data_4JZJ
# 
_entry.id   4JZJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4JZJ         
RCSB  RCSB078701   
WWPDB D_1000078701 
# 
_pdbx_database_status.entry_id                        4JZJ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-03 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Broughton, S.E.' 1 
'Parker, M.W.'    2 
# 
_citation.id                        primary 
_citation.title                     'Dual mechanism of interleukin-3 receptor blockade by an anti-cancer antibody' 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_volume            8 
_citation.page_first                410 
_citation.page_last                 419 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25043189 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2014.06.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Broughton, S.E.' 1  ? 
primary 'Hercus, T.R.'    2  ? 
primary 'Hardy, M.P.'     3  ? 
primary 'McClure, B.J.'   4  ? 
primary 'Nero, T.L.'      5  ? 
primary 'Dottore, M.'     6  ? 
primary 'Huynh, H.'       7  ? 
primary 'Braley, H.'      8  ? 
primary 'Barry, E.F.'     9  ? 
primary 'Kan, W.L.'       10 ? 
primary 'Dhagat, U.'      11 ? 
primary 'Scotney, P.'     12 ? 
primary 'Hartman, D.'     13 ? 
primary 'Busfield, S.J.'  14 ? 
primary 'Owczarek, C.M.'  15 ? 
primary 'Nash, A.D.'      16 ? 
primary 'Wilson, N.J.'    17 ? 
primary 'Parker, M.W.'    18 ? 
primary 'Lopez, A.F.'     19 ? 
# 
_cell.length_a           88.300 
_cell.length_b           120.648 
_cell.length_c           92.968 
_cell.angle_alpha        90.000 
_cell.angle_beta         97.450 
_cell.angle_gamma        90.000 
_cell.entry_id           4JZJ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4JZJ 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Interleukin-3 receptor subunit alpha' 33097.426 2  ? 'Deletion R145, A298V' 
'DOMAIN 2, DOMAIN 3, UNP residues 20-307' ? 
2 polymer     nat 'Fab Heavy Chain' 23799.941 2  ? ?                      ?                                         ? 
3 polymer     nat 'Fab Light Chain' 24256.727 2  ? ?                      ?                                         ? 
4 branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[beta-L-fucopyranose-(1-3)][beta-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
1203.105  1  ? ?                      ?                                         ? 
5 branched    man 
;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[beta-L-fucopyranose-(1-3)][beta-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
878.823   1  ? ?                      ?                                         ? 
6 branched    man 'alpha-L-fucopyranose-(1-3)-[beta-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 513.490   1  ? 
?                      ?                                         ? 
7 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2  ? ?                      ? ? 
8 non-polymer syn GLYCEROL 92.094    2  ? ?                      ?                                         ? 
9 water       nat water 18.015    39 ? ?                      ?                                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IL-3 receptor subunit alpha, IL-3R subunit alpha, IL-3R-alpha, IL-3RA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN
SGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAKRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSF
QLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGVNTRAWRTS
;
;KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN
SGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAKRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSF
QLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGVNTRAWRTS
;
C,D ? 
2 'polypeptide(L)' no no 
;EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQMPGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTY
LQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
;EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQMPGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTY
LQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
A,H ? 
3 'polypeptide(L)' no no 
;DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLTWYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLTWYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
B,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   ASP n 
1 4   PRO n 
1 5   ASN n 
1 6   PRO n 
1 7   PRO n 
1 8   ILE n 
1 9   THR n 
1 10  ASN n 
1 11  LEU n 
1 12  ARG n 
1 13  MET n 
1 14  LYS n 
1 15  ALA n 
1 16  LYS n 
1 17  ALA n 
1 18  GLN n 
1 19  GLN n 
1 20  LEU n 
1 21  THR n 
1 22  TRP n 
1 23  ASP n 
1 24  LEU n 
1 25  ASN n 
1 26  ARG n 
1 27  ASN n 
1 28  VAL n 
1 29  THR n 
1 30  ASP n 
1 31  ILE n 
1 32  GLU n 
1 33  CYS n 
1 34  VAL n 
1 35  LYS n 
1 36  ASP n 
1 37  ALA n 
1 38  ASP n 
1 39  TYR n 
1 40  SER n 
1 41  MET n 
1 42  PRO n 
1 43  ALA n 
1 44  VAL n 
1 45  ASN n 
1 46  ASN n 
1 47  SER n 
1 48  TYR n 
1 49  CYS n 
1 50  GLN n 
1 51  PHE n 
1 52  GLY n 
1 53  ALA n 
1 54  ILE n 
1 55  SER n 
1 56  LEU n 
1 57  CYS n 
1 58  GLU n 
1 59  VAL n 
1 60  THR n 
1 61  ASN n 
1 62  TYR n 
1 63  THR n 
1 64  VAL n 
1 65  ARG n 
1 66  VAL n 
1 67  ALA n 
1 68  ASN n 
1 69  PRO n 
1 70  PRO n 
1 71  PHE n 
1 72  SER n 
1 73  THR n 
1 74  TRP n 
1 75  ILE n 
1 76  LEU n 
1 77  PHE n 
1 78  PRO n 
1 79  GLU n 
1 80  ASN n 
1 81  SER n 
1 82  GLY n 
1 83  LYS n 
1 84  PRO n 
1 85  TRP n 
1 86  ALA n 
1 87  GLY n 
1 88  ALA n 
1 89  GLU n 
1 90  ASN n 
1 91  LEU n 
1 92  THR n 
1 93  CYS n 
1 94  TRP n 
1 95  ILE n 
1 96  HIS n 
1 97  ASP n 
1 98  VAL n 
1 99  ASP n 
1 100 PHE n 
1 101 LEU n 
1 102 SER n 
1 103 CYS n 
1 104 SER n 
1 105 TRP n 
1 106 ALA n 
1 107 VAL n 
1 108 GLY n 
1 109 PRO n 
1 110 GLY n 
1 111 ALA n 
1 112 PRO n 
1 113 ALA n 
1 114 ASP n 
1 115 VAL n 
1 116 GLN n 
1 117 TYR n 
1 118 ASP n 
1 119 LEU n 
1 120 TYR n 
1 121 LEU n 
1 122 ASN n 
1 123 VAL n 
1 124 ALA n 
1 125 LYS n 
1 126 ARG n 
1 127 GLN n 
1 128 GLN n 
1 129 TYR n 
1 130 GLU n 
1 131 CYS n 
1 132 LEU n 
1 133 HIS n 
1 134 TYR n 
1 135 LYS n 
1 136 THR n 
1 137 ASP n 
1 138 ALA n 
1 139 GLN n 
1 140 GLY n 
1 141 THR n 
1 142 ARG n 
1 143 ILE n 
1 144 GLY n 
1 145 CYS n 
1 146 ARG n 
1 147 PHE n 
1 148 ASP n 
1 149 ASP n 
1 150 ILE n 
1 151 SER n 
1 152 ARG n 
1 153 LEU n 
1 154 SER n 
1 155 SER n 
1 156 GLY n 
1 157 SER n 
1 158 GLN n 
1 159 SER n 
1 160 SER n 
1 161 HIS n 
1 162 ILE n 
1 163 LEU n 
1 164 VAL n 
1 165 ARG n 
1 166 GLY n 
1 167 ARG n 
1 168 SER n 
1 169 ALA n 
1 170 ALA n 
1 171 PHE n 
1 172 GLY n 
1 173 ILE n 
1 174 PRO n 
1 175 CYS n 
1 176 THR n 
1 177 ASP n 
1 178 LYS n 
1 179 PHE n 
1 180 VAL n 
1 181 VAL n 
1 182 PHE n 
1 183 SER n 
1 184 GLN n 
1 185 ILE n 
1 186 GLU n 
1 187 ILE n 
1 188 LEU n 
1 189 THR n 
1 190 PRO n 
1 191 PRO n 
1 192 ASN n 
1 193 MET n 
1 194 THR n 
1 195 ALA n 
1 196 LYS n 
1 197 CYS n 
1 198 ASN n 
1 199 LYS n 
1 200 THR n 
1 201 HIS n 
1 202 SER n 
1 203 PHE n 
1 204 MET n 
1 205 HIS n 
1 206 TRP n 
1 207 LYS n 
1 208 MET n 
1 209 ARG n 
1 210 SER n 
1 211 HIS n 
1 212 PHE n 
1 213 ASN n 
1 214 ARG n 
1 215 LYS n 
1 216 PHE n 
1 217 ARG n 
1 218 TYR n 
1 219 GLU n 
1 220 LEU n 
1 221 GLN n 
1 222 ILE n 
1 223 GLN n 
1 224 LYS n 
1 225 ARG n 
1 226 MET n 
1 227 GLN n 
1 228 PRO n 
1 229 VAL n 
1 230 ILE n 
1 231 THR n 
1 232 GLU n 
1 233 GLN n 
1 234 VAL n 
1 235 ARG n 
1 236 ASP n 
1 237 ARG n 
1 238 THR n 
1 239 SER n 
1 240 PHE n 
1 241 GLN n 
1 242 LEU n 
1 243 LEU n 
1 244 ASN n 
1 245 PRO n 
1 246 GLY n 
1 247 THR n 
1 248 TYR n 
1 249 THR n 
1 250 VAL n 
1 251 GLN n 
1 252 ILE n 
1 253 ARG n 
1 254 ALA n 
1 255 ARG n 
1 256 GLU n 
1 257 ARG n 
1 258 VAL n 
1 259 TYR n 
1 260 GLU n 
1 261 PHE n 
1 262 LEU n 
1 263 SER n 
1 264 ALA n 
1 265 TRP n 
1 266 SER n 
1 267 THR n 
1 268 PRO n 
1 269 GLN n 
1 270 ARG n 
1 271 PHE n 
1 272 GLU n 
1 273 CYS n 
1 274 ASP n 
1 275 GLN n 
1 276 GLU n 
1 277 GLU n 
1 278 GLY n 
1 279 VAL n 
1 280 ASN n 
1 281 THR n 
1 282 ARG n 
1 283 ALA n 
1 284 TRP n 
1 285 ARG n 
1 286 THR n 
1 287 SER n 
2 1   GLU n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   VAL n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   ALA n 
2 10  GLU n 
2 11  VAL n 
2 12  LYS n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  GLU n 
2 17  SER n 
2 18  LEU n 
2 19  LYS n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  GLY n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  SER n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  TYR n 
2 33  TYR n 
2 34  MET n 
2 35  LYS n 
2 36  TRP n 
2 37  ALA n 
2 38  ARG n 
2 39  GLN n 
2 40  MET n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  MET n 
2 49  GLY n 
2 50  ASP n 
2 51  ILE n 
2 52  ILE n 
2 53  PRO n 
2 54  SER n 
2 55  ASN n 
2 56  GLY n 
2 57  ALA n 
2 58  THR n 
2 59  PHE n 
2 60  TYR n 
2 61  ASN n 
2 62  GLN n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  GLN n 
2 68  VAL n 
2 69  THR n 
2 70  ILE n 
2 71  SER n 
2 72  ALA n 
2 73  ASP n 
2 74  LYS n 
2 75  SER n 
2 76  ILE n 
2 77  SER n 
2 78  THR n 
2 79  THR n 
2 80  TYR n 
2 81  LEU n 
2 82  GLN n 
2 83  TRP n 
2 84  SER n 
2 85  SER n 
2 86  LEU n 
2 87  LYS n 
2 88  ALA n 
2 89  SER n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  MET n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  ARG n 
2 99  SER n 
2 100 HIS n 
2 101 LEU n 
2 102 LEU n 
2 103 ARG n 
2 104 ALA n 
2 105 SER n 
2 106 TRP n 
2 107 PHE n 
2 108 ALA n 
2 109 TYR n 
2 110 TRP n 
2 111 GLY n 
2 112 GLN n 
2 113 GLY n 
2 114 THR n 
2 115 MET n 
2 116 VAL n 
2 117 THR n 
2 118 VAL n 
2 119 SER n 
2 120 SER n 
2 121 ALA n 
2 122 SER n 
2 123 THR n 
2 124 LYS n 
2 125 GLY n 
2 126 PRO n 
2 127 SER n 
2 128 VAL n 
2 129 PHE n 
2 130 PRO n 
2 131 LEU n 
2 132 ALA n 
2 133 PRO n 
2 134 SER n 
2 135 SER n 
2 136 LYS n 
2 137 SER n 
2 138 THR n 
2 139 SER n 
2 140 GLY n 
2 141 GLY n 
2 142 THR n 
2 143 ALA n 
2 144 ALA n 
2 145 LEU n 
2 146 GLY n 
2 147 CYS n 
2 148 LEU n 
2 149 VAL n 
2 150 LYS n 
2 151 ASP n 
2 152 TYR n 
2 153 PHE n 
2 154 PRO n 
2 155 GLU n 
2 156 PRO n 
2 157 VAL n 
2 158 THR n 
2 159 VAL n 
2 160 SER n 
2 161 TRP n 
2 162 ASN n 
2 163 SER n 
2 164 GLY n 
2 165 ALA n 
2 166 LEU n 
2 167 THR n 
2 168 SER n 
2 169 GLY n 
2 170 VAL n 
2 171 HIS n 
2 172 THR n 
2 173 PHE n 
2 174 PRO n 
2 175 ALA n 
2 176 VAL n 
2 177 LEU n 
2 178 GLN n 
2 179 SER n 
2 180 SER n 
2 181 GLY n 
2 182 LEU n 
2 183 TYR n 
2 184 SER n 
2 185 LEU n 
2 186 SER n 
2 187 SER n 
2 188 VAL n 
2 189 VAL n 
2 190 THR n 
2 191 VAL n 
2 192 PRO n 
2 193 SER n 
2 194 SER n 
2 195 SER n 
2 196 LEU n 
2 197 GLY n 
2 198 THR n 
2 199 GLN n 
2 200 THR n 
2 201 TYR n 
2 202 ILE n 
2 203 CYS n 
2 204 ASN n 
2 205 VAL n 
2 206 ASN n 
2 207 HIS n 
2 208 LYS n 
2 209 PRO n 
2 210 SER n 
2 211 ASN n 
2 212 THR n 
2 213 LYS n 
2 214 VAL n 
2 215 ASP n 
2 216 LYS n 
2 217 LYS n 
2 218 VAL n 
2 219 GLU n 
2 220 PRO n 
2 221 LYS n 
3 1   ASP n 
3 2   ILE n 
3 3   VAL n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   PRO n 
3 9   ASP n 
3 10  SER n 
3 11  LEU n 
3 12  ALA n 
3 13  VAL n 
3 14  SER n 
3 15  LEU n 
3 16  GLY n 
3 17  GLU n 
3 18  ARG n 
3 19  ALA n 
3 20  THR n 
3 21  ILE n 
3 22  ASN n 
3 23  CYS n 
3 24  GLU n 
3 25  SER n 
3 26  SER n 
3 27  GLN n 
3 28  SER n 
3 29  LEU n 
3 30  LEU n 
3 31  ASN n 
3 32  SER n 
3 33  GLY n 
3 34  ASN n 
3 35  GLN n 
3 36  LYS n 
3 37  ASN n 
3 38  TYR n 
3 39  LEU n 
3 40  THR n 
3 41  TRP n 
3 42  TYR n 
3 43  GLN n 
3 44  GLN n 
3 45  LYS n 
3 46  PRO n 
3 47  GLY n 
3 48  GLN n 
3 49  PRO n 
3 50  PRO n 
3 51  LYS n 
3 52  PRO n 
3 53  LEU n 
3 54  ILE n 
3 55  TYR n 
3 56  TRP n 
3 57  ALA n 
3 58  SER n 
3 59  THR n 
3 60  ARG n 
3 61  GLU n 
3 62  SER n 
3 63  GLY n 
3 64  VAL n 
3 65  PRO n 
3 66  ASP n 
3 67  ARG n 
3 68  PHE n 
3 69  SER n 
3 70  GLY n 
3 71  SER n 
3 72  GLY n 
3 73  SER n 
3 74  GLY n 
3 75  THR n 
3 76  ASP n 
3 77  PHE n 
3 78  THR n 
3 79  LEU n 
3 80  THR n 
3 81  ILE n 
3 82  SER n 
3 83  SER n 
3 84  LEU n 
3 85  GLN n 
3 86  ALA n 
3 87  GLU n 
3 88  ASP n 
3 89  VAL n 
3 90  ALA n 
3 91  VAL n 
3 92  TYR n 
3 93  TYR n 
3 94  CYS n 
3 95  GLN n 
3 96  ASN n 
3 97  ASP n 
3 98  TYR n 
3 99  SER n 
3 100 TYR n 
3 101 PRO n 
3 102 TYR n 
3 103 THR n 
3 104 PHE n 
3 105 GLY n 
3 106 GLN n 
3 107 GLY n 
3 108 THR n 
3 109 LYS n 
3 110 LEU n 
3 111 GLU n 
3 112 ILE n 
3 113 LYS n 
3 114 ARG n 
3 115 THR n 
3 116 VAL n 
3 117 ALA n 
3 118 ALA n 
3 119 PRO n 
3 120 SER n 
3 121 VAL n 
3 122 PHE n 
3 123 ILE n 
3 124 PHE n 
3 125 PRO n 
3 126 PRO n 
3 127 SER n 
3 128 ASP n 
3 129 GLU n 
3 130 GLN n 
3 131 LEU n 
3 132 LYS n 
3 133 SER n 
3 134 GLY n 
3 135 THR n 
3 136 ALA n 
3 137 SER n 
3 138 VAL n 
3 139 VAL n 
3 140 CYS n 
3 141 LEU n 
3 142 LEU n 
3 143 ASN n 
3 144 ASN n 
3 145 PHE n 
3 146 TYR n 
3 147 PRO n 
3 148 ARG n 
3 149 GLU n 
3 150 ALA n 
3 151 LYS n 
3 152 VAL n 
3 153 GLN n 
3 154 TRP n 
3 155 LYS n 
3 156 VAL n 
3 157 ASP n 
3 158 ASN n 
3 159 ALA n 
3 160 LEU n 
3 161 GLN n 
3 162 SER n 
3 163 GLY n 
3 164 ASN n 
3 165 SER n 
3 166 GLN n 
3 167 GLU n 
3 168 SER n 
3 169 VAL n 
3 170 THR n 
3 171 GLU n 
3 172 GLN n 
3 173 ASP n 
3 174 SER n 
3 175 LYS n 
3 176 ASP n 
3 177 SER n 
3 178 THR n 
3 179 TYR n 
3 180 SER n 
3 181 LEU n 
3 182 SER n 
3 183 SER n 
3 184 THR n 
3 185 LEU n 
3 186 THR n 
3 187 LEU n 
3 188 SER n 
3 189 LYS n 
3 190 ALA n 
3 191 ASP n 
3 192 TYR n 
3 193 GLU n 
3 194 LYS n 
3 195 HIS n 
3 196 LYS n 
3 197 VAL n 
3 198 TYR n 
3 199 ALA n 
3 200 CYS n 
3 201 GLU n 
3 202 VAL n 
3 203 THR n 
3 204 HIS n 
3 205 GLN n 
3 206 GLY n 
3 207 LEU n 
3 208 SER n 
3 209 SER n 
3 210 PRO n 
3 211 VAL n 
3 212 THR n 
3 213 LYS n 
3 214 SER n 
3 215 PHE n 
3 216 ASN n 
3 217 ARG n 
3 218 GLY n 
3 219 GLU n 
3 220 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 IL3RA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            Sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFastBac1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
'The Fab fragment was prepared by papain digestion of MAb and Protein A removal of undigested immunoglobulin and Fc fragment.' 
3 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
'The Fab fragment was prepared by papain digestion of MAb and Protein A removal of undigested immunoglobulin and Fc fragment.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IL3RA_HUMAN P26951 1 
;KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN
SGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
SHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTS
FQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTS
;
20 ? 
2 PDB 4JZJ        4JZJ   2 ? ?  ? 
3 PDB 4JZJ        4JZJ   3 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4JZJ C 1 ? 287 ? P26951 20 ? 307 ? 20 306 
2 1 4JZJ D 1 ? 287 ? P26951 20 ? 307 ? 20 306 
3 2 4JZJ A 1 ? 221 ? 4JZJ   1  ? 221 ? 1  221 
4 2 4JZJ H 1 ? 221 ? 4JZJ   1  ? 221 ? 1  221 
5 3 4JZJ B 1 ? 220 ? 4JZJ   1  ? 220 ? 1  220 
6 3 4JZJ L 1 ? 220 ? 4JZJ   1  ? 220 ? 1  220 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4JZJ LYS C 125 ? UNP P26951 ASN 144 'SEE REMARK 999'      144 1 
1 4JZJ ?   C ?   ? UNP P26951 ARG 145 deletion              ?   2 
1 4JZJ VAL C 279 ? UNP P26951 ALA 299 'engineered mutation' 298 3 
2 4JZJ LYS D 125 ? UNP P26951 ASN 144 'SEE REMARK 999'      144 4 
2 4JZJ ?   D ?   ? UNP P26951 ARG 145 deletion              ?   5 
2 4JZJ VAL D 279 ? UNP P26951 ALA 299 'engineered mutation' 298 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                               'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'     
133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ?                               'C6 H12 O6'      
180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ?                               'C3 H7 N O2 S'   
121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ?                               'C6 H12 O5'      
164.156 
FUL 'L-saccharide, beta linking'  . beta-L-fucopyranose                      6-DEOXY-BETA-L-GALACTOSE        'C6 H12 O5'      
164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?                               'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'     
147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                               'C2 H5 N O2'     
75.067  
GOL non-polymer                   . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking'           y HISTIDINE                                ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                   . WATER                                    ?                               'H2 O'           
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                               'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                               'C6 H15 N2 O2 1' 
147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ?                               'C6 H12 O6'      
180.156 
MET 'L-peptide linking'           y METHIONINE                               ?                               'C5 H11 N O2 S'  
149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                               'C8 H15 N O6'    
221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                               'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking'           y SERINE                                   ?                               'C3 H7 N O3'     
105.093 
THR 'L-peptide linking'           y THREONINE                                ?                               'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                               'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking'           y VALINE                                   ?                               'C5 H11 N O2'    
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4JZJ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.03 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   59.34 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'22% PEG 3350, 200mM Sodium Malonate, 100mM Citrate Buffer, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2011-11-19 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.954 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.pdbx_wavelength_list        0.954 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
# 
_reflns.entry_id                     4JZJ 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.80 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   47603 
_reflns.number_obs                   47194 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.07 
_reflns.pdbx_netI_over_sigmaI        25 
_reflns.B_iso_Wilson_estimate        50.3 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.85 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4JZJ 
_refine.ls_d_res_high                            2.8010 
_refine.ls_d_res_low                             49.6750 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.1200 
_refine.ls_number_reflns_obs                     47185 
_refine.ls_number_reflns_all                     47191 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1878 
_refine.ls_R_factor_R_work                       0.1849 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2444 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0400 
_refine.ls_number_reflns_R_free                  2379 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               50.3063 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4200 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7957 
_refine.B_iso_max                                135.290 
_refine.B_iso_min                                10.450 
_refine.pdbx_overall_phase_error                 27.3000 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.960 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10719 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         214 
_refine_hist.number_atoms_solvent             39 
_refine_hist.number_atoms_total               10972 
_refine_hist.d_res_high                       2.8010 
_refine_hist.d_res_low                        49.6750 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           11222 0.011  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          15220 1.456  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     1685  0.087  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      1915  0.006  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 4161  17.060 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.8012 2.8584  17 96.0000  2549 . 0.2934 0.3677 . 128 . 2677 . 'X-RAY DIFFRACTION' . 
2.8584 2.9205  17 100.0000 2664 . 0.2767 0.3479 . 146 . 2810 . 'X-RAY DIFFRACTION' . 
2.9205 2.9884  17 100.0000 2622 . 0.2593 0.3292 . 152 . 2774 . 'X-RAY DIFFRACTION' . 
2.9884 3.0632  17 100.0000 2613 . 0.2513 0.3884 . 150 . 2763 . 'X-RAY DIFFRACTION' . 
3.0632 3.1460  17 100.0000 2633 . 0.2548 0.3452 . 157 . 2790 . 'X-RAY DIFFRACTION' . 
3.1460 3.2385  17 100.0000 2656 . 0.2410 0.2849 . 126 . 2782 . 'X-RAY DIFFRACTION' . 
3.2385 3.3430  17 100.0000 2630 . 0.2292 0.3042 . 138 . 2768 . 'X-RAY DIFFRACTION' . 
3.3430 3.4625  17 100.0000 2656 . 0.2147 0.3054 . 133 . 2789 . 'X-RAY DIFFRACTION' . 
3.4625 3.6011  17 100.0000 2626 . 0.1988 0.2788 . 154 . 2780 . 'X-RAY DIFFRACTION' . 
3.6011 3.7649  17 99.0000  2626 . 0.1882 0.2539 . 148 . 2774 . 'X-RAY DIFFRACTION' . 
3.7649 3.9633  17 100.0000 2648 . 0.1808 0.2490 . 139 . 2787 . 'X-RAY DIFFRACTION' . 
3.9633 4.2115  17 99.0000  2653 . 0.1677 0.2098 . 148 . 2801 . 'X-RAY DIFFRACTION' . 
4.2115 4.5365  17 99.0000  2620 . 0.1420 0.1908 . 132 . 2752 . 'X-RAY DIFFRACTION' . 
4.5365 4.9927  17 99.0000  2639 . 0.1322 0.1908 . 135 . 2774 . 'X-RAY DIFFRACTION' . 
4.9927 5.7142  17 99.0000  2656 . 0.1502 0.1832 . 130 . 2786 . 'X-RAY DIFFRACTION' . 
5.7142 7.1958  17 99.0000  2677 . 0.1876 0.2537 . 127 . 2804 . 'X-RAY DIFFRACTION' . 
7.1958 49.6826 17 97.0000  2638 . 0.1816 0.2219 . 136 . 2774 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4JZJ 
_struct.title                     'Crystal Structure of Receptor-Fab Complex' 
_struct.pdbx_descriptor           'Interleukin-3 receptor subunit alpha, Fab Heavy Chain, Fab Light Chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4JZJ 
_struct_keywords.text            'receptor-fab complex, CYTOKINE RECEPTOR-IMMUNE SYSTEM complex' 
_struct_keywords.pdbx_keywords   'CYTOKINE RECEPTOR/IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
N N N 9 ? 
O N N 9 ? 
P N N 9 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 149 ? SER A 154 ? ASP C 168 SER C 173 1 ? 6 
HELX_P HELX_P2  2  PHE A 182 ? GLU A 186 ? PHE C 201 GLU C 205 1 ? 5 
HELX_P HELX_P3  3  ASP B 149 ? SER B 155 ? ASP D 168 SER D 174 1 ? 7 
HELX_P HELX_P4  4  PHE B 182 ? GLU B 186 ? PHE D 201 GLU D 205 1 ? 5 
HELX_P HELX_P5  5  GLN C 62  ? LYS C 65  ? GLN A 62  LYS A 65  5 ? 4 
HELX_P HELX_P6  6  LYS C 87  ? THR C 91  ? LYS A 87  THR A 91  5 ? 5 
HELX_P HELX_P7  7  SER C 163 ? ALA C 165 ? SER A 163 ALA A 165 5 ? 3 
HELX_P HELX_P8  8  SER C 194 ? THR C 198 ? SER A 194 THR A 198 5 ? 5 
HELX_P HELX_P9  9  LYS C 208 ? ASN C 211 ? LYS A 208 ASN A 211 5 ? 4 
HELX_P HELX_P10 10 GLN D 85  ? VAL D 89  ? GLN B 85  VAL B 89  5 ? 5 
HELX_P HELX_P11 11 SER D 127 ? SER D 133 ? SER B 127 SER B 133 1 ? 7 
HELX_P HELX_P12 12 LYS D 189 ? GLU D 193 ? LYS B 189 GLU B 193 1 ? 5 
HELX_P HELX_P13 13 SER E 28  ? TYR E 32  ? SER H 28  TYR H 32  5 ? 5 
HELX_P HELX_P14 14 ASN E 61  ? GLY E 66  ? ASN H 61  GLY H 66  1 ? 6 
HELX_P HELX_P15 15 LYS E 87  ? THR E 91  ? LYS H 87  THR H 91  5 ? 5 
HELX_P HELX_P16 16 SER E 163 ? ALA E 165 ? SER H 163 ALA H 165 5 ? 3 
HELX_P HELX_P17 17 SER E 194 ? LEU E 196 ? SER H 194 LEU H 196 5 ? 3 
HELX_P HELX_P18 18 LYS E 208 ? ASN E 211 ? LYS H 208 ASN H 211 5 ? 4 
HELX_P HELX_P19 19 GLN F 85  ? VAL F 89  ? GLN L 85  VAL L 89  5 ? 5 
HELX_P HELX_P20 20 SER F 127 ? SER F 133 ? SER L 127 SER L 133 1 ? 7 
HELX_P HELX_P21 21 LYS F 189 ? GLU F 193 ? LYS L 189 GLU L 193 1 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 33  SG  ? ? ? 1_555 A CYS 49  SG ? ? C CYS 52  C CYS 68  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf2  disulf ?    ? A CYS 57  SG  ? ? ? 1_555 A CYS 175 SG ? ? C CYS 76  C CYS 194 1_555 ? ? ? ? ? ? ? 2.071 ? ?               
disulf3  disulf ?    ? A CYS 93  SG  ? ? ? 1_555 A CYS 103 SG ? ? C CYS 112 C CYS 122 1_555 ? ? ? ? ? ? ? 2.070 ? ?               
disulf4  disulf ?    ? A CYS 131 SG  ? ? ? 1_555 A CYS 145 SG ? ? C CYS 150 C CYS 164 1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf5  disulf ?    ? B CYS 33  SG  ? ? ? 1_555 B CYS 49  SG ? ? D CYS 52  D CYS 68  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf6  disulf ?    ? B CYS 57  SG  ? ? ? 1_555 B CYS 175 SG ? ? D CYS 76  D CYS 194 1_555 ? ? ? ? ? ? ? 2.068 ? ?               
disulf7  disulf ?    ? B CYS 93  SG  ? ? ? 1_555 B CYS 103 SG ? ? D CYS 112 D CYS 122 1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf8  disulf ?    ? B CYS 131 SG  ? ? ? 1_555 B CYS 145 SG ? ? D CYS 150 D CYS 164 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf9  disulf ?    ? C CYS 22  SG  ? ? ? 1_555 C CYS 96  SG ? ? A CYS 22  A CYS 96  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf10 disulf ?    ? C CYS 147 SG  ? ? ? 1_555 C CYS 203 SG ? ? A CYS 147 A CYS 203 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf11 disulf ?    ? D CYS 23  SG  ? ? ? 1_555 D CYS 94  SG ? ? B CYS 23  B CYS 94  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf12 disulf ?    ? D CYS 140 SG  ? ? ? 1_555 D CYS 200 SG ? ? B CYS 140 B CYS 200 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf13 disulf ?    ? E CYS 22  SG  ? ? ? 1_555 E CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf14 disulf ?    ? E CYS 147 SG  ? ? ? 1_555 E CYS 203 SG ? ? H CYS 147 H CYS 203 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf15 disulf ?    ? F CYS 23  SG  ? ? ? 1_555 F CYS 94  SG ? ? L CYS 23  L CYS 94  1_555 ? ? ? ? ? ? ? 2.073 ? ?               
disulf16 disulf ?    ? F CYS 140 SG  ? ? ? 1_555 F CYS 200 SG ? ? L CYS 140 L CYS 200 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
covale1  covale one  ? A ASN 27  ND2 ? ? ? 1_555 J NAG .   C1 ? ? C ASN 46  C NAG 408 1_555 ? ? ? ? ? ? ? 1.722 ? N-Glycosylation 
covale2  covale one  ? A ASN 61  ND2 ? ? ? 1_555 G NAG .   C1 ? ? C ASN 80  E NAG 1   1_555 ? ? ? ? ? ? ? 1.719 ? N-Glycosylation 
covale3  covale one  ? B ASN 61  ND2 ? ? ? 1_555 H NAG .   C1 ? ? D ASN 80  F NAG 1   1_555 ? ? ? ? ? ? ? 1.425 ? N-Glycosylation 
covale4  covale one  ? B ASN 90  ND2 ? ? ? 1_555 I NAG .   C1 ? ? D ASN 109 G NAG 1   1_555 ? ? ? ? ? ? ? 1.996 ? N-Glycosylation 
covale5  covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.206 ? ?               
covale6  covale both ? G NAG .   O3  ? ? ? 1_555 G FUL .   C1 ? ? E NAG 1   E FUL 6   1_555 ? ? ? ? ? ? ? 1.552 ? ?               
covale7  covale both ? G NAG .   O6  ? ? ? 1_555 G FUL .   C1 ? ? E NAG 1   E FUL 7   1_555 ? ? ? ? ? ? ? 1.298 ? ?               
covale8  covale both ? G NAG .   O4  ? ? ? 1_555 G BMA .   C1 ? ? E NAG 2   E BMA 3   1_555 ? ? ? ? ? ? ? 1.432 ? ?               
covale9  covale both ? G BMA .   O3  ? ? ? 1_555 G MAN .   C1 ? ? E BMA 3   E MAN 4   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale10 covale both ? G BMA .   O6  ? ? ? 1_555 G MAN .   C1 ? ? E BMA 3   E MAN 5   1_555 ? ? ? ? ? ? ? 1.449 ? ?               
covale11 covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.370 ? ?               
covale12 covale both ? H NAG .   O3  ? ? ? 1_555 H FUL .   C1 ? ? F NAG 1   F FUL 4   1_555 ? ? ? ? ? ? ? 1.430 ? ?               
covale13 covale both ? H NAG .   O6  ? ? ? 1_555 H FUL .   C1 ? ? F NAG 1   F FUL 5   1_555 ? ? ? ? ? ? ? 1.493 ? ?               
covale14 covale both ? H NAG .   O4  ? ? ? 1_555 H BMA .   C1 ? ? F NAG 2   F BMA 3   1_555 ? ? ? ? ? ? ? 1.438 ? ?               
covale15 covale both ? I NAG .   O3  ? ? ? 1_555 I FUC .   C1 ? ? G NAG 1   G FUC 2   1_555 ? ? ? ? ? ? ? 1.348 ? ?               
covale16 covale both ? I NAG .   O6  ? ? ? 1_555 I FUL .   C1 ? ? G NAG 1   G FUL 3   1_555 ? ? ? ? ? ? ? 1.448 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 68  A . ? ASN 87  C PRO 69  A ? PRO 88  C 1 -10.40 
2  PHE 77  A . ? PHE 96  C PRO 78  A ? PRO 97  C 1 -9.42  
3  PRO 84  A . ? PRO 103 C TRP 85  A ? TRP 104 C 1 -6.14  
4  LEU 243 A . ? LEU 262 C ASN 244 A ? ASN 263 C 1 9.45   
5  ASN 244 A . ? ASN 263 C PRO 245 A ? PRO 264 C 1 0.04   
6  ASN 68  B . ? ASN 87  D PRO 69  B ? PRO 88  D 1 -4.09  
7  PHE 77  B . ? PHE 96  D PRO 78  B ? PRO 97  D 1 -10.16 
8  PRO 84  B . ? PRO 103 D TRP 85  B ? TRP 104 D 1 -1.22  
9  LYS 125 B . ? LYS 144 D ARG 126 B ? ARG 145 D 1 -0.72  
10 PHE 153 C . ? PHE 153 A PRO 154 C ? PRO 154 A 1 -4.39  
11 GLU 155 C . ? GLU 155 A PRO 156 C ? PRO 156 A 1 -0.65  
12 SER 7   D . ? SER 7   B PRO 8   D ? PRO 8   B 1 2.30   
13 TYR 100 D . ? TYR 100 B PRO 101 D ? PRO 101 B 1 -1.68  
14 TYR 146 D . ? TYR 146 B PRO 147 D ? PRO 147 B 1 8.40   
15 PHE 153 E . ? PHE 153 H PRO 154 E ? PRO 154 H 1 -3.93  
16 GLU 155 E . ? GLU 155 H PRO 156 E ? PRO 156 H 1 3.37   
17 SER 7   F . ? SER 7   L PRO 8   F ? PRO 8   L 1 -6.21  
18 TYR 100 F . ? TYR 100 L PRO 101 F ? PRO 101 L 1 -15.07 
19 TYR 146 F . ? TYR 146 L PRO 147 F ? PRO 147 L 1 -5.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
B  ? 4 ? 
C  ? 4 ? 
D  ? 4 ? 
E  ? 3 ? 
F  ? 3 ? 
G  ? 3 ? 
H  ? 4 ? 
I  ? 4 ? 
J  ? 3 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 6 ? 
P  ? 4 ? 
Q  ? 4 ? 
R  ? 4 ? 
S  ? 3 ? 
T  ? 4 ? 
U  ? 6 ? 
V  ? 4 ? 
W  ? 4 ? 
X  ? 4 ? 
Y  ? 6 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 4 ? 
AE ? 6 ? 
AF ? 2 ? 
AG ? 4 ? 
AH ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? parallel      
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
O  5 6 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? parallel      
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
U  4 5 ? anti-parallel 
U  5 6 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? parallel      
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Y  5 6 ? anti-parallel 
Z  1 2 ? parallel      
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AE 5 6 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ILE A 8   ? LYS A 14  ? ILE C 27  LYS C 33  
A  2 GLN A 19  ? LEU A 24  ? GLN C 38  LEU C 43  
A  3 TYR A 48  ? GLN A 50  ? TYR C 67  GLN C 69  
B  1 TYR A 39  ? PRO A 42  ? TYR C 58  PRO C 61  
B  2 ILE A 31  ? LYS A 35  ? ILE C 50  LYS C 54  
B  3 THR A 60  ? VAL A 66  ? THR C 79  VAL C 85  
B  4 PHE A 71  ? PHE A 77  ? PHE C 90  PHE C 96  
C  1 ALA A 88  ? HIS A 96  ? ALA C 107 HIS C 115 
C  2 PHE A 100 ? VAL A 107 ? PHE C 119 VAL C 126 
C  3 ARG A 142 ? PHE A 147 ? ARG C 161 PHE C 166 
C  4 HIS A 133 ? THR A 136 ? HIS C 152 THR C 155 
D  1 GLN A 127 ? GLU A 130 ? GLN C 146 GLU C 149 
D  2 GLN A 116 ? VAL A 123 ? GLN C 135 VAL C 142 
D  3 SER A 159 ? ARG A 167 ? SER C 178 ARG C 186 
D  4 THR A 176 ? VAL A 181 ? THR C 195 VAL C 200 
E  1 ASN A 192 ? THR A 194 ? ASN C 211 THR C 213 
E  2 PHE A 203 ? LYS A 207 ? PHE C 222 LYS C 226 
E  3 SER A 239 ? GLN A 241 ? SER C 258 GLN C 260 
F  1 ILE A 230 ? VAL A 234 ? ILE C 249 VAL C 253 
F  2 PHE A 216 ? ILE A 222 ? PHE C 235 ILE C 241 
F  3 VAL A 250 ? GLU A 256 ? VAL C 269 GLU C 275 
G  1 ILE B 8   ? LYS B 14  ? ILE D 27  LYS D 33  
G  2 GLN B 19  ? LEU B 24  ? GLN D 38  LEU D 43  
G  3 TYR B 48  ? GLN B 50  ? TYR D 67  GLN D 69  
H  1 TYR B 39  ? PRO B 42  ? TYR D 58  PRO D 61  
H  2 ILE B 31  ? LYS B 35  ? ILE D 50  LYS D 54  
H  3 THR B 60  ? VAL B 66  ? THR D 79  VAL D 85  
H  4 PHE B 71  ? PHE B 77  ? PHE D 90  PHE D 96  
I  1 GLU B 89  ? HIS B 96  ? GLU D 108 HIS D 115 
I  2 PHE B 100 ? ALA B 106 ? PHE D 119 ALA D 125 
I  3 ARG B 142 ? PHE B 147 ? ARG D 161 PHE D 166 
I  4 TYR B 134 ? THR B 136 ? TYR D 153 THR D 155 
J  1 GLN B 116 ? ASN B 122 ? GLN D 135 ASN D 141 
J  2 SER B 159 ? ARG B 167 ? SER D 178 ARG D 186 
J  3 GLY B 172 ? VAL B 181 ? GLY D 191 VAL D 200 
K  1 ASN B 192 ? THR B 194 ? ASN D 211 THR D 213 
K  2 PHE B 203 ? LYS B 207 ? PHE D 222 LYS D 226 
K  3 SER B 239 ? GLN B 241 ? SER D 258 GLN D 260 
L  1 ILE B 230 ? VAL B 234 ? ILE D 249 VAL D 253 
L  2 PHE B 216 ? ILE B 222 ? PHE D 235 ILE D 241 
L  3 ALA B 254 ? GLU B 256 ? ALA D 273 GLU D 275 
M  1 ILE B 230 ? VAL B 234 ? ILE D 249 VAL D 253 
M  2 PHE B 216 ? ILE B 222 ? PHE D 235 ILE D 241 
M  3 THR B 249 ? GLN B 251 ? THR D 268 GLN D 270 
M  4 GLN B 269 ? ARG B 270 ? GLN D 288 ARG D 289 
N  1 GLN C 3   ? GLN C 6   ? GLN A 3   GLN A 6   
N  2 LEU C 18  ? SER C 25  ? LEU A 18  SER A 25  
N  3 THR C 78  ? TRP C 83  ? THR A 78  TRP A 83  
N  4 THR C 69  ? ASP C 73  ? THR A 69  ASP A 73  
O  1 GLU C 10  ? LYS C 12  ? GLU A 10  LYS A 12  
O  2 THR C 114 ? VAL C 118 ? THR A 114 VAL A 118 
O  3 ALA C 92  ? ARG C 98  ? ALA A 92  ARG A 98  
O  4 MET C 34  ? GLN C 39  ? MET A 34  GLN A 39  
O  5 LEU C 45  ? ILE C 51  ? LEU A 45  ILE A 51  
O  6 THR C 58  ? TYR C 60  ? THR A 58  TYR A 60  
P  1 GLU C 10  ? LYS C 12  ? GLU A 10  LYS A 12  
P  2 THR C 114 ? VAL C 118 ? THR A 114 VAL A 118 
P  3 ALA C 92  ? ARG C 98  ? ALA A 92  ARG A 98  
P  4 TYR C 109 ? TRP C 110 ? TYR A 109 TRP A 110 
Q  1 SER C 127 ? LEU C 131 ? SER A 127 LEU A 131 
Q  2 THR C 142 ? TYR C 152 ? THR A 142 TYR A 152 
Q  3 TYR C 183 ? PRO C 192 ? TYR A 183 PRO A 192 
Q  4 VAL C 170 ? THR C 172 ? VAL A 170 THR A 172 
R  1 SER C 127 ? LEU C 131 ? SER A 127 LEU A 131 
R  2 THR C 142 ? TYR C 152 ? THR A 142 TYR A 152 
R  3 TYR C 183 ? PRO C 192 ? TYR A 183 PRO A 192 
R  4 VAL C 176 ? LEU C 177 ? VAL A 176 LEU A 177 
S  1 THR C 158 ? TRP C 161 ? THR A 158 TRP A 161 
S  2 TYR C 201 ? HIS C 207 ? TYR A 201 HIS A 207 
S  3 THR C 212 ? VAL C 218 ? THR A 212 VAL A 218 
T  1 MET D 4   ? SER D 7   ? MET B 4   SER B 7   
T  2 ALA D 19  ? SER D 25  ? ALA B 19  SER B 25  
T  3 ASP D 76  ? ILE D 81  ? ASP B 76  ILE B 81  
T  4 PHE D 68  ? SER D 73  ? PHE B 68  SER B 73  
U  1 SER D 10  ? VAL D 13  ? SER B 10  VAL B 13  
U  2 THR D 108 ? ILE D 112 ? THR B 108 ILE B 112 
U  3 ALA D 90  ? ASN D 96  ? ALA B 90  ASN B 96  
U  4 LEU D 39  ? GLN D 44  ? LEU B 39  GLN B 44  
U  5 LYS D 51  ? TYR D 55  ? LYS B 51  TYR B 55  
U  6 THR D 59  ? ARG D 60  ? THR B 59  ARG B 60  
V  1 SER D 120 ? PHE D 124 ? SER B 120 PHE B 124 
V  2 THR D 135 ? PHE D 145 ? THR B 135 PHE B 145 
V  3 TYR D 179 ? SER D 188 ? TYR B 179 SER B 188 
V  4 SER D 165 ? VAL D 169 ? SER B 165 VAL B 169 
W  1 ALA D 159 ? LEU D 160 ? ALA B 159 LEU B 160 
W  2 LYS D 151 ? VAL D 156 ? LYS B 151 VAL B 156 
W  3 VAL D 197 ? THR D 203 ? VAL B 197 THR B 203 
W  4 VAL D 211 ? ASN D 216 ? VAL B 211 ASN B 216 
X  1 GLN E 3   ? GLN E 6   ? GLN H 3   GLN H 6   
X  2 LEU E 18  ? SER E 25  ? LEU H 18  SER H 25  
X  3 THR E 78  ? TRP E 83  ? THR H 78  TRP H 83  
X  4 THR E 69  ? ASP E 73  ? THR H 69  ASP H 73  
Y  1 GLU E 10  ? LYS E 12  ? GLU H 10  LYS H 12  
Y  2 THR E 114 ? VAL E 118 ? THR H 114 VAL H 118 
Y  3 ALA E 92  ? ARG E 98  ? ALA H 92  ARG H 98  
Y  4 MET E 34  ? GLN E 39  ? MET H 34  GLN H 39  
Y  5 LEU E 45  ? ILE E 51  ? LEU H 45  ILE H 51  
Y  6 THR E 58  ? TYR E 60  ? THR H 58  TYR H 60  
Z  1 GLU E 10  ? LYS E 12  ? GLU H 10  LYS H 12  
Z  2 THR E 114 ? VAL E 118 ? THR H 114 VAL H 118 
Z  3 ALA E 92  ? ARG E 98  ? ALA H 92  ARG H 98  
Z  4 TYR E 109 ? TRP E 110 ? TYR H 109 TRP H 110 
AA 1 SER E 127 ? LEU E 131 ? SER H 127 LEU H 131 
AA 2 THR E 142 ? TYR E 152 ? THR H 142 TYR H 152 
AA 3 TYR E 183 ? PRO E 192 ? TYR H 183 PRO H 192 
AA 4 VAL E 170 ? THR E 172 ? VAL H 170 THR H 172 
AB 1 SER E 127 ? LEU E 131 ? SER H 127 LEU H 131 
AB 2 THR E 142 ? TYR E 152 ? THR H 142 TYR H 152 
AB 3 TYR E 183 ? PRO E 192 ? TYR H 183 PRO H 192 
AB 4 VAL E 176 ? LEU E 177 ? VAL H 176 LEU H 177 
AC 1 THR E 158 ? TRP E 161 ? THR H 158 TRP H 161 
AC 2 ILE E 202 ? HIS E 207 ? ILE H 202 HIS H 207 
AC 3 THR E 212 ? LYS E 217 ? THR H 212 LYS H 217 
AD 1 MET F 4   ? SER F 7   ? MET L 4   SER L 7   
AD 2 ALA F 19  ? SER F 25  ? ALA L 19  SER L 25  
AD 3 ASP F 76  ? ILE F 81  ? ASP L 76  ILE L 81  
AD 4 PHE F 68  ? SER F 73  ? PHE L 68  SER L 73  
AE 1 SER F 10  ? SER F 14  ? SER L 10  SER L 14  
AE 2 THR F 108 ? LYS F 113 ? THR L 108 LYS L 113 
AE 3 ALA F 90  ? ASN F 96  ? ALA L 90  ASN L 96  
AE 4 LEU F 39  ? GLN F 44  ? LEU L 39  GLN L 44  
AE 5 LYS F 51  ? TYR F 55  ? LYS L 51  TYR L 55  
AE 6 THR F 59  ? ARG F 60  ? THR L 59  ARG L 60  
AF 1 LEU F 30  ? ASN F 31  ? LEU L 30  ASN L 31  
AF 2 LYS F 36  ? ASN F 37  ? LYS L 36  ASN L 37  
AG 1 SER F 120 ? PHE F 124 ? SER L 120 PHE L 124 
AG 2 THR F 135 ? PHE F 145 ? THR L 135 PHE L 145 
AG 3 TYR F 179 ? SER F 188 ? TYR L 179 SER L 188 
AG 4 SER F 165 ? VAL F 169 ? SER L 165 VAL L 169 
AH 1 ALA F 159 ? LEU F 160 ? ALA L 159 LEU L 160 
AH 2 LYS F 151 ? VAL F 156 ? LYS L 151 VAL L 156 
AH 3 VAL F 197 ? THR F 203 ? VAL L 197 THR L 203 
AH 4 VAL F 211 ? ASN F 216 ? VAL L 211 ASN L 216 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N THR A 9   ? N THR C 28  O ASP A 23  ? O ASP C 42  
A  2 3 N LEU A 20  ? N LEU C 39  O CYS A 49  ? O CYS C 68  
B  1 2 O TYR A 39  ? O TYR C 58  N LYS A 35  ? N LYS C 54  
B  2 3 N VAL A 34  ? N VAL C 53  O THR A 63  ? O THR C 82  
B  3 4 N VAL A 66  ? N VAL C 85  O PHE A 71  ? O PHE C 90  
C  1 2 N GLU A 89  ? N GLU C 108 O ALA A 106 ? O ALA C 125 
C  2 3 N LEU A 101 ? N LEU C 120 O PHE A 147 ? O PHE C 166 
C  3 4 O ILE A 143 ? O ILE C 162 N LYS A 135 ? N LYS C 154 
D  1 2 O TYR A 129 ? O TYR C 148 N LEU A 121 ? N LEU C 140 
D  2 3 N TYR A 120 ? N TYR C 139 O LEU A 163 ? O LEU C 182 
D  3 4 N VAL A 164 ? N VAL C 183 O THR A 176 ? O THR C 195 
E  1 2 N THR A 194 ? N THR C 213 O HIS A 205 ? O HIS C 224 
E  2 3 N MET A 204 ? N MET C 223 O PHE A 240 ? O PHE C 259 
F  1 2 O GLU A 232 ? O GLU C 251 N LEU A 220 ? N LEU C 239 
F  2 3 N GLU A 219 ? N GLU C 238 O ARG A 253 ? O ARG C 272 
G  1 2 N LYS B 14  ? N LYS D 33  O GLN B 19  ? O GLN D 38  
G  2 3 N LEU B 20  ? N LEU D 39  O CYS B 49  ? O CYS D 68  
H  1 2 O MET B 41  ? O MET D 60  N CYS B 33  ? N CYS D 52  
H  2 3 N VAL B 34  ? N VAL D 53  O THR B 63  ? O THR D 82  
H  3 4 N VAL B 64  ? N VAL D 83  O THR B 73  ? O THR D 92  
I  1 2 N THR B 92  ? N THR D 111 O SER B 104 ? O SER D 123 
I  2 3 N LEU B 101 ? N LEU D 120 O PHE B 147 ? O PHE D 166 
I  3 4 O GLY B 144 ? O GLY D 163 N LYS B 135 ? N LYS D 154 
J  1 2 N ASN B 122 ? N ASN D 141 O HIS B 161 ? O HIS D 180 
J  2 3 N VAL B 164 ? N VAL D 183 O THR B 176 ? O THR D 195 
K  1 2 N THR B 194 ? N THR D 213 O HIS B 205 ? O HIS D 224 
K  2 3 N MET B 204 ? N MET D 223 O PHE B 240 ? O PHE D 259 
L  1 2 O ILE B 230 ? O ILE D 249 N ILE B 222 ? N ILE D 241 
L  2 3 N ARG B 217 ? N ARG D 236 O ARG B 255 ? O ARG D 274 
M  1 2 O ILE B 230 ? O ILE D 249 N ILE B 222 ? N ILE D 241 
M  2 3 N GLN B 221 ? N GLN D 240 O GLN B 251 ? O GLN D 270 
M  3 4 N VAL B 250 ? N VAL D 269 O GLN B 269 ? O GLN D 288 
N  1 2 N VAL C 5   ? N VAL A 5   O LYS C 23  ? O LYS A 23  
N  2 3 N LEU C 18  ? N LEU A 18  O TRP C 83  ? O TRP A 83  
N  3 4 O GLN C 82  ? O GLN A 82  N THR C 69  ? N THR A 69  
O  1 2 N LYS C 12  ? N LYS A 12  O THR C 117 ? O THR A 117 
O  2 3 O VAL C 116 ? O VAL A 116 N ALA C 92  ? N ALA A 92  
O  3 4 O ALA C 97  ? O ALA A 97  N LYS C 35  ? N LYS A 35  
O  4 5 N TRP C 36  ? N TRP A 36  O MET C 48  ? O MET A 48  
O  5 6 N ASP C 50  ? N ASP A 50  O PHE C 59  ? O PHE A 59  
P  1 2 N LYS C 12  ? N LYS A 12  O THR C 117 ? O THR A 117 
P  2 3 O VAL C 116 ? O VAL A 116 N ALA C 92  ? N ALA A 92  
P  3 4 N ARG C 98  ? N ARG A 98  O TYR C 109 ? O TYR A 109 
Q  1 2 N PHE C 129 ? N PHE A 129 O LEU C 148 ? O LEU A 148 
Q  2 3 N TYR C 152 ? N TYR A 152 O TYR C 183 ? O TYR A 183 
Q  3 4 O VAL C 188 ? O VAL A 188 N HIS C 171 ? N HIS A 171 
R  1 2 N PHE C 129 ? N PHE A 129 O LEU C 148 ? O LEU A 148 
R  2 3 N TYR C 152 ? N TYR A 152 O TYR C 183 ? O TYR A 183 
R  3 4 O SER C 184 ? O SER A 184 N VAL C 176 ? N VAL A 176 
S  1 2 N SER C 160 ? N SER A 160 O ASN C 204 ? O ASN A 204 
S  2 3 N HIS C 207 ? N HIS A 207 O THR C 212 ? O THR A 212 
T  1 2 N SER D 7   ? N SER B 7   O ASN D 22  ? O ASN B 22  
T  2 3 N CYS D 23  ? N CYS B 23  O PHE D 77  ? O PHE B 77  
T  3 4 O THR D 80  ? O THR B 80  N SER D 69  ? N SER B 69  
U  1 2 N VAL D 13  ? N VAL B 13  O GLU D 111 ? O GLU B 111 
U  2 3 O LEU D 110 ? O LEU B 110 N ALA D 90  ? N ALA B 90  
U  3 4 O GLN D 95  ? O GLN B 95  N THR D 40  ? N THR B 40  
U  4 5 N TRP D 41  ? N TRP B 41  O LEU D 53  ? O LEU B 53  
U  5 6 N TYR D 55  ? N TYR B 55  O THR D 59  ? O THR B 59  
V  1 2 N PHE D 124 ? N PHE B 124 O VAL D 139 ? O VAL B 139 
V  2 3 N ALA D 136 ? N ALA B 136 O LEU D 187 ? O LEU B 187 
V  3 4 O THR D 184 ? O THR B 184 N GLN D 166 ? N GLN B 166 
W  1 2 O ALA D 159 ? O ALA B 159 N VAL D 156 ? N VAL B 156 
W  2 3 N GLN D 153 ? N GLN B 153 O GLU D 201 ? O GLU B 201 
W  3 4 N VAL D 202 ? N VAL B 202 O VAL D 211 ? O VAL B 211 
X  1 2 N GLN E 3   ? N GLN H 3   O SER E 25  ? O SER H 25  
X  2 3 N CYS E 22  ? N CYS H 22  O THR E 79  ? O THR H 79  
X  3 4 O THR E 78  ? O THR H 78  N ASP E 73  ? N ASP H 73  
Y  1 2 N GLU E 10  ? N GLU H 10  O MET E 115 ? O MET H 115 
Y  2 3 O VAL E 116 ? O VAL H 116 N ALA E 92  ? N ALA H 92  
Y  3 4 O TYR E 95  ? O TYR H 95  N ALA E 37  ? N ALA H 37  
Y  4 5 N TRP E 36  ? N TRP H 36  O MET E 48  ? O MET H 48  
Y  5 6 N ASP E 50  ? N ASP H 50  O PHE E 59  ? O PHE H 59  
Z  1 2 N GLU E 10  ? N GLU H 10  O MET E 115 ? O MET H 115 
Z  2 3 O VAL E 116 ? O VAL H 116 N ALA E 92  ? N ALA H 92  
Z  3 4 N ARG E 98  ? N ARG H 98  O TYR E 109 ? O TYR H 109 
AA 1 2 N LEU E 131 ? N LEU H 131 O GLY E 146 ? O GLY H 146 
AA 2 3 N TYR E 152 ? N TYR H 152 O TYR E 183 ? O TYR H 183 
AA 3 4 O VAL E 188 ? O VAL H 188 N HIS E 171 ? N HIS H 171 
AB 1 2 N LEU E 131 ? N LEU H 131 O GLY E 146 ? O GLY H 146 
AB 2 3 N TYR E 152 ? N TYR H 152 O TYR E 183 ? O TYR H 183 
AB 3 4 O SER E 184 ? O SER H 184 N VAL E 176 ? N VAL H 176 
AC 1 2 N SER E 160 ? N SER H 160 O ASN E 204 ? O ASN H 204 
AC 2 3 N VAL E 205 ? N VAL H 205 O VAL E 214 ? O VAL H 214 
AD 1 2 N SER F 7   ? N SER L 7   O ASN F 22  ? O ASN L 22  
AD 2 3 N ALA F 19  ? N ALA L 19  O ILE F 81  ? O ILE L 81  
AD 3 4 O THR F 80  ? O THR L 80  N SER F 69  ? N SER L 69  
AE 1 2 N LEU F 11  ? N LEU L 11  O GLU F 111 ? O GLU L 111 
AE 2 3 O LEU F 110 ? O LEU L 110 N ALA F 90  ? N ALA L 90  
AE 3 4 O TYR F 93  ? O TYR L 93  N TYR F 42  ? N TYR L 42  
AE 4 5 N TRP F 41  ? N TRP L 41  O LEU F 53  ? O LEU L 53  
AE 5 6 N TYR F 55  ? N TYR L 55  O THR F 59  ? O THR L 59  
AF 1 2 N ASN F 31  ? N ASN L 31  O LYS F 36  ? O LYS L 36  
AG 1 2 N SER F 120 ? N SER L 120 O ASN F 143 ? O ASN L 143 
AG 2 3 N ALA F 136 ? N ALA L 136 O LEU F 187 ? O LEU L 187 
AG 3 4 O THR F 184 ? O THR L 184 N GLN F 166 ? N GLN L 166 
AH 1 2 O ALA F 159 ? O ALA L 159 N VAL F 156 ? N VAL L 156 
AH 2 3 N GLN F 153 ? N GLN L 153 O GLU F 201 ? O GLU L 201 
AH 3 4 N VAL F 202 ? N VAL L 202 O VAL F 211 ? O VAL L 211 
# 
_atom_sites.entry_id                    4JZJ 
_atom_sites.fract_transf_matrix[1][1]   0.011325 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001482 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008289 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010848 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ASN A 1 5   ? 78.699  4.040   1.071   1.00 61.39  ? 24  ASN C N   1 
ATOM   2     C CA  . ASN A 1 5   ? 77.782  4.759   1.957   1.00 61.41  ? 24  ASN C CA  1 
ATOM   3     C C   . ASN A 1 5   ? 76.329  5.031   1.393   1.00 22.35  ? 24  ASN C C   1 
ATOM   4     O O   . ASN A 1 5   ? 75.369  4.357   1.833   1.00 24.18  ? 24  ASN C O   1 
ATOM   5     C CB  . ASN A 1 5   ? 78.479  5.996   2.580   1.00 67.22  ? 24  ASN C CB  1 
ATOM   6     C CG  . ASN A 1 5   ? 77.685  6.610   3.741   1.00 67.33  ? 24  ASN C CG  1 
ATOM   7     O OD1 . ASN A 1 5   ? 76.754  5.987   4.280   1.00 67.43  ? 24  ASN C OD1 1 
ATOM   8     N ND2 . ASN A 1 5   ? 78.055  7.834   4.133   1.00 67.26  ? 24  ASN C ND2 1 
ATOM   9     N N   . PRO A 1 6   ? 76.128  5.986   0.451   1.00 66.40  ? 25  PRO C N   1 
ATOM   10    C CA  . PRO A 1 6   ? 74.728  6.088   0.025   1.00 60.98  ? 25  PRO C CA  1 
ATOM   11    C C   . PRO A 1 6   ? 74.424  5.170   -1.150  1.00 58.94  ? 25  PRO C C   1 
ATOM   12    O O   . PRO A 1 6   ? 75.299  4.976   -1.992  1.00 60.01  ? 25  PRO C O   1 
ATOM   13    C CB  . PRO A 1 6   ? 74.600  7.551   -0.419  1.00 57.47  ? 25  PRO C CB  1 
ATOM   14    C CG  . PRO A 1 6   ? 75.950  8.178   -0.216  1.00 59.49  ? 25  PRO C CG  1 
ATOM   15    C CD  . PRO A 1 6   ? 76.933  7.061   -0.143  1.00 64.30  ? 25  PRO C CD  1 
ATOM   16    N N   . PRO A 1 7   ? 73.193  4.633   -1.229  1.00 56.11  ? 26  PRO C N   1 
ATOM   17    C CA  . PRO A 1 7   ? 72.825  3.703   -2.305  1.00 55.33  ? 26  PRO C CA  1 
ATOM   18    C C   . PRO A 1 7   ? 72.729  4.395   -3.668  1.00 50.45  ? 26  PRO C C   1 
ATOM   19    O O   . PRO A 1 7   ? 72.773  3.748   -4.718  1.00 51.31  ? 26  PRO C O   1 
ATOM   20    C CB  . PRO A 1 7   ? 71.437  3.236   -1.885  1.00 55.40  ? 26  PRO C CB  1 
ATOM   21    C CG  . PRO A 1 7   ? 70.875  4.400   -1.151  1.00 52.75  ? 26  PRO C CG  1 
ATOM   22    C CD  . PRO A 1 7   ? 72.031  4.989   -0.394  1.00 54.09  ? 26  PRO C CD  1 
ATOM   23    N N   . ILE A 1 8   ? 72.594  5.713   -3.643  1.00 45.64  ? 27  ILE C N   1 
ATOM   24    C CA  . ILE A 1 8   ? 72.350  6.475   -4.851  1.00 41.55  ? 27  ILE C CA  1 
ATOM   25    C C   . ILE A 1 8   ? 73.253  7.676   -4.843  1.00 39.28  ? 27  ILE C C   1 
ATOM   26    O O   . ILE A 1 8   ? 73.282  8.444   -3.873  1.00 38.61  ? 27  ILE C O   1 
ATOM   27    C CB  . ILE A 1 8   ? 70.869  6.910   -4.934  1.00 39.19  ? 27  ILE C CB  1 
ATOM   28    C CG1 . ILE A 1 8   ? 70.071  5.865   -5.693  1.00 40.40  ? 27  ILE C CG1 1 
ATOM   29    C CG2 . ILE A 1 8   ? 70.693  8.269   -5.595  1.00 35.95  ? 27  ILE C CG2 1 
ATOM   30    C CD1 . ILE A 1 8   ? 68.660  5.750   -5.199  1.00 40.21  ? 27  ILE C CD1 1 
ATOM   31    N N   . THR A 1 9   ? 74.022  7.817   -5.915  1.00 38.60  ? 28  THR C N   1 
ATOM   32    C CA  . THR A 1 9   ? 74.929  8.949   -6.046  1.00 37.54  ? 28  THR C CA  1 
ATOM   33    C C   . THR A 1 9   ? 74.799  9.562   -7.445  1.00 35.14  ? 28  THR C C   1 
ATOM   34    O O   . THR A 1 9   ? 74.256  8.939   -8.354  1.00 34.93  ? 28  THR C O   1 
ATOM   35    C CB  . THR A 1 9   ? 76.399  8.540   -5.764  1.00 34.90  ? 28  THR C CB  1 
ATOM   36    O OG1 . THR A 1 9   ? 76.895  7.714   -6.827  1.00 36.68  ? 28  THR C OG1 1 
ATOM   37    C CG2 . THR A 1 9   ? 76.510  7.777   -4.450  1.00 37.55  ? 28  THR C CG2 1 
ATOM   38    N N   . ASN A 1 10  ? 75.289  10.783  -7.610  1.00 33.82  ? 29  ASN C N   1 
ATOM   39    C CA  . ASN A 1 10  ? 75.327  11.443  -8.916  1.00 32.47  ? 29  ASN C CA  1 
ATOM   40    C C   . ASN A 1 10  ? 73.950  11.653  -9.519  1.00 29.58  ? 29  ASN C C   1 
ATOM   41    O O   . ASN A 1 10  ? 73.665  11.208  -10.617 1.00 29.51  ? 29  ASN C O   1 
ATOM   42    C CB  . ASN A 1 10  ? 76.217  10.682  -9.896  1.00 35.07  ? 29  ASN C CB  1 
ATOM   43    C CG  . ASN A 1 10  ? 76.651  11.546  -11.063 1.00 35.43  ? 29  ASN C CG  1 
ATOM   44    O OD1 . ASN A 1 10  ? 76.518  12.776  -11.010 1.00 34.46  ? 29  ASN C OD1 1 
ATOM   45    N ND2 . ASN A 1 10  ? 77.177  10.918  -12.122 1.00 37.23  ? 29  ASN C ND2 1 
ATOM   46    N N   . LEU A 1 11  ? 73.092  12.319  -8.779  1.00 27.75  ? 30  LEU C N   1 
ATOM   47    C CA  . LEU A 1 11  ? 71.754  12.570  -9.225  1.00 25.98  ? 30  LEU C CA  1 
ATOM   48    C C   . LEU A 1 11  ? 71.904  13.617  -10.296 1.00 25.89  ? 30  LEU C C   1 
ATOM   49    O O   . LEU A 1 11  ? 72.707  14.541  -10.130 1.00 26.82  ? 30  LEU C O   1 
ATOM   50    C CB  . LEU A 1 11  ? 70.965  13.140  -8.074  1.00 25.13  ? 30  LEU C CB  1 
ATOM   51    C CG  . LEU A 1 11  ? 69.458  13.130  -8.161  1.00 24.52  ? 30  LEU C CG  1 
ATOM   52    C CD1 . LEU A 1 11  ? 68.953  11.758  -8.612  1.00 25.25  ? 30  LEU C CD1 1 
ATOM   53    C CD2 . LEU A 1 11  ? 68.909  13.511  -6.795  1.00 24.78  ? 30  LEU C CD2 1 
ATOM   54    N N   . ARG A 1 12  ? 71.161  13.485  -11.398 1.00 25.01  ? 31  ARG C N   1 
ATOM   55    C CA  . ARG A 1 12  ? 71.278  14.450  -12.477 1.00 24.61  ? 31  ARG C CA  1 
ATOM   56    C C   . ARG A 1 12  ? 70.135  14.370  -13.460 1.00 23.48  ? 31  ARG C C   1 
ATOM   57    O O   . ARG A 1 12  ? 69.477  13.340  -13.592 1.00 23.45  ? 31  ARG C O   1 
ATOM   58    C CB  . ARG A 1 12  ? 72.603  14.267  -13.210 1.00 26.81  ? 31  ARG C CB  1 
ATOM   59    C CG  . ARG A 1 12  ? 72.713  12.971  -13.943 1.00 28.35  ? 31  ARG C CG  1 
