363 363 ALA ALA A . n 
A 1 253 HIS 253 364 364 HIS HIS A . n 
A 1 254 ALA 254 365 365 ALA ALA A . n 
A 1 255 ILE 255 366 366 ILE ILE A . n 
A 1 256 GLY 256 367 367 GLY GLY A . n 
A 1 257 THR 257 368 368 THR THR A . n 
A 1 258 VAL 258 369 369 VAL VAL A . n 
A 1 259 LYS 259 370 370 LYS LYS A . n 
A 1 260 CYS 260 371 371 CYS CYS A . n 
A 1 261 LEU 261 372 372 LEU LEU A . n 
A 1 262 ALA 262 373 373 ALA ALA A . n 
A 1 263 MET 263 374 374 MET MET A . n 
A 1 264 ASP 264 375 375 ASP ASP A . n 
A 1 265 VAL 265 376 376 VAL VAL A . n 
A 1 266 GLN 266 377 377 GLN GLN A . n 
A 1 267 ALA 267 378 378 ALA ALA A . n 
A 1 268 PHE 268 379 379 PHE PHE A . n 
A 1 269 GLU 269 380 380 GLU GLU A . n 
A 1 270 ARG 270 381 381 ARG ARG A . n 
A 1 271 LEU 271 382 382 LEU LEU A . n 
A 1 272 LEU 272 383 383 LEU LEU A . n 
A 1 273 GLY 273 384 384 GLY GLY A . n 
A 1 274 PRO 274 385 385 PRO PRO A . n 
A 1 275 CYS 275 386 386 CYS CYS A . n 
A 1 276 MET 276 387 387 MET ALA A . n 
A 1 277 GLU 277 388 388 GLU ALA A . n 
A 1 278 ILE 278 389 389 ILE ALA A . n 
A 1 279 MET 279 390 390 MET ALA A . n 
A 1 280 LYS 280 391 391 LYS ALA A . n 
A 1 281 ARG 281 392 392 ARG ALA A . n 
A 1 282 ASN 282 393 393 ASN ALA A . n 
A 1 283 ILE 283 394 394 ILE ALA A . n 
A 1 284 ALA 284 395 395 ALA ALA A . n 
A 1 285 THR 285 396 396 THR THR A . n 
A 1 286 TYR 286 397 397 TYR TYR A . n 
A 1 287 GLU 287 398 ?   ?   ?   A . n 
A 1 288 GLU 288 399 ?   ?   ?   A . n 
A 1 289 GLN 289 400 ?   ?   ?   A . n 
A 1 290 LEU 290 401 ?   ?   ?   A . n 
A 1 291 VAL 291 402 ?   ?   ?   A . n 
A 1 292 ALA 292 403 ?   ?   ?   A . n 
A 1 293 LEU 293 404 ?   ?   ?   A . n 
A 1 294 PHE 294 405 ?   ?   ?   A . n 
A 1 295 GLY 295 406 ?   ?   ?   A . n 
A 1 296 THR 296 407 ?   ?   ?   A . n 
A 1 297 ASN 297 408 ?   ?   ?   A . n 
A 1 298 MET 298 409 ?   ?   ?   A . n 
A 1 299 ASP 299 410 ?   ?   ?   A . n 
A 1 300 ILE 300 411 ?   ?   ?   A . n 
A 1 301 VAL 301 412 ?   ?   ?   A . n 
A 1 302 GLU 302 413 ?   ?   ?   A . n 
A 1 303 PRO 303 414 ?   ?   ?   A . n 
A 1 304 THR 304 415 ?   ?   ?   A . n 
A 1 305 ALA 305 416 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-09-18 
2 'Structure model' 1 1 2013-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum ? 1 
PHASES   phasing           .       ? 2 
CNS      refinement        1.2     ? 3 
HKL-2000 'data reduction'  .       ? 4 