ATOM   60    C CD  . ARG A 1 12  ? 74.128  12.490  -13.925 1.00 30.97  ? 31  ARG C CD  1 
ATOM   61    N NE  . ARG A 1 12  ? 74.296  11.307  -14.765 1.00 33.07  ? 31  ARG C NE  1 
ATOM   62    C CZ  . ARG A 1 12  ? 74.376  10.061  -14.306 1.00 34.65  ? 31  ARG C CZ  1 
ATOM   63    N NH1 . ARG A 1 12  ? 74.305  9.829   -12.995 1.00 34.51  ? 31  ARG C NH1 1 
ATOM   64    N NH2 . ARG A 1 12  ? 74.549  9.049   -15.152 1.00 36.68  ? 31  ARG C NH2 1 
ATOM   65    N N   . MET A 1 13  ? 69.906  15.484  -14.148 1.00 22.97  ? 32  MET C N   1 
ATOM   66    C CA  . MET A 1 13  ? 68.868  15.582  -15.174 1.00 22.30  ? 32  MET C CA  1 
ATOM   67    C C   . MET A 1 13  ? 69.495  15.464  -16.546 1.00 23.72  ? 32  MET C C   1 
ATOM   68    O O   . MET A 1 13  ? 70.430  16.175  -16.903 1.00 24.95  ? 32  MET C O   1 
ATOM   69    C CB  . MET A 1 13  ? 68.114  16.904  -15.072 1.00 21.69  ? 32  MET C CB  1 
ATOM   70    C CG  . MET A 1 13  ? 67.015  17.050  -16.098 1.00 22.50  ? 32  MET C CG  1 
ATOM   71    S SD  . MET A 1 13  ? 65.735  15.768  -16.075 1.00 33.60  ? 32  MET C SD  1 
ATOM   72    C CE  . MET A 1 13  ? 64.841  16.199  -14.572 1.00 19.56  ? 32  MET C CE  1 
ATOM   73    N N   . LYS A 1 14  ? 69.003  14.528  -17.323 1.00 23.84  ? 33  LYS C N   1 
ATOM   74    C CA  . LYS A 1 14  ? 69.350  14.538  -18.703 1.00 24.86  ? 33  LYS C CA  1 
ATOM   75    C C   . LYS A 1 14  ? 68.247  15.344  -19.373 1.00 25.19  ? 33  LYS C C   1 
ATOM   76    O O   . LYS A 1 14  ? 67.160  14.839  -19.622 1.00 25.43  ? 33  LYS C O   1 
ATOM   77    C CB  . LYS A 1 14  ? 69.437  13.112  -19.197 1.00 25.62  ? 33  LYS C CB  1 
ATOM   78    C CG  . LYS A 1 14  ? 70.678  12.461  -18.710 1.00 25.81  ? 33  LYS C CG  1 
ATOM   79    C CD  . LYS A 1 14  ? 70.581  10.968  -18.770 1.00 26.93  ? 33  LYS C CD  1 
ATOM   80    C CE  . LYS A 1 14  ? 70.480  10.450  -20.179 1.00 28.99  ? 33  LYS C CE  1 
ATOM   81    N NZ  . LYS A 1 14  ? 71.150  9.112   -20.326 1.00 31.44  ? 33  LYS C NZ  1 
ATOM   82    N N   . ALA A 1 15  ? 68.533  16.616  -19.628 1.00 25.79  ? 34  ALA C N   1 
ATOM   83    C CA  . ALA A 1 15  ? 67.557  17.546  -20.180 1.00 25.23  ? 34  ALA C CA  1 
ATOM   84    C C   . ALA A 1 15  ? 67.032  17.234  -21.590 1.00 32.02  ? 34  ALA C C   1 
ATOM   85    O O   . ALA A 1 15  ? 65.870  17.545  -21.898 1.00 27.97  ? 34  ALA C O   1 
ATOM   86    C CB  . ALA A 1 15  ? 68.096  18.956  -20.121 1.00 26.12  ? 34  ALA C CB  1 
ATOM   87    N N   . LYS A 1 16  ? 67.868  16.662  -22.458 1.00 28.38  ? 35  LYS C N   1 
ATOM   88    C CA  . LYS A 1 16  ? 67.401  16.349  -23.804 1.00 31.47  ? 35  LYS C CA  1 
ATOM   89    C C   . LYS A 1 16  ? 66.320  15.276  -23.735 1.00 31.59  ? 35  LYS C C   1 
ATOM   90    O O   . LYS A 1 16  ? 65.284  15.393  -24.374 1.00 32.01  ? 35  LYS C O   1 
ATOM   91    C CB  . LYS A 1 16  ? 68.557  15.908  -24.717 1.00 33.32  ? 35  LYS C CB  1 
ATOM   92    C CG  . LYS A 1 16  ? 68.222  14.836  -25.742 1.00 34.47  ? 35  LYS C CG  1 
ATOM   93    C CD  . LYS A 1 16  ? 67.604  15.452  -26.950 1.00 37.04  ? 35  LYS C CD  1 
ATOM   94    C CE  . LYS A 1 16  ? 66.797  14.424  -27.726 1.00 42.73  ? 35  LYS C CE  1 
ATOM   95    N NZ  . LYS A 1 16  ? 67.240  13.082  -27.301 1.00 42.13  ? 35  LYS C NZ  1 
ATOM   96    N N   . ALA A 1 17  ? 66.564  14.237  -22.946 1.00 30.61  ? 36  ALA C N   1 
ATOM   97    C CA  . ALA A 1 17  ? 65.631  13.121  -22.844 1.00 31.38  ? 36  ALA C CA  1 
ATOM   98    C C   . ALA A 1 17  ? 64.630  13.384  -21.762 1.00 30.16  ? 36  ALA C C   1 
ATOM   99    O O   . ALA A 1 17  ? 63.716  12.596  -21.574 1.00 30.65  ? 36  ALA C O   1 
ATOM   100   C CB  . ALA A 1 17  ? 66.374  11.836  -22.526 1.00 31.64  ? 36  ALA C CB  1 
ATOM   101   N N   . GLN A 1 18  ? 64.836  14.487  -21.044 1.00 29.12  ? 37  GLN C N   1 
ATOM   102   C CA  . GLN A 1 18  ? 64.050  14.867  -19.876 1.00 28.03  ? 37  GLN C CA  1 
ATOM   103   C C   . GLN A 1 18  ? 63.983  13.763  -18.834 1.00 27.10  ? 37  GLN C C   1 
ATOM   104   O O   . GLN A 1 18  ? 62.921  13.507  -18.278 1.00 27.64  ? 37  GLN C O   1 
ATOM   105   C CB  . GLN A 1 18  ? 62.661  15.309  -20.292 1.00 29.91  ? 37  GLN C CB  1 
ATOM   106   C CG  . GLN A 1 18  ? 62.683  16.190  -21.508 1.00 32.76  ? 37  GLN C CG  1 
ATOM   107   C CD  . GLN A 1 18  ? 61.444  17.038  -21.616 1.00 35.65  ? 37  GLN C CD  1 
ATOM   108   O OE1 . GLN A 1 18  ? 60.549  16.782  -22.450 1.00 38.46  ? 37  GLN C OE1 1 
ATOM   109   N NE2 . GLN A 1 18  ? 61.368  18.072  -20.767 1.00 35.31  ? 37  GLN C NE2 1 
ATOM   110   N N   . GLN A 1 19  ? 65.117  13.119  -18.571 1.00 26.46  ? 38  GLN C N   1 
ATOM   111   C CA  . GLN A 1 19  ? 65.157  11.980  -17.665 1.00 26.59  ? 38  GLN C CA  1 
ATOM   112   C C   . GLN A 1 19  ? 65.997  12.231  -16.407 1.00 25.58  ? 38  GLN C C   1 
ATOM   113   O O   . GLN A 1 19  ? 67.183  12.535  -16.500 1.00 25.81  ? 38  GLN C O   1 
ATOM   114   C CB  . GLN A 1 19  ? 65.679  10.755  -18.404 1.00 28.37  ? 38  GLN C CB  1 
ATOM   115   C CG  . GLN A 1 19  ? 64.603  10.062  -19.212 1.00 30.62  ? 38  GLN C CG  1 
ATOM   116   C CD  . GLN A 1 19  ? 65.124  8.946   -20.114 1.00 33.13  ? 38  GLN C CD  1 
ATOM   117   O OE1 . GLN A 1 19  ? 66.244  8.470   -19.963 1.00 33.50  ? 38  GLN C OE1 1 
ATOM   118   N NE2 . GLN A 1 19  ? 64.293  8.519   -21.042 1.00 35.36  ? 38  GLN C NE2 1 
ATOM   119   N N   . LEU A 1 20  ? 65.392  12.119  -15.227 1.00 24.87  ? 39  LEU C N   1 
ATOM   120   C CA  . LEU A 1 20  ? 66.172  12.237  -13.998 1.00 24.14  ? 39  LEU C CA  1 
ATOM   121   C C   . LEU A 1 20  ? 66.908  10.919  -13.786 1.00 25.25  ? 39  LEU C C   1 
ATOM   122   O O   . LEU A 1 20  ? 66.297  9.862   -13.919 1.00 27.62  ? 39  LEU C O   1 
ATOM   123   C CB  . LEU A 1 20  ? 65.285  12.540  -12.797 1.00 23.75  ? 39  LEU C CB  1 
ATOM   124   C CG  . LEU A 1 20  ? 66.129  12.995  -11.610 1.00 23.48  ? 39  LEU C CG  1 
ATOM   125   C CD1 . LEU A 1 20  ? 66.832  14.308  -11.933 1.00 23.14  ? 39  LEU C CD1 1 
ATOM   126   C CD2 . LEU A 1 20  ? 65.308  13.163  -10.343 1.00 23.60  ? 39  LEU C CD2 1 
ATOM   127   N N   . THR A 1 21  ? 68.203  10.959  -13.493 1.00 23.92  ? 40  THR C N   1 
ATOM   128   C CA  . THR A 1 21  ? 68.927  9.716   -13.266 1.00 24.79  ? 40  THR C CA  1 
ATOM   129   C C   . THR A 1 21  ? 70.072  9.798   -12.222 1.00 29.35  ? 40  THR C C   1 
ATOM   130   O O   . THR A 1 21  ? 70.317  10.845  -11.614 1.00 25.68  ? 40  THR C O   1 
ATOM   131   C CB  . THR A 1 21  ? 69.419  9.115   -14.571 1.00 24.60  ? 40  THR C CB  1 
ATOM   132   O OG1 . THR A 1 21  ? 69.741  7.740   -14.366 1.00 28.17  ? 40  THR C OG1 1 
ATOM   133   C CG2 . THR A 1 21  ? 70.652  9.842   -15.090 1.00 24.69  ? 40  THR C CG2 1 
ATOM   134   N N   . TRP A 1 22  ? 70.754  8.678   -12.015 1.00 27.71  ? 41  TRP C N   1 
ATOM   135   C CA  . TRP A 1 22  ? 71.634  8.508   -10.887 1.00 31.08  ? 41  TRP C CA  1 
ATOM   136   C C   . TRP A 1 22  ? 72.519  7.295   -11.111 1.00 34.35  ? 41  TRP C C   1 
ATOM   137   O O   . TRP A 1 22  ? 72.301  6.511   -12.030 1.00 34.48  ? 41  TRP C O   1 
ATOM   138   C CB  . TRP A 1 22  ? 70.810  8.318   -9.608  1.00 25.81  ? 41  TRP C CB  1 
ATOM   139   C CG  . TRP A 1 22  ? 69.688  7.322   -9.775  1.00 26.97  ? 41  TRP C CG  1 
ATOM   140   C CD1 . TRP A 1 22  ? 69.790  5.966   -9.748  1.00 29.61  ? 41  TRP C CD1 1 
ATOM   141   C CD2 . TRP A 1 22  ? 68.293  7.612   -10.007 1.00 25.41  ? 41  TRP C CD2 1 
ATOM   142   N NE1 . TRP A 1 22  ? 68.560  5.395   -9.956  1.00 30.16  ? 41  TRP C NE1 1 
ATOM   143   C CE2 . TRP A 1 22  ? 67.628  6.381   -10.120 1.00 27.59  ? 41  TRP C CE2 1 
ATOM   144   C CE3 . TRP A 1 22  ? 67.552  8.795   -10.140 1.00 23.15  ? 41  TRP C CE3 1 
ATOM   145   C CZ2 . TRP A 1 22  ? 66.265  6.294   -10.367 1.00 34.89  ? 41  TRP C CZ2 1 
ATOM   146   C CZ3 . TRP A 1 22  ? 66.199  8.708   -10.368 1.00 23.10  ? 41  TRP C CZ3 1 
ATOM   147   C CH2 . TRP A 1 22  ? 65.565  7.465   -10.478 1.00 32.60  ? 41  TRP C CH2 1 
ATOM   148   N N   . ASP A 1 23  ? 73.531  7.153   -10.264 1.00 37.05  ? 42  ASP C N   1 
ATOM   149   C CA  . ASP A 1 23  ? 74.325  5.934   -10.189 1.00 42.30  ? 42  ASP C CA  1 
ATOM   150   C C   . ASP A 1 23  ? 73.788  5.088   -9.052  1.00 44.44  ? 42  ASP C C   1 
ATOM   151   O O   . ASP A 1 23  ? 73.423  5.608   -8.001  1.00 43.13  ? 42  ASP C O   1 
ATOM   152   C CB  . ASP A 1 23  ? 75.792  6.280   -9.913  1.00 45.45  ? 42  ASP C CB  1 
ATOM   153   C CG  . ASP A 1 23  ? 76.516  6.852   -11.138 1.00 46.82  ? 42  ASP C CG  1 
ATOM   154   O OD1 . ASP A 1 23  ? 75.824  7.259   -12.121 1.00 45.15  ? 42  ASP C OD1 1 
ATOM   155   O OD2 . ASP A 1 23  ? 77.788  6.897   -11.113 1.00 49.82  ? 42  ASP C OD2 1 
ATOM   156   N N   . LEU A 1 24  ? 73.728  3.786   -9.258  1.00 48.60  ? 43  LEU C N   1 
ATOM   157   C CA  . LEU A 1 24  ? 73.442  2.879   -8.158  1.00 52.29  ? 43  LEU C CA  1 
ATOM   158   C C   . LEU A 1 24  ? 74.714  2.266   -7.573  1.00 57.84  ? 43  LEU C C   1 
ATOM   159   O O   . LEU A 1 24  ? 75.631  1.885   -8.292  1.00 60.58  ? 43  LEU C O   1 
ATOM   160   C CB  . LEU A 1 24  ? 72.504  1.765   -8.604  1.00 54.12  ? 43  LEU C CB  1 
ATOM   161   C CG  . LEU A 1 24  ? 71.021  2.092   -8.723  1.00 41.23  ? 43  LEU C CG  1 
ATOM   162   C CD1 . LEU A 1 24  ? 70.245  0.819   -9.017  1.00 46.70  ? 43  LEU C CD1 1 
ATOM   163   C CD2 . LEU A 1 24  ? 70.501  2.753   -7.462  1.00 43.90  ? 43  LEU C CD2 1 
ATOM   164   N N   . ASN A 1 25  ? 74.765  2.171   -6.257  1.00 60.20  ? 44  ASN C N   1 
ATOM   165   C CA  . ASN A 1 25  ? 75.859  1.473   -5.598  1.00 66.15  ? 44  ASN C CA  1 
ATOM   166   C C   . ASN A 1 25  ? 75.466  0.040   -5.306  1.00 71.49  ? 44  ASN C C   1 
ATOM   167   O O   . ASN A 1 25  ? 76.279  -0.869  -5.380  1.00 76.25  ? 44  ASN C O   1 
ATOM   168   C CB  . ASN A 1 25  ? 76.219  2.172   -4.294  1.00 66.12  ? 44  ASN C CB  1 
ATOM   169   C CG  . ASN A 1 25  ? 77.072  3.399   -4.512  1.00 64.41  ? 44  ASN C CG  1 
ATOM   170   O OD1 . ASN A 1 25  ? 78.138  3.528   -3.900  1.00 67.34  ? 44  ASN C OD1 1 
ATOM   171   N ND2 . ASN A 1 25  ? 76.626  4.302   -5.401  1.00 60.13  ? 44  ASN C ND2 1 
ATOM   172   N N   . ARG A 1 26  ? 74.197  -0.150  -4.981  1.00 71.36  ? 45  ARG C N   1 
ATOM   173   C CA  . ARG A 1 26  ? 73.691  -1.455  -4.621  1.00 77.03  ? 45  ARG C CA  1 
ATOM   174   C C   . ARG A 1 26  ? 72.281  -1.644  -5.170  1.00 76.15  ? 45  ARG C C   1 
ATOM   175   O O   . ARG A 1 26  ? 71.616  -0.680  -5.545  1.00 71.42  ? 45  ARG C O   1 
ATOM   176   C CB  . ARG A 1 26  ? 73.655  -1.568  -3.106  1.00 79.19  ? 45  ARG C CB  1 
ATOM   177   C CG  . ARG A 1 26  ? 72.602  -0.691  -2.476  1.00 75.07  ? 45  ARG C CG  1 
ATOM   178   C CD  . ARG A 1 26  ? 72.792  -0.623  -0.981  1.00 77.06  ? 45  ARG C CD  1 
ATOM   179   N NE  . ARG A 1 26  ? 73.711  0.447   -0.619  1.00 75.02  ? 45  ARG C NE  1 
ATOM   180   C CZ  . ARG A 1 26  ? 73.550  1.232   0.440   1.00 73.60  ? 45  ARG C CZ  1 
ATOM   181   N NH1 . ARG A 1 26  ? 72.502  1.052   1.246   1.00 74.02  ? 45  ARG C NH1 1 
ATOM   182   N NH2 . ARG A 1 26  ? 74.433  2.193   0.689   1.00 72.15  ? 45  ARG C NH2 1 
ATOM   183   N N   . ASN A 1 27  ? 71.833  -2.894  -5.224  1.00 81.32  ? 46  ASN C N   1 
ATOM   184   C CA  . ASN A 1 27  ? 70.449  -3.181  -5.557  1.00 81.21  ? 46  ASN C CA  1 
ATOM   185   C C   . ASN A 1 27  ? 69.558  -2.548  -4.509  1.00 78.43  ? 46  ASN C C   1 
ATOM   186   O O   . ASN A 1 27  ? 69.834  -2.646  -3.320  1.00 80.18  ? 46  ASN C O   1 
ATOM   187   C CB  . ASN A 1 27  ? 70.199  -4.690  -5.611  1.00 88.25  ? 46  ASN C CB  1 
ATOM   188   C CG  . ASN A 1 27  ? 69.925  -5.185  -7.018  1.00 90.03  ? 46  ASN C CG  1 
ATOM   189   O OD1 . ASN A 1 27  ? 70.645  -4.855  -7.959  1.00 95.00  ? 46  ASN C OD1 1 
ATOM   190   N ND2 . ASN A 1 27  ? 68.876  -5.985  -7.165  1.00 86.43  ? 46  ASN C ND2 1 
ATOM   191   N N   . VAL A 1 28  ? 68.506  -1.874  -4.954  1.00 74.55  ? 47  VAL C N   1 
ATOM   192   C CA  . VAL A 1 28  ? 67.526  -1.313  -4.035  1.00 72.52  ? 47  VAL C CA  1 
ATOM   193   C C   . VAL A 1 28  ? 66.144  -1.853  -4.364  1.00 73.35  ? 47  VAL C C   1 
ATOM   194   O O   . VAL A 1 28  ? 65.993  -2.656  -5.284  1.00 76.16  ? 47  VAL C O   1 
ATOM   195   C CB  . VAL A 1 28  ? 67.507  0.224   -4.056  1.00 67.04  ? 47  VAL C CB  1 
ATOM   196   C CG1 . VAL A 1 28  ? 67.571  0.744   -2.640  1.00 66.67  ? 47  VAL C CG1 1 
ATOM   197   C CG2 . VAL A 1 28  ? 68.672  0.771   -4.862  1.00 65.14  ? 47  VAL C CG2 1 
ATOM   198   N N   . THR A 1 29  ? 65.142  -1.420  -3.605  1.00 71.20  ? 48  THR C N   1 
ATOM   199   C CA  . THR A 1 29  ? 63.779  -1.924  -3.781  1.00 72.39  ? 48  THR C CA  1 
ATOM   200   C C   . THR A 1 29  ? 62.970  -1.141  -4.827  1.00 67.97  ? 48  THR C C   1 
ATOM   201   O O   . THR A 1 29  ? 62.500  -1.704  -5.823  1.00 69.90  ? 48  THR C O   1 
ATOM   202   C CB  . THR A 1 29  ? 62.997  -1.930  -2.447  1.00 73.93  ? 48  THR C CB  1 
ATOM   203   O OG1 . THR A 1 29  ? 63.304  -0.739  -1.710  1.00 70.08  ? 48  THR C OG1 1 
ATOM   204   C CG2 . THR A 1 29  ? 63.373  -3.143  -1.614  1.00 79.74  ? 48  THR C CG2 1 
ATOM   205   N N   . ASP A 1 30  ? 62.799  0.153   -4.594  1.00 62.34  ? 49  ASP C N   1 
ATOM   206   C CA  . ASP A 1 30  ? 61.967  0.951   -5.461  1.00 58.41  ? 49  ASP C CA  1 
ATOM   207   C C   . ASP A 1 30  ? 62.280  2.397   -5.233  1.00 52.68  ? 49  ASP C C   1 
ATOM   208   O O   . ASP A 1 30  ? 62.302  2.857   -4.095  1.00 52.29  ? 49  ASP C O   1 
ATOM   209   C CB  . ASP A 1 30  ? 60.495  0.710   -5.157  1.00 61.03  ? 49  ASP C CB  1 
ATOM   210   C CG  . ASP A 1 30  ? 59.595  1.059   -6.329  1.00 60.59  ? 49  ASP C CG  1 
ATOM   211   O OD1 . ASP A 1 30  ? 59.062  0.109   -6.978  1.00 64.24  ? 49  ASP C OD1 1 
ATOM   212   O OD2 . ASP A 1 30  ? 59.433  2.281   -6.605  1.00 56.89  ? 49  ASP C OD2 1 
ATOM   213   N N   . ILE A 1 31  ? 62.509  3.106   -6.331  1.00 48.79  ? 50  ILE C N   1 
ATOM   214   C CA  . ILE A 1 31  ? 62.844  4.518   -6.316  1.00 43.55  ? 50  ILE C CA  1 
ATOM   215   C C   . ILE A 1 31  ? 61.656  5.342   -6.814  1.00 40.97  ? 50  ILE C C   1 
ATOM   216   O O   . ILE A 1 31  ? 60.999  4.981   -7.783  1.00 41.99  ? 50  ILE C O   1 
ATOM   217   C CB  . ILE A 1 31  ? 64.074  4.780   -7.205  1.00 41.74  ? 50  ILE C CB  1 
ATOM   218   C CG1 . ILE A 1 31  ? 65.266  3.980   -6.692  1.00 43.99  ? 50  ILE C CG1 1 
ATOM   219   C CG2 . ILE A 1 31  ? 64.408  6.225   -7.244  1.00 38.00  ? 50  ILE C CG2 1 
ATOM   220   C CD1 . ILE A 1 31  ? 66.518  4.207   -7.479  1.00 43.26  ? 50  ILE C CD1 1 
ATOM   221   N N   . GLU A 1 32  ? 61.374  6.438   -6.125  1.00 38.03  ? 51  GLU C N   1 
ATOM   222   C CA  . GLU A 1 32  ? 60.305  7.349   -6.483  1.00 35.97  ? 51  GLU C CA  1 
ATOM   223   C C   . GLU A 1 32  ? 60.972  8.694   -6.649  1.00 32.51  ? 51  GLU C C   1 
ATOM   224   O O   . GLU A 1 32  ? 61.802  9.059   -5.830  1.00 31.46  ? 51  GLU C O   1 
ATOM   225   C CB  . GLU A 1 32  ? 59.262  7.365   -5.357  1.00 37.34  ? 51  GLU C CB  1 
ATOM   226   C CG  . GLU A 1 32  ? 58.206  8.479   -5.364  1.00 30.34  ? 51  GLU C CG  1 
ATOM   227   C CD  . GLU A 1 32  ? 57.096  8.296   -4.283  1.00 59.97  ? 51  GLU C CD  1 
ATOM   228   O OE1 . GLU A 1 32  ? 57.128  7.327   -3.480  1.00 62.11  ? 51  GLU C OE1 1 
ATOM   229   O OE2 . GLU A 1 32  ? 56.171  9.135   -4.245  1.00 60.32  ? 51  GLU C OE2 1 
ATOM   230   N N   . CYS A 1 33  ? 60.651  9.413   -7.724  1.00 31.26  ? 52  CYS C N   1 
ATOM   231   C CA  . CYS A 1 33  ? 61.151  10.779  -7.915  1.00 28.94  ? 52  CYS C CA  1 
ATOM   232   C C   . CYS A 1 33  ? 60.034  11.779  -7.717  1.00 29.22  ? 52  CYS C C   1 
ATOM   233   O O   . CYS A 1 33  ? 58.945  11.590  -8.222  1.00 30.95  ? 52  CYS C O   1 
ATOM   234   C CB  . CYS A 1 33  ? 61.728  10.975  -9.311  1.00 27.88  ? 52  CYS C CB  1 
ATOM   235   S SG  . CYS A 1 33  ? 62.881  9.729   -9.819  1.00 33.75  ? 52  CYS C SG  1 
ATOM   236   N N   . VAL A 1 34  ? 60.310  12.849  -6.995  1.00 28.22  ? 53  VAL C N   1 
ATOM   237   C CA  . VAL A 1 34  ? 59.299  13.846  -6.692  1.00 29.19  ? 53  VAL C CA  1 
ATOM   238   C C   . VAL A 1 34  ? 59.731  15.132  -7.340  1.00 28.76  ? 53  VAL C C   1 
ATOM   239   O O   . VAL A 1 34  ? 60.920  15.452  -7.312  1.00 27.69  ? 53  VAL C O   1 
ATOM   240   C CB  . VAL A 1 34  ? 59.209  14.086  -5.182  1.00 29.72  ? 53  VAL C CB  1 
ATOM   241   C CG1 . VAL A 1 34  ? 58.013  14.958  -4.861  1.00 25.68  ? 53  VAL C CG1 1 
ATOM   242   C CG2 . VAL A 1 34  ? 59.158  12.768  -4.451  1.00 25.08  ? 53  VAL C CG2 1 
ATOM   243   N N   . LYS A 1 35  ? 58.794  15.861  -7.942  1.00 30.23  ? 54  LYS C N   1 
ATOM   244   C CA  . LYS A 1 35  ? 59.120  17.140  -8.566  1.00 30.79  ? 54  LYS C CA  1 
ATOM   245   C C   . LYS A 1 35  ? 58.526  18.228  -7.741  1.00 32.92  ? 54  LYS C C   1 
ATOM   246   O O   . LYS A 1 35  ? 57.320  18.459  -7.825  1.00 34.99  ? 54  LYS C O   1 
ATOM   247   C CB  . LYS A 1 35  ? 58.561  17.234  -10.004 1.00 31.93  ? 54  LYS C CB  1 
ATOM   248   C CG  . LYS A 1 35  ? 58.882  18.564  -10.748 1.00 24.45  ? 54  LYS C CG  1 
ATOM   249   C CD  . LYS A 1 35  ? 57.682  19.505  -10.890 1.00 27.16  ? 54  LYS C CD  1 
ATOM   250   C CE  . LYS A 1 35  ? 58.129  20.959  -11.029 1.00 30.82  ? 54  LYS C CE  1 
ATOM   251   N NZ  . LYS A 1 35  ? 57.039  21.972  -11.159 1.00 34.15  ? 54  LYS C NZ  1 
ATOM   252   N N   . ASP A 1 36  ? 59.342  18.841  -6.891  1.00 33.07  ? 55  ASP C N   1 
ATOM   253   C CA  . ASP A 1 36  ? 58.961  20.074  -6.234  1.00 35.81  ? 55  ASP C CA  1 
ATOM   254   C C   . ASP A 1 36  ? 57.726  20.035  -5.331  1.00 38.42  ? 55  ASP C C   1 
ATOM   255   O O   . ASP A 1 36  ? 57.008  21.050  -5.249  1.00 41.68  ? 55  ASP C O   1 
ATOM   256   C CB  . ASP A 1 36  ? 58.630  21.065  -7.340  1.00 38.03  ? 55  ASP C CB  1 
ATOM   257   C CG  . ASP A 1 36  ? 59.540  22.241  -7.364  1.00 39.33  ? 55  ASP C CG  1 
ATOM   258   O OD1 . ASP A 1 36  ? 60.245  22.434  -6.350  1.00 39.39  ? 55  ASP C OD1 1 
ATOM   259   O OD2 . ASP A 1 36  ? 59.525  22.972  -8.396  1.00 40.67  ? 55  ASP C OD2 1 
ATOM   260   N N   . ALA A 1 37  ? 57.408  18.929  -4.675  1.00 38.03  ? 56  ALA C N   1 
ATOM   261   C CA  . ALA A 1 37  ? 56.053  18.889  -4.031  1.00 41.17  ? 56  ALA C CA  1 
ATOM   262   C C   . ALA A 1 37  ? 54.859  19.286  -4.941  1.00 37.77  ? 56  ALA C C   1 
ATOM   263   O O   . ALA A 1 37  ? 54.066  20.146  -4.567  1.00 40.61  ? 56  ALA C O   1 
ATOM   264   C CB  . ALA A 1 37  ? 55.992  19.741  -2.718  1.00 33.01  ? 56  ALA C CB  1 
ATOM   265   N N   . ASP A 1 38  ? 54.760  18.655  -6.113  1.00 36.62  ? 57  ASP C N   1 
ATOM   266   C CA  . ASP A 1 38  ? 53.746  18.940  -7.130  1.00 38.41  ? 57  ASP C CA  1 
ATOM   267   C C   . ASP A 1 38  ? 53.150  17.629  -7.524  1.00 37.27  ? 57  ASP C C   1 
ATOM   268   O O   . ASP A 1 38  ? 51.972  17.419  -7.474  1.00 39.78  ? 57  ASP C O   1 
ATOM   269   C CB  . ASP A 1 38  ? 54.425  19.436  -8.391  1.00 38.56  ? 57  ASP C CB  1 
ATOM   270   C CG  . ASP A 1 38  ? 54.410  20.921  -8.529  1.00 41.64  ? 57  ASP C CG  1 
ATOM   271   O OD1 . ASP A 1 38  ? 54.620  21.624  -7.513  1.00 42.74  ? 57  ASP C OD1 1 
ATOM   272   O OD2 . ASP A 1 38  ? 54.205  21.383  -9.680  1.00 43.28  ? 57  ASP C OD2 1 
ATOM   273   N N   . TYR A 1 39  ? 54.025  16.753  -7.966  1.00 34.32  ? 58  TYR C N   1 
ATOM   274   C CA  . TYR A 1 39  ? 53.669  15.424  -8.392  1.00 34.62  ? 58  TYR C CA  1 
ATOM   275   C C   . TYR A 1 39  ? 54.937  14.569  -8.284  1.00 31.90  ? 58  TYR C C   1 
ATOM   276   O O   . TYR A 1 39  ? 56.044  15.074  -8.110  1.00 27.75  ? 58  TYR C O   1 
ATOM   277   C CB  . TYR A 1 39  ? 53.106  15.439  -9.827  1.00 34.10  ? 58  TYR C CB  1 
ATOM   278   C CG  . TYR A 1 39  ? 54.086  15.909  -10.885 1.00 32.67  ? 58  TYR C CG  1 
ATOM   279   C CD1 . TYR A 1 39  ? 54.930  15.006  -11.529 1.00 30.29  ? 58  TYR C CD1 1 
ATOM   280   C CD2 . TYR A 1 39  ? 54.180  17.252  -11.233 1.00 32.43  ? 58  TYR C CD2 1 
ATOM   281   C CE1 . TYR A 1 39  ? 55.847  15.424  -12.459 1.00 35.42  ? 58  TYR C CE1 1 
ATOM   282   C CE2 . TYR A 1 39  ? 55.095  17.671  -12.172 1.00 37.73  ? 58  TYR C CE2 1 
ATOM   283   C CZ  . TYR A 1 39  ? 55.927  16.752  -12.779 1.00 35.98  ? 58  TYR C CZ  1 
ATOM   284   O OH  . TYR A 1 39  ? 56.842  17.162  -13.725 1.00 35.51  ? 58  TYR C OH  1 
ATOM   285   N N   . SER A 1 40  ? 54.766  13.265  -8.382  1.00 32.75  ? 59  SER C N   1 
ATOM   286   C CA  . SER A 1 40  ? 55.912  12.378  -8.387  1.00 31.38  ? 59  SER C CA  1 
ATOM   287   C C   . SER A 1 40  ? 55.619  11.237  -9.363  1.00 32.54  ? 59  SER C C   1 
ATOM   288   O O   . SER A 1 40  ? 54.552  11.194  -9.959  1.00 34.84  ? 59  SER C O   1 
ATOM   289   C CB  . SER A 1 40  ? 56.228  11.854  -6.965  1.00 31.89  ? 59  SER C CB  1 
ATOM   290   O OG  . SER A 1 40  ? 55.464  10.710  -6.604  1.00 34.71  ? 59  SER C OG  1 
ATOM   291   N N   . MET A 1 41  ? 56.567  10.324  -9.519  1.00 31.40  ? 60  MET C N   1 
ATOM   292   C CA  . MET A 1 41  ? 56.347  9.129   -10.309 1.00 33.13  ? 60  MET C CA  1 
ATOM   293   C C   . MET A 1 41  ? 57.330  8.092   -9.839  1.00 32.71  ? 60  MET C C   1 
ATOM   294   O O   . MET A 1 41  ? 58.280  8.412   -9.128  1.00 30.82  ? 60  MET C O   1 
ATOM   295   C CB  . MET A 1 41  ? 56.635  9.425   -11.767 1.00 32.69  ? 60  MET C CB  1 
ATOM   296   C CG  . MET A 1 41  ? 58.088  9.785   -12.016 1.00 29.94  ? 60  MET C CG  1 
ATOM   297   S SD  . MET A 1 41  ? 58.260  10.551  -13.609 1.00 51.68  ? 60  MET C SD  1 
ATOM   298   C CE  . MET A 1 41  ? 57.169  11.964  -13.466 1.00 27.94  ? 60  MET C CE  1 
ATOM   299   N N   . PRO A 1 42  ? 57.110  6.840   -10.223 1.00 35.09  ? 61  PRO C N   1 
ATOM   300   C CA  . PRO A 1 42  ? 58.121  5.831   -9.891  1.00 35.78  ? 61  PRO C CA  1 
ATOM   301   C C   . PRO A 1 42  ? 59.187  5.730   -10.966 1.00 34.91  ? 61  PRO C C   1 
ATOM   302   O O   . PRO A 1 42  ? 58.883  5.940   -12.145 1.00 35.36  ? 61  PRO C O   1 
ATOM   303   C CB  . PRO A 1 42  ? 57.316  4.540   -9.830  1.00 39.92  ? 61  PRO C CB  1 
ATOM   304   C CG  . PRO A 1 42  ? 56.135  4.801   -10.709 1.00 41.25  ? 61  PRO C CG  1 
ATOM   305   C CD  . PRO A 1 42  ? 55.826  6.254   -10.628 1.00 38.41  ? 61  PRO C CD  1 
ATOM   306   N N   . ALA A 1 43  ? 60.417  5.410   -10.564 1.00 34.13  ? 62  ALA C N   1 
ATOM   307   C CA  . ALA A 1 43  ? 61.506  5.188   -11.509 1.00 31.97  ? 62  ALA C CA  1 
ATOM   308   C C   . ALA A 1 43  ? 61.168  4.046   -12.455 1.00 35.32  ? 62  ALA C C   1 
ATOM   309   O O   . ALA A 1 43  ? 60.201  3.328   -12.255 1.00 38.23  ? 62  ALA C O   1 
ATOM   310   C CB  . ALA A 1 43  ? 62.813  4.894   -10.774 1.00 31.63  ? 62  ALA C CB  1 
ATOM   311   N N   . VAL A 1 44  ? 61.984  3.898   -13.485 1.00 35.79  ? 63  VAL C N   1 
ATOM   312   C CA  . VAL A 1 44  ? 61.896  2.802   -14.431 1.00 39.53  ? 63  VAL C CA  1 
ATOM   313   C C   . VAL A 1 44  ? 63.072  1.886   -14.174 1.00 41.59  ? 63  VAL C C   1 
ATOM   314   O O   . VAL A 1 44  ? 64.216  2.320   -14.317 1.00 39.98  ? 63  VAL C O   1 
ATOM   315   C CB  . VAL A 1 44  ? 62.075  3.334   -15.867 1.00 38.83  ? 63  VAL C CB  1 
ATOM   316   C CG1 . VAL A 1 44  ? 62.098  2.193   -16.862 1.00 42.52  ? 63  VAL C CG1 1 
ATOM   317   C CG2 . VAL A 1 44  ? 60.994  4.367   -16.181 1.00 36.90  ? 63  VAL C CG2 1 
ATOM   318   N N   . ASN A 1 45  ? 62.804  0.632   -13.823 1.00 45.79  ? 64  ASN C N   1 
ATOM   319   C CA  . ASN A 1 45  ? 63.858  -0.327  -13.477 1.00 48.67  ? 64  ASN C CA  1 
ATOM   320   C C   . ASN A 1 45  ? 64.911  0.338   -12.582 1.00 46.21  ? 64  ASN C C   1 
ATOM   321   O O   . ASN A 1 45  ? 66.104  0.295   -12.887 1.00 46.71  ? 64  ASN C O   1 
ATOM   322   C CB  . ASN A 1 45  ? 64.520  -0.939  -14.734 1.00 51.13  ? 64  ASN C CB  1 
ATOM   323   C CG  . ASN A 1 45  ? 63.502  -1.624  -15.689 1.00 101.93 ? 64  ASN C CG  1 
ATOM   324   O OD1 . ASN A 1 45  ? 63.550  -1.442  -16.918 1.00 102.16 ? 64  ASN C OD1 1 
ATOM   325   N ND2 . ASN A 1 45  ? 62.591  -2.416  -15.122 1.00 105.14 ? 64  ASN C ND2 1 
ATOM   326   N N   . ASN A 1 46  ? 64.467  1.015   -11.525 1.00 43.88  ? 65  ASN C N   1 
ATOM   327   C CA  . ASN A 1 46  ? 65.388  1.670   -10.590 1.00 41.88  ? 65  ASN C CA  1 
ATOM   328   C C   . ASN A 1 46  ? 66.500  2.506   -11.229 1.00 39.50  ? 65  ASN C C   1 
ATOM   329   O O   . ASN A 1 46  ? 67.494  2.843   -10.568 1.00 36.45  ? 65  ASN C O   1 
ATOM   330   C CB  . ASN A 1 46  ? 66.053  0.627   -9.703  1.00 45.60  ? 65  ASN C CB  1 
ATOM   331   C CG  . ASN A 1 46  ? 65.133  0.100   -8.651  1.00 47.70  ? 65  ASN C CG  1 
ATOM   332   O OD1 . ASN A 1 46  ? 64.097  0.706   -8.364  1.00 45.97  ? 65  ASN C OD1 1 
ATOM   333   N ND2 . ASN A 1 46  ? 65.509  -1.023  -8.045  1.00 51.85  ? 65  ASN C ND2 1 
ATOM   334   N N   . SER A 1 47  ? 66.312  2.832   -12.506 1.00 38.71  ? 66  SER C N   1 
ATOM   335   C CA  . SER A 1 47  ? 67.343  3.402   -13.347 1.00 37.63  ? 66  SER C CA  1 
ATOM   336   C C   . SER A 1 47  ? 67.200  4.915   -13.557 1.00 34.09  ? 66  SER C C   1 
ATOM   337   O O   . SER A 1 47  ? 68.147  5.667   -13.365 1.00 29.91  ? 66  SER C O   1 
ATOM   338   C CB  . SER A 1 47  ? 67.318  2.667   -14.676 1.00 38.12  ? 66  SER C CB  1 
ATOM   339   O OG  . SER A 1 47  ? 68.228  3.240   -15.575 1.00 41.43  ? 66  SER C OG  1 
ATOM   340   N N   . TYR A 1 48  ? 66.006  5.352   -13.946 1.00 33.44  ? 67  TYR C N   1 
ATOM   341   C CA  . TYR A 1 48  ? 65.723  6.771   -14.173 1.00 30.54  ? 67  TYR C CA  1 
ATOM   342   C C   . TYR A 1 48  ? 64.235  7.063   -14.016 1.00 30.62  ? 67  TYR C C   1 
ATOM   343   O O   . TYR A 1 48  ? 63.422  6.151   -13.917 1.00 32.50  ? 67  TYR C O   1 
ATOM   344   C CB  . TYR A 1 48  ? 66.136  7.166   -15.594 1.00 30.16  ? 67  TYR C CB  1 
ATOM   345   C CG  . TYR A 1 48  ? 65.332  6.464   -16.664 1.00 32.12  ? 67  TYR C CG  1 
ATOM   346   C CD1 . TYR A 1 48  ? 64.180  7.034   -17.188 1.00 31.72  ? 67  TYR C CD1 1 
ATOM   347   C CD2 . TYR A 1 48  ? 65.708  5.217   -17.129 1.00 35.04  ? 67  TYR C CD2 1 
ATOM   348   C CE1 . TYR A 1 48  ? 63.437  6.381   -18.159 1.00 34.30  ? 67  TYR C CE1 1 
ATOM   349   C CE2 . TYR A 1 48  ? 64.975  4.560   -18.103 1.00 37.64  ? 67  TYR C CE2 1 
ATOM   350   C CZ  . TYR A 1 48  ? 63.844  5.143   -18.618 1.00 37.26  ? 67  TYR C CZ  1 
ATOM   351   O OH  . TYR A 1 48  ? 63.116  4.481   -19.594 1.00 38.61  ? 67  TYR C OH  1 
ATOM   352   N N   . CYS A 1 49  ? 63.880  8.341   -14.042 1.00 29.26  ? 68  CYS C N   1 
ATOM   353   C CA  . CYS A 1 49  ? 62.472  8.753   -14.070 1.00 30.12  ? 68  CYS C CA  1 
ATOM   354   C C   . CYS A 1 49  ? 62.179  9.563   -15.319 1.00 30.53  ? 68  CYS C C   1 
ATOM   355   O O   . CYS A 1 49  ? 62.927  10.459  -15.695 1.00 29.80  ? 68  CYS C O   1 
ATOM   356   C CB  . CYS A 1 49  ? 62.104  9.582   -12.835 1.00 28.79  ? 68  CYS C CB  1 
ATOM   357   S SG  . CYS A 1 49  ? 62.007  8.625   -11.295 1.00 39.24  ? 68  CYS C SG  1 
ATOM   358   N N   . GLN A 1 50  ? 61.077  9.249   -15.972 1.00 32.15  ? 69  GLN C N   1 
ATOM   359   C CA  . GLN A 1 50  ? 60.733  9.937   -17.194 1.00 32.17  ? 69  GLN C CA  1 
ATOM   360   C C   . GLN A 1 50  ? 59.895  11.157  -16.889 1.00 32.01  ? 69  GLN C C   1 
ATOM   361   O O   . GLN A 1 50  ? 58.734  11.031  -16.544 1.00 33.28  ? 69  GLN C O   1 
ATOM   362   C CB  . GLN A 1 50  ? 59.956  8.996   -18.113 1.00 34.41  ? 69  GLN C CB  1 
ATOM   363   C CG  . GLN A 1 50  ? 59.683  9.556   -19.494 1.00 35.11  ? 69  GLN C CG  1 
ATOM   364   C CD  . GLN A 1 50  ? 60.921  10.101  -20.117 1.00 30.99  ? 69  GLN C CD  1 
ATOM   365   O OE1 . GLN A 1 50  ? 61.683  9.364   -20.733 1.00 32.03  ? 69  GLN C OE1 1 
ATOM   366   N NE2 . GLN A 1 50  ? 61.160  11.404  -19.938 1.00 29.17  ? 69  GLN C NE2 1 
ATOM   367   N N   . PHE A 1 51  ? 60.466  12.346  -17.015 1.00 31.37  ? 70  PHE C N   1 
ATOM   368   C CA  . PHE A 1 51  ? 59.649  13.556  -16.887 1.00 32.38  ? 70  PHE C CA  1 
ATOM   369   C C   . PHE A 1 51  ? 59.114  14.058  -18.219 1.00 34.66  ? 70  PHE C C   1 
ATOM   370   O O   . PHE A 1 51  ? 59.516  13.589  -19.291 1.00 35.59  ? 70  PHE C O   1 
ATOM   371   C CB  . PHE A 1 51  ? 60.392  14.667  -16.185 1.00 30.96  ? 70  PHE C CB  1 
ATOM   372   C CG  . PHE A 1 51  ? 60.566  14.436  -14.726 1.00 30.20  ? 70  PHE C CG  1 
ATOM   373   C CD1 . PHE A 1 51  ? 61.655  13.728  -14.249 1.00 29.24  ? 70  PHE C CD1 1 
ATOM   374   C CD2 . PHE A 1 51  ? 59.642  14.923  -13.829 1.00 31.02  ? 70  PHE C CD2 1 
ATOM   375   C CE1 . PHE A 1 51  ? 61.824  13.519  -12.902 1.00 28.80  ? 70  PHE C CE1 1 
ATOM   376   C CE2 . PHE A 1 51  ? 59.797  14.707  -12.473 1.00 30.59  ? 70  PHE C CE2 1 
ATOM   377   C CZ  . PHE A 1 51  ? 60.892  14.010  -12.007 1.00 29.36  ? 70  PHE C CZ  1 
ATOM   378   N N   . GLY A 1 52  ? 58.209  15.026  -18.129 1.00 35.71  ? 71  GLY C N   1 
ATOM   379   C CA  . GLY A 1 52  ? 57.394  15.418  -19.254 1.00 38.28  ? 71  GLY C CA  1 
ATOM   380   C C   . GLY A 1 52  ? 57.790  16.768  -19.788 1.00 39.12  ? 71  GLY C C   1 
ATOM   381   O O   . GLY A 1 52  ? 57.860  16.956  -21.012 1.00 41.89  ? 71  GLY C O   1 
ATOM   382   N N   . ALA A 1 53  ? 58.042  17.721  -18.903 1.00 37.52  ? 72  ALA C N   1 
ATOM   383   C CA  . ALA A 1 53  ? 58.357  19.070  -19.362 1.00 38.55  ? 72  ALA C CA  1 
ATOM   384   C C   . ALA A 1 53  ? 59.167  19.860  -18.361 1.00 37.29  ? 72  ALA C C   1 
ATOM   385   O O   . ALA A 1 53  ? 58.674  20.827  -17.790 1.00 39.18  ? 72  ALA C O   1 
ATOM   386   C CB  . ALA A 1 53  ? 57.090  19.838  -19.727 1.00 41.70  ? 72  ALA C CB  1 
ATOM   387   N N   . ILE A 1 54  ? 60.394  19.412  -18.130 1.00 34.59  ? 73  ILE C N   1 
ATOM   388   C CA  . ILE A 1 54  ? 61.457  20.191  -17.506 1.00 32.84  ? 73  ILE C CA  1 
ATOM   389   C C   . ILE A 1 54  ? 61.431  21.642  -17.977 1.00 34.96  ? 73  ILE C C   1 
ATOM   390   O O   . ILE A 1 54  ? 61.047  21.935  -19.102 1.00 36.86  ? 73  ILE C O   1 
ATOM   391   C CB  . ILE A 1 54  ? 62.830  19.637  -17.965 1.00 39.65  ? 73  ILE C CB  1 
ATOM   392   C CG1 . ILE A 1 54  ? 62.815  18.121  -18.023 1.00 38.28  ? 73  ILE C CG1 1 
ATOM   393   C CG2 . ILE A 1 54  ? 63.945  20.059  -17.043 1.00 38.67  ? 73  ILE C CG2 1 
ATOM   394   C CD1 . ILE A 1 54  ? 62.300  17.488  -16.759 1.00 36.94  ? 73  ILE C CD1 1 
ATOM   395   N N   . SER A 1 55  ? 61.833  22.553  -17.107 1.00 35.44  ? 74  SER C N   1 
ATOM   396   C CA  . SER A 1 55  ? 62.204  23.890  -17.538 1.00 38.21  ? 74  SER C CA  1 
ATOM   397   C C   . SER A 1 55  ? 63.707  23.975  -17.578 1.00 37.32  ? 74  SER C C   1 
ATOM   398   O O   . SER A 1 55  ? 64.395  23.528  -16.670 1.00 35.05  ? 74  SER C O   1 
ATOM   399   C CB  . SER A 1 55  ? 61.655  24.963  -16.620 1.00 40.07  ? 74  SER C CB  1 
ATOM   400   O OG  . SER A 1 55  ? 61.422  24.410  -15.361 1.00 38.31  ? 74  SER C OG  1 
ATOM   401   N N   . LEU A 1 56  ? 64.219  24.538  -18.657 1.00 39.58  ? 75  LEU C N   1 
ATOM   402   C CA  . LEU A 1 56  ? 65.643  24.615  -18.814 1.00 39.25  ? 75  LEU C CA  1 
ATOM   403   C C   . LEU A 1 56  ? 66.167  25.703  -17.908 1.00 40.21  ? 75  LEU C C   1 
ATOM   404   O O   . LEU A 1 56  ? 67.343  25.733  -17.597 1.00 39.90  ? 75  LEU C O   1 
ATOM   405   C CB  . LEU A 1 56  ? 66.001  24.894  -20.269 1.00 42.06  ? 75  LEU C CB  1 
ATOM   406   C CG  . LEU A 1 56  ? 66.097  23.632  -21.128 1.00 41.27  ? 75  LEU C CG  1 
ATOM   407   C CD1 . LEU A 1 56  ? 64.738  23.189  -21.680 1.00 42.04  ? 75  LEU C CD1 1 
ATOM   408   C CD2 . LEU A 1 56  ? 67.087  23.847  -22.271 1.00 43.61  ? 75  LEU C CD2 1 
ATOM   409   N N   . CYS A 1 57  ? 65.293  26.588  -17.462 1.00 41.97  ? 76  CYS C N   1 
ATOM   410   C CA  . CYS A 1 57  ? 65.790  27.812  -16.873 1.00 44.51  ? 76  CYS C CA  1 
ATOM   411   C C   . CYS A 1 57  ? 65.260  28.209  -15.505 1.00 44.89  ? 76  CYS C C   1 
ATOM   412   O O   . CYS A 1 57  ? 65.969  28.862  -14.752 1.00 46.07  ? 76  CYS C O   1 
ATOM   413   C CB  . CYS A 1 57  ? 65.681  28.952  -17.883 1.00 48.74  ? 76  CYS C CB  1 
ATOM   414   S SG  . CYS A 1 57  ? 67.080  28.908  -19.004 1.00 52.34  ? 76  CYS C SG  1 
ATOM   415   N N   . GLU A 1 58  ? 64.028  27.819  -15.194 1.00 44.30  ? 77  GLU C N   1 
ATOM   416   C CA  . GLU A 1 58  ? 63.461  28.012  -13.867 1.00 44.46  ? 77  GLU C CA  1 
ATOM   417   C C   . GLU A 1 58  ? 63.884  26.888  -12.914 1.00 40.16  ? 77  GLU C C   1 
ATOM   418   O O   . GLU A 1 58  ? 63.604  25.719  -13.169 1.00 37.15  ? 77  GLU C O   1 
ATOM   419   C CB  . GLU A 1 58  ? 61.942  28.026  -13.949 1.00 46.55  ? 77  GLU C CB  1 
ATOM   420   C CG  . GLU A 1 58  ? 61.267  28.566  -12.701 1.00 48.95  ? 77  GLU C CG  1 
ATOM   421   C CD  . GLU A 1 58  ? 61.208  30.095  -12.710 1.00 54.58  ? 77  GLU C CD  1 
ATOM   422   O OE1 . GLU A 1 58  ? 60.995  30.698  -11.624 1.00 56.66  ? 77  GLU C OE1 1 
ATOM   423   O OE2 . GLU A 1 58  ? 61.370  30.686  -13.813 1.00 57.19  ? 77  GLU C OE2 1 
ATOM   424   N N   . VAL A 1 59  ? 64.557  27.246  -11.823 1.00 40.28  ? 78  VAL C N   1 
ATOM   425   C CA  . VAL A 1 59  ? 65.014  26.265  -10.834 1.00 37.23  ? 78  VAL C CA  1 
ATOM   426   C C   . VAL A 1 59  ? 63.913  25.303  -10.385 1.00 35.39  ? 78  VAL C C   1 
ATOM   427   O O   . VAL A 1 59  ? 62.797  25.707  -10.113 1.00 37.53  ? 78  VAL C O   1 
ATOM   428   C CB  . VAL A 1 59  ? 65.614  26.946  -9.570  1.00 42.19  ? 78  VAL C CB  1 
ATOM   429   C CG1 . VAL A 1 59  ? 65.791  25.935  -8.457  1.00 39.72  ? 78  VAL C CG1 1 
ATOM   430   C CG2 . VAL A 1 59  ? 66.952  27.620  -9.884  1.00 43.78  ? 78  VAL C CG2 1 
ATOM   431   N N   . THR A 1 60  ? 64.231  24.027  -10.316 1.00 32.13  ? 79  THR C N   1 
ATOM   432   C CA  . THR A 1 60  ? 63.287  23.053  -9.842  1.00 30.89  ? 79  THR C CA  1 
ATOM   433   C C   . THR A 1 60  ? 63.965  22.103  -8.871  1.00 29.59  ? 79  THR C C   1 
ATOM   434   O O   . THR A 1 60  ? 65.114  21.732  -9.049  1.00 28.70  ? 79  THR C O   1 
ATOM   435   C CB  . THR A 1 60  ? 62.744  22.239  -10.988 1.00 29.76  ? 79  THR C CB  1 
ATOM   436   O OG1 . THR A 1 60  ? 62.208  23.137  -11.960 1.00 32.35  ? 79  THR C OG1 1 
ATOM   437   C CG2 . THR A 1 60  ? 61.667  21.260  -10.509 1.00 28.69  ? 79  THR C CG2 1 
ATOM   438   N N   . ASN A 1 61  ? 63.191  21.600  -7.731  1.00 29.56  ? 80  ASN C N   1 
ATOM   439   C CA  . ASN A 1 61  ? 63.725  20.721  -6.742  1.00 28.05  ? 80  ASN C CA  1 
ATOM   440   C C   . ASN A 1 61  ? 63.255  19.294  -6.929  1.00 26.49  ? 80  ASN C C   1 
ATOM   441   O O   . ASN A 1 61  ? 62.116  18.974  -6.659  1.00 26.96  ? 80  ASN C O   1 
ATOM   442   C CB  . ASN A 1 61  ? 63.223  21.247  -5.452  1.00 29.61  ? 80  ASN C CB  1 
ATOM   443   C CG  . ASN A 1 61  ? 63.863  20.618  -4.274  1.00 29.29  ? 80  ASN C CG  1 
ATOM   444   O OD1 . ASN A 1 61  ? 64.622  19.651  -4.354  1.00 27.24  ? 80  ASN C OD1 1 
ATOM   445   N ND2 . ASN A 1 61  ? 63.493  21.147  -3.117  1.00 31.68  ? 80  ASN C ND2 1 
ATOM   446   N N   . TYR A 1 62  ? 64.188  18.525  -7.503  1.00 25.25  ? 81  TYR C N   1 
ATOM   447   C CA  . TYR A 1 62  ? 63.868  17.114  -7.700  1.00 24.66  ? 81  TYR C CA  1 
ATOM   448   C C   . TYR A 1 62  ? 64.355  16.261  -6.508  1.00 24.50  ? 81  TYR C C   1 
ATOM   449   O O   . TYR A 1 62  ? 65.544  16.299  -6.141  1.00 24.44  ? 81  TYR C O   1 
ATOM   450   C CB  . TYR A 1 62  ? 64.487  16.599  -9.021  1.00 24.16  ? 81  TYR C CB  1 
ATOM   451   C CG  . TYR A 1 62  ? 63.969  17.313  -10.263 1.00 24.52  ? 81  TYR C CG  1 
ATOM   452   C CD1 . TYR A 1 62  ? 62.812  16.874  -10.898 1.00 25.30  ? 81  TYR C CD1 1 
ATOM   453   C CD2 . TYR A 1 62  ? 64.617  18.439  -10.771 1.00 24.52  ? 81  TYR C CD2 1 
ATOM   454   C CE1 . TYR A 1 62  ? 62.331  17.522  -12.018 1.00 26.41  ? 81  TYR C CE1 1 
ATOM   455   C CE2 . TYR A 1 62  ? 64.140  19.100  -11.871 1.00 25.52  ? 81  TYR C CE2 1 
ATOM   456   C CZ  . TYR A 1 62  ? 62.997  18.639  -12.509 1.00 26.37  ? 81  TYR C CZ  1 
ATOM   457   O OH  . TYR A 1 62  ? 62.483  19.271  -13.629 1.00 27.48  ? 81  TYR C OH  1 
ATOM   458   N N   . THR A 1 63  ? 63.430  15.492  -5.921  1.00 24.55  ? 82  THR C N   1 
ATOM   459   C CA  . THR A 1 63  ? 63.734  14.635  -4.788  1.00 24.32  ? 82  THR C CA  1 
ATOM   460   C C   . THR A 1 63  ? 63.550  13.170  -5.143  1.00 24.71  ? 82  THR C C   1 
ATOM   461   O O   . THR A 1 63  ? 62.543  12.785  -5.707  1.00 25.23  ? 82  THR C O   1 
ATOM   462   C CB  . THR A 1 63  ? 62.849  14.958  -3.580  1.00 24.86  ? 82  THR C CB  1 
ATOM   463   O OG1 . THR A 1 63  ? 62.980  16.342  -3.240  1.00 24.84  ? 82  THR C OG1 1 
ATOM   464   C CG2 . THR A 1 63  ? 63.246  14.093  -2.395  1.00 25.72  ? 82  THR C CG2 1 
ATOM   465   N N   . VAL A 1 64  ? 64.526  12.349  -4.791  1.00 25.07  ? 83  VAL C N   1 
ATOM   466   C CA  . VAL A 1 64  ? 64.472  10.936  -5.092  1.00 26.19  ? 83  VAL C CA  1 
ATOM   467   C C   . VAL A 1 64  ? 64.570  10.216  -3.774  1.00 27.51  ? 83  VAL C C   1 
ATOM   468   O O   . VAL A 1 64  ? 65.384  10.564  -2.935  1.00 27.56  ? 83  VAL C O   1 
ATOM   469   C CB  . VAL A 1 64  ? 65.649  10.519  -6.003  1.00 26.73  ? 83  VAL C CB  1 
ATOM   470   C CG1 . VAL A 1 64  ? 65.835  9.024   -6.000  1.00 28.96  ? 83  VAL C CG1 1 
ATOM   471   C CG2 . VAL A 1 64  ? 65.435  11.034  -7.444  1.00 25.82  ? 83  VAL C CG2 1 
ATOM   472   N N   . ARG A 1 65  ? 63.727  9.222   -3.567  1.00 29.20  ? 84  ARG C N   1 
ATOM   473   C CA  . ARG A 1 65  ? 63.726  8.573   -2.290  1.00 27.88  ? 84  ARG C CA  1 
ATOM   474   C C   . ARG A 1 65  ? 63.606  7.087   -2.447  1.00 36.07  ? 84  ARG C C   1 
ATOM   475   O O   . ARG A 1 65  ? 63.017  6.595   -3.394  1.00 30.69  ? 84  ARG C O   1 
ATOM   476   C CB  . ARG A 1 65  ? 62.618  9.122   -1.404  1.00 30.68  ? 84  ARG C CB  1 
ATOM   477   C CG  . ARG A 1 65  ? 61.220  8.736   -1.783  1.00 29.61  ? 84  ARG C CG  1 
ATOM   478   C CD  . ARG A 1 65  ? 60.260  9.231   -0.729  1.00 30.94  ? 84  ARG C CD  1 
ATOM   479   N NE  . ARG A 1 65  ? 58.889  8.953   -1.108  1.00 32.40  ? 84  ARG C NE  1 
ATOM   480   C CZ  . ARG A 1 65  ? 57.855  8.942   -0.276  1.00 36.58  ? 84  ARG C CZ  1 
ATOM   481   N NH1 . ARG A 1 65  ? 58.018  9.180   1.025   1.00 35.95  ? 84  ARG C NH1 1 
ATOM   482   N NH2 . ARG A 1 65  ? 56.648  8.672   -0.761  1.00 36.41  ? 84  ARG C NH2 1 
ATOM   483   N N   . VAL A 1 66  ? 64.187  6.368   -1.506  1.00 38.32  ? 85  VAL C N   1 
ATOM   484   C CA  . VAL A 1 66  ? 64.236  4.944   -1.631  1.00 41.66  ? 85  VAL C CA  1 
ATOM   485   C C   . VAL A 1 66  ? 63.303  4.351   -0.619  1.00 45.14  ? 85  VAL C C   1 
ATOM   486   O O   . VAL A 1 66  ? 63.298  4.781   0.530   1.00 45.95  ? 85  VAL C O   1 
ATOM   487   C CB  . VAL A 1 66  ? 65.661  4.441   -1.455  1.00 42.97  ? 85  VAL C CB  1 
ATOM   488   C CG1 . VAL A 1 66  ? 65.665  3.073   -0.848  1.00 47.57  ? 85  VAL C CG1 1 
ATOM   489   C CG2 . VAL A 1 66  ? 66.362  4.421   -2.799  1.00 41.49  ? 85  VAL C CG2 1 
ATOM   490   N N   . ALA A 1 67  ? 62.494  3.386   -1.058  1.00 47.62  ? 86  ALA C N   1 
ATOM   491   C CA  . ALA A 1 67  ? 61.561  2.671   -0.180  1.00 51.29  ? 86  ALA C CA  1 
ATOM   492   C C   . ALA A 1 67  ? 62.243  1.935   0.991   1.00 54.64  ? 86  ALA C C   1 
ATOM   493   O O   . ALA A 1 67  ? 61.718  1.889   2.106   1.00 56.88  ? 86  ALA C O   1 
ATOM   494   C CB  . ALA A 1 67  ? 60.711  1.694   -0.999  1.00 53.84  ? 86  ALA C CB  1 
ATOM   495   N N   . ASN A 1 68  ? 63.409  1.357   0.726   1.00 55.41  ? 87  ASN C N   1 
ATOM   496   C CA  . ASN A 1 68  ? 64.105  0.549   1.717   1.00 59.33  ? 87  ASN C CA  1 
ATOM   497   C C   . ASN A 1 68  ? 65.569  0.251   1.373   1.00 60.22  ? 87  ASN C C   1 
ATOM   498   O O   . ASN A 1 68  ? 65.873  -0.162  0.250   1.00 60.11  ? 87  ASN C O   1 
ATOM   499   C CB  . ASN A 1 68  ? 63.369  -0.760  1.967   1.00 64.13  ? 87  ASN C CB  1 
ATOM   500   C CG  . ASN A 1 68  ? 64.204  -1.741  2.740   1.00 68.82  ? 87  ASN C CG  1 
ATOM   501   O OD1 . ASN A 1 68  ? 64.278  -1.671  3.967   1.00 70.78  ? 87  ASN C OD1 1 
ATOM   502   N ND2 . ASN A 1 68  ? 64.852  -2.663  2.027   1.00 71.20  ? 87  ASN C ND2 1 
ATOM   503   N N   . PRO A 1 69  ? 66.477  0.475   2.346   1.00 61.49  ? 88  PRO C N   1 
ATOM   504   C CA  . PRO A 1 69  ? 66.085  1.187   3.565   1.00 61.27  ? 88  PRO C CA  1 
ATOM   505   C C   . PRO A 1 69  ? 65.864  2.666   3.232   1.00 55.98  ? 88  PRO C C   1 
ATOM   506   O O   . PRO A 1 69  ? 66.391  3.132   2.226   1.00 52.95  ? 88  PRO C O   1 
ATOM   507   C CB  . PRO A 1 69  ? 67.286  0.974   4.490   1.00 63.96  ? 88  PRO C CB  1 
ATOM   508   C CG  . PRO A 1 69  ? 67.884  -0.300  4.009   1.00 67.69  ? 88  PRO C CG  1 
ATOM   509   C CD  . PRO A 1 69  ? 67.776  -0.196  2.521   1.00 64.58  ? 88  PRO C CD  1 
ATOM   510   N N   . PRO A 1 70  ? 65.041  3.362   4.031   1.00 55.32  ? 89  PRO C N   1 
ATOM   511   C CA  . PRO A 1 70  ? 64.678  4.744   3.731   1.00 50.92  ? 89  PRO C CA  1 
ATOM   512   C C   . PRO A 1 70  ? 65.929  5.560   3.532   1.00 48.57  ? 89  PRO C C   1 
ATOM   513   O O   . PRO A 1 70  ? 66.853  5.546   4.346   1.00 50.48  ? 89  PRO C O   1 
ATOM   514   C CB  . PRO A 1 70  ? 63.962  5.201   4.997   1.00 45.85  ? 89  PRO C CB  1 
ATOM   515   C CG  . PRO A 1 70  ? 63.473  3.955   5.628   1.00 50.44  ? 89  PRO C CG  1 
ATOM   516   C CD  . PRO A 1 70  ? 64.484  2.910   5.318   1.00 59.16  ? 89  PRO C CD  1 
ATOM   517   N N   . PHE A 1 71  ? 65.960  6.249   2.410   1.00 44.93  ? 90  PHE C N   1 
ATOM   518   C CA  . PHE A 1 71  ? 67.046  7.134   2.067   1.00 42.78  ? 90  PHE C CA  1 
ATOM   519   C C   . PHE A 1 71  ? 66.413  8.110   1.114   1.00 39.20  ? 90  PHE C C   1 
ATOM   520   O O   . PHE A 1 71  ? 65.544  7.741   0.335   1.00 38.69  ? 90  PHE C O   1 
ATOM   521   C CB  . PHE A 1 71  ? 68.162  6.368   1.366   1.00 37.26  ? 90  PHE C CB  1 
ATOM   522   C CG  . PHE A 1 71  ? 69.161  7.243   0.715   1.00 35.05  ? 90  PHE C CG  1 
ATOM   523   C CD1 . PHE A 1 71  ? 70.260  7.676   1.405   1.00 36.18  ? 90  PHE C CD1 1 
ATOM   524   C CD2 . PHE A 1 71  ? 69.001  7.646   -0.592  1.00 32.30  ? 90  PHE C CD2 1 
ATOM   525   C CE1 . PHE A 1 71  ? 71.191  8.495   0.812   1.00 34.68  ? 90  PHE C CE1 1 
ATOM   526   C CE2 . PHE A 1 71  ? 69.920  8.476   -1.183  1.00 32.32  ? 90  PHE C CE2 1 
ATOM   527   C CZ  . PHE A 1 71  ? 71.022  8.897   -0.475  1.00 33.54  ? 90  PHE C CZ  1 
ATOM   528   N N   . SER A 1 72  ? 66.831  9.360   1.175   1.00 37.25  ? 91  SER C N   1 
ATOM   529   C CA  . SER A 1 72  ? 66.381  10.312  0.182   1.00 34.46  ? 91  SER C CA  1 
ATOM   530   C C   . SER A 1 72  ? 67.489  11.323  -0.131  1.00 33.30  ? 91  SER C C   1 
ATOM   531   O O   . SER A 1 72  ? 68.362  11.594  0.679   1.00 34.78  ? 91  SER C O   1 
ATOM   532   C CB  . SER A 1 72  ? 65.094  11.005  0.644   1.00 34.33  ? 91  SER C CB  1 
ATOM   533   O OG  . SER A 1 72  ? 65.403  12.183  1.373   1.00 34.40  ? 91  SER C OG  1 
ATOM   534   N N   . THR A 1 73  ? 67.455  11.865  -1.330  1.00 31.32  ? 92  THR C N   1 
ATOM   535   C CA  . THR A 1 73  ? 68.408  12.891  -1.723  1.00 30.56  ? 92  THR C CA  1 
ATOM   536   C C   . THR A 1 73  ? 67.727  13.836  -2.751  1.00 31.31  ? 92  THR C C   1 
ATOM   537   O O   . THR A 1 73  ? 66.567  13.630  -3.143  1.00 30.76  ? 92  THR C O   1 
ATOM   538   C CB  . THR A 1 73  ? 69.781  12.264  -2.217  1.00 24.66  ? 92  THR C CB  1 
ATOM   539   O OG1 . THR A 1 73  ? 70.764  13.293  -2.405  1.00 24.53  ? 92  THR C OG1 1 
ATOM   540   C CG2 . THR A 1 73  ? 69.611  11.472  -3.492  1.00 23.94  ? 92  THR C CG2 1 
ATOM   541   N N   . TRP A 1 74  ? 68.424  14.890  -3.151  1.00 30.58  ? 93  TRP C N   1 
ATOM   542   C CA  . TRP A 1 74  ? 67.804  15.883  -4.001  1.00 29.17  ? 93  TRP C CA  1 
ATOM   543   C C   . TRP A 1 74  ? 68.824  16.739  -4.736  1.00 29.38  ? 93  TRP C C   1 
ATOM   544   O O   . TRP A 1 74  ? 69.990  16.825  -4.322  1.00 30.88  ? 93  TRP C O   1 
ATOM   545   C CB  . TRP A 1 74  ? 66.858  16.757  -3.177  1.00 29.13  ? 93  TRP C CB  1 
ATOM   546   C CG  . TRP A 1 74  ? 67.515  17.553  -2.102  1.00 30.04  ? 93  TRP C CG  1 
ATOM   547   C CD1 . TRP A 1 74  ? 67.518  17.273  -0.779  1.00 31.17  ? 93  TRP C CD1 1 
ATOM   548   C CD2 . TRP A 1 74  ? 68.251  18.784  -2.255  1.00 30.51  ? 93  TRP C CD2 1 
ATOM   549   N NE1 . TRP A 1 74  ? 68.213  18.236  -0.092  1.00 32.61  ? 93  TRP C NE1 1 
ATOM   550   C CE2 . TRP A 1 74  ? 68.669  19.179  -0.972  1.00 32.23  ? 93  TRP C CE2 1 
ATOM   551   C CE3 . TRP A 1 74  ? 68.587  19.591  -3.350  1.00 29.81  ? 93  TRP C CE3 1 
ATOM   552   C CZ2 . TRP A 1 74  ? 69.416  20.335  -0.751  1.00 33.59  ? 93  TRP C CZ2 1 
ATOM   553   C CZ3 . TRP A 1 74  ? 69.320  20.746  -3.124  1.00 31.28  ? 93  TRP C CZ3 1 
ATOM   554   C CH2 . TRP A 1 74  ? 69.728  21.102  -1.835  1.00 33.16  ? 93  TRP C CH2 1 
ATOM   555   N N   . ILE A 1 75  ? 68.382  17.350  -5.837  1.00 28.16  ? 94  ILE C N   1 
ATOM   556   C CA  . ILE A 1 75  ? 69.180  18.345  -6.569  1.00 28.00  ? 94  ILE C CA  1 
ATOM   557   C C   . ILE A 1 75  ? 68.277  19.494  -6.984  1.00 27.95  ? 94  ILE C C   1 
ATOM   558   O O   . ILE A 1 75  ? 67.059  19.349  -7.054  1.00 27.24  ? 94  ILE C O   1 
ATOM   559   C CB  . ILE A 1 75  ? 69.835  17.772  -7.852  1.00 27.24  ? 94  ILE C CB  1 
ATOM   560   C CG1 . ILE A 1 75  ? 68.767  17.343  -8.855  1.00 26.02  ? 94  ILE C CG1 1 
ATOM   561   C CG2 . ILE A 1 75  ? 70.720  16.608  -7.537  1.00 27.57  ? 94  ILE C CG2 1 
ATOM   562   C CD1 . ILE A 1 75  ? 69.290  16.474  -9.965  1.00 25.76  ? 94  ILE C CD1 1 
ATOM   563   N N   . LEU A 1 76  ? 68.872  20.643  -7.241  1.00 29.34  ? 95  LEU C N   1 
ATOM   564   C CA  . LEU A 1 76  ? 68.170  21.688  -7.957  1.00 22.60  ? 95  LEU C CA  1 
ATOM   565   C C   . LEU A 1 76  ? 68.651  21.615  -9.392  1.00 29.91  ? 95  LEU C C   1 
ATOM   566   O O   . LEU A 1 76  ? 69.840  21.654  -9.619  1.00 30.56  ? 95  LEU C O   1 
ATOM   567   C CB  . LEU A 1 76  ? 68.488  23.061  -7.363  1.00 25.01  ? 95  LEU C CB  1 
ATOM   568   C CG  . LEU A 1 76  ? 68.174  23.257  -5.882  1.00 25.94  ? 95  LEU C CG  1 
ATOM   569   C CD1 . LEU A 1 76  ? 68.260  24.720  -5.553  1.00 28.95  ? 95  LEU C CD1 1 
ATOM   570   C CD2 . LEU A 1 76  ? 66.788  22.693  -5.513  1.00 24.98  ? 95  LEU C CD2 1 
ATOM   571   N N   . PHE A 1 77  ? 67.747  21.469  -10.355 1.00 29.58  ? 96  PHE C N   1 
ATOM   572   C CA  . PHE A 1 77  ? 68.105  21.593  -11.767 1.00 30.32  ? 96  PHE C CA  1 
ATOM   573   C C   . PHE A 1 77  ? 67.265  22.684  -12.360 1.00 33.52  ? 96  PHE C C   1 
ATOM   574   O O   . PHE A 1 77  ? 66.066  22.683  -12.169 1.00 33.49  ? 96  PHE C O   1 
ATOM   575   C CB  . PHE A 1 77  ? 67.838  20.310  -12.555 1.00 27.92  ? 96  PHE C CB  1 
ATOM   576   C CG  . PHE A 1 77  ? 68.125  20.444  -14.025 1.00 27.97  ? 96  PHE C CG  1 
ATOM   577   C CD1 . PHE A 1 77  ? 67.115  20.787  -14.930 1.00 28.51  ? 96  PHE C CD1 1 
ATOM   578   C CD2 . PHE A 1 77  ? 69.412  20.267  -14.516 1.00 27.95  ? 96  PHE C CD2 1 
ATOM   579   C CE1 . PHE A 1 77  ? 67.388  20.942  -16.297 1.00 29.23  ? 96  PHE C CE1 1 
ATOM   580   C CE2 . PHE A 1 77  ? 69.685  20.411  -15.882 1.00 28.59  ? 96  PHE C CE2 1 
ATOM   581   C CZ  . PHE A 1 77  ? 68.666  20.747  -16.765 1.00 29.30  ? 96  PHE C CZ  1 
ATOM   582   N N   . PRO A 1 78  ? 67.885  23.629  -13.086 1.00 37.23  ? 97  PRO C N   1 
ATOM   583   C CA  . PRO A 1 78  ? 69.318  23.877  -13.252 1.00 39.62  ? 97  PRO C CA  1 
ATOM   584   C C   . PRO A 1 78  ? 69.970  24.403  -11.986 1.00 42.17  ? 97  PRO C C   1 
ATOM   585   O O   . PRO A 1 78  ? 69.273  24.845  -11.079 1.00 42.41  ? 97  PRO C O   1 
ATOM   586   C CB  . PRO A 1 78  ? 69.347  24.963  -14.321 1.00 41.79  ? 97  PRO C CB  1 
ATOM   587   C CG  . PRO A 1 78  ? 68.030  25.592  -14.244 1.00 42.38  ? 97  PRO C CG  1 
ATOM   588   C CD  . PRO A 1 78  ? 67.105  24.482  -13.991 1.00 39.55  ? 97  PRO C CD  1 
ATOM   589   N N   . GLU A 1 79  ? 71.299  24.348  -11.938 1.00 62.31  ? 98  GLU C N   1 
ATOM   590   C CA  . GLU A 1 79  ? 72.040  24.682  -10.724 1.00 66.30  ? 98  GLU C CA  1 
ATOM   591   C C   . GLU A 1 79  ? 71.809  26.147  -10.353 1.00 65.62  ? 98  GLU C C   1 
ATOM   592   O O   . GLU A 1 79  ? 72.118  27.066  -11.125 1.00 62.66  ? 98  GLU C O   1 
ATOM   593   C CB  . GLU A 1 79  ? 73.536  24.376  -10.887 1.00 67.57  ? 98  GLU C CB  1 
ATOM   594   C CG  . GLU A 1 79  ? 73.862  22.928  -11.250 1.00 69.89  ? 98  GLU C CG  1 
ATOM   595   C CD  . GLU A 1 79  ? 75.316  22.535  -10.915 1.00 72.57  ? 98  GLU C CD  1 
ATOM   596   O OE1 . GLU A 1 79  ? 76.052  23.378  -10.350 1.00 72.82  ? 98  GLU C OE1 1 
ATOM   597   O OE2 . GLU A 1 79  ? 75.734  21.382  -11.209 1.00 74.61  ? 98  GLU C OE2 1 
ATOM   598   N N   . ASN A 1 80  ? 71.227  26.345  -9.176  1.00 68.60  ? 99  ASN C N   1 
ATOM   599   C CA  . ASN A 1 80  ? 70.957  27.675  -8.631  1.00 68.67  ? 99  ASN C CA  1 
ATOM   600   C C   . ASN A 1 80  ? 72.239  28.503  -8.340  1.00 117.53 ? 99  ASN C C   1 
ATOM   601   O O   . ASN A 1 80  ? 73.136  28.054  -7.606  1.00 120.40 ? 99  ASN C O   1 
ATOM   602   C CB  . ASN A 1 80  ? 70.118  27.525  -7.354  1.00 72.51  ? 99  ASN C CB  1 
ATOM   603   C CG  . ASN A 1 80  ? 69.605  28.851  -6.830  1.00 72.52  ? 99  ASN C CG  1 
ATOM   604   O OD1 . ASN A 1 80  ? 69.141  29.710  -7.605  1.00 69.77  ? 99  ASN C OD1 1 
ATOM   605   N ND2 . ASN A 1 80  ? 69.698  29.036  -5.508  1.00 75.80  ? 99  ASN C ND2 1 
ATOM   606   N N   . PRO A 1 84  ? 72.489  35.201  -6.490  1.00 69.00  ? 103 PRO C N   1 
ATOM   607   C CA  . PRO A 1 84  ? 71.192  35.900  -6.631  1.00 67.80  ? 103 PRO C CA  1 
ATOM   608   C C   . PRO A 1 84  ? 71.230  37.376  -7.099  1.00 64.63  ? 103 PRO C C   1 
ATOM   609   O O   . PRO A 1 84  ? 71.553  38.217  -6.231  1.00 67.04  ? 103 PRO C O   1 
ATOM   610   C CB  . PRO A 1 84  ? 70.649  35.872  -5.189  1.00 72.10  ? 103 PRO C CB  1 
ATOM   611   C CG  . PRO A 1 84  ? 71.849  35.865  -4.348  1.00 74.31  ? 103 PRO C CG  1 
ATOM   612   C CD  . PRO A 1 84  ? 72.858  35.030  -5.071  1.00 72.70  ? 103 PRO C CD  1 
ATOM   613   N N   . TRP A 1 85  ? 70.880  37.722  -8.350  1.00 59.38  ? 104 TRP C N   1 
ATOM   614   C CA  . TRP A 1 85  ? 70.547  36.834  -9.471  1.00 54.88  ? 104 TRP C CA  1 
ATOM   615   C C   . TRP A 1 85  ? 71.255  37.432  -10.695 1.00 51.43  ? 104 TRP C C   1 
ATOM   616   O O   . TRP A 1 85  ? 71.074  38.607  -11.024 1.00 50.76  ? 104 TRP C O   1 
ATOM   617   C CB  . TRP A 1 85  ? 69.033  36.748  -9.745  1.00 53.90  ? 104 TRP C CB  1 
ATOM   618   C CG  . TRP A 1 85  ? 68.674  36.427  -11.244 1.00 43.06  ? 104 TRP C CG  1 
ATOM   619   C CD1 . TRP A 1 85  ? 68.605  37.327  -12.300 1.00 41.00  ? 104 TRP C CD1 1 
ATOM   620   C CD2 . TRP A 1 85  ? 68.330  35.143  -11.818 1.00 42.05  ? 104 TRP C CD2 1 
ATOM   621   N NE1 . TRP A 1 85  ? 68.269  36.679  -13.470 1.00 38.79  ? 104 TRP C NE1 1 
ATOM   622   C CE2 . TRP A 1 85  ? 68.091  35.346  -13.204 1.00 39.48  ? 104 TRP C CE2 1 
ATOM   623   C CE3 . TRP A 1 85  ? 68.209  33.846  -11.299 1.00 43.41  ? 104 TRP C CE3 1 
ATOM   624   C CZ2 . TRP A 1 85  ? 67.750  34.300  -14.065 1.00 38.34  ? 104 TRP C CZ2 1 
ATOM   625   C CZ3 . TRP A 1 85  ? 67.859  32.812  -12.154 1.00 42.17  ? 104 TRP C CZ3 1 
ATOM   626   C CH2 . TRP A 1 85  ? 67.642  33.043  -13.522 1.00 39.75  ? 104 TRP C CH2 1 
ATOM   627   N N   . ALA A 1 86  ? 72.062  36.632  -11.375 1.00 49.40  ? 105 ALA C N   1 
ATOM   628   C CA  . ALA A 1 86  ? 72.986  37.206  -12.324 1.00 46.88  ? 105 ALA C CA  1 
ATOM   629   C C   . ALA A 1 86  ? 72.553  36.995  -13.777 1.00 43.81  ? 105 ALA C C   1 
ATOM   630   O O   . ALA A 1 86  ? 73.125  37.580  -14.693 1.00 42.77  ? 105 ALA C O   1 
ATOM   631   C CB  . ALA A 1 86  ? 74.363  36.655  -12.083 1.00 47.42  ? 105 ALA C CB  1 
ATOM   632   N N   . GLY A 1 87  ? 71.533  36.177  -13.992 1.00 42.37  ? 106 GLY C N   1 
ATOM   633   C CA  . GLY A 1 87  ? 71.000  36.002  -15.325 1.00 39.62  ? 106 GLY C CA  1 
ATOM   634   C C   . GLY A 1 87  ? 70.309  37.241  -15.895 1.00 38.24  ? 106 GLY C C   1 
ATOM   635   O O   . GLY A 1 87  ? 70.323  38.319  -15.294 1.00 39.17  ? 106 GLY C O   1 
ATOM   636   N N   . ALA A 1 88  ? 69.695  37.081  -17.064 1.00 36.25  ? 107 ALA C N   1 
ATOM   637   C CA  . ALA A 1 88  ? 69.011  38.178  -17.728 1.00 27.09  ? 107 ALA C CA  1 
ATOM   638   C C   . ALA A 1 88  ? 67.582  38.290  -17.199 1.00 31.03  ? 107 ALA C C   1 
ATOM   639   O O   . ALA A 1 88  ? 67.069  37.358  -16.586 1.00 29.58  ? 107 ALA C O   1 
ATOM   640   C CB  . ALA A 1 88  ? 69.038  37.985  -19.263 1.00 25.30  ? 107 ALA C CB  1 
ATOM   641   N N   . GLU A 1 89  ? 66.947  39.431  -17.430 1.00 32.17  ? 108 GLU C N   1 
ATOM   642   C CA  . GLU A 1 89  ? 65.657  39.747  -16.818 1.00 34.06  ? 108 GLU C CA  1 
ATOM   643   C C   . GLU A 1 89  ? 64.840  40.551  -17.802 1.00 33.77  ? 108 GLU C C   1 
ATOM   644   O O   . GLU A 1 89  ? 65.398  41.259  -18.636 1.00 32.94  ? 108 GLU C O   1 
ATOM   645   C CB  . GLU A 1 89  ? 65.830  40.630  -15.568 1.00 36.61  ? 108 GLU C CB  1 
ATOM   646   C CG  . GLU A 1 89  ? 66.537  40.004  -14.396 1.00 38.52  ? 108 GLU C CG  1 
ATOM   647   C CD  . GLU A 1 89  ? 66.438  40.839  -13.106 1.00 42.05  ? 108 GLU C CD  1 
ATOM   648   O OE1 . GLU A 1 89  ? 65.986  42.010  -13.162 1.00 43.22  ? 108 GLU C OE1 1 
ATOM   649   O OE2 . GLU A 1 89  ? 66.811  40.315  -12.028 1.00 43.78  ? 108 GLU C OE2 1 
ATOM   650   N N   . ASN A 1 90  ? 63.521  40.488  -17.640 1.00 34.80  ? 109 ASN C N   1 
ATOM   651   C CA  . ASN A 1 90  ? 62.564  41.179  -18.492 1.00 34.95  ? 109 ASN C CA  1 
ATOM   652   C C   . ASN A 1 90  ? 62.861  40.887  -19.957 1.00 32.29  ? 109 ASN C C   1 
ATOM   653   O O   . ASN A 1 90  ? 63.027  41.791  -20.776 1.00 32.09  ? 109 ASN C O   1 
ATOM   654   C CB  . ASN A 1 90  ? 62.491  42.686  -18.191 1.00 37.92  ? 109 ASN C CB  1 
ATOM   655   C CG  . ASN A 1 90  ? 62.402  43.000  -16.680 1.00 42.36  ? 109 ASN C CG  1 
ATOM   656   O OD1 . ASN A 1 90  ? 61.300  42.981  -16.060 1.00 45.22  ? 109 ASN C OD1 1 
ATOM   657   N ND2 . ASN A 1 90  ? 63.561  43.320  -16.076 1.00 43.04  ? 109 ASN C ND2 1 
ATOM   658   N N   . LEU A 1 91  ? 62.953  39.603  -20.274 1.00 30.99  ? 110 LEU C N   1 
ATOM   659   C CA  . LEU A 1 91  ? 63.243  39.164  -21.643 1.00 29.39  ? 110 LEU C CA  1 
ATOM   660   C C   . LEU A 1 91  ? 61.985  39.290  -22.489 1.00 29.48  ? 110 LEU C C   1 
ATOM   661   O O   . LEU A 1 91  ? 60.975  38.657  -22.205 1.00 25.64  ? 110 LEU C O   1 
ATOM   662   C CB  . LEU A 1 91  ? 63.743  37.719  -21.642 1.00 24.13  ? 110 LEU C CB  1 
ATOM   663   C CG  . LEU A 1 91  ? 63.774  36.905  -22.939 1.00 24.78  ? 110 LEU C CG  1 
ATOM   664   C CD1 . LEU A 1 91  ? 64.798  37.444  -23.962 1.00 21.92  ? 110 LEU C CD1 1 
ATOM   665   C CD2 . LEU A 1 91  ? 64.041  35.436  -22.609 1.00 22.71  ? 110 LEU C CD2 1 
ATOM   666   N N   . THR A 1 92  ? 62.021  40.148  -23.499 1.00 24.83  ? 111 THR C N   1 
ATOM   667   C CA  . THR A 1 92  ? 60.844  40.317  -24.332 1.00 25.18  ? 111 THR C CA  1 
ATOM   668   C C   . THR A 1 92  ? 61.232  40.234  -25.796 1.00 24.14  ? 111 THR C C   1 
ATOM   669   O O   . THR A 1 92  ? 62.286  40.717  -26.202 1.00 23.78  ? 111 THR C O   1 
ATOM   670   C CB  . THR A 1 92  ? 60.069  41.628  -24.030 1.00 36.21  ? 111 THR C CB  1 
ATOM   671   O OG1 . THR A 1 92  ? 60.688  42.726  -24.713 1.00 36.73  ? 111 THR C OG1 1 
ATOM   672   C CG2 . THR A 1 92  ? 59.982  41.901  -22.516 1.00 37.27  ? 111 THR C CG2 1 
ATOM   673   N N   . CYS A 1 93  ? 60.391  39.585  -26.586 1.00 24.20  ? 112 CYS C N   1 
ATOM   674   C CA  . CYS A 1 93  ? 60.705  39.431  -27.999 1.00 23.84  ? 112 CYS C CA  1 
ATOM   675   C C   . CYS A 1 93  ? 59.574  39.974  -28.859 1.00 25.08  ? 112 CYS C C   1 
ATOM   676   O O   . CYS A 1 93  ? 58.425  40.049  -28.402 1.00 26.39  ? 112 CYS C O   1 
ATOM   677   C CB  . CYS A 1 93  ? 61.013  37.973  -28.323 1.00 22.10  ? 112 CYS C CB  1 
ATOM   678   S SG  . CYS A 1 93  ? 62.540  37.399  -27.544 1.00 47.00  ? 112 CYS C SG  1 
ATOM   679   N N   . TRP A 1 94  ? 59.898  40.393  -30.079 1.00 25.01  ? 113 TRP C N   1 
ATOM   680   C CA  . TRP A 1 94  ? 58.874  40.832  -31.012 1.00 25.63  ? 113 TRP C CA  1 
ATOM   681   C C   . TRP A 1 94  ? 59.330  40.627  -32.451 1.00 28.21  ? 113 TRP C C   1 
ATOM   682   O O   . TRP A 1 94  ? 60.520  40.741  -32.763 1.00 25.11  ? 113 TRP C O   1 
ATOM   683   C CB  . TRP A 1 94  ? 58.513  42.292  -30.771 1.00 27.39  ? 113 TRP C CB  1 
ATOM   684   C CG  . TRP A 1 94  ? 59.646  43.224  -30.983 1.00 27.75  ? 113 TRP C CG  1 
ATOM   685   C CD1 . TRP A 1 94  ? 59.881  43.981  -32.087 1.00 33.31  ? 113 TRP C CD1 1 
ATOM   686   C CD2 . TRP A 1 94  ? 60.725  43.502  -30.074 1.00 27.24  ? 113 TRP C CD2 1 
ATOM   687   N NE1 . TRP A 1 94  ? 61.034  44.727  -31.927 1.00 33.64  ? 113 TRP C NE1 1 
ATOM   688   C CE2 . TRP A 1 94  ? 61.563  44.454  -30.695 1.00 28.19  ? 113 TRP C CE2 1 
ATOM   689   C CE3 . TRP A 1 94  ? 61.057  43.047  -28.799 1.00 26.37  ? 113 TRP C CE3 1 
ATOM   690   C CZ2 . TRP A 1 94  ? 62.713  44.950  -30.084 1.00 28.21  ? 113 TRP C CZ2 1 
ATOM   691   C CZ3 . TRP A 1 94  ? 62.191  43.547  -28.192 1.00 27.76  ? 113 TRP C CZ3 1 
ATOM   692   C CH2 . TRP A 1 94  ? 63.015  44.479  -28.837 1.00 27.21  ? 113 TRP C CH2 1 
ATOM   693   N N   . ILE A 1 95  ? 58.361  40.298  -33.310 1.00 28.84  ? 114 ILE C N   1 
ATOM   694   C CA  . ILE A 1 95  ? 58.536  40.268  -34.748 1.00 26.82  ? 114 ILE C CA  1 
ATOM   695   C C   . ILE A 1 95  ? 58.232  41.668  -35.201 1.00 28.81  ? 114 ILE C C   1 
ATOM   696   O O   . ILE A 1 95  ? 57.242  42.259  -34.782 1.00 29.94  ? 114 ILE C O   1 
ATOM   697   C CB  . ILE A 1 95  ? 57.546  39.304  -35.409 1.00 31.59  ? 114 ILE C CB  1 
ATOM   698   C CG1 . ILE A 1 95  ? 57.684  37.900  -34.809 1.00 30.56  ? 114 ILE C CG1 1 
ATOM   699   C CG2 . ILE A 1 95  ? 57.720  39.274  -36.952 1.00 28.03  ? 114 ILE C CG2 1 
ATOM   700   C CD1 . ILE A 1 95  ? 58.950  37.181  -35.227 1.00 24.45  ? 114 ILE C CD1 1 
ATOM   701   N N   . HIS A 1 96  ? 59.096  42.225  -36.034 1.00 29.59  ? 115 HIS C N   1 
ATOM   702   C CA  . HIS A 1 96  ? 58.911  43.596  -36.464 1.00 33.46  ? 115 HIS C CA  1 
ATOM   703   C C   . HIS A 1 96  ? 59.411  43.726  -37.866 1.00 34.88  ? 115 HIS C C   1 
ATOM   704   O O   . HIS A 1 96  ? 60.224  42.920  -38.316 1.00 33.74  ? 115 HIS C O   1 
ATOM   705   C CB  . HIS A 1 96  ? 59.652  44.583  -35.568 1.00 32.14  ? 115 HIS C CB  1 
ATOM   706   C CG  . HIS A 1 96  ? 61.139  44.497  -35.684 1.00 31.65  ? 115 HIS C CG  1 
ATOM   707   N ND1 . HIS A 1 96  ? 61.872  45.366  -36.462 1.00 33.27  ? 115 HIS C ND1 1 
ATOM   708   C CD2 . HIS A 1 96  ? 62.027  43.635  -35.127 1.00 29.40  ? 115 HIS C CD2 1 
ATOM   709   C CE1 . HIS A 1 96  ? 63.151  45.041  -36.380 1.00 33.70  ? 115 HIS C CE1 1 
ATOM   710   N NE2 . HIS A 1 96  ? 63.272  43.994  -35.578 1.00 30.00  ? 115 HIS C NE2 1 
ATOM   711   N N   . ASP A 1 97  ? 58.938  44.778  -38.529 1.00 37.77  ? 116 ASP C N   1 
ATOM   712   C CA  . ASP A 1 97  ? 58.953  44.843  -39.973 1.00 40.17  ? 116 ASP C CA  1 
ATOM   713   C C   . ASP A 1 97  ? 58.337  43.531  -40.430 1.00 39.21  ? 116 ASP C C   1 
ATOM   714   O O   . ASP A 1 97  ? 57.359  43.074  -39.797 1.00 38.98  ? 116 ASP C O   1 
ATOM   715   C CB  . ASP A 1 97  ? 60.342  45.157  -40.456 1.00 41.38  ? 116 ASP C CB  1 
ATOM   716   C CG  . ASP A 1 97  ? 60.839  46.469  -39.846 1.00 43.43  ? 116 ASP C CG  1 
ATOM   717   O OD1 . ASP A 1 97  ? 60.213  47.520  -40.104 1.00 45.91  ? 116 ASP C OD1 1 
ATOM   718   O OD2 . ASP A 1 97  ? 61.804  46.457  -39.047 1.00 42.61  ? 116 ASP C OD2 1 
ATOM   719   N N   . VAL A 1 98  ? 58.816  42.872  -41.462 1.00 38.89  ? 117 VAL C N   1 
ATOM   720   C CA  . VAL A 1 98  ? 58.089  41.631  -41.718 1.00 37.77  ? 117 VAL C CA  1 
ATOM   721   C C   . VAL A 1 98  ? 58.865  40.405  -41.247 1.00 35.39  ? 117 VAL C C   1 
ATOM   722   O O   . VAL A 1 98  ? 58.278  39.407  -40.831 1.00 32.12  ? 117 VAL C O   1 
ATOM   723   C CB  . VAL A 1 98  ? 57.611  41.518  -43.181 1.00 38.43  ? 117 VAL C CB  1 
ATOM   724   C CG1 . VAL A 1 98  ? 56.856  40.234  -43.401 1.00 37.60  ? 117 VAL C CG1 1 
ATOM   725   C CG2 . VAL A 1 98  ? 56.728  42.691  -43.520 1.00 41.11  ? 117 VAL C CG2 1 
ATOM   726   N N   . ASP A 1 99  ? 60.189  40.534  -41.272 1.00 35.16  ? 118 ASP C N   1 
ATOM   727   C CA  . ASP A 1 99  ? 61.096  39.396  -41.303 1.00 34.01  ? 118 ASP C CA  1 
ATOM   728   C C   . ASP A 1 99  ? 62.070  39.348  -40.125 1.00 31.86  ? 118 ASP C C   1 
ATOM   729   O O   . ASP A 1 99  ? 62.934  38.491  -40.074 1.00 30.96  ? 118 ASP C O   1 
ATOM   730   C CB  . ASP A 1 99  ? 61.930  39.446  -42.594 1.00 36.74  ? 118 ASP C CB  1 
ATOM   731   C CG  . ASP A 1 99  ? 61.115  39.108  -43.868 1.00 39.66  ? 118 ASP C CG  1 
ATOM   732   O OD1 . ASP A 1 99  ? 61.040  37.910  -44.225 1.00 39.52  ? 118 ASP C OD1 1 
ATOM   733   O OD2 . ASP A 1 99  ? 60.581  40.035  -44.533 1.00 42.31  ? 118 ASP C OD2 1 
ATOM   734   N N   . PHE A 1 100 ? 61.945  40.272  -39.184 1.00 31.34  ? 119 PHE C N   1 
ATOM   735   C CA  . PHE A 1 100 ? 62.934  40.402  -38.133 1.00 29.92  ? 119 PHE C CA  1 
ATOM   736   C C   . PHE A 1 100 ? 62.386  40.051  -36.741 1.00 27.84  ? 119 PHE C C   1 
ATOM   737   O O   . PHE A 1 100 ? 61.251  40.397  -36.408 1.00 27.80  ? 119 PHE C O   1 
ATOM   738   C CB  . PHE A 1 100 ? 63.498  41.811  -38.152 1.00 31.75  ? 119 PHE C CB  1 
ATOM   739   C CG  . PHE A 1 100 ? 64.000  42.236  -39.493 1.00 34.46  ? 119 PHE C CG  1 
ATOM   740   C CD1 . PHE A 1 100 ? 65.278  41.903  -39.907 1.00 34.90  ? 119 PHE C CD1 1 
ATOM   741   C CD2 . PHE A 1 100 ? 63.197  42.972  -40.352 1.00 36.94  ? 119 PHE C CD2 1 
ATOM   742   C CE1 . PHE A 1 100 ? 65.752  42.302  -41.166 1.00 37.46  ? 119 PHE C CE1 1 
ATOM   743   C CE2 . PHE A 1 100 ? 63.670  43.370  -41.620 1.00 39.37  ? 119 PHE C CE2 1 
ATOM   744   C CZ  . PHE A 1 100 ? 64.947  43.036  -42.014 1.00 39.57  ? 119 PHE C CZ  1 
ATOM   745   N N   . LEU A 1 101 ? 63.198  39.326  -35.965 1.00 26.27  ? 120 LEU C N   1 
ATOM   746   C CA  . LEU A 1 101 ? 62.857  38.917  -34.617 1.00 23.79  ? 120 LEU C CA  1 
ATOM   747   C C   . LEU A 1 101 ? 63.885  39.509  -33.674 1.00 23.47  ? 120 LEU C C   1 
ATOM   748   O O   . LEU A 1 101 ? 65.047  39.124  -33.673 1.00 23.10  ? 120 LEU C O   1 
ATOM   749   C CB  . LEU A 1 101 ? 62.826  37.401  -34.481 1.00 22.70  ? 120 LEU C CB  1 
ATOM   750   C CG  . LEU A 1 101 ? 62.787  36.931  -33.018 1.00 21.64  ? 120 LEU C CG  1 
ATOM   751   C CD1 . LEU A 1 101 ? 61.428  37.145  -32.408 1.00 21.90  ? 120 LEU C CD1 1 
ATOM   752   C CD2 . LEU A 1 101 ? 63.186  35.491  -32.909 1.00 20.95  ? 120 LEU C CD2 1 
ATOM   753   N N   . SER A 1 102 ? 63.454  40.474  -32.884 1.00 23.90  ? 121 SER C N   1 
ATOM   754   C CA  . SER A 1 102 ? 64.357  41.149  -31.972 1.00 26.61  ? 121 SER C CA  1 
ATOM   755   C C   . SER A 1 102 ? 63.949  40.874  -30.541 1.00 25.53  ? 121 SER C C   1 
ATOM   756   O O   . SER A 1 102 ? 62.747  40.782  -30.226 1.00 26.17  ? 121 SER C O   1 
ATOM   757   C CB  . SER A 1 102 ? 64.387  42.656  -32.233 1.00 25.66  ? 121 SER C CB  1 
ATOM   758   O OG  . SER A 1 102 ? 65.248  42.981  -33.300 1.00 26.61  ? 121 SER C OG  1 
ATOM   759   N N   . CYS A 1 103 ? 64.951  40.731  -29.678 1.00 25.00  ? 122 CYS C N   1 
ATOM   760   C CA  . CYS A 1 103 ? 64.702  40.590  -28.251 1.00 24.60  ? 122 CYS C CA  1 
ATOM   761   C C   . CYS A 1 103 ? 65.411  41.693  -27.486 1.00 25.60  ? 122 CYS C C   1 
ATOM   762   O O   . CYS A 1 103 ? 66.396  42.268  -27.961 1.00 26.25  ? 122 CYS C O   1 
ATOM   763   C CB  . CYS A 1 103 ? 65.178  39.231  -27.780 1.00 21.45  ? 122 CYS C CB  1 
ATOM   764   S SG  . CYS A 1 103 ? 64.303  37.856  -28.528 1.00 41.20  ? 122 CYS C SG  1 
ATOM   765   N N   . SER A 1 104 ? 64.899  42.004  -26.304 1.00 26.23  ? 123 SER C N   1 
ATOM   766   C CA  . SER A 1 104 ? 65.589  42.878  -25.346 1.00 24.84  ? 123 SER C CA  1 
ATOM   767   C C   . SER A 1 104 ? 65.683  42.199  -23.986 1.00 24.66  ? 123 SER C C   1 
ATOM   768   O O   . SER A 1 104 ? 64.897  41.316  -23.654 1.00 24.48  ? 123 SER C O   1 
ATOM   769   C CB  . SER A 1 104 ? 64.827  44.183  -25.188 1.00 26.55  ? 123 SER C CB  1 
ATOM   770   O OG  . SER A 1 104 ? 63.530  43.941  -24.647 1.00 26.95  ? 123 SER C OG  1 
ATOM   771   N N   . TRP A 1 105 ? 66.647  42.614  -23.186 1.00 25.24  ? 124 TRP C N   1 
ATOM   772   C CA  . TRP A 1 105 ? 66.682  42.181  -21.792 1.00 28.23  ? 124 TRP C CA  1 
ATOM   773   C C   . TRP A 1 105 ? 67.530  43.109  -20.936 1.00 29.59  ? 124 TRP C C   1 
ATOM   774   O O   . TRP A 1 105 ? 68.256  43.956  -21.462 1.00 27.41  ? 124 TRP C O   1 
ATOM   775   C CB  . TRP A 1 105 ? 67.156  40.738  -21.658 1.00 24.61  ? 124 TRP C CB  1 
ATOM   776   C CG  . TRP A 1 105 ? 68.501  40.522  -22.169 1.00 24.01  ? 124 TRP C CG  1 
ATOM   777   C CD1 . TRP A 1 105 ? 69.659  40.563  -21.453 1.00 24.57  ? 124 TRP C CD1 1 
ATOM   778   C CD2 . TRP A 1 105 ? 68.868  40.221  -23.520 1.00 27.23  ? 124 TRP C CD2 1 
ATOM   779   N NE1 . TRP A 1 105 ? 70.728  40.304  -22.270 1.00 28.49  ? 124 TRP C NE1 1 
ATOM   780   C CE2 . TRP A 1 105 ? 70.275  40.090  -23.546 1.00 27.45  ? 124 TRP C CE2 1 
ATOM   781   C CE3 . TRP A 1 105 ? 68.151  40.058  -24.709 1.00 22.44  ? 124 TRP C CE3 1 
ATOM   782   C CZ2 . TRP A 1 105 ? 70.975  39.809  -24.711 1.00 22.80  ? 124 TRP C CZ2 1 
ATOM   783   C CZ3 . TRP A 1 105 ? 68.842  39.764  -25.856 1.00 22.01  ? 124 TRP C CZ3 1 
ATOM   784   C CH2 . TRP A 1 105 ? 70.242  39.640  -25.850 1.00 22.23  ? 124 TRP C CH2 1 
ATOM   785   N N   . ALA A 1 106 ? 67.400  42.967  -19.617 1.00 28.04  ? 125 ALA C N   1 
ATOM   786   C CA  . ALA A 1 106 ? 68.227  43.714  -18.687 1.00 29.50  ? 125 ALA C CA  1 
ATOM   787   C C   . ALA A 1 106 ? 69.298  42.809  -18.074 1.00 34.61  ? 125 ALA C C   1 
ATOM   788   O O   . ALA A 1 106 ? 69.170  41.576  -18.049 1.00 28.31  ? 125 ALA C O   1 
ATOM   789   C CB  . ALA A 1 106 ? 67.383  44.316  -17.620 1.00 31.45  ? 125 ALA C CB  1 
ATOM   790   N N   . VAL A 1 107 ? 70.376  43.436  -17.623 1.00 30.22  ? 126 VAL C N   1 
ATOM   791   C CA  . VAL A 1 107 ? 71.415  42.739  -16.868 1.00 30.57  ? 126 VAL C CA  1 
ATOM   792   C C   . VAL A 1 107 ? 70.938  42.486  -15.415 1.00 35.26  ? 126 VAL C C   1 
ATOM   793   O O   . VAL A 1 107 ? 70.461  43.400  -14.739 1.00 33.86  ? 126 VAL C O   1 
ATOM   794   C CB  . VAL A 1 107 ? 72.714  43.562  -16.853 1.00 31.49  ? 126 VAL C CB  1 
ATOM   795   C CG1 . VAL A 1 107 ? 73.799  42.823  -16.129 1.00 32.03  ? 126 VAL C CG1 1 
ATOM   796   C CG2 . VAL A 1 107 ? 73.135  43.893  -18.249 1.00 30.47  ? 126 VAL C CG2 1 
ATOM   797   N N   . GLY A 1 108 ? 71.040  41.247  -14.950 1.00 35.56  ? 127 GLY C N   1 
ATOM   798   C CA  . GLY A 1 108 ? 70.697  40.947  -13.580 1.00 38.51  ? 127 GLY C CA  1 
ATOM   799   C C   . GLY A 1 108 ? 71.459  41.789  -12.567 1.00 41.61  ? 127 GLY C C   1 
ATOM   800   O O   . GLY A 1 108 ? 72.594  42.194  -12.794 1.00 41.57  ? 127 GLY C O   1 
ATOM   801   N N   . PRO A 1 109 ? 70.817  42.096  -11.437 1.00 44.82  ? 128 PRO C N   1 
ATOM   802   C CA  . PRO A 1 109 ? 71.575  42.750  -10.373 1.00 47.72  ? 128 PRO C CA  1 
ATOM   803   C C   . PRO A 1 109 ? 72.316  41.628  -9.663  1.00 48.84  ? 128 PRO C C   1 
ATOM   804   O O   . PRO A 1 109 ? 71.703  40.637  -9.280  1.00 50.13  ? 128 PRO C O   1 
ATOM   805   C CB  . PRO A 1 109 ? 70.474  43.343  -9.495  1.00 50.12  ? 128 PRO C CB  1 
ATOM   806   C CG  . PRO A 1 109 ? 69.322  42.419  -9.671  1.00 49.31  ? 128 PRO C CG  1 
ATOM   807   C CD  . PRO A 1 109 ? 69.416  41.853  -11.054 1.00 45.96  ? 128 PRO C CD  1 
ATOM   808   N N   . GLY A 1 110 ? 73.620  41.701  -9.537  1.00 48.55  ? 129 GLY C N   1 
ATOM   809   C CA  . GLY A 1 110 ? 74.264  40.494  -9.083  1.00 48.99  ? 129 GLY C CA  1 
ATOM   810   C C   . GLY A 1 110 ? 74.967  39.776  -10.208 1.00 46.73  ? 129 GLY C C   1 
ATOM   811   O O   . GLY A 1 110 ? 75.546  38.692  -10.023 1.00 47.02  ? 129 GLY C O   1 
ATOM   812   N N   . ALA A 1 111 ? 74.918  40.387  -11.387 1.00 44.75  ? 130 ALA C N   1 
ATOM   813   C CA  . ALA A 1 111 ? 75.811  39.993  -12.455 1.00 43.11  ? 130 ALA C CA  1 
ATOM   814   C C   . ALA A 1 111 ? 77.206  40.553  -12.160 1.00 44.34  ? 130 ALA C C   1 
ATOM   815   O O   . ALA A 1 111 ? 77.354  41.696  -11.711 1.00 45.20  ? 130 ALA C O   1 
ATOM   816   C CB  . ALA A 1 111 ? 75.294  40.474  -13.815 1.00 40.99  ? 130 ALA C CB  1 
ATOM   817   N N   . PRO A 1 112 ? 78.229  39.721  -12.384 1.00 44.78  ? 131 PRO C N   1 
ATOM   818   C CA  . PRO A 1 112 ? 79.638  40.102  -12.344 1.00 46.40  ? 131 PRO C CA  1 
ATOM   819   C C   . PRO A 1 112 ? 79.937  41.198  -13.359 1.00 45.93  ? 131 PRO C C   1 
ATOM   820   O O   . PRO A 1 112 ? 79.192  41.329  -14.327 1.00 36.46  ? 131 PRO C O   1 
ATOM   821   C CB  . PRO A 1 112 ? 80.354  38.812  -12.745 1.00 38.94  ? 131 PRO C CB  1 
ATOM   822   C CG  . PRO A 1 112 ? 79.330  38.007  -13.431 1.00 39.23  ? 131 PRO C CG  1 
ATOM   823   C CD  . PRO A 1 112 ? 78.051  38.314  -12.766 1.00 37.00  ? 131 PRO C CD  1 
ATOM   824   N N   . ALA A 1 113 ? 80.998  41.973  -13.130 1.00 47.91  ? 132 ALA C N   1 
ATOM   825   C CA  . ALA A 1 113 ? 81.374  43.048  -14.029 1.00 39.81  ? 132 ALA C CA  1 
ATOM   826   C C   . ALA A 1 113 ? 81.702  42.502  -15.409 1.00 40.25  ? 132 ALA C C   1 
ATOM   827   O O   . ALA A 1 113 ? 81.455  43.163  -16.399 1.00 39.23  ? 132 ALA C O   1 
ATOM   828   C CB  . ALA A 1 113 ? 82.539  43.824  -13.470 1.00 42.28  ? 132 ALA C CB  1 
ATOM   829   N N   . ASP A 1 114 ? 82.233  41.287  -15.484 1.00 40.42  ? 133 ASP C N   1 
ATOM   830   C CA  . ASP A 1 114 ? 82.534  40.711  -16.785 1.00 39.99  ? 133 ASP C CA  1 
ATOM   831   C C   . ASP A 1 114 ? 81.410  39.856  -17.355 1.00 38.20  ? 133 ASP C C   1 
ATOM   832   O O   . ASP A 1 114 ? 81.687  38.928  -18.113 1.00 38.12  ? 133 ASP C O   1 
ATOM   833   C CB  . ASP A 1 114 ? 83.824  39.889  -16.766 1.00 42.02  ? 133 ASP C CB  1 
ATOM   834   C CG  . ASP A 1 114 ? 83.630  38.480  -16.200 1.00 42.71  ? 133 ASP C CG  1 
ATOM   835   O OD1 . ASP A 1 114 ? 83.122  38.361  -15.055 1.00 43.56  ? 133 ASP C OD1 1 
ATOM   836   O OD2 . ASP A 1 114 ? 83.989  37.497  -16.903 1.00 42.56  ? 133 ASP C OD2 1 
ATOM   837   N N   . VAL A 1 115 ? 80.152  40.148  -17.024 1.00 36.81  ? 134 VAL C N   1 
ATOM   838   C CA  . VAL A 1 115 ? 79.084  39.306  -17.539 1.00 34.55  ? 134 VAL C CA  1 
ATOM   839   C C   . VAL A 1 115 ? 78.907  39.531  -19.040 1.00 30.62  ? 134 VAL C C   1 
ATOM   840   O O   . VAL A 1 115 ? 79.193  40.598  -19.578 1.00 30.97  ? 134 VAL C O   1 
ATOM   841   C CB  . VAL A 1 115 ? 77.721  39.491  -16.785 1.00 38.42  ? 134 VAL C CB  1 
ATOM   842   C CG1 . VAL A 1 115 ? 76.926  40.670  -17.343 1.00 30.97  ? 134 VAL C CG1 1 
ATOM   843   C CG2 . VAL A 1 115 ? 76.880  38.211  -16.856 1.00 30.66  ? 134 VAL C CG2 1 
ATOM   844   N N   . GLN A 1 116 ? 78.451  38.484  -19.697 1.00 29.40  ? 135 GLN C N   1 
ATOM   845   C CA  . GLN A 1 116 ? 78.033  38.551  -21.069 1.00 28.16  ? 135 GLN C CA  1 
ATOM   846   C C   . GLN A 1 116 ? 76.850  37.601  -21.324 1.00 28.48  ? 135 GLN C C   1 
ATOM   847   O O   . GLN A 1 116 ? 76.756  36.538  -20.703 1.00 26.96  ? 135 GLN C O   1 
ATOM   848   C CB  . GLN A 1 116 ? 79.204  38.215  -21.989 1.00 28.80  ? 135 GLN C CB  1 
ATOM   849   C CG  . GLN A 1 116 ? 79.049  38.796  -23.373 1.00 28.36  ? 135 GLN C CG  1 
ATOM   850   C CD  . GLN A 1 116 ? 78.610  40.258  -23.377 1.00 29.10  ? 135 GLN C CD  1 
ATOM   851   O OE1 . GLN A 1 116 ? 77.413  40.553  -23.420 1.00 27.53  ? 135 GLN C OE1 1 
ATOM   852   N NE2 . GLN A 1 116 ? 79.578  41.175  -23.358 1.00 30.12  ? 135 GLN C NE2 1 
ATOM   853   N N   . TYR A 1 117 ? 75.962  37.989  -22.247 1.00 25.66  ? 136 TYR C N   1 
ATOM   854   C CA  . TYR A 1 117 ? 74.824  37.149  -22.625 1.00 24.48  ? 136 TYR C CA  1 
ATOM   855   C C   . TYR A 1 117 ? 74.813  36.752  -24.098 1.00 24.05  ? 136 TYR C C   1 
ATOM   856   O O   . TYR A 1 117 ? 75.207  37.534  -24.947 1.00 24.36  ? 136 TYR C O   1 
ATOM   857   C CB  . TYR A 1 117 ? 73.522  37.835  -22.278 1.00 24.03  ? 136 TYR C CB  1 
ATOM   858   C CG  . TYR A 1 117 ? 73.432  38.229  -20.843 1.00 25.00  ? 136 TYR C CG  1 
ATOM   859   C CD1 . TYR A 1 117 ? 73.166  37.290  -19.864 1.00 25.45  ? 136 TYR C CD1 1 
ATOM   860   C CD2 . TYR A 1 117 ? 73.600  39.550  -20.461 1.00 25.83  ? 136 TYR C CD2 1 
ATOM   861   C CE1 . TYR A 1 117 ? 73.080  37.650  -18.539 1.00 26.73  ? 136 TYR C CE1 1 
ATOM   862   C CE2 . TYR A 1 117 ? 73.502  39.926  -19.148 1.00 27.02  ? 136 TYR C CE2 1 
ATOM   863   C CZ  . TYR A 1 117 ? 73.241  38.973  -18.187 1.00 27.47  ? 136 TYR C CZ  1 
ATOM   864   O OH  . TYR A 1 117 ? 73.140  39.357  -16.869 1.00 31.30  ? 136 TYR C OH  1 
ATOM   865   N N   . ASP A 1 118 ? 74.362  35.536  -24.385 1.00 23.73  ? 137 ASP C N   1 
ATOM   866   C CA  . ASP A 1 118 ? 74.140  35.088  -25.749 1.00 24.20  ? 137 ASP C CA  1 
ATOM   867   C C   . ASP A 1 118 ? 72.665  34.732  -25.926 1.00 23.17  ? 137 ASP C C   1 
ATOM   868   O O   . ASP A 1 118 ? 72.125  34.002  -25.105 1.00 23.39  ? 137 ASP C O   1 
ATOM   869   C CB  . ASP A 1 118 ? 74.979  33.838  -26.084 1.00 26.00  ? 137 ASP C CB  1 
ATOM   870   C CG  . ASP A 1 118 ? 76.463  33.995  -25.753 1.00 28.34  ? 137 ASP C CG  1 
ATOM   871   O OD1 . ASP A 1 118 ? 77.093  34.989  -26.169 1.00 29.11  ? 137 ASP C OD1 1 
ATOM   872   O OD2 . ASP A 1 118 ? 77.007  33.098  -25.070 1.00 29.73  ? 137 ASP C OD2 1 
ATOM   873   N N   . LEU A 1 119 ? 72.030  35.205  -27.009 1.00 22.20  ? 138 LEU C N   1 
ATOM   874   C CA  . LEU A 1 119 ? 70.629  34.866  -27.293 1.00 21.25  ? 138 LEU C CA  1 
ATOM   875   C C   . LEU A 1 119 ? 70.509  33.676  -28.238 1.00 21.16  ? 138 LEU C C   1 
ATOM   876   O O   . LEU A 1 119 ? 71.269  33.566  -29.184 1.00 21.15  ? 138 LEU C O   1 
ATOM   877   C CB  . LEU A 1 119 ? 69.950  36.052  -27.935 1.00 21.26  ? 138 LEU C CB  1 
ATOM   878   C CG  . LEU A 1 119 ? 68.498  35.914  -28.379 1.00 21.02  ? 138 LEU C CG  1 
ATOM   879   C CD1 . LEU A 1 119 ? 67.603  36.145  -27.179 1.00 20.12  ? 138 LEU C CD1 1 
ATOM   880   C CD2 . LEU A 1 119 ? 68.220  36.947  -29.505 1.00 20.49  ? 138 LEU C CD2 1 
ATOM   881   N N   . TYR A 1 120 ? 69.543  32.794  -28.007 1.00 20.44  ? 139 TYR C N   1 
ATOM   882   C CA  . TYR A 1 120 ? 69.389  31.623  -28.874 1.00 20.68  ? 139 TYR C CA  1 
ATOM   883   C C   . TYR A 1 120 ? 67.974  31.410  -29.339 1.00 20.34  ? 139 TYR C C   1 
ATOM   884   O O   . TYR A 1 120 ? 67.056  31.550  -28.564 1.00 26.70  ? 139 TYR C O   1 
ATOM   885   C CB  . TYR A 1 120 ? 69.832  30.366  -28.154 1.00 21.39  ? 139 TYR C CB  1 
ATOM   886   C CG  . TYR A 1 120 ? 71.304  30.315  -27.904 1.00 22.13  ? 139 TYR C CG  1 
ATOM   887   C CD1 . TYR A 1 120 ? 72.151  29.860  -28.888 1.00 22.88  ? 139 TYR C CD1 1 
ATOM   888   C CD2 . TYR A 1 120 ? 71.859  30.715  -26.665 1.00 25.85  ? 139 TYR C CD2 1 
ATOM   889   C CE1 . TYR A 1 120 ? 73.511  29.797  -28.682 1.00 24.78  ? 139 TYR C CE1 1 
ATOM   890   C CE2 . TYR A 1 120 ? 73.236  30.657  -26.444 1.00 23.31  ? 139 TYR C CE2 1 
ATOM   891   C CZ  . TYR A 1 120 ? 74.049  30.189  -27.476 1.00 24.97  ? 139 TYR C CZ  1 
ATOM   892   O OH  . TYR A 1 120 ? 75.406  30.094  -27.355 1.00 26.28  ? 139 TYR C OH  1 
ATOM   893   N N   . LEU A 1 121 ? 67.802  31.064  -30.606 1.00 20.55  ? 140 LEU C N   1 
ATOM   894   C CA  . LEU A 1 121 ? 66.519  30.571  -31.069 1.00 20.55  ? 140 LEU C CA  1 
ATOM   895   C C   . LEU A 1 121 ? 66.603  29.084  -31.167 1.00 21.29  ? 140 LEU C C   1 
ATOM   896   O O   . LEU A 1 121 ? 67.502  28.557  -31.786 1.00 21.95  ? 140 LEU C O   1 
ATOM   897   C CB  . LEU A 1 121 ? 66.154  31.117  -32.431 1.00 20.69  ? 140 LEU C CB  1 
ATOM   898   C CG  . LEU A 1 121 ? 64.766  30.716  -32.922 1.00 22.49  ? 140 LEU C CG  1 
ATOM   899   C CD1 . LEU A 1 121 ? 63.675  31.471  -32.189 1.00 22.08  ? 140 LEU C CD1 1 
ATOM   900   C CD2 . LEU A 1 121 ? 64.695  30.997  -34.392 1.00 23.22  ? 140 LEU C CD2 1 
ATOM   901   N N   . ASN A 1 122 ? 65.661  28.405  -30.532 1.00 21.50  ? 141 ASN C N   1 
ATOM   902   C CA  . ASN A 1 122 ? 65.637  26.959  -30.570 1.00 23.70  ? 141 ASN C CA  1 
ATOM   903   C C   . ASN A 1 122 ? 64.372  26.458  -31.235 1.00 22.98  ? 141 ASN C C   1 
ATOM   904   O O   . ASN A 1 122 ? 63.289  26.654  -30.712 1.00 22.87  ? 141 ASN C O   1 
ATOM   905   C CB  . ASN A 1 122 ? 65.753  26.399  -29.156 1.00 24.46  ? 141 ASN C CB  1 
ATOM   906   C CG  . ASN A 1 122 ? 65.866  24.886  -29.141 1.00 26.30  ? 141 ASN C CG  1 
ATOM   907   O OD1 . ASN A 1 122 ? 64.934  24.177  -29.535 1.00 27.26  ? 141 ASN C OD1 1 
ATOM   908   N ND2 . ASN A 1 122 ? 67.002  24.383  -28.682 1.00 27.07  ? 141 ASN C ND2 1 
ATOM   909   N N   . VAL A 1 123 ? 64.527  25.793  -32.372 1.00 23.73  ? 142 VAL C N   1 
ATOM   910   C CA  . VAL A 1 123 ? 63.400  25.373  -33.215 1.00 24.32  ? 142 VAL C CA  1 
ATOM   911   C C   . VAL A 1 123 ? 63.012  23.912  -33.004 1.00 25.81  ? 142 VAL C C   1 
ATOM   912   O O   . VAL A 1 123 ? 63.760  23.010  -33.352 1.00 26.94  ? 142 VAL C O   1 
ATOM   913   C CB  . VAL A 1 123 ? 63.717  25.595  -34.760 1.00 24.68  ? 142 VAL C CB  1 
ATOM   914   C CG1 . VAL A 1 123 ? 62.523  25.309  -35.618 1.00 25.38  ? 142 VAL C CG1 1 
ATOM   915   C CG2 . VAL A 1 123 ? 64.170  27.001  -35.026 1.00 23.71  ? 142 VAL C CG2 1 
ATOM   916   N N   . ALA A 1 124 ? 61.826  23.687  -32.476 1.00 26.14  ? 143 ALA C N   1 
ATOM   917   C CA  . ALA A 1 124 ? 61.293  22.344  -32.312 1.00 27.91  ? 143 ALA C CA  1 
ATOM   918   C C   . ALA A 1 124 ? 62.196  21.357  -31.582 1.00 29.11  ? 143 ALA C C   1 
ATOM   919   O O   . ALA A 1 124 ? 62.173  20.159  -31.884 1.00 30.94  ? 143 ALA C O   1 
ATOM   920   C CB  . ALA A 1 124 ? 60.840  21.779  -33.628 1.00 28.91  ? 143 ALA C CB  1 
ATOM   921   N N   . LYS A 1 125 ? 62.941  21.866  -30.589 1.00 33.10  ? 144 LYS C N   1 
ATOM   922   C CA  . LYS A 1 125 ? 63.873  21.097  -29.734 1.00 29.59  ? 144 LYS C CA  1 
ATOM   923   C C   . LYS A 1 125 ? 64.973  20.356  -30.480 1.00 30.67  ? 144 LYS C C   1 
ATOM   924   O O   . LYS A 1 125 ? 65.585  19.458  -29.926 1.00 32.36  ? 144 LYS C O   1 
ATOM   925   C CB  . LYS A 1 125 ? 63.147  20.084  -28.838 1.00 31.58  ? 144 LYS C CB  1 
ATOM   926   C CG  . LYS A 1 125 ? 61.800  20.522  -28.334 1.00 31.35  ? 144 LYS C CG  1 
ATOM   927   C CD  . LYS A 1 125 ? 61.535  20.034  -26.915 1.00 35.44  ? 144 LYS C CD  1 
ATOM   928   C CE  . LYS A 1 125 ? 61.131  18.584  -26.860 1.00 37.50  ? 144 LYS C CE  1 
ATOM   929   N NZ  . LYS A 1 125 ? 60.403  18.309  -25.595 1.00 38.85  ? 144 LYS C NZ  1 
ATOM   930   N N   . ARG A 1 126 ? 65.220  20.715  -31.730 1.00 30.06  ? 145 ARG C N   1 
ATOM   931   C CA  . ARG A 1 126 ? 66.044  19.875  -32.586 1.00 31.67  ? 145 ARG C CA  1 
ATOM   932   C C   . ARG A 1 126 ? 67.254  20.663  -33.060 1.00 31.80  ? 145 ARG C C   1 
ATOM   933   O O   . ARG A 1 126 ? 68.348  20.135  -33.166 1.00 32.25  ? 145 ARG C O   1 
ATOM   934   C CB  . ARG A 1 126 ? 65.233  19.336  -33.775 1.00 32.63  ? 145 ARG C CB  1 
ATOM   935   C CG  . ARG A 1 126 ? 64.356  18.110  -33.484 1.00 34.58  ? 145 ARG C CG  1 
ATOM   936   C CD  . ARG A 1 126 ? 63.686  17.515  -34.779 1.00 73.51  ? 145 ARG C CD  1 
ATOM   937   N NE  . ARG A 1 126 ? 62.837  18.463  -35.539 1.00 71.89  ? 145 ARG C NE  1 
ATOM   938   C CZ  . ARG A 1 126 ? 61.804  18.126  -36.327 1.00 72.47  ? 145 ARG C CZ  1 
ATOM   939   N NH1 . ARG A 1 126 ? 61.458  16.849  -36.479 1.00 74.85  ? 145 ARG C NH1 1 
ATOM   940   N NH2 . ARG A 1 126 ? 61.104  19.072  -36.960 1.00 70.90  ? 145 ARG C NH2 1 
ATOM   941   N N   . GLN A 1 127 ? 67.044  21.950  -33.288 1.00 28.95  ? 146 GLN C N   1 
ATOM   942   C CA  . GLN A 1 127 ? 68.037  22.799  -33.888 1.00 28.43  ? 146 GLN C CA  1 
ATOM   943   C C   . GLN A 1 127 ? 68.067  24.112  -33.156 1.00 26.54  ? 146 GLN C C   1 
ATOM   944   O O   . GLN A 1 127 ? 67.028  24.667  -32.803 1.00 29.68  ? 146 GLN C O   1 
ATOM   945   C CB  . GLN A 1 127 ? 67.653  23.062  -35.342 1.00 35.37  ? 146 GLN C CB  1 
ATOM   946   C CG  . GLN A 1 127 ? 67.831  21.853  -36.269 1.00 37.66  ? 146 GLN C CG  1 
ATOM   947   C CD  . GLN A 1 127 ? 69.297  21.529  -36.464 1.00 32.39  ? 146 GLN C CD  1 
ATOM   948   O OE1 . GLN A 1 127 ? 70.095  22.440  -36.611 1.00 33.74  ? 146 GLN C OE1 1 
ATOM   949   N NE2 . GLN A 1 127 ? 69.663  20.240  -36.428 1.00 34.55  ? 146 GLN C NE2 1 
ATOM   950   N N   . GLN A 1 128 ? 69.257  24.635  -32.929 1.00 26.45  ? 147 GLN C N   1 
ATOM   951   C CA  . GLN A 1 128 ? 69.361  25.891  -32.232 1.00 24.96  ? 147 GLN C CA  1 
ATOM   952   C C   . GLN A 1 128 ? 70.241  26.851  -32.983 1.00 24.88  ? 147 GLN C C   1 
ATOM   953   O O   . GLN A 1 128 ? 71.269  26.467  -33.495 1.00 26.16  ? 147 GLN C O   1 
ATOM   954   C CB  . GLN A 1 128 ? 69.930  25.646  -30.852 1.00 25.16  ? 147 GLN C CB  1 
ATOM   955   C CG  . GLN A 1 128 ? 70.060  26.879  -30.014 1.00 25.90  ? 147 GLN C CG  1 
ATOM   956   C CD  . GLN A 1 128 ? 70.578  26.549  -28.655 1.00 26.48  ? 147 GLN C CD  1 
ATOM   957   O OE1 . GLN A 1 128 ? 69.807  26.315  -27.706 1.00 26.27  ? 147 GLN C OE1 1 
ATOM   958   N NE2 . GLN A 1 128 ? 71.894  26.490  -28.548 1.00 27.50  ? 147 GLN C NE2 1 
ATOM   959   N N   . TYR A 1 129 ? 69.844  28.113  -33.015 1.00 23.70  ? 148 TYR C N   1 
ATOM   960   C CA  . TYR A 1 129 ? 70.535  29.122  -33.792 1.00 23.93  ? 148 TYR C CA  1 
ATOM   961   C C   . TYR A 1 129 ? 70.958  30.292  -32.920 1.00 23.13  ? 148 TYR C C   1 
ATOM   962   O O   . TYR A 1 129 ? 70.158  30.863  -32.210 1.00 22.08  ? 148 TYR C O   1 
ATOM   963   C CB  . TYR A 1 129 ? 69.642  29.550  -34.970 1.00 23.97  ? 148 TYR C CB  1 
ATOM   964   C CG  . TYR A 1 129 ? 69.290  28.362  -35.840 1.00 25.06  ? 148 TYR C CG  1 
ATOM   965   C CD1 . TYR A 1 129 ? 68.055  27.730  -35.740 1.00 24.72  ? 148 TYR C CD1 1 
ATOM   966   C CD2 . TYR A 1 129 ? 70.232  27.821  -36.719 1.00 26.77  ? 148 TYR C CD2 1 
ATOM   967   C CE1 . TYR A 1 129 ? 67.762  26.613  -36.521 1.00 26.00  ? 148 TYR C CE1 1 
ATOM   968   C CE2 . TYR A 1 129 ? 69.954  26.714  -37.496 1.00 28.11  ? 148 TYR C CE2 1 
ATOM   969   C CZ  . TYR A 1 129 ? 68.722  26.107  -37.411 1.00 27.70  ? 148 TYR C CZ  1 
ATOM   970   O OH  . TYR A 1 129 ? 68.457  24.996  -38.211 1.00 29.31  ? 148 TYR C OH  1 
ATOM   971   N N   . GLU A 1 130 ? 72.230  30.638  -32.951 1.00 23.91  ? 149 GLU C N   1 
ATOM   972   C CA  . GLU A 1 130 ? 72.696  31.770  -32.168 1.00 23.45  ? 149 GLU C CA  1 
ATOM   973   C C   . GLU A 1 130 ? 72.613  33.092  -32.924 1.00 24.06  ? 149 GLU C C   1 
ATOM   974   O O   . GLU A 1 130 ? 72.988  33.192  -34.093 1.00 25.27  ? 149 GLU C O   1 
ATOM   975   C CB  . GLU A 1 130 ? 74.113  31.561  -31.638 1.00 28.12  ? 149 GLU C CB  1 
ATOM   976   C CG  . GLU A 1 130 ? 74.507  32.640  -30.660 1.00 28.29  ? 149 GLU C CG  1 
ATOM   977   C CD  . GLU A 1 130 ? 75.990  32.652  -30.291 1.00 30.25  ? 149 GLU C CD  1 
ATOM   978   O OE1 . GLU A 1 130 ? 76.686  31.647  -30.612 1.00 31.49  ? 149 GLU C OE1 1 
ATOM   979   O OE2 . GLU A 1 130 ? 76.446  33.684  -29.694 1.00 30.52  ? 149 GLU C OE2 1 
ATOM   980   N N   . CYS A 1 131 ? 72.111  34.104  -32.232 1.00 22.76  ? 150 CYS C N   1 
ATOM   981   C CA  . CYS A 1 131 ? 71.969  35.442  -32.767 1.00 23.14  ? 150 CYS C CA  1 
ATOM   982   C C   . CYS A 1 131 ? 73.330  36.086  -33.015 1.00 27.47  ? 150 CYS C C   1 
ATOM   983   O O   . CYS A 1 131 ? 74.276  35.814  -32.288 1.00 27.65  ? 150 CYS C O   1 
ATOM   984   C CB  . CYS A 1 131 ? 71.166  36.261  -31.774 1.00 22.24  ? 150 CYS C CB  1 
ATOM   985   S SG  . CYS A 1 131 ? 70.507  37.776  -32.380 1.00 40.89  ? 150 CYS C SG  1 
ATOM   986   N N   . LEU A 1 132 ? 73.430  36.932  -34.040 1.00 28.85  ? 151 LEU C N   1 
ATOM   987   C CA  . LEU A 1 132 ? 74.712  37.516  -34.409 1.00 31.06  ? 151 LEU C CA  1 
ATOM   988   C C   . LEU A 1 132 ? 74.741  39.012  -34.189 1.00 32.22  ? 151 LEU C C   1 
ATOM   989   O O   . LEU A 1 132 ? 75.814  39.581  -33.995 1.00 33.98  ? 151 LEU C O   1 
ATOM   990   C CB  . LEU A 1 132 ? 75.038  37.275  -35.890 1.00 33.15  ? 151 LEU C CB  1 
ATOM   991   C CG  . LEU A 1 132 ? 74.893  35.978  -36.704 1.00 33.67  ? 151 LEU C CG  1 
ATOM   992   C CD1 . LEU A 1 132 ? 74.682  36.366  -38.157 1.00 35.38  ? 151 LEU C CD1 1 
ATOM   993   C CD2 . LEU A 1 132 ? 76.107  35.058  -36.594 1.00 34.81  ? 151 LEU C CD2 1 
ATOM   994   N N   . HIS A 1 133 ? 73.585  39.665  -34.242 1.00 31.89  ? 152 HIS C N   1 
ATOM   995   C CA  . HIS A 1 133 ? 73.557  41.132  -34.253 1.00 33.41  ? 152 HIS C CA  1 
ATOM   996   C C   . HIS A 1 133 ? 73.147  41.786  -32.929 1.00 32.41  ? 152 HIS C C   1 
ATOM   997   O O   . HIS A 1 133 ? 72.052  42.302  -32.783 1.00 32.10  ? 152 HIS C O   1 
ATOM   998   C CB  . HIS A 1 133 ? 72.707  41.641  -35.418 1.00 34.91  ? 152 HIS C CB  1 
ATOM   999   C CG  . HIS A 1 133 ? 73.178  41.141  -36.745 1.00 37.17  ? 152 HIS C CG  1 
ATOM   1000  N ND1 . HIS A 1 133 ? 72.375  40.414  -37.602 1.00 37.20  ? 152 HIS C ND1 1 
ATOM   1001  C CD2 . HIS A 1 133 ? 74.386  41.229  -37.353 1.00 39.52  ? 152 HIS C CD2 1 
ATOM   1002  C CE1 . HIS A 1 133 ? 73.065  40.076  -38.676 1.00 39.00  ? 152 HIS C CE1 1 
ATOM   1003  N NE2 . HIS A 1 133 ? 74.286  40.565  -38.554 1.00 40.54  ? 152 HIS C NE2 1 
ATOM   1004  N N   . TYR A 1 134 ? 74.051  41.795  -31.970 1.00 32.39  ? 153 TYR C N   1 
ATOM   1005  C CA  . TYR A 1 134 ? 73.712  42.310  -30.661 1.00 27.14  ? 153 TYR C CA  1 
ATOM   1006  C C   . TYR A 1 134 ? 73.762  43.822  -30.550 1.00 28.74  ? 153 TYR C C   1 
ATOM   1007  O O   . TYR A 1 134 ? 74.236  44.532  -31.436 1.00 30.56  ? 153 TYR C O   1 
ATOM   1008  C CB  . TYR A 1 134 ? 74.615  41.704  -29.598 1.00 26.70  ? 153 TYR C CB  1 
ATOM   1009  C CG  . TYR A 1 134 ? 74.496  40.235  -29.479 1.00 25.39  ? 153 TYR C CG  1 
ATOM   1010  C CD1 . TYR A 1 134 ? 73.490  39.653  -28.725 1.00 24.00  ? 153 TYR C CD1 1 
ATOM   1011  C CD2 . TYR A 1 134 ? 75.393  39.422  -30.113 1.00 25.92  ? 153 TYR C CD2 1 
ATOM   1012  C CE1 . TYR A 1 134 ? 73.380  38.271  -28.621 1.00 23.15  ? 153 TYR C CE1 1 
ATOM   1013  C CE2 . TYR A 1 134 ? 75.306  38.059  -30.019 1.00 32.13  ? 153 TYR C CE2 1 
ATOM   1014  C CZ  . TYR A 1 134 ? 74.302  37.472  -29.278 1.00 30.79  ? 153 TYR C CZ  1 
ATOM   1015  O OH  . TYR A 1 134 ? 74.269  36.086  -29.222 1.00 30.40  ? 153 TYR C OH  1 
ATOM   1016  N N   . LYS A 1 135 ? 73.290  44.273  -29.398 1.00 28.35  ? 154 LYS C N   1 
ATOM   1017  C CA  . LYS A 1 135 ? 73.175  45.660  -29.010 1.00 29.89  ? 154 LYS C CA  1 
ATOM   1018  C C   . LYS A 1 135 ? 73.713  45.660  -27.569 1.00 29.70  ? 154 LYS C C   1 
ATOM   1019  O O   . LYS A 1 135 ? 73.454  44.715  -26.827 1.00 29.87  ? 154 LYS C O   1 
ATOM   1020  C CB  . LYS A 1 135 ? 71.690  45.949  -29.024 1.00 29.52  ? 154 LYS C CB  1 
ATOM   1021  C CG  . LYS A 1 135 ? 71.250  47.361  -28.963 1.00 34.01  ? 154 LYS C CG  1 
ATOM   1022  C CD  . LYS A 1 135 ? 69.834  47.360  -28.400 1.00 33.43  ? 154 LYS C CD  1 
ATOM   1023  C CE  . LYS A 1 135 ? 68.941  48.375  -29.076 1.00 35.57  ? 154 LYS C CE  1 
ATOM   1024  N NZ  . LYS A 1 135 ? 68.875  48.267  -30.586 1.00 36.50  ? 154 LYS C NZ  1 
ATOM   1025  N N   . THR A 1 136 ? 74.463  46.676  -27.151 1.00 31.48  ? 155 THR C N   1 
ATOM   1026  C CA  . THR A 1 136 ? 75.010  46.682  -25.766 1.00 32.39  ? 155 THR C CA  1 
ATOM   1027  C C   . THR A 1 136 ? 74.809  47.973  -24.944 1.00 34.24  ? 155 THR C C   1 
ATOM   1028  O O   . THR A 1 136 ? 74.679  49.079  -25.497 1.00 35.09  ? 155 THR C O   1 
ATOM   1029  C CB  . THR A 1 136 ? 76.529  46.360  -25.722 1.00 32.29  ? 155 THR C CB  1 
ATOM   1030  O OG1 . THR A 1 136 ? 77.273  47.557  -25.963 1.00 34.68  ? 155 THR C OG1 1 
ATOM   1031  C CG2 . THR A 1 136 ? 76.914  45.310  -26.747 1.00 31.46  ? 155 THR C CG2 1 
ATOM   1032  N N   . ASP A 1 137 ? 74.795  47.834  -23.619 1.00 34.17  ? 156 ASP C N   1 
ATOM   1033  C CA  . ASP A 1 137 ? 74.863  49.015  -22.755 1.00 36.58  ? 156 ASP C CA  1 
ATOM   1034  C C   . ASP A 1 137 ? 76.240  49.698  -22.811 1.00 38.37  ? 156 ASP C C   1 
ATOM   1035  O O   . ASP A 1 137 ? 77.110  49.268  -23.541 1.00 38.26  ? 156 ASP C O   1 
ATOM   1036  C CB  . ASP A 1 137 ? 74.453  48.681  -21.322 1.00 37.14  ? 156 ASP C CB  1 
ATOM   1037  C CG  . ASP A 1 137 ? 75.442  47.755  -20.608 1.00 37.36  ? 156 ASP C CG  1 
ATOM   1038  O OD1 . ASP A 1 137 ? 76.571  47.534  -21.111 1.00 37.49  ? 156 ASP C OD1 1 
ATOM   1039  O OD2 . ASP A 1 137 ? 75.076  47.259  -19.513 1.00 37.58  ? 156 ASP C OD2 1 
ATOM   1040  N N   . ALA A 1 138 ? 76.441  50.761  -22.051 1.00 40.57  ? 157 ALA C N   1 
ATOM   1041  C CA  . ALA A 1 138 ? 77.734  51.440  -22.057 1.00 41.60  ? 157 ALA C CA  1 
ATOM   1042  C C   . ALA A 1 138 ? 78.859  50.554  -21.505 1.00 42.54  ? 157 ALA C C   1 
ATOM   1043  O O   . ALA A 1 138 ? 80.024  50.701  -21.881 1.00 42.34  ? 157 ALA C O   1 
ATOM   1044  C CB  . ALA A 1 138 ? 77.654  52.741  -21.294 1.00 44.26  ? 157 ALA C CB  1 
ATOM   1045  N N   . GLN A 1 139 ? 78.507  49.628  -20.622 1.00 40.87  ? 158 GLN C N   1 
ATOM   1046  C CA  . GLN A 1 139 ? 79.482  48.699  -20.058 1.00 40.64  ? 158 GLN C CA  1 
ATOM   1047  C C   . GLN A 1 139 ? 79.993  47.688  -21.074 1.00 39.23  ? 158 GLN C C   1 
ATOM   1048  O O   . GLN A 1 139 ? 81.010  47.027  -20.841 1.00 39.44  ? 158 GLN C O   1 
ATOM   1049  C CB  . GLN A 1 139 ? 78.881  47.948  -18.865 1.00 40.04  ? 158 GLN C CB  1 
ATOM   1050  C CG  . GLN A 1 139 ? 79.745  48.002  -17.619 1.00 42.05  ? 158 GLN C CG  1 
ATOM   1051  C CD  . GLN A 1 139 ? 80.108  49.420  -17.269 1.00 45.18  ? 158 GLN C CD  1 
ATOM   1052  O OE1 . GLN A 1 139 ? 79.293  50.334  -17.430 1.00 46.18  ? 158 GLN C OE1 1 
ATOM   1053  N NE2 . GLN A 1 139 ? 81.337  49.625  -16.806 1.00 47.05  ? 158 GLN C NE2 1 
ATOM   1054  N N   . GLY A 1 140 ? 79.272  47.560  -22.189 1.00 37.98  ? 159 GLY C N   1 
ATOM   1055  C CA  . GLY A 1 140 ? 79.571  46.567  -23.200 1.00 36.81  ? 159 GLY C CA  1 
ATOM   1056  C C   . GLY A 1 140 ? 78.771  45.287  -23.051 1.00 34.84  ? 159 GLY C C   1 
ATOM   1057  O O   . GLY A 1 140 ? 79.019  44.317  -23.766 1.00 34.38  ? 159 GLY C O   1 
ATOM   1058  N N   . THR A 1 141 ? 77.806  45.267  -22.140 1.00 32.27  ? 160 THR C N   1 
ATOM   1059  C CA  . THR A 1 141 ? 77.036  44.061  -21.884 1.00 30.43  ? 160 THR C CA  1 
ATOM   1060  C C   . THR A 1 141 ? 75.871  43.949  -22.878 1.00 29.13  ? 160 THR C C   1 
ATOM   1061  O O   . THR A 1 141 ? 75.141  44.916  -23.106 1.00 29.61  ? 160 THR C O   1 
ATOM   1062  C CB  . THR A 1 141 ? 76.482  44.040  -20.443 1.00 30.67  ? 160 THR C CB  1 
ATOM   1063  O OG1 . THR A 1 141 ? 77.535  44.298  -19.505 1.00 36.96  ? 160 THR C OG1 1 
ATOM   1064  C CG2 . THR A 1 141 ? 75.864  42.692  -20.132 1.00 29.28  ? 160 THR C CG2 1 
ATOM   1065  N N   . ARG A 1 142 ? 75.696  42.773  -23.472 1.00 27.74  ? 161 ARG C N   1 
ATOM   1066  C CA  . ARG A 1 142 ? 74.657  42.586  -24.485 1.00 26.67  ? 161 ARG C CA  1 
ATOM   1067  C C   . ARG A 1 142 ? 73.250  42.636  -23.851 1.00 30.30  ? 161 ARG C C   1 
ATOM   1068  O O   . ARG A 1 142 ? 72.969  41.943  -22.869 1.00 29.93  ? 161 ARG C O   1 
ATOM   1069  C CB  . ARG A 1 142 ? 74.880  41.292  -25.289 1.00 25.69  ? 161 ARG C CB  1 
ATOM   1070  C CG  . ARG A 1 142 ? 76.073  41.310  -26.219 1.00 26.64  ? 161 ARG C CG  1 
ATOM   1071  C CD  . ARG A 1 142 ? 76.666  39.921  -26.358 1.00 26.26  ? 161 ARG C CD  1 
ATOM   1072  N NE  . ARG A 1 142 ? 77.606  39.813  -27.476 1.00 28.16  ? 161 ARG C NE  1 
ATOM   1073  C CZ  . ARG A 1 142 ? 77.966  38.671  -28.075 1.00 27.30  ? 161 ARG C CZ  1 
ATOM   1074  N NH1 . ARG A 1 142 ? 77.486  37.506  -27.675 1.00 26.24  ? 161 ARG C NH1 1 
ATOM   1075  N NH2 . ARG A 1 142 ? 78.809  38.695  -29.102 1.00 28.70  ? 161 ARG C NH2 1 
ATOM   1076  N N   . ILE A 1 143 ? 72.371  43.477  -24.398 1.00 30.46  ? 162 ILE C N   1 
ATOM   1077  C CA  . ILE A 1 143 ? 71.051  43.673  -23.803 1.00 30.21  ? 162 ILE C CA  1 
ATOM   1078  C C   . ILE A 1 143 ? 69.912  43.555  -24.826 1.00 29.57  ? 162 ILE C C   1 
ATOM   1079  O O   . ILE A 1 143 ? 68.774  43.920  -24.546 1.00 25.92  ? 162 ILE C O   1 
ATOM   1080  C CB  . ILE A 1 143 ? 70.964  45.033  -23.089 1.00 31.79  ? 162 ILE C CB  1 
ATOM   1081  C CG1 . ILE A 1 143 ? 71.176  46.169  -24.081 1.00 29.18  ? 162 ILE C CG1 1 
ATOM   1082  C CG2 . ILE A 1 143 ? 72.006  45.124  -22.013 1.00 28.80  ? 162 ILE C CG2 1 
ATOM   1083  C CD1 . ILE A 1 143 ? 71.245  47.505  -23.425 1.00 31.27  ? 162 ILE C CD1 1 
ATOM   1084  N N   . GLY A 1 144 ? 70.226  43.023  -25.999 1.00 24.94  ? 163 GLY C N   1 
ATOM   1085  C CA  . GLY A 1 144 ? 69.326  43.087  -27.132 1.00 24.79  ? 163 GLY C CA  1 
ATOM   1086  C C   . GLY A 1 144 ? 70.000  42.498  -28.352 1.00 26.48  ? 163 GLY C C   1 
ATOM   1087  O O   . GLY A 1 144 ? 71.201  42.689  -28.549 1.00 25.17  ? 163 GLY C O   1 
ATOM   1088  N N   . CYS A 1 145 ? 69.226  41.757  -29.144 1.00 25.37  ? 164 CYS C N   1 
ATOM   1089  C CA  . CYS A 1 145 ? 69.712  41.158  -30.377 1.00 25.36  ? 164 CYS C CA  1 
ATOM   1090  C C   . CYS A 1 145 ? 68.629  41.086  -31.459 1.00 25.87  ? 164 CYS C C   1 
ATOM   1091  O O   . CYS A 1 145 ? 67.437  41.127  -31.156 1.00 25.93  ? 164 CYS C O   1 
ATOM   1092  C CB  . CYS A 1 145 ? 70.263  39.759  -30.122 1.00 24.33  ? 164 CYS C CB  1 
ATOM   1093  S SG  . CYS A 1 145 ? 71.477  39.266  -31.420 1.00 49.22  ? 164 CYS C SG  1 
ATOM   1094  N N   . ARG A 1 146 ? 69.049  40.971  -32.715 1.00 26.69  ? 165 ARG C N   1 
ATOM   1095  C CA  . ARG A 1 146 ? 68.114  40.829  -33.811 1.00 27.41  ? 165 ARG C CA  1 
ATOM   1096  C C   . ARG A 1 146 ? 68.420  39.637  -34.693 1.00 28.44  ? 165 ARG C C   1 
ATOM   1097  O O   . ARG A 1 146 ? 69.572  39.417  -35.095 1.00 29.42  ? 165 ARG C O   1 
ATOM   1098  C CB  . ARG A 1 146 ? 68.098  42.056  -34.689 1.00 28.74  ? 165 ARG C CB  1 
ATOM   1099  C CG  . ARG A 1 146 ? 67.016  41.953  -35.705 1.00 29.13  ? 165 ARG C CG  1 
ATOM   1100  C CD  . ARG A 1 146 ? 67.076  43.080  -36.675 1.00 31.71  ? 165 ARG C CD  1 
ATOM   1101  N NE  . ARG A 1 146 ? 68.204  42.920  -37.576 1.00 33.25  ? 165 ARG C NE  1 
ATOM   1102  C CZ  . ARG A 1 146 ? 69.281  43.694  -37.563 1.00 34.99  ? 165 ARG C CZ  1 
ATOM   1103  N NH1 . ARG A 1 146 ? 69.359  44.693  -36.676 1.00 35.22  ? 165 ARG C NH1 1 
ATOM   1104  N NH2 . ARG A 1 146 ? 70.269  43.466  -38.434 1.00 36.47  ? 165 ARG C NH2 1 
ATOM   1105  N N   . PHE A 1 147 ? 67.380  38.871  -34.997 1.00 28.58  ? 166 PHE C N   1 
ATOM   1106  C CA  . PHE A 1 147 ? 67.497  37.759  -35.900 1.00 29.76  ? 166 PHE C CA  1 
ATOM   1107  C C   . PHE A 1 147 ? 67.052  38.208  -37.286 1.00 32.98  ? 166 PHE C C   1 
ATOM   1108  O O   . PHE A 1 147 ? 65.944  38.745  -37.455 1.00 33.71  ? 166 PHE C O   1 
ATOM   1109  C CB  . PHE A 1 147 ? 66.608  36.629  -35.435 1.00 28.35  ? 166 PHE C CB  1 
ATOM   1110  C CG  . PHE A 1 147 ? 67.208  35.773  -34.370 1.00 27.33  ? 166 PHE C CG  1 
ATOM   1111  C CD1 . PHE A 1 147 ? 68.300  34.965  -34.649 1.00 27.28  ? 166 PHE C CD1 1 
ATOM   1112  C CD2 . PHE A 1 147 ? 66.660  35.742  -33.090 1.00 26.64  ? 166 PHE C CD2 1 
ATOM   1113  C CE1 . PHE A 1 147 ? 68.833  34.149  -33.696 1.00 26.57  ? 166 PHE C CE1 1 
ATOM   1114  C CE2 . PHE A 1 147 ? 67.216  34.908  -32.098 1.00 25.97  ? 166 PHE C CE2 1 
ATOM   1115  C CZ  . PHE A 1 147 ? 68.301  34.108  -32.421 1.00 25.93  ? 166 PHE C CZ  1 
ATOM   1116  N N   . ASP A 1 148 ? 67.908  38.007  -38.286 1.00 35.23  ? 167 ASP C N   1 
ATOM   1117  C CA  . ASP A 1 148 ? 67.532  38.349  -39.637 1.00 38.04  ? 167 ASP C CA  1 
ATOM   1118  C C   . ASP A 1 148 ? 66.710  37.224  -40.233 1.00 38.41  ? 167 ASP C C   1 
ATOM   1119  O O   . ASP A 1 148 ? 67.058  36.042  -40.100 1.00 37.66  ? 167 ASP C O   1 
ATOM   1120  C CB  . ASP A 1 148 ? 68.771  38.561  -40.497 1.00 40.73  ? 167 ASP C CB  1 
ATOM   1121  C CG  . ASP A 1 148 ? 69.273  39.979  -40.461 1.00 42.69  ? 167 ASP C CG  1 
ATOM   1122  O OD1 . ASP A 1 148 ? 68.544  40.837  -39.915 1.00 42.37  ? 167 ASP C OD1 1 
ATOM   1123  O OD2 . ASP A 1 148 ? 70.389  40.230  -40.991 1.00 44.73  ? 167 ASP C OD2 1 
ATOM   1124  N N   . ASP A 1 149 ? 65.618  37.601  -40.888 1.00 39.92  ? 168 ASP C N   1 
ATOM   1125  C CA  . ASP A 1 149 ? 64.932  36.701  -41.788 1.00 40.94  ? 168 ASP C CA  1 
ATOM   1126  C C   . ASP A 1 149 ? 64.391  35.486  -41.016 1.00 38.56  ? 168 ASP C C   1 
ATOM   1127  O O   . ASP A 1 149 ? 64.720  34.335  -41.296 1.00 38.15  ? 168 ASP C O   1 
ATOM   1128  C CB  . ASP A 1 149 ? 65.921  36.330  -42.883 1.00 43.90  ? 168 ASP C CB  1 
ATOM   1129  C CG  . ASP A 1 149 ? 65.328  35.460  -43.931 1.00 46.26  ? 168 ASP C CG  1 
ATOM   1130  O OD1 . ASP A 1 149 ? 64.080  35.416  -44.017 1.00 46.36  ? 168 ASP C OD1 1 
ATOM   1131  O OD2 . ASP A 1 149 ? 66.123  34.820  -44.662 1.00 48.19  ? 168 ASP C OD2 1 
ATOM   1132  N N   . ILE A 1 150 ? 63.548  35.781  -40.029 1.00 37.26  ? 169 ILE C N   1 
ATOM   1133  C CA  . ILE A 1 150 ? 63.036  34.800  -39.080 1.00 35.64  ? 169 ILE C CA  1 
ATOM   1134  C C   . ILE A 1 150 ? 62.314  33.584  -39.710 1.00 36.01  ? 169 ILE C C   1 
ATOM   1135  O O   . ILE A 1 150 ? 62.419  32.459  -39.226 1.00 25.40  ? 169 ILE C O   1 
ATOM   1136  C CB  . ILE A 1 150 ? 62.163  35.511  -37.996 1.00 24.83  ? 169 ILE C CB  1 
ATOM   1137  C CG1 . ILE A 1 150 ? 61.840  34.555  -36.831 1.00 23.45  ? 169 ILE C CG1 1 
ATOM   1138  C CG2 . ILE A 1 150 ? 60.931  36.182  -38.607 1.00 26.02  ? 169 ILE C CG2 1 