HKL-2000 'data scaling'    .       ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 184 ? ? -59.63  173.54  
2  1 ASN A 212 ? ? 174.82  170.82  
3  1 ASN A 227 ? ? 38.71   52.72   
4  1 SER A 238 ? ? 163.37  161.83  
5  1 ASP A 306 ? ? -43.70  159.83  
6  1 ASP A 309 ? ? -140.27 21.22   
7  1 LYS A 324 ? ? -123.38 -163.80 
8  1 LYS A 326 ? ? -37.11  72.94   
9  1 THR A 355 ? ? -61.44  0.18    
10 1 PRO A 385 ? ? -62.78  3.03    
11 1 THR A 396 ? ? -74.28  21.66   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 128 ? CG  ? A GLU 17  CG  
2  1 Y 1 A GLU 128 ? CD  ? A GLU 17  CD  
3  1 Y 1 A GLU 128 ? OE1 ? A GLU 17  OE1 
4  1 Y 1 A GLU 128 ? OE2 ? A GLU 17  OE2 
5  1 Y 1 A CYS 203 ? SG  ? A CYS 92  SG  
6  1 Y 1 A LYS 276 ? CG  ? A LYS 165 CG  
7  1 Y 1 A LYS 276 ? CD  ? A LYS 165 CD  
8  1 Y 1 A LYS 276 ? CE  ? A LYS 165 CE  
9  1 Y 1 A LYS 276 ? NZ  ? A LYS 165 NZ  
10 1 Y 1 A GLU 279 ? CG  ? A GLU 168 CG  
11 1 Y 1 A GLU 279 ? CD  ? A GLU 168 CD  
12 1 Y 1 A GLU 279 ? OE1 ? A GLU 168 OE1 
13 1 Y 1 A GLU 279 ? OE2 ? A GLU 168 OE2 
14 1 Y 1 A VAL 280 ? CG1 ? A VAL 169 CG1 
15 1 Y 1 A VAL 280 ? CG2 ? A VAL 169 CG2 
16 1 Y 1 A SER 281 ? OG  ? A SER 170 OG  
17 1 Y 1 A GLU 318 ? CG  ? A GLU 207 CG  
18 1 Y 1 A GLU 318 ? CD  ? A GLU 207 CD  
19 1 Y 1 A GLU 318 ? OE1 ? A GLU 207 OE1 
20 1 Y 1 A GLU 318 ? OE2 ? A GLU 207 OE2 
21 1 Y 1 A LYS 324 ? CG  ? A LYS 213 CG  
22 1 Y 1 A LYS 324 ? CD  ? A LYS 213 CD  
23 1 Y 1 A LYS 324 ? CE  ? A LYS 213 CE  
24 1 Y 1 A LYS 324 ? NZ  ? A LYS 213 NZ  
25 1 Y 1 A LYS 326 ? CG  ? A LYS 215 CG  
26 1 Y 1 A LYS 326 ? CD  ? A LYS 215 CD  
27 1 Y 1 A LYS 326 ? CE  ? A LYS 215 CE  
28 1 Y 1 A LYS 326 ? NZ  ? A LYS 215 NZ  
29 1 Y 1 A LYS 328 ? CG  ? A LYS 217 CG  
30 1 Y 1 A LYS 328 ? CD  ? A LYS 217 CD  
31 1 Y 1 A LYS 328 ? CE  ? A LYS 217 CE  
32 1 Y 1 A LYS 328 ? NZ  ? A LYS 217 NZ  
33 1 Y 1 A MET 387 ? CG  ? A MET 276 CG  
34 1 Y 1 A MET 387 ? SD  ? A MET 276 SD  
35 1 Y 1 A MET 387 ? CE  ? A MET 276 CE  
36 1 Y 1 A GLU 388 ? CG  ? A GLU 277 CG  
37 1 Y 1 A GLU 388 ? CD  ? A GLU 277 CD  
38 1 Y 1 A GLU 388 ? OE1 ? A GLU 277 OE1 
39 1 Y 1 A GLU 388 ? OE2 ? A GLU 277 OE2 
40 1 Y 1 A ILE 389 ? CG1 ? A ILE 278 CG1 
41 1 Y 1 A ILE 389 ? CG2 ? A ILE 278 CG2 
42 1 Y 1 A ILE 389 ? CD1 ? A ILE 278 CD1 
43 1 Y 1 A MET 390 ? CG  ? A MET 279 CG  
44 1 Y 1 A MET 390 ? SD  ? A MET 279 SD  
45 1 Y 1 A MET 390 ? CE  ? A MET 279 CE  
46 1 Y 1 A LYS 391 ? CG  ? A LYS 280 CG  