ATOM   1139  C CD1 . ILE A 1 150 ? 63.077  33.930  -36.215 1.00 22.63  ? 169 ILE C CD1 1 
ATOM   1140  N N   . SER A 1 151 ? 61.598  33.814  -40.802 1.00 37.24  ? 170 SER C N   1 
ATOM   1141  C CA  . SER A 1 151 ? 60.914  32.730  -41.496 1.00 38.06  ? 170 SER C CA  1 
ATOM   1142  C C   . SER A 1 151 ? 61.882  31.655  -41.999 1.00 39.12  ? 170 SER C C   1 
ATOM   1143  O O   . SER A 1 151 ? 61.657  30.461  -41.812 1.00 39.27  ? 170 SER C O   1 
ATOM   1144  C CB  . SER A 1 151 ? 60.080  33.274  -42.644 1.00 39.39  ? 170 SER C CB  1 
ATOM   1145  O OG  . SER A 1 151 ? 58.837  32.608  -42.692 1.00 39.38  ? 170 SER C OG  1 
ATOM   1146  N N   . ARG A 1 152 ? 62.979  32.072  -42.611 1.00 39.84  ? 171 ARG C N   1 
ATOM   1147  C CA  . ARG A 1 152 ? 63.945  31.108  -43.119 1.00 40.22  ? 171 ARG C CA  1 
ATOM   1148  C C   . ARG A 1 152 ? 64.618  30.367  -41.978 1.00 37.09  ? 171 ARG C C   1 
ATOM   1149  O O   . ARG A 1 152 ? 64.961  29.195  -42.085 1.00 37.36  ? 171 ARG C O   1 
ATOM   1150  C CB  . ARG A 1 152 ? 65.008  31.815  -43.961 1.00 43.39  ? 171 ARG C CB  1 
ATOM   1151  C CG  . ARG A 1 152 ? 66.105  30.903  -44.484 1.00 45.99  ? 171 ARG C CG  1 
ATOM   1152  C CD  . ARG A 1 152 ? 67.162  31.696  -45.248 1.00 48.87  ? 171 ARG C CD  1 
ATOM   1153  N NE  . ARG A 1 152 ? 66.550  32.582  -46.244 1.00 51.26  ? 171 ARG C NE  1 
ATOM   1154  C CZ  . ARG A 1 152 ? 66.145  32.203  -47.456 1.00 53.88  ? 171 ARG C CZ  1 
ATOM   1155  N NH1 . ARG A 1 152 ? 66.294  30.939  -47.862 1.00 54.78  ? 171 ARG C NH1 1 
ATOM   1156  N NH2 . ARG A 1 152 ? 65.597  33.101  -48.265 1.00 55.77  ? 171 ARG C NH2 1 
ATOM   1157  N N   . LEU A 1 153 ? 64.816  31.069  -40.879 1.00 34.96  ? 172 LEU C N   1 
ATOM   1158  C CA  . LEU A 1 153 ? 65.627  30.541  -39.818 1.00 33.05  ? 172 LEU C CA  1 
ATOM   1159  C C   . LEU A 1 153 ? 64.842  29.526  -38.985 1.00 31.04  ? 172 LEU C C   1 
ATOM   1160  O O   . LEU A 1 153 ? 65.348  28.458  -38.611 1.00 30.24  ? 172 LEU C O   1 
ATOM   1161  C CB  . LEU A 1 153 ? 66.096  31.707  -38.984 1.00 31.62  ? 172 LEU C CB  1 
ATOM   1162  C CG  . LEU A 1 153 ? 67.137  31.397  -37.943 1.00 30.92  ? 172 LEU C CG  1 
ATOM   1163  C CD1 . LEU A 1 153 ? 68.356  30.807  -38.628 1.00 26.35  ? 172 LEU C CD1 1 
ATOM   1164  C CD2 . LEU A 1 153 ? 67.416  32.705  -37.247 1.00 24.17  ? 172 LEU C CD2 1 
ATOM   1165  N N   . SER A 1 154 ? 63.583  29.875  -38.739 1.00 29.55  ? 173 SER C N   1 
ATOM   1166  C CA  . SER A 1 154 ? 62.656  29.084  -37.958 1.00 28.50  ? 173 SER C CA  1 
ATOM   1167  C C   . SER A 1 154 ? 62.005  27.996  -38.804 1.00 29.83  ? 173 SER C C   1 
ATOM   1168  O O   . SER A 1 154 ? 61.131  27.281  -38.310 1.00 29.95  ? 173 SER C O   1 
ATOM   1169  C CB  . SER A 1 154 ? 61.570  30.003  -37.403 1.00 27.97  ? 173 SER C CB  1 
ATOM   1170  O OG  . SER A 1 154 ? 60.777  30.546  -38.459 1.00 29.23  ? 173 SER C OG  1 
ATOM   1171  N N   . SER A 1 155 ? 62.412  27.881  -40.078 1.00 30.98  ? 174 SER C N   1 
ATOM   1172  C CA  . SER A 1 155 ? 61.847  26.881  -40.986 1.00 32.32  ? 174 SER C CA  1 
ATOM   1173  C C   . SER A 1 155 ? 60.312  26.881  -41.047 1.00 29.10  ? 174 SER C C   1 
ATOM   1174  O O   . SER A 1 155 ? 59.686  25.829  -41.082 1.00 29.91  ? 174 SER C O   1 
ATOM   1175  C CB  . SER A 1 155 ? 62.333  25.482  -40.602 1.00 32.82  ? 174 SER C CB  1 
ATOM   1176  O OG  . SER A 1 155 ? 63.481  25.112  -41.334 1.00 34.37  ? 174 SER C OG  1 
ATOM   1177  N N   . GLY A 1 156 ? 59.712  28.059  -41.051 1.00 28.63  ? 175 GLY C N   1 
ATOM   1178  C CA  . GLY A 1 156 ? 58.274  28.151  -41.152 1.00 29.11  ? 175 GLY C CA  1 
ATOM   1179  C C   . GLY A 1 156 ? 57.502  27.923  -39.864 1.00 30.76  ? 175 GLY C C   1 
ATOM   1180  O O   . GLY A 1 156 ? 56.295  27.799  -39.898 1.00 31.67  ? 175 GLY C O   1 
ATOM   1181  N N   . SER A 1 157 ? 58.183  27.910  -38.726 1.00 29.38  ? 176 SER C N   1 
ATOM   1182  C CA  . SER A 1 157 ? 57.538  27.740  -37.415 1.00 29.12  ? 176 SER C CA  1 
ATOM   1183  C C   . SER A 1 157 ? 56.541  28.825  -37.073 1.00 29.59  ? 176 SER C C   1 
ATOM   1184  O O   . SER A 1 157 ? 56.745  29.981  -37.434 1.00 29.66  ? 176 SER C O   1 
ATOM   1185  C CB  . SER A 1 157 ? 58.582  27.754  -36.305 1.00 27.53  ? 176 SER C CB  1 
ATOM   1186  O OG  . SER A 1 157 ? 59.266  26.537  -36.244 1.00 27.96  ? 176 SER C OG  1 
ATOM   1187  N N   . GLN A 1 158 ? 55.507  28.445  -36.317 1.00 30.29  ? 177 GLN C N   1 
ATOM   1188  C CA  . GLN A 1 158 ? 54.505  29.367  -35.788 1.00 26.78  ? 177 GLN C CA  1 
ATOM   1189  C C   . GLN A 1 158 ? 54.847  29.713  -34.368 1.00 25.89  ? 177 GLN C C   1 
ATOM   1190  O O   . GLN A 1 158 ? 54.393  30.718  -33.833 1.00 26.84  ? 177 GLN C O   1 
ATOM   1191  C CB  . GLN A 1 158 ? 53.118  28.738  -35.836 1.00 28.32  ? 177 GLN C CB  1 
ATOM   1192  C CG  . GLN A 1 158 ? 52.602  28.445  -37.246 1.00 31.17  ? 177 GLN C CG  1 
ATOM   1193  C CD  . GLN A 1 158 ? 52.637  29.679  -38.156 1.00 32.06  ? 177 GLN C CD  1 
ATOM   1194  O OE1 . GLN A 1 158 ? 53.526  29.812  -38.986 1.00 29.47  ? 177 GLN C OE1 1 
ATOM   1195  N NE2 . GLN A 1 158 ? 51.676  30.584  -37.985 1.00 30.51  ? 177 GLN C NE2 1 
ATOM   1196  N N   . SER A 1 159 ? 55.651  28.862  -33.744 1.00 32.61  ? 178 SER C N   1 
ATOM   1197  C CA  . SER A 1 159 ? 56.165  29.123  -32.400 1.00 24.69  ? 178 SER C CA  1 
ATOM   1198  C C   . SER A 1 159 ? 57.592  28.627  -32.244 1.00 25.84  ? 178 SER C C   1 
ATOM   1199  O O   . SER A 1 159 ? 58.037  27.699  -32.925 1.00 24.15  ? 178 SER C O   1 
ATOM   1200  C CB  . SER A 1 159 ? 55.295  28.441  -31.352 1.00 25.81  ? 178 SER C CB  1 
ATOM   1201  O OG  . SER A 1 159 ? 55.578  27.053  -31.288 1.00 26.41  ? 178 SER C OG  1 
ATOM   1202  N N   . SER A 1 160 ? 58.311  29.254  -31.324 1.00 25.22  ? 179 SER C N   1 
ATOM   1203  C CA  . SER A 1 160 ? 59.571  28.680  -30.847 1.00 24.99  ? 179 SER C CA  1 
ATOM   1204  C C   . SER A 1 160 ? 60.027  29.152  -29.488 1.00 24.09  ? 179 SER C C   1 
ATOM   1205  O O   . SER A 1 160 ? 59.299  29.829  -28.756 1.00 22.64  ? 179 SER C O   1 
ATOM   1206  C CB  . SER A 1 160 ? 60.699  28.849  -31.877 1.00 25.15  ? 179 SER C CB  1 
ATOM   1207  O OG  . SER A 1 160 ? 60.482  30.009  -32.656 1.00 25.25  ? 179 SER C OG  1 
ATOM   1208  N N   . HIS A 1 161 ? 61.268  28.786  -29.184 1.00 23.40  ? 180 HIS C N   1 
ATOM   1209  C CA  . HIS A 1 161 ? 61.816  28.883  -27.841 1.00 22.20  ? 180 HIS C CA  1 
ATOM   1210  C C   . HIS A 1 161 ? 63.000  29.825  -27.820 1.00 21.29  ? 180 HIS C C   1 
ATOM   1211  O O   . HIS A 1 161 ? 63.980  29.565  -28.475 1.00 22.51  ? 180 HIS C O   1 
ATOM   1212  C CB  . HIS A 1 161 ? 62.277  27.513  -27.435 1.00 23.15  ? 180 HIS C CB  1 
ATOM   1213  C CG  . HIS A 1 161 ? 62.675  27.404  -26.002 1.00 26.16  ? 180 HIS C CG  1 
ATOM   1214  N ND1 . HIS A 1 161 ? 63.464  26.384  -25.534 1.00 27.02  ? 180 HIS C ND1 1 
ATOM   1215  C CD2 . HIS A 1 161 ? 62.361  28.174  -24.929 1.00 26.38  ? 180 HIS C CD2 1 
ATOM   1216  C CE1 . HIS A 1 161 ? 63.622  26.524  -24.226 1.00 27.81  ? 180 HIS C CE1 1 
ATOM   1217  N NE2 . HIS A 1 161 ? 62.959  27.592  -23.835 1.00 27.32  ? 180 HIS C NE2 1 
ATOM   1218  N N   . ILE A 1 162 ? 62.906  30.933  -27.109 1.00 21.08  ? 181 ILE C N   1 
ATOM   1219  C CA  . ILE A 1 162 ? 64.010  31.862  -27.052 1.00 20.50  ? 181 ILE C CA  1 
ATOM   1220  C C   . ILE A 1 162 ? 64.803  31.619  -25.778 1.00 23.65  ? 181 ILE C C   1 
ATOM   1221  O O   . ILE A 1 162 ? 64.248  31.448  -24.677 1.00 21.75  ? 181 ILE C O   1 
ATOM   1222  C CB  . ILE A 1 162 ? 63.527  33.304  -27.008 1.00 24.36  ? 181 ILE C CB  1 
ATOM   1223  C CG1 . ILE A 1 162 ? 62.730  33.642  -28.252 1.00 24.28  ? 181 ILE C CG1 1 
ATOM   1224  C CG2 . ILE A 1 162 ? 64.695  34.233  -26.908 1.00 20.09  ? 181 ILE C CG2 1 
ATOM   1225  C CD1 . ILE A 1 162 ? 63.579  33.782  -29.457 1.00 24.05  ? 181 ILE C CD1 1 
ATOM   1226  N N   . LEU A 1 163 ? 66.112  31.631  -25.904 1.00 23.28  ? 182 LEU C N   1 
ATOM   1227  C CA  . LEU A 1 163 ? 66.904  31.299  -24.758 1.00 24.34  ? 182 LEU C CA  1 
ATOM   1228  C C   . LEU A 1 163 ? 68.005  32.317  -24.583 1.00 24.22  ? 182 LEU C C   1 
ATOM   1229  O O   . LEU A 1 163 ? 68.756  32.563  -25.517 1.00 24.44  ? 182 LEU C O   1 
ATOM   1230  C CB  . LEU A 1 163 ? 67.473  29.912  -24.979 1.00 25.50  ? 182 LEU C CB  1 
ATOM   1231  C CG  . LEU A 1 163 ? 68.252  29.381  -23.796 1.00 27.37  ? 182 LEU C CG  1 
ATOM   1232  C CD1 . LEU A 1 163 ? 67.349  28.876  -22.679 1.00 28.45  ? 182 LEU C CD1 1 
ATOM   1233  C CD2 . LEU A 1 163 ? 69.173  28.290  -24.289 1.00 28.45  ? 182 LEU C CD2 1 
ATOM   1234  N N   . VAL A 1 164 ? 68.108  32.947  -23.417 1.00 24.54  ? 183 VAL C N   1 
ATOM   1235  C CA  . VAL A 1 164 ? 69.302  33.757  -23.147 1.00 21.87  ? 183 VAL C CA  1 
ATOM   1236  C C   . VAL A 1 164 ? 70.194  33.059  -22.146 1.00 22.92  ? 183 VAL C C   1 
ATOM   1237  O O   . VAL A 1 164 ? 69.758  32.779  -21.045 1.00 23.84  ? 183 VAL C O   1 
ATOM   1238  C CB  . VAL A 1 164 ? 68.975  35.163  -22.651 1.00 22.02  ? 183 VAL C CB  1 
ATOM   1239  C CG1 . VAL A 1 164 ? 70.233  35.967  -22.493 1.00 22.36  ? 183 VAL C CG1 1 
ATOM   1240  C CG2 . VAL A 1 164 ? 68.054  35.853  -23.613 1.00 21.38  ? 183 VAL C CG2 1 
ATOM   1241  N N   . ARG A 1 165 ? 71.431  32.753  -22.536 1.00 23.12  ? 184 ARG C N   1 
ATOM   1242  C CA  . ARG A 1 165 ? 72.441  32.216  -21.613 1.00 24.42  ? 184 ARG C CA  1 
ATOM   1243  C C   . ARG A 1 165 ? 73.400  33.308  -21.127 1.00 24.86  ? 184 ARG C C   1 
ATOM   1244  O O   . ARG A 1 165 ? 73.567  34.309  -21.787 1.00 24.21  ? 184 ARG C O   1 
ATOM   1245  C CB  . ARG A 1 165 ? 73.200  31.078  -22.252 1.00 24.90  ? 184 ARG C CB  1 
ATOM   1246  C CG  . ARG A 1 165 ? 72.314  29.938  -22.603 1.00 24.91  ? 184 ARG C CG  1 
ATOM   1247  C CD  . ARG A 1 165 ? 73.044  28.616  -22.753 1.00 28.32  ? 184 ARG C CD  1 
ATOM   1248  N NE  . ARG A 1 165 ? 72.060  27.566  -22.971 1.00 28.96  ? 184 ARG C NE  1 
ATOM   1249  C CZ  . ARG A 1 165 ? 71.478  26.843  -22.007 1.00 30.52  ? 184 ARG C CZ  1 
ATOM   1250  N NH1 . ARG A 1 165 ? 71.796  26.997  -20.719 1.00 31.50  ? 184 ARG C NH1 1 
ATOM   1251  N NH2 . ARG A 1 165 ? 70.569  25.933  -22.339 1.00 31.33  ? 184 ARG C NH2 1 
ATOM   1252  N N   . GLY A 1 166 ? 73.993  33.146  -19.950 1.00 26.23  ? 185 GLY C N   1 
ATOM   1253  C CA  . GLY A 1 166 ? 74.934  34.137  -19.464 1.00 26.92  ? 185 GLY C CA  1 
ATOM   1254  C C   . GLY A 1 166 ? 76.259  33.456  -19.249 1.00 30.11  ? 185 GLY C C   1 
ATOM   1255  O O   . GLY A 1 166 ? 76.314  32.230  -19.078 1.00 30.77  ? 185 GLY C O   1 
ATOM   1256  N N   . ARG A 1 167 ? 77.342  34.219  -19.274 1.00 28.84  ? 186 ARG C N   1 
ATOM   1257  C CA  . ARG A 1 167 ? 78.638  33.624  -19.003 1.00 30.96  ? 186 ARG C CA  1 
ATOM   1258  C C   . ARG A 1 167 ? 79.532  34.547  -18.208 1.00 32.17  ? 186 ARG C C   1 
ATOM   1259  O O   . ARG A 1 167 ? 79.328  35.761  -18.196 1.00 31.76  ? 186 ARG C O   1 
ATOM   1260  C CB  . ARG A 1 167 ? 79.318  33.181  -20.289 1.00 30.90  ? 186 ARG C CB  1 
ATOM   1261  C CG  . ARG A 1 167 ? 79.261  34.195  -21.392 1.00 30.28  ? 186 ARG C CG  1 
ATOM   1262  C CD  . ARG A 1 167 ? 79.713  33.546  -22.696 1.00 30.73  ? 186 ARG C CD  1 
ATOM   1263  N NE  . ARG A 1 167 ? 79.592  34.427  -23.860 1.00 30.18  ? 186 ARG C NE  1 
ATOM   1264  C CZ  . ARG A 1 167 ? 80.505  35.327  -24.227 1.00 31.08  ? 186 ARG C CZ  1 
ATOM   1265  N NH1 . ARG A 1 167 ? 81.625  35.492  -23.520 1.00 32.26  ? 186 ARG C NH1 1 
ATOM   1266  N NH2 . ARG A 1 167 ? 80.292  36.066  -25.313 1.00 30.94  ? 186 ARG C NH2 1 
ATOM   1267  N N   . SER A 1 168 ? 80.515  33.962  -17.524 1.00 33.71  ? 187 SER C N   1 
ATOM   1268  C CA  . SER A 1 168 ? 81.397  34.745  -16.696 1.00 35.32  ? 187 SER C CA  1 
ATOM   1269  C C   . SER A 1 168 ? 82.576  33.929  -16.285 1.00 37.70  ? 187 SER C C   1 
ATOM   1270  O O   . SER A 1 168 ? 82.470  32.718  -16.120 1.00 38.33  ? 187 SER C O   1 
ATOM   1271  C CB  . SER A 1 168 ? 80.677  35.182  -15.439 1.00 35.84  ? 187 SER C CB  1 
ATOM   1272  O OG  . SER A 1 168 ? 81.480  36.079  -14.734 1.00 37.40  ? 187 SER C OG  1 
ATOM   1273  N N   . ALA A 1 169 ? 83.707  34.596  -16.103 1.00 39.23  ? 188 ALA C N   1 
ATOM   1274  C CA  . ALA A 1 169 ? 84.885  33.929  -15.603 1.00 41.50  ? 188 ALA C CA  1 
ATOM   1275  C C   . ALA A 1 169 ? 84.740  33.819  -14.093 1.00 48.73  ? 188 ALA C C   1 
ATOM   1276  O O   . ALA A 1 169 ? 85.344  32.946  -13.460 1.00 51.00  ? 188 ALA C O   1 
ATOM   1277  C CB  . ALA A 1 169 ? 86.123  34.712  -15.976 1.00 42.69  ? 188 ALA C CB  1 
ATOM   1278  N N   . ALA A 1 170 ? 83.918  34.703  -13.528 1.00 47.86  ? 189 ALA C N   1 
ATOM   1279  C CA  . ALA A 1 170 ? 83.714  34.796  -12.087 1.00 44.25  ? 189 ALA C CA  1 
ATOM   1280  C C   . ALA A 1 170 ? 82.965  33.597  -11.524 1.00 44.85  ? 189 ALA C C   1 
ATOM   1281  O O   . ALA A 1 170 ? 83.388  33.002  -10.551 1.00 47.44  ? 189 ALA C O   1 
ATOM   1282  C CB  . ALA A 1 170 ? 82.974  36.077  -11.761 1.00 43.42  ? 189 ALA C CB  1 
ATOM   1283  N N   . PHE A 1 171 ? 81.843  33.247  -12.137 1.00 42.74  ? 190 PHE C N   1 
ATOM   1284  C CA  . PHE A 1 171 ? 81.013  32.143  -11.660 1.00 43.41  ? 190 PHE C CA  1 
ATOM   1285  C C   . PHE A 1 171 ? 79.890  31.855  -12.642 1.00 40.83  ? 190 PHE C C   1 
ATOM   1286  O O   . PHE A 1 171 ? 79.646  32.647  -13.551 1.00 40.99  ? 190 PHE C O   1 
ATOM   1287  C CB  . PHE A 1 171 ? 80.427  32.444  -10.272 1.00 45.19  ? 190 PHE C CB  1 
ATOM   1288  C CG  . PHE A 1 171 ? 79.827  33.825  -10.139 1.00 44.05  ? 190 PHE C CG  1 
ATOM   1289  C CD1 . PHE A 1 171 ? 78.532  34.096  -10.607 1.00 41.99  ? 190 PHE C CD1 1 
ATOM   1290  C CD2 . PHE A 1 171 ? 80.538  34.848  -9.517  1.00 45.38  ? 190 PHE C CD2 1 
ATOM   1291  C CE1 . PHE A 1 171 ? 77.957  35.378  -10.467 1.00 41.33  ? 190 PHE C CE1 1 
ATOM   1292  C CE2 . PHE A 1 171 ? 79.985  36.127  -9.387  1.00 44.71  ? 190 PHE C CE2 1 
ATOM   1293  C CZ  . PHE A 1 171 ? 78.683  36.392  -9.858  1.00 42.73  ? 190 PHE C CZ  1 
ATOM   1294  N N   . GLY A 1 172 ? 79.209  30.726  -12.444 1.00 41.46  ? 191 GLY C N   1 
ATOM   1295  C CA  . GLY A 1 172 ? 78.114  30.302  -13.298 1.00 39.45  ? 191 GLY C CA  1 
ATOM   1296  C C   . GLY A 1 172 ? 76.974  31.288  -13.313 1.00 37.76  ? 191 GLY C C   1 
ATOM   1297  O O   . GLY A 1 172 ? 76.593  31.811  -12.271 1.00 46.80  ? 191 GLY C O   1 
ATOM   1298  N N   . ILE A 1 173 ? 76.444  31.554  -14.504 1.00 35.28  ? 192 ILE C N   1 
ATOM   1299  C CA  . ILE A 1 173 ? 75.319  32.464  -14.684 1.00 33.75  ? 192 ILE C CA  1 
ATOM   1300  C C   . ILE A 1 173 ? 74.107  31.618  -15.047 1.00 35.80  ? 192 ILE C C   1 
ATOM   1301  O O   . ILE A 1 173 ? 74.262  30.619  -15.741 1.00 32.85  ? 192 ILE C O   1 
ATOM   1302  C CB  . ILE A 1 173 ? 75.605  33.486  -15.805 1.00 31.76  ? 192 ILE C CB  1 
ATOM   1303  C CG1 . ILE A 1 173 ? 76.912  34.230  -15.542 1.00 32.68  ? 192 ILE C CG1 1 
ATOM   1304  C CG2 . ILE A 1 173 ? 74.449  34.492  -15.971 1.00 30.56  ? 192 ILE C CG2 1 
ATOM   1305  C CD1 . ILE A 1 173 ? 76.845  35.148  -14.375 1.00 34.01  ? 192 ILE C CD1 1 
ATOM   1306  N N   . PRO A 1 174 ? 72.906  31.975  -14.526 1.00 35.89  ? 193 PRO C N   1 
ATOM   1307  C CA  . PRO A 1 174 ? 71.654  31.306  -14.904 1.00 35.29  ? 193 PRO C CA  1 
ATOM   1308  C C   . PRO A 1 174 ? 71.035  31.902  -16.162 1.00 32.63  ? 193 PRO C C   1 
ATOM   1309  O O   . PRO A 1 174 ? 71.350  33.029  -16.551 1.00 29.24  ? 193 PRO C O   1 
ATOM   1310  C CB  . PRO A 1 174 ? 70.747  31.587  -13.711 1.00 34.51  ? 193 PRO C CB  1 
ATOM   1311  C CG  . PRO A 1 174 ? 71.189  32.878  -13.253 1.00 34.63  ? 193 PRO C CG  1 
ATOM   1312  C CD  . PRO A 1 174 ? 72.680  32.896  -13.399 1.00 34.60  ? 193 PRO C CD  1 
ATOM   1313  N N   . CYS A 1 175 ? 70.127  31.142  -16.767 1.00 32.06  ? 194 CYS C N   1 
ATOM   1314  C CA  . CYS A 1 175 ? 69.558  31.502  -18.061 1.00 29.66  ? 194 CYS C CA  1 
ATOM   1315  C C   . CYS A 1 175 ? 68.095  31.908  -17.977 1.00 29.51  ? 194 CYS C C   1 
ATOM   1316  O O   . CYS A 1 175 ? 67.426  31.555  -17.042 1.00 31.43  ? 194 CYS C O   1 
ATOM   1317  C CB  . CYS A 1 175 ? 69.764  30.354  -19.053 1.00 27.19  ? 194 CYS C CB  1 
ATOM   1318  S SG  . CYS A 1 175 ? 69.101  28.754  -18.577 1.00 39.76  ? 194 CYS C SG  1 
ATOM   1319  N N   . THR A 1 176 ? 67.611  32.685  -18.935 1.00 28.05  ? 195 THR C N   1 
ATOM   1320  C CA  . THR A 1 176 ? 66.173  32.990  -19.030 1.00 28.21  ? 195 THR C CA  1 
ATOM   1321  C C   . THR A 1 176 ? 65.625  32.428  -20.317 1.00 27.23  ? 195 THR C C   1 
ATOM   1322  O O   . THR A 1 176 ? 66.328  32.329  -21.314 1.00 26.30  ? 195 THR C O   1 
ATOM   1323  C CB  . THR A 1 176 ? 65.869  34.494  -19.031 1.00 27.81  ? 195 THR C CB  1 
ATOM   1324  O OG1 . THR A 1 176 ? 66.718  35.130  -18.089 1.00 28.94  ? 195 THR C OG1 1 
ATOM   1325  C CG2 . THR A 1 176 ? 64.450  34.759  -18.603 1.00 28.84  ? 195 THR C CG2 1 
ATOM   1326  N N   . ASP A 1 177 ? 64.362  32.053  -20.296 1.00 27.83  ? 196 ASP C N   1 
ATOM   1327  C CA  . ASP A 1 177 ? 63.745  31.591  -21.512 1.00 26.95  ? 196 ASP C CA  1 
ATOM   1328  C C   . ASP A 1 177 ? 62.270  31.937  -21.592 1.00 26.93  ? 196 ASP C C   1 
ATOM   1329  O O   . ASP A 1 177 ? 61.621  32.217  -20.604 1.00 28.38  ? 196 ASP C O   1 
ATOM   1330  C CB  . ASP A 1 177 ? 64.041  30.112  -21.755 1.00 27.91  ? 196 ASP C CB  1 
ATOM   1331  C CG  . ASP A 1 177 ? 63.363  29.223  -20.794 1.00 30.84  ? 196 ASP C CG  1 
ATOM   1332  O OD1 . ASP A 1 177 ? 63.169  29.644  -19.632 1.00 33.01  ? 196 ASP C OD1 1 
ATOM   1333  O OD2 . ASP A 1 177 ? 63.026  28.083  -21.176 1.00 31.63  ? 196 ASP C OD2 1 
ATOM   1334  N N   . LYS A 1 178 ? 61.769  31.973  -22.810 1.00 25.85  ? 197 LYS C N   1 
ATOM   1335  C CA  . LYS A 1 178 ? 60.411  32.397  -23.091 1.00 24.50  ? 197 LYS C CA  1 
ATOM   1336  C C   . LYS A 1 178 ? 60.003  31.546  -24.279 1.00 24.92  ? 197 LYS C C   1 
ATOM   1337  O O   . LYS A 1 178 ? 60.800  31.352  -25.192 1.00 23.72  ? 197 LYS C O   1 
ATOM   1338  C CB  . LYS A 1 178 ? 60.414  33.875  -23.448 1.00 23.94  ? 197 LYS C CB  1 
ATOM   1339  C CG  . LYS A 1 178 ? 59.106  34.560  -23.326 1.00 25.03  ? 197 LYS C CG  1 
ATOM   1340  C CD  . LYS A 1 178 ? 59.280  36.077  -23.376 1.00 29.36  ? 197 LYS C CD  1 
ATOM   1341  C CE  . LYS A 1 178 ? 57.938  36.827  -23.393 1.00 30.91  ? 197 LYS C CE  1 
ATOM   1342  N NZ  . LYS A 1 178 ? 57.098  36.638  -22.153 1.00 33.02  ? 197 LYS C NZ  1 
ATOM   1343  N N   . PHE A 1 179 ? 58.810  30.963  -24.242 1.00 25.89  ? 198 PHE C N   1 
ATOM   1344  C CA  . PHE A 1 179 ? 58.250  30.382  -25.458 1.00 25.76  ? 198 PHE C CA  1 
ATOM   1345  C C   . PHE A 1 179 ? 57.338  31.422  -26.097 1.00 25.86  ? 198 PHE C C   1 
ATOM   1346  O O   . PHE A 1 179 ? 56.471  31.989  -25.426 1.00 25.98  ? 198 PHE C O   1 
ATOM   1347  C CB  . PHE A 1 179 ? 57.489  29.103  -25.173 1.00 26.38  ? 198 PHE C CB  1 
ATOM   1348  C CG  . PHE A 1 179 ? 58.363  27.911  -24.976 1.00 26.61  ? 198 PHE C CG  1 
ATOM   1349  C CD1 . PHE A 1 179 ? 58.745  27.128  -26.066 1.00 26.10  ? 198 PHE C CD1 1 
ATOM   1350  C CD2 . PHE A 1 179 ? 58.791  27.552  -23.715 1.00 27.72  ? 198 PHE C CD2 1 
ATOM   1351  C CE1 . PHE A 1 179 ? 59.531  26.005  -25.897 1.00 26.71  ? 198 PHE C CE1 1 
ATOM   1352  C CE2 . PHE A 1 179 ? 59.597  26.433  -23.526 1.00 28.32  ? 198 PHE C CE2 1 
ATOM   1353  C CZ  . PHE A 1 179 ? 59.968  25.658  -24.607 1.00 36.09  ? 198 PHE C CZ  1 
ATOM   1354  N N   . VAL A 1 180 ? 57.560  31.694  -27.382 1.00 24.92  ? 199 VAL C N   1 
ATOM   1355  C CA  . VAL A 1 180 ? 56.743  32.673  -28.119 1.00 25.27  ? 199 VAL C CA  1 
ATOM   1356  C C   . VAL A 1 180 ? 55.888  32.068  -29.246 1.00 24.53  ? 199 VAL C C   1 
ATOM   1357  O O   . VAL A 1 180 ? 56.246  31.071  -29.851 1.00 28.40  ? 199 VAL C O   1 
ATOM   1358  C CB  . VAL A 1 180 ? 57.605  33.837  -28.681 1.00 23.11  ? 199 VAL C CB  1 
ATOM   1359  C CG1 . VAL A 1 180 ? 58.251  34.605  -27.545 1.00 23.04  ? 199 VAL C CG1 1 
ATOM   1360  C CG2 . VAL A 1 180 ? 58.666  33.304  -29.627 1.00 22.09  ? 199 VAL C CG2 1 
ATOM   1361  N N   . VAL A 1 181 ? 54.738  32.679  -29.497 1.00 25.57  ? 200 VAL C N   1 
ATOM   1362  C CA  . VAL A 1 181 ? 53.983  32.458  -30.721 1.00 26.13  ? 200 VAL C CA  1 
ATOM   1363  C C   . VAL A 1 181 ? 54.192  33.682  -31.581 1.00 28.49  ? 200 VAL C C   1 
ATOM   1364  O O   . VAL A 1 181 ? 53.870  34.795  -31.164 1.00 26.49  ? 200 VAL C O   1 
ATOM   1365  C CB  . VAL A 1 181 ? 52.506  32.322  -30.458 1.00 27.93  ? 200 VAL C CB  1 
ATOM   1366  C CG1 . VAL A 1 181 ? 51.755  32.377  -31.754 1.00 28.67  ? 200 VAL C CG1 1 
ATOM   1367  C CG2 . VAL A 1 181 ? 52.231  31.033  -29.748 1.00 28.65  ? 200 VAL C CG2 1 
ATOM   1368  N N   . PHE A 1 182 ? 54.756  33.477  -32.770 1.00 25.35  ? 201 PHE C N   1 
ATOM   1369  C CA  . PHE A 1 182 ? 55.146  34.588  -33.615 1.00 25.38  ? 201 PHE C CA  1 
ATOM   1370  C C   . PHE A 1 182 ? 53.975  35.504  -33.952 1.00 33.65  ? 201 PHE C C   1 
ATOM   1371  O O   . PHE A 1 182 ? 54.128  36.728  -33.939 1.00 34.01  ? 201 PHE C O   1 
ATOM   1372  C CB  . PHE A 1 182 ? 55.827  34.083  -34.874 1.00 25.09  ? 201 PHE C CB  1 
ATOM   1373  C CG  . PHE A 1 182 ? 57.153  33.440  -34.630 1.00 23.85  ? 201 PHE C CG  1 
ATOM   1374  C CD1 . PHE A 1 182 ? 58.062  34.020  -33.761 1.00 23.00  ? 201 PHE C CD1 1 
ATOM   1375  C CD2 . PHE A 1 182 ? 57.484  32.252  -35.246 1.00 23.83  ? 201 PHE C CD2 1 
ATOM   1376  C CE1 . PHE A 1 182 ? 59.264  33.438  -33.521 1.00 22.14  ? 201 PHE C CE1 1 
ATOM   1377  C CE2 . PHE A 1 182 ? 58.687  31.665  -35.013 1.00 23.05  ? 201 PHE C CE2 1 
ATOM   1378  C CZ  . PHE A 1 182 ? 59.577  32.254  -34.157 1.00 22.19  ? 201 PHE C CZ  1 
ATOM   1379  N N   . SER A 1 183 ? 52.802  34.933  -34.216 1.00 28.10  ? 202 SER C N   1 
ATOM   1380  C CA  . SER A 1 183 ? 51.657  35.757  -34.546 1.00 29.93  ? 202 SER C CA  1 
ATOM   1381  C C   . SER A 1 183 ? 51.318  36.732  -33.415 1.00 32.13  ? 202 SER C C   1 
ATOM   1382  O O   . SER A 1 183 ? 50.862  37.847  -33.663 1.00 33.74  ? 202 SER C O   1 
ATOM   1383  C CB  . SER A 1 183 ? 50.446  34.899  -34.929 1.00 31.26  ? 202 SER C CB  1 
ATOM   1384  O OG  . SER A 1 183 ? 49.732  34.394  -33.819 1.00 31.84  ? 202 SER C OG  1 
ATOM   1385  N N   . GLN A 1 184 ? 51.590  36.324  -32.176 1.00 31.32  ? 203 GLN C N   1 
ATOM   1386  C CA  . GLN A 1 184 ? 51.199  37.094  -30.984 1.00 32.37  ? 203 GLN C CA  1 
ATOM   1387  C C   . GLN A 1 184 ? 52.229  38.099  -30.473 1.00 30.17  ? 203 GLN C C   1 
ATOM   1388  O O   . GLN A 1 184 ? 51.962  38.810  -29.519 1.00 31.22  ? 203 GLN C O   1 
ATOM   1389  C CB  . GLN A 1 184 ? 50.818  36.156  -29.843 1.00 31.19  ? 203 GLN C CB  1 
ATOM   1390  C CG  . GLN A 1 184 ? 49.801  35.114  -30.228 1.00 36.75  ? 203 GLN C CG  1 
ATOM   1391  C CD  . GLN A 1 184 ? 48.487  35.737  -30.666 1.00 39.03  ? 203 GLN C CD  1 
ATOM   1392  O OE1 . GLN A 1 184 ? 47.775  36.358  -29.862 1.00 40.87  ? 203 GLN C OE1 1 
ATOM   1393  N NE2 . GLN A 1 184 ? 48.175  35.607  -31.954 1.00 39.14  ? 203 GLN C NE2 1 
ATOM   1394  N N   . ILE A 1 185 ? 53.407  38.143  -31.089 1.00 30.79  ? 204 ILE C N   1 
ATOM   1395  C CA  . ILE A 1 185 ? 54.427  39.116  -30.693 1.00 28.18  ? 204 ILE C CA  1 
ATOM   1396  C C   . ILE A 1 185 ? 54.775  40.057  -31.834 1.00 28.68  ? 204 ILE C C   1 
ATOM   1397  O O   . ILE A 1 185 ? 55.693  40.845  -31.718 1.00 28.47  ? 204 ILE C O   1 
ATOM   1398  C CB  . ILE A 1 185 ? 55.745  38.442  -30.204 1.00 29.34  ? 204 ILE C CB  1 
ATOM   1399  C CG1 . ILE A 1 185 ? 56.391  37.634  -31.356 1.00 28.26  ? 204 ILE C CG1 1 
ATOM   1400  C CG2 . ILE A 1 185 ? 55.500  37.610  -28.961 1.00 26.20  ? 204 ILE C CG2 1 
ATOM   1401  C CD1 . ILE A 1 185 ? 57.651  36.889  -30.998 1.00 23.67  ? 204 ILE C CD1 1 
ATOM   1402  N N   . GLU A 1 186 ? 54.047  39.966  -32.940 1.00 29.63  ? 205 GLU C N   1 
ATOM   1403  C CA  . GLU A 1 186 ? 54.349  40.782  -34.114 1.00 31.83  ? 205 GLU C CA  1 
ATOM   1404  C C   . GLU A 1 186 ? 53.866  42.220  -33.963 1.00 32.67  ? 205 GLU C C   1 
ATOM   1405  O O   . GLU A 1 186 ? 52.731  42.462  -33.544 1.00 34.16  ? 205 GLU C O   1 
ATOM   1406  C CB  . GLU A 1 186 ? 53.745  40.155  -35.387 1.00 31.17  ? 205 GLU C CB  1 
ATOM   1407  C CG  . GLU A 1 186 ? 54.067  40.886  -36.726 1.00 32.51  ? 205 GLU C CG  1 
ATOM   1408  C CD  . GLU A 1 186 ? 53.525  40.128  -37.931 1.00 33.21  ? 205 GLU C CD  1 
ATOM   1409  O OE1 . GLU A 1 186 ? 52.368  39.687  -37.836 1.00 33.92  ? 205 GLU C OE1 1 
ATOM   1410  O OE2 . GLU A 1 186 ? 54.245  39.932  -38.949 1.00 33.65  ? 205 GLU C OE2 1 
ATOM   1411  N N   . ILE A 1 187 ? 54.750  43.162  -34.288 1.00 33.95  ? 206 ILE C N   1 
ATOM   1412  C CA  . ILE A 1 187 ? 54.347  44.532  -34.599 1.00 36.71  ? 206 ILE C CA  1 
ATOM   1413  C C   . ILE A 1 187 ? 54.006  44.655  -36.079 1.00 38.75  ? 206 ILE C C   1 
ATOM   1414  O O   . ILE A 1 187 ? 54.912  44.714  -36.934 1.00 38.97  ? 206 ILE C O   1 
ATOM   1415  C CB  . ILE A 1 187 ? 55.464  45.523  -34.353 1.00 36.73  ? 206 ILE C CB  1 
ATOM   1416  C CG1 . ILE A 1 187 ? 55.936  45.439  -32.904 1.00 35.38  ? 206 ILE C CG1 1 
ATOM   1417  C CG2 . ILE A 1 187 ? 55.003  46.922  -34.742 1.00 39.66  ? 206 ILE C CG2 1 
ATOM   1418  C CD1 . ILE A 1 187 ? 57.327  45.987  -32.712 1.00 34.13  ? 206 ILE C CD1 1 
ATOM   1419  N N   . LEU A 1 188 ? 52.703  44.699  -36.362 1.00 40.55  ? 207 LEU C N   1 
ATOM   1420  C CA  . LEU A 1 188 ? 52.179  44.757  -37.724 1.00 40.85  ? 207 LEU C CA  1 
ATOM   1421  C C   . LEU A 1 188 ? 52.716  45.946  -38.496 1.00 43.03  ? 207 LEU C C   1 
ATOM   1422  O O   . LEU A 1 188 ? 52.649  47.078  -38.027 1.00 44.76  ? 207 LEU C O   1 
ATOM   1423  C CB  . LEU A 1 188 ? 50.658  44.806  -37.697 1.00 42.87  ? 207 LEU C CB  1 
ATOM   1424  C CG  . LEU A 1 188 ? 49.939  43.584  -37.150 1.00 41.49  ? 207 LEU C CG  1 
ATOM   1425  C CD1 . LEU A 1 188 ? 48.451  43.832  -37.249 1.00 44.19  ? 207 LEU C CD1 1 
ATOM   1426  C CD2 . LEU A 1 188 ? 50.323  42.354  -37.928 1.00 39.77  ? 207 LEU C CD2 1 
ATOM   1427  N N   . THR A 1 189 ? 53.278  45.692  -39.673 1.00 43.27  ? 208 THR C N   1 
ATOM   1428  C CA  . THR A 1 189 ? 53.662  46.794  -40.552 1.00 46.05  ? 208 THR C CA  1 
ATOM   1429  C C   . THR A 1 189 ? 52.386  47.411  -41.139 1.00 49.45  ? 208 THR C C   1 
ATOM   1430  O O   . THR A 1 189 ? 51.456  46.695  -41.510 1.00 49.61  ? 208 THR C O   1 
ATOM   1431  C CB  . THR A 1 189 ? 54.562  46.319  -41.686 1.00 45.89  ? 208 THR C CB  1 
ATOM   1432  O OG1 . THR A 1 189 ? 53.757  45.690  -42.693 1.00 56.04  ? 208 THR C OG1 1 
ATOM   1433  C CG2 . THR A 1 189 ? 55.541  45.333  -41.174 1.00 42.51  ? 208 THR C CG2 1 
ATOM   1434  N N   . PRO A 1 190 ? 52.325  48.744  -41.194 1.00 52.44  ? 209 PRO C N   1 
ATOM   1435  C CA  . PRO A 1 190 ? 51.212  49.436  -41.850 1.00 56.30  ? 209 PRO C CA  1 
ATOM   1436  C C   . PRO A 1 190 ? 51.123  49.024  -43.313 1.00 57.75  ? 209 PRO C C   1 
ATOM   1437  O O   . PRO A 1 190 ? 52.159  48.959  -43.979 1.00 57.55  ? 209 PRO C O   1 
ATOM   1438  C CB  . PRO A 1 190 ? 51.622  50.908  -41.766 1.00 59.23  ? 209 PRO C CB  1 
ATOM   1439  C CG  . PRO A 1 190 ? 52.587  50.972  -40.616 1.00 56.56  ? 209 PRO C CG  1 
ATOM   1440  C CD  . PRO A 1 190 ? 53.320  49.675  -40.635 1.00 52.66  ? 209 PRO C CD  1 
ATOM   1441  N N   . PRO A 1 191 ? 49.908  48.736  -43.809 1.00 59.44  ? 210 PRO C N   1 
ATOM   1442  C CA  . PRO A 1 191 ? 49.727  48.415  -45.231 1.00 64.69  ? 210 PRO C CA  1 
ATOM   1443  C C   . PRO A 1 191 ? 50.262  49.507  -46.152 1.00 68.39  ? 210 PRO C C   1 
ATOM   1444  O O   . PRO A 1 191 ? 50.152  50.684  -45.822 1.00 67.55  ? 210 PRO C O   1 
ATOM   1445  C CB  . PRO A 1 191 ? 48.202  48.290  -45.381 1.00 63.49  ? 210 PRO C CB  1 
ATOM   1446  C CG  . PRO A 1 191 ? 47.624  48.861  -44.124 1.00 64.94  ? 210 PRO C CG  1 
ATOM   1447  C CD  . PRO A 1 191 ? 48.645  48.640  -43.061 1.00 59.76  ? 210 PRO C CD  1 
ATOM   1448  N N   . ASN A 1 192 ? 50.860  49.106  -47.271 1.00 69.13  ? 211 ASN C N   1 
ATOM   1449  C CA  . ASN A 1 192 ? 51.307  50.038  -48.308 1.00 73.45  ? 211 ASN C CA  1 
ATOM   1450  C C   . ASN A 1 192 ? 50.204  50.297  -49.361 1.00 77.79  ? 211 ASN C C   1 
ATOM   1451  O O   . ASN A 1 192 ? 49.778  49.382  -50.075 1.00 77.37  ? 211 ASN C O   1 
ATOM   1452  C CB  . ASN A 1 192 ? 52.613  49.531  -48.953 1.00 72.66  ? 211 ASN C CB  1 
ATOM   1453  C CG  . ASN A 1 192 ? 53.004  50.313  -50.220 1.00 77.77  ? 211 ASN C CG  1 
ATOM   1454  O OD1 . ASN A 1 192 ? 52.715  51.508  -50.348 1.00 81.68  ? 211 ASN C OD1 1 
ATOM   1455  N ND2 . ASN A 1 192 ? 53.664  49.629  -51.160 1.00 77.96  ? 211 ASN C ND2 1 
ATOM   1456  N N   . MET A 1 193 ? 49.758  51.553  -49.452 1.00 65.52  ? 212 MET C N   1 
ATOM   1457  C CA  . MET A 1 193 ? 48.582  51.930  -50.264 1.00 67.49  ? 212 MET C CA  1 
ATOM   1458  C C   . MET A 1 193 ? 48.846  52.740  -51.544 1.00 69.57  ? 212 MET C C   1 
ATOM   1459  O O   . MET A 1 193 ? 49.643  53.672  -51.546 1.00 70.39  ? 212 MET C O   1 
ATOM   1460  C CB  . MET A 1 193 ? 47.573  52.695  -49.399 1.00 68.59  ? 212 MET C CB  1 
ATOM   1461  C CG  . MET A 1 193 ? 46.440  53.320  -50.178 1.00 70.37  ? 212 MET C CG  1 
ATOM   1462  S SD  . MET A 1 193 ? 45.194  54.074  -49.128 1.00 103.43 ? 212 MET C SD  1 
ATOM   1463  C CE  . MET A 1 193 ? 44.312  52.651  -48.502 1.00 67.30  ? 212 MET C CE  1 
ATOM   1464  N N   . THR A 1 194 ? 48.153  52.365  -52.622 1.00 70.92  ? 213 THR C N   1 
ATOM   1465  C CA  . THR A 1 194 ? 48.139  53.123  -53.879 1.00 73.44  ? 213 THR C CA  1 
ATOM   1466  C C   . THR A 1 194 ? 46.721  53.625  -54.209 1.00 75.43  ? 213 THR C C   1 
ATOM   1467  O O   . THR A 1 194 ? 45.719  53.094  -53.714 1.00 75.37  ? 213 THR C O   1 
ATOM   1468  C CB  . THR A 1 194 ? 48.631  52.264  -55.082 1.00 72.71  ? 213 THR C CB  1 
ATOM   1469  O OG1 . THR A 1 194 ? 49.659  51.357  -54.662 1.00 70.85  ? 213 THR C OG1 1 
ATOM   1470  C CG2 . THR A 1 194 ? 49.148  53.152  -56.223 1.00 74.73  ? 213 THR C CG2 1 
ATOM   1471  N N   . ALA A 1 195 ? 46.642  54.646  -55.055 1.00 77.24  ? 214 ALA C N   1 
ATOM   1472  C CA  . ALA A 1 195 ? 45.361  55.130  -55.555 1.00 78.82  ? 214 ALA C CA  1 
ATOM   1473  C C   . ALA A 1 195 ? 45.407  55.213  -57.091 1.00 80.54  ? 214 ALA C C   1 
ATOM   1474  O O   . ALA A 1 195 ? 46.484  55.060  -57.687 1.00 80.51  ? 214 ALA C O   1 
ATOM   1475  C CB  . ALA A 1 195 ? 45.022  56.483  -54.929 1.00 79.98  ? 214 ALA C CB  1 
ATOM   1476  N N   . LYS A 1 196 ? 44.244  55.437  -57.719 1.00 82.30  ? 215 LYS C N   1 
ATOM   1477  C CA  . LYS A 1 196 ? 44.129  55.530  -59.178 1.00 83.61  ? 215 LYS C CA  1 
ATOM   1478  C C   . LYS A 1 196 ? 44.026  56.987  -59.634 1.00 78.40  ? 215 LYS C C   1 
ATOM   1479  O O   . LYS A 1 196 ? 42.932  57.542  -59.746 1.00 79.88  ? 215 LYS C O   1 
ATOM   1480  C CB  . LYS A 1 196 ? 42.920  54.730  -59.687 1.00 77.00  ? 215 LYS C CB  1 
ATOM   1481  C CG  . LYS A 1 196 ? 43.049  54.258  -61.152 1.00 81.93  ? 215 LYS C CG  1 
ATOM   1482  C CD  . LYS A 1 196 ? 41.701  54.198  -61.913 1.00 83.87  ? 215 LYS C CD  1 
ATOM   1483  C CE  . LYS A 1 196 ? 41.905  54.194  -63.442 1.00 81.54  ? 215 LYS C CE  1 
ATOM   1484  N NZ  . LYS A 1 196 ? 40.634  54.284  -64.230 1.00 83.73  ? 215 LYS C NZ  1 
ATOM   1485  N N   . SER A 1 202 ? 39.267  57.646  -57.868 1.00 94.98  ? 221 SER C N   1 
ATOM   1486  C CA  . SER A 1 202 ? 40.327  56.909  -57.163 1.00 92.43  ? 221 SER C CA  1 
ATOM   1487  C C   . SER A 1 202 ? 39.866  55.566  -56.599 1.00 91.01  ? 221 SER C C   1 
ATOM   1488  O O   . SER A 1 202 ? 39.067  55.508  -55.663 1.00 91.54  ? 221 SER C O   1 
ATOM   1489  C CB  . SER A 1 202 ? 40.962  57.755  -56.041 1.00 92.17  ? 221 SER C CB  1 
ATOM   1490  O OG  . SER A 1 202 ? 41.699  58.859  -56.557 1.00 93.02  ? 221 SER C OG  1 
ATOM   1491  N N   . PHE A 1 203 ? 40.368  54.492  -57.202 1.00 89.35  ? 222 PHE C N   1 
ATOM   1492  C CA  . PHE A 1 203 ? 40.260  53.152  -56.638 1.00 87.64  ? 222 PHE C CA  1 
ATOM   1493  C C   . PHE A 1 203 ? 41.525  52.921  -55.826 1.00 85.24  ? 222 PHE C C   1 
ATOM   1494  O O   . PHE A 1 203 ? 42.632  53.075  -56.340 1.00 84.47  ? 222 PHE C O   1 
ATOM   1495  C CB  . PHE A 1 203 ? 40.174  52.090  -57.740 1.00 87.41  ? 222 PHE C CB  1 
ATOM   1496  C CG  . PHE A 1 203 ? 38.838  52.027  -58.433 1.00 89.23  ? 222 PHE C CG  1 
ATOM   1497  C CD1 . PHE A 1 203 ? 37.869  51.120  -58.021 1.00 89.74  ? 222 PHE C CD1 1 
ATOM   1498  C CD2 . PHE A 1 203 ? 38.556  52.861  -59.514 1.00 90.58  ? 222 PHE C CD2 1 
ATOM   1499  C CE1 . PHE A 1 203 ? 36.635  51.059  -58.668 1.00 92.15  ? 222 PHE C CE1 1 
ATOM   1500  C CE2 . PHE A 1 203 ? 37.331  52.803  -60.160 1.00 92.64  ? 222 PHE C CE2 1 
ATOM   1501  C CZ  . PHE A 1 203 ? 36.371  51.903  -59.736 1.00 93.55  ? 222 PHE C CZ  1 
ATOM   1502  N N   . MET A 1 204 ? 41.372  52.559  -54.559 1.00 84.36  ? 223 MET C N   1 
ATOM   1503  C CA  . MET A 1 204 ? 42.532  52.347  -53.705 1.00 81.96  ? 223 MET C CA  1 
ATOM   1504  C C   . MET A 1 204 ? 42.819  50.865  -53.537 1.00 79.90  ? 223 MET C C   1 
ATOM   1505  O O   . MET A 1 204 ? 41.920  50.083  -53.241 1.00 80.22  ? 223 MET C O   1 
ATOM   1506  C CB  . MET A 1 204 ? 42.321  53.015  -52.347 1.00 82.09  ? 223 MET C CB  1 
ATOM   1507  C CG  . MET A 1 204 ? 42.272  54.536  -52.412 1.00 83.84  ? 223 MET C CG  1 
ATOM   1508  S SD  . MET A 1 204 ? 41.833  55.295  -50.832 1.00 94.21  ? 223 MET C SD  1 
ATOM   1509  C CE  . MET A 1 204 ? 40.061  55.487  -50.998 1.00 77.17  ? 223 MET C CE  1 
ATOM   1510  N N   . HIS A 1 205 ? 44.069  50.478  -53.764 1.00 77.97  ? 224 HIS C N   1 
ATOM   1511  C CA  . HIS A 1 205 ? 44.525  49.129  -53.421 1.00 75.77  ? 224 HIS C CA  1 
ATOM   1512  C C   . HIS A 1 205 ? 45.694  49.209  -52.434 1.00 73.26  ? 224 HIS C C   1 
ATOM   1513  O O   . HIS A 1 205 ? 46.484  50.155  -52.464 1.00 73.06  ? 224 HIS C O   1 
ATOM   1514  C CB  . HIS A 1 205 ? 44.916  48.319  -54.673 1.00 75.98  ? 224 HIS C CB  1 
ATOM   1515  C CG  . HIS A 1 205 ? 45.183  46.865  -54.396 1.00 74.75  ? 224 HIS C CG  1 
ATOM   1516  N ND1 . HIS A 1 205 ? 44.239  45.877  -54.601 1.00 75.75  ? 224 HIS C ND1 1 
ATOM   1517  C CD2 . HIS A 1 205 ? 46.282  46.233  -53.918 1.00 72.88  ? 224 HIS C CD2 1 
ATOM   1518  C CE1 . HIS A 1 205 ? 44.747  44.703  -54.270 1.00 74.43  ? 224 HIS C CE1 1 
ATOM   1519  N NE2 . HIS A 1 205 ? 45.986  44.890  -53.851 1.00 72.62  ? 224 HIS C NE2 1 
ATOM   1520  N N   . TRP A 1 206 ? 45.792  48.224  -51.549 1.00 71.78  ? 225 TRP C N   1 
ATOM   1521  C CA  . TRP A 1 206 ? 46.927  48.152  -50.626 1.00 70.09  ? 225 TRP C CA  1 
ATOM   1522  C C   . TRP A 1 206 ? 47.464  46.743  -50.444 1.00 68.27  ? 225 TRP C C   1 
ATOM   1523  O O   . TRP A 1 206 ? 46.736  45.762  -50.594 1.00 68.68  ? 225 TRP C O   1 
ATOM   1524  C CB  . TRP A 1 206 ? 46.584  48.764  -49.263 1.00 70.19  ? 225 TRP C CB  1 
ATOM   1525  C CG  . TRP A 1 206 ? 45.354  48.194  -48.570 1.00 61.11  ? 225 TRP C CG  1 
ATOM   1526  C CD1 . TRP A 1 206 ? 45.318  47.175  -47.664 1.00 59.88  ? 225 TRP C CD1 1 
ATOM   1527  C CD2 . TRP A 1 206 ? 43.994  48.635  -48.722 1.00 67.87  ? 225 TRP C CD2 1 
ATOM   1528  N NE1 . TRP A 1 206 ? 44.028  46.951  -47.244 1.00 61.37  ? 225 TRP C NE1 1 
ATOM   1529  C CE2 . TRP A 1 206 ? 43.198  47.838  -47.875 1.00 68.02  ? 225 TRP C CE2 1 
ATOM   1530  C CE3 . TRP A 1 206 ? 43.372  49.623  -49.498 1.00 65.39  ? 225 TRP C CE3 1 
ATOM   1531  C CZ2 . TRP A 1 206 ? 41.817  48.001  -47.782 1.00 70.40  ? 225 TRP C CZ2 1 
ATOM   1532  C CZ3 . TRP A 1 206 ? 42.016  49.794  -49.388 1.00 67.54  ? 225 TRP C CZ3 1 
ATOM   1533  C CH2 . TRP A 1 206 ? 41.249  48.986  -48.545 1.00 67.91  ? 225 TRP C CH2 1 
ATOM   1534  N N   . LYS A 1 207 ? 48.753  46.649  -50.132 1.00 66.42  ? 226 LYS C N   1 
ATOM   1535  C CA  . LYS A 1 207 ? 49.363  45.371  -49.762 1.00 64.30  ? 226 LYS C CA  1 
ATOM   1536  C C   . LYS A 1 207 ? 49.550  45.277  -48.246 1.00 62.81  ? 226 LYS C C   1 
ATOM   1537  O O   . LYS A 1 207 ? 49.612  46.281  -47.542 1.00 63.21  ? 226 LYS C O   1 
ATOM   1538  C CB  . LYS A 1 207 ? 50.708  45.181  -50.464 1.00 63.89  ? 226 LYS C CB  1 
ATOM   1539  C CG  . LYS A 1 207 ? 50.653  45.319  -51.985 1.00 65.71  ? 226 LYS C CG  1 
ATOM   1540  C CD  . LYS A 1 207 ? 49.896  44.159  -52.651 1.00 66.23  ? 226 LYS C CD  1 
ATOM   1541  C CE  . LYS A 1 207 ? 50.192  44.100  -54.148 1.00 67.68  ? 226 LYS C CE  1 
ATOM   1542  N NZ  . LYS A 1 207 ? 51.656  43.960  -54.437 1.00 67.18  ? 226 LYS C NZ  1 
ATOM   1543  N N   . MET A 1 208 ? 49.653  44.058  -47.745 1.00 61.50  ? 227 MET C N   1 
ATOM   1544  C CA  . MET A 1 208 ? 49.798  43.834  -46.322 1.00 59.90  ? 227 MET C CA  1 
ATOM   1545  C C   . MET A 1 208 ? 50.557  42.532  -46.139 1.00 57.82  ? 227 MET C C   1 
ATOM   1546  O O   . MET A 1 208 ? 50.023  41.459  -46.403 1.00 57.50  ? 227 MET C O   1 
ATOM   1547  C CB  . MET A 1 208 ? 48.413  43.768  -45.683 1.00 52.52  ? 227 MET C CB  1 
ATOM   1548  C CG  . MET A 1 208 ? 48.414  43.549  -44.194 1.00 57.72  ? 227 MET C CG  1 
ATOM   1549  S SD  . MET A 1 208 ? 49.187  44.880  -43.261 1.00 61.79  ? 227 MET C SD  1 
ATOM   1550  C CE  . MET A 1 208 ? 49.170  44.150  -41.631 1.00 50.36  ? 227 MET C CE  1 
ATOM   1551  N N   . ARG A 1 209 ? 51.813  42.642  -45.707 1.00 56.68  ? 228 ARG C N   1 
ATOM   1552  C CA  . ARG A 1 209 ? 52.669  41.482  -45.462 1.00 54.94  ? 228 ARG C CA  1 
ATOM   1553  C C   . ARG A 1 209 ? 52.727  41.134  -43.984 1.00 53.44  ? 228 ARG C C   1 
ATOM   1554  O O   . ARG A 1 209 ? 52.806  42.016  -43.147 1.00 53.39  ? 228 ARG C O   1 
ATOM   1555  C CB  . ARG A 1 209 ? 54.091  41.731  -45.968 1.00 54.72  ? 228 ARG C CB  1 
ATOM   1556  C CG  . ARG A 1 209 ? 54.198  42.707  -47.138 1.00 56.75  ? 228 ARG C CG  1 
ATOM   1557  C CD  . ARG A 1 209 ? 55.447  42.461  -47.997 1.00 57.90  ? 228 ARG C CD  1 
ATOM   1558  N NE  . ARG A 1 209 ? 56.726  42.573  -47.276 1.00 57.95  ? 228 ARG C NE  1 
ATOM   1559  C CZ  . ARG A 1 209 ? 57.490  41.539  -46.903 1.00 57.31  ? 228 ARG C CZ  1 
ATOM   1560  N NH1 . ARG A 1 209 ? 57.117  40.279  -47.160 1.00 56.99  ? 228 ARG C NH1 1 
ATOM   1561  N NH2 . ARG A 1 209 ? 58.632  41.766  -46.260 1.00 56.95  ? 228 ARG C NH2 1 
ATOM   1562  N N   . SER A 1 210 ? 52.666  39.835  -43.697 1.00 52.76  ? 229 SER C N   1 
ATOM   1563  C CA  . SER A 1 210 ? 52.929  39.231  -42.391 1.00 43.10  ? 229 SER C CA  1 
ATOM   1564  C C   . SER A 1 210 ? 53.027  37.734  -42.593 1.00 42.43  ? 229 SER C C   1 
ATOM   1565  O O   . SER A 1 210 ? 52.234  37.164  -43.338 1.00 57.92  ? 229 SER C O   1 
ATOM   1566  C CB  . SER A 1 210 ? 51.804  39.502  -41.404 1.00 43.64  ? 229 SER C CB  1 
ATOM   1567  O OG  . SER A 1 210 ? 51.822  38.553  -40.342 1.00 42.46  ? 229 SER C OG  1 
ATOM   1568  N N   . HIS A 1 211 ? 53.985  37.090  -41.938 1.00 40.82  ? 230 HIS C N   1 
ATOM   1569  C CA  . HIS A 1 211 ? 54.185  35.652  -42.091 1.00 40.30  ? 230 HIS C CA  1 
ATOM   1570  C C   . HIS A 1 211 ? 53.304  34.845  -41.166 1.00 47.41  ? 230 HIS C C   1 
ATOM   1571  O O   . HIS A 1 211 ? 53.304  33.612  -41.222 1.00 39.92  ? 230 HIS C O   1 
ATOM   1572  C CB  . HIS A 1 211 ? 55.622  35.280  -41.774 1.00 38.86  ? 230 HIS C CB  1 
ATOM   1573  C CG  . HIS A 1 211 ? 56.615  35.808  -42.750 1.00 39.52  ? 230 HIS C CG  1 
ATOM   1574  N ND1 . HIS A 1 211 ? 56.662  35.396  -44.060 1.00 43.76  ? 230 HIS C ND1 1 
ATOM   1575  C CD2 . HIS A 1 211 ? 57.620  36.701  -42.598 1.00 47.67  ? 230 HIS C CD2 1 
ATOM   1576  C CE1 . HIS A 1 211 ? 57.642  36.027  -44.682 1.00 44.46  ? 230 HIS C CE1 1 
ATOM   1577  N NE2 . HIS A 1 211 ? 58.240  36.819  -43.819 1.00 40.66  ? 230 HIS C NE2 1 
ATOM   1578  N N   . PHE A 1 212 ? 52.569  35.547  -40.307 1.00 47.54  ? 231 PHE C N   1 
ATOM   1579  C CA  . PHE A 1 212 ? 51.953  34.924  -39.146 1.00 47.12  ? 231 PHE C CA  1 
ATOM   1580  C C   . PHE A 1 212 ? 50.515  35.367  -38.914 1.00 48.35  ? 231 PHE C C   1 
ATOM   1581  O O   . PHE A 1 212 ? 49.730  34.653  -38.276 1.00 48.70  ? 231 PHE C O   1 
ATOM   1582  C CB  . PHE A 1 212 ? 52.793  35.214  -37.896 1.00 46.09  ? 231 PHE C CB  1 
ATOM   1583  C CG  . PHE A 1 212 ? 54.258  34.949  -38.072 1.00 44.85  ? 231 PHE C CG  1 
ATOM   1584  C CD1 . PHE A 1 212 ? 54.739  33.657  -38.126 1.00 35.88  ? 231 PHE C CD1 1 
ATOM   1585  C CD2 . PHE A 1 212 ? 55.152  35.988  -38.171 1.00 36.55  ? 231 PHE C CD2 1 
ATOM   1586  C CE1 . PHE A 1 212 ? 56.082  33.414  -38.293 1.00 34.76  ? 231 PHE C CE1 1 
ATOM   1587  C CE2 . PHE A 1 212 ? 56.491  35.746  -38.331 1.00 35.53  ? 231 PHE C CE2 1 
ATOM   1588  C CZ  . PHE A 1 212 ? 56.956  34.459  -38.394 1.00 34.62  ? 231 PHE C CZ  1 
ATOM   1589  N N   . ASN A 1 213 ? 50.176  36.556  -39.402 1.00 49.47  ? 232 ASN C N   1 
ATOM   1590  C CA  . ASN A 1 213 ? 48.793  37.021  -39.359 1.00 52.18  ? 232 ASN C CA  1 
ATOM   1591  C C   . ASN A 1 213 ? 48.222  37.235  -40.758 1.00 54.82  ? 232 ASN C C   1 
ATOM   1592  O O   . ASN A 1 213 ? 48.846  37.852  -41.620 1.00 54.49  ? 232 ASN C O   1 
ATOM   1593  C CB  . ASN A 1 213 ? 48.662  38.291  -38.524 1.00 52.25  ? 232 ASN C CB  1 
ATOM   1594  C CG  . ASN A 1 213 ? 49.116  38.097  -37.100 1.00 44.63  ? 232 ASN C CG  1 
ATOM   1595  O OD1 . ASN A 1 213 ? 48.434  37.478  -36.290 1.00 45.28  ? 232 ASN C OD1 1 
ATOM   1596  N ND2 . ASN A 1 213 ? 50.274  38.629  -36.787 1.00 43.19  ? 232 ASN C ND2 1 
ATOM   1597  N N   . ARG A 1 214 ? 47.026  36.713  -40.989 1.00 57.59  ? 233 ARG C N   1 
ATOM   1598  C CA  . ARG A 1 214 ? 46.435  36.795  -42.306 1.00 60.07  ? 233 ARG C CA  1 
ATOM   1599  C C   . ARG A 1 214 ? 45.010  37.306  -42.236 1.00 62.50  ? 233 ARG C C   1 
ATOM   1600  O O   . ARG A 1 214 ? 44.440  37.702  -43.253 1.00 64.51  ? 233 ARG C O   1 
ATOM   1601  C CB  . ARG A 1 214 ? 46.463  35.415  -42.951 1.00 61.59  ? 233 ARG C CB  1 
ATOM   1602  C CG  . ARG A 1 214 ? 47.836  34.763  -42.945 1.00 60.41  ? 233 ARG C CG  1 
ATOM   1603  C CD  . ARG A 1 214 ? 47.750  33.257  -43.163 1.00 61.86  ? 233 ARG C CD  1 
ATOM   1604  N NE  . ARG A 1 214 ? 47.023  32.574  -42.097 1.00 62.92  ? 233 ARG C NE  1 
ATOM   1605  C CZ  . ARG A 1 214 ? 45.800  32.055  -42.236 1.00 65.53  ? 233 ARG C CZ  1 
ATOM   1606  N NH1 . ARG A 1 214 ? 45.160  32.124  -43.408 1.00 67.47  ? 233 ARG C NH1 1 
ATOM   1607  N NH2 . ARG A 1 214 ? 45.216  31.460  -41.200 1.00 66.18  ? 233 ARG C NH2 1 
ATOM   1608  N N   . LYS A 1 215 ? 44.427  37.297  -41.043 1.00 62.57  ? 234 LYS C N   1 
ATOM   1609  C CA  . LYS A 1 215 ? 43.006  37.603  -40.910 1.00 64.91  ? 234 LYS C CA  1 
ATOM   1610  C C   . LYS A 1 215 ? 42.747  39.024  -40.398 1.00 65.19  ? 234 LYS C C   1 
ATOM   1611  O O   . LYS A 1 215 ? 42.755  39.274  -39.188 1.00 65.08  ? 234 LYS C O   1 
ATOM   1612  C CB  . LYS A 1 215 ? 42.287  36.532  -40.063 1.00 66.05  ? 234 LYS C CB  1 
ATOM   1613  C CG  . LYS A 1 215 ? 42.118  35.184  -40.793 1.00 66.66  ? 234 LYS C CG  1 
ATOM   1614  C CD  . LYS A 1 215 ? 41.669  35.413  -42.267 1.00 80.05  ? 234 LYS C CD  1 
ATOM   1615  C CE  . LYS A 1 215 ? 41.469  34.114  -43.084 1.00 81.31  ? 234 LYS C CE  1 
ATOM   1616  N NZ  . LYS A 1 215 ? 41.053  34.366  -44.509 1.00 82.97  ? 234 LYS C NZ  1 
ATOM   1617  N N   . PHE A 1 216 ? 42.487  39.946  -41.326 1.00 65.89  ? 235 PHE C N   1 
ATOM   1618  C CA  . PHE A 1 216 ? 42.465  41.364  -40.984 1.00 66.21  ? 235 PHE C CA  1 
ATOM   1619  C C   . PHE A 1 216 ? 41.138  42.074  -41.169 1.00 69.57  ? 235 PHE C C   1 
ATOM   1620  O O   . PHE A 1 216 ? 40.128  41.460  -41.497 1.00 71.87  ? 235 PHE C O   1 
ATOM   1621  C CB  . PHE A 1 216 ? 43.526  42.113  -41.786 1.00 64.16  ? 235 PHE C CB  1 
ATOM   1622  C CG  . PHE A 1 216 ? 44.921  41.697  -41.468 1.00 60.99  ? 235 PHE C CG  1 
ATOM   1623  C CD1 . PHE A 1 216 ? 45.498  42.044  -40.273 1.00 60.00  ? 235 PHE C CD1 1 
ATOM   1624  C CD2 . PHE A 1 216 ? 45.656  40.960  -42.370 1.00 59.44  ? 235 PHE C CD2 1 
ATOM   1625  C CE1 . PHE A 1 216 ? 46.778  41.660  -39.987 1.00 57.56  ? 235 PHE C CE1 1 
ATOM   1626  C CE2 . PHE A 1 216 ? 46.934  40.577  -42.093 1.00 56.98  ? 235 PHE C CE2 1 
ATOM   1627  C CZ  . PHE A 1 216 ? 47.497  40.926  -40.908 1.00 56.04  ? 235 PHE C CZ  1 
ATOM   1628  N N   . ARG A 1 217 ? 41.172  43.378  -40.901 1.00 70.06  ? 236 ARG C N   1 
ATOM   1629  C CA  . ARG A 1 217 ? 40.166  44.340  -41.339 1.00 72.87  ? 236 ARG C CA  1 
ATOM   1630  C C   . ARG A 1 217 ? 40.815  45.728  -41.317 1.00 72.45  ? 236 ARG C C   1 
ATOM   1631  O O   . ARG A 1 217 ? 41.608  46.040  -40.422 1.00 71.26  ? 236 ARG C O   1 
ATOM   1632  C CB  . ARG A 1 217 ? 38.887  44.286  -40.493 1.00 76.18  ? 236 ARG C CB  1 
ATOM   1633  C CG  . ARG A 1 217 ? 39.031  44.707  -39.045 1.00 76.70  ? 236 ARG C CG  1 
ATOM   1634  C CD  . ARG A 1 217 ? 37.676  45.091  -38.427 1.00 81.05  ? 236 ARG C CD  1 
ATOM   1635  N NE  . ARG A 1 217 ? 36.669  44.036  -38.552 1.00 83.14  ? 236 ARG C NE  1 
ATOM   1636  C CZ  . ARG A 1 217 ? 36.509  43.034  -37.687 1.00 83.47  ? 236 ARG C CZ  1 
ATOM   1637  N NH1 . ARG A 1 217 ? 37.300  42.941  -36.619 1.00 81.70  ? 236 ARG C NH1 1 
ATOM   1638  N NH2 . ARG A 1 217 ? 35.558  42.122  -37.887 1.00 85.73  ? 236 ARG C NH2 1 
ATOM   1639  N N   . TYR A 1 218 ? 40.500  46.553  -42.313 1.00 73.62  ? 237 TYR C N   1 
ATOM   1640  C CA  . TYR A 1 218 ? 41.255  47.790  -42.528 1.00 72.97  ? 237 TYR C CA  1 
ATOM   1641  C C   . TYR A 1 218 ? 40.512  49.067  -42.117 1.00 75.72  ? 237 TYR C C   1 
ATOM   1642  O O   . TYR A 1 218 ? 39.285  49.133  -42.195 1.00 72.61  ? 237 TYR C O   1 
ATOM   1643  C CB  . TYR A 1 218 ? 41.773  47.841  -43.973 1.00 65.60  ? 237 TYR C CB  1 
ATOM   1644  C CG  . TYR A 1 218 ? 42.624  46.625  -44.296 1.00 64.13  ? 237 TYR C CG  1 
ATOM   1645  C CD1 . TYR A 1 218 ? 43.940  46.539  -43.849 1.00 60.46  ? 237 TYR C CD1 1 
ATOM   1646  C CD2 . TYR A 1 218 ? 42.105  45.545  -45.009 1.00 63.07  ? 237 TYR C CD2 1 
ATOM   1647  C CE1 . TYR A 1 218 ? 44.720  45.426  -44.119 1.00 58.23  ? 237 TYR C CE1 1 
ATOM   1648  C CE2 . TYR A 1 218 ? 42.886  44.427  -45.289 1.00 60.94  ? 237 TYR C CE2 1 
ATOM   1649  C CZ  . TYR A 1 218 ? 44.193  44.374  -44.837 1.00 58.48  ? 237 TYR C CZ  1 
ATOM   1650  O OH  . TYR A 1 218 ? 44.978  43.275  -45.100 1.00 56.61  ? 237 TYR C OH  1 
ATOM   1651  N N   . GLU A 1 219 ? 41.271  50.054  -41.638 1.00 75.23  ? 238 GLU C N   1 
ATOM   1652  C CA  . GLU A 1 219 ? 40.723  51.343  -41.221 1.00 78.07  ? 238 GLU C CA  1 
ATOM   1653  C C   . GLU A 1 219 ? 41.312  52.471  -42.051 1.00 77.57  ? 238 GLU C C   1 
ATOM   1654  O O   . GLU A 1 219 ? 42.506  52.752  -41.961 1.00 75.67  ? 238 GLU C O   1 
ATOM   1655  C CB  . GLU A 1 219 ? 41.026  51.630  -39.746 1.00 79.17  ? 238 GLU C CB  1 
ATOM   1656  C CG  . GLU A 1 219 ? 40.356  50.704  -38.735 1.00 80.14  ? 238 GLU C CG  1 
ATOM   1657  C CD  . GLU A 1 219 ? 40.296  51.297  -37.324 1.00 82.46  ? 238 GLU C CD  1 
ATOM   1658  O OE1 . GLU A 1 219 ? 39.867  52.465  -37.165 1.00 85.60  ? 238 GLU C OE1 1 
ATOM   1659  O OE2 . GLU A 1 219 ? 40.672  50.587  -36.369 1.00 81.35  ? 238 GLU C OE2 1 
ATOM   1660  N N   . LEU A 1 220 ? 40.474  53.122  -42.851 1.00 79.44  ? 239 LEU C N   1 
ATOM   1661  C CA  . LEU A 1 220 ? 40.909  54.275  -43.630 1.00 79.89  ? 239 LEU C CA  1 
ATOM   1662  C C   . LEU A 1 220 ? 40.282  55.534  -43.072 1.00 83.60  ? 239 LEU C C   1 
ATOM   1663  O O   . LEU A 1 220 ? 39.059  55.635  -43.005 1.00 86.27  ? 239 LEU C O   1 
ATOM   1664  C CB  . LEU A 1 220 ? 40.498  54.151  -45.098 1.00 79.69  ? 239 LEU C CB  1 
ATOM   1665  C CG  . LEU A 1 220 ? 40.996  52.993  -45.960 1.00 76.80  ? 239 LEU C CG  1 
ATOM   1666  C CD1 . LEU A 1 220 ? 40.191  51.735  -45.704 1.00 76.72  ? 239 LEU C CD1 1 
ATOM   1667  C CD2 . LEU A 1 220 ? 40.909  53.375  -47.419 1.00 77.12  ? 239 LEU C CD2 1 
ATOM   1668  N N   . GLN A 1 221 ? 41.118  56.488  -42.669 1.00 84.13  ? 240 GLN C N   1 
ATOM   1669  C CA  . GLN A 1 221 ? 40.651  57.828  -42.323 1.00 87.79  ? 240 GLN C CA  1 
ATOM   1670  C C   . GLN A 1 221 ? 40.822  58.742  -43.528 1.00 88.27  ? 240 GLN C C   1 
ATOM   1671  O O   . GLN A 1 221 ? 41.934  58.915  -44.025 1.00 86.47  ? 240 GLN C O   1 
ATOM   1672  C CB  . GLN A 1 221 ? 41.433  58.396  -41.141 1.00 88.77  ? 240 GLN C CB  1 
ATOM   1673  C CG  . GLN A 1 221 ? 40.992  57.908  -39.773 1.00 89.94  ? 240 GLN C CG  1 
ATOM   1674  C CD  . GLN A 1 221 ? 41.651  58.707  -38.668 1.00 91.90  ? 240 GLN C CD  1 
ATOM   1675  O OE1 . GLN A 1 221 ? 42.010  59.868  -38.874 1.00 93.97  ? 240 GLN C OE1 1 
ATOM   1676  N NE2 . GLN A 1 221 ? 41.830  58.090  -37.495 1.00 91.42  ? 240 GLN C NE2 1 
ATOM   1677  N N   . ILE A 1 222 ? 39.720  59.324  -43.993 1.00 90.97  ? 241 ILE C N   1 
ATOM   1678  C CA  . ILE A 1 222 ? 39.737  60.161  -45.188 1.00 87.83  ? 241 ILE C CA  1 
ATOM   1679  C C   . ILE A 1 222 ? 39.233  61.587  -44.921 1.00 96.08  ? 241 ILE C C   1 
ATOM   1680  O O   . ILE A 1 222 ? 38.246  61.786  -44.213 1.00 94.90  ? 241 ILE C O   1 
ATOM   1681  C CB  . ILE A 1 222 ? 38.908  59.520  -46.333 1.00 87.17  ? 241 ILE C CB  1 
ATOM   1682  C CG1 . ILE A 1 222 ? 37.441  59.387  -45.931 1.00 89.94  ? 241 ILE C CG1 1 
ATOM   1683  C CG2 . ILE A 1 222 ? 39.459  58.148  -46.714 1.00 83.39  ? 241 ILE C CG2 1 
ATOM   1684  C CD1 . ILE A 1 222 ? 36.594  58.694  -46.976 1.00 91.40  ? 241 ILE C CD1 1 
ATOM   1685  N N   . GLN A 1 223 ? 39.921  62.573  -45.494 1.00 96.66  ? 242 GLN C N   1 
ATOM   1686  C CA  . GLN A 1 223 ? 39.498  63.970  -45.413 1.00 100.76 ? 242 GLN C CA  1 
ATOM   1687  C C   . GLN A 1 223 ? 39.102  64.527  -46.783 1.00 101.34 ? 242 GLN C C   1 
ATOM   1688  O O   . GLN A 1 223 ? 38.505  65.602  -46.888 1.00 104.72 ? 242 GLN C O   1 
ATOM   1689  C CB  . GLN A 1 223 ? 40.610  64.818  -44.812 1.00 102.03 ? 242 GLN C CB  1 
ATOM   1690  C CG  . GLN A 1 223 ? 40.164  65.670  -43.647 1.00 106.43 ? 242 GLN C CG  1 
ATOM   1691  C CD  . GLN A 1 223 ? 41.345  66.233  -42.893 1.00 107.46 ? 242 GLN C CD  1 
ATOM   1692  O OE1 . GLN A 1 223 ? 42.476  66.192  -43.383 1.00 105.41 ? 242 GLN C OE1 1 
ATOM   1693  N NE2 . GLN A 1 223 ? 41.100  66.749  -41.692 1.00 110.92 ? 242 GLN C NE2 1 
ATOM   1694  N N   . VAL A 1 229 ? 37.353  64.823  -41.639 1.00 107.27 ? 248 VAL C N   1 
ATOM   1695  C CA  . VAL A 1 229 ? 37.783  63.443  -41.390 1.00 110.77 ? 248 VAL C CA  1 
ATOM   1696  C C   . VAL A 1 229 ? 36.596  62.491  -41.235 1.00 111.01 ? 248 VAL C C   1 
ATOM   1697  O O   . VAL A 1 229 ? 35.633  62.801  -40.532 1.00 114.95 ? 248 VAL C O   1 
ATOM   1698  C CB  . VAL A 1 229 ? 38.723  63.330  -40.145 1.00 102.67 ? 248 VAL C CB  1 
ATOM   1699  C CG1 . VAL A 1 229 ? 38.676  61.929  -39.528 1.00 99.93  ? 248 VAL C CG1 1 
ATOM   1700  C CG2 . VAL A 1 229 ? 40.159  63.721  -40.503 1.00 100.64 ? 248 VAL C CG2 1 
ATOM   1701  N N   . ILE A 1 230 ? 36.671  61.343  -41.915 1.00 107.18 ? 249 ILE C N   1 
ATOM   1702  C CA  . ILE A 1 230 ? 35.665  60.281  -41.819 1.00 107.24 ? 249 ILE C CA  1 
ATOM   1703  C C   . ILE A 1 230 ? 36.321  58.889  -41.747 1.00 103.07 ? 249 ILE C C   1 
ATOM   1704  O O   . ILE A 1 230 ? 37.037  58.487  -42.667 1.00 99.56  ? 249 ILE C O   1 
ATOM   1705  C CB  . ILE A 1 230 ? 34.685  60.312  -43.015 1.00 108.25 ? 249 ILE C CB  1 
ATOM   1706  C CG1 . ILE A 1 230 ? 33.818  61.577  -42.980 1.00 113.24 ? 249 ILE C CG1 1 
ATOM   1707  C CG2 . ILE A 1 230 ? 33.808  59.071  -43.019 1.00 107.92 ? 249 ILE C CG2 1 
ATOM   1708  C CD1 . ILE A 1 230 ? 32.738  61.568  -41.916 1.00 117.48 ? 249 ILE C CD1 1 
ATOM   1709  N N   . THR A 1 231 ? 36.077  58.159  -40.660 1.00 103.93 ? 250 THR C N   1 
ATOM   1710  C CA  . THR A 1 231 ? 36.636  56.813  -40.495 1.00 100.91 ? 250 THR C CA  1 
ATOM   1711  C C   . THR A 1 231 ? 35.847  55.786  -41.334 1.00 100.88 ? 250 THR C C   1 
ATOM   1712  O O   . THR A 1 231 ? 34.629  55.889  -41.476 1.00 103.70 ? 250 THR C O   1 
ATOM   1713  C CB  . THR A 1 231 ? 36.727  56.393  -38.977 1.00 94.89  ? 250 THR C CB  1 
ATOM   1714  O OG1 . THR A 1 231 ? 37.233  57.484  -38.193 1.00 94.43  ? 250 THR C OG1 1 
ATOM   1715  C CG2 . THR A 1 231 ? 37.640  55.162  -38.770 1.00 90.49  ? 250 THR C CG2 1 
ATOM   1716  N N   . GLU A 1 232 ? 36.561  54.812  -41.897 1.00 98.11  ? 251 GLU C N   1 
ATOM   1717  C CA  . GLU A 1 232 ? 35.967  53.793  -42.767 1.00 98.40  ? 251 GLU C CA  1 
ATOM   1718  C C   . GLU A 1 232 ? 36.565  52.389  -42.528 1.00 96.88  ? 251 GLU C C   1 
ATOM   1719  O O   . GLU A 1 232 ? 37.771  52.244  -42.299 1.00 93.93  ? 251 GLU C O   1 
ATOM   1720  C CB  . GLU A 1 232 ? 36.127  54.195  -44.241 1.00 96.79  ? 251 GLU C CB  1 
ATOM   1721  C CG  . GLU A 1 232 ? 35.468  53.240  -45.247 1.00 95.68  ? 251 GLU C CG  1 
ATOM   1722  C CD  . GLU A 1 232 ? 34.156  53.777  -45.832 1.00 98.51  ? 251 GLU C CD  1 
ATOM   1723  O OE1 . GLU A 1 232 ? 33.930  55.008  -45.770 1.00 100.40 ? 251 GLU C OE1 1 
ATOM   1724  O OE2 . GLU A 1 232 ? 33.357  52.966  -46.359 1.00 99.05  ? 251 GLU C OE2 1 
ATOM   1725  N N   . GLN A 1 233 ? 35.708  51.368  -42.590 1.00 99.40  ? 252 GLN C N   1 
ATOM   1726  C CA  . GLN A 1 233 ? 36.102  49.977  -42.391 1.00 98.38  ? 252 GLN C CA  1 
ATOM   1727  C C   . GLN A 1 233 ? 36.113  49.180  -43.694 1.00 98.40  ? 252 GLN C C   1 
ATOM   1728  O O   . GLN A 1 233 ? 35.320  49.439  -44.588 1.00 100.87 ? 252 GLN C O   1 
ATOM   1729  C CB  . GLN A 1 233 ? 35.145  49.305  -41.409 1.00 101.00 ? 252 GLN C CB  1 
ATOM   1730  C CG  . GLN A 1 233 ? 35.232  49.849  -39.997 1.00 102.77 ? 252 GLN C CG  1 
ATOM   1731  C CD  . GLN A 1 233 ? 36.633  49.723  -39.395 1.00 99.58  ? 252 GLN C CD  1 
ATOM   1732  O OE1 . GLN A 1 233 ? 37.220  50.717  -38.959 1.00 99.82  ? 252 GLN C OE1 1 
ATOM   1733  N NE2 . GLN A 1 233 ? 37.169  48.498  -39.364 1.00 96.77  ? 252 GLN C NE2 1 
ATOM   1734  N N   . VAL A 1 234 ? 37.019  48.213  -43.803 1.00 96.21  ? 253 VAL C N   1 
ATOM   1735  C CA  . VAL A 1 234 ? 37.000  47.273  -44.927 1.00 96.34  ? 253 VAL C CA  1 
ATOM   1736  C C   . VAL A 1 234 ? 37.097  45.815  -44.430 1.00 95.93  ? 253 VAL C C   1 
ATOM   1737  O O   . VAL A 1 234 ? 38.055  45.440  -43.750 1.00 93.15  ? 253 VAL C O   1 
ATOM   1738  C CB  . VAL A 1 234 ? 38.093  47.585  -45.985 1.00 73.05  ? 253 VAL C CB  1 
ATOM   1739  C CG1 . VAL A 1 234 ? 38.043  46.571  -47.109 1.00 72.55  ? 253 VAL C CG1 1 
ATOM   1740  C CG2 . VAL A 1 234 ? 37.923  48.996  -46.543 1.00 74.48  ? 253 VAL C CG2 1 
ATOM   1741  N N   . ARG A 1 235 ? 36.079  45.023  -44.777 1.00 98.82  ? 254 ARG C N   1 
ATOM   1742  C CA  . ARG A 1 235 ? 35.866  43.660  -44.277 1.00 99.69  ? 254 ARG C CA  1 
ATOM   1743  C C   . ARG A 1 235 ? 37.113  42.785  -44.334 1.00 96.01  ? 254 ARG C C   1 
ATOM   1744  O O   . ARG A 1 235 ? 37.808  42.627  -43.328 1.00 94.15  ? 254 ARG C O   1 
ATOM   1745  C CB  . ARG A 1 235 ? 34.694  43.000  -45.034 1.00 103.77 ? 254 ARG C CB  1 
ATOM   1746  C CG  . ARG A 1 235 ? 34.387  41.544  -44.654 1.00 105.38 ? 254 ARG C CG  1 
ATOM   1747  C CD  . ARG A 1 235 ? 34.293  41.366  -43.143 1.00 106.47 ? 254 ARG C CD  1 
ATOM   1748  N NE  . ARG A 1 235 ? 34.878  40.101  -42.704 1.00 105.13 ? 254 ARG C NE  1 
ATOM   1749  C CZ  . ARG A 1 235 ? 35.125  39.789  -41.436 1.00 104.72 ? 254 ARG C CZ  1 
ATOM   1750  N NH1 . ARG A 1 235 ? 34.840  40.651  -40.465 1.00 106.01 ? 254 ARG C NH1 1 
ATOM   1751  N NH2 . ARG A 1 235 ? 35.657  38.612  -41.137 1.00 103.09 ? 254 ARG C NH2 1 
ATOM   1752  N N   . ASP A 1 236 ? 37.389  42.206  -45.501 1.00 95.25  ? 255 ASP C N   1 
ATOM   1753  C CA  . ASP A 1 236 ? 38.601  41.399  -45.700 1.00 91.95  ? 255 ASP C CA  1 
ATOM   1754  C C   . ASP A 1 236 ? 39.243  41.825  -47.024 1.00 89.27  ? 255 ASP C C   1 
ATOM   1755  O O   . ASP A 1 236 ? 40.429  41.559  -47.268 1.00 86.22  ? 255 ASP C O   1 
ATOM   1756  C CB  . ASP A 1 236 ? 38.276  39.886  -45.687 1.00 94.07  ? 255 ASP C CB  1 
ATOM   1757  C CG  . ASP A 1 236 ? 39.529  38.994  -45.672 1.00 91.07  ? 255 ASP C CG  1 
ATOM   1758  O OD1 . ASP A 1 236 ? 40.034  38.671  -44.569 1.00 89.45  ? 255 ASP C OD1 1 
ATOM   1759  O OD2 . ASP A 1 236 ? 39.998  38.590  -46.763 1.00 90.49  ? 255 ASP C OD2 1 
ATOM   1760  N N   . ARG A 1 237 ? 38.442  42.493  -47.861 1.00 90.57  ? 256 ARG C N   1 
ATOM   1761  C CA  . ARG A 1 237 ? 38.908  43.032  -49.132 1.00 89.26  ? 256 ARG C CA  1 
ATOM   1762  C C   . ARG A 1 237 ? 40.175  43.862  -48.949 1.00 85.64  ? 256 ARG C C   1 
ATOM   1763  O O   . ARG A 1 237 ? 40.459  44.373  -47.866 1.00 84.47  ? 256 ARG C O   1 
ATOM   1764  C CB  . ARG A 1 237 ? 37.828  43.884  -49.801 1.00 92.49  ? 256 ARG C CB  1 
ATOM   1765  C CG  . ARG A 1 237 ? 36.586  43.126  -50.269 1.00 96.31  ? 256 ARG C CG  1 
ATOM   1766  C CD  . ARG A 1 237 ? 35.722  44.047  -51.137 1.00 99.48  ? 256 ARG C CD  1 
ATOM   1767  N NE  . ARG A 1 237 ? 35.783  45.421  -50.636 1.00 99.82  ? 256 ARG C NE  1 
ATOM   1768  C CZ  . ARG A 1 237 ? 35.306  46.488  -51.271 1.00 102.06 ? 256 ARG C CZ  1 
ATOM   1769  N NH1 . ARG A 1 237 ? 34.718  46.356  -52.457 1.00 104.24 ? 256 ARG C NH1 1 
ATOM   1770  N NH2 . ARG A 1 237 ? 35.418  47.692  -50.713 1.00 102.16 ? 256 ARG C NH2 1 
ATOM   1771  N N   . THR A 1 238 ? 40.929  43.995  -50.028 1.00 84.41  ? 257 THR C N   1 
ATOM   1772  C CA  . THR A 1 238 ? 42.223  44.655  -49.997 1.00 81.77  ? 257 THR C CA  1 
ATOM   1773  C C   . THR A 1 238 ? 42.166  45.912  -50.895 1.00 82.35  ? 257 THR C C   1 
ATOM   1774  O O   . THR A 1 238 ? 43.187  46.398  -51.385 1.00 81.32  ? 257 THR C O   1 
ATOM   1775  C CB  . THR A 1 238 ? 43.321  43.637  -50.431 1.00 62.51  ? 257 THR C CB  1 
ATOM   1776  O OG1 . THR A 1 238 ? 44.634  44.201  -50.312 1.00 60.63  ? 257 THR C OG1 1 
ATOM   1777  C CG2 . THR A 1 238 ? 43.070  43.158  -51.868 1.00 69.33  ? 257 THR C CG2 1 
ATOM   1778  N N   . SER A 1 239 ? 40.954  46.442  -51.081 1.00 84.13  ? 258 SER C N   1 
ATOM   1779  C CA  . SER A 1 239 ? 40.701  47.542  -52.021 1.00 84.74  ? 258 SER C CA  1 
ATOM   1780  C C   . SER A 1 239 ? 39.498  48.399  -51.619 1.00 86.35  ? 258 SER C C   1 
ATOM   1781  O O   . SER A 1 239 ? 38.579  47.915  -50.965 1.00 87.78  ? 258 SER C O   1 
ATOM   1782  C CB  . SER A 1 239 ? 40.465  46.980  -53.418 1.00 85.81  ? 258 SER C CB  1 
ATOM   1783  O OG  . SER A 1 239 ? 39.350  46.100  -53.430 1.00 87.57  ? 258 SER C OG  1 
ATOM   1784  N N   . PHE A 1 240 ? 39.496  49.669  -52.013 1.00 86.50  ? 259 PHE C N   1 
ATOM   1785  C CA  . PHE A 1 240 ? 38.367  50.551  -51.696 1.00 88.60  ? 259 PHE C CA  1 
ATOM   1786  C C   . PHE A 1 240 ? 38.042  51.547  -52.818 1.00 89.97  ? 259 PHE C C   1 
ATOM   1787  O O   . PHE A 1 240 ? 38.944  52.131  -53.413 1.00 88.88  ? 259 PHE C O   1 
ATOM   1788  C CB  . PHE A 1 240 ? 38.627  51.295  -50.386 1.00 87.96  ? 259 PHE C CB  1 
ATOM   1789  C CG  . PHE A 1 240 ? 37.450  52.095  -49.891 1.00 90.80  ? 259 PHE C CG  1 
ATOM   1790  C CD1 . PHE A 1 240 ? 36.315  51.461  -49.404 1.00 92.70  ? 259 PHE C CD1 1 
ATOM   1791  C CD2 . PHE A 1 240 ? 37.488  53.482  -49.894 1.00 92.07  ? 259 PHE C CD2 1 
ATOM   1792  C CE1 . PHE A 1 240 ? 35.243  52.198  -48.938 1.00 83.22  ? 259 PHE C CE1 1 
ATOM   1793  C CE2 . PHE A 1 240 ? 36.423  54.222  -49.429 1.00 82.53  ? 259 PHE C CE2 1 
ATOM   1794  C CZ  . PHE A 1 240 ? 35.302  53.583  -48.950 1.00 84.46  ? 259 PHE C CZ  1 
ATOM   1795  N N   . GLN A 1 241 ? 36.753  51.738  -53.098 1.00 92.19  ? 260 GLN C N   1 
ATOM   1796  C CA  . GLN A 1 241 ? 36.339  52.622  -54.193 1.00 93.47  ? 260 GLN C CA  1 
ATOM   1797  C C   . GLN A 1 241 ? 35.746  53.945  -53.708 1.00 96.06  ? 260 GLN C C   1 
ATOM   1798  O O   . GLN A 1 241 ? 34.983  53.971  -52.739 1.00 97.46  ? 260 GLN C O   1 
ATOM   1799  C CB  . GLN A 1 241 ? 35.360  51.915  -55.157 1.00 94.45  ? 260 GLN C CB  1 
ATOM   1800  C CG  . GLN A 1 241 ? 33.928  51.708  -54.640 1.00 96.11  ? 260 GLN C CG  1 
ATOM   1801  C CD  . GLN A 1 241 ? 33.742  50.395  -53.867 1.00 94.47  ? 260 GLN C CD  1 
ATOM   1802  O OE1 . GLN A 1 241 ? 34.713  49.744  -53.438 1.00 91.09  ? 260 GLN C OE1 1 
ATOM   1803  N NE2 . GLN A 1 241 ? 32.479  50.001  -53.695 1.00 97.06  ? 260 GLN C NE2 1 
ATOM   1804  N N   . LEU A 1 242 ? 36.105  55.036  -54.387 1.00 97.25  ? 261 LEU C N   1 
ATOM   1805  C CA  . LEU A 1 242 ? 35.555  56.360  -54.077 1.00 100.41 ? 261 LEU C CA  1 
ATOM   1806  C C   . LEU A 1 242 ? 35.833  57.439  -55.151 1.00 101.71 ? 261 LEU C C   1 
ATOM   1807  O O   . LEU A 1 242 ? 36.862  57.413  -55.828 1.00 100.28 ? 261 LEU C O   1 
ATOM   1808  C CB  . LEU A 1 242 ? 36.066  56.832  -52.710 1.00 99.87  ? 261 LEU C CB  1 
ATOM   1809  C CG  . LEU A 1 242 ? 35.144  57.786  -51.959 1.00 102.86 ? 261 LEU C CG  1 
ATOM   1810  C CD1 . LEU A 1 242 ? 33.718  57.245  -51.980 1.00 105.24 ? 261 LEU C CD1 1 
ATOM   1811  C CD2 . LEU A 1 242 ? 35.641  57.983  -50.539 1.00 102.31 ? 261 LEU C CD2 1 
ATOM   1812  N N   . LEU A 1 243 ? 34.898  58.376  -55.301 1.00 104.67 ? 262 LEU C N   1 
ATOM   1813  C CA  . LEU A 1 243 ? 35.104  59.600  -56.086 1.00 105.75 ? 262 LEU C CA  1 
ATOM   1814  C C   . LEU A 1 243 ? 34.269  60.665  -55.367 1.00 108.20 ? 262 LEU C C   1 
ATOM   1815  O O   . LEU A 1 243 ? 33.086  60.433  -55.120 1.00 109.92 ? 262 LEU C O   1 
ATOM   1816  C CB  . LEU A 1 243 ? 34.626  59.418  -57.547 1.00 106.90 ? 262 LEU C CB  1 
ATOM   1817  C CG  . LEU A 1 243 ? 35.406  60.008  -58.745 1.00 106.70 ? 262 LEU C CG  1 
ATOM   1818  C CD1 . LEU A 1 243 ? 36.506  59.064  -59.237 1.00 104.10 ? 262 LEU C CD1 1 
ATOM   1819  C CD2 . LEU A 1 243 ? 34.488  60.430  -59.906 1.00 109.14 ? 262 LEU C CD2 1 
ATOM   1820  N N   . ASN A 1 244 ? 34.834  61.824  -55.019 1.00 108.75 ? 263 ASN C N   1 
ATOM   1821  C CA  . ASN A 1 244 ? 36.158  62.307  -55.413 1.00 107.16 ? 263 ASN C CA  1 
ATOM   1822  C C   . ASN A 1 244 ? 36.587  63.379  -54.377 1.00 118.32 ? 263 ASN C C   1 
ATOM   1823  O O   . ASN A 1 244 ? 35.853  63.593  -53.408 1.00 120.19 ? 263 ASN C O   1 
ATOM   1824  C CB  . ASN A 1 244 ? 36.075  62.892  -56.830 1.00 108.22 ? 263 ASN C CB  1 
ATOM   1825  C CG  . ASN A 1 244 ? 34.711  63.521  -57.141 1.00 111.36 ? 263 ASN C CG  1 
ATOM   1826  O OD1 . ASN A 1 244 ? 34.018  64.022  -56.247 1.00 113.48 ? 263 ASN C OD1 1 
ATOM   1827  N ND2 . ASN A 1 244 ? 34.324  63.491  -58.419 1.00 111.82 ? 263 ASN C ND2 1 
ATOM   1828  N N   . PRO A 1 245 ? 37.754  64.062  -54.545 1.00 117.80 ? 264 PRO C N   1 
ATOM   1829  C CA  . PRO A 1 245 ? 38.850  64.082  -55.535 1.00 116.33 ? 264 PRO C CA  1 
ATOM   1830  C C   . PRO A 1 245 ? 39.619  62.756  -55.633 1.00 113.18 ? 264 PRO C C   1 
ATOM   1831  O O   . PRO A 1 245 ? 40.034  62.350  -56.724 1.00 112.18 ? 264 PRO C O   1 
ATOM   1832  C CB  . PRO A 1 245 ? 39.771  65.209  -55.025 1.00 117.41 ? 264 PRO C CB  1 
ATOM   1833  C CG  . PRO A 1 245 ? 39.459  65.344  -53.580 1.00 118.30 ? 264 PRO C CG  1 
ATOM   1834  C CD  . PRO A 1 245 ? 37.991  65.057  -53.477 1.00 119.65 ? 264 PRO C CD  1 
ATOM   1835  N N   . THR A 1 249 ? 43.112  63.259  -48.976 1.00 87.99  ? 268 THR C N   1 
ATOM   1836  C CA  . THR A 1 249 ? 44.162  62.743  -48.093 1.00 87.26  ? 268 THR C CA  1 
ATOM   1837  C C   . THR A 1 249 ? 43.703  61.537  -47.271 1.00 84.20  ? 268 THR C C   1 
ATOM   1838  O O   . THR A 1 249 ? 42.646  61.578  -46.645 1.00 85.80  ? 268 THR C O   1 
ATOM   1839  C CB  . THR A 1 249 ? 44.698  63.826  -47.128 1.00 90.01  ? 268 THR C CB  1 
ATOM   1840  O OG1 . THR A 1 249 ? 45.293  64.893  -47.877 1.00 91.92  ? 268 THR C OG1 1 
ATOM   1841  C CG2 . THR A 1 249 ? 45.741  63.234  -46.188 1.00 87.11  ? 268 THR C CG2 1 
ATOM   1842  N N   . VAL A 1 250 ? 44.504  60.472  -47.266 1.00 81.02  ? 269 VAL C N   1 
ATOM   1843  C CA  . VAL A 1 250 ? 44.117  59.227  -46.602 1.00 78.99  ? 269 VAL C CA  1 
ATOM   1844  C C   . VAL A 1 250 ? 45.266  58.575  -45.818 1.00 85.74  ? 269 VAL C C   1 
ATOM   1845  O O   . VAL A 1 250 ? 46.442  58.746  -46.145 1.00 84.80  ? 269 VAL C O   1 
ATOM   1846  C CB  . VAL A 1 250 ? 43.539  58.215  -47.626 1.00 77.27  ? 269 VAL C CB  1 
ATOM   1847  C CG1 . VAL A 1 250 ? 44.625  57.732  -48.577 1.00 75.01  ? 269 VAL C CG1 1 
ATOM   1848  C CG2 . VAL A 1 250 ? 42.849  57.041  -46.927 1.00 76.13  ? 269 VAL C CG2 1 
ATOM   1849  N N   . GLN A 1 251 ? 44.917  57.844  -44.765 1.00 84.78  ? 270 GLN C N   1 
ATOM   1850  C CA  . GLN A 1 251 ? 45.876  56.996  -44.077 1.00 82.24  ? 270 GLN C CA  1 
ATOM   1851  C C   . GLN A 1 251 ? 45.206  55.696  -43.650 1.00 80.43  ? 270 GLN C C   1 
ATOM   1852  O O   . GLN A 1 251 ? 44.090  55.700  -43.142 1.00 81.87  ? 270 GLN C O   1 
ATOM   1853  C CB  . GLN A 1 251 ? 46.492  57.721  -42.879 1.00 84.05  ? 270 GLN C CB  1 
ATOM   1854  C CG  . GLN A 1 251 ? 45.495  58.235  -41.848 1.00 87.04  ? 270 GLN C CG  1 
ATOM   1855  C CD  . GLN A 1 251 ? 46.158  59.095  -40.781 1.00 89.17  ? 270 GLN C CD  1 
ATOM   1856  O OE1 . GLN A 1 251 ? 46.946  59.988  -41.094 1.00 90.40  ? 270 GLN C OE1 1 
ATOM   1857  N NE2 . GLN A 1 251 ? 45.845  58.824  -39.515 1.00 89.89  ? 270 GLN C NE2 1 
ATOM   1858  N N   . ILE A 1 252 ? 45.888  54.580  -43.872 1.00 77.76  ? 271 ILE C N   1 
ATOM   1859  C CA  . ILE A 1 252 ? 45.318  53.276  -43.568 1.00 76.21  ? 271 ILE C CA  1 
ATOM   1860  C C   . ILE A 1 252 ? 46.055  52.612  -42.411 1.00 74.25  ? 271 ILE C C   1 
ATOM   1861  O O   . ILE A 1 252 ? 47.235  52.873  -42.180 1.00 64.72  ? 271 ILE C O   1 
ATOM   1862  C CB  . ILE A 1 252 ? 45.360  52.366  -44.803 1.00 65.54  ? 271 ILE C CB  1 
ATOM   1863  C CG1 . ILE A 1 252 ? 44.659  51.036  -44.522 1.00 64.55  ? 271 ILE C CG1 1 
ATOM   1864  C CG2 . ILE A 1 252 ? 46.793  52.174  -45.269 1.00 63.58  ? 271 ILE C CG2 1 
ATOM   1865  C CD1 . ILE A 1 252 ? 44.130  50.333  -45.751 1.00 64.35  ? 271 ILE C CD1 1 
ATOM   1866  N N   . ARG A 1 253 ? 45.340  51.783  -41.658 1.00 73.43  ? 272 ARG C N   1 
ATOM   1867  C CA  . ARG A 1 253 ? 45.963  50.917  -40.669 1.00 70.46  ? 272 ARG C CA  1 
ATOM   1868  C C   . ARG A 1 253 ? 45.230  49.568  -40.631 1.00 69.09  ? 272 ARG C C   1 
ATOM   1869  O O   . ARG A 1 253 ? 44.050  49.476  -40.993 1.00 70.40  ? 272 ARG C O   1 
ATOM   1870  C CB  . ARG A 1 253 ? 46.012  51.588  -39.294 1.00 71.43  ? 272 ARG C CB  1 
ATOM   1871  C CG  . ARG A 1 253 ? 44.693  51.655  -38.579 1.00 73.53  ? 272 ARG C CG  1 
ATOM   1872  C CD  . ARG A 1 253 ? 44.890  51.989  -37.120 1.00 74.68  ? 272 ARG C CD  1 
ATOM   1873  N NE  . ARG A 1 253 ? 43.619  52.036  -36.411 1.00 77.66  ? 272 ARG C NE  1 
ATOM   1874  C CZ  . ARG A 1 253 ? 43.430  52.653  -35.248 1.00 80.44  ? 272 ARG C CZ  1 
ATOM   1875  N NH1 . ARG A 1 253 ? 44.436  53.285  -34.657 1.00 80.67  ? 272 ARG C NH1 1 
ATOM   1876  N NH2 . ARG A 1 253 ? 42.233  52.641  -34.676 1.00 83.33  ? 272 ARG C NH2 1 
ATOM   1877  N N   . ALA A 1 254 ? 45.943  48.521  -40.217 1.00 66.68  ? 273 ALA C N   1 
ATOM   1878  C CA  . ALA A 1 254 ? 45.402  47.167  -40.228 1.00 58.99  ? 273 ALA C CA  1 
ATOM   1879  C C   . ALA A 1 254 ? 45.040  46.717  -38.832 1.00 64.06  ? 273 ALA C C   1 
ATOM   1880  O O   . ALA A 1 254 ? 45.725  47.052  -37.874 1.00 59.03  ? 273 ALA C O   1 
ATOM   1881  C CB  . ALA A 1 254 ? 46.396  46.219  -40.835 1.00 56.22  ? 273 ALA C CB  1 
ATOM   1882  N N   . ARG A 1 255 ? 43.959  45.963  -38.711 1.00 65.20  ? 274 ARG C N   1 
ATOM   1883  C CA  . ARG A 1 255 ? 43.618  45.371  -37.427 1.00 66.09  ? 274 ARG C CA  1 
ATOM   1884  C C   . ARG A 1 255 ? 43.269  43.921  -37.635 1.00 65.43  ? 274 ARG C C   1 
ATOM   1885  O O   . ARG A 1 255 ? 42.290  43.611  -38.295 1.00 67.11  ? 274 ARG C O   1 
ATOM   1886  C CB  . ARG A 1 255 ? 42.446  46.097  -36.758 1.00 70.09  ? 274 ARG C CB  1 
ATOM   1887  C CG  . ARG A 1 255 ? 42.074  45.521  -35.394 1.00 71.47  ? 274 ARG C CG  1 
ATOM   1888  C CD  . ARG A 1 255 ? 40.699  45.986  -34.924 1.00 76.30  ? 274 ARG C CD  1 
ATOM   1889  N NE  . ARG A 1 255 ? 40.776  46.947  -33.821 1.00 78.96  ? 274 ARG C NE  1 
ATOM   1890  C CZ  . ARG A 1 255 ? 40.610  48.264  -33.951 1.00 81.55  ? 274 ARG C CZ  1 
ATOM   1891  N NH1 . ARG A 1 255 ? 40.356  48.787  -35.146 1.00 81.89  ? 274 ARG C NH1 1 
ATOM   1892  N NH2 . ARG A 1 255 ? 40.701  49.064  -32.889 1.00 83.82  ? 274 ARG C NH2 1 
ATOM   1893  N N   . GLU A 1 256 ? 44.073  43.024  -37.087 1.00 63.49  ? 275 GLU C N   1 
ATOM   1894  C CA  . GLU A 1 256 ? 43.780  41.612  -37.236 1.00 63.54  ? 275 GLU C CA  1 
ATOM   1895  C C   . GLU A 1 256 ? 42.563  41.317  -36.362 1.00 66.62  ? 275 GLU C C   1 
ATOM   1896  O O   . GLU A 1 256 ? 42.426  41.865  -35.271 1.00 67.87  ? 275 GLU C O   1 
ATOM   1897  C CB  . GLU A 1 256 ? 45.020  40.755  -36.919 1.00 60.55  ? 275 GLU C CB  1 
ATOM   1898  C CG  . GLU A 1 256 ? 45.008  40.047  -35.603 1.00 60.58  ? 275 GLU C CG  1 
ATOM   1899  C CD  . GLU A 1 256 ? 44.424  38.658  -35.707 1.00 61.29  ? 275 GLU C CD  1 
ATOM   1900  O OE1 . GLU A 1 256 ? 44.563  38.000  -36.767 1.00 60.63  ? 275 GLU C OE1 1 
ATOM   1901  O OE2 . GLU A 1 256 ? 43.814  38.210  -34.719 1.00 62.84  ? 275 GLU C OE2 1 
ATOM   1902  N N   . ARG A 1 257 ? 41.648  40.502  -36.863 1.00 68.22  ? 276 ARG C N   1 
ATOM   1903  C CA  . ARG A 1 257 ? 40.303  40.517  -36.303 1.00 72.18  ? 276 ARG C CA  1 
ATOM   1904  C C   . ARG A 1 257 ? 39.953  39.361  -35.383 1.00 72.77  ? 276 ARG C C   1 
ATOM   1905  O O   . ARG A 1 257 ? 38.777  39.000  -35.253 1.00 76.35  ? 276 ARG C O   1 
ATOM   1906  C CB  . ARG A 1 257 ? 39.255  40.630  -37.414 1.00 75.05  ? 276 ARG C CB  1 
ATOM   1907  C CG  . ARG A 1 257 ? 39.397  39.575  -38.473 1.00 74.09  ? 276 ARG C CG  1 
ATOM   1908  C CD  . ARG A 1 257 ? 38.062  39.163  -39.034 1.00 77.75  ? 276 ARG C CD  1 
ATOM   1909  N NE  . ARG A 1 257 ? 38.189  37.933  -39.810 1.00 77.12  ? 276 ARG C NE  1 
ATOM   1910  C CZ  . ARG A 1 257 ? 38.716  37.877  -41.031 1.00 75.43  ? 276 ARG C CZ  1 
ATOM   1911  N NH1 . ARG A 1 257 ? 39.164  38.985  -41.615 1.00 74.19  ? 276 ARG C NH1 1 
ATOM   1912  N NH2 . ARG A 1 257 ? 38.796  36.713  -41.669 1.00 75.25  ? 276 ARG C NH2 1 
ATOM   1913  N N   . VAL A 1 258 ? 40.963  38.788  -34.743 1.00 69.43  ? 277 VAL C N   1 
ATOM   1914  C CA  . VAL A 1 258 ? 40.730  37.789  -33.715 1.00 69.27  ? 277 VAL C CA  1 
ATOM   1915  C C   . VAL A 1 258 ? 41.298  38.322  -32.410 1.00 67.84  ? 277 VAL C C   1 
ATOM   1916  O O   . VAL A 1 258 ? 40.739  38.100  -31.352 1.00 69.95  ? 277 VAL C O   1 
ATOM   1917  C CB  . VAL A 1 258 ? 41.400  36.445  -34.055 1.00 66.71  ? 277 VAL C CB  1 
ATOM   1918  C CG1 . VAL A 1 258 ? 40.608  35.291  -33.476 1.00 68.86  ? 277 VAL C CG1 1 
ATOM   1919  C CG2 . VAL A 1 258 ? 41.533  36.288  -35.560 1.00 65.94  ? 277 VAL C CG2 1 
ATOM   1920  N N   . TYR A 1 259 ? 42.405  39.047  -32.497 1.00 64.67  ? 278 TYR C N   1 
ATOM   1921  C CA  . TYR A 1 259 ? 43.103  39.512  -31.308 1.00 63.37  ? 278 TYR C CA  1 
ATOM   1922  C C   . TYR A 1 259 ? 43.212  41.016  -31.280 1.00 64.05  ? 278 TYR C C   1 
ATOM   1923  O O   . TYR A 1 259 ? 43.860  41.575  -30.406 1.00 63.65  ? 278 TYR C O   1 
ATOM   1924  C CB  . TYR A 1 259 ? 44.506  38.910  -31.235 1.00 59.34  ? 278 TYR C CB  1 
ATOM   1925  C CG  . TYR A 1 259 ? 44.509  37.407  -31.262 1.00 58.20  ? 278 TYR C CG  1 
ATOM   1926  C CD1 . TYR A 1 259 ? 44.260  36.677  -30.111 1.00 58.94  ? 278 TYR C CD1 1 
ATOM   1927  C CD2 . TYR A 1 259 ? 44.760  36.714  -32.437 1.00 56.72  ? 278 TYR C CD2 1 
ATOM   1928  C CE1 . TYR A 1 259 ? 44.250  35.298  -30.126 1.00 58.11  ? 278 TYR C CE1 1 
ATOM   1929  C CE2 . TYR A 1 259 ? 44.757  35.330  -32.463 1.00 56.04  ? 278 TYR C CE2 1 
ATOM   1930  C CZ  . TYR A 1 259 ? 44.499  34.628  -31.303 1.00 56.65  ? 278 TYR C CZ  1 
ATOM   1931  O OH  . TYR A 1 259 ? 44.483  33.252  -31.311 1.00 56.10  ? 278 TYR C OH  1 
ATOM   1932  N N   . GLU A 1 260 ? 42.609  41.665  -32.263 1.00 65.23  ? 279 GLU C N   1 
ATOM   1933  C CA  . GLU A 1 260 ? 42.538  43.123  -32.292 1.00 66.73  ? 279 GLU C CA  1 
ATOM   1934  C C   . GLU A 1 260 ? 43.892  43.860  -32.329 1.00 64.25  ? 279 GLU C C   1 
ATOM   1935  O O   . GLU A 1 260 ? 43.944  45.039  -31.954 1.00 66.18  ? 279 GLU C O   1 
ATOM   1936  C CB  . GLU A 1 260 ? 41.714  43.629  -31.102 1.00 70.34  ? 279 GLU C CB  1 
ATOM   1937  C CG  . GLU A 1 260 ? 40.369  42.918  -30.903 1.00 73.20  ? 279 GLU C CG  1 
ATOM   1938  C CD  . GLU A 1 260 ? 39.199  43.756  -31.370 1.00 76.87  ? 279 GLU C CD  1 
ATOM   1939  O OE1 . GLU A 1 260 ? 39.265  44.995  -31.229 1.00 78.27  ? 279 GLU C OE1 1 
ATOM   1940  O OE2 . GLU A 1 260 ? 38.216  43.184  -31.886 1.00 78.64  ? 279 GLU C OE2 1 
ATOM   1941  N N   . PHE A 1 261 ? 44.968  43.189  -32.769 1.00 60.34  ? 280 PHE C N   1 
ATOM   1942  C CA  . PHE A 1 261 ? 46.288  43.829  -32.923 1.00 57.95  ? 280 PHE C CA  1 
ATOM   1943  C C   . PHE A 1 261 ? 46.197  44.948  -33.955 1.00 59.00  ? 280 PHE C C   1 
ATOM   1944  O O   . PHE A 1 261 ? 45.763  44.717  -35.083 1.00 59.10  ? 280 PHE C O   1 
ATOM   1945  C CB  . PHE A 1 261 ? 47.338  42.847  -33.455 1.00 54.13  ? 280 PHE C CB  1 
ATOM   1946  C CG  . PHE A 1 261 ? 47.537  41.616  -32.624 1.00 52.59  ? 280 PHE C CG  1 
ATOM   1947  C CD1 . PHE A 1 261 ? 47.595  40.365  -33.235 1.00 50.91  ? 280 PHE C CD1 1 
ATOM   1948  C CD2 . PHE A 1 261 ? 47.729  41.697  -31.253 1.00 53.04  ? 280 PHE C CD2 1 
ATOM   1949  C CE1 . PHE A 1 261 ? 47.805  39.209  -32.485 1.00 49.74  ? 280 PHE C CE1 1 
ATOM   1950  C CE2 . PHE A 1 261 ? 47.945  40.543  -30.491 1.00 51.65  ? 280 PHE C CE2 1 
ATOM   1951  C CZ  . PHE A 1 261 ? 47.982  39.300  -31.105 1.00 49.99  ? 280 PHE C CZ  1 
ATOM   1952  N N   . LEU A 1 262 ? 46.625  46.150  -33.596 1.00 59.97  ? 281 LEU C N   1 
ATOM   1953  C CA  . LEU A 1 262 ? 46.599  47.260  -34.540 1.00 60.91  ? 281 LEU C CA  1 
ATOM   1954  C C   . LEU A 1 262 ? 47.993  47.474  -35.084 1.00 58.58  ? 281 LEU C C   1 
ATOM   1955  O O   . LEU A 1 262 ? 48.965  47.164  -34.411 1.00 56.96  ? 281 LEU C O   1 
ATOM   1956  C CB  . LEU A 1 262 ? 46.131  48.532  -33.839 1.00 64.31  ? 281 LEU C CB  1 
ATOM   1957  C CG  . LEU A 1 262 ? 44.657  48.584  -33.463 1.00 67.39  ? 281 LEU C CG  1 
ATOM   1958  C CD1 . LEU A 1 262 ? 44.440  49.514  -32.289 1.00 70.58  ? 281 LEU C CD1 1 
ATOM   1959  C CD2 . LEU A 1 262 ? 43.848  49.027  -34.678 1.00 68.66  ? 281 LEU C CD2 1 
ATOM   1960  N N   . SER A 1 263 ? 48.106  47.995  -36.296 1.00 57.48  ? 282 SER C N   1 
ATOM   1961  C CA  . SER A 1 263 ? 49.397  48.480  -36.756 1.00 56.42  ? 282 SER C CA  1 
ATOM   1962  C C   . SER A 1 263 ? 49.386  49.993  -36.618 1.00 63.17  ? 282 SER C C   1 
ATOM   1963  O O   . SER A 1 263 ? 48.404  50.570  -36.136 1.00 65.72  ? 282 SER C O   1 
ATOM   1964  C CB  . SER A 1 263 ? 49.653  48.077  -38.202 1.00 54.97  ? 282 SER C CB  1 
ATOM   1965  O OG  . SER A 1 263 ? 48.815  48.776  -39.100 1.00 56.81  ? 282 SER C OG  1 
ATOM   1966  N N   . ALA A 1 264 ? 50.467  50.644  -37.029 1.00 63.46  ? 283 ALA C N   1 
ATOM   1967  C CA  . ALA A 1 264 ? 50.498  52.099  -37.020 1.00 65.74  ? 283 ALA C CA  1 
ATOM   1968  C C   . ALA A 1 264 ? 49.718  52.578  -38.232 1.00 66.22  ? 283 ALA C C   1 
ATOM   1969  O O   . ALA A 1 264 ? 49.508  51.805  -39.167 1.00 64.22  ? 283 ALA C O   1 
ATOM   1970  C CB  . ALA A 1 264 ? 51.920  52.594  -37.085 1.00 61.99  ? 283 ALA C CB  1 
ATOM   1971  N N   . TRP A 1 265 ? 49.272  53.836  -38.215 1.00 69.38  ? 284 TRP C N   1 
ATOM   1972  C CA  . TRP A 1 265 ? 48.631  54.426  -39.387 1.00 70.83  ? 284 TRP C CA  1 
ATOM   1973  C C   . TRP A 1 265 ? 49.700  54.662  -40.446 1.00 70.02  ? 284 TRP C C   1 
ATOM   1974  O O   . TRP A 1 265 ? 50.813  55.058  -40.120 1.00 70.38  ? 284 TRP C O   1 
ATOM   1975  C CB  . TRP A 1 265 ? 47.933  55.748  -39.038 1.00 74.73  ? 284 TRP C CB  1 
ATOM   1976  C CG  . TRP A 1 265 ? 46.721  55.609  -38.153 1.00 76.30  ? 284 TRP C CG  1 
ATOM   1977  C CD1 . TRP A 1 265 ? 46.688  55.666  -36.787 1.00 77.51  ? 284 TRP C CD1 1 
ATOM   1978  C CD2 . TRP A 1 265 ? 45.365  55.406  -38.576 1.00 77.23  ? 284 TRP C CD2 1 
ATOM   1979  N NE1 . TRP A 1 265 ? 45.400  55.502  -36.334 1.00 79.26  ? 284 TRP C NE1 1 
ATOM   1980  C CE2 . TRP A 1 265 ? 44.568  55.340  -37.411 1.00 79.17  ? 284 TRP C CE2 1 
ATOM   1981  C CE3 . TRP A 1 265 ? 44.748  55.262  -39.826 1.00 76.77  ? 284 TRP C CE3 1 
ATOM   1982  C CZ2 . TRP A 1 265 ? 43.183  55.139  -37.461 1.00 80.85  ? 284 TRP C CZ2 1 
ATOM   1983  C CZ3 . TRP A 1 265 ? 43.372  55.060  -39.871 1.00 78.32  ? 284 TRP C CZ3 1 
ATOM   1984  C CH2 . TRP A 1 265 ? 42.607  55.002  -38.696 1.00 80.40  ? 284 TRP C CH2 1 
ATOM   1985  N N   . SER A 1 266 ? 49.374  54.397  -41.706 1.00 69.27  ? 285 SER C N   1 
ATOM   1986  C CA  . SER A 1 266 ? 50.287  54.700  -42.797 1.00 65.52  ? 285 SER C CA  1 
ATOM   1987  C C   . SER A 1 266 ? 50.571  56.197  -42.788 1.00 77.03  ? 285 SER C C   1 
ATOM   1988  O O   . SER A 1 266 ? 49.719  56.992  -42.379 1.00 79.43  ? 285 SER C O   1 
ATOM   1989  C CB  . SER A 1 266 ? 49.675  54.289  -44.140 1.00 64.88  ? 285 SER C CB  1 
ATOM   1990  O OG  . SER A 1 266 ? 48.551  55.089  -44.480 1.00 67.15  ? 285 SER C OG  1 
ATOM   1991  N N   . THR A 1 267 ? 51.769  56.587  -43.216 1.00 77.07  ? 286 THR C N   1 
ATOM   1992  C CA  . THR A 1 267 ? 52.093  58.009  -43.335 1.00 80.01  ? 286 THR C CA  1 
ATOM   1993  C C   . THR A 1 267 ? 51.274  58.600  -44.488 1.00 81.13  ? 286 THR C C   1 
ATOM   1994  O O   . THR A 1 267 ? 51.427  58.181  -45.640 1.00 80.10  ? 286 THR C O   1 
ATOM   1995  C CB  . THR A 1 267 ? 53.622  58.256  -43.509 1.00 90.30  ? 286 THR C CB  1 
ATOM   1996  O OG1 . THR A 1 267 ? 54.114  57.535  -44.646 1.00 88.45  ? 286 THR C OG1 1 
ATOM   1997  C CG2 . THR A 1 267 ? 54.382  57.799  -42.262 1.00 89.40  ? 286 THR C CG2 1 
ATOM   1998  N N   . PRO A 1 268 ? 50.379  59.551  -44.164 1.00 83.49  ? 287 PRO C N   1 
ATOM   1999  C CA  . PRO A 1 268 ? 49.350  60.125  -45.045 1.00 84.88  ? 287 PRO C CA  1 
ATOM   2000  C C   . PRO A 1 268 ? 49.746  60.331  -46.514 1.00 84.76  ? 287 PRO C C   1 
ATOM   2001  O O   . PRO A 1 268 ? 50.910  60.600  -46.822 1.00 85.06  ? 287 PRO C O   1 
ATOM   2002  C CB  . PRO A 1 268 ? 49.049  61.467  -44.374 1.00 81.49  ? 287 PRO C CB  1 
ATOM   2003  C CG  . PRO A 1 268 ? 49.202  61.171  -42.937 1.00 81.42  ? 287 PRO C CG  1 
ATOM   2004  C CD  . PRO A 1 268 ? 50.336  60.171  -42.828 1.00 85.54  ? 287 PRO C CD  1 
ATOM   2005  N N   . GLN A 1 269 ? 48.759  60.195  -47.402 1.00 84.55  ? 288 GLN C N   1 
ATOM   2006  C CA  . GLN A 1 269 ? 48.934  60.413  -48.843 1.00 84.58  ? 288 GLN C CA  1 
ATOM   2007  C C   . GLN A 1 269 ? 47.789  61.237  -49.434 1.00 86.58  ? 288 GLN C C   1 
ATOM   2008  O O   . GLN A 1 269 ? 46.715  61.300  -48.849 1.00 87.11  ? 288 GLN C O   1 
ATOM   2009  C CB  . GLN A 1 269 ? 49.029  59.073  -49.566 1.00 81.45  ? 288 GLN C CB  1 
ATOM   2010  C CG  . GLN A 1 269 ? 50.335  58.349  -49.331 1.00 79.22  ? 288 GLN C CG  1 
ATOM   2011  C CD  . GLN A 1 269 ? 50.258  56.897  -49.740 1.00 76.06  ? 288 GLN C CD  1 
ATOM   2012  O OE1 . GLN A 1 269 ? 49.657  56.081  -49.042 1.00 74.49  ? 288 GLN C OE1 1 
ATOM   2013  N NE2 . GLN A 1 269 ? 50.862  56.564  -50.878 1.00 75.49  ? 288 GLN C NE2 1 
ATOM   2014  N N   . ARG A 1 270 ? 48.018  61.852  -50.596 1.00 87.98  ? 289 ARG C N   1 
ATOM   2015  C CA  . ARG A 1 270 ? 46.989  62.662  -51.264 1.00 83.38  ? 289 ARG C CA  1 
ATOM   2016  C C   . ARG A 1 270 ? 46.873  62.387  -52.761 1.00 82.82  ? 289 ARG C C   1 
ATOM   2017  O O   . ARG A 1 270 ? 45.843  62.672  -53.375 1.00 83.89  ? 289 ARG C O   1 
ATOM   2018  C CB  . ARG A 1 270 ? 47.276  64.136  -51.050 1.00 86.82  ? 289 ARG C CB  1 
ATOM   2019  C CG  . ARG A 1 270 ? 48.672  64.529  -51.481 1.00 88.81  ? 289 ARG C CG  1 
ATOM   2020  C CD  . ARG A 1 270 ? 49.066  65.878  -50.892 1.00 92.42  ? 289 ARG C CD  1 
ATOM   2021  N NE  . ARG A 1 270 ? 47.997  66.861  -51.053 1.00 95.13  ? 289 ARG C NE  1 
ATOM   2022  C CZ  . ARG A 1 270 ? 47.421  67.505  -50.044 1.00 97.32  ? 289 ARG C CZ  1 
ATOM   2023  N NH1 . ARG A 1 270 ? 47.830  67.276  -48.798 1.00 97.20  ? 289 ARG C NH1 1 
ATOM   2024  N NH2 . ARG A 1 270 ? 46.450  68.383  -50.281 1.00 99.81  ? 289 ARG C NH2 1 
ATOM   2025  N N   . PRO B 1 6   ? 5.860   15.034  -58.044 1.00 94.68  ? 25  PRO D N   1 
ATOM   2026  C CA  . PRO B 1 6   ? 4.506   15.483  -58.411 1.00 88.14  ? 25  PRO D CA  1 
ATOM   2027  C C   . PRO B 1 6   ? 3.426   14.442  -58.068 1.00 86.88  ? 25  PRO D C   1 
ATOM   2028  O O   . PRO B 1 6   ? 2.719   13.993  -58.970 1.00 88.06  ? 25  PRO D O   1 
ATOM   2029  C CB  . PRO B 1 6   ? 4.605   15.685  -59.929 1.00 95.32  ? 25  PRO D CB  1 
ATOM   2030  C CG  . PRO B 1 6   ? 5.861   14.897  -60.370 1.00 99.73  ? 25  PRO D CG  1 
ATOM   2031  C CD  . PRO B 1 6   ? 6.780   14.965  -59.201 1.00 95.86  ? 25  PRO D CD  1 
ATOM   2032  N N   . PRO B 1 7   ? 3.273   14.113  -56.765 1.00 87.20  ? 26  PRO D N   1 
ATOM   2033  C CA  . PRO B 1 7   ? 2.632   12.907  -56.197 1.00 86.96  ? 26  PRO D CA  1 
ATOM   2034  C C   . PRO B 1 7   ? 1.119   12.736  -56.356 1.00 84.51  ? 26  PRO D C   1 
ATOM   2035  O O   . PRO B 1 7   ? 0.612   11.649  -56.068 1.00 82.68  ? 26  PRO D O   1 
ATOM   2036  C CB  . PRO B 1 7   ? 2.976   13.000  -54.709 1.00 82.59  ? 26  PRO D CB  1 
ATOM   2037  C CG  . PRO B 1 7   ? 3.143   14.435  -54.454 1.00 79.82  ? 26  PRO D CG  1 
ATOM   2038  C CD  . PRO B 1 7   ? 3.720   15.034  -55.701 1.00 84.70  ? 26  PRO D CD  1 
ATOM   2039  N N   . ILE B 1 8   ? 0.419   13.779  -56.790 1.00 82.09  ? 27  ILE D N   1 
ATOM   2040  C CA  . ILE B 1 8   ? -1.027  13.701  -57.011 1.00 79.98  ? 27  ILE D CA  1 
ATOM   2041  C C   . ILE B 1 8   ? -1.486  14.569  -58.189 1.00 77.65  ? 27  ILE D C   1 
ATOM   2042  O O   . ILE B 1 8   ? -1.118  15.739  -58.323 1.00 76.71  ? 27  ILE D O   1 
ATOM   2043  C CB  . ILE B 1 8   ? -1.833  14.016  -55.713 1.00 81.22  ? 27  ILE D CB  1 
ATOM   2044  C CG1 . ILE B 1 8   ? -2.220  12.720  -55.004 1.00 81.70  ? 27  ILE D CG1 1 
ATOM   2045  C CG2 . ILE B 1 8   ? -3.107  14.813  -56.007 1.00 78.36  ? 27  ILE D CG2 1 
ATOM   2046  C CD1 . ILE B 1 8   ? -3.212  12.934  -53.894 1.00 77.93  ? 27  ILE D CD1 1 
ATOM   2047  N N   . THR B 1 9   ? -2.285  13.973  -59.056 1.00 79.20  ? 28  THR D N   1 
ATOM   2048  C CA  . THR B 1 9   ? -2.725  14.657  -60.253 1.00 86.17  ? 28  THR D CA  1 
ATOM   2049  C C   . THR B 1 9   ? -4.185  14.336  -60.540 1.00 85.30  ? 28  THR D C   1 
ATOM   2050  O O   . THR B 1 9   ? -4.735  13.373  -59.997 1.00 78.73  ? 28  THR D O   1 
ATOM   2051  C CB  . THR B 1 9   ? -1.850  14.272  -61.487 1.00 86.11  ? 28  THR D CB  1 
ATOM   2052  O OG1 . THR B 1 9   ? -1.709  12.844  -61.568 1.00 87.95  ? 28  THR D OG1 1 
ATOM   2053  C CG2 . THR B 1 9   ? -0.473  14.912  -61.391 1.00 87.10  ? 28  THR D CG2 1 
ATOM   2054  N N   . ASN B 1 10  ? -4.798  15.153  -61.396 1.00 85.33  ? 29  ASN D N   1 
ATOM   2055  C CA  . ASN B 1 10  ? -6.147  14.896  -61.899 1.00 85.32  ? 29  ASN D CA  1 
ATOM   2056  C C   . ASN B 1 10  ? -7.157  14.791  -60.746 1.00 81.10  ? 29  ASN D C   1 
ATOM   2057  O O   . ASN B 1 10  ? -8.072  13.955  -60.744 1.00 81.07  ? 29  ASN D O   1 
ATOM   2058  C CB  . ASN B 1 10  ? -6.152  13.669  -62.833 1.00 89.94  ? 29  ASN D CB  1 
ATOM   2059  C CG  . ASN B 1 10  ? -7.521  13.365  -63.392 1.00 90.69  ? 29  ASN D CG  1 
ATOM   2060  O OD1 . ASN B 1 10  ? -7.943  12.209  -63.434 1.00 92.30  ? 29  ASN D OD1 1 
ATOM   2061  N ND2 . ASN B 1 10  ? -8.242  14.409  -63.788 1.00 89.64  ? 29  ASN D ND2 1 
ATOM   2062  N N   . LEU B 1 11  ? -6.936  15.660  -59.760 1.00 77.96  ? 30  LEU D N   1 
ATOM   2063  C CA  . LEU B 1 11  ? -7.829  15.884  -58.639 1.00 74.37  ? 30  LEU D CA  1 
ATOM   2064  C C   . LEU B 1 11  ? -9.110  16.477  -59.182 1.00 74.00  ? 30  LEU D C   1 
ATOM   2065  O O   . LEU B 1 11  ? -9.083  17.516  -59.839 1.00 74.35  ? 30  LEU D O   1 
ATOM   2066  C CB  . LEU B 1 11  ? -7.184  16.904  -57.709 1.00 65.26  ? 30  LEU D CB  1 
ATOM   2067  C CG  . LEU B 1 11  ? -7.497  17.007  -56.209 1.00 64.59  ? 30  LEU D CG  1 
ATOM   2068  C CD1 . LEU B 1 11  ? -6.814  18.234  -55.651 1.00 61.67  ? 30  LEU D CD1 1 
ATOM   2069  C CD2 . LEU B 1 11  ? -8.976  17.056  -55.900 1.00 62.19  ? 30  LEU D CD2 1 
ATOM   2070  N N   . ARG B 1 12  ? -10.231 15.825  -58.908 1.00 73.59  ? 31  ARG D N   1 
ATOM   2071  C CA  . ARG B 1 12  ? -11.530 16.353  -59.298 1.00 73.22  ? 31  ARG D CA  1 
ATOM   2072  C C   . ARG B 1 12  ? -12.570 15.744  -58.404 1.00 70.98  ? 31  ARG D C   1 
ATOM   2073  O O   . ARG B 1 12  ? -12.303 14.751  -57.737 1.00 71.03  ? 31  ARG D O   1 
ATOM   2074  C CB  . ARG B 1 12  ? -11.846 16.008  -60.754 1.00 77.58  ? 31  ARG D CB  1 
ATOM   2075  C CG  . ARG B 1 12  ? -11.551 17.137  -61.730 1.00 79.39  ? 31  ARG D CG  1 
ATOM   2076  C CD  . ARG B 1 12  ? -12.012 16.808  -63.147 1.00 83.77  ? 31  ARG D CD  1 
ATOM   2077  N NE  . ARG B 1 12  ? -11.166 17.466  -64.142 1.00 86.75  ? 31  ARG D NE  1 
ATOM   2078  C CZ  . ARG B 1 12  ? -11.370 17.418  -65.455 1.00 90.79  ? 31  ARG D CZ  1 
ATOM   2079  N NH1 . ARG B 1 12  ? -12.403 16.742  -65.934 1.00 92.43  ? 31  ARG D NH1 1 
ATOM   2080  N NH2 . ARG B 1 12  ? -10.543 18.046  -66.292 1.00 93.45  ? 31  ARG D NH2 1 
ATOM   2081  N N   . MET B 1 13  ? -13.763 16.317  -58.385 1.00 69.38  ? 32  MET D N   1 
ATOM   2082  C CA  . MET B 1 13  ? -14.792 15.718  -57.560 1.00 67.68  ? 32  MET D CA  1 
ATOM   2083  C C   . MET B 1 13  ? -15.931 15.051  -58.299 1.00 69.76  ? 32  MET D C   1 
ATOM   2084  O O   . MET B 1 13  ? -16.382 15.532  -59.334 1.00 71.47  ? 32  MET D O   1 
ATOM   2085  C CB  . MET B 1 13  ? -15.369 16.705  -56.555 1.00 63.90  ? 32  MET D CB  1 
ATOM   2086  C CG  . MET B 1 13  ? -16.039 15.957  -55.420 1.00 62.14  ? 32  MET D CG  1 
ATOM   2087  S SD  . MET B 1 13  ? -16.931 16.993  -54.313 1.00 68.54  ? 32  MET D SD  1 
ATOM   2088  C CE  . MET B 1 13  ? -15.616 18.071  -53.772 1.00 54.74  ? 32  MET D CE  1 
ATOM   2089  N N   . LYS B 1 14  ? -16.382 13.934  -57.740 1.00 62.72  ? 33  LYS D N   1 
ATOM   2090  C CA  . LYS B 1 14  ? -17.598 13.270  -58.167 1.00 64.32  ? 33  LYS D CA  1 
ATOM   2091  C C   . LYS B 1 14  ? -18.791 13.880  -57.428 1.00 61.52  ? 33  LYS D C   1 
ATOM   2092  O O   . LYS B 1 14  ? -19.125 13.426  -56.347 1.00 59.77  ? 33  LYS D O   1 
ATOM   2093  C CB  . LYS B 1 14  ? -17.513 11.774  -57.834 1.00 66.54  ? 33  LYS D CB  1 
ATOM   2094  C CG  . LYS B 1 14  ? -16.165 11.101  -58.149 1.00 68.20  ? 33  LYS D CG  1 
ATOM   2095  C CD  . LYS B 1 14  ? -16.225 9.581   -57.892 1.00 73.27  ? 33  LYS D CD  1 
ATOM   2096  C CE  . LYS B 1 14  ? -14.908 8.849   -58.213 1.00 76.03  ? 33  LYS D CE  1 
ATOM   2097  N NZ  . LYS B 1 14  ? -14.568 8.733   -59.682 1.00 79.77  ? 33  LYS D NZ  1 
ATOM   2098  N N   . ALA B 1 15  ? -19.428 14.898  -58.007 1.00 61.43  ? 34  ALA D N   1 
ATOM   2099  C CA  . ALA B 1 15  ? -20.556 15.591  -57.373 1.00 59.08  ? 34  ALA D CA  1 
ATOM   2100  C C   . ALA B 1 15  ? -21.680 14.628  -57.011 1.00 63.54  ? 34  ALA D C   1 
ATOM   2101  O O   . ALA B 1 15  ? -22.296 14.711  -55.939 1.00 61.23  ? 34  ALA D O   1 
ATOM   2102  C CB  . ALA B 1 15  ? -21.077 16.674  -58.294 1.00 60.11  ? 34  ALA D CB  1 
ATOM   2103  N N   . LYS B 1 16  ? -21.943 13.738  -57.955 1.00 67.00  ? 35  LYS D N   1 
ATOM   2104  C CA  . LYS B 1 16  ? -22.775 12.555  -57.794 1.00 68.62  ? 35  LYS D CA  1 
ATOM   2105  C C   . LYS B 1 16  ? -22.542 11.866  -56.451 1.00 66.67  ? 35  LYS D C   1 
ATOM   2106  O O   . LYS B 1 16  ? -23.318 12.008  -55.518 1.00 60.41  ? 35  LYS D O   1 
ATOM   2107  C CB  . LYS B 1 16  ? -22.417 11.590  -58.936 1.00 72.81  ? 35  LYS D CB  1 
ATOM   2108  C CG  . LYS B 1 16  ? -20.940 11.724  -59.408 1.00 69.33  ? 35  LYS D CG  1 
ATOM   2109  C CD  . LYS B 1 16  ? -20.631 10.944  -60.681 1.00 79.37  ? 35  LYS D CD  1 
ATOM   2110  C CE  . LYS B 1 16  ? -21.206 11.623  -61.929 1.00 81.76  ? 35  LYS D CE  1 
ATOM   2111  N NZ  . LYS B 1 16  ? -21.071 10.794  -63.167 1.00 80.96  ? 35  LYS D NZ  1 
ATOM   2112  N N   . ALA B 1 17  ? -21.442 11.128  -56.376 1.00 67.42  ? 36  ALA D N   1 
ATOM   2113  C CA  . ALA B 1 17  ? -21.088 10.317  -55.221 1.00 66.26  ? 36  ALA D CA  1 
ATOM   2114  C C   . ALA B 1 17  ? -20.623 11.153  -54.039 1.00 62.28  ? 36  ALA D C   1 
ATOM   2115  O O   . ALA B 1 17  ? -20.397 10.620  -52.950 1.00 61.52  ? 36  ALA D O   1 
ATOM   2116  C CB  . ALA B 1 17  ? -19.991 9.320   -55.617 1.00 69.07  ? 36  ALA D CB  1 
ATOM   2117  N N   . GLN B 1 18  ? -20.472 12.457  -54.267 1.00 60.13  ? 37  GLN D N   1 
ATOM   2118  C CA  . GLN B 1 18  ? -19.886 13.396  -53.296 1.00 56.57  ? 37  GLN D CA  1 
ATOM   2119  C C   . GLN B 1 18  ? -18.491 13.005  -52.786 1.00 56.23  ? 37  GLN D C   1 
ATOM   2120  O O   . GLN B 1 18  ? -18.227 13.039  -51.588 1.00 54.35  ? 37  GLN D O   1 
ATOM   2121  C CB  . GLN B 1 18  ? -20.852 13.677  -52.143 1.00 54.14  ? 37  GLN D CB  1 
ATOM   2122  C CG  . GLN B 1 18  ? -22.153 14.317  -52.621 1.00 54.08  ? 37  GLN D CG  1 
ATOM   2123  C CD  . GLN B 1 18  ? -22.933 14.996  -51.503 1.00 51.31  ? 37  GLN D CD  1 
ATOM   2124  O OE1 . GLN B 1 18  ? -22.984 16.234  -51.421 1.00 49.24  ? 37  GLN D OE1 1 
ATOM   2125  N NE2 . GLN B 1 18  ? -23.563 14.187  -50.646 1.00 51.32  ? 37  GLN D NE2 1 
ATOM   2126  N N   . GLN B 1 19  ? -17.600 12.663  -53.714 1.00 58.47  ? 38  GLN D N   1 
ATOM   2127  C CA  . GLN B 1 19  ? -16.267 12.206  -53.367 1.00 56.93  ? 38  GLN D CA  1 
ATOM   2128  C C   . GLN B 1 19  ? -15.178 12.958  -54.106 1.00 57.44  ? 38  GLN D C   1 
ATOM   2129  O O   . GLN B 1 19  ? -15.149 12.960  -55.327 1.00 65.25  ? 38  GLN D O   1 
ATOM   2130  C CB  . GLN B 1 19  ? -16.131 10.741  -53.713 1.00 60.22  ? 38  GLN D CB  1 
ATOM   2131  C CG  . GLN B 1 19  ? -17.175 9.858   -53.108 1.00 60.47  ? 38  GLN D CG  1 
ATOM   2132  C CD  . GLN B 1 19  ? -16.852 8.402   -53.342 1.00 69.07  ? 38  GLN D CD  1 
ATOM   2133  O OE1 . GLN B 1 19  ? -15.912 8.071   -54.074 1.00 71.33  ? 38  GLN D OE1 1 
ATOM   2134  N NE2 . GLN B 1 19  ? -17.616 7.521   -52.713 1.00 69.73  ? 38  GLN D NE2 1 
ATOM   2135  N N   . LEU B 1 20  ? -14.268 13.574  -53.359 1.00 55.66  ? 39  LEU D N   1 
ATOM   2136  C CA  . LEU B 1 20  ? -13.095 14.206  -53.937 1.00 56.38  ? 39  LEU D CA  1 
ATOM   2137  C C   . LEU B 1 20  ? -12.064 13.127  -54.252 1.00 67.05  ? 39  LEU D C   1 
ATOM   2138  O O   . LEU B 1 20  ? -11.539 12.504  -53.327 1.00 67.11  ? 39  LEU D O   1 
ATOM   2139  C CB  . LEU B 1 20  ? -12.506 15.185  -52.938 1.00 53.61  ? 39  LEU D CB  1 
ATOM   2140  C CG  . LEU B 1 20  ? -11.509 16.195  -53.484 1.00 53.80  ? 39  LEU D CG  1 
ATOM   2141  C CD1 . LEU B 1 20  ? -12.277 17.170  -54.335 1.00 59.43  ? 39  LEU D CD1 1 
ATOM   2142  C CD2 . LEU B 1 20  ? -10.724 16.917  -52.383 1.00 51.64  ? 39  LEU D CD2 1 
ATOM   2143  N N   . THR B 1 21  ? -11.785 12.894  -55.542 1.00 69.95  ? 40  THR D N   1 
ATOM   2144  C CA  . THR B 1 21  ? -10.815 11.867  -55.965 1.00 65.85  ? 40  THR D CA  1 
ATOM   2145  C C   . THR B 1 21  ? -9.625  12.439  -56.739 1.00 76.97  ? 40  THR D C   1 
ATOM   2146  O O   . THR B 1 21  ? -9.612  13.604  -57.147 1.00 66.35  ? 40  THR D O   1 
ATOM   2147  C CB  . THR B 1 21  ? -11.447 10.750  -56.857 1.00 69.07  ? 40  THR D CB  1 
ATOM   2148  O OG1 . THR B 1 21  ? -12.861 10.690  -56.661 1.00 70.06  ? 40  THR D OG1 1 
ATOM   2149  C CG2 . THR B 1 21  ? -10.835 9.379   -56.557 1.00 71.72  ? 40  THR D CG2 1 
ATOM   2150  N N   . TRP B 1 22  ? -8.636  11.577  -56.950 1.00 79.57  ? 41  TRP D N   1 
ATOM   2151  C CA  . TRP B 1 22  ? -7.403  11.925  -57.633 1.00 81.67  ? 41  TRP D CA  1 
ATOM   2152  C C   . TRP B 1 22  ? -6.755  10.648  -58.192 1.00 86.01  ? 41  TRP D C   1 
ATOM   2153  O O   . TRP B 1 22  ? -7.414  9.604   -58.301 1.00 87.44  ? 41  TRP D O   1 
ATOM   2154  C CB  . TRP B 1 22  ? -6.455  12.600  -56.647 1.00 79.76  ? 41  TRP D CB  1 
ATOM   2155  C CG  . TRP B 1 22  ? -6.309  11.801  -55.408 1.00 79.36  ? 41  TRP D CG  1 
ATOM   2156  C CD1 . TRP B 1 22  ? -5.489  10.728  -55.220 1.00 82.34  ? 41  TRP D CD1 1 
ATOM   2157  C CD2 . TRP B 1 22  ? -7.027  11.983  -54.174 1.00 76.30  ? 41  TRP D CD2 1 
ATOM   2158  N NE1 . TRP B 1 22  ? -5.641  10.234  -53.943 1.00 81.33  ? 41  TRP D NE1 1 
ATOM   2159  C CE2 . TRP B 1 22  ? -6.577  10.989  -53.280 1.00 77.55  ? 41  TRP D CE2 1 
ATOM   2160  C CE3 . TRP B 1 22  ? -8.003  12.894  -53.737 1.00 72.68  ? 41  TRP D CE3 1 
ATOM   2161  C CZ2 . TRP B 1 22  ? -7.071  10.879  -51.977 1.00 75.25  ? 41  TRP D CZ2 1 
ATOM   2162  C CZ3 . TRP B 1 22  ? -8.490  12.779  -52.449 1.00 70.27  ? 41  TRP D CZ3 1 
ATOM   2163  C CH2 . TRP B 1 22  ? -8.025  11.781  -51.585 1.00 71.58  ? 41  TRP D CH2 1 
ATOM   2164  N N   . ASP B 1 23  ? -5.467  10.752  -58.537 1.00 88.22  ? 42  ASP D N   1 
ATOM   2165  C CA  . ASP B 1 23  ? -4.641  9.620   -58.968 1.00 92.29  ? 42  ASP D CA  1 
ATOM   2166  C C   . ASP B 1 23  ? -3.320  9.582   -58.200 1.00 92.57  ? 42  ASP D C   1 
ATOM   2167  O O   . ASP B 1 23  ? -2.697  10.620  -57.972 1.00 91.06  ? 42  ASP D O   1 
ATOM   2168  C CB  . ASP B 1 23  ? -4.351  9.711   -60.467 1.00 95.84  ? 42  ASP D CB  1 
ATOM   2169  C CG  . ASP B 1 23  ? -5.607  9.653   -61.305 1.00 96.17  ? 42  ASP D CG  1 
ATOM   2170  O OD1 . ASP B 1 23  ? -6.578  9.001   -60.859 1.00 95.06  ? 42  ASP D OD1 1 
ATOM   2171  O OD2 . ASP B 1 23  ? -5.623  10.260  -62.400 1.00 97.74  ? 42  ASP D OD2 1 
ATOM   2172  N N   . LEU B 1 24  ? -2.894  8.383   -57.814 1.00 94.95  ? 43  LEU D N   1 
ATOM   2173  C CA  . LEU B 1 24  ? -1.649  8.201   -57.064 1.00 96.04  ? 43  LEU D CA  1 
ATOM   2174  C C   . LEU B 1 24  ? -0.437  7.881   -57.958 1.00 100.63 ? 43  LEU D C   1 
ATOM   2175  O O   . LEU B 1 24  ? -0.455  6.918   -58.724 1.00 104.31 ? 43  LEU D O   1 
ATOM   2176  C CB  . LEU B 1 24  ? -1.826  7.105   -56.013 1.00 96.43  ? 43  LEU D CB  1 
ATOM   2177  C CG  . LEU B 1 24  ? -2.383  7.547   -54.667 1.00 83.99  ? 43  LEU D CG  1 
ATOM   2178  C CD1 . LEU B 1 24  ? -2.764  6.343   -53.818 1.00 85.10  ? 43  LEU D CD1 1 
ATOM   2179  C CD2 . LEU B 1 24  ? -1.352  8.397   -53.963 1.00 84.29  ? 43  LEU D CD2 1 
ATOM   2180  N N   . ASN B 1 25  ? 0.624   8.679   -57.829 1.00 100.49 ? 44  ASN D N   1 
ATOM   2181  C CA  . ASN B 1 25  ? 1.801   8.575   -58.696 1.00 104.56 ? 44  ASN D CA  1 
ATOM   2182  C C   . ASN B 1 25  ? 3.045   7.996   -58.007 1.00 107.17 ? 44  ASN D C   1 
ATOM   2183  O O   . ASN B 1 25  ? 3.943   7.457   -58.664 1.00 111.64 ? 44  ASN D O   1 
ATOM   2184  C CB  . ASN B 1 25  ? 2.121   9.944   -59.308 1.00 103.44 ? 44  ASN D CB  1 
ATOM   2185  C CG  . ASN B 1 25  ? 0.998   10.467  -60.193 1.00 102.09 ? 44  ASN D CG  1 
ATOM   2186  O OD1 . ASN B 1 25  ? 0.384   9.714   -60.954 1.00 104.22 ? 44  ASN D OD1 1 
ATOM   2187  N ND2 . ASN B 1 25  ? 0.724   11.765  -60.094 1.00 98.83  ? 44  ASN D ND2 1 
ATOM   2188  N N   . ARG B 1 26  ? 3.091   8.129   -56.687 1.00 104.81 ? 45  ARG D N   1 
ATOM   2189  C CA  . ARG B 1 26  ? 4.152   7.556   -55.871 1.00 107.66 ? 45  ARG D CA  1 
ATOM   2190  C C   . ARG B 1 26  ? 3.539   7.168   -54.531 1.00 105.46 ? 45  ARG D C   1 
ATOM   2191  O O   . ARG B 1 26  ? 2.561   7.777   -54.091 1.00 101.11 ? 45  ARG D O   1 
ATOM   2192  C CB  . ARG B 1 26  ? 5.294   8.558   -55.681 1.00 107.75 ? 45  ARG D CB  1 
ATOM   2193  C CG  . ARG B 1 26  ? 4.849   9.889   -55.121 1.00 102.97 ? 45  ARG D CG  1 
ATOM   2194  C CD  . ARG B 1 26  ? 5.802   11.015  -55.472 1.00 103.58 ? 45  ARG D CD  1 
ATOM   2195  N NE  . ARG B 1 26  ? 6.964   11.069  -54.589 1.00 105.41 ? 45  ARG D NE  1 
ATOM   2196  C CZ  . ARG B 1 26  ? 7.667   12.175  -54.350 1.00 104.70 ? 45  ARG D CZ  1 
ATOM   2197  N NH1 . ARG B 1 26  ? 7.310   13.318  -54.923 1.00 102.38 ? 45  ARG D NH1 1 
ATOM   2198  N NH2 . ARG B 1 26  ? 8.719   12.144  -53.538 1.00 106.42 ? 45  ARG D NH2 1 
ATOM   2199  N N   . ASN B 1 27  ? 4.099   6.144   -53.895 1.00 108.62 ? 46  ASN D N   1 
ATOM   2200  C CA  . ASN B 1 27  ? 3.574   5.638   -52.627 1.00 107.16 ? 46  ASN D CA  1 
ATOM   2201  C C   . ASN B 1 27  ? 3.652   6.690   -51.521 1.00 103.72 ? 46  ASN D C   1 
ATOM   2202  O O   . ASN B 1 27  ? 4.736   7.105   -51.116 1.00 104.78 ? 46  ASN D O   1 
ATOM   2203  C CB  . ASN B 1 27  ? 4.305   4.353   -52.227 1.00 111.93 ? 46  ASN D CB  1 
ATOM   2204  C CG  . ASN B 1 27  ? 4.003   3.195   -53.171 1.00 115.40 ? 46  ASN D CG  1 
ATOM   2205  O OD1 . ASN B 1 27  ? 2.837   2.857   -53.387 1.00 113.85 ? 46  ASN D OD1 1 
ATOM   2206  N ND2 . ASN B 1 27  ? 5.049   2.596   -53.750 1.00 120.20 ? 46  ASN D ND2 1 
ATOM   2207  N N   . VAL B 1 28  ? 2.492   7.125   -51.039 1.00 99.96  ? 47  VAL D N   1 
ATOM   2208  C CA  . VAL B 1 28  ? 2.434   8.254   -50.120 1.00 96.44  ? 47  VAL D CA  1 
ATOM   2209  C C   . VAL B 1 28  ? 1.950   7.834   -48.735 1.00 95.68  ? 47  VAL D C   1 
ATOM   2210  O O   . VAL B 1 28  ? 1.200   6.862   -48.594 1.00 96.60  ? 47  VAL D O   1 
ATOM   2211  C CB  . VAL B 1 28  ? 1.548   9.385   -50.690 1.00 92.03  ? 47  VAL D CB  1 
ATOM   2212  C CG1 . VAL B 1 28  ? 0.083   8.966   -50.690 1.00 89.90  ? 47  VAL D CG1 1 
ATOM   2213  C CG2 . VAL B 1 28  ? 1.761   10.696  -49.926 1.00 88.62  ? 47  VAL D CG2 1 
ATOM   2214  N N   . THR B 1 29  ? 2.400   8.573   -47.722 1.00 94.25  ? 48  THR D N   1 
ATOM   2215  C CA  . THR B 1 29  ? 2.060   8.309   -46.327 1.00 93.62  ? 48  THR D CA  1 
ATOM   2216  C C   . THR B 1 29  ? 0.577   8.472   -46.055 1.00 89.60  ? 48  THR D C   1 