47 1 Y 1 A LYS 391 ? CD  ? A LYS 280 CD  
48 1 Y 1 A LYS 391 ? CE  ? A LYS 280 CE  
49 1 Y 1 A LYS 391 ? NZ  ? A LYS 280 NZ  
50 1 Y 1 A ARG 392 ? CG  ? A ARG 281 CG  
51 1 Y 1 A ARG 392 ? CD  ? A ARG 281 CD  
52 1 Y 1 A ARG 392 ? NE  ? A ARG 281 NE  
53 1 Y 1 A ARG 392 ? CZ  ? A ARG 281 CZ  
54 1 Y 1 A ARG 392 ? NH1 ? A ARG 281 NH1 
55 1 Y 1 A ARG 392 ? NH2 ? A ARG 281 NH2 
56 1 Y 1 A ASN 393 ? CG  ? A ASN 282 CG  
57 1 Y 1 A ASN 393 ? OD1 ? A ASN 282 OD1 
58 1 Y 1 A ASN 393 ? ND2 ? A ASN 282 ND2 
59 1 Y 1 A ILE 394 ? CG1 ? A ILE 283 CG1 
60 1 Y 1 A ILE 394 ? CG2 ? A ILE 283 CG2 
61 1 Y 1 A ILE 394 ? CD1 ? A ILE 283 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 112 ? A SER 1   
2  1 Y 1 A VAL 113 ? A VAL 2   
3  1 Y 1 A CYS 114 ? A CYS 3   
4  1 Y 1 A ALA 115 ? A ALA 4   
5  1 Y 1 A GLU 116 ? A GLU 5   
6  1 Y 1 A ALA 117 ? A ALA 6   
7  1 Y 1 A TYR 118 ? A TYR 7   
8  1 Y 1 A ASN 119 ? A ASN 8   
9  1 Y 1 A PRO 120 ? A PRO 9   
10 1 Y 1 A ASP 121 ? A ASP 10  
11 1 Y 1 A GLU 122 ? A GLU 11  
12 1 Y 1 A GLU 123 ? A GLU 12  
13 1 Y 1 A GLU 124 ? A GLU 13  
14 1 Y 1 A ASP 125 ? A ASP 14  
15 1 Y 1 A ASP 126 ? A ASP 15  
16 1 Y 1 A SER 329 ? A SER 218 
17 1 Y 1 A ASP 330 ? A ASP 219 
18 1 Y 1 A ILE 331 ? A ILE 220 
19 1 Y 1 A GLU 332 ? A GLU 221 
20 1 Y 1 A GLU 333 ? A GLU 222 
21 1 Y 1 A ASN 334 ? A ASN 223 
22 1 Y 1 A GLY 335 ? A GLY 224 
23 1 Y 1 A GLU 398 ? A GLU 287 
24 1 Y 1 A GLU 399 ? A GLU 288 
25 1 Y 1 A GLN 400 ? A GLN 289 
26 1 Y 1 A LEU 401 ? A LEU 290 
27 1 Y 1 A VAL 402 ? A VAL 291 
28 1 Y 1 A ALA 403 ? A ALA 292 
29 1 Y 1 A LEU 404 ? A LEU 293 
30 1 Y 1 A PHE 405 ? A PHE 294 
31 1 Y 1 A GLY 406 ? A GLY 295 
32 1 Y 1 A THR 407 ? A THR 296 
33 1 Y 1 A ASN 408 ? A ASN 297 
34 1 Y 1 A MET 409 ? A MET 298 
35 1 Y 1 A ASP 410 ? A ASP 299 
36 1 Y 1 A ILE 411 ? A ILE 300 
37 1 Y 1 A VAL 412 ? A VAL 301 
38 1 Y 1 A GLU 413 ? A GLU 302 
39 1 Y 1 A PRO 414 ? A PRO 303 
40 1 Y 1 A THR 415 ? A THR 304 
41 1 Y 1 A ALA 416 ? A ALA 305 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2R,4aR,6R,7R,7aS)-6-[6-(dipropylamino)-9H-purin-9-yl]tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinine-2,7-diol 2-oxide' 1OR 
3 water                                                                                                                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 1OR 1  501 440 1OR HE3 A . 
C 2 1OR 1  502 450 1OR HE3 A . 