ATOM   2217  O O   . THR B 1 29  ? -0.166  7.496   -46.001 1.00 90.52  ? 48  THR D O   1 
ATOM   2218  C CB  . THR B 1 29  ? 2.807   9.269   -45.396 1.00 92.84  ? 48  THR D CB  1 
ATOM   2219  O OG1 . THR B 1 29  ? 2.827   10.569  -45.998 1.00 89.92  ? 48  THR D OG1 1 
ATOM   2220  C CG2 . THR B 1 29  ? 4.242   8.793   -45.174 1.00 97.56  ? 48  THR D CG2 1 
ATOM   2221  N N   . ASP B 1 30  ? 0.152   9.715   -45.876 1.00 85.41  ? 49  ASP D N   1 
ATOM   2222  C CA  . ASP B 1 30  ? -1.248  9.989   -45.621 1.00 81.82  ? 49  ASP D CA  1 
ATOM   2223  C C   . ASP B 1 30  ? -1.734  11.226  -46.371 1.00 77.81  ? 49  ASP D C   1 
ATOM   2224  O O   . ASP B 1 30  ? -0.956  12.136  -46.657 1.00 77.01  ? 49  ASP D O   1 
ATOM   2225  C CB  . ASP B 1 30  ? -1.498  10.141  -44.120 1.00 81.18  ? 49  ASP D CB  1 
ATOM   2226  C CG  . ASP B 1 30  ? -2.971  10.236  -43.792 1.00 78.70  ? 49  ASP D CG  1 
ATOM   2227  O OD1 . ASP B 1 30  ? -3.759  9.549   -44.493 1.00 79.31  ? 49  ASP D OD1 1 
ATOM   2228  O OD2 . ASP B 1 30  ? -3.341  11.003  -42.865 1.00 76.20  ? 49  ASP D OD2 1 
ATOM   2229  N N   . ILE B 1 31  ? -3.033  11.241  -46.670 1.00 75.73  ? 50  ILE D N   1 
ATOM   2230  C CA  . ILE B 1 31  ? -3.690  12.322  -47.403 1.00 62.94  ? 50  ILE D CA  1 
ATOM   2231  C C   . ILE B 1 31  ? -4.843  12.921  -46.588 1.00 59.27  ? 50  ILE D C   1 
ATOM   2232  O O   . ILE B 1 31  ? -5.609  12.203  -45.945 1.00 59.21  ? 50  ILE D O   1 
ATOM   2233  C CB  . ILE B 1 31  ? -4.236  11.809  -48.768 1.00 64.22  ? 50  ILE D CB  1 
ATOM   2234  C CG1 . ILE B 1 31  ? -3.081  11.382  -49.690 1.00 67.91  ? 50  ILE D CG1 1 
ATOM   2235  C CG2 . ILE B 1 31  ? -5.136  12.845  -49.442 1.00 61.34  ? 50  ILE D CG2 1 
ATOM   2236  C CD1 . ILE B 1 31  ? -3.532  10.794  -51.020 1.00 69.81  ? 50  ILE D CD1 1 
ATOM   2237  N N   . GLU B 1 32  ? -4.957  14.244  -46.630 1.00 56.50  ? 51  GLU D N   1 
ATOM   2238  C CA  . GLU B 1 32  ? -6.012  14.959  -45.936 1.00 53.12  ? 51  GLU D CA  1 
ATOM   2239  C C   . GLU B 1 32  ? -6.650  15.964  -46.876 1.00 51.12  ? 51  GLU D C   1 
ATOM   2240  O O   . GLU B 1 32  ? -5.950  16.731  -47.522 1.00 51.33  ? 51  GLU D O   1 
ATOM   2241  C CB  . GLU B 1 32  ? -5.439  15.667  -44.703 1.00 51.97  ? 51  GLU D CB  1 
ATOM   2242  C CG  . GLU B 1 32  ? -6.212  16.877  -44.237 1.00 52.17  ? 51  GLU D CG  1 
ATOM   2243  C CD  . GLU B 1 32  ? -5.713  17.412  -42.903 1.00 51.70  ? 51  GLU D CD  1 
ATOM   2244  O OE1 . GLU B 1 32  ? -4.476  17.469  -42.700 1.00 53.46  ? 51  GLU D OE1 1 
ATOM   2245  O OE2 . GLU B 1 32  ? -6.560  17.762  -42.040 1.00 49.83  ? 51  GLU D OE2 1 
ATOM   2246  N N   . CYS B 1 33  ? -7.979  15.957  -46.956 1.00 49.48  ? 52  CYS D N   1 
ATOM   2247  C CA  . CYS B 1 33  ? -8.702  16.944  -47.759 1.00 47.75  ? 52  CYS D CA  1 
ATOM   2248  C C   . CYS B 1 33  ? -9.320  18.031  -46.865 1.00 44.60  ? 52  CYS D C   1 
ATOM   2249  O O   . CYS B 1 33  ? -9.999  17.722  -45.911 1.00 43.56  ? 52  CYS D O   1 
ATOM   2250  C CB  . CYS B 1 33  ? -9.797  16.274  -48.588 1.00 48.48  ? 52  CYS D CB  1 
ATOM   2251  S SG  . CYS B 1 33  ? -9.439  14.600  -49.189 1.00 58.93  ? 52  CYS D SG  1 
ATOM   2252  N N   . VAL B 1 34  ? -9.079  19.294  -47.200 1.00 43.41  ? 53  VAL D N   1 
ATOM   2253  C CA  . VAL B 1 34  ? -9.529  20.434  -46.420 1.00 40.76  ? 53  VAL D CA  1 
ATOM   2254  C C   . VAL B 1 34  ? -10.508 21.263  -47.213 1.00 46.80  ? 53  VAL D C   1 
ATOM   2255  O O   . VAL B 1 34  ? -10.135 21.887  -48.206 1.00 40.40  ? 53  VAL D O   1 
ATOM   2256  C CB  . VAL B 1 34  ? -8.369  21.402  -46.088 1.00 43.45  ? 53  VAL D CB  1 
ATOM   2257  C CG1 . VAL B 1 34  ? -8.884  22.619  -45.302 1.00 37.98  ? 53  VAL D CG1 1 
ATOM   2258  C CG2 . VAL B 1 34  ? -7.245  20.686  -45.368 1.00 42.15  ? 53  VAL D CG2 1 
ATOM   2259  N N   . LYS B 1 35  ? -11.751 21.303  -46.742 1.00 45.22  ? 54  LYS D N   1 
ATOM   2260  C CA  . LYS B 1 35  ? -12.786 22.138  -47.328 1.00 44.23  ? 54  LYS D CA  1 
ATOM   2261  C C   . LYS B 1 35  ? -12.690 23.594  -46.881 1.00 43.09  ? 54  LYS D C   1 
ATOM   2262  O O   . LYS B 1 35  ? -13.316 23.976  -45.913 1.00 41.42  ? 54  LYS D O   1 
ATOM   2263  C CB  . LYS B 1 35  ? -14.157 21.581  -46.969 1.00 43.03  ? 54  LYS D CB  1 
ATOM   2264  C CG  . LYS B 1 35  ? -15.301 22.249  -47.696 1.00 42.43  ? 54  LYS D CG  1 
ATOM   2265  C CD  . LYS B 1 35  ? -16.085 23.175  -46.808 1.00 33.79  ? 54  LYS D CD  1 
ATOM   2266  C CE  . LYS B 1 35  ? -16.966 24.137  -47.570 1.00 33.68  ? 54  LYS D CE  1 
ATOM   2267  N NZ  . LYS B 1 35  ? -17.149 25.391  -46.782 1.00 38.92  ? 54  LYS D NZ  1 
ATOM   2268  N N   . ASP B 1 36  ? -11.849 24.384  -47.542 1.00 44.31  ? 55  ASP D N   1 
ATOM   2269  C CA  . ASP B 1 36  ? -12.024 25.834  -47.569 1.00 43.80  ? 55  ASP D CA  1 
ATOM   2270  C C   . ASP B 1 36  ? -11.563 26.634  -46.350 1.00 42.51  ? 55  ASP D C   1 
ATOM   2271  O O   . ASP B 1 36  ? -11.886 27.802  -46.275 1.00 42.13  ? 55  ASP D O   1 
ATOM   2272  C CB  . ASP B 1 36  ? -13.525 26.136  -47.794 1.00 43.59  ? 55  ASP D CB  1 
ATOM   2273  C CG  . ASP B 1 36  ? -13.786 27.095  -48.944 1.00 45.28  ? 55  ASP D CG  1 
ATOM   2274  O OD1 . ASP B 1 36  ? -12.847 27.799  -49.399 1.00 46.51  ? 55  ASP D OD1 1 
ATOM   2275  O OD2 . ASP B 1 36  ? -14.957 27.155  -49.386 1.00 45.55  ? 55  ASP D OD2 1 
ATOM   2276  N N   . ALA B 1 37  ? -10.837 26.046  -45.404 1.00 42.33  ? 56  ALA D N   1 
ATOM   2277  C CA  . ALA B 1 37  ? -10.708 26.632  -44.031 1.00 40.79  ? 56  ALA D CA  1 
ATOM   2278  C C   . ALA B 1 37  ? -12.001 26.610  -43.153 1.00 40.83  ? 56  ALA D C   1 
ATOM   2279  O O   . ALA B 1 37  ? -12.244 27.502  -42.341 1.00 39.66  ? 56  ALA D O   1 
ATOM   2280  C CB  . ALA B 1 37  ? -10.064 28.045  -44.033 1.00 31.55  ? 56  ALA D CB  1 
ATOM   2281  N N   . ASP B 1 38  ? -12.818 25.582  -43.303 1.00 40.90  ? 57  ASP D N   1 
ATOM   2282  C CA  . ASP B 1 38  ? -13.969 25.412  -42.447 1.00 39.99  ? 57  ASP D CA  1 
ATOM   2283  C C   . ASP B 1 38  ? -13.642 24.255  -41.577 1.00 40.43  ? 57  ASP D C   1 
ATOM   2284  O O   . ASP B 1 38  ? -13.534 24.363  -40.348 1.00 40.41  ? 57  ASP D O   1 
ATOM   2285  C CB  . ASP B 1 38  ? -15.154 24.966  -43.267 1.00 41.57  ? 57  ASP D CB  1 
ATOM   2286  C CG  . ASP B 1 38  ? -15.954 26.106  -43.798 1.00 42.29  ? 57  ASP D CG  1 
ATOM   2287  O OD1 . ASP B 1 38  ? -15.439 27.256  -43.786 1.00 42.16  ? 57  ASP D OD1 1 
ATOM   2288  O OD2 . ASP B 1 38  ? -17.101 25.828  -44.234 1.00 43.12  ? 57  ASP D OD2 1 
ATOM   2289  N N   . TYR B 1 39  ? -13.497 23.125  -42.244 1.00 41.36  ? 58  TYR D N   1 
ATOM   2290  C CA  . TYR B 1 39  ? -13.177 21.891  -41.598 1.00 42.22  ? 58  TYR D CA  1 
ATOM   2291  C C   . TYR B 1 39  ? -12.405 21.083  -42.612 1.00 44.03  ? 58  TYR D C   1 
ATOM   2292  O O   . TYR B 1 39  ? -12.097 21.579  -43.677 1.00 44.27  ? 58  TYR D O   1 
ATOM   2293  C CB  . TYR B 1 39  ? -14.460 21.182  -41.221 1.00 42.10  ? 58  TYR D CB  1 
ATOM   2294  C CG  . TYR B 1 39  ? -15.312 20.777  -42.395 1.00 42.90  ? 58  TYR D CG  1 
ATOM   2295  C CD1 . TYR B 1 39  ? -15.268 19.484  -42.886 1.00 34.91  ? 58  TYR D CD1 1 
ATOM   2296  C CD2 . TYR B 1 39  ? -16.158 21.687  -43.015 1.00 31.89  ? 58  TYR D CD2 1 
ATOM   2297  C CE1 . TYR B 1 39  ? -16.047 19.098  -43.957 1.00 42.99  ? 58  TYR D CE1 1 
ATOM   2298  C CE2 . TYR B 1 39  ? -16.938 21.321  -44.092 1.00 39.75  ? 58  TYR D CE2 1 
ATOM   2299  C CZ  . TYR B 1 39  ? -16.887 20.019  -44.561 1.00 41.72  ? 58  TYR D CZ  1 
ATOM   2300  O OH  . TYR B 1 39  ? -17.673 19.623  -45.627 1.00 42.70  ? 58  TYR D OH  1 
ATOM   2301  N N   . SER B 1 40  ? -12.109 19.836  -42.286 1.00 45.66  ? 59  SER D N   1 
ATOM   2302  C CA  . SER B 1 40  ? -11.309 18.991  -43.134 1.00 38.68  ? 59  SER D CA  1 
ATOM   2303  C C   . SER B 1 40  ? -11.500 17.551  -42.693 1.00 40.48  ? 59  SER D C   1 
ATOM   2304  O O   . SER B 1 40  ? -12.287 17.279  -41.787 1.00 46.72  ? 59  SER D O   1 
ATOM   2305  C CB  . SER B 1 40  ? -9.854  19.399  -43.052 1.00 39.51  ? 59  SER D CB  1 
ATOM   2306  O OG  . SER B 1 40  ? -9.155  18.573  -42.166 1.00 41.17  ? 59  SER D OG  1 
ATOM   2307  N N   . MET B 1 41  ? -10.809 16.624  -43.344 1.00 42.93  ? 60  MET D N   1 
ATOM   2308  C CA  . MET B 1 41  ? -10.954 15.207  -43.033 1.00 45.13  ? 60  MET D CA  1 
ATOM   2309  C C   . MET B 1 41  ? -9.834  14.370  -43.633 1.00 56.57  ? 60  MET D C   1 
ATOM   2310  O O   . MET B 1 41  ? -9.231  14.762  -44.634 1.00 56.84  ? 60  MET D O   1 
ATOM   2311  C CB  . MET B 1 41  ? -12.284 14.697  -43.550 1.00 45.60  ? 60  MET D CB  1 
ATOM   2312  C CG  . MET B 1 41  ? -12.602 15.152  -44.963 1.00 45.28  ? 60  MET D CG  1 
ATOM   2313  S SD  . MET B 1 41  ? -14.175 14.466  -45.487 1.00 66.73  ? 60  MET D SD  1 
ATOM   2314  C CE  . MET B 1 41  ? -13.931 12.771  -44.939 1.00 57.97  ? 60  MET D CE  1 
ATOM   2315  N N   . PRO B 1 42  ? -9.540  13.214  -43.011 1.00 59.14  ? 61  PRO D N   1 
ATOM   2316  C CA  . PRO B 1 42  ? -8.633  12.211  -43.579 1.00 62.73  ? 61  PRO D CA  1 
ATOM   2317  C C   . PRO B 1 42  ? -9.216  11.486  -44.786 1.00 64.37  ? 61  PRO D C   1 
ATOM   2318  O O   . PRO B 1 42  ? -10.430 11.388  -44.945 1.00 63.18  ? 61  PRO D O   1 
ATOM   2319  C CB  . PRO B 1 42  ? -8.429  11.221  -42.420 1.00 64.77  ? 61  PRO D CB  1 
ATOM   2320  C CG  . PRO B 1 42  ? -9.573  11.441  -41.514 1.00 62.64  ? 61  PRO D CG  1 
ATOM   2321  C CD  . PRO B 1 42  ? -9.882  12.902  -41.613 1.00 59.10  ? 61  PRO D CD  1 
ATOM   2322  N N   . ALA B 1 43  ? -8.338  10.970  -45.634 1.00 67.52  ? 62  ALA D N   1 
ATOM   2323  C CA  . ALA B 1 43  ? -8.778  10.248  -46.815 1.00 69.77  ? 62  ALA D CA  1 
ATOM   2324  C C   . ALA B 1 43  ? -8.974  8.750   -46.546 1.00 73.48  ? 62  ALA D C   1 
ATOM   2325  O O   . ALA B 1 43  ? -8.458  8.198   -45.571 1.00 75.02  ? 62  ALA D O   1 
ATOM   2326  C CB  . ALA B 1 43  ? -7.811  10.475  -47.966 1.00 71.20  ? 62  ALA D CB  1 
ATOM   2327  N N   . VAL B 1 44  ? -9.734  8.109   -47.428 1.00 75.14  ? 63  VAL D N   1 
ATOM   2328  C CA  . VAL B 1 44  ? -9.999  6.682   -47.349 1.00 78.83  ? 63  VAL D CA  1 
ATOM   2329  C C   . VAL B 1 44  ? -9.181  5.962   -48.421 1.00 82.70  ? 63  VAL D C   1 
ATOM   2330  O O   . VAL B 1 44  ? -9.182  6.376   -49.575 1.00 82.87  ? 63  VAL D O   1 
ATOM   2331  C CB  . VAL B 1 44  ? -11.506 6.402   -47.531 1.00 78.01  ? 63  VAL D CB  1 
ATOM   2332  C CG1 . VAL B 1 44  ? -11.743 4.995   -48.033 1.00 81.84  ? 63  VAL D CG1 1 
ATOM   2333  C CG2 . VAL B 1 44  ? -12.248 6.639   -46.221 1.00 75.86  ? 63  VAL D CG2 1 
ATOM   2334  N N   . ASN B 1 45  ? -8.469  4.904   -48.025 1.00 85.87  ? 64  ASN D N   1 
ATOM   2335  C CA  . ASN B 1 45  ? -7.570  4.152   -48.918 1.00 89.43  ? 64  ASN D CA  1 
ATOM   2336  C C   . ASN B 1 45  ? -6.522  5.029   -49.623 1.00 88.50  ? 64  ASN D C   1 
ATOM   2337  O O   . ASN B 1 45  ? -5.929  4.615   -50.619 1.00 91.19  ? 64  ASN D O   1 
ATOM   2338  C CB  . ASN B 1 45  ? -8.367  3.339   -49.958 1.00 91.85  ? 64  ASN D CB  1 
ATOM   2339  C CG  . ASN B 1 45  ? -8.506  1.863   -49.579 1.00 95.95  ? 64  ASN D CG  1 
ATOM   2340  O OD1 . ASN B 1 45  ? -7.692  1.021   -49.984 1.00 100.06 ? 64  ASN D OD1 1 
ATOM   2341  N ND2 . ASN B 1 45  ? -9.547  1.544   -48.806 1.00 94.97  ? 64  ASN D ND2 1 
ATOM   2342  N N   . ASN B 1 46  ? -6.310  6.239   -49.104 1.00 85.25  ? 65  ASN D N   1 
ATOM   2343  C CA  . ASN B 1 46  ? -5.571  7.282   -49.813 1.00 84.50  ? 65  ASN D CA  1 
ATOM   2344  C C   . ASN B 1 46  ? -6.086  7.486   -51.237 1.00 84.56  ? 65  ASN D C   1 
ATOM   2345  O O   . ASN B 1 46  ? -5.387  8.016   -52.093 1.00 85.29  ? 65  ASN D O   1 
ATOM   2346  C CB  . ASN B 1 46  ? -4.079  6.980   -49.816 1.00 76.73  ? 65  ASN D CB  1 
ATOM   2347  C CG  . ASN B 1 46  ? -3.424  7.303   -48.500 1.00 80.82  ? 65  ASN D CG  1 
ATOM   2348  O OD1 . ASN B 1 46  ? -3.949  8.092   -47.713 1.00 77.43  ? 65  ASN D OD1 1 
ATOM   2349  N ND2 . ASN B 1 46  ? -2.260  6.710   -48.253 1.00 79.50  ? 65  ASN D ND2 1 
ATOM   2350  N N   . SER B 1 47  ? -7.328  7.077   -51.465 1.00 83.94  ? 66  SER D N   1 
ATOM   2351  C CA  . SER B 1 47  ? -7.915  7.021   -52.796 1.00 85.03  ? 66  SER D CA  1 
ATOM   2352  C C   . SER B 1 47  ? -8.887  8.180   -53.045 1.00 81.00  ? 66  SER D C   1 
ATOM   2353  O O   . SER B 1 47  ? -8.885  8.780   -54.124 1.00 81.52  ? 66  SER D O   1 
ATOM   2354  C CB  . SER B 1 47  ? -8.626  5.675   -52.991 1.00 88.21  ? 66  SER D CB  1 
ATOM   2355  O OG  . SER B 1 47  ? -9.227  5.592   -54.272 1.00 89.75  ? 66  SER D OG  1 
ATOM   2356  N N   . TYR B 1 48  ? -9.715  8.487   -52.047 1.00 77.17  ? 67  TYR D N   1 
ATOM   2357  C CA  . TYR B 1 48  ? -10.725 9.537   -52.169 1.00 73.05  ? 67  TYR D CA  1 
ATOM   2358  C C   . TYR B 1 48  ? -11.096 10.110  -50.817 1.00 68.69  ? 67  TYR D C   1 
ATOM   2359  O O   . TYR B 1 48  ? -10.665 9.603   -49.783 1.00 68.93  ? 67  TYR D O   1 
ATOM   2360  C CB  . TYR B 1 48  ? -11.984 9.016   -52.881 1.00 74.00  ? 67  TYR D CB  1 
ATOM   2361  C CG  . TYR B 1 48  ? -12.763 7.946   -52.134 1.00 74.67  ? 67  TYR D CG  1 
ATOM   2362  C CD1 . TYR B 1 48  ? -13.993 8.235   -51.545 1.00 72.21  ? 67  TYR D CD1 1 
ATOM   2363  C CD2 . TYR B 1 48  ? -12.281 6.642   -52.026 1.00 78.03  ? 67  TYR D CD2 1 
ATOM   2364  C CE1 . TYR B 1 48  ? -14.724 7.262   -50.862 1.00 72.94  ? 67  TYR D CE1 1 
ATOM   2365  C CE2 . TYR B 1 48  ? -13.006 5.659   -51.343 1.00 78.92  ? 67  TYR D CE2 1 
ATOM   2366  C CZ  . TYR B 1 48  ? -14.227 5.982   -50.763 1.00 76.37  ? 67  TYR D CZ  1 
ATOM   2367  O OH  . TYR B 1 48  ? -14.949 5.024   -50.088 1.00 77.59  ? 67  TYR D OH  1 
ATOM   2368  N N   . CYS B 1 49  ? -11.898 11.170  -50.834 1.00 65.02  ? 68  CYS D N   1 
ATOM   2369  C CA  . CYS B 1 49  ? -12.409 11.782  -49.599 1.00 61.23  ? 68  CYS D CA  1 
ATOM   2370  C C   . CYS B 1 49  ? -13.929 11.881  -49.605 1.00 59.04  ? 68  CYS D C   1 
ATOM   2371  O O   . CYS B 1 49  ? -14.516 12.495  -50.499 1.00 58.40  ? 68  CYS D O   1 
ATOM   2372  C CB  . CYS B 1 49  ? -11.803 13.166  -49.373 1.00 58.87  ? 68  CYS D CB  1 
ATOM   2373  S SG  . CYS B 1 49  ? -10.483 13.182  -48.153 1.00 74.66  ? 68  CYS D SG  1 
ATOM   2374  N N   . GLN B 1 50  ? -14.563 11.280  -48.603 1.00 58.11  ? 69  GLN D N   1 
ATOM   2375  C CA  . GLN B 1 50  ? -16.013 11.189  -48.588 1.00 56.83  ? 69  GLN D CA  1 
ATOM   2376  C C   . GLN B 1 50  ? -16.625 12.416  -47.943 1.00 53.54  ? 69  GLN D C   1 
ATOM   2377  O O   . GLN B 1 50  ? -16.516 12.588  -46.740 1.00 52.50  ? 69  GLN D O   1 
ATOM   2378  C CB  . GLN B 1 50  ? -16.456 9.951   -47.829 1.00 57.99  ? 69  GLN D CB  1 
ATOM   2379  C CG  . GLN B 1 50  ? -17.935 9.709   -47.934 1.00 57.70  ? 69  GLN D CG  1 
ATOM   2380  C CD  . GLN B 1 50  ? -18.351 9.377   -49.347 1.00 59.68  ? 69  GLN D CD  1 
ATOM   2381  O OE1 . GLN B 1 50  ? -17.921 8.368   -49.912 1.00 58.91  ? 69  GLN D OE1 1 
ATOM   2382  N NE2 . GLN B 1 50  ? -19.182 10.231  -49.936 1.00 54.61  ? 69  GLN D NE2 1 
ATOM   2383  N N   . PHE B 1 51  ? -17.261 13.275  -48.731 1.00 52.42  ? 70  PHE D N   1 
ATOM   2384  C CA  . PHE B 1 51  ? -17.882 14.475  -48.190 1.00 45.35  ? 70  PHE D CA  1 
ATOM   2385  C C   . PHE B 1 51  ? -19.371 14.233  -48.033 1.00 45.16  ? 70  PHE D C   1 
ATOM   2386  O O   . PHE B 1 51  ? -19.876 13.173  -48.398 1.00 47.23  ? 70  PHE D O   1 
ATOM   2387  C CB  . PHE B 1 51  ? -17.639 15.683  -49.086 1.00 44.59  ? 70  PHE D CB  1 
ATOM   2388  C CG  . PHE B 1 51  ? -16.274 16.297  -48.938 1.00 44.04  ? 70  PHE D CG  1 
ATOM   2389  C CD1 . PHE B 1 51  ? -15.277 16.038  -49.860 1.00 46.06  ? 70  PHE D CD1 1 
ATOM   2390  C CD2 . PHE B 1 51  ? -15.992 17.158  -47.893 1.00 43.17  ? 70  PHE D CD2 1 
ATOM   2391  C CE1 . PHE B 1 51  ? -14.022 16.612  -49.725 1.00 45.77  ? 70  PHE D CE1 1 
ATOM   2392  C CE2 . PHE B 1 51  ? -14.743 17.737  -47.763 1.00 41.44  ? 70  PHE D CE2 1 
ATOM   2393  C CZ  . PHE B 1 51  ? -13.760 17.464  -48.681 1.00 43.45  ? 70  PHE D CZ  1 
ATOM   2394  N N   . GLY B 1 52  ? -20.080 15.212  -47.491 1.00 42.90  ? 71  GLY D N   1 
ATOM   2395  C CA  . GLY B 1 52  ? -21.460 14.990  -47.136 1.00 45.48  ? 71  GLY D CA  1 
ATOM   2396  C C   . GLY B 1 52  ? -22.425 16.027  -47.652 1.00 44.70  ? 71  GLY D C   1 
ATOM   2397  O O   . GLY B 1 52  ? -23.621 15.776  -47.748 1.00 45.73  ? 71  GLY D O   1 
ATOM   2398  N N   . ALA B 1 53  ? -21.937 17.203  -47.980 1.00 43.30  ? 72  ALA D N   1 
ATOM   2399  C CA  . ALA B 1 53  ? -22.851 18.227  -48.420 1.00 42.98  ? 72  ALA D CA  1 
ATOM   2400  C C   . ALA B 1 53  ? -22.032 19.251  -49.128 1.00 43.12  ? 72  ALA D C   1 
ATOM   2401  O O   . ALA B 1 53  ? -21.447 20.142  -48.518 1.00 41.98  ? 72  ALA D O   1 
ATOM   2402  C CB  . ALA B 1 53  ? -23.584 18.841  -47.255 1.00 37.99  ? 72  ALA D CB  1 
ATOM   2403  N N   . ILE B 1 54  ? -21.987 19.089  -50.435 1.00 44.97  ? 73  ILE D N   1 
ATOM   2404  C CA  . ILE B 1 54  ? -21.155 19.866  -51.319 1.00 45.55  ? 73  ILE D CA  1 
ATOM   2405  C C   . ILE B 1 54  ? -22.062 20.825  -52.047 1.00 46.53  ? 73  ILE D C   1 
ATOM   2406  O O   . ILE B 1 54  ? -23.081 20.409  -52.587 1.00 48.51  ? 73  ILE D O   1 
ATOM   2407  C CB  . ILE B 1 54  ? -20.508 18.919  -52.351 1.00 48.06  ? 73  ILE D CB  1 
ATOM   2408  C CG1 . ILE B 1 54  ? -19.419 18.087  -51.683 1.00 47.72  ? 73  ILE D CG1 1 
ATOM   2409  C CG2 . ILE B 1 54  ? -19.935 19.687  -53.516 1.00 49.57  ? 73  ILE D CG2 1 
ATOM   2410  C CD1 . ILE B 1 54  ? -18.454 18.917  -50.871 1.00 45.57  ? 73  ILE D CD1 1 
ATOM   2411  N N   . SER B 1 55  ? -21.721 22.101  -52.074 1.00 45.66  ? 74  SER D N   1 
ATOM   2412  C CA  . SER B 1 55  ? -22.484 22.999  -52.906 1.00 47.37  ? 74  SER D CA  1 
ATOM   2413  C C   . SER B 1 55  ? -22.255 22.602  -54.366 1.00 51.07  ? 74  SER D C   1 
ATOM   2414  O O   . SER B 1 55  ? -21.114 22.486  -54.801 1.00 52.22  ? 74  SER D O   1 
ATOM   2415  C CB  . SER B 1 55  ? -22.040 24.428  -52.688 1.00 41.89  ? 74  SER D CB  1 
ATOM   2416  O OG  . SER B 1 55  ? -22.968 25.320  -53.260 1.00 44.92  ? 74  SER D OG  1 
ATOM   2417  N N   . LEU B 1 56  ? -23.327 22.360  -55.118 1.00 52.62  ? 75  LEU D N   1 
ATOM   2418  C CA  . LEU B 1 56  ? -23.203 22.135  -56.552 1.00 54.51  ? 75  LEU D CA  1 
ATOM   2419  C C   . LEU B 1 56  ? -23.215 23.480  -57.261 1.00 53.14  ? 75  LEU D C   1 
ATOM   2420  O O   . LEU B 1 56  ? -23.142 23.552  -58.488 1.00 56.33  ? 75  LEU D O   1 
ATOM   2421  C CB  . LEU B 1 56  ? -24.354 21.274  -57.085 1.00 58.76  ? 75  LEU D CB  1 
ATOM   2422  C CG  . LEU B 1 56  ? -24.469 19.818  -56.647 1.00 54.26  ? 75  LEU D CG  1 
ATOM   2423  C CD1 . LEU B 1 56  ? -25.452 19.111  -57.532 1.00 57.48  ? 75  LEU D CD1 1 
ATOM   2424  C CD2 . LEU B 1 56  ? -23.137 19.125  -56.688 1.00 54.36  ? 75  LEU D CD2 1 
ATOM   2425  N N   . CYS B 1 57  ? -23.308 24.542  -56.473 1.00 50.82  ? 76  CYS D N   1 
ATOM   2426  C CA  . CYS B 1 57  ? -23.505 25.871  -56.996 1.00 51.95  ? 76  CYS D CA  1 
ATOM   2427  C C   . CYS B 1 57  ? -22.420 26.805  -56.562 1.00 57.03  ? 76  CYS D C   1 
ATOM   2428  O O   . CYS B 1 57  ? -21.626 27.253  -57.364 1.00 58.74  ? 76  CYS D O   1 
ATOM   2429  C CB  . CYS B 1 57  ? -24.832 26.413  -56.516 1.00 51.39  ? 76  CYS D CB  1 
ATOM   2430  S SG  . CYS B 1 57  ? -26.197 25.626  -57.339 1.00 56.80  ? 76  CYS D SG  1 
ATOM   2431  N N   . GLU B 1 58  ? -22.387 27.116  -55.281 1.00 53.67  ? 77  GLU D N   1 
ATOM   2432  C CA  . GLU B 1 58  ? -21.405 28.060  -54.789 1.00 52.10  ? 77  GLU D CA  1 
ATOM   2433  C C   . GLU B 1 58  ? -19.989 27.510  -54.786 1.00 50.38  ? 77  GLU D C   1 
ATOM   2434  O O   . GLU B 1 58  ? -19.731 26.445  -54.241 1.00 49.21  ? 77  GLU D O   1 
ATOM   2435  C CB  . GLU B 1 58  ? -21.772 28.519  -53.399 1.00 50.45  ? 77  GLU D CB  1 
ATOM   2436  C CG  . GLU B 1 58  ? -20.782 29.484  -52.837 1.00 50.31  ? 77  GLU D CG  1 
ATOM   2437  C CD  . GLU B 1 58  ? -20.751 29.407  -51.343 1.00 48.86  ? 77  GLU D CD  1 
ATOM   2438  O OE1 . GLU B 1 58  ? -19.893 28.641  -50.818 1.00 48.33  ? 77  GLU D OE1 1 
ATOM   2439  O OE2 . GLU B 1 58  ? -21.599 30.086  -50.692 1.00 48.43  ? 77  GLU D OE2 1 
ATOM   2440  N N   . VAL B 1 59  ? -19.078 28.276  -55.376 1.00 50.78  ? 78  VAL D N   1 
ATOM   2441  C CA  . VAL B 1 59  ? -17.706 27.844  -55.600 1.00 52.57  ? 78  VAL D CA  1 
ATOM   2442  C C   . VAL B 1 59  ? -16.896 27.647  -54.320 1.00 49.30  ? 78  VAL D C   1 
ATOM   2443  O O   . VAL B 1 59  ? -16.620 28.590  -53.592 1.00 48.40  ? 78  VAL D O   1 
ATOM   2444  C CB  . VAL B 1 59  ? -16.952 28.836  -56.500 1.00 53.34  ? 78  VAL D CB  1 
ATOM   2445  C CG1 . VAL B 1 59  ? -15.549 28.321  -56.795 1.00 49.91  ? 78  VAL D CG1 1 
ATOM   2446  C CG2 . VAL B 1 59  ? -17.725 29.066  -57.770 1.00 52.33  ? 78  VAL D CG2 1 
ATOM   2447  N N   . THR B 1 60  ? -16.487 26.408  -54.087 1.00 48.89  ? 79  THR D N   1 
ATOM   2448  C CA  . THR B 1 60  ? -15.721 26.040  -52.919 1.00 45.71  ? 79  THR D CA  1 
ATOM   2449  C C   . THR B 1 60  ? -14.326 25.576  -53.323 1.00 47.44  ? 79  THR D C   1 
ATOM   2450  O O   . THR B 1 60  ? -14.128 24.967  -54.373 1.00 50.12  ? 79  THR D O   1 
ATOM   2451  C CB  . THR B 1 60  ? -16.459 24.948  -52.151 1.00 45.25  ? 79  THR D CB  1 
ATOM   2452  O OG1 . THR B 1 60  ? -17.636 25.517  -51.573 1.00 44.46  ? 79  THR D OG1 1 
ATOM   2453  C CG2 . THR B 1 60  ? -15.623 24.378  -51.045 1.00 43.92  ? 79  THR D CG2 1 
ATOM   2454  N N   . ASN B 1 61  ? -13.359 25.889  -52.473 1.00 46.22  ? 80  ASN D N   1 
ATOM   2455  C CA  . ASN B 1 61  ? -11.967 25.574  -52.715 1.00 47.67  ? 80  ASN D CA  1 
ATOM   2456  C C   . ASN B 1 61  ? -11.495 24.413  -51.849 1.00 42.50  ? 80  ASN D C   1 
ATOM   2457  O O   . ASN B 1 61  ? -11.185 24.595  -50.676 1.00 40.66  ? 80  ASN D O   1 
ATOM   2458  C CB  . ASN B 1 61  ? -11.178 26.844  -52.431 1.00 47.35  ? 80  ASN D CB  1 
ATOM   2459  C CG  . ASN B 1 61  ? -9.669  26.663  -52.452 1.00 48.93  ? 80  ASN D CG  1 
ATOM   2460  O OD1 . ASN B 1 61  ? -9.098  25.606  -52.756 1.00 45.27  ? 80  ASN D OD1 1 
ATOM   2461  N ND2 . ASN B 1 61  ? -9.008  27.746  -52.114 1.00 48.57  ? 80  ASN D ND2 1 
ATOM   2462  N N   . TYR B 1 62  ? -11.430 23.226  -52.448 1.00 44.42  ? 81  TYR D N   1 
ATOM   2463  C CA  . TYR B 1 62  ? -10.936 22.036  -51.764 1.00 44.60  ? 81  TYR D CA  1 
ATOM   2464  C C   . TYR B 1 62  ? -9.416  21.901  -51.922 1.00 50.70  ? 81  TYR D C   1 
ATOM   2465  O O   . TYR B 1 62  ? -8.902  21.877  -53.023 1.00 48.65  ? 81  TYR D O   1 
ATOM   2466  C CB  . TYR B 1 62  ? -11.665 20.776  -52.255 1.00 46.06  ? 81  TYR D CB  1 
ATOM   2467  C CG  . TYR B 1 62  ? -13.173 20.925  -52.287 1.00 46.56  ? 81  TYR D CG  1 
ATOM   2468  C CD1 . TYR B 1 62  ? -13.976 20.446  -51.250 1.00 46.68  ? 81  TYR D CD1 1 
ATOM   2469  C CD2 . TYR B 1 62  ? -13.797 21.566  -53.348 1.00 45.96  ? 81  TYR D CD2 1 
ATOM   2470  C CE1 . TYR B 1 62  ? -15.360 20.600  -51.282 1.00 46.92  ? 81  TYR D CE1 1 
ATOM   2471  C CE2 . TYR B 1 62  ? -15.156 21.728  -53.385 1.00 50.34  ? 81  TYR D CE2 1 
ATOM   2472  C CZ  . TYR B 1 62  ? -15.937 21.245  -52.360 1.00 48.51  ? 81  TYR D CZ  1 
ATOM   2473  O OH  . TYR B 1 62  ? -17.296 21.426  -52.456 1.00 48.46  ? 81  TYR D OH  1 
ATOM   2474  N N   . THR B 1 63  ? -8.708  21.844  -50.797 1.00 49.68  ? 82  THR D N   1 
ATOM   2475  C CA  . THR B 1 63  ? -7.253  21.694  -50.775 1.00 51.36  ? 82  THR D CA  1 
ATOM   2476  C C   . THR B 1 63  ? -6.873  20.307  -50.290 1.00 52.62  ? 82  THR D C   1 
ATOM   2477  O O   . THR B 1 63  ? -7.373  19.832  -49.274 1.00 51.09  ? 82  THR D O   1 
ATOM   2478  C CB  . THR B 1 63  ? -6.587  22.711  -49.827 1.00 49.80  ? 82  THR D CB  1 
ATOM   2479  O OG1 . THR B 1 63  ? -6.836  24.033  -50.307 1.00 49.15  ? 82  THR D OG1 1 
ATOM   2480  C CG2 . THR B 1 63  ? -5.064  22.484  -49.750 1.00 51.72  ? 82  THR D CG2 1 
ATOM   2481  N N   . VAL B 1 64  ? -5.978  19.655  -51.017 1.00 55.53  ? 83  VAL D N   1 
ATOM   2482  C CA  . VAL B 1 64  ? -5.500  18.348  -50.594 1.00 56.95  ? 83  VAL D CA  1 
ATOM   2483  C C   . VAL B 1 64  ? -4.014  18.435  -50.236 1.00 57.84  ? 83  VAL D C   1 
ATOM   2484  O O   . VAL B 1 64  ? -3.274  19.207  -50.829 1.00 58.45  ? 83  VAL D O   1 
ATOM   2485  C CB  . VAL B 1 64  ? -5.793  17.296  -51.681 1.00 59.66  ? 83  VAL D CB  1 
ATOM   2486  C CG1 . VAL B 1 64  ? -5.536  15.891  -51.164 1.00 61.48  ? 83  VAL D CG1 1 
ATOM   2487  C CG2 . VAL B 1 64  ? -7.236  17.442  -52.142 1.00 58.30  ? 83  VAL D CG2 1 
ATOM   2488  N N   . ARG B 1 65  ? -3.594  17.682  -49.230 1.00 58.21  ? 84  ARG D N   1 
ATOM   2489  C CA  . ARG B 1 65  ? -2.200  17.689  -48.828 1.00 56.82  ? 84  ARG D CA  1 
ATOM   2490  C C   . ARG B 1 65  ? -1.761  16.332  -48.320 1.00 59.31  ? 84  ARG D C   1 
ATOM   2491  O O   . ARG B 1 65  ? -2.575  15.496  -47.948 1.00 59.04  ? 84  ARG D O   1 
ATOM   2492  C CB  . ARG B 1 65  ? -1.918  18.764  -47.782 1.00 54.64  ? 84  ARG D CB  1 
ATOM   2493  C CG  . ARG B 1 65  ? -2.414  18.445  -46.374 1.00 53.12  ? 84  ARG D CG  1 
ATOM   2494  C CD  . ARG B 1 65  ? -2.106  19.599  -45.435 1.00 51.26  ? 84  ARG D CD  1 
ATOM   2495  N NE  . ARG B 1 65  ? -2.630  19.354  -44.100 1.00 57.54  ? 84  ARG D NE  1 
ATOM   2496  C CZ  . ARG B 1 65  ? -2.178  19.918  -42.985 1.00 49.46  ? 84  ARG D CZ  1 
ATOM   2497  N NH1 . ARG B 1 65  ? -2.748  19.613  -41.840 1.00 48.64  ? 84  ARG D NH1 1 
ATOM   2498  N NH2 . ARG B 1 65  ? -1.176  20.783  -43.014 1.00 49.99  ? 84  ARG D NH2 1 
ATOM   2499  N N   . VAL B 1 66  ? -0.454  16.121  -48.322 1.00 62.06  ? 85  VAL D N   1 
ATOM   2500  C CA  . VAL B 1 66  ? 0.112   14.841  -47.952 1.00 66.51  ? 85  VAL D CA  1 
ATOM   2501  C C   . VAL B 1 66  ? 1.133   15.043  -46.842 1.00 66.05  ? 85  VAL D C   1 
ATOM   2502  O O   . VAL B 1 66  ? 1.828   16.057  -46.814 1.00 67.52  ? 85  VAL D O   1 
ATOM   2503  C CB  . VAL B 1 66  ? 0.759   14.155  -49.183 1.00 72.22  ? 85  VAL D CB  1 
ATOM   2504  C CG1 . VAL B 1 66  ? -0.306  13.749  -50.179 1.00 68.55  ? 85  VAL D CG1 1 
ATOM   2505  C CG2 . VAL B 1 66  ? 1.713   15.087  -49.848 1.00 69.67  ? 85  VAL D CG2 1 
ATOM   2506  N N   . ALA B 1 67  ? 1.202   14.095  -45.914 1.00 67.57  ? 86  ALA D N   1 
ATOM   2507  C CA  . ALA B 1 67  ? 2.146   14.182  -44.797 1.00 80.28  ? 86  ALA D CA  1 
ATOM   2508  C C   . ALA B 1 67  ? 3.591   14.271  -45.285 1.00 83.51  ? 86  ALA D C   1 
ATOM   2509  O O   . ALA B 1 67  ? 4.223   15.322  -45.182 1.00 82.69  ? 86  ALA D O   1 
ATOM   2510  C CB  . ALA B 1 67  ? 1.976   12.988  -43.858 1.00 70.91  ? 86  ALA D CB  1 
ATOM   2511  N N   . ASN B 1 68  ? 4.095   13.155  -45.809 1.00 87.37  ? 87  ASN D N   1 
ATOM   2512  C CA  . ASN B 1 68  ? 5.423   13.075  -46.413 1.00 91.25  ? 87  ASN D CA  1 
ATOM   2513  C C   . ASN B 1 68  ? 5.357   12.400  -47.783 1.00 93.51  ? 87  ASN D C   1 
ATOM   2514  O O   . ASN B 1 68  ? 4.691   11.371  -47.935 1.00 94.52  ? 87  ASN D O   1 
ATOM   2515  C CB  . ASN B 1 68  ? 6.388   12.299  -45.519 1.00 95.19  ? 87  ASN D CB  1 
ATOM   2516  C CG  . ASN B 1 68  ? 7.443   11.553  -46.318 1.00 100.21 ? 87  ASN D CG  1 
ATOM   2517  O OD1 . ASN B 1 68  ? 8.499   12.102  -46.633 1.00 102.13 ? 87  ASN D OD1 1 
ATOM   2518  N ND2 . ASN B 1 68  ? 7.158   10.296  -46.655 1.00 102.65 ? 87  ASN D ND2 1 
ATOM   2519  N N   . PRO B 1 69  ? 6.040   12.977  -48.791 1.00 94.44  ? 88  PRO D N   1 
ATOM   2520  C CA  . PRO B 1 69  ? 6.776   14.242  -48.719 1.00 92.94  ? 88  PRO D CA  1 
ATOM   2521  C C   . PRO B 1 69  ? 5.789   15.386  -48.604 1.00 86.88  ? 88  PRO D C   1 
ATOM   2522  O O   . PRO B 1 69  ? 4.646   15.219  -49.014 1.00 85.14  ? 88  PRO D O   1 
ATOM   2523  C CB  . PRO B 1 69  ? 7.472   14.316  -50.080 1.00 96.22  ? 88  PRO D CB  1 
ATOM   2524  C CG  . PRO B 1 69  ? 7.400   12.934  -50.638 1.00 99.67  ? 88  PRO D CG  1 
ATOM   2525  C CD  . PRO B 1 69  ? 6.126   12.380  -50.131 1.00 97.15  ? 88  PRO D CD  1 
ATOM   2526  N N   . PRO B 1 70  ? 6.199   16.515  -48.025 1.00 83.71  ? 89  PRO D N   1 
ATOM   2527  C CA  . PRO B 1 70  ? 5.204   17.588  -47.982 1.00 78.55  ? 89  PRO D CA  1 
ATOM   2528  C C   . PRO B 1 70  ? 4.856   18.077  -49.385 1.00 77.41  ? 89  PRO D C   1 
ATOM   2529  O O   . PRO B 1 70  ? 5.681   18.704  -50.049 1.00 78.89  ? 89  PRO D O   1 
ATOM   2530  C CB  . PRO B 1 70  ? 5.896   18.679  -47.163 1.00 77.68  ? 89  PRO D CB  1 
ATOM   2531  C CG  . PRO B 1 70  ? 6.913   17.926  -46.330 1.00 73.71  ? 89  PRO D CG  1 
ATOM   2532  C CD  . PRO B 1 70  ? 7.382   16.807  -47.201 1.00 85.13  ? 89  PRO D CD  1 
ATOM   2533  N N   . PHE B 1 71  ? 3.650   17.740  -49.835 1.00 75.26  ? 90  PHE D N   1 
ATOM   2534  C CA  . PHE B 1 71  ? 3.079   18.309  -51.052 1.00 74.22  ? 90  PHE D CA  1 
ATOM   2535  C C   . PHE B 1 71  ? 1.615   18.716  -50.839 1.00 69.80  ? 90  PHE D C   1 
ATOM   2536  O O   . PHE B 1 71  ? 0.864   18.007  -50.179 1.00 68.40  ? 90  PHE D O   1 
ATOM   2537  C CB  . PHE B 1 71  ? 3.188   17.336  -52.240 1.00 77.72  ? 90  PHE D CB  1 
ATOM   2538  C CG  . PHE B 1 71  ? 2.379   17.760  -53.448 1.00 77.26  ? 90  PHE D CG  1 
ATOM   2539  C CD1 . PHE B 1 71  ? 2.800   18.814  -54.245 1.00 77.85  ? 90  PHE D CD1 1 
ATOM   2540  C CD2 . PHE B 1 71  ? 1.189   17.119  -53.768 1.00 76.47  ? 90  PHE D CD2 1 
ATOM   2541  C CE1 . PHE B 1 71  ? 2.060   19.215  -55.344 1.00 77.79  ? 90  PHE D CE1 1 
ATOM   2542  C CE2 . PHE B 1 71  ? 0.439   17.515  -54.867 1.00 76.32  ? 90  PHE D CE2 1 
ATOM   2543  C CZ  . PHE B 1 71  ? 0.878   18.564  -55.661 1.00 77.04  ? 90  PHE D CZ  1 
ATOM   2544  N N   . SER B 1 72  ? 1.228   19.855  -51.411 1.00 67.94  ? 91  SER D N   1 
ATOM   2545  C CA  . SER B 1 72  ? -0.172  20.263  -51.454 1.00 64.89  ? 91  SER D CA  1 
ATOM   2546  C C   . SER B 1 72  ? -0.595  20.790  -52.826 1.00 65.28  ? 91  SER D C   1 
ATOM   2547  O O   . SER B 1 72  ? 0.224   21.320  -53.590 1.00 67.51  ? 91  SER D O   1 
ATOM   2548  C CB  . SER B 1 72  ? -0.451  21.353  -50.425 1.00 62.02  ? 91  SER D CB  1 
ATOM   2549  O OG  . SER B 1 72  ? -0.525  22.619  -51.063 1.00 61.60  ? 91  SER D OG  1 
ATOM   2550  N N   . THR B 1 73  ? -1.884  20.634  -53.122 1.00 63.33  ? 92  THR D N   1 
ATOM   2551  C CA  . THR B 1 73  ? -2.523  21.269  -54.276 1.00 62.94  ? 92  THR D CA  1 
ATOM   2552  C C   . THR B 1 73  ? -4.033  21.443  -54.060 1.00 59.61  ? 92  THR D C   1 
ATOM   2553  O O   . THR B 1 73  ? -4.633  20.837  -53.157 1.00 57.60  ? 92  THR D O   1 
ATOM   2554  C CB  . THR B 1 73  ? -2.240  20.536  -55.612 1.00 64.99  ? 92  THR D CB  1 
ATOM   2555  O OG1 . THR B 1 73  ? -2.702  21.350  -56.696 1.00 63.75  ? 92  THR D OG1 1 
ATOM   2556  C CG2 . THR B 1 73  ? -2.925  19.168  -55.662 1.00 63.71  ? 92  THR D CG2 1 
ATOM   2557  N N   . TRP B 1 74  ? -4.643  22.277  -54.893 1.00 59.29  ? 93  TRP D N   1 
ATOM   2558  C CA  . TRP B 1 74  ? -6.010  22.673  -54.651 1.00 54.04  ? 93  TRP D CA  1 
ATOM   2559  C C   . TRP B 1 74  ? -6.871  22.710  -55.901 1.00 57.67  ? 93  TRP D C   1 
ATOM   2560  O O   . TRP B 1 74  ? -6.354  22.821  -57.001 1.00 60.65  ? 93  TRP D O   1 
ATOM   2561  C CB  . TRP B 1 74  ? -6.019  24.027  -53.962 1.00 56.88  ? 93  TRP D CB  1 
ATOM   2562  C CG  . TRP B 1 74  ? -5.402  25.128  -54.748 1.00 58.31  ? 93  TRP D CG  1 
ATOM   2563  C CD1 . TRP B 1 74  ? -4.160  25.682  -54.565 1.00 54.00  ? 93  TRP D CD1 1 
ATOM   2564  C CD2 . TRP B 1 74  ? -6.011  25.851  -55.815 1.00 54.33  ? 93  TRP D CD2 1 
ATOM   2565  N NE1 . TRP B 1 74  ? -3.958  26.697  -55.468 1.00 55.60  ? 93  TRP D NE1 1 
ATOM   2566  C CE2 . TRP B 1 74  ? -5.081  26.820  -56.249 1.00 60.85  ? 93  TRP D CE2 1 
ATOM   2567  C CE3 . TRP B 1 74  ? -7.255  25.782  -56.443 1.00 54.48  ? 93  TRP D CE3 1 
ATOM   2568  C CZ2 . TRP B 1 74  ? -5.358  27.703  -57.296 1.00 62.59  ? 93  TRP D CZ2 1 
ATOM   2569  C CZ3 . TRP B 1 74  ? -7.519  26.652  -57.488 1.00 62.70  ? 93  TRP D CZ3 1 
ATOM   2570  C CH2 . TRP B 1 74  ? -6.577  27.599  -57.902 1.00 57.99  ? 93  TRP D CH2 1 
ATOM   2571  N N   . ILE B 1 75  ? -8.186  22.598  -55.724 1.00 56.08  ? 94  ILE D N   1 
ATOM   2572  C CA  . ILE B 1 75  ? -9.132  22.761  -56.831 1.00 57.83  ? 94  ILE D CA  1 
ATOM   2573  C C   . ILE B 1 75  ? -10.361 23.587  -56.457 1.00 55.61  ? 94  ILE D C   1 
ATOM   2574  O O   . ILE B 1 75  ? -10.665 23.804  -55.283 1.00 52.72  ? 94  ILE D O   1 
ATOM   2575  C CB  . ILE B 1 75  ? -9.654  21.414  -57.417 1.00 58.88  ? 94  ILE D CB  1 
ATOM   2576  C CG1 . ILE B 1 75  ? -10.658 20.763  -56.459 1.00 56.25  ? 94  ILE D CG1 1 
ATOM   2577  C CG2 . ILE B 1 75  ? -8.505  20.485  -57.783 1.00 61.60  ? 94  ILE D CG2 1 
ATOM   2578  C CD1 . ILE B 1 75  ? -11.389 19.596  -57.041 1.00 57.99  ? 94  ILE D CD1 1 
ATOM   2579  N N   . LEU B 1 76  ? -11.065 24.036  -57.485 1.00 57.26  ? 95  LEU D N   1 
ATOM   2580  C CA  . LEU B 1 76  ? -12.305 24.738  -57.288 1.00 53.17  ? 95  LEU D CA  1 
ATOM   2581  C C   . LEU B 1 76  ? -13.449 23.886  -57.800 1.00 54.29  ? 95  LEU D C   1 
ATOM   2582  O O   . LEU B 1 76  ? -13.501 23.551  -58.973 1.00 57.46  ? 95  LEU D O   1 
ATOM   2583  C CB  . LEU B 1 76  ? -12.282 26.089  -58.004 1.00 54.47  ? 95  LEU D CB  1 
ATOM   2584  C CG  . LEU B 1 76  ? -11.286 27.130  -57.495 1.00 53.43  ? 95  LEU D CG  1 
ATOM   2585  C CD1 . LEU B 1 76  ? -11.749 28.530  -57.855 1.00 53.90  ? 95  LEU D CD1 1 
ATOM   2586  C CD2 . LEU B 1 76  ? -11.076 26.994  -55.977 1.00 53.50  ? 95  LEU D CD2 1 
ATOM   2587  N N   . PHE B 1 77  ? -14.356 23.517  -56.909 1.00 51.95  ? 96  PHE D N   1 
ATOM   2588  C CA  . PHE B 1 77  ? -15.608 22.925  -57.330 1.00 52.91  ? 96  PHE D CA  1 
ATOM   2589  C C   . PHE B 1 77  ? -16.801 23.651  -56.719 1.00 74.31  ? 96  PHE D C   1 
ATOM   2590  O O   . PHE B 1 77  ? -16.802 23.965  -55.533 1.00 71.13  ? 96  PHE D O   1 
ATOM   2591  C CB  . PHE B 1 77  ? -15.679 21.440  -57.010 1.00 53.08  ? 96  PHE D CB  1 
ATOM   2592  C CG  . PHE B 1 77  ? -16.931 20.809  -57.502 1.00 54.45  ? 96  PHE D CG  1 
ATOM   2593  C CD1 . PHE B 1 77  ? -17.067 20.471  -58.840 1.00 58.04  ? 96  PHE D CD1 1 
ATOM   2594  C CD2 . PHE B 1 77  ? -18.000 20.603  -56.655 1.00 52.44  ? 96  PHE D CD2 1 
ATOM   2595  C CE1 . PHE B 1 77  ? -18.226 19.911  -59.320 1.00 59.62  ? 96  PHE D CE1 1 
ATOM   2596  C CE2 . PHE B 1 77  ? -19.175 20.040  -57.128 1.00 56.60  ? 96  PHE D CE2 1 
ATOM   2597  C CZ  . PHE B 1 77  ? -19.279 19.691  -58.476 1.00 60.26  ? 96  PHE D CZ  1 
ATOM   2598  N N   . PRO B 1 78  ? -17.810 23.963  -57.542 1.00 73.38  ? 97  PRO D N   1 
ATOM   2599  C CA  . PRO B 1 78  ? -17.736 23.843  -58.992 1.00 74.78  ? 97  PRO D CA  1 
ATOM   2600  C C   . PRO B 1 78  ? -16.996 25.048  -59.557 1.00 74.10  ? 97  PRO D C   1 
ATOM   2601  O O   . PRO B 1 78  ? -16.985 26.105  -58.917 1.00 71.80  ? 97  PRO D O   1 
ATOM   2602  C CB  . PRO B 1 78  ? -19.205 23.900  -59.401 1.00 76.64  ? 97  PRO D CB  1 
ATOM   2603  C CG  . PRO B 1 78  ? -19.834 24.755  -58.384 1.00 54.65  ? 97  PRO D CG  1 
ATOM   2604  C CD  . PRO B 1 78  ? -19.140 24.427  -57.104 1.00 51.33  ? 97  PRO D CD  1 
ATOM   2605  N N   . GLU B 1 79  ? -16.366 24.888  -60.720 1.00 77.27  ? 98  GLU D N   1 
ATOM   2606  C CA  . GLU B 1 79  ? -15.757 26.024  -61.402 1.00 78.47  ? 98  GLU D CA  1 
ATOM   2607  C C   . GLU B 1 79  ? -16.909 26.960  -61.715 1.00 79.04  ? 98  GLU D C   1 
ATOM   2608  O O   . GLU B 1 79  ? -18.002 26.490  -62.034 1.00 79.76  ? 98  GLU D O   1 
ATOM   2609  C CB  . GLU B 1 79  ? -15.064 25.577  -62.690 1.00 82.02  ? 98  GLU D CB  1 
ATOM   2610  C CG  . GLU B 1 79  ? -13.554 25.349  -62.572 1.00 82.31  ? 98  GLU D CG  1 
ATOM   2611  C CD  . GLU B 1 79  ? -12.863 25.224  -63.948 1.00 87.78  ? 98  GLU D CD  1 
ATOM   2612  O OE1 . GLU B 1 79  ? -12.276 24.155  -64.235 1.00 89.55  ? 98  GLU D OE1 1 
ATOM   2613  O OE2 . GLU B 1 79  ? -12.898 26.194  -64.748 1.00 90.55  ? 98  GLU D OE2 1 
ATOM   2614  N N   . ASN B 1 80  ? -16.703 28.269  -61.593 1.00 78.76  ? 99  ASN D N   1 
ATOM   2615  C CA  . ASN B 1 80  ? -17.799 29.173  -61.915 1.00 80.70  ? 99  ASN D CA  1 
ATOM   2616  C C   . ASN B 1 80  ? -18.050 29.339  -63.415 1.00 85.75  ? 99  ASN D C   1 
ATOM   2617  O O   . ASN B 1 80  ? -17.125 29.542  -64.218 1.00 88.63  ? 99  ASN D O   1 
ATOM   2618  C CB  . ASN B 1 80  ? -17.688 30.541  -61.245 1.00 79.60  ? 99  ASN D CB  1 
ATOM   2619  C CG  . ASN B 1 80  ? -19.031 31.281  -61.224 1.00 80.51  ? 99  ASN D CG  1 
ATOM   2620  O OD1 . ASN B 1 80  ? -19.726 31.298  -60.203 1.00 77.63  ? 99  ASN D OD1 1 
ATOM   2621  N ND2 . ASN B 1 80  ? -19.411 31.872  -62.363 1.00 84.71  ? 99  ASN D ND2 1 
ATOM   2622  N N   . SER B 1 81  ? -19.329 29.248  -63.766 1.00 86.55  ? 100 SER D N   1 
ATOM   2623  C CA  . SER B 1 81  ? -19.784 29.320  -65.134 1.00 90.84  ? 100 SER D CA  1 
ATOM   2624  C C   . SER B 1 81  ? -21.179 29.937  -65.071 1.00 90.63  ? 100 SER D C   1 
ATOM   2625  O O   . SER B 1 81  ? -21.863 29.810  -64.055 1.00 87.15  ? 100 SER D O   1 
ATOM   2626  C CB  . SER B 1 81  ? -19.809 27.913  -65.738 1.00 92.84  ? 100 SER D CB  1 
ATOM   2627  O OG  . SER B 1 81  ? -18.606 27.203  -65.446 1.00 91.35  ? 100 SER D OG  1 
ATOM   2628  N N   . GLY B 1 82  ? -21.587 30.625  -66.133 1.00 73.38  ? 101 GLY D N   1 
ATOM   2629  C CA  . GLY B 1 82  ? -22.829 31.379  -66.120 1.00 70.82  ? 101 GLY D CA  1 
ATOM   2630  C C   . GLY B 1 82  ? -22.569 32.867  -65.952 1.00 71.64  ? 101 GLY D C   1 
ATOM   2631  O O   . GLY B 1 82  ? -21.471 33.276  -65.571 1.00 73.54  ? 101 GLY D O   1 
ATOM   2632  N N   . LYS B 1 83  ? -23.583 33.678  -66.239 1.00 70.81  ? 102 LYS D N   1 
ATOM   2633  C CA  . LYS B 1 83  ? -23.482 35.136  -66.141 1.00 72.86  ? 102 LYS D CA  1 
ATOM   2634  C C   . LYS B 1 83  ? -23.497 35.644  -64.683 1.00 70.91  ? 102 LYS D C   1 
ATOM   2635  O O   . LYS B 1 83  ? -24.441 35.368  -63.925 1.00 67.95  ? 102 LYS D O   1 
ATOM   2636  C CB  . LYS B 1 83  ? -24.626 35.767  -66.937 1.00 62.57  ? 102 LYS D CB  1 
ATOM   2637  C CG  . LYS B 1 83  ? -24.780 37.259  -66.807 1.00 64.87  ? 102 LYS D CG  1 
ATOM   2638  C CD  . LYS B 1 83  ? -26.092 37.683  -67.440 1.00 65.06  ? 102 LYS D CD  1 
ATOM   2639  C CE  . LYS B 1 83  ? -26.441 39.132  -67.153 1.00 70.90  ? 102 LYS D CE  1 
ATOM   2640  N NZ  . LYS B 1 83  ? -25.981 40.053  -68.230 1.00 75.66  ? 102 LYS D NZ  1 
ATOM   2641  N N   . PRO B 1 84  ? -22.442 36.376  -64.277 1.00 72.46  ? 103 PRO D N   1 
ATOM   2642  C CA  . PRO B 1 84  ? -22.469 37.046  -62.971 1.00 70.94  ? 103 PRO D CA  1 
ATOM   2643  C C   . PRO B 1 84  ? -23.105 38.427  -63.128 1.00 72.20  ? 103 PRO D C   1 
ATOM   2644  O O   . PRO B 1 84  ? -22.841 39.102  -64.124 1.00 75.89  ? 103 PRO D O   1 
ATOM   2645  C CB  . PRO B 1 84  ? -20.985 37.172  -62.622 1.00 73.59  ? 103 PRO D CB  1 
ATOM   2646  C CG  . PRO B 1 84  ? -20.308 37.323  -63.947 1.00 77.46  ? 103 PRO D CG  1 
ATOM   2647  C CD  . PRO B 1 84  ? -21.150 36.560  -64.966 1.00 76.11  ? 103 PRO D CD  1 
ATOM   2648  N N   . TRP B 1 85  ? -23.951 38.847  -62.194 1.00 69.59  ? 104 TRP D N   1 
ATOM   2649  C CA  . TRP B 1 85  ? -24.345 38.079  -61.032 1.00 64.83  ? 104 TRP D CA  1 
ATOM   2650  C C   . TRP B 1 85  ? -25.803 37.730  -61.210 1.00 61.44  ? 104 TRP D C   1 
ATOM   2651  O O   . TRP B 1 85  ? -26.631 38.098  -60.391 1.00 60.03  ? 104 TRP D O   1 
ATOM   2652  C CB  . TRP B 1 85  ? -24.275 38.959  -59.803 1.00 59.02  ? 104 TRP D CB  1 
ATOM   2653  C CG  . TRP B 1 85  ? -22.953 39.545  -59.519 1.00 66.39  ? 104 TRP D CG  1 
ATOM   2654  C CD1 . TRP B 1 85  ? -22.142 40.222  -60.387 1.00 66.24  ? 104 TRP D CD1 1 
ATOM   2655  C CD2 . TRP B 1 85  ? -22.286 39.554  -58.253 1.00 66.06  ? 104 TRP D CD2 1 
ATOM   2656  N NE1 . TRP B 1 85  ? -20.997 40.622  -59.745 1.00 72.83  ? 104 TRP D NE1 1 
ATOM   2657  C CE2 . TRP B 1 85  ? -21.061 40.231  -58.432 1.00 70.15  ? 104 TRP D CE2 1 
ATOM   2658  C CE3 . TRP B 1 85  ? -22.602 39.048  -56.986 1.00 63.00  ? 104 TRP D CE3 1 
ATOM   2659  C CZ2 . TRP B 1 85  ? -20.152 40.423  -57.387 1.00 71.32  ? 104 TRP D CZ2 1 
ATOM   2660  C CZ3 . TRP B 1 85  ? -21.691 39.235  -55.947 1.00 64.04  ? 104 TRP D CZ3 1 
ATOM   2661  C CH2 . TRP B 1 85  ? -20.484 39.917  -56.157 1.00 63.91  ? 104 TRP D CH2 1 
ATOM   2662  N N   . ALA B 1 86  ? -26.128 37.070  -62.309 1.00 60.38  ? 105 ALA D N   1 
ATOM   2663  C CA  . ALA B 1 86  ? -27.487 36.622  -62.550 1.00 57.63  ? 105 ALA D CA  1 
ATOM   2664  C C   . ALA B 1 86  ? -27.672 35.434  -61.636 1.00 54.53  ? 105 ALA D C   1 
ATOM   2665  O O   . ALA B 1 86  ? -26.696 34.883  -61.131 1.00 54.56  ? 105 ALA D O   1 
ATOM   2666  C CB  . ALA B 1 86  ? -27.655 36.218  -64.013 1.00 58.05  ? 105 ALA D CB  1 
ATOM   2667  N N   . GLY B 1 87  ? -28.892 35.017  -61.377 1.00 52.42  ? 106 GLY D N   1 
ATOM   2668  C CA  . GLY B 1 87  ? -29.003 33.870  -60.496 1.00 49.54  ? 106 GLY D CA  1 
ATOM   2669  C C   . GLY B 1 87  ? -29.322 34.232  -59.064 1.00 43.83  ? 106 GLY D C   1 
ATOM   2670  O O   . GLY B 1 87  ? -28.922 35.278  -58.560 1.00 45.21  ? 106 GLY D O   1 
ATOM   2671  N N   . ALA B 1 88  ? -30.053 33.336  -58.421 1.00 41.48  ? 107 ALA D N   1 
ATOM   2672  C CA  . ALA B 1 88  ? -30.747 33.632  -57.187 1.00 44.85  ? 107 ALA D CA  1 
ATOM   2673  C C   . ALA B 1 88  ? -29.798 33.985  -56.046 1.00 45.02  ? 107 ALA D C   1 
ATOM   2674  O O   . ALA B 1 88  ? -28.676 33.471  -55.956 1.00 44.98  ? 107 ALA D O   1 
ATOM   2675  C CB  . ALA B 1 88  ? -31.673 32.468  -56.818 1.00 38.20  ? 107 ALA D CB  1 
ATOM   2676  N N   . GLU B 1 89  ? -30.260 34.887  -55.186 1.00 45.64  ? 108 GLU D N   1 
ATOM   2677  C CA  . GLU B 1 89  ? -29.484 35.350  -54.046 1.00 46.27  ? 108 GLU D CA  1 
ATOM   2678  C C   . GLU B 1 89  ? -30.239 35.156  -52.745 1.00 44.48  ? 108 GLU D C   1 
ATOM   2679  O O   . GLU B 1 89  ? -31.465 35.250  -52.713 1.00 43.93  ? 108 GLU D O   1 
ATOM   2680  C CB  . GLU B 1 89  ? -29.128 36.821  -54.211 1.00 49.83  ? 108 GLU D CB  1 
ATOM   2681  C CG  . GLU B 1 89  ? -27.852 37.033  -54.967 1.00 52.52  ? 108 GLU D CG  1 
ATOM   2682  C CD  . GLU B 1 89  ? -27.441 38.499  -55.053 1.00 56.91  ? 108 GLU D CD  1 
ATOM   2683  O OE1 . GLU B 1 89  ? -27.607 39.263  -54.059 1.00 58.00  ? 108 GLU D OE1 1 
ATOM   2684  O OE2 . GLU B 1 89  ? -26.940 38.880  -56.136 1.00 59.47  ? 108 GLU D OE2 1 
ATOM   2685  N N   . ASN B 1 90  ? -29.488 34.877  -51.683 1.00 43.76  ? 109 ASN D N   1 
ATOM   2686  C CA  . ASN B 1 90  ? -30.028 34.763  -50.333 1.00 42.47  ? 109 ASN D CA  1 
ATOM   2687  C C   . ASN B 1 90  ? -31.074 33.710  -50.141 1.00 36.12  ? 109 ASN D C   1 
ATOM   2688  O O   . ASN B 1 90  ? -32.122 33.989  -49.551 1.00 36.07  ? 109 ASN D O   1 
ATOM   2689  C CB  . ASN B 1 90  ? -30.655 36.063  -49.913 1.00 39.94  ? 109 ASN D CB  1 
ATOM   2690  C CG  . ASN B 1 90  ? -29.739 37.201  -50.085 1.00 52.92  ? 109 ASN D CG  1 
ATOM   2691  O OD1 . ASN B 1 90  ? -28.558 37.024  -50.395 1.00 43.08  ? 109 ASN D OD1 1 
ATOM   2692  N ND2 . ASN B 1 90  ? -30.260 38.401  -49.868 1.00 53.55  ? 109 ASN D ND2 1 
ATOM   2693  N N   . LEU B 1 91  ? -30.798 32.508  -50.627 1.00 39.18  ? 110 LEU D N   1 
ATOM   2694  C CA  . LEU B 1 91  ? -31.707 31.396  -50.439 1.00 37.19  ? 110 LEU D CA  1 
ATOM   2695  C C   . LEU B 1 91  ? -31.888 31.117  -48.935 1.00 38.29  ? 110 LEU D C   1 
ATOM   2696  O O   . LEU B 1 91  ? -30.953 30.713  -48.240 1.00 38.97  ? 110 LEU D O   1 
ATOM   2697  C CB  . LEU B 1 91  ? -31.175 30.166  -51.168 1.00 32.88  ? 110 LEU D CB  1 
ATOM   2698  C CG  . LEU B 1 91  ? -32.105 28.958  -51.103 1.00 31.94  ? 110 LEU D CG  1 
ATOM   2699  C CD1 . LEU B 1 91  ? -33.510 29.403  -51.426 1.00 32.08  ? 110 LEU D CD1 1 
ATOM   2700  C CD2 . LEU B 1 91  ? -31.657 27.864  -52.050 1.00 32.12  ? 110 LEU D CD2 1 
ATOM   2701  N N   . THR B 1 92  ? -33.085 31.366  -48.429 1.00 39.16  ? 111 THR D N   1 
ATOM   2702  C CA  . THR B 1 92  ? -33.386 31.103  -47.036 1.00 39.35  ? 111 THR D CA  1 
ATOM   2703  C C   . THR B 1 92  ? -34.605 30.186  -46.950 1.00 39.24  ? 111 THR D C   1 
ATOM   2704  O O   . THR B 1 92  ? -35.565 30.396  -47.673 1.00 40.04  ? 111 THR D O   1 
ATOM   2705  C CB  . THR B 1 92  ? -33.632 32.427  -46.268 1.00 41.63  ? 111 THR D CB  1 
ATOM   2706  O OG1 . THR B 1 92  ? -32.381 33.095  -46.052 1.00 42.55  ? 111 THR D OG1 1 
ATOM   2707  C CG2 . THR B 1 92  ? -34.259 32.159  -44.930 1.00 41.46  ? 111 THR D CG2 1 
ATOM   2708  N N   . CYS B 1 93  ? -34.570 29.177  -46.079 1.00 38.74  ? 112 CYS D N   1 
ATOM   2709  C CA  . CYS B 1 93  ? -35.648 28.178  -45.998 1.00 38.58  ? 112 CYS D CA  1 
ATOM   2710  C C   . CYS B 1 93  ? -36.014 27.847  -44.550 1.00 38.75  ? 112 CYS D C   1 
ATOM   2711  O O   . CYS B 1 93  ? -35.134 27.773  -43.712 1.00 38.15  ? 112 CYS D O   1 
ATOM   2712  C CB  . CYS B 1 93  ? -35.245 26.884  -46.738 1.00 38.08  ? 112 CYS D CB  1 
ATOM   2713  S SG  . CYS B 1 93  ? -35.449 26.904  -48.541 1.00 65.90  ? 112 CYS D SG  1 
ATOM   2714  N N   . TRP B 1 94  ? -37.310 27.646  -44.281 1.00 39.77  ? 113 TRP D N   1 
ATOM   2715  C CA  . TRP B 1 94  ? -37.839 27.293  -42.956 1.00 40.65  ? 113 TRP D CA  1 
ATOM   2716  C C   . TRP B 1 94  ? -38.894 26.205  -43.000 1.00 40.93  ? 113 TRP D C   1 
ATOM   2717  O O   . TRP B 1 94  ? -39.861 26.315  -43.739 1.00 41.78  ? 113 TRP D O   1 
ATOM   2718  C CB  . TRP B 1 94  ? -38.606 28.459  -42.345 1.00 42.76  ? 113 TRP D CB  1 
ATOM   2719  C CG  . TRP B 1 94  ? -38.047 29.806  -42.500 1.00 44.10  ? 113 TRP D CG  1 
ATOM   2720  C CD1 . TRP B 1 94  ? -37.353 30.528  -41.553 1.00 44.97  ? 113 TRP D CD1 1 
ATOM   2721  C CD2 . TRP B 1 94  ? -38.177 30.659  -43.643 1.00 45.08  ? 113 TRP D CD2 1 
ATOM   2722  N NE1 . TRP B 1 94  ? -37.032 31.775  -42.053 1.00 46.07  ? 113 TRP D NE1 1 
ATOM   2723  C CE2 . TRP B 1 94  ? -37.517 31.878  -43.336 1.00 46.21  ? 113 TRP D CE2 1 
ATOM   2724  C CE3 . TRP B 1 94  ? -38.770 30.509  -44.900 1.00 45.31  ? 113 TRP D CE3 1 
ATOM   2725  C CZ2 . TRP B 1 94  ? -37.435 32.932  -44.247 1.00 47.33  ? 113 TRP D CZ2 1 
ATOM   2726  C CZ3 . TRP B 1 94  ? -38.690 31.547  -45.799 1.00 46.20  ? 113 TRP D CZ3 1 
ATOM   2727  C CH2 . TRP B 1 94  ? -38.024 32.742  -45.475 1.00 47.32  ? 113 TRP D CH2 1 
ATOM   2728  N N   . ILE B 1 95  ? -38.758 25.188  -42.165 1.00 41.16  ? 114 ILE D N   1 
ATOM   2729  C CA  . ILE B 1 95  ? -39.918 24.386  -41.804 1.00 43.05  ? 114 ILE D CA  1 
ATOM   2730  C C   . ILE B 1 95  ? -40.749 25.246  -40.851 1.00 36.66  ? 114 ILE D C   1 
ATOM   2731  O O   . ILE B 1 95  ? -40.218 25.886  -39.952 1.00 36.50  ? 114 ILE D O   1 
ATOM   2732  C CB  . ILE B 1 95  ? -39.534 23.074  -41.081 1.00 44.72  ? 114 ILE D CB  1 
ATOM   2733  C CG1 . ILE B 1 95  ? -38.799 22.131  -42.026 1.00 35.93  ? 114 ILE D CG1 1 
ATOM   2734  C CG2 . ILE B 1 95  ? -40.784 22.380  -40.482 1.00 48.18  ? 114 ILE D CG2 1 
ATOM   2735  C CD1 . ILE B 1 95  ? -39.554 21.885  -43.259 1.00 36.31  ? 114 ILE D CD1 1 
ATOM   2736  N N   . HIS B 1 96  ? -42.054 25.291  -41.059 1.00 42.99  ? 115 HIS D N   1 
ATOM   2737  C CA  . HIS B 1 96  ? -42.892 26.129  -40.228 1.00 44.54  ? 115 HIS D CA  1 
ATOM   2738  C C   . HIS B 1 96  ? -44.317 25.622  -40.173 1.00 46.01  ? 115 HIS D C   1 
ATOM   2739  O O   . HIS B 1 96  ? -44.751 24.793  -40.960 1.00 45.99  ? 115 HIS D O   1 
ATOM   2740  C CB  . HIS B 1 96  ? -42.888 27.560  -40.723 1.00 45.00  ? 115 HIS D CB  1 
ATOM   2741  C CG  . HIS B 1 96  ? -43.707 27.751  -41.955 1.00 46.10  ? 115 HIS D CG  1 
ATOM   2742  N ND1 . HIS B 1 96  ? -44.855 28.512  -41.975 1.00 48.46  ? 115 HIS D ND1 1 
ATOM   2743  C CD2 . HIS B 1 96  ? -43.559 27.247  -43.201 1.00 45.42  ? 115 HIS D CD2 1 
ATOM   2744  C CE1 . HIS B 1 96  ? -45.369 28.478  -43.190 1.00 49.03  ? 115 HIS D CE1 1 
ATOM   2745  N NE2 . HIS B 1 96  ? -44.605 27.713  -43.952 1.00 47.07  ? 115 HIS D NE2 1 
ATOM   2746  N N   . ASP B 1 97  ? -45.052 26.178  -39.233 1.00 47.68  ? 116 ASP D N   1 
ATOM   2747  C CA  . ASP B 1 97  ? -46.163 25.458  -38.642 1.00 50.18  ? 116 ASP D CA  1 
ATOM   2748  C C   . ASP B 1 97  ? -45.715 24.037  -38.474 1.00 50.74  ? 116 ASP D C   1 
ATOM   2749  O O   . ASP B 1 97  ? -44.606 23.802  -37.936 1.00 49.86  ? 116 ASP D O   1 
ATOM   2750  C CB  . ASP B 1 97  ? -47.432 25.683  -39.403 1.00 51.23  ? 116 ASP D CB  1 
ATOM   2751  C CG  . ASP B 1 97  ? -47.820 27.115  -39.315 1.00 51.90  ? 116 ASP D CG  1 
ATOM   2752  O OD1 . ASP B 1 97  ? -48.273 27.523  -38.219 1.00 54.03  ? 116 ASP D OD1 1 
ATOM   2753  O OD2 . ASP B 1 97  ? -47.549 27.862  -40.276 1.00 50.59  ? 116 ASP D OD2 1 
ATOM   2754  N N   . VAL B 1 98  ? -46.490 23.061  -38.884 1.00 52.44  ? 117 VAL D N   1 
ATOM   2755  C CA  . VAL B 1 98  ? -45.900 21.776  -38.633 1.00 52.49  ? 117 VAL D CA  1 
ATOM   2756  C C   . VAL B 1 98  ? -45.526 21.126  -39.931 1.00 51.19  ? 117 VAL D C   1 
ATOM   2757  O O   . VAL B 1 98  ? -44.509 20.441  -40.018 1.00 45.98  ? 117 VAL D O   1 
ATOM   2758  C CB  . VAL B 1 98  ? -46.755 20.911  -37.704 1.00 55.98  ? 117 VAL D CB  1 
ATOM   2759  C CG1 . VAL B 1 98  ? -46.004 19.650  -37.351 1.00 56.58  ? 117 VAL D CG1 1 
ATOM   2760  C CG2 . VAL B 1 98  ? -47.056 21.693  -36.437 1.00 52.51  ? 117 VAL D CG2 1 
ATOM   2761  N N   . ASP B 1 99  ? -46.315 21.415  -40.959 1.00 51.31  ? 118 ASP D N   1 
ATOM   2762  C CA  . ASP B 1 99  ? -46.280 20.602  -42.160 1.00 51.21  ? 118 ASP D CA  1 
ATOM   2763  C C   . ASP B 1 99  ? -45.642 21.242  -43.392 1.00 48.16  ? 118 ASP D C   1 
ATOM   2764  O O   . ASP B 1 99  ? -45.471 20.575  -44.395 1.00 48.11  ? 118 ASP D O   1 
ATOM   2765  C CB  . ASP B 1 99  ? -47.675 20.092  -42.455 1.00 55.07  ? 118 ASP D CB  1 
ATOM   2766  C CG  . ASP B 1 99  ? -48.272 19.368  -41.275 1.00 59.05  ? 118 ASP D CG  1 
ATOM   2767  O OD1 . ASP B 1 99  ? -47.658 18.375  -40.826 1.00 59.79  ? 118 ASP D OD1 1 
ATOM   2768  O OD2 . ASP B 1 99  ? -49.342 19.796  -40.767 1.00 61.85  ? 118 ASP D OD2 1 
ATOM   2769  N N   . PHE B 1 100 ? -45.234 22.501  -43.294 1.00 46.06  ? 119 PHE D N   1 
ATOM   2770  C CA  . PHE B 1 100 ? -44.769 23.239  -44.464 1.00 44.44  ? 119 PHE D CA  1 
ATOM   2771  C C   . PHE B 1 100 ? -43.270 23.540  -44.546 1.00 42.17  ? 119 PHE D C   1 
ATOM   2772  O O   . PHE B 1 100 ? -42.591 23.775  -43.541 1.00 38.25  ? 119 PHE D O   1 
ATOM   2773  C CB  . PHE B 1 100 ? -45.597 24.518  -44.630 1.00 42.22  ? 119 PHE D CB  1 
ATOM   2774  C CG  . PHE B 1 100 ? -47.065 24.260  -44.552 1.00 50.32  ? 119 PHE D CG  1 
ATOM   2775  C CD1 . PHE B 1 100 ? -47.760 23.810  -45.668 1.00 51.60  ? 119 PHE D CD1 1 
ATOM   2776  C CD2 . PHE B 1 100 ? -47.742 24.375  -43.345 1.00 51.99  ? 119 PHE D CD2 1 
ATOM   2777  C CE1 . PHE B 1 100 ? -49.111 23.515  -45.588 1.00 54.76  ? 119 PHE D CE1 1 
ATOM   2778  C CE2 . PHE B 1 100 ? -49.109 24.087  -43.266 1.00 55.11  ? 119 PHE D CE2 1 
ATOM   2779  C CZ  . PHE B 1 100 ? -49.791 23.656  -44.388 1.00 51.44  ? 119 PHE D CZ  1 
ATOM   2780  N N   . LEU B 1 101 ? -42.760 23.504  -45.773 1.00 41.44  ? 120 LEU D N   1 
ATOM   2781  C CA  . LEU B 1 101 ? -41.437 24.015  -46.071 1.00 35.99  ? 120 LEU D CA  1 
ATOM   2782  C C   . LEU B 1 101 ? -41.571 25.184  -47.034 1.00 35.56  ? 120 LEU D C   1 
ATOM   2783  O O   . LEU B 1 101 ? -42.142 25.054  -48.108 1.00 36.24  ? 120 LEU D O   1 
ATOM   2784  C CB  . LEU B 1 101 ? -40.556 22.928  -46.662 1.00 35.63  ? 120 LEU D CB  1 
ATOM   2785  C CG  . LEU B 1 101 ? -39.222 23.493  -47.140 1.00 36.61  ? 120 LEU D CG  1 
ATOM   2786  C CD1 . LEU B 1 101 ? -38.506 24.228  -46.051 1.00 33.10  ? 120 LEU D CD1 1 
ATOM   2787  C CD2 . LEU B 1 101 ? -38.346 22.392  -47.647 1.00 36.76  ? 120 LEU D CD2 1 
ATOM   2788  N N   . SER B 1 102 ? -41.064 26.337  -46.621 1.00 38.35  ? 121 SER D N   1 
ATOM   2789  C CA  . SER B 1 102 ? -41.066 27.524  -47.460 1.00 34.82  ? 121 SER D CA  1 
ATOM   2790  C C   . SER B 1 102 ? -39.654 28.029  -47.699 1.00 34.78  ? 121 SER D C   1 
ATOM   2791  O O   . SER B 1 102 ? -38.747 27.786  -46.888 1.00 32.73  ? 121 SER D O   1 
ATOM   2792  C CB  . SER B 1 102 ? -41.905 28.620  -46.843 1.00 36.15  ? 121 SER D CB  1 
ATOM   2793  O OG  . SER B 1 102 ? -43.254 28.241  -46.889 1.00 37.80  ? 121 SER D OG  1 
ATOM   2794  N N   . CYS B 1 103 ? -39.482 28.716  -48.826 1.00 33.63  ? 122 CYS D N   1 
ATOM   2795  C CA  . CYS B 1 103 ? -38.195 29.243  -49.250 1.00 32.93  ? 122 CYS D CA  1 
ATOM   2796  C C   . CYS B 1 103 ? -38.423 30.594  -49.858 1.00 34.04  ? 122 CYS D C   1 
ATOM   2797  O O   . CYS B 1 103 ? -39.534 30.933  -50.250 1.00 38.83  ? 122 CYS D O   1 
ATOM   2798  C CB  . CYS B 1 103 ? -37.554 28.350  -50.307 1.00 32.37  ? 122 CYS D CB  1 
ATOM   2799  S SG  . CYS B 1 103 ? -37.092 26.696  -49.757 1.00 41.59  ? 122 CYS D SG  1 
ATOM   2800  N N   . SER B 1 104 ? -37.355 31.365  -49.944 1.00 34.03  ? 123 SER D N   1 
ATOM   2801  C CA  . SER B 1 104 ? -37.406 32.649  -50.599 1.00 35.54  ? 123 SER D CA  1 
ATOM   2802  C C   . SER B 1 104 ? -35.991 33.018  -51.019 1.00 37.19  ? 123 SER D C   1 
ATOM   2803  O O   . SER B 1 104 ? -35.011 32.547  -50.438 1.00 34.48  ? 123 SER D O   1 
ATOM   2804  C CB  . SER B 1 104 ? -38.002 33.699  -49.675 1.00 37.04  ? 123 SER D CB  1 
ATOM   2805  O OG  . SER B 1 104 ? -37.333 33.685  -48.420 1.00 45.54  ? 123 SER D OG  1 
ATOM   2806  N N   . TRP B 1 105 ? -35.906 33.825  -52.069 1.00 39.78  ? 124 TRP D N   1 
ATOM   2807  C CA  . TRP B 1 105 ? -34.650 34.314  -52.585 1.00 37.50  ? 124 TRP D CA  1 
ATOM   2808  C C   . TRP B 1 105 ? -34.899 35.679  -53.181 1.00 40.02  ? 124 TRP D C   1 
ATOM   2809  O O   . TRP B 1 105 ? -35.998 36.223  -53.082 1.00 41.23  ? 124 TRP D O   1 
ATOM   2810  C CB  . TRP B 1 105 ? -34.077 33.359  -53.626 1.00 36.65  ? 124 TRP D CB  1 
ATOM   2811  C CG  . TRP B 1 105 ? -35.052 32.978  -54.699 1.00 36.90  ? 124 TRP D CG  1 
ATOM   2812  C CD1 . TRP B 1 105 ? -35.165 33.536  -55.944 1.00 38.46  ? 124 TRP D CD1 1 
ATOM   2813  C CD2 . TRP B 1 105 ? -36.036 31.942  -54.636 1.00 35.93  ? 124 TRP D CD2 1 
ATOM   2814  N NE1 . TRP B 1 105 ? -36.160 32.922  -56.648 1.00 38.44  ? 124 TRP D NE1 1 
ATOM   2815  C CE2 . TRP B 1 105 ? -36.712 31.936  -55.876 1.00 36.96  ? 124 TRP D CE2 1 
ATOM   2816  C CE3 . TRP B 1 105 ? -36.409 31.016  -53.660 1.00 34.65  ? 124 TRP D CE3 1 
ATOM   2817  C CZ2 . TRP B 1 105 ? -37.746 31.053  -56.156 1.00 36.81  ? 124 TRP D CZ2 1 
ATOM   2818  C CZ3 . TRP B 1 105 ? -37.431 30.141  -53.933 1.00 34.58  ? 124 TRP D CZ3 1 
ATOM   2819  C CH2 . TRP B 1 105 ? -38.095 30.165  -55.175 1.00 36.35  ? 124 TRP D CH2 1 
ATOM   2820  N N   . ALA B 1 106 ? -33.853 36.243  -53.757 1.00 41.25  ? 125 ALA D N   1 
ATOM   2821  C CA  . ALA B 1 106 ? -33.950 37.492  -54.475 1.00 44.14  ? 125 ALA D CA  1 
ATOM   2822  C C   . ALA B 1 106 ? -33.457 37.247  -55.897 1.00 50.18  ? 125 ALA D C   1 
ATOM   2823  O O   . ALA B 1 106 ? -32.605 36.375  -56.119 1.00 43.17  ? 125 ALA D O   1 
ATOM   2824  C CB  . ALA B 1 106 ? -33.113 38.551  -53.805 1.00 46.11  ? 125 ALA D CB  1 
ATOM   2825  N N   . VAL B 1 107 ? -34.006 37.993  -56.858 1.00 46.90  ? 126 VAL D N   1 
ATOM   2826  C CA  . VAL B 1 107 ? -33.482 37.977  -58.210 1.00 48.06  ? 126 VAL D CA  1 
ATOM   2827  C C   . VAL B 1 107 ? -32.068 38.544  -58.162 1.00 49.57  ? 126 VAL D C   1 
ATOM   2828  O O   . VAL B 1 107 ? -31.835 39.545  -57.502 1.00 51.43  ? 126 VAL D O   1 
ATOM   2829  C CB  . VAL B 1 107 ? -34.321 38.851  -59.160 1.00 50.92  ? 126 VAL D CB  1 
ATOM   2830  C CG1 . VAL B 1 107 ? -33.840 38.677  -60.582 1.00 52.03  ? 126 VAL D CG1 1 
ATOM   2831  C CG2 . VAL B 1 107 ? -35.794 38.515  -59.051 1.00 50.21  ? 126 VAL D CG2 1 
ATOM   2832  N N   . GLY B 1 108 ? -31.127 37.903  -58.846 1.00 49.15  ? 127 GLY D N   1 
ATOM   2833  C CA  . GLY B 1 108 ? -29.787 38.442  -58.960 1.00 51.19  ? 127 GLY D CA  1 
ATOM   2834  C C   . GLY B 1 108 ? -29.783 39.799  -59.645 1.00 56.30  ? 127 GLY D C   1 
ATOM   2835  O O   . GLY B 1 108 ? -30.435 39.975  -60.673 1.00 57.66  ? 127 GLY D O   1 
ATOM   2836  N N   . PRO B 1 109 ? -29.055 40.776  -59.074 1.00 58.74  ? 128 PRO D N   1 
ATOM   2837  C CA  . PRO B 1 109 ? -28.960 42.097  -59.700 1.00 62.14  ? 128 PRO D CA  1 
ATOM   2838  C C   . PRO B 1 109 ? -28.272 41.926  -61.049 1.00 70.25  ? 128 PRO D C   1 
ATOM   2839  O O   . PRO B 1 109 ? -27.349 41.127  -61.181 1.00 69.25  ? 128 PRO D O   1 
ATOM   2840  C CB  . PRO B 1 109 ? -28.070 42.874  -58.723 1.00 64.20  ? 128 PRO D CB  1 
ATOM   2841  C CG  . PRO B 1 109 ? -27.216 41.840  -58.097 1.00 61.22  ? 128 PRO D CG  1 
ATOM   2842  C CD  . PRO B 1 109 ? -28.116 40.638  -57.948 1.00 56.87  ? 128 PRO D CD  1 
ATOM   2843  N N   . GLY B 1 110 ? -28.714 42.634  -62.064 1.00 72.78  ? 129 GLY D N   1 
ATOM   2844  C CA  . GLY B 1 110 ? -28.226 42.277  -63.378 1.00 73.71  ? 129 GLY D CA  1 
ATOM   2845  C C   . GLY B 1 110 ? -28.562 40.818  -63.678 1.00 69.62  ? 129 GLY D C   1 
ATOM   2846  O O   . GLY B 1 110 ? -27.702 40.005  -64.037 1.00 68.78  ? 129 GLY D O   1 
ATOM   2847  N N   . ALA B 1 111 ? -29.823 40.473  -63.471 1.00 67.49  ? 130 ALA D N   1 
ATOM   2848  C CA  . ALA B 1 111 ? -30.370 39.327  -64.142 1.00 65.33  ? 130 ALA D CA  1 
ATOM   2849  C C   . ALA B 1 111 ? -30.832 39.882  -65.473 1.00 68.68  ? 130 ALA D C   1 
ATOM   2850  O O   . ALA B 1 111 ? -31.098 41.079  -65.597 1.00 65.69  ? 130 ALA D O   1 
ATOM   2851  C CB  . ALA B 1 111 ? -31.530 38.778  -63.384 1.00 56.36  ? 130 ALA D CB  1 
ATOM   2852  N N   . PRO B 1 112 ? -30.897 39.029  -66.488 1.00 61.96  ? 131 PRO D N   1 
ATOM   2853  C CA  . PRO B 1 112 ? -31.554 39.480  -67.708 1.00 67.25  ? 131 PRO D CA  1 
ATOM   2854  C C   . PRO B 1 112 ? -33.048 39.635  -67.453 1.00 64.12  ? 131 PRO D C   1 
ATOM   2855  O O   . PRO B 1 112 ? -33.586 38.960  -66.590 1.00 60.93  ? 131 PRO D O   1 
ATOM   2856  C CB  . PRO B 1 112 ? -31.259 38.353  -68.707 1.00 66.62  ? 131 PRO D CB  1 
ATOM   2857  C CG  . PRO B 1 112 ? -30.848 37.185  -67.885 1.00 63.01  ? 131 PRO D CG  1 
ATOM   2858  C CD  . PRO B 1 112 ? -30.229 37.731  -66.644 1.00 62.49  ? 131 PRO D CD  1 
ATOM   2859  N N   . ALA B 1 113 ? -33.701 40.522  -68.194 1.00 70.08  ? 132 ALA D N   1 
ATOM   2860  C CA  . ALA B 1 113 ? -35.104 40.837  -67.957 1.00 67.85  ? 132 ALA D CA  1 
ATOM   2861  C C   . ALA B 1 113 ? -36.022 39.614  -68.047 1.00 67.41  ? 132 ALA D C   1 
ATOM   2862  O O   . ALA B 1 113 ? -37.107 39.606  -67.469 1.00 66.69  ? 132 ALA D O   1 
ATOM   2863  C CB  . ALA B 1 113 ? -35.556 41.913  -68.924 1.00 72.61  ? 132 ALA D CB  1 
ATOM   2864  N N   . ASP B 1 114 ? -35.579 38.587  -68.771 1.00 66.14  ? 133 ASP D N   1 
ATOM   2865  C CA  . ASP B 1 114 ? -36.379 37.384  -69.011 1.00 61.54  ? 133 ASP D CA  1 
ATOM   2866  C C   . ASP B 1 114 ? -36.064 36.233  -68.053 1.00 57.58  ? 133 ASP D C   1 
ATOM   2867  O O   . ASP B 1 114 ? -36.571 35.126  -68.222 1.00 56.05  ? 133 ASP D O   1 
ATOM   2868  C CB  . ASP B 1 114 ? -36.174 36.893  -70.448 1.00 63.18  ? 133 ASP D CB  1 
ATOM   2869  C CG  . ASP B 1 114 ? -34.721 36.534  -70.748 1.00 64.72  ? 133 ASP D CG  1 
ATOM   2870  O OD1 . ASP B 1 114 ? -33.833 37.363  -70.460 1.00 65.99  ? 133 ASP D OD1 1 
ATOM   2871  O OD2 . ASP B 1 114 ? -34.463 35.424  -71.270 1.00 62.15  ? 133 ASP D OD2 1 
ATOM   2872  N N   . VAL B 1 115 ? -35.214 36.487  -67.068 1.00 56.33  ? 134 VAL D N   1 
ATOM   2873  C CA  . VAL B 1 115 ? -34.800 35.440  -66.156 1.00 53.01  ? 134 VAL D CA  1 
ATOM   2874  C C   . VAL B 1 115 ? -36.005 34.750  -65.508 1.00 50.98  ? 134 VAL D C   1 
ATOM   2875  O O   . VAL B 1 115 ? -37.024 35.372  -65.204 1.00 51.77  ? 134 VAL D O   1 
ATOM   2876  C CB  . VAL B 1 115 ? -33.819 35.983  -65.070 1.00 52.36  ? 134 VAL D CB  1 
ATOM   2877  C CG1 . VAL B 1 115 ? -34.541 36.864  -64.062 1.00 52.49  ? 134 VAL D CG1 1 
ATOM   2878  C CG2 . VAL B 1 115 ? -33.121 34.841  -64.372 1.00 49.57  ? 134 VAL D CG2 1 
ATOM   2879  N N   . GLN B 1 116 ? -35.901 33.445  -65.336 1.00 48.87  ? 135 GLN D N   1 
ATOM   2880  C CA  . GLN B 1 116 ? -36.841 32.767  -64.470 1.00 46.98  ? 135 GLN D CA  1 
ATOM   2881  C C   . GLN B 1 116 ? -36.098 31.789  -63.559 1.00 44.52  ? 135 GLN D C   1 
ATOM   2882  O O   . GLN B 1 116 ? -34.983 31.371  -63.870 1.00 51.94  ? 135 GLN D O   1 
ATOM   2883  C CB  . GLN B 1 116 ? -37.942 32.079  -65.275 1.00 47.78  ? 135 GLN D CB  1 
ATOM   2884  C CG  . GLN B 1 116 ? -39.138 31.591  -64.462 1.00 46.77  ? 135 GLN D CG  1 
ATOM   2885  C CD  . GLN B 1 116 ? -39.692 32.639  -63.494 1.00 50.24  ? 135 GLN D CD  1 
ATOM   2886  O OE1 . GLN B 1 116 ? -39.106 32.904  -62.428 1.00 48.74  ? 135 GLN D OE1 1 
ATOM   2887  N NE2 . GLN B 1 116 ? -40.836 33.221  -63.845 1.00 48.97  ? 135 GLN D NE2 1 
ATOM   2888  N N   . TYR B 1 117 ? -36.702 31.449  -62.427 1.00 42.87  ? 136 TYR D N   1 
ATOM   2889  C CA  . TYR B 1 117 ? -36.083 30.503  -61.507 1.00 44.51  ? 136 TYR D CA  1 
ATOM   2890  C C   . TYR B 1 117 ? -36.965 29.274  -61.216 1.00 40.02  ? 136 TYR D C   1 
ATOM   2891  O O   . TYR B 1 117 ? -38.191 29.356  -61.236 1.00 40.59  ? 136 TYR D O   1 
ATOM   2892  C CB  . TYR B 1 117 ? -35.671 31.203  -60.211 1.00 39.85  ? 136 TYR D CB  1 
ATOM   2893  C CG  . TYR B 1 117 ? -34.714 32.367  -60.379 1.00 41.06  ? 136 TYR D CG  1 
ATOM   2894  C CD1 . TYR B 1 117 ? -33.376 32.162  -60.713 1.00 41.31  ? 136 TYR D CD1 1 
ATOM   2895  C CD2 . TYR B 1 117 ? -35.139 33.673  -60.159 1.00 42.43  ? 136 TYR D CD2 1 
ATOM   2896  C CE1 . TYR B 1 117 ? -32.489 33.238  -60.827 1.00 42.87  ? 136 TYR D CE1 1 
ATOM   2897  C CE2 . TYR B 1 117 ? -34.271 34.747  -60.273 1.00 44.07  ? 136 TYR D CE2 1 
ATOM   2898  C CZ  . TYR B 1 117 ? -32.949 34.534  -60.607 1.00 44.27  ? 136 TYR D CZ  1 
ATOM   2899  O OH  . TYR B 1 117 ? -32.104 35.624  -60.735 1.00 46.40  ? 136 TYR D OH  1 
ATOM   2900  N N   . ASP B 1 118 ? -36.329 28.131  -60.984 1.00 39.16  ? 137 ASP D N   1 
ATOM   2901  C CA  . ASP B 1 118 ? -37.035 26.909  -60.626 1.00 39.65  ? 137 ASP D CA  1 
ATOM   2902  C C   . ASP B 1 118 ? -36.374 26.398  -59.365 1.00 38.13  ? 137 ASP D C   1 
ATOM   2903  O O   . ASP B 1 118 ? -35.146 26.429  -59.257 1.00 37.93  ? 137 ASP D O   1 
ATOM   2904  C CB  . ASP B 1 118 ? -36.874 25.788  -61.679 1.00 41.25  ? 137 ASP D CB  1 
ATOM   2905  C CG  . ASP B 1 118 ? -37.269 26.200  -63.103 1.00 43.39  ? 137 ASP D CG  1 
ATOM   2906  O OD1 . ASP B 1 118 ? -38.347 26.819  -63.285 1.00 44.01  ? 137 ASP D OD1 1 
ATOM   2907  O OD2 . ASP B 1 118 ? -36.496 25.854  -64.045 1.00 44.55  ? 137 ASP D OD2 1 
ATOM   2908  N N   . LEU B 1 119 ? -37.167 25.882  -58.432 1.00 37.46  ? 138 LEU D N   1 
ATOM   2909  C CA  . LEU B 1 119 ? -36.612 25.264  -57.235 1.00 35.64  ? 138 LEU D CA  1 
ATOM   2910  C C   . LEU B 1 119 ? -36.855 23.743  -57.170 1.00 36.38  ? 138 LEU D C   1 
ATOM   2911  O O   . LEU B 1 119 ? -37.970 23.267  -57.337 1.00 37.31  ? 138 LEU D O   1 
ATOM   2912  C CB  . LEU B 1 119 ? -37.128 25.990  -55.987 1.00 34.69  ? 138 LEU D CB  1 
ATOM   2913  C CG  . LEU B 1 119 ? -36.741 25.467  -54.606 1.00 33.74  ? 138 LEU D CG  1 
ATOM   2914  C CD1 . LEU B 1 119 ? -36.680 26.642  -53.658 1.00 33.83  ? 138 LEU D CD1 1 
ATOM   2915  C CD2 . LEU B 1 119 ? -37.720 24.421  -54.104 1.00 34.27  ? 138 LEU D CD2 1 
ATOM   2916  N N   . TYR B 1 120 ? -35.792 22.993  -56.924 1.00 36.40  ? 139 TYR D N   1 
ATOM   2917  C CA  . TYR B 1 120 ? -35.891 21.548  -56.750 1.00 37.58  ? 139 TYR D CA  1 
ATOM   2918  C C   . TYR B 1 120 ? -35.472 21.090  -55.337 1.00 36.94  ? 139 TYR D C   1 
ATOM   2919  O O   . TYR B 1 120 ? -34.632 21.702  -54.678 1.00 35.74  ? 139 TYR D O   1 
ATOM   2920  C CB  . TYR B 1 120 ? -35.078 20.828  -57.837 1.00 42.14  ? 139 TYR D CB  1 
ATOM   2921  C CG  . TYR B 1 120 ? -35.354 21.347  -59.240 1.00 43.16  ? 139 TYR D CG  1 
ATOM   2922  C CD1 . TYR B 1 120 ? -36.312 20.759  -60.048 1.00 41.68  ? 139 TYR D CD1 1 
ATOM   2923  C CD2 . TYR B 1 120 ? -34.667 22.449  -59.741 1.00 42.98  ? 139 TYR D CD2 1 
ATOM   2924  C CE1 . TYR B 1 120 ? -36.565 21.246  -61.315 1.00 47.19  ? 139 TYR D CE1 1 
ATOM   2925  C CE2 . TYR B 1 120 ? -34.921 22.941  -61.001 1.00 44.33  ? 139 TYR D CE2 1 
ATOM   2926  C CZ  . TYR B 1 120 ? -35.864 22.344  -61.783 1.00 46.43  ? 139 TYR D CZ  1 
ATOM   2927  O OH  . TYR B 1 120 ? -36.092 22.856  -63.050 1.00 48.23  ? 139 TYR D OH  1 
ATOM   2928  N N   . LEU B 1 121 ? -36.079 20.012  -54.870 1.00 38.09  ? 140 LEU D N   1 
ATOM   2929  C CA  . LEU B 1 121 ? -35.798 19.503  -53.540 1.00 57.61  ? 140 LEU D CA  1 
ATOM   2930  C C   . LEU B 1 121 ? -35.294 18.061  -53.636 1.00 59.93  ? 140 LEU D C   1 
ATOM   2931  O O   . LEU B 1 121 ? -36.042 17.180  -54.027 1.00 61.79  ? 140 LEU D O   1 
ATOM   2932  C CB  . LEU B 1 121 ? -37.056 19.607  -52.665 1.00 37.77  ? 140 LEU D CB  1 
ATOM   2933  C CG  . LEU B 1 121 ? -36.931 19.180  -51.198 1.00 43.67  ? 140 LEU D CG  1 
ATOM   2934  C CD1 . LEU B 1 121 ? -37.732 20.064  -50.261 1.00 42.41  ? 140 LEU D CD1 1 
ATOM   2935  C CD2 . LEU B 1 121 ? -37.372 17.748  -51.027 1.00 46.22  ? 140 LEU D CD2 1 
ATOM   2936  N N   . ASN B 1 122 ? -34.027 17.818  -53.308 1.00 60.74  ? 141 ASN D N   1 
ATOM   2937  C CA  . ASN B 1 122 ? -33.520 16.452  -53.277 1.00 64.36  ? 141 ASN D CA  1 
ATOM   2938  C C   . ASN B 1 122 ? -33.613 15.932  -51.867 1.00 65.58  ? 141 ASN D C   1 
ATOM   2939  O O   . ASN B 1 122 ? -33.266 16.636  -50.933 1.00 63.67  ? 141 ASN D O   1 
ATOM   2940  C CB  . ASN B 1 122 ? -32.050 16.375  -53.689 1.00 65.33  ? 141 ASN D CB  1 
ATOM   2941  C CG  . ASN B 1 122 ? -31.752 17.103  -54.982 1.00 65.20  ? 141 ASN D CG  1 
ATOM   2942  O OD1 . ASN B 1 122 ? -32.552 17.087  -55.929 1.00 65.90  ? 141 ASN D OD1 1 
ATOM   2943  N ND2 . ASN B 1 122 ? -30.576 17.738  -55.039 1.00 64.63  ? 141 ASN D ND2 1 
ATOM   2944  N N   . VAL B 1 123 ? -34.070 14.698  -51.713 1.00 69.25  ? 142 VAL D N   1 
ATOM   2945  C CA  . VAL B 1 123 ? -33.992 14.013  -50.430 1.00 71.79  ? 142 VAL D CA  1 
ATOM   2946  C C   . VAL B 1 123 ? -33.264 12.694  -50.603 1.00 77.19  ? 142 VAL D C   1 
ATOM   2947  O O   . VAL B 1 123 ? -33.469 11.758  -49.830 1.00 79.71  ? 142 VAL D O   1 
ATOM   2948  C CB  . VAL B 1 123 ? -35.371 13.709  -49.875 1.00 72.22  ? 142 VAL D CB  1 
ATOM   2949  C CG1 . VAL B 1 123 ? -36.028 14.983  -49.413 1.00 68.98  ? 142 VAL D CG1 1 
ATOM   2950  C CG2 . VAL B 1 123 ? -36.211 13.008  -50.937 1.00 74.56  ? 142 VAL D CG2 1 
ATOM   2951  N N   . ALA B 1 124 ? -32.429 12.626  -51.637 1.00 79.50  ? 143 ALA D N   1 
ATOM   2952  C CA  . ALA B 1 124 ? -31.619 11.441  -51.933 1.00 84.74  ? 143 ALA D CA  1 
ATOM   2953  C C   . ALA B 1 124 ? -32.433 10.146  -52.128 1.00 89.85  ? 143 ALA D C   1 
ATOM   2954  O O   . ALA B 1 124 ? -32.108 9.103   -51.547 1.00 93.04  ? 143 ALA D O   1 
ATOM   2955  C CB  . ALA B 1 124 ? -30.506 11.252  -50.876 1.00 85.42  ? 143 ALA D CB  1 
ATOM   2956  N N   . LYS B 1 125 ? -33.482 10.220  -52.950 1.00 91.25  ? 144 LYS D N   1 
ATOM   2957  C CA  . LYS B 1 125 ? -34.289 9.031   -53.295 1.00 96.71  ? 144 LYS D CA  1 
ATOM   2958  C C   . LYS B 1 125 ? -33.592 7.880   -54.083 1.00 108.35 ? 144 LYS D C   1 
ATOM   2959  O O   . LYS B 1 125 ? -33.778 6.713   -53.720 1.00 112.56 ? 144 LYS D O   1 
ATOM   2960  C CB  . LYS B 1 125 ? -35.634 9.413   -53.961 1.00 96.66  ? 144 LYS D CB  1 
ATOM   2961  C CG  . LYS B 1 125 ? -36.703 9.990   -53.035 1.00 94.92  ? 144 LYS D CG  1 
ATOM   2962  C CD  . LYS B 1 125 ? -37.983 9.153   -53.086 1.00 98.48  ? 144 LYS D CD  1 
ATOM   2963  C CE  . LYS B 1 125 ? -39.139 9.859   -52.391 1.00 96.43  ? 144 LYS D CE  1 
ATOM   2964  N NZ  . LYS B 1 125 ? -38.795 10.345  -51.030 1.00 94.06  ? 144 LYS D NZ  1 
ATOM   2965  N N   . ARG B 1 126 ? -32.825 8.161   -55.147 1.00 108.01 ? 145 ARG D N   1 
ATOM   2966  C CA  . ARG B 1 126 ? -32.564 9.499   -55.692 1.00 103.32 ? 145 ARG D CA  1 
ATOM   2967  C C   . ARG B 1 126 ? -33.723 10.078  -56.515 1.00 100.20 ? 145 ARG D C   1 
ATOM   2968  O O   . ARG B 1 126 ? -34.179 9.453   -57.480 1.00 103.39 ? 145 ARG D O   1 
ATOM   2969  C CB  . ARG B 1 126 ? -31.280 9.506   -56.539 1.00 105.60 ? 145 ARG D CB  1 
ATOM   2970  C CG  . ARG B 1 126 ? -29.966 9.449   -55.755 1.00 106.82 ? 145 ARG D CG  1 
ATOM   2971  C CD  . ARG B 1 126 ? -29.809 10.581  -54.730 1.00 103.11 ? 145 ARG D CD  1 
ATOM   2972  N NE  . ARG B 1 126 ? -30.612 11.772  -55.023 1.00 99.87  ? 145 ARG D NE  1 
ATOM   2973  C CZ  . ARG B 1 126 ? -30.137 12.919  -55.503 1.00 97.80  ? 145 ARG D CZ  1 
ATOM   2974  N NH1 . ARG B 1 126 ? -28.840 13.061  -55.753 1.00 98.68  ? 145 ARG D NH1 1 
ATOM   2975  N NH2 . ARG B 1 126 ? -30.968 13.933  -55.730 1.00 95.04  ? 145 ARG D NH2 1 
ATOM   2976  N N   . GLN B 1 127 ? -34.194 11.264  -56.118 1.00 94.05  ? 146 GLN D N   1 
ATOM   2977  C CA  . GLN B 1 127 ? -35.224 11.981  -56.869 1.00 90.46  ? 146 GLN D CA  1 
ATOM   2978  C C   . GLN B 1 127 ? -35.397 13.451  -56.458 1.00 83.12  ? 146 GLN D C   1 
ATOM   2979  O O   . GLN B 1 127 ? -35.626 13.761  -55.286 1.00 81.61  ? 146 GLN D O   1 
ATOM   2980  C CB  . GLN B 1 127 ? -36.579 11.264  -56.797 1.00 93.49  ? 146 GLN D CB  1 
ATOM   2981  C CG  . GLN B 1 127 ? -37.566 11.751  -57.858 1.00 94.02  ? 146 GLN D CG  1 
ATOM   2982  C CD  . GLN B 1 127 ? -38.973 11.190  -57.688 1.00 96.90  ? 146 GLN D CD  1 
ATOM   2983  O OE1 . GLN B 1 127 ? -39.381 10.796  -56.589 1.00 97.69  ? 146 GLN D OE1 1 
ATOM   2984  N NE2 . GLN B 1 127 ? -39.723 11.153  -58.785 1.00 98.67  ? 146 GLN D NE2 1 
ATOM   2985  N N   . GLN B 1 128 ? -35.287 14.339  -57.446 1.00 78.35  ? 147 GLN D N   1 
ATOM   2986  C CA  . GLN B 1 128 ? -35.658 15.746  -57.311 1.00 71.48  ? 147 GLN D CA  1 
ATOM   2987  C C   . GLN B 1 128 ? -37.168 15.896  -57.132 1.00 68.16  ? 147 GLN D C   1 
ATOM   2988  O O   . GLN B 1 128 ? -37.916 14.963  -57.373 1.00 70.75  ? 147 GLN D O   1 
ATOM   2989  C CB  . GLN B 1 128 ? -35.244 16.522  -58.560 1.00 70.81  ? 147 GLN D CB  1 
ATOM   2990  C CG  . GLN B 1 128 ? -33.755 16.633  -58.777 1.00 70.83  ? 147 GLN D CG  1 
ATOM   2991  C CD  . GLN B 1 128 ? -33.375 17.897  -59.545 1.00 69.30  ? 147 GLN D CD  1 
ATOM   2992  O OE1 . GLN B 1 128 ? -33.951 18.191  -60.595 1.00 69.79  ? 147 GLN D OE1 1 
ATOM   2993  N NE2 . GLN B 1 128 ? -32.411 18.660  -59.012 1.00 67.71  ? 147 GLN D NE2 1 
ATOM   2994  N N   . TYR B 1 129 ? -37.605 17.085  -56.741 1.00 62.67  ? 148 TYR D N   1 
ATOM   2995  C CA  . TYR B 1 129 ? -39.007 17.388  -56.530 1.00 59.93  ? 148 TYR D CA  1 
ATOM   2996  C C   . TYR B 1 129 ? -39.175 18.858  -56.791 1.00 55.21  ? 148 TYR D C   1 
ATOM   2997  O O   . TYR B 1 129 ? -38.709 19.679  -56.022 1.00 52.70  ? 148 TYR D O   1 
ATOM   2998  C CB  . TYR B 1 129 ? -39.399 17.087  -55.095 1.00 59.87  ? 148 TYR D CB  1 
ATOM   2999  C CG  . TYR B 1 129 ? -39.741 15.647  -54.883 1.00 63.39  ? 148 TYR D CG  1 
ATOM   3000  C CD1 . TYR B 1 129 ? -40.386 14.939  -55.880 1.00 66.42  ? 148 TYR D CD1 1 
ATOM   3001  C CD2 . TYR B 1 129 ? -39.427 14.985  -53.698 1.00 64.15  ? 148 TYR D CD2 1 
ATOM   3002  C CE1 . TYR B 1 129 ? -40.708 13.615  -55.731 1.00 70.03  ? 148 TYR D CE1 1 
ATOM   3003  C CE2 . TYR B 1 129 ? -39.762 13.641  -53.524 1.00 67.81  ? 148 TYR D CE2 1 
ATOM   3004  C CZ  . TYR B 1 129 ? -40.405 12.961  -54.561 1.00 70.95  ? 148 TYR D CZ  1 
ATOM   3005  O OH  . TYR B 1 129 ? -40.765 11.625  -54.476 1.00 75.34  ? 148 TYR D OH  1 
ATOM   3006  N N   . GLU B 1 130 ? -39.825 19.211  -57.889 1.00 54.19  ? 149 GLU D N   1 
ATOM   3007  C CA  . GLU B 1 130 ? -39.943 20.623  -58.225 1.00 50.75  ? 149 GLU D CA  1 
ATOM   3008  C C   . GLU B 1 130 ? -41.009 21.323  -57.384 1.00 48.46  ? 149 GLU D C   1 
ATOM   3009  O O   . GLU B 1 130 ? -41.994 20.713  -56.999 1.00 49.38  ? 149 GLU D O   1 
ATOM   3010  C CB  . GLU B 1 130 ? -40.207 20.825  -59.718 1.00 51.89  ? 149 GLU D CB  1 
ATOM   3011  C CG  . GLU B 1 130 ? -40.338 22.294  -60.070 1.00 50.71  ? 149 GLU D CG  1 
ATOM   3012  C CD  . GLU B 1 130 ? -40.423 22.555  -61.541 1.00 52.03  ? 149 GLU D CD  1 
ATOM   3013  O OE1 . GLU B 1 130 ? -40.389 21.554  -62.301 1.00 53.84  ? 149 GLU D OE1 1 
ATOM   3014  O OE2 . GLU B 1 130 ? -40.523 23.758  -61.920 1.00 51.54  ? 149 GLU D OE2 1 
ATOM   3015  N N   . CYS B 1 131 ? -40.807 22.597  -57.084 1.00 46.14  ? 150 CYS D N   1 
ATOM   3016  C CA  . CYS B 1 131 ? -41.844 23.344  -56.407 1.00 46.10  ? 150 CYS D CA  1 
ATOM   3017  C C   . CYS B 1 131 ? -43.125 23.338  -57.226 1.00 48.24  ? 150 CYS D C   1 
ATOM   3018  O O   . CYS B 1 131 ? -43.105 23.621  -58.413 1.00 48.82  ? 150 CYS D O   1 
ATOM   3019  C CB  . CYS B 1 131 ? -41.430 24.786  -56.133 1.00 38.23  ? 150 CYS D CB  1 
ATOM   3020  S SG  . CYS B 1 131 ? -42.494 25.535  -54.877 1.00 63.07  ? 150 CYS D SG  1 
ATOM   3021  N N   . LEU B 1 132 ? -44.232 23.009  -56.571 1.00 42.95  ? 151 LEU D N   1 
ATOM   3022  C CA  . LEU B 1 132 ? -45.540 23.014  -57.186 1.00 45.34  ? 151 LEU D CA  1 
ATOM   3023  C C   . LEU B 1 132 ? -46.240 24.355  -56.957 1.00 47.89  ? 151 LEU D C   1 
ATOM   3024  O O   . LEU B 1 132 ? -47.136 24.738  -57.719 1.00 49.91  ? 151 LEU D O   1 
ATOM   3025  C CB  . LEU B 1 132 ? -46.380 21.860  -56.634 1.00 47.32  ? 151 LEU D CB  1 
ATOM   3026  C CG  . LEU B 1 132 ? -45.772 20.442  -56.644 1.00 47.86  ? 151 LEU D CG  1 
ATOM   3027  C CD1 . LEU B 1 132 ? -46.803 19.392  -56.249 1.00 50.76  ? 151 LEU D CD1 1 
ATOM   3028  C CD2 . LEU B 1 132 ? -45.082 20.069  -57.971 1.00 48.22  ? 151 LEU D CD2 1 
ATOM   3029  N N   . HIS B 1 133 ? -45.806 25.081  -55.927 1.00 45.96  ? 152 HIS D N   1 
ATOM   3030  C CA  . HIS B 1 133 ? -46.486 26.297  -55.483 1.00 46.36  ? 152 HIS D CA  1 
ATOM   3031  C C   . HIS B 1 133 ? -45.523 27.451  -55.363 1.00 44.64  ? 152 HIS D C   1 
ATOM   3032  O O   . HIS B 1 133 ? -44.878 27.601  -54.330 1.00 43.47  ? 152 HIS D O   1 
ATOM   3033  C CB  . HIS B 1 133 ? -47.137 26.069  -54.117 1.00 46.97  ? 152 HIS D CB  1 
ATOM   3034  C CG  . HIS B 1 133 ? -48.138 24.951  -54.097 1.00 49.19  ? 152 HIS D CG  1 
ATOM   3035  N ND1 . HIS B 1 133 ? -49.319 24.997  -54.801 1.00 51.70  ? 152 HIS D ND1 1 
ATOM   3036  C CD2 . HIS B 1 133 ? -48.124 23.758  -53.453 1.00 49.49  ? 152 HIS D CD2 1 
ATOM   3037  C CE1 . HIS B 1 133 ? -49.991 23.876  -54.598 1.00 53.57  ? 152 HIS D CE1 1 
ATOM   3038  N NE2 . HIS B 1 133 ? -49.290 23.111  -53.785 1.00 52.29  ? 152 HIS D NE2 1 
ATOM   3039  N N   . TYR B 1 134 ? -45.416 28.270  -56.405 1.00 45.00  ? 153 TYR D N   1 
ATOM   3040  C CA  . TYR B 1 134 ? -44.445 29.368  -56.400 1.00 43.76  ? 153 TYR D CA  1 
ATOM   3041  C C   . TYR B 1 134 ? -45.020 30.699  -55.955 1.00 45.20  ? 153 TYR D C   1 
ATOM   3042  O O   . TYR B 1 134 ? -46.209 30.956  -56.083 1.00 47.51  ? 153 TYR D O   1 
ATOM   3043  C CB  . TYR B 1 134 ? -43.803 29.568  -57.769 1.00 43.75  ? 153 TYR D CB  1 
ATOM   3044  C CG  . TYR B 1 134 ? -42.766 28.550  -58.167 1.00 42.29  ? 153 TYR D CG  1 
ATOM   3045  C CD1 . TYR B 1 134 ? -41.438 28.678  -57.798 1.00 40.36  ? 153 TYR D CD1 1 
ATOM   3046  C CD2 . TYR B 1 134 ? -43.112 27.478  -58.948 1.00 43.36  ? 153 TYR D CD2 1 
ATOM   3047  C CE1 . TYR B 1 134 ? -40.496 27.755  -58.197 1.00 39.49  ? 153 TYR D CE1 1 
ATOM   3048  C CE2 . TYR B 1 134 ? -42.181 26.548  -59.345 1.00 42.57  ? 153 TYR D CE2 1 
ATOM   3049  C CZ  . TYR B 1 134 ? -40.879 26.685  -58.969 1.00 40.62  ? 153 TYR D CZ  1 
ATOM   3050  O OH  . TYR B 1 134 ? -39.987 25.728  -59.396 1.00 40.32  ? 153 TYR D OH  1 
ATOM   3051  N N   . LYS B 1 135 ? -44.148 31.546  -55.429 1.00 44.18  ? 154 LYS D N   1 
ATOM   3052  C CA  . LYS B 1 135 ? -44.503 32.906  -55.081 1.00 45.76  ? 154 LYS D CA  1 
ATOM   3053  C C   . LYS B 1 135 ? -43.771 33.705  -56.130 1.00 46.29  ? 154 LYS D C   1 
ATOM   3054  O O   . LYS B 1 135 ? -42.637 33.379  -56.445 1.00 44.81  ? 154 LYS D O   1 
ATOM   3055  C CB  . LYS B 1 135 ? -43.983 33.238  -53.678 1.00 44.70  ? 154 LYS D CB  1 
ATOM   3056  C CG  . LYS B 1 135 ? -44.418 34.585  -53.100 1.00 47.41  ? 154 LYS D CG  1 
ATOM   3057  C CD  . LYS B 1 135 ? -44.043 34.675  -51.603 1.00 46.98  ? 154 LYS D CD  1 
ATOM   3058  C CE  . LYS B 1 135 ? -44.906 35.660  -50.794 1.00 50.00  ? 154 LYS D CE  1 
ATOM   3059  N NZ  . LYS B 1 135 ? -44.822 37.069  -51.294 1.00 52.65  ? 154 LYS D NZ  1 
ATOM   3060  N N   . THR B 1 136 ? -44.407 34.719  -56.706 1.00 48.84  ? 155 THR D N   1 
ATOM   3061  C CA  . THR B 1 136 ? -43.752 35.485  -57.763 1.00 49.36  ? 155 THR D CA  1 
ATOM   3062  C C   . THR B 1 136 ? -43.844 36.986  -57.497 1.00 58.81  ? 155 THR D C   1 
ATOM   3063  O O   . THR B 1 136 ? -44.813 37.454  -56.900 1.00 54.08  ? 155 THR D O   1 
ATOM   3064  C CB  . THR B 1 136 ? -44.334 35.167  -59.192 1.00 50.79  ? 155 THR D CB  1 
ATOM   3065  O OG1 . THR B 1 136 ? -45.530 35.921  -59.414 1.00 54.12  ? 155 THR D OG1 1 
ATOM   3066  C CG2 . THR B 1 136 ? -44.625 33.680  -59.380 1.00 49.12  ? 155 THR D CG2 1 
ATOM   3067  N N   . ASP B 1 137 ? -42.841 37.738  -57.951 1.00 59.24  ? 156 ASP D N   1 
ATOM   3068  C CA  . ASP B 1 137 ? -42.831 39.186  -57.753 1.00 62.64  ? 156 ASP D CA  1 
ATOM   3069  C C   . ASP B 1 137 ? -43.795 39.933  -58.674 1.00 66.58  ? 156 ASP D C   1 
ATOM   3070  O O   . ASP B 1 137 ? -44.740 39.350  -59.208 1.00 66.84  ? 156 ASP D O   1 
ATOM   3071  C CB  . ASP B 1 137 ? -41.408 39.777  -57.826 1.00 62.94  ? 156 ASP D CB  1 
ATOM   3072  C CG  . ASP B 1 137 ? -40.751 39.638  -59.205 1.00 63.45  ? 156 ASP D CG  1 
ATOM   3073  O OD1 . ASP B 1 137 ? -41.446 39.370  -60.214 1.00 64.50  ? 156 ASP D OD1 1 
ATOM   3074  O OD2 . ASP B 1 137 ? -39.508 39.817  -59.271 1.00 62.96  ? 156 ASP D OD2 1 
ATOM   3075  N N   . ALA B 1 138 ? -43.551 41.228  -58.852 1.00 70.15  ? 157 ALA D N   1 
ATOM   3076  C CA  . ALA B 1 138 ? -44.407 42.059  -59.697 1.00 74.69  ? 157 ALA D CA  1 
ATOM   3077  C C   . ALA B 1 138 ? -44.219 41.775  -61.189 1.00 75.01  ? 157 ALA D C   1 
ATOM   3078  O O   . ALA B 1 138 ? -45.122 42.011  -61.986 1.00 78.01  ? 157 ALA D O   1 
ATOM   3079  C CB  . ALA B 1 138 ? -44.175 43.540  -59.397 1.00 78.84  ? 157 ALA D CB  1 
ATOM   3080  N N   . GLN B 1 139 ? -43.046 41.269  -61.559 1.00 72.27  ? 158 GLN D N   1 
ATOM   3081  C CA  . GLN B 1 139 ? -42.724 40.986  -62.955 1.00 72.53  ? 158 GLN D CA  1 
ATOM   3082  C C   . GLN B 1 139 ? -42.839 39.499  -63.277 1.00 68.93  ? 158 GLN D C   1 
ATOM   3083  O O   . GLN B 1 139 ? -42.350 39.037  -64.312 1.00 68.47  ? 158 GLN D O   1 
ATOM   3084  C CB  . GLN B 1 139 ? -41.318 41.480  -63.293 1.00 72.90  ? 158 GLN D CB  1 
ATOM   3085  C CG  . GLN B 1 139 ? -41.190 42.987  -63.372 1.00 77.71  ? 158 GLN D CG  1 
ATOM   3086  C CD  . GLN B 1 139 ? -40.864 43.630  -62.035 1.00 78.30  ? 158 GLN D CD  1 
ATOM   3087  O OE1 . GLN B 1 139 ? -41.026 43.019  -60.977 1.00 75.53  ? 158 GLN D OE1 1 
ATOM   3088  N NE2 . GLN B 1 139 ? -40.391 44.872  -62.078 1.00 82.27  ? 158 GLN D NE2 1 
ATOM   3089  N N   . GLY B 1 140 ? -43.471 38.752  -62.374 1.00 66.69  ? 159 GLY D N   1 
ATOM   3090  C CA  . GLY B 1 140 ? -43.749 37.344  -62.594 1.00 64.04  ? 159 GLY D CA  1 
ATOM   3091  C C   . GLY B 1 140 ? -42.538 36.453  -62.441 1.00 54.07  ? 159 GLY D C   1 
ATOM   3092  O O   . GLY B 1 140 ? -42.542 35.313  -62.909 1.00 52.58  ? 159 GLY D O   1 
ATOM   3093  N N   . THR B 1 141 ? -41.498 36.978  -61.794 1.00 53.25  ? 160 THR D N   1 
ATOM   3094  C CA  . THR B 1 141 ? -40.292 36.204  -61.544 1.00 50.37  ? 160 THR D CA  1 
ATOM   3095  C C   . THR B 1 141 ? -40.418 35.476  -60.209 1.00 50.46  ? 160 THR D C   1 
ATOM   3096  O O   . THR B 1 141 ? -40.700 36.084  -59.171 1.00 48.10  ? 160 THR D O   1 
ATOM   3097  C CB  . THR B 1 141 ? -39.016 37.076  -61.520 1.00 51.23  ? 160 THR D CB  1 
ATOM   3098  O OG1 . THR B 1 141 ? -38.992 37.947  -62.656 1.00 54.27  ? 160 THR D OG1 1 
ATOM   3099  C CG2 . THR B 1 141 ? -37.757 36.199  -61.515 1.00 48.78  ? 160 THR D CG2 1 
ATOM   3100  N N   . ARG B 1 142 ? -40.209 34.168  -60.250 1.00 45.56  ? 161 ARG D N   1 
ATOM   3101  C CA  . ARG B 1 142 ? -40.263 33.355  -59.058 1.00 43.34  ? 161 ARG D CA  1 
ATOM   3102  C C   . ARG B 1 142 ? -39.260 33.811  -57.983 1.00 42.22  ? 161 ARG D C   1 
ATOM   3103  O O   . ARG B 1 142 ? -38.076 33.965  -58.266 1.00 41.93  ? 161 ARG D O   1 
ATOM   3104  C CB  . ARG B 1 142 ? -40.071 31.886  -59.425 1.00 41.84  ? 161 ARG D CB  1 
ATOM   3105  C CG  . ARG B 1 142 ? -41.364 31.215  -59.830 1.00 42.76  ? 161 ARG D CG  1 
ATOM   3106  C CD  . ARG B 1 142 ? -41.451 30.892  -61.302 1.00 44.09  ? 161 ARG D CD  1 
ATOM   3107  N NE  . ARG B 1 142 ? -40.956 29.571  -61.681 1.00 43.16  ? 161 ARG D NE  1 
ATOM   3108  C CZ  . ARG B 1 142 ? -41.665 28.704  -62.397 1.00 44.26  ? 161 ARG D CZ  1 
ATOM   3109  N NH1 . ARG B 1 142 ? -42.895 29.018  -62.784 1.00 46.17  ? 161 ARG D NH1 1 
ATOM   3110  N NH2 . ARG B 1 142 ? -41.157 27.524  -62.733 1.00 49.99  ? 161 ARG D NH2 1 
ATOM   3111  N N   . ILE B 1 143 ? -39.769 34.044  -56.765 1.00 47.26  ? 162 ILE D N   1 
ATOM   3112  C CA  . ILE B 1 143 ? -38.968 34.435  -55.597 1.00 46.44  ? 162 ILE D CA  1 
ATOM   3113  C C   . ILE B 1 143 ? -39.261 33.649  -54.324 1.00 39.49  ? 162 ILE D C   1 
ATOM   3114  O O   . ILE B 1 143 ? -38.634 33.910  -53.321 1.00 47.98  ? 162 ILE D O   1 
ATOM   3115  C CB  . ILE B 1 143 ? -39.125 35.930  -55.222 1.00 43.51  ? 162 ILE D CB  1 
ATOM   3116  C CG1 . ILE B 1 143 ? -40.598 36.298  -55.066 1.00 45.36  ? 162 ILE D CG1 1 
ATOM   3117  C CG2 . ILE B 1 143 ? -38.408 36.820  -56.214 1.00 45.35  ? 162 ILE D CG2 1 
ATOM   3118  C CD1 . ILE B 1 143 ? -40.821 37.769  -54.838 1.00 48.44  ? 162 ILE D CD1 1 
ATOM   3119  N N   . GLY B 1 144 ? -40.202 32.706  -54.363 1.00 39.10  ? 163 GLY D N   1 
ATOM   3120  C CA  . GLY B 1 144 ? -40.567 31.918  -53.199 1.00 38.02  ? 163 GLY D CA  1 
ATOM   3121  C C   . GLY B 1 144 ? -41.203 30.563  -53.487 1.00 37.58  ? 163 GLY D C   1 
ATOM   3122  O O   . GLY B 1 144 ? -41.813 30.333  -54.534 1.00 38.58  ? 163 GLY D O   1 
ATOM   3123  N N   . CYS B 1 145 ? -41.054 29.648  -52.534 1.00 38.04  ? 164 CYS D N   1 
ATOM   3124  C CA  . CYS B 1 145 ? -41.633 28.306  -52.648 1.00 38.07  ? 164 CYS D CA  1 
ATOM   3125  C C   . CYS B 1 145 ? -42.338 27.919  -51.358 1.00 38.37  ? 164 CYS D C   1 
ATOM   3126  O O   . CYS B 1 145 ? -41.914 28.338  -50.302 1.00 36.17  ? 164 CYS D O   1 
ATOM   3127  C CB  . CYS B 1 145 ? -40.552 27.258  -52.929 1.00 36.71  ? 164 CYS D CB  1 
ATOM   3128  S SG  . CYS B 1 145 ? -41.285 25.637  -53.231 1.00 95.24  ? 164 CYS D SG  1 
ATOM   3129  N N   . ARG B 1 146 ? -43.405 27.128  -51.447 1.00 38.08  ? 165 ARG D N   1 
ATOM   3130  C CA  . ARG B 1 146 ? -44.011 26.532  -50.268 1.00 38.69  ? 165 ARG D CA  1 
ATOM   3131  C C   . ARG B 1 146 ? -44.354 25.105  -50.586 1.00 40.43  ? 165 ARG D C   1 
ATOM   3132  O O   . ARG B 1 146 ? -45.149 24.866  -51.482 1.00 42.13  ? 165 ARG D O   1 
ATOM   3133  C CB  . ARG B 1 146 ? -45.290 27.271  -49.859 1.00 42.64  ? 165 ARG D CB  1 
ATOM   3134  C CG  . ARG B 1 146 ? -45.939 26.776  -48.539 1.00 48.18  ? 165 ARG D CG  1 
ATOM   3135  C CD  . ARG B 1 146 ? -47.431 27.134  -48.423 1.00 51.16  ? 165 ARG D CD  1 
ATOM   3136  N NE  . ARG B 1 146 ? -48.251 26.267  -49.271 1.00 53.10  ? 165 ARG D NE  1 
ATOM   3137  C CZ  . ARG B 1 146 ? -48.711 26.593  -50.482 1.00 54.46  ? 165 ARG D CZ  1 
ATOM   3138  N NH1 . ARG B 1 146 ? -48.468 27.792  -51.001 1.00 54.32  ? 165 ARG D NH1 1 
ATOM   3139  N NH2 . ARG B 1 146 ? -49.433 25.722  -51.181 1.00 56.25  ? 165 ARG D NH2 1 
ATOM   3140  N N   . PHE B 1 147 ? -43.758 24.154  -49.873 1.00 38.87  ? 166 PHE D N   1 
ATOM   3141  C CA  . PHE B 1 147 ? -44.184 22.763  -49.989 1.00 40.39  ? 166 PHE D CA  1 
ATOM   3142  C C   . PHE B 1 147 ? -45.234 22.458  -48.948 1.00 47.58  ? 166 PHE D C   1 
ATOM   3143  O O   . PHE B 1 147 ? -45.053 22.777  -47.784 1.00 47.07  ? 166 PHE D O   1 
ATOM   3144  C CB  . PHE B 1 147 ? -43.023 21.804  -49.819 1.00 39.55  ? 166 PHE D CB  1 
ATOM   3145  C CG  . PHE B 1 147 ? -42.084 21.798  -50.970 1.00 38.60  ? 166 PHE D CG  1 
ATOM   3146  C CD1 . PHE B 1 147 ? -42.200 20.849  -51.967 1.00 40.03  ? 166 PHE D CD1 1 
ATOM   3147  C CD2 . PHE B 1 147 ? -41.081 22.751  -51.077 1.00 36.68  ? 166 PHE D CD2 1 
ATOM   3148  C CE1 . PHE B 1 147 ? -41.328 20.845  -53.048 1.00 39.47  ? 166 PHE D CE1 1 
ATOM   3149  C CE2 . PHE B 1 147 ? -40.212 22.745  -52.150 1.00 36.19  ? 166 PHE D CE2 1 
ATOM   3150  C CZ  . PHE B 1 147 ? -40.333 21.800  -53.132 1.00 37.53  ? 166 PHE D CZ  1 
ATOM   3151  N N   . ASP B 1 148 ? -46.346 21.865  -49.360 1.00 50.05  ? 167 ASP D N   1 
ATOM   3152  C CA  . ASP B 1 148 ? -47.309 21.374  -48.392 1.00 52.66  ? 167 ASP D CA  1 
ATOM   3153  C C   . ASP B 1 148 ? -46.799 20.026  -47.927 1.00 53.00  ? 167 ASP D C   1 
ATOM   3154  O O   . ASP B 1 148 ? -46.105 19.339  -48.667 1.00 52.86  ? 167 ASP D O   1 
ATOM   3155  C CB  . ASP B 1 148 ? -48.689 21.212  -49.037 1.00 56.38  ? 167 ASP D CB  1 
ATOM   3156  C CG  . ASP B 1 148 ? -49.167 22.487  -49.738 1.00 56.89  ? 167 ASP D CG  1 
ATOM   3157  O OD1 . ASP B 1 148 ? -48.862 23.595  -49.214 1.00 55.60  ? 167 ASP D OD1 1 
ATOM   3158  O OD2 . ASP B 1 148 ? -49.848 22.374  -50.804 1.00 58.73  ? 167 ASP D OD2 1 
ATOM   3159  N N   . ASP B 1 149 ? -47.099 19.669  -46.691 1.00 53.93  ? 168 ASP D N   1 
ATOM   3160  C CA  . ASP B 1 149 ? -46.903 18.301  -46.231 1.00 55.66  ? 168 ASP D CA  1 
ATOM   3161  C C   . ASP B 1 149 ? -45.483 17.675  -46.375 1.00 49.23  ? 168 ASP D C   1 
ATOM   3162  O O   . ASP B 1 149 ? -45.363 16.586  -46.927 1.00 50.95  ? 168 ASP D O   1 
ATOM   3163  C CB  . ASP B 1 149 ? -47.921 17.434  -46.963 1.00 59.10  ? 168 ASP D CB  1 
ATOM   3164  C CG  . ASP B 1 149 ? -48.230 16.153  -46.238 1.00 62.67  ? 168 ASP D CG  1 
ATOM   3165  O OD1 . ASP B 1 149 ? -48.147 16.125  -44.984 1.00 63.03  ? 168 ASP D OD1 1 
ATOM   3166  O OD2 . ASP B 1 149 ? -48.571 15.168  -46.932 1.00 65.49  ? 168 ASP D OD2 1 
ATOM   3167  N N   . ILE B 1 150 ? -44.426 18.309  -45.856 1.00 46.25  ? 169 ILE D N   1 
ATOM   3168  C CA  . ILE B 1 150 ? -43.057 17.848  -46.169 1.00 44.96  ? 169 ILE D CA  1 
ATOM   3169  C C   . ILE B 1 150 ? -42.640 16.536  -45.534 1.00 55.36  ? 169 ILE D C   1 
ATOM   3170  O O   . ILE B 1 150 ? -41.638 15.949  -45.950 1.00 55.20  ? 169 ILE D O   1 
ATOM   3171  C CB  . ILE B 1 150 ? -41.962 18.823  -45.753 1.00 42.01  ? 169 ILE D CB  1 
ATOM   3172  C CG1 . ILE B 1 150 ? -42.560 20.097  -45.225 1.00 44.79  ? 169 ILE D CG1 1 
ATOM   3173  C CG2 . ILE B 1 150 ? -40.985 19.059  -46.854 1.00 40.40  ? 169 ILE D CG2 1 
ATOM   3174  C CD1 . ILE B 1 150 ? -42.572 20.068  -43.728 1.00 45.22  ? 169 ILE D CD1 1 
ATOM   3175  N N   . SER B 1 151 ? -43.350 16.091  -44.502 1.00 49.09  ? 170 SER D N   1 
ATOM   3176  C CA  . SER B 1 151 ? -43.027 14.801  -43.920 1.00 61.73  ? 170 SER D CA  1 
ATOM   3177  C C   . SER B 1 151 ? -43.462 13.691  -44.888 1.00 64.85  ? 170 SER D C   1 
ATOM   3178  O O   . SER B 1 151 ? -42.899 12.593  -44.876 1.00 66.87  ? 170 SER D O   1 
ATOM   3179  C CB  . SER B 1 151 ? -43.686 14.639  -42.561 1.00 53.53  ? 170 SER D CB  1 
ATOM   3180  O OG  . SER B 1 151 ? -45.061 14.932  -42.662 1.00 57.79  ? 170 SER D OG  1 
ATOM   3181  N N   . ARG B 1 152 ? -44.449 13.995  -45.737 1.00 65.53  ? 171 ARG D N   1 
ATOM   3182  C CA  . ARG B 1 152 ? -44.872 13.091  -46.810 1.00 68.63  ? 171 ARG D CA  1 
ATOM   3183  C C   . ARG B 1 152 ? -43.817 13.025  -47.911 1.00 67.09  ? 171 ARG D C   1 
ATOM   3184  O O   . ARG B 1 152 ? -43.670 12.008  -48.587 1.00 69.77  ? 171 ARG D O   1 
ATOM   3185  C CB  . ARG B 1 152 ? -46.218 13.542  -47.394 1.00 69.95  ? 171 ARG D CB  1 
ATOM   3186  C CG  . ARG B 1 152 ? -46.737 12.724  -48.579 1.00 73.19  ? 171 ARG D CG  1 
ATOM   3187  C CD  . ARG B 1 152 ? -47.896 13.457  -49.283 1.00 73.68  ? 171 ARG D CD  1 
ATOM   3188  N NE  . ARG B 1 152 ? -48.042 13.148  -50.718 1.00 74.86  ? 171 ARG D NE  1 
ATOM   3189  C CZ  . ARG B 1 152 ? -47.352 13.745  -51.693 1.00 71.76  ? 171 ARG D CZ  1 
ATOM   3190  N NH1 . ARG B 1 152 ? -46.441 14.674  -51.406 1.00 67.58  ? 171 ARG D NH1 1 
ATOM   3191  N NH2 . ARG B 1 152 ? -47.561 13.405  -52.957 1.00 73.19  ? 171 ARG D NH2 1 
ATOM   3192  N N   . LEU B 1 153 ? -43.078 14.118  -48.066 1.00 63.19  ? 172 LEU D N   1 
ATOM   3193  C CA  . LEU B 1 153 ? -42.026 14.235  -49.069 1.00 61.56  ? 172 LEU D CA  1 
ATOM   3194  C C   . LEU B 1 153 ? -40.697 13.634  -48.637 1.00 61.42  ? 172 LEU D C   1 
ATOM   3195  O O   . LEU B 1 153 ? -40.131 12.783  -49.325 1.00 63.42  ? 172 LEU D O   1 
ATOM   3196  C CB  . LEU B 1 153 ? -41.808 15.701  -49.417 1.00 57.95  ? 172 LEU D CB  1 
ATOM   3197  C CG  . LEU B 1 153 ? -42.650 16.215  -50.573 1.00 57.90  ? 172 LEU D CG  1 
ATOM   3198  C CD1 . LEU B 1 153 ? -42.347 17.691  -50.789 1.00 54.53  ? 172 LEU D CD1 1 
ATOM   3199  C CD2 . LEU B 1 153 ? -42.353 15.359  -51.813 1.00 59.68  ? 172 LEU D CD2 1 
ATOM   3200  N N   . SER B 1 154 ? -40.178 14.105  -47.514 1.00 59.31  ? 173 SER D N   1 
ATOM   3201  C CA  . SER B 1 154 ? -38.964 13.534  -46.963 1.00 59.81  ? 173 SER D CA  1 
ATOM   3202  C C   . SER B 1 154 ? -39.187 12.049  -46.646 1.00 64.38  ? 173 SER D C   1 
ATOM   3203  O O   . SER B 1 154 ? -38.411 11.183  -47.071 1.00 66.52  ? 173 SER D O   1 
ATOM   3204  C CB  . SER B 1 154 ? -38.579 14.283  -45.699 1.00 57.66  ? 173 SER D CB  1 
ATOM   3205  O OG  . SER B 1 154 ? -39.655 14.272  -44.774 1.00 58.78  ? 173 SER D OG  1 
ATOM   3206  N N   . SER B 1 155 ? -40.274 11.771  -45.926 1.00 66.19  ? 174 SER D N   1 
ATOM   3207  C CA  . SER B 1 155 ? -40.582 10.435  -45.417 1.00 70.67  ? 174 SER D CA  1 
ATOM   3208  C C   . SER B 1 155 ? -39.407 9.828   -44.648 1.00 71.54  ? 174 SER D C   1 
ATOM   3209  O O   . SER B 1 155 ? -38.850 8.794   -45.032 1.00 74.50  ? 174 SER D O   1 
ATOM   3210  C CB  . SER B 1 155 ? -41.109 9.494   -46.516 1.00 74.41  ? 174 SER D CB  1 
ATOM   3211  O OG  . SER B 1 155 ? -40.141 9.263   -47.521 1.00 74.45  ? 174 SER D OG  1 
ATOM   3212  N N   . GLY B 1 156 ? -39.038 10.490  -43.557 1.00 69.32  ? 175 GLY D N   1 
ATOM   3213  C CA  . GLY B 1 156 ? -38.034 9.959   -42.659 1.00 70.50  ? 175 GLY D CA  1 
ATOM   3214  C C   . GLY B 1 156 ? -36.659 10.521  -42.934 1.00 67.76  ? 175 GLY D C   1 
ATOM   3215  O O   . GLY B 1 156 ? -35.698 10.214  -42.223 1.00 68.60  ? 175 GLY D O   1 
ATOM   3216  N N   . SER B 1 157 ? -36.558 11.337  -43.976 1.00 64.84  ? 176 SER D N   1 
ATOM   3217  C CA  . SER B 1 157 ? -35.319 12.039  -44.249 1.00 62.21  ? 176 SER D CA  1 
ATOM   3218  C C   . SER B 1 157 ? -35.103 13.096  -43.177 1.00 59.27  ? 176 SER D C   1 
ATOM   3219  O O   . SER B 1 157 ? -36.027 13.807  -42.802 1.00 57.79  ? 176 SER D O   1 
ATOM   3220  C CB  . SER B 1 157 ? -35.367 12.691  -45.628 1.00 60.31  ? 176 SER D CB  1 
ATOM   3221  O OG  . SER B 1 157 ? -34.601 11.951  -46.561 1.00 62.35  ? 176 SER D OG  1 
ATOM   3222  N N   . GLN B 1 158 ? -33.888 13.195  -42.666 1.00 58.75  ? 177 GLN D N   1 
ATOM   3223  C CA  . GLN B 1 158 ? -33.624 14.227  -41.686 1.00 56.42  ? 177 GLN D CA  1 
ATOM   3224  C C   . GLN B 1 158 ? -33.145 15.487  -42.408 1.00 53.66  ? 177 GLN D C   1 
ATOM   3225  O O   . GLN B 1 158 ? -33.350 16.606  -41.934 1.00 51.74  ? 177 GLN D O   1 
ATOM   3226  C CB  . GLN B 1 158 ? -32.634 13.739  -40.612 1.00 57.77  ? 177 GLN D CB  1 
ATOM   3227  C CG  . GLN B 1 158 ? -33.186 12.594  -39.725 1.00 60.82  ? 177 GLN D CG  1 
ATOM   3228  C CD  . GLN B 1 158 ? -32.112 11.877  -38.883 1.00 63.23  ? 177 GLN D CD  1 
ATOM   3229  O OE1 . GLN B 1 158 ? -31.968 10.654  -38.953 1.00 66.87  ? 177 GLN D OE1 1 
ATOM   3230  N NE2 . GLN B 1 158 ? -31.371 12.637  -38.078 1.00 61.63  ? 177 GLN D NE2 1 
ATOM   3231  N N   . SER B 1 159 ? -32.536 15.310  -43.577 1.00 54.07  ? 178 SER D N   1 
ATOM   3232  C CA  . SER B 1 159 ? -32.055 16.447  -44.356 1.00 51.82  ? 178 SER D CA  1 
ATOM   3233  C C   . SER B 1 159 ? -32.450 16.381  -45.831 1.00 51.91  ? 178 SER D C   1 
ATOM   3234  O O   . SER B 1 159 ? -33.104 15.436  -46.290 1.00 53.74  ? 178 SER D O   1 
ATOM   3235  C CB  . SER B 1 159 ? -30.540 16.549  -44.272 1.00 41.64  ? 178 SER D CB  1 
ATOM   3236  O OG  . SER B 1 159 ? -29.950 15.403  -44.845 1.00 44.30  ? 178 SER D OG  1 
ATOM   3237  N N   . SER B 1 160 ? -31.998 17.386  -46.574 1.00 50.17  ? 179 SER D N   1 
ATOM   3238  C CA  . SER B 1 160 ? -32.341 17.519  -47.963 1.00 39.21  ? 179 SER D CA  1 
ATOM   3239  C C   . SER B 1 160 ? -31.631 18.716  -48.569 1.00 37.43  ? 179 SER D C   1 
ATOM   3240  O O   . SER B 1 160 ? -31.347 19.693  -47.890 1.00 35.93  ? 179 SER D O   1 
ATOM   3241  C CB  . SER B 1 160 ? -33.842 17.691  -48.087 1.00 38.79  ? 179 SER D CB  1 
ATOM   3242  O OG  . SER B 1 160 ? -34.150 18.976  -48.554 1.00 51.05  ? 179 SER D OG  1 
ATOM   3243  N N   . HIS B 1 161 ? -31.365 18.621  -49.869 1.00 38.29  ? 180 HIS D N   1 
ATOM   3244  C CA  . HIS B 1 161 ? -30.593 19.605  -50.617 1.00 37.41  ? 180 HIS D CA  1 
ATOM   3245  C C   . HIS B 1 161 ? -31.565 20.405  -51.469 1.00 36.42  ? 180 HIS D C   1 
ATOM   3246  O O   . HIS B 1 161 ? -32.375 19.820  -52.145 1.00 37.56  ? 180 HIS D O   1 
ATOM   3247  C CB  . HIS B 1 161 ? -29.551 18.871  -51.463 1.00 39.68  ? 180 HIS D CB  1 
ATOM   3248  C CG  . HIS B 1 161 ? -28.724 19.760  -52.340 1.00 39.85  ? 180 HIS D CG  1 
ATOM   3249  N ND1 . HIS B 1 161 ? -28.557 19.526  -53.690 1.00 41.50  ? 180 HIS D ND1 1 
ATOM   3250  C CD2 . HIS B 1 161 ? -28.007 20.874  -52.062 1.00 38.86  ? 180 HIS D CD2 1 
ATOM   3251  C CE1 . HIS B 1 161 ? -27.783 20.463  -54.207 1.00 41.16  ? 180 HIS D CE1 1 
ATOM   3252  N NE2 . HIS B 1 161 ? -27.442 21.297  -53.242 1.00 39.68  ? 180 HIS D NE2 1 
ATOM   3253  N N   . ILE B 1 162 ? -31.517 21.734  -51.386 1.00 34.38  ? 181 ILE D N   1 
ATOM   3254  C CA  . ILE B 1 162 ? -32.451 22.620  -52.082 1.00 33.61  ? 181 ILE D CA  1 
ATOM   3255  C C   . ILE B 1 162 ? -31.705 23.362  -53.166 1.00 39.77  ? 181 ILE D C   1 
ATOM   3256  O O   . ILE B 1 162 ? -30.665 23.936  -52.899 1.00 33.70  ? 181 ILE D O   1 
ATOM   3257  C CB  . ILE B 1 162 ? -33.034 23.733  -51.154 1.00 32.52  ? 181 ILE D CB  1 
ATOM   3258  C CG1 . ILE B 1 162 ? -33.732 23.168  -49.917 1.00 32.25  ? 181 ILE D CG1 1 
ATOM   3259  C CG2 . ILE B 1 162 ? -33.991 24.629  -51.932 1.00 32.11  ? 181 ILE D CG2 1 
ATOM   3260  C CD1 . ILE B 1 162 ? -34.843 22.262  -50.230 1.00 33.15  ? 181 ILE D CD1 1 
ATOM   3261  N N   . LEU B 1 163 ? -32.251 23.387  -54.380 1.00 39.34  ? 182 LEU D N   1 
ATOM   3262  C CA  . LEU B 1 163 ? -31.577 24.026  -55.512 1.00 34.97  ? 182 LEU D CA  1 
ATOM   3263  C C   . LEU B 1 163 ? -32.439 25.040  -56.256 1.00 34.80  ? 182 LEU D C   1 
ATOM   3264  O O   . LEU B 1 163 ? -33.572 24.757  -56.599 1.00 34.98  ? 182 LEU D O   1 
ATOM   3265  C CB  . LEU B 1 163 ? -31.119 22.952  -56.476 1.00 36.67  ? 182 LEU D CB  1 
ATOM   3266  C CG  . LEU B 1 163 ? -30.248 23.358  -57.644 1.00 37.88  ? 182 LEU D CG  1 
ATOM   3267  C CD1 . LEU B 1 163 ? -28.815 23.234  -57.254 1.00 38.61  ? 182 LEU D CD1 1 
ATOM   3268  C CD2 . LEU B 1 163 ? -30.575 22.434  -58.780 1.00 46.67  ? 182 LEU D CD2 1 
ATOM   3269  N N   . VAL B 1 164 ? -31.901 26.228  -56.501 1.00 34.86  ? 183 VAL D N   1 
ATOM   3270  C CA  . VAL B 1 164 ? -32.601 27.227  -57.312 1.00 35.31  ? 183 VAL D CA  1 
ATOM   3271  C C   . VAL B 1 164 ? -31.816 27.567  -58.579 1.00 36.79  ? 183 VAL D C   1 
ATOM   3272  O O   . VAL B 1 164 ? -30.900 28.405  -58.571 1.00 37.35  ? 183 VAL D O   1 
ATOM   3273  C CB  . VAL B 1 164 ? -32.932 28.511  -56.509 1.00 34.81  ? 183 VAL D CB  1 
ATOM   3274  C CG1 . VAL B 1 164 ? -33.673 29.527  -57.363 1.00 35.85  ? 183 VAL D CG1 1 
ATOM   3275  C CG2 . VAL B 1 164 ? -33.748 28.163  -55.292 1.00 33.69  ? 183 VAL D CG2 1 
ATOM   3276  N N   . ARG B 1 165 ? -32.203 26.896  -59.665 1.00 37.74  ? 184 ARG D N   1 
ATOM   3277  C CA  . ARG B 1 165 ? -31.605 27.074  -60.983 1.00 39.49  ? 184 ARG D CA  1 
ATOM   3278  C C   . ARG B 1 165 ? -32.114 28.297  -61.693 1.00 40.33  ? 184 ARG D C   1 
ATOM   3279  O O   . ARG B 1 165 ? -33.207 28.749  -61.444 1.00 39.84  ? 184 ARG D O   1 
ATOM   3280  C CB  . ARG B 1 165 ? -31.932 25.895  -61.848 1.00 47.61  ? 184 ARG D CB  1 
ATOM   3281  C CG  . ARG B 1 165 ? -31.305 24.622  -61.437 1.00 48.18  ? 184 ARG D CG  1 
ATOM   3282  C CD  . ARG B 1 165 ? -31.494 23.633  -62.559 1.00 50.84  ? 184 ARG D CD  1 
ATOM   3283  N NE  . ARG B 1 165 ? -31.041 22.294  -62.213 1.00 52.44  ? 184 ARG D NE  1 
ATOM   3284  C CZ  . ARG B 1 165 ? -29.766 21.958  -62.054 1.00 53.99  ? 184 ARG D CZ  1 
ATOM   3285  N NH1 . ARG B 1 165 ? -28.804 22.873  -62.180 1.00 54.19  ? 184 ARG D NH1 1 
ATOM   3286  N NH2 . ARG B 1 165 ? -29.458 20.707  -61.745 1.00 55.55  ? 184 ARG D NH2 1 
ATOM   3287  N N   . GLY B 1 166 ? -31.303 28.834  -62.584 1.00 42.00  ? 185 GLY D N   1 
ATOM   3288  C CA  . GLY B 1 166 ? -31.746 29.931  -63.418 1.00 43.45  ? 185 GLY D CA  1 
ATOM   3289  C C   . GLY B 1 166 ? -31.739 29.640  -64.922 1.00 49.25  ? 185 GLY D C   1 
ATOM   3290  O O   . GLY B 1 166 ? -31.042 28.743  -65.429 1.00 46.26  ? 185 GLY D O   1 
ATOM   3291  N N   . ARG B 1 167 ? -32.524 30.414  -65.659 1.00 46.77  ? 186 ARG D N   1 
ATOM   3292  C CA  . ARG B 1 167 ? -32.529 30.266  -67.103 1.00 54.40  ? 186 ARG D CA  1 
ATOM   3293  C C   . ARG B 1 167 ? -32.913 31.558  -67.797 1.00 56.52  ? 186 ARG D C   1 
ATOM   3294  O O   . ARG B 1 167 ? -33.704 32.347  -67.276 1.00 56.28  ? 186 ARG D O   1 
ATOM   3295  C CB  . ARG B 1 167 ? -33.470 29.141  -67.517 1.00 48.84  ? 186 ARG D CB  1 