D 3 HOH 1  601 501 HOH WAT A . 
D 3 HOH 2  602 502 HOH WAT A . 
D 3 HOH 3  603 503 HOH WAT A . 
D 3 HOH 4  604 504 HOH WAT A . 
D 3 HOH 5  605 505 HOH WAT A . 
D 3 HOH 6  606 506 HOH WAT A . 
D 3 HOH 7  607 507 HOH WAT A . 
D 3 HOH 8  608 508 HOH WAT A . 
D 3 HOH 9  609 509 HOH WAT A . 
D 3 HOH 10 610 510 HOH WAT A . 
D 3 HOH 11 611 511 HOH WAT A . 
D 3 HOH 12 612 512 HOH WAT A . 
D 3 HOH 13 613 513 HOH WAT A . 
D 3 HOH 14 614 514 HOH WAT A . 
D 3 HOH 15 615 515 HOH WAT A . 
D 3 HOH 16 616 516 HOH WAT A . 
D 3 HOH 17 617 517 HOH WAT A . 
D 3 HOH 18 618 518 HOH WAT A . 
D 3 HOH 19 619 519 HOH WAT A . 
D 3 HOH 20 620 520 HOH WAT A . 
D 3 HOH 21 621 521 HOH WAT A . 
D 3 HOH 22 622 522 HOH WAT A . 
D 3 HOH 23 623 523 HOH WAT A . 
D 3 HOH 24 624 524 HOH WAT A . 
D 3 HOH 25 625 525 HOH WAT A . 
D 3 HOH 26 626 526 HOH WAT A . 
D 3 HOH 27 627 527 HOH WAT A . 
D 3 HOH 28 628 528 HOH WAT A . 
D 3 HOH 29 629 529 HOH WAT A . 
D 3 HOH 30 630 530 HOH WAT A . 
D 3 HOH 31 631 531 HOH WAT A . 
D 3 HOH 32 632 532 HOH WAT A . 
D 3 HOH 33 633 533 HOH WAT A . 
D 3 HOH 34 634 534 HOH WAT A . 
D 3 HOH 35 635 535 HOH WAT A . 
D 3 HOH 36 636 536 HOH WAT A . 
D 3 HOH 37 637 537 HOH WAT A . 
D 3 HOH 38 638 538 HOH WAT A . 
D 3 HOH 39 639 539 HOH WAT A . 
D 3 HOH 40 640 540 HOH WAT A . 
D 3 HOH 41 641 541 HOH WAT A . 
D 3 HOH 42 642 542 HOH WAT A . 
D 3 HOH 43 643 543 HOH WAT A . 
D 3 HOH 44 644 544 HOH WAT A . 
D 3 HOH 45 645 545 HOH WAT A . 
D 3 HOH 46 646 546 HOH WAT A . 
D 3 HOH 47 647 547 HOH WAT A . 
D 3 HOH 48 648 548 HOH WAT A . 
D 3 HOH 49 649 549 HOH WAT A . 
D 3 HOH 50 650 550 HOH WAT A . 
D 3 HOH 51 651 551 HOH WAT A . 
D 3 HOH 52 652 552 HOH WAT A . 
D 3 HOH 53 653 553 HOH WAT A . 
D 3 HOH 54 654 554 HOH WAT A . 
D 3 HOH 55 655 555 HOH WAT A . 
D 3 HOH 56 656 556 HOH WAT A . 
D 3 HOH 57 657 557 HOH WAT A . 
D 3 HOH 58 658 558 HOH WAT A . 
D 3 HOH 59 659 559 HOH WAT A . 
D 3 HOH 60 660 560 HOH WAT A . 
D 3 HOH 61 661 561 HOH WAT A . 
D 3 HOH 62 662 562 HOH WAT A . 
D 3 HOH 63 663 563 HOH WAT A . 
D 3 HOH 64 664 564 HOH WAT A . 
D 3 HOH 65 665 565 HOH WAT A . 
D 3 HOH 66 666 566 HOH WAT A . 
D 3 HOH 67 667 567 HOH WAT A . 
D 3 HOH 68 668 568 HOH WAT A . 
D 3 HOH 69 669 569 HOH WAT A . 
D 3 HOH 70 670 570 HOH WAT A . 
D 3 HOH 71 671 571 HOH WAT A . 
#