ATOM   3296  C CG  . ARG B 1 167 ? -34.887 29.363  -67.089 1.00 48.01  ? 186 ARG D CG  1 
ATOM   3297  C CD  . ARG B 1 167 ? -35.663 28.071  -67.157 1.00 47.69  ? 186 ARG D CD  1 
ATOM   3298  N NE  . ARG B 1 167 ? -36.829 28.126  -66.292 1.00 46.74  ? 186 ARG D NE  1 
ATOM   3299  C CZ  . ARG B 1 167 ? -38.058 28.402  -66.705 1.00 48.04  ? 186 ARG D CZ  1 
ATOM   3300  N NH1 . ARG B 1 167 ? -38.315 28.639  -67.995 1.00 50.25  ? 186 ARG D NH1 1 
ATOM   3301  N NH2 . ARG B 1 167 ? -39.039 28.433  -65.818 1.00 47.36  ? 186 ARG D NH2 1 
ATOM   3302  N N   . SER B 1 168 ? -32.319 31.774  -68.962 1.00 53.59  ? 187 SER D N   1 
ATOM   3303  C CA  . SER B 1 168 ? -32.756 32.820  -69.861 1.00 56.19  ? 187 SER D CA  1 
ATOM   3304  C C   . SER B 1 168 ? -32.422 32.337  -71.263 1.00 62.79  ? 187 SER D C   1 
ATOM   3305  O O   . SER B 1 168 ? -31.796 31.288  -71.425 1.00 62.42  ? 187 SER D O   1 
ATOM   3306  C CB  . SER B 1 168 ? -32.056 34.142  -69.552 1.00 57.57  ? 187 SER D CB  1 
ATOM   3307  O OG  . SER B 1 168 ? -30.673 34.049  -69.820 1.00 58.74  ? 187 SER D OG  1 
ATOM   3308  N N   . ALA B 1 169 ? -32.831 33.088  -72.277 1.00 65.60  ? 188 ALA D N   1 
ATOM   3309  C CA  . ALA B 1 169 ? -32.653 32.632  -73.649 1.00 63.87  ? 188 ALA D CA  1 
ATOM   3310  C C   . ALA B 1 169 ? -31.307 33.056  -74.225 1.00 68.19  ? 188 ALA D C   1 
ATOM   3311  O O   . ALA B 1 169 ? -30.873 32.522  -75.247 1.00 70.11  ? 188 ALA D O   1 
ATOM   3312  C CB  . ALA B 1 169 ? -33.784 33.117  -74.510 1.00 65.95  ? 188 ALA D CB  1 
ATOM   3313  N N   . ALA B 1 170 ? -30.641 34.004  -73.566 1.00 66.54  ? 189 ALA D N   1 
ATOM   3314  C CA  . ALA B 1 170 ? -29.375 34.539  -74.070 1.00 69.47  ? 189 ALA D CA  1 
ATOM   3315  C C   . ALA B 1 170 ? -28.180 34.256  -73.162 1.00 70.75  ? 189 ALA D C   1 
ATOM   3316  O O   . ALA B 1 170 ? -27.031 34.424  -73.576 1.00 70.69  ? 189 ALA D O   1 
ATOM   3317  C CB  . ALA B 1 170 ? -29.488 36.036  -74.329 1.00 72.37  ? 189 ALA D CB  1 
ATOM   3318  N N   . PHE B 1 171 ? -28.444 33.844  -71.924 1.00 67.18  ? 190 PHE D N   1 
ATOM   3319  C CA  . PHE B 1 171 ? -27.358 33.615  -70.970 1.00 66.17  ? 190 PHE D CA  1 
ATOM   3320  C C   . PHE B 1 171 ? -27.519 32.325  -70.174 1.00 60.21  ? 190 PHE D C   1 
ATOM   3321  O O   . PHE B 1 171 ? -28.629 31.861  -69.936 1.00 58.98  ? 190 PHE D O   1 
ATOM   3322  C CB  . PHE B 1 171 ? -27.223 34.789  -69.981 1.00 65.94  ? 190 PHE D CB  1 
ATOM   3323  C CG  . PHE B 1 171 ? -27.200 36.147  -70.628 1.00 69.50  ? 190 PHE D CG  1 
ATOM   3324  C CD1 . PHE B 1 171 ? -28.374 36.855  -70.831 1.00 67.30  ? 190 PHE D CD1 1 
ATOM   3325  C CD2 . PHE B 1 171 ? -26.002 36.727  -71.009 1.00 70.20  ? 190 PHE D CD2 1 
ATOM   3326  C CE1 . PHE B 1 171 ? -28.349 38.106  -71.419 1.00 71.09  ? 190 PHE D CE1 1 
ATOM   3327  C CE2 . PHE B 1 171 ? -25.976 37.972  -71.589 1.00 73.97  ? 190 PHE D CE2 1 
ATOM   3328  C CZ  . PHE B 1 171 ? -27.149 38.661  -71.795 1.00 74.43  ? 190 PHE D CZ  1 
ATOM   3329  N N   . GLY B 1 172 ? -26.393 31.753  -69.770 1.00 60.21  ? 191 GLY D N   1 
ATOM   3330  C CA  . GLY B 1 172 ? -26.386 30.800  -68.681 1.00 57.32  ? 191 GLY D CA  1 
ATOM   3331  C C   . GLY B 1 172 ? -26.580 31.569  -67.381 1.00 55.29  ? 191 GLY D C   1 
ATOM   3332  O O   . GLY B 1 172 ? -26.042 32.656  -67.201 1.00 56.72  ? 191 GLY D O   1 
ATOM   3333  N N   . ILE B 1 173 ? -27.376 31.022  -66.478 1.00 52.33  ? 192 ILE D N   1 
ATOM   3334  C CA  . ILE B 1 173 ? -27.636 31.690  -65.220 1.00 50.53  ? 192 ILE D CA  1 
ATOM   3335  C C   . ILE B 1 173 ? -27.116 30.756  -64.152 1.00 48.66  ? 192 ILE D C   1 
ATOM   3336  O O   . ILE B 1 173 ? -27.498 29.594  -64.119 1.00 53.98  ? 192 ILE D O   1 
ATOM   3337  C CB  . ILE B 1 173 ? -29.141 31.937  -65.058 1.00 49.09  ? 192 ILE D CB  1 
ATOM   3338  C CG1 . ILE B 1 173 ? -29.698 32.643  -66.301 1.00 51.38  ? 192 ILE D CG1 1 
ATOM   3339  C CG2 . ILE B 1 173 ? -29.438 32.720  -63.811 1.00 47.78  ? 192 ILE D CG2 1 
ATOM   3340  C CD1 . ILE B 1 173 ? -29.762 34.142  -66.200 1.00 53.04  ? 192 ILE D CD1 1 
ATOM   3341  N N   . PRO B 1 174 ? -26.191 31.235  -63.307 1.00 50.73  ? 193 PRO D N   1 
ATOM   3342  C CA  . PRO B 1 174 ? -25.696 30.345  -62.241 1.00 49.38  ? 193 PRO D CA  1 
ATOM   3343  C C   . PRO B 1 174 ? -26.783 29.954  -61.223 1.00 46.48  ? 193 PRO D C   1 
ATOM   3344  O O   . PRO B 1 174 ? -27.823 30.603  -61.125 1.00 45.53  ? 193 PRO D O   1 
ATOM   3345  C CB  . PRO B 1 174 ? -24.550 31.150  -61.590 1.00 48.59  ? 193 PRO D CB  1 
ATOM   3346  C CG  . PRO B 1 174 ? -24.728 32.547  -62.047 1.00 50.26  ? 193 PRO D CG  1 
ATOM   3347  C CD  . PRO B 1 174 ? -25.451 32.506  -63.368 1.00 51.10  ? 193 PRO D CD  1 
ATOM   3348  N N   . CYS B 1 175 ? -26.556 28.879  -60.487 1.00 43.25  ? 194 CYS D N   1 
ATOM   3349  C CA  . CYS B 1 175 ? -27.565 28.418  -59.556 1.00 40.92  ? 194 CYS D CA  1 
ATOM   3350  C C   . CYS B 1 175 ? -27.219 28.755  -58.109 1.00 39.81  ? 194 CYS D C   1 
ATOM   3351  O O   . CYS B 1 175 ? -26.150 29.280  -57.824 1.00 46.44  ? 194 CYS D O   1 
ATOM   3352  C CB  . CYS B 1 175 ? -27.799 26.919  -59.750 1.00 40.72  ? 194 CYS D CB  1 
ATOM   3353  S SG  . CYS B 1 175 ? -26.401 25.863  -59.383 1.00 67.50  ? 194 CYS D SG  1 
ATOM   3354  N N   . THR B 1 176 ? -28.144 28.498  -57.195 1.00 37.95  ? 195 THR D N   1 
ATOM   3355  C CA  . THR B 1 176 ? -27.836 28.544  -55.770 1.00 36.99  ? 195 THR D CA  1 
ATOM   3356  C C   . THR B 1 176 ? -28.356 27.293  -55.126 1.00 35.80  ? 195 THR D C   1 
ATOM   3357  O O   . THR B 1 176 ? -29.298 26.703  -55.620 1.00 35.46  ? 195 THR D O   1 
ATOM   3358  C CB  . THR B 1 176 ? -28.498 29.705  -55.032 1.00 36.35  ? 195 THR D CB  1 
ATOM   3359  O OG1 . THR B 1 176 ? -28.656 30.819  -55.909 1.00 39.02  ? 195 THR D OG1 1 
ATOM   3360  C CG2 . THR B 1 176 ? -27.629 30.124  -53.840 1.00 43.60  ? 195 THR D CG2 1 
ATOM   3361  N N   . ASP B 1 177 ? -27.735 26.893  -54.021 1.00 35.56  ? 196 ASP D N   1 
ATOM   3362  C CA  . ASP B 1 177 ? -28.227 25.771  -53.230 1.00 34.74  ? 196 ASP D CA  1 
ATOM   3363  C C   . ASP B 1 177 ? -27.882 25.883  -51.751 1.00 35.30  ? 196 ASP D C   1 
ATOM   3364  O O   . ASP B 1 177 ? -26.822 26.372  -51.389 1.00 34.92  ? 196 ASP D O   1 
ATOM   3365  C CB  . ASP B 1 177 ? -27.768 24.428  -53.811 1.00 35.99  ? 196 ASP D CB  1 
ATOM   3366  C CG  . ASP B 1 177 ? -26.277 24.237  -53.749 1.00 37.56  ? 196 ASP D CG  1 
ATOM   3367  O OD1 . ASP B 1 177 ? -25.544 25.198  -53.460 1.00 40.18  ? 196 ASP D OD1 1 
ATOM   3368  O OD2 . ASP B 1 177 ? -25.824 23.113  -54.011 1.00 39.00  ? 196 ASP D OD2 1 
ATOM   3369  N N   . LYS B 1 178 ? -28.808 25.465  -50.904 1.00 34.56  ? 197 LYS D N   1 
ATOM   3370  C CA  . LYS B 1 178 ? -28.534 25.290  -49.484 1.00 34.99  ? 197 LYS D CA  1 
ATOM   3371  C C   . LYS B 1 178 ? -28.603 23.787  -49.238 1.00 36.05  ? 197 LYS D C   1 
ATOM   3372  O O   . LYS B 1 178 ? -29.207 23.060  -50.027 1.00 36.33  ? 197 LYS D O   1 
ATOM   3373  C CB  . LYS B 1 178 ? -29.574 26.019  -48.609 1.00 34.22  ? 197 LYS D CB  1 
ATOM   3374  C CG  . LYS B 1 178 ? -29.136 27.350  -48.004 1.00 35.01  ? 197 LYS D CG  1 
ATOM   3375  C CD  . LYS B 1 178 ? -28.188 28.133  -48.946 1.00 36.67  ? 197 LYS D CD  1 
ATOM   3376  C CE  . LYS B 1 178 ? -27.807 29.501  -48.385 1.00 37.88  ? 197 LYS D CE  1 
ATOM   3377  N NZ  . LYS B 1 178 ? -27.113 29.404  -47.062 1.00 38.69  ? 197 LYS D NZ  1 
ATOM   3378  N N   . PHE B 1 179 ? -27.961 23.318  -48.172 1.00 36.95  ? 198 PHE D N   1 
ATOM   3379  C CA  . PHE B 1 179 ? -28.228 21.986  -47.671 1.00 38.03  ? 198 PHE D CA  1 
ATOM   3380  C C   . PHE B 1 179 ? -28.944 22.303  -46.368 1.00 36.84  ? 198 PHE D C   1 
ATOM   3381  O O   . PHE B 1 179 ? -28.647 23.295  -45.710 1.00 36.04  ? 198 PHE D O   1 
ATOM   3382  C CB  . PHE B 1 179 ? -26.938 21.189  -47.492 1.00 40.72  ? 198 PHE D CB  1 
ATOM   3383  C CG  . PHE B 1 179 ? -27.128 19.843  -46.821 1.00 43.21  ? 198 PHE D CG  1 
ATOM   3384  C CD1 . PHE B 1 179 ? -27.743 18.782  -47.498 1.00 44.83  ? 198 PHE D CD1 1 
ATOM   3385  C CD2 . PHE B 1 179 ? -26.667 19.616  -45.504 1.00 44.10  ? 198 PHE D CD2 1 
ATOM   3386  C CE1 . PHE B 1 179 ? -27.917 17.514  -46.850 1.00 46.83  ? 198 PHE D CE1 1 
ATOM   3387  C CE2 . PHE B 1 179 ? -26.826 18.366  -44.871 1.00 45.87  ? 198 PHE D CE2 1 
ATOM   3388  C CZ  . PHE B 1 179 ? -27.448 17.320  -45.544 1.00 47.29  ? 198 PHE D CZ  1 
ATOM   3389  N N   . VAL B 1 180 ? -29.933 21.507  -46.016 1.00 37.03  ? 199 VAL D N   1 
ATOM   3390  C CA  . VAL B 1 180 ? -30.880 21.924  -45.007 1.00 33.39  ? 199 VAL D CA  1 
ATOM   3391  C C   . VAL B 1 180 ? -31.188 20.711  -44.149 1.00 42.61  ? 199 VAL D C   1 
ATOM   3392  O O   . VAL B 1 180 ? -31.353 19.606  -44.662 1.00 43.88  ? 199 VAL D O   1 
ATOM   3393  C CB  . VAL B 1 180 ? -32.138 22.487  -45.701 1.00 32.50  ? 199 VAL D CB  1 
ATOM   3394  C CG1 . VAL B 1 180 ? -33.405 21.765  -45.270 1.00 33.09  ? 199 VAL D CG1 1 
ATOM   3395  C CG2 . VAL B 1 180 ? -32.241 23.986  -45.532 1.00 31.44  ? 199 VAL D CG2 1 
ATOM   3396  N N   . VAL B 1 181 ? -31.190 20.899  -42.836 1.00 34.80  ? 200 VAL D N   1 
ATOM   3397  C CA  . VAL B 1 181 ? -31.532 19.837  -41.910 1.00 36.36  ? 200 VAL D CA  1 
ATOM   3398  C C   . VAL B 1 181 ? -32.832 20.270  -41.309 1.00 35.86  ? 200 VAL D C   1 
ATOM   3399  O O   . VAL B 1 181 ? -32.925 21.345  -40.708 1.00 34.88  ? 200 VAL D O   1 
ATOM   3400  C CB  . VAL B 1 181 ? -30.509 19.707  -40.764 1.00 45.74  ? 200 VAL D CB  1 
ATOM   3401  C CG1 . VAL B 1 181 ? -30.886 18.549  -39.835 1.00 39.36  ? 200 VAL D CG1 1 
ATOM   3402  C CG2 . VAL B 1 181 ? -29.104 19.550  -41.318 1.00 37.93  ? 200 VAL D CG2 1 
ATOM   3403  N N   . PHE B 1 182 ? -33.839 19.426  -41.480 1.00 41.75  ? 201 PHE D N   1 
ATOM   3404  C CA  . PHE B 1 182 ? -35.210 19.749  -41.083 1.00 41.75  ? 201 PHE D CA  1 
ATOM   3405  C C   . PHE B 1 182 ? -35.372 20.197  -39.615 1.00 37.26  ? 201 PHE D C   1 
ATOM   3406  O O   . PHE B 1 182 ? -35.927 21.255  -39.374 1.00 36.40  ? 201 PHE D O   1 
ATOM   3407  C CB  . PHE B 1 182 ? -36.156 18.603  -41.472 1.00 43.58  ? 201 PHE D CB  1 
ATOM   3408  C CG  . PHE B 1 182 ? -36.308 18.420  -42.968 1.00 43.28  ? 201 PHE D CG  1 
ATOM   3409  C CD1 . PHE B 1 182 ? -36.337 19.520  -43.821 1.00 41.44  ? 201 PHE D CD1 1 
ATOM   3410  C CD2 . PHE B 1 182 ? -36.423 17.155  -43.526 1.00 45.23  ? 201 PHE D CD2 1 
ATOM   3411  C CE1 . PHE B 1 182 ? -36.478 19.368  -45.204 1.00 36.72  ? 201 PHE D CE1 1 
ATOM   3412  C CE2 . PHE B 1 182 ? -36.561 17.005  -44.906 1.00 45.29  ? 201 PHE D CE2 1 
ATOM   3413  C CZ  . PHE B 1 182 ? -36.584 18.122  -45.738 1.00 38.66  ? 201 PHE D CZ  1 
ATOM   3414  N N   . SER B 1 183 ? -34.863 19.430  -38.655 1.00 38.75  ? 202 SER D N   1 
ATOM   3415  C CA  . SER B 1 183 ? -34.879 19.851  -37.245 1.00 39.21  ? 202 SER D CA  1 
ATOM   3416  C C   . SER B 1 183 ? -34.258 21.226  -36.983 1.00 37.58  ? 202 SER D C   1 
ATOM   3417  O O   . SER B 1 183 ? -34.795 22.041  -36.232 1.00 37.57  ? 202 SER D O   1 
ATOM   3418  C CB  . SER B 1 183 ? -34.228 18.788  -36.352 1.00 41.30  ? 202 SER D CB  1 
ATOM   3419  O OG  . SER B 1 183 ? -32.828 18.703  -36.534 1.00 41.09  ? 202 SER D OG  1 
ATOM   3420  N N   . GLN B 1 184 ? -33.139 21.491  -37.640 1.00 36.62  ? 203 GLN D N   1 
ATOM   3421  C CA  . GLN B 1 184 ? -32.407 22.752  -37.518 1.00 35.55  ? 203 GLN D CA  1 
ATOM   3422  C C   . GLN B 1 184 ? -33.121 23.996  -38.078 1.00 34.35  ? 203 GLN D C   1 
ATOM   3423  O O   . GLN B 1 184 ? -32.894 25.094  -37.600 1.00 40.01  ? 203 GLN D O   1 
ATOM   3424  C CB  . GLN B 1 184 ? -31.034 22.593  -38.173 1.00 35.39  ? 203 GLN D CB  1 
ATOM   3425  C CG  . GLN B 1 184 ? -30.076 23.713  -37.981 1.00 35.02  ? 203 GLN D CG  1 
ATOM   3426  C CD  . GLN B 1 184 ? -28.626 23.245  -38.014 1.00 42.31  ? 203 GLN D CD  1 
ATOM   3427  O OE1 . GLN B 1 184 ? -28.301 22.103  -37.658 1.00 43.69  ? 203 GLN D OE1 1 
ATOM   3428  N NE2 . GLN B 1 184 ? -27.740 24.131  -38.432 1.00 42.03  ? 203 GLN D NE2 1 
ATOM   3429  N N   . ILE B 1 185 ? -33.971 23.844  -39.087 1.00 33.86  ? 204 ILE D N   1 
ATOM   3430  C CA  . ILE B 1 185 ? -34.555 25.023  -39.742 1.00 36.99  ? 204 ILE D CA  1 
ATOM   3431  C C   . ILE B 1 185 ? -36.024 25.236  -39.381 1.00 37.87  ? 204 ILE D C   1 
ATOM   3432  O O   . ILE B 1 185 ? -36.679 26.152  -39.901 1.00 33.60  ? 204 ILE D O   1 
ATOM   3433  C CB  . ILE B 1 185 ? -34.391 25.001  -41.301 1.00 32.20  ? 204 ILE D CB  1 
ATOM   3434  C CG1 . ILE B 1 185 ? -35.249 23.882  -41.925 1.00 32.66  ? 204 ILE D CG1 1 
ATOM   3435  C CG2 . ILE B 1 185 ? -32.929 24.882  -41.680 1.00 31.92  ? 204 ILE D CG2 1 
ATOM   3436  C CD1 . ILE B 1 185 ? -35.724 24.134  -43.308 1.00 32.19  ? 204 ILE D CD1 1 
ATOM   3437  N N   . GLU B 1 186 ? -36.534 24.383  -38.494 1.00 34.94  ? 205 GLU D N   1 
ATOM   3438  C CA  . GLU B 1 186 ? -37.917 24.478  -38.046 1.00 36.15  ? 205 GLU D CA  1 
ATOM   3439  C C   . GLU B 1 186 ? -38.173 25.619  -37.054 1.00 36.82  ? 205 GLU D C   1 
ATOM   3440  O O   . GLU B 1 186 ? -37.537 25.715  -36.019 1.00 37.24  ? 205 GLU D O   1 
ATOM   3441  C CB  . GLU B 1 186 ? -38.378 23.154  -37.453 1.00 37.72  ? 205 GLU D CB  1 
ATOM   3442  C CG  . GLU B 1 186 ? -39.627 23.275  -36.627 1.00 39.52  ? 205 GLU D CG  1 
ATOM   3443  C CD  . GLU B 1 186 ? -40.368 21.959  -36.461 1.00 54.40  ? 205 GLU D CD  1 
ATOM   3444  O OE1 . GLU B 1 186 ? -39.738 20.936  -36.113 1.00 42.17  ? 205 GLU D OE1 1 
ATOM   3445  O OE2 . GLU B 1 186 ? -41.600 21.950  -36.686 1.00 55.61  ? 205 GLU D OE2 1 
ATOM   3446  N N   . ILE B 1 187 ? -39.089 26.506  -37.421 1.00 34.82  ? 206 ILE D N   1 
ATOM   3447  C CA  . ILE B 1 187 ? -39.653 27.480  -36.495 1.00 34.81  ? 206 ILE D CA  1 
ATOM   3448  C C   . ILE B 1 187 ? -40.622 26.733  -35.624 1.00 35.92  ? 206 ILE D C   1 
ATOM   3449  O O   . ILE B 1 187 ? -41.742 26.465  -36.061 1.00 38.35  ? 206 ILE D O   1 
ATOM   3450  C CB  . ILE B 1 187 ? -40.467 28.545  -37.221 1.00 36.64  ? 206 ILE D CB  1 
ATOM   3451  C CG1 . ILE B 1 187 ? -39.581 29.289  -38.228 1.00 35.97  ? 206 ILE D CG1 1 
ATOM   3452  C CG2 . ILE B 1 187 ? -41.103 29.476  -36.224 1.00 37.26  ? 206 ILE D CG2 1 
ATOM   3453  C CD1 . ILE B 1 187 ? -40.322 30.267  -39.100 1.00 38.61  ? 206 ILE D CD1 1 
ATOM   3454  N N   . LEU B 1 188 ? -40.181 26.363  -34.418 1.00 34.50  ? 207 LEU D N   1 
ATOM   3455  C CA  . LEU B 1 188 ? -40.993 25.581  -33.493 1.00 35.83  ? 207 LEU D CA  1 
ATOM   3456  C C   . LEU B 1 188 ? -42.091 26.468  -32.972 1.00 38.95  ? 207 LEU D C   1 
ATOM   3457  O O   . LEU B 1 188 ? -41.822 27.548  -32.432 1.00 38.19  ? 207 LEU D O   1 
ATOM   3458  C CB  . LEU B 1 188 ? -40.153 25.081  -32.316 1.00 34.38  ? 207 LEU D CB  1 
ATOM   3459  C CG  . LEU B 1 188 ? -38.973 24.143  -32.565 1.00 33.06  ? 207 LEU D CG  1 
ATOM   3460  C CD1 . LEU B 1 188 ? -37.958 24.251  -31.442 1.00 31.71  ? 207 LEU D CD1 1 
ATOM   3461  C CD2 . LEU B 1 188 ? -39.467 22.731  -32.680 1.00 34.75  ? 207 LEU D CD2 1 
ATOM   3462  N N   . THR B 1 189 ? -43.333 26.025  -33.146 1.00 41.58  ? 208 THR D N   1 
ATOM   3463  C CA  . THR B 1 189 ? -44.491 26.780  -32.670 1.00 44.01  ? 208 THR D CA  1 
ATOM   3464  C C   . THR B 1 189 ? -44.561 26.711  -31.145 1.00 43.90  ? 208 THR D C   1 
ATOM   3465  O O   . THR B 1 189 ? -44.609 25.613  -30.581 1.00 44.20  ? 208 THR D O   1 
ATOM   3466  C CB  . THR B 1 189 ? -45.827 26.247  -33.270 1.00 61.82  ? 208 THR D CB  1 
ATOM   3467  O OG1 . THR B 1 189 ? -45.943 24.845  -33.013 1.00 62.45  ? 208 THR D OG1 1 
ATOM   3468  C CG2 . THR B 1 189 ? -45.866 26.449  -34.757 1.00 62.68  ? 208 THR D CG2 1 
ATOM   3469  N N   . PRO B 1 190 ? -44.541 27.878  -30.475 1.00 43.85  ? 209 PRO D N   1 
ATOM   3470  C CA  . PRO B 1 190 ? -44.774 27.869  -29.034 1.00 44.51  ? 209 PRO D CA  1 
ATOM   3471  C C   . PRO B 1 190 ? -46.056 27.125  -28.756 1.00 45.77  ? 209 PRO D C   1 
ATOM   3472  O O   . PRO B 1 190 ? -46.965 27.158  -29.573 1.00 55.86  ? 209 PRO D O   1 
ATOM   3473  C CB  . PRO B 1 190 ? -44.907 29.349  -28.705 1.00 43.61  ? 209 PRO D CB  1 
ATOM   3474  C CG  . PRO B 1 190 ? -43.990 29.986  -29.687 1.00 41.63  ? 209 PRO D CG  1 
ATOM   3475  C CD  . PRO B 1 190 ? -44.161 29.215  -30.953 1.00 41.61  ? 209 PRO D CD  1 
ATOM   3476  N N   . PRO B 1 191 ? -46.105 26.387  -27.656 1.00 56.55  ? 210 PRO D N   1 
ATOM   3477  C CA  . PRO B 1 191 ? -47.362 25.675  -27.447 1.00 59.87  ? 210 PRO D CA  1 
ATOM   3478  C C   . PRO B 1 191 ? -48.485 26.657  -27.121 1.00 62.43  ? 210 PRO D C   1 
ATOM   3479  O O   . PRO B 1 191 ? -48.239 27.724  -26.564 1.00 62.26  ? 210 PRO D O   1 
ATOM   3480  C CB  . PRO B 1 191 ? -47.049 24.768  -26.258 1.00 60.06  ? 210 PRO D CB  1 
ATOM   3481  C CG  . PRO B 1 191 ? -45.545 24.614  -26.297 1.00 56.88  ? 210 PRO D CG  1 
ATOM   3482  C CD  . PRO B 1 191 ? -45.039 25.933  -26.755 1.00 44.54  ? 210 PRO D CD  1 
ATOM   3483  N N   . ASN B 1 192 ? -49.703 26.328  -27.522 1.00 64.70  ? 211 ASN D N   1 
ATOM   3484  C CA  . ASN B 1 192 ? -50.842 27.062  -27.005 1.00 67.57  ? 211 ASN D CA  1 
ATOM   3485  C C   . ASN B 1 192 ? -51.613 26.190  -26.027 1.00 70.35  ? 211 ASN D C   1 
ATOM   3486  O O   . ASN B 1 192 ? -51.756 24.974  -26.221 1.00 70.73  ? 211 ASN D O   1 
ATOM   3487  C CB  . ASN B 1 192 ? -51.746 27.640  -28.107 1.00 69.68  ? 211 ASN D CB  1 
ATOM   3488  C CG  . ASN B 1 192 ? -51.621 29.172  -28.227 1.00 69.48  ? 211 ASN D CG  1 
ATOM   3489  O OD1 . ASN B 1 192 ? -50.572 29.758  -27.885 1.00 66.58  ? 211 ASN D OD1 1 
ATOM   3490  N ND2 . ASN B 1 192 ? -52.691 29.822  -28.711 1.00 72.90  ? 211 ASN D ND2 1 
ATOM   3491  N N   . MET B 1 193 ? -52.085 26.823  -24.961 1.00 72.54  ? 212 MET D N   1 
ATOM   3492  C CA  . MET B 1 193 ? -52.662 26.091  -23.856 1.00 74.90  ? 212 MET D CA  1 
ATOM   3493  C C   . MET B 1 193 ? -54.105 26.487  -23.532 1.00 79.41  ? 212 MET D C   1 
ATOM   3494  O O   . MET B 1 193 ? -54.651 27.461  -24.053 1.00 80.73  ? 212 MET D O   1 
ATOM   3495  C CB  . MET B 1 193 ? -51.766 26.227  -22.622 1.00 73.39  ? 212 MET D CB  1 
ATOM   3496  C CG  . MET B 1 193 ? -51.077 27.576  -22.520 1.00 71.80  ? 212 MET D CG  1 
ATOM   3497  S SD  . MET B 1 193 ? -50.598 27.920  -20.830 1.00 101.72 ? 212 MET D SD  1 
ATOM   3498  C CE  . MET B 1 193 ? -49.823 26.360  -20.446 1.00 77.93  ? 212 MET D CE  1 
ATOM   3499  N N   . THR B 1 194 ? -54.704 25.699  -22.653 1.00 82.14  ? 213 THR D N   1 
ATOM   3500  C CA  . THR B 1 194 ? -56.089 25.868  -22.265 1.00 86.96  ? 213 THR D CA  1 
ATOM   3501  C C   . THR B 1 194 ? -56.241 25.519  -20.782 1.00 88.77  ? 213 THR D C   1 
ATOM   3502  O O   . THR B 1 194 ? -55.398 24.823  -20.228 1.00 86.63  ? 213 THR D O   1 
ATOM   3503  C CB  . THR B 1 194 ? -56.981 24.971  -23.135 1.00 89.35  ? 213 THR D CB  1 
ATOM   3504  O OG1 . THR B 1 194 ? -56.201 23.873  -23.631 1.00 86.44  ? 213 THR D OG1 1 
ATOM   3505  C CG2 . THR B 1 194 ? -57.515 25.761  -24.315 1.00 90.64  ? 213 THR D CG2 1 
ATOM   3506  N N   . ALA B 1 195 ? -57.296 26.023  -20.142 1.00 93.02  ? 214 ALA D N   1 
ATOM   3507  C CA  . ALA B 1 195 ? -57.590 25.680  -18.746 1.00 95.68  ? 214 ALA D CA  1 
ATOM   3508  C C   . ALA B 1 195 ? -59.023 26.036  -18.340 1.00 100.98 ? 214 ALA D C   1 
ATOM   3509  O O   . ALA B 1 195 ? -59.811 26.499  -19.167 1.00 102.95 ? 214 ALA D O   1 
ATOM   3510  C CB  . ALA B 1 195 ? -56.596 26.355  -17.811 1.00 93.94  ? 214 ALA D CB  1 
ATOM   3511  N N   . LYS B 1 196 ? -59.354 25.817  -17.066 1.00 103.54 ? 215 LYS D N   1 
ATOM   3512  C CA  . LYS B 1 196 ? -60.637 26.253  -16.515 1.00 108.69 ? 215 LYS D CA  1 
ATOM   3513  C C   . LYS B 1 196 ? -60.600 26.354  -14.988 1.00 111.07 ? 215 LYS D C   1 
ATOM   3514  O O   . LYS B 1 196 ? -59.779 27.079  -14.420 1.00 109.38 ? 215 LYS D O   1 
ATOM   3515  C CB  . LYS B 1 196 ? -61.768 25.325  -16.967 1.00 111.89 ? 215 LYS D CB  1 
ATOM   3516  C CG  . LYS B 1 196 ? -62.703 25.913  -18.033 1.00 113.97 ? 215 LYS D CG  1 
ATOM   3517  C CD  . LYS B 1 196 ? -63.719 26.891  -17.442 1.00 118.79 ? 215 LYS D CD  1 
ATOM   3518  C CE  . LYS B 1 196 ? -64.681 27.393  -18.514 1.00 121.58 ? 215 LYS D CE  1 
ATOM   3519  N NZ  . LYS B 1 196 ? -63.959 27.842  -19.746 1.00 117.33 ? 215 LYS D NZ  1 
ATOM   3520  N N   . SER B 1 202 ? -56.311 25.368  -11.300 1.00 108.68 ? 221 SER D N   1 
ATOM   3521  C CA  . SER B 1 202 ? -56.661 25.064  -12.688 1.00 106.14 ? 221 SER D CA  1 
ATOM   3522  C C   . SER B 1 202 ? -55.813 23.930  -13.261 1.00 102.23 ? 221 SER D C   1 
ATOM   3523  O O   . SER B 1 202 ? -54.735 23.624  -12.747 1.00 100.58 ? 221 SER D O   1 
ATOM   3524  C CB  . SER B 1 202 ? -56.503 26.305  -13.574 1.00 103.84 ? 221 SER D CB  1 
ATOM   3525  O OG  . SER B 1 202 ? -55.139 26.537  -13.885 1.00 87.23  ? 221 SER D OG  1 
ATOM   3526  N N   . PHE B 1 203 ? -56.312 23.309  -14.327 1.00 101.23 ? 222 PHE D N   1 
ATOM   3527  C CA  . PHE B 1 203 ? -55.541 22.326  -15.086 1.00 97.53  ? 222 PHE D CA  1 
ATOM   3528  C C   . PHE B 1 203 ? -55.184 22.935  -16.436 1.00 93.49  ? 222 PHE D C   1 
ATOM   3529  O O   . PHE B 1 203 ? -56.073 23.339  -17.179 1.00 94.65  ? 222 PHE D O   1 
ATOM   3530  C CB  . PHE B 1 203 ? -56.352 21.053  -15.325 1.00 99.97  ? 222 PHE D CB  1 
ATOM   3531  C CG  . PHE B 1 203 ? -56.789 20.345  -14.069 1.00 103.95 ? 222 PHE D CG  1 
ATOM   3532  C CD1 . PHE B 1 203 ? -56.154 19.179  -13.661 1.00 103.80 ? 222 PHE D CD1 1 
ATOM   3533  C CD2 . PHE B 1 203 ? -57.858 20.822  -13.315 1.00 108.19 ? 222 PHE D CD2 1 
ATOM   3534  C CE1 . PHE B 1 203 ? -56.568 18.513  -12.518 1.00 108.05 ? 222 PHE D CE1 1 
ATOM   3535  C CE2 . PHE B 1 203 ? -58.276 20.162  -12.168 1.00 112.33 ? 222 PHE D CE2 1 
ATOM   3536  C CZ  . PHE B 1 203 ? -57.631 19.007  -11.767 1.00 112.31 ? 222 PHE D CZ  1 
ATOM   3537  N N   . MET B 1 204 ? -53.891 22.997  -16.753 1.00 89.23  ? 223 MET D N   1 
ATOM   3538  C CA  . MET B 1 204 ? -53.431 23.592  -18.008 1.00 85.54  ? 223 MET D CA  1 
ATOM   3539  C C   . MET B 1 204 ? -52.861 22.534  -18.929 1.00 83.10  ? 223 MET D C   1 
ATOM   3540  O O   . MET B 1 204 ? -51.908 21.842  -18.578 1.00 81.52  ? 223 MET D O   1 
ATOM   3541  C CB  . MET B 1 204 ? -52.377 24.668  -17.749 1.00 82.59  ? 223 MET D CB  1 
ATOM   3542  C CG  . MET B 1 204 ? -52.829 25.743  -16.776 1.00 85.22  ? 223 MET D CG  1 
ATOM   3543  S SD  . MET B 1 204 ? -51.469 26.636  -15.991 1.00 88.50  ? 223 MET D SD  1 
ATOM   3544  C CE  . MET B 1 204 ? -50.906 27.656  -17.363 1.00 69.29  ? 223 MET D CE  1 
ATOM   3545  N N   . HIS B 1 205 ? -53.456 22.425  -20.112 1.00 82.91  ? 224 HIS D N   1 
ATOM   3546  C CA  . HIS B 1 205 ? -53.048 21.461  -21.132 1.00 80.52  ? 224 HIS D CA  1 
ATOM   3547  C C   . HIS B 1 205 ? -52.583 22.202  -22.381 1.00 76.85  ? 224 HIS D C   1 
ATOM   3548  O O   . HIS B 1 205 ? -53.247 23.129  -22.837 1.00 77.84  ? 224 HIS D O   1 
ATOM   3549  C CB  . HIS B 1 205 ? -54.233 20.561  -21.506 1.00 84.05  ? 224 HIS D CB  1 
ATOM   3550  C CG  . HIS B 1 205 ? -53.895 19.103  -21.582 1.00 83.95  ? 224 HIS D CG  1 
ATOM   3551  N ND1 . HIS B 1 205 ? -52.978 18.595  -22.479 1.00 80.82  ? 224 HIS D ND1 1 
ATOM   3552  C CD2 . HIS B 1 205 ? -54.364 18.041  -20.880 1.00 87.04  ? 224 HIS D CD2 1 
ATOM   3553  C CE1 . HIS B 1 205 ? -52.888 17.286  -22.320 1.00 82.31  ? 224 HIS D CE1 1 
ATOM   3554  N NE2 . HIS B 1 205 ? -53.719 16.924  -21.357 1.00 86.12  ? 224 HIS D NE2 1 
ATOM   3555  N N   . TRP B 1 206 ? -51.446 21.795  -22.933 1.00 73.14  ? 225 TRP D N   1 
ATOM   3556  C CA  . TRP B 1 206 ? -50.998 22.316  -24.219 1.00 70.35  ? 225 TRP D CA  1 
ATOM   3557  C C   . TRP B 1 206 ? -50.625 21.151  -25.097 1.00 68.98  ? 225 TRP D C   1 
ATOM   3558  O O   . TRP B 1 206 ? -50.603 20.011  -24.645 1.00 70.22  ? 225 TRP D O   1 
ATOM   3559  C CB  . TRP B 1 206 ? -49.779 23.204  -24.042 1.00 67.10  ? 225 TRP D CB  1 
ATOM   3560  C CG  . TRP B 1 206 ? -48.695 22.529  -23.269 1.00 65.70  ? 225 TRP D CG  1 
ATOM   3561  C CD1 . TRP B 1 206 ? -47.676 21.794  -23.770 1.00 63.46  ? 225 TRP D CD1 1 
ATOM   3562  C CD2 . TRP B 1 206 ? -48.546 22.506  -21.843 1.00 67.04  ? 225 TRP D CD2 1 
ATOM   3563  N NE1 . TRP B 1 206 ? -46.888 21.320  -22.755 1.00 63.32  ? 225 TRP D NE1 1 
ATOM   3564  C CE2 . TRP B 1 206 ? -47.395 21.748  -21.559 1.00 65.61  ? 225 TRP D CE2 1 
ATOM   3565  C CE3 . TRP B 1 206 ? -49.271 23.056  -20.781 1.00 69.62  ? 225 TRP D CE3 1 
ATOM   3566  C CZ2 . TRP B 1 206 ? -46.948 21.521  -20.253 1.00 66.87  ? 225 TRP D CZ2 1 
ATOM   3567  C CZ3 . TRP B 1 206 ? -48.823 22.840  -19.487 1.00 70.66  ? 225 TRP D CZ3 1 
ATOM   3568  C CH2 . TRP B 1 206 ? -47.674 22.078  -19.235 1.00 69.35  ? 225 TRP D CH2 1 
ATOM   3569  N N   . LYS B 1 207 ? -50.341 21.431  -26.361 1.00 66.69  ? 226 LYS D N   1 
ATOM   3570  C CA  . LYS B 1 207 ? -49.783 20.402  -27.229 1.00 65.10  ? 226 LYS D CA  1 
ATOM   3571  C C   . LYS B 1 207 ? -48.646 20.938  -28.113 1.00 60.62  ? 226 LYS D C   1 
ATOM   3572  O O   . LYS B 1 207 ? -48.581 22.126  -28.428 1.00 59.00  ? 226 LYS D O   1 
ATOM   3573  C CB  . LYS B 1 207 ? -50.877 19.702  -28.034 1.00 68.90  ? 226 LYS D CB  1 
ATOM   3574  C CG  . LYS B 1 207 ? -50.500 18.290  -28.467 1.00 69.88  ? 226 LYS D CG  1 
ATOM   3575  C CD  . LYS B 1 207 ? -51.733 17.378  -28.624 1.00 74.87  ? 226 LYS D CD  1 
ATOM   3576  C CE  . LYS B 1 207 ? -52.816 17.952  -29.576 1.00 93.48  ? 226 LYS D CE  1 
ATOM   3577  N NZ  . LYS B 1 207 ? -52.400 18.130  -31.010 1.00 92.38  ? 226 LYS D NZ  1 
ATOM   3578  N N   . MET B 1 208 ? -47.738 20.049  -28.481 1.00 59.05  ? 227 MET D N   1 
ATOM   3579  C CA  . MET B 1 208 ? -46.538 20.434  -29.192 1.00 55.95  ? 227 MET D CA  1 
ATOM   3580  C C   . MET B 1 208 ? -46.238 19.367  -30.231 1.00 56.62  ? 227 MET D C   1 
ATOM   3581  O O   . MET B 1 208 ? -46.040 18.204  -29.900 1.00 57.60  ? 227 MET D O   1 
ATOM   3582  C CB  . MET B 1 208 ? -45.378 20.568  -28.200 1.00 53.45  ? 227 MET D CB  1 
ATOM   3583  C CG  . MET B 1 208 ? -44.040 20.945  -28.814 1.00 50.15  ? 227 MET D CG  1 
ATOM   3584  S SD  . MET B 1 208 ? -44.029 22.677  -29.273 1.00 53.99  ? 227 MET D SD  1 
ATOM   3585  C CE  . MET B 1 208 ? -42.685 22.743  -30.455 1.00 40.08  ? 227 MET D CE  1 
ATOM   3586  N N   . ARG B 1 209 ? -46.209 19.762  -31.493 1.00 56.42  ? 228 ARG D N   1 
ATOM   3587  C CA  . ARG B 1 209 ? -46.049 18.790  -32.556 1.00 57.69  ? 228 ARG D CA  1 
ATOM   3588  C C   . ARG B 1 209 ? -44.891 19.163  -33.472 1.00 54.84  ? 228 ARG D C   1 
ATOM   3589  O O   . ARG B 1 209 ? -44.611 20.342  -33.697 1.00 53.17  ? 228 ARG D O   1 
ATOM   3590  C CB  . ARG B 1 209 ? -47.347 18.676  -33.350 1.00 61.74  ? 228 ARG D CB  1 
ATOM   3591  C CG  . ARG B 1 209 ? -47.601 17.325  -33.970 1.00 64.79  ? 228 ARG D CG  1 
ATOM   3592  C CD  . ARG B 1 209 ? -48.994 17.312  -34.583 1.00 69.22  ? 228 ARG D CD  1 
ATOM   3593  N NE  . ARG B 1 209 ? -49.216 18.450  -35.484 1.00 69.31  ? 228 ARG D NE  1 
ATOM   3594  C CZ  . ARG B 1 209 ? -49.634 18.347  -36.750 1.00 72.17  ? 228 ARG D CZ  1 
ATOM   3595  N NH1 . ARG B 1 209 ? -49.890 17.153  -37.285 1.00 75.15  ? 228 ARG D NH1 1 
ATOM   3596  N NH2 . ARG B 1 209 ? -49.799 19.441  -37.494 1.00 72.37  ? 228 ARG D NH2 1 
ATOM   3597  N N   . SER B 1 210 ? -44.215 18.138  -33.980 1.00 54.43  ? 229 SER D N   1 
ATOM   3598  C CA  . SER B 1 210 ? -43.092 18.305  -34.890 1.00 51.48  ? 229 SER D CA  1 
ATOM   3599  C C   . SER B 1 210 ? -42.767 16.969  -35.549 1.00 52.83  ? 229 SER D C   1 
ATOM   3600  O O   . SER B 1 210 ? -42.777 15.926  -34.902 1.00 54.12  ? 229 SER D O   1 
ATOM   3601  C CB  . SER B 1 210 ? -41.865 18.832  -34.142 1.00 47.27  ? 229 SER D CB  1 
ATOM   3602  O OG  . SER B 1 210 ? -40.739 18.906  -34.995 1.00 45.20  ? 229 SER D OG  1 
ATOM   3603  N N   . HIS B 1 211 ? -42.469 16.994  -36.836 1.00 52.95  ? 230 HIS D N   1 
ATOM   3604  C CA  . HIS B 1 211 ? -42.096 15.768  -37.518 1.00 54.89  ? 230 HIS D CA  1 
ATOM   3605  C C   . HIS B 1 211 ? -40.611 15.491  -37.399 1.00 48.58  ? 230 HIS D C   1 
ATOM   3606  O O   . HIS B 1 211 ? -40.159 14.403  -37.722 1.00 50.23  ? 230 HIS D O   1 
ATOM   3607  C CB  . HIS B 1 211 ? -42.460 15.869  -38.989 1.00 53.18  ? 230 HIS D CB  1 
ATOM   3608  C CG  . HIS B 1 211 ? -43.928 15.887  -39.238 1.00 56.66  ? 230 HIS D CG  1 
ATOM   3609  N ND1 . HIS B 1 211 ? -44.682 14.737  -39.307 1.00 60.60  ? 230 HIS D ND1 1 
ATOM   3610  C CD2 . HIS B 1 211 ? -44.788 16.913  -39.431 1.00 58.11  ? 230 HIS D CD2 1 
ATOM   3611  C CE1 . HIS B 1 211 ? -45.943 15.054  -39.536 1.00 63.44  ? 230 HIS D CE1 1 
ATOM   3612  N NE2 . HIS B 1 211 ? -46.036 16.368  -39.612 1.00 61.54  ? 230 HIS D NE2 1 
ATOM   3613  N N   . PHE B 1 212 ? -39.853 16.474  -36.925 1.00 45.13  ? 231 PHE D N   1 
ATOM   3614  C CA  . PHE B 1 212 ? -38.403 16.434  -37.056 1.00 46.42  ? 231 PHE D CA  1 
ATOM   3615  C C   . PHE B 1 212 ? -37.665 16.586  -35.757 1.00 44.47  ? 231 PHE D C   1 
ATOM   3616  O O   . PHE B 1 212 ? -36.474 16.270  -35.677 1.00 43.43  ? 231 PHE D O   1 
ATOM   3617  C CB  . PHE B 1 212 ? -37.969 17.514  -38.029 1.00 41.49  ? 231 PHE D CB  1 
ATOM   3618  C CG  . PHE B 1 212 ? -38.718 17.449  -39.314 1.00 47.06  ? 231 PHE D CG  1 
ATOM   3619  C CD1 . PHE B 1 212 ? -38.493 16.409  -40.196 1.00 46.54  ? 231 PHE D CD1 1 
ATOM   3620  C CD2 . PHE B 1 212 ? -39.696 18.378  -39.609 1.00 48.90  ? 231 PHE D CD2 1 
ATOM   3621  C CE1 . PHE B 1 212 ? -39.189 16.327  -41.352 1.00 49.48  ? 231 PHE D CE1 1 
ATOM   3622  C CE2 . PHE B 1 212 ? -40.402 18.294  -40.761 1.00 47.64  ? 231 PHE D CE2 1 
ATOM   3623  C CZ  . PHE B 1 212 ? -40.150 17.267  -41.640 1.00 55.34  ? 231 PHE D CZ  1 
ATOM   3624  N N   . ASN B 1 213 ? -38.365 17.099  -34.750 1.00 44.45  ? 232 ASN D N   1 
ATOM   3625  C CA  . ASN B 1 213 ? -37.798 17.225  -33.421 1.00 43.63  ? 232 ASN D CA  1 
ATOM   3626  C C   . ASN B 1 213 ? -38.491 16.276  -32.462 1.00 46.79  ? 232 ASN D C   1 
ATOM   3627  O O   . ASN B 1 213 ? -39.596 15.796  -32.726 1.00 49.29  ? 232 ASN D O   1 
ATOM   3628  C CB  . ASN B 1 213 ? -37.825 18.671  -32.924 1.00 41.00  ? 232 ASN D CB  1 
ATOM   3629  C CG  . ASN B 1 213 ? -36.808 19.569  -33.650 1.00 38.41  ? 232 ASN D CG  1 
ATOM   3630  O OD1 . ASN B 1 213 ? -35.589 19.479  -33.438 1.00 37.22  ? 232 ASN D OD1 1 
ATOM   3631  N ND2 . ASN B 1 213 ? -37.317 20.455  -34.486 1.00 37.83  ? 232 ASN D ND2 1 
ATOM   3632  N N   . ARG B 1 214 ? -37.818 15.992  -31.353 1.00 47.06  ? 233 ARG D N   1 
ATOM   3633  C CA  . ARG B 1 214 ? -38.220 14.935  -30.427 1.00 49.81  ? 233 ARG D CA  1 
ATOM   3634  C C   . ARG B 1 214 ? -37.808 15.342  -29.009 1.00 49.10  ? 233 ARG D C   1 
ATOM   3635  O O   . ARG B 1 214 ? -36.963 16.224  -28.832 1.00 46.79  ? 233 ARG D O   1 
ATOM   3636  C CB  . ARG B 1 214 ? -37.529 13.613  -30.812 1.00 51.96  ? 233 ARG D CB  1 
ATOM   3637  C CG  . ARG B 1 214 ? -38.441 12.498  -31.283 1.00 55.65  ? 233 ARG D CG  1 
ATOM   3638  C CD  . ARG B 1 214 ? -37.682 11.160  -31.388 1.00 58.63  ? 233 ARG D CD  1 
ATOM   3639  N NE  . ARG B 1 214 ? -38.552 9.978   -31.224 1.00 63.04  ? 233 ARG D NE  1 
ATOM   3640  C CZ  . ARG B 1 214 ? -38.820 9.377   -30.056 1.00 65.29  ? 233 ARG D CZ  1 
ATOM   3641  N NH1 . ARG B 1 214 ? -38.291 9.837   -28.928 1.00 63.97  ? 233 ARG D NH1 1 
ATOM   3642  N NH2 . ARG B 1 214 ? -39.621 8.313   -30.007 1.00 69.15  ? 233 ARG D NH2 1 
ATOM   3643  N N   . LYS B 1 215 ? -38.412 14.698  -28.009 1.00 51.52  ? 234 LYS D N   1 
ATOM   3644  C CA  . LYS B 1 215 ? -38.015 14.840  -26.602 1.00 51.63  ? 234 LYS D CA  1 
ATOM   3645  C C   . LYS B 1 215 ? -38.148 16.253  -26.056 1.00 49.57  ? 234 LYS D C   1 
ATOM   3646  O O   . LYS B 1 215 ? -37.173 16.826  -25.590 1.00 48.60  ? 234 LYS D O   1 
ATOM   3647  C CB  . LYS B 1 215 ? -36.583 14.334  -26.386 1.00 51.55  ? 234 LYS D CB  1 
ATOM   3648  C CG  . LYS B 1 215 ? -36.408 12.849  -26.662 1.00 54.40  ? 234 LYS D CG  1 
ATOM   3649  C CD  . LYS B 1 215 ? -34.950 12.443  -26.641 1.00 54.75  ? 234 LYS D CD  1 
ATOM   3650  C CE  . LYS B 1 215 ? -34.794 10.942  -26.830 1.00 58.44  ? 234 LYS D CE  1 
ATOM   3651  N NZ  . LYS B 1 215 ? -34.982 10.520  -28.251 1.00 58.50  ? 234 LYS D NZ  1 
ATOM   3652  N N   . PHE B 1 216 ? -39.353 16.809  -26.093 1.00 49.50  ? 235 PHE D N   1 
ATOM   3653  C CA  . PHE B 1 216 ? -39.554 18.160  -25.591 1.00 47.90  ? 235 PHE D CA  1 
ATOM   3654  C C   . PHE B 1 216 ? -39.712 18.218  -24.076 1.00 49.46  ? 235 PHE D C   1 
ATOM   3655  O O   . PHE B 1 216 ? -40.148 17.262  -23.422 1.00 47.84  ? 235 PHE D O   1 
ATOM   3656  C CB  . PHE B 1 216 ? -40.779 18.806  -26.224 1.00 43.21  ? 235 PHE D CB  1 
ATOM   3657  C CG  . PHE B 1 216 ? -40.722 18.895  -27.715 1.00 43.86  ? 235 PHE D CG  1 
ATOM   3658  C CD1 . PHE B 1 216 ? -40.142 19.998  -28.338 1.00 41.32  ? 235 PHE D CD1 1 
ATOM   3659  C CD2 . PHE B 1 216 ? -41.267 17.885  -28.502 1.00 43.59  ? 235 PHE D CD2 1 
ATOM   3660  C CE1 . PHE B 1 216 ? -40.108 20.088  -29.724 1.00 40.49  ? 235 PHE D CE1 1 
ATOM   3661  C CE2 . PHE B 1 216 ? -41.238 17.963  -29.876 1.00 42.93  ? 235 PHE D CE2 1 
ATOM   3662  C CZ  . PHE B 1 216 ? -40.660 19.067  -30.495 1.00 40.42  ? 235 PHE D CZ  1 
ATOM   3663  N N   . ARG B 1 217 ? -39.333 19.360  -23.527 1.00 48.01  ? 236 ARG D N   1 
ATOM   3664  C CA  . ARG B 1 217 ? -39.663 19.704  -22.166 1.00 50.04  ? 236 ARG D CA  1 
ATOM   3665  C C   . ARG B 1 217 ? -40.177 21.114  -22.284 1.00 49.21  ? 236 ARG D C   1 
ATOM   3666  O O   . ARG B 1 217 ? -40.066 21.714  -23.342 1.00 46.23  ? 236 ARG D O   1 
ATOM   3667  C CB  . ARG B 1 217 ? -38.454 19.607  -21.241 1.00 50.60  ? 236 ARG D CB  1 
ATOM   3668  C CG  . ARG B 1 217 ? -37.357 20.591  -21.525 1.00 48.40  ? 236 ARG D CG  1 
ATOM   3669  C CD  . ARG B 1 217 ? -36.035 20.031  -21.066 1.00 49.38  ? 236 ARG D CD  1 
ATOM   3670  N NE  . ARG B 1 217 ? -34.917 20.597  -21.808 1.00 47.04  ? 236 ARG D NE  1 
ATOM   3671  C CZ  . ARG B 1 217 ? -34.354 21.755  -21.499 1.00 46.35  ? 236 ARG D CZ  1 
ATOM   3672  N NH1 . ARG B 1 217 ? -33.337 22.211  -22.211 1.00 44.29  ? 236 ARG D NH1 1 
ATOM   3673  N NH2 . ARG B 1 217 ? -34.813 22.454  -20.467 1.00 48.02  ? 236 ARG D NH2 1 
ATOM   3674  N N   . TYR B 1 218 ? -40.785 21.629  -21.227 1.00 51.81  ? 237 TYR D N   1 
ATOM   3675  C CA  . TYR B 1 218 ? -41.458 22.910  -21.329 1.00 52.05  ? 237 TYR D CA  1 
ATOM   3676  C C   . TYR B 1 218 ? -41.144 23.773  -20.125 1.00 54.07  ? 237 TYR D C   1 
ATOM   3677  O O   . TYR B 1 218 ? -40.654 23.282  -19.112 1.00 49.21  ? 237 TYR D O   1 
ATOM   3678  C CB  . TYR B 1 218 ? -42.957 22.695  -21.465 1.00 54.65  ? 237 TYR D CB  1 
ATOM   3679  C CG  . TYR B 1 218 ? -43.338 21.749  -22.591 1.00 54.63  ? 237 TYR D CG  1 
ATOM   3680  C CD1 . TYR B 1 218 ? -43.675 22.233  -23.852 1.00 46.30  ? 237 TYR D CD1 1 
ATOM   3681  C CD2 . TYR B 1 218 ? -43.384 20.372  -22.384 1.00 49.34  ? 237 TYR D CD2 1 
ATOM   3682  C CE1 . TYR B 1 218 ? -44.038 21.368  -24.884 1.00 46.52  ? 237 TYR D CE1 1 
ATOM   3683  C CE2 . TYR B 1 218 ? -43.739 19.504  -23.403 1.00 49.50  ? 237 TYR D CE2 1 
ATOM   3684  C CZ  . TYR B 1 218 ? -44.062 20.003  -24.656 1.00 48.10  ? 237 TYR D CZ  1 
ATOM   3685  O OH  . TYR B 1 218 ? -44.416 19.131  -25.667 1.00 48.79  ? 237 TYR D OH  1 
ATOM   3686  N N   . GLU B 1 219 ? -41.398 25.066  -20.260 1.00 54.27  ? 238 GLU D N   1 
ATOM   3687  C CA  . GLU B 1 219 ? -41.108 26.018  -19.203 1.00 56.36  ? 238 GLU D CA  1 
ATOM   3688  C C   . GLU B 1 219 ? -42.232 27.027  -19.094 1.00 58.73  ? 238 GLU D C   1 
ATOM   3689  O O   . GLU B 1 219 ? -42.481 27.797  -20.017 1.00 57.46  ? 238 GLU D O   1 
ATOM   3690  C CB  . GLU B 1 219 ? -39.779 26.732  -19.459 1.00 54.62  ? 238 GLU D CB  1 
ATOM   3691  C CG  . GLU B 1 219 ? -38.559 25.841  -19.277 1.00 54.63  ? 238 GLU D CG  1 
ATOM   3692  C CD  . GLU B 1 219 ? -37.238 26.568  -19.466 1.00 53.39  ? 238 GLU D CD  1 
ATOM   3693  O OE1 . GLU B 1 219 ? -37.241 27.717  -19.972 1.00 52.12  ? 238 GLU D OE1 1 
ATOM   3694  O OE2 . GLU B 1 219 ? -36.194 25.975  -19.099 1.00 53.93  ? 238 GLU D OE2 1 
ATOM   3695  N N   . LEU B 1 220 ? -42.907 27.018  -17.955 1.00 63.06  ? 239 LEU D N   1 
ATOM   3696  C CA  . LEU B 1 220 ? -44.065 27.870  -17.739 1.00 66.14  ? 239 LEU D CA  1 
ATOM   3697  C C   . LEU B 1 220 ? -43.684 29.110  -16.936 1.00 68.78  ? 239 LEU D C   1 
ATOM   3698  O O   . LEU B 1 220 ? -43.137 28.997  -15.851 1.00 70.87  ? 239 LEU D O   1 
ATOM   3699  C CB  . LEU B 1 220 ? -45.146 27.080  -16.995 1.00 69.14  ? 239 LEU D CB  1 
ATOM   3700  C CG  . LEU B 1 220 ? -45.977 26.016  -17.730 1.00 68.78  ? 239 LEU D CG  1 
ATOM   3701  C CD1 . LEU B 1 220 ? -46.701 26.664  -18.891 1.00 67.78  ? 239 LEU D CD1 1 
ATOM   3702  C CD2 . LEU B 1 220 ? -45.173 24.792  -18.195 1.00 66.57  ? 239 LEU D CD2 1 
ATOM   3703  N N   . GLN B 1 221 ? -43.966 30.292  -17.463 1.00 69.55  ? 240 GLN D N   1 
ATOM   3704  C CA  . GLN B 1 221 ? -43.716 31.519  -16.720 1.00 72.77  ? 240 GLN D CA  1 
ATOM   3705  C C   . GLN B 1 221 ? -45.040 32.150  -16.227 1.00 77.33  ? 240 GLN D C   1 
ATOM   3706  O O   . GLN B 1 221 ? -45.823 32.687  -17.023 1.00 77.46  ? 240 GLN D O   1 
ATOM   3707  C CB  . GLN B 1 221 ? -42.891 32.487  -17.568 1.00 70.79  ? 240 GLN D CB  1 
ATOM   3708  C CG  . GLN B 1 221 ? -42.964 33.930  -17.123 1.00 73.88  ? 240 GLN D CG  1 
ATOM   3709  C CD  . GLN B 1 221 ? -41.915 34.809  -17.779 1.00 72.52  ? 240 GLN D CD  1 
ATOM   3710  O OE1 . GLN B 1 221 ? -41.016 34.318  -18.480 1.00 69.52  ? 240 GLN D OE1 1 
ATOM   3711  N NE2 . GLN B 1 221 ? -42.015 36.123  -17.544 1.00 74.97  ? 240 GLN D NE2 1 
ATOM   3712  N N   . ILE B 1 222 ? -45.277 32.075  -14.913 1.00 81.49  ? 241 ILE D N   1 
ATOM   3713  C CA  . ILE B 1 222 ? -46.568 32.430  -14.305 1.00 86.21  ? 241 ILE D CA  1 
ATOM   3714  C C   . ILE B 1 222 ? -46.500 33.540  -13.250 1.00 90.63  ? 241 ILE D C   1 
ATOM   3715  O O   . ILE B 1 222 ? -45.675 33.490  -12.339 1.00 91.75  ? 241 ILE D O   1 
ATOM   3716  C CB  . ILE B 1 222 ? -47.203 31.206  -13.594 1.00 76.32  ? 241 ILE D CB  1 
ATOM   3717  C CG1 . ILE B 1 222 ? -46.888 29.909  -14.342 1.00 73.10  ? 241 ILE D CG1 1 
ATOM   3718  C CG2 . ILE B 1 222 ? -48.702 31.396  -13.428 1.00 79.63  ? 241 ILE D CG2 1 
ATOM   3719  C CD1 . ILE B 1 222 ? -47.478 28.675  -13.685 1.00 75.40  ? 241 ILE D CD1 1 
ATOM   3720  N N   . GLN B 1 223 ? -47.390 34.525  -13.370 1.00 93.59  ? 242 GLN D N   1 
ATOM   3721  C CA  . GLN B 1 223 ? -47.613 35.523  -12.321 1.00 98.74  ? 242 GLN D CA  1 
ATOM   3722  C C   . GLN B 1 223 ? -49.087 35.935  -12.268 1.00 102.60 ? 242 GLN D C   1 
ATOM   3723  O O   . GLN B 1 223 ? -49.602 36.335  -11.220 1.00 107.46 ? 242 GLN D O   1 
ATOM   3724  C CB  . GLN B 1 223 ? -46.736 36.760  -12.534 1.00 98.50  ? 242 GLN D CB  1 
ATOM   3725  C CG  . GLN B 1 223 ? -47.189 37.654  -13.678 1.00 97.62  ? 242 GLN D CG  1 
ATOM   3726  C CD  . GLN B 1 223 ? -46.845 39.117  -13.454 1.00 100.11 ? 242 GLN D CD  1 
ATOM   3727  O OE1 . GLN B 1 223 ? -46.276 39.484  -12.423 1.00 102.69 ? 242 GLN D OE1 1 
ATOM   3728  N NE2 . GLN B 1 223 ? -47.198 39.962  -14.419 1.00 99.80  ? 242 GLN D NE2 1 
ATOM   3729  N N   . VAL B 1 229 ? -43.582 36.856  -10.292 1.00 97.74  ? 248 VAL D N   1 
ATOM   3730  C CA  . VAL B 1 229 ? -43.318 36.029  -11.479 1.00 92.32  ? 248 VAL D CA  1 
ATOM   3731  C C   . VAL B 1 229 ? -42.538 34.744  -11.151 1.00 90.80  ? 248 VAL D C   1 
ATOM   3732  O O   . VAL B 1 229 ? -41.336 34.787  -10.861 1.00 90.62  ? 248 VAL D O   1 
ATOM   3733  C CB  . VAL B 1 229 ? -42.588 36.820  -12.618 1.00 83.17  ? 248 VAL D CB  1 
ATOM   3734  C CG1 . VAL B 1 229 ? -42.258 35.899  -13.791 1.00 77.92  ? 248 VAL D CG1 1 
ATOM   3735  C CG2 . VAL B 1 229 ? -43.428 38.014  -13.085 1.00 84.70  ? 248 VAL D CG2 1 
ATOM   3736  N N   . ILE B 1 230 ? -43.237 33.609  -11.204 1.00 90.08  ? 249 ILE D N   1 
ATOM   3737  C CA  . ILE B 1 230 ? -42.643 32.294  -10.960 1.00 88.81  ? 249 ILE D CA  1 
ATOM   3738  C C   . ILE B 1 230 ? -42.160 31.660  -12.284 1.00 83.42  ? 249 ILE D C   1 
ATOM   3739  O O   . ILE B 1 230 ? -42.349 32.223  -13.368 1.00 80.64  ? 249 ILE D O   1 
ATOM   3740  C CB  . ILE B 1 230 ? -43.651 31.340  -10.246 1.00 76.82  ? 249 ILE D CB  1 
ATOM   3741  C CG1 . ILE B 1 230 ? -44.661 32.133  -9.409  1.00 81.50  ? 249 ILE D CG1 1 
ATOM   3742  C CG2 . ILE B 1 230 ? -42.927 30.311  -9.372  1.00 78.49  ? 249 ILE D CG2 1 
ATOM   3743  C CD1 . ILE B 1 230 ? -45.692 31.266  -8.701  1.00 84.69  ? 249 ILE D CD1 1 
ATOM   3744  N N   . THR B 1 231 ? -41.516 30.502  -12.181 1.00 82.37  ? 250 THR D N   1 
ATOM   3745  C CA  . THR B 1 231 ? -41.115 29.713  -13.341 1.00 78.01  ? 250 THR D CA  1 
ATOM   3746  C C   . THR B 1 231 ? -41.160 28.232  -12.958 1.00 78.94  ? 250 THR D C   1 
ATOM   3747  O O   . THR B 1 231 ? -40.495 27.808  -12.005 1.00 81.39  ? 250 THR D O   1 
ATOM   3748  C CB  . THR B 1 231 ? -39.703 30.120  -13.863 1.00 76.16  ? 250 THR D CB  1 
ATOM   3749  O OG1 . THR B 1 231 ? -39.837 31.133  -14.867 1.00 73.88  ? 250 THR D OG1 1 
ATOM   3750  C CG2 . THR B 1 231 ? -38.966 28.932  -14.474 1.00 73.39  ? 250 THR D CG2 1 
ATOM   3751  N N   . GLU B 1 232 ? -41.975 27.456  -13.670 1.00 77.73  ? 251 GLU D N   1 
ATOM   3752  C CA  . GLU B 1 232 ? -42.086 26.021  -13.409 1.00 79.12  ? 251 GLU D CA  1 
ATOM   3753  C C   . GLU B 1 232 ? -41.573 25.219  -14.616 1.00 76.52  ? 251 GLU D C   1 
ATOM   3754  O O   . GLU B 1 232 ? -41.237 25.797  -15.641 1.00 73.22  ? 251 GLU D O   1 
ATOM   3755  C CB  . GLU B 1 232 ? -43.528 25.640  -13.046 1.00 81.09  ? 251 GLU D CB  1 
ATOM   3756  C CG  . GLU B 1 232 ? -44.149 26.457  -11.892 1.00 84.72  ? 251 GLU D CG  1 
ATOM   3757  C CD  . GLU B 1 232 ? -43.859 25.899  -10.490 1.00 88.56  ? 251 GLU D CD  1 
ATOM   3758  O OE1 . GLU B 1 232 ? -44.806 25.430  -9.818  1.00 91.73  ? 251 GLU D OE1 1 
ATOM   3759  O OE2 . GLU B 1 232 ? -42.690 25.956  -10.055 1.00 88.80  ? 251 GLU D OE2 1 
ATOM   3760  N N   . GLN B 1 233 ? -41.505 23.895  -14.482 1.00 78.51  ? 252 GLN D N   1 
ATOM   3761  C CA  . GLN B 1 233 ? -40.860 23.037  -15.478 1.00 76.72  ? 252 GLN D CA  1 
ATOM   3762  C C   . GLN B 1 233 ? -41.452 21.637  -15.570 1.00 79.62  ? 252 GLN D C   1 
ATOM   3763  O O   . GLN B 1 233 ? -41.694 20.982  -14.553 1.00 83.14  ? 252 GLN D O   1 
ATOM   3764  C CB  . GLN B 1 233 ? -39.369 22.924  -15.186 1.00 76.02  ? 252 GLN D CB  1 
ATOM   3765  C CG  . GLN B 1 233 ? -38.562 24.080  -15.728 1.00 73.03  ? 252 GLN D CG  1 
ATOM   3766  C CD  . GLN B 1 233 ? -37.126 24.055  -15.260 1.00 73.42  ? 252 GLN D CD  1 
ATOM   3767  O OE1 . GLN B 1 233 ? -36.803 23.450  -14.234 1.00 76.62  ? 252 GLN D OE1 1 
ATOM   3768  N NE2 . GLN B 1 233 ? -36.250 24.719  -16.009 1.00 70.68  ? 252 GLN D NE2 1 
ATOM   3769  N N   . VAL B 1 234 ? -41.667 21.172  -16.798 1.00 78.98  ? 253 VAL D N   1 
ATOM   3770  C CA  . VAL B 1 234 ? -42.308 19.886  -17.015 1.00 82.18  ? 253 VAL D CA  1 
ATOM   3771  C C   . VAL B 1 234 ? -41.473 18.936  -17.873 1.00 81.90  ? 253 VAL D C   1 
ATOM   3772  O O   . VAL B 1 234 ? -41.493 19.022  -19.096 1.00 79.16  ? 253 VAL D O   1 
ATOM   3773  C CB  . VAL B 1 234 ? -43.699 20.062  -17.634 1.00 82.38  ? 253 VAL D CB  1 
ATOM   3774  C CG1 . VAL B 1 234 ? -44.542 18.826  -17.379 1.00 85.37  ? 253 VAL D CG1 1 
ATOM   3775  C CG2 . VAL B 1 234 ? -44.390 21.288  -17.052 1.00 59.54  ? 253 VAL D CG2 1 
ATOM   3776  N N   . ARG B 1 235 ? -40.768 18.014  -17.217 1.00 85.49  ? 254 ARG D N   1 
ATOM   3777  C CA  . ARG B 1 235 ? -39.823 17.115  -17.887 1.00 86.15  ? 254 ARG D CA  1 
ATOM   3778  C C   . ARG B 1 235 ? -40.434 16.268  -19.004 1.00 85.84  ? 254 ARG D C   1 
ATOM   3779  O O   . ARG B 1 235 ? -39.700 15.718  -19.830 1.00 85.26  ? 254 ARG D O   1 
ATOM   3780  C CB  . ARG B 1 235 ? -39.081 16.204  -16.887 1.00 90.26  ? 254 ARG D CB  1 
ATOM   3781  C CG  . ARG B 1 235 ? -37.780 15.584  -17.453 1.00 89.46  ? 254 ARG D CG  1 
ATOM   3782  C CD  . ARG B 1 235 ? -37.044 14.664  -16.465 1.00 93.80  ? 254 ARG D CD  1 
ATOM   3783  N NE  . ARG B 1 235 ? -35.632 14.499  -16.832 1.00 93.21  ? 254 ARG D NE  1 
ATOM   3784  C CZ  . ARG B 1 235 ? -34.750 13.765  -16.149 1.00 96.35  ? 254 ARG D CZ  1 
ATOM   3785  N NH1 . ARG B 1 235 ? -35.130 13.109  -15.059 1.00 100.64 ? 254 ARG D NH1 1 
ATOM   3786  N NH2 . ARG B 1 235 ? -33.485 13.680  -16.557 1.00 95.41  ? 254 ARG D NH2 1 
ATOM   3787  N N   . ASP B 1 236 ? -41.759 16.153  -19.050 1.00 85.95  ? 255 ASP D N   1 
ATOM   3788  C CA  . ASP B 1 236 ? -42.371 15.372  -20.131 1.00 84.56  ? 255 ASP D CA  1 
ATOM   3789  C C   . ASP B 1 236 ? -43.805 15.755  -20.530 1.00 84.68  ? 255 ASP D C   1 
ATOM   3790  O O   . ASP B 1 236 ? -44.047 16.158  -21.681 1.00 82.61  ? 255 ASP D O   1 
ATOM   3791  C CB  . ASP B 1 236 ? -42.280 13.862  -19.839 1.00 86.96  ? 255 ASP D CB  1 
ATOM   3792  C CG  . ASP B 1 236 ? -41.701 13.068  -21.015 1.00 85.06  ? 255 ASP D CG  1 
ATOM   3793  O OD1 . ASP B 1 236 ? -41.354 13.688  -22.061 1.00 81.39  ? 255 ASP D OD1 1 
ATOM   3794  O OD2 . ASP B 1 236 ? -41.583 11.825  -20.883 1.00 87.53  ? 255 ASP D OD2 1 
ATOM   3795  N N   . ARG B 1 237 ? -44.742 15.628  -19.590 1.00 87.47  ? 256 ARG D N   1 
ATOM   3796  C CA  . ARG B 1 237 ? -46.167 15.723  -19.906 1.00 88.45  ? 256 ARG D CA  1 
ATOM   3797  C C   . ARG B 1 237 ? -46.644 17.084  -20.444 1.00 84.84  ? 256 ARG D C   1 
ATOM   3798  O O   . ARG B 1 237 ? -46.049 18.135  -20.186 1.00 82.78  ? 256 ARG D O   1 
ATOM   3799  C CB  . ARG B 1 237 ? -47.008 15.305  -18.697 1.00 93.62  ? 256 ARG D CB  1 
ATOM   3800  C CG  . ARG B 1 237 ? -47.105 16.368  -17.629 1.00 94.94  ? 256 ARG D CG  1 
ATOM   3801  C CD  . ARG B 1 237 ? -47.523 15.777  -16.313 1.00 99.91  ? 256 ARG D CD  1 
ATOM   3802  N NE  . ARG B 1 237 ? -47.665 16.809  -15.289 1.00 101.43 ? 256 ARG D NE  1 
ATOM   3803  C CZ  . ARG B 1 237 ? -46.648 17.359  -14.632 1.00 101.04 ? 256 ARG D CZ  1 
ATOM   3804  N NH1 . ARG B 1 237 ? -45.403 16.977  -14.898 1.00 99.33  ? 256 ARG D NH1 1 
ATOM   3805  N NH2 . ARG B 1 237 ? -46.878 18.291  -13.712 1.00 102.61 ? 256 ARG D NH2 1 
ATOM   3806  N N   . THR B 1 238 ? -47.740 17.042  -21.192 1.00 84.50  ? 257 THR D N   1 
ATOM   3807  C CA  . THR B 1 238 ? -48.326 18.229  -21.795 1.00 81.91  ? 257 THR D CA  1 
ATOM   3808  C C   . THR B 1 238 ? -49.410 18.885  -20.915 1.00 82.85  ? 257 THR D C   1 
ATOM   3809  O O   . THR B 1 238 ? -50.119 19.798  -21.343 1.00 83.01  ? 257 THR D O   1 
ATOM   3810  C CB  . THR B 1 238 ? -48.899 17.863  -23.159 1.00 82.16  ? 257 THR D CB  1 
ATOM   3811  O OG1 . THR B 1 238 ? -49.292 16.483  -23.142 1.00 84.91  ? 257 THR D OG1 1 
ATOM   3812  C CG2 . THR B 1 238 ? -47.843 18.057  -24.227 1.00 78.61  ? 257 THR D CG2 1 
ATOM   3813  N N   . SER B 1 239 ? -49.515 18.417  -19.675 1.00 83.41  ? 258 SER D N   1 
ATOM   3814  C CA  . SER B 1 239 ? -50.507 18.913  -18.727 1.00 84.53  ? 258 SER D CA  1 
ATOM   3815  C C   . SER B 1 239 ? -49.831 19.544  -17.512 1.00 82.45  ? 258 SER D C   1 
ATOM   3816  O O   . SER B 1 239 ? -48.678 19.237  -17.216 1.00 80.97  ? 258 SER D O   1 
ATOM   3817  C CB  . SER B 1 239 ? -51.411 17.765  -18.282 1.00 88.83  ? 258 SER D CB  1 
ATOM   3818  O OG  . SER B 1 239 ? -52.271 18.176  -17.238 1.00 92.30  ? 258 SER D OG  1 
ATOM   3819  N N   . PHE B 1 240 ? -50.543 20.424  -16.811 1.00 82.57  ? 259 PHE D N   1 
ATOM   3820  C CA  . PHE B 1 240 ? -50.005 21.034  -15.594 1.00 81.59  ? 259 PHE D CA  1 
ATOM   3821  C C   . PHE B 1 240 ? -51.059 21.595  -14.642 1.00 84.62  ? 259 PHE D C   1 
ATOM   3822  O O   . PHE B 1 240 ? -51.605 22.668  -14.888 1.00 84.55  ? 259 PHE D O   1 
ATOM   3823  C CB  . PHE B 1 240 ? -49.032 22.147  -15.942 1.00 77.28  ? 259 PHE D CB  1 
ATOM   3824  C CG  . PHE B 1 240 ? -48.396 22.776  -14.748 1.00 78.02  ? 259 PHE D CG  1 
ATOM   3825  C CD1 . PHE B 1 240 ? -47.458 22.071  -13.997 1.00 78.57  ? 259 PHE D CD1 1 
ATOM   3826  C CD2 . PHE B 1 240 ? -48.728 24.071  -14.366 1.00 78.84  ? 259 PHE D CD2 1 
ATOM   3827  C CE1 . PHE B 1 240 ? -46.854 22.645  -12.878 1.00 80.14  ? 259 PHE D CE1 1 
ATOM   3828  C CE2 . PHE B 1 240 ? -48.128 24.659  -13.255 1.00 80.36  ? 259 PHE D CE2 1 
ATOM   3829  C CZ  . PHE B 1 240 ? -47.189 23.942  -12.508 1.00 81.06  ? 259 PHE D CZ  1 
ATOM   3830  N N   . GLN B 1 241 ? -51.311 20.886  -13.542 1.00 87.56  ? 260 GLN D N   1 
ATOM   3831  C CA  . GLN B 1 241 ? -52.263 21.335  -12.520 1.00 91.07  ? 260 GLN D CA  1 
ATOM   3832  C C   . GLN B 1 241 ? -51.706 22.511  -11.707 1.00 90.75  ? 260 GLN D C   1 
ATOM   3833  O O   . GLN B 1 241 ? -50.534 22.519  -11.331 1.00 89.39  ? 260 GLN D O   1 
ATOM   3834  C CB  . GLN B 1 241 ? -52.650 20.177  -11.584 1.00 95.10  ? 260 GLN D CB  1 
ATOM   3835  C CG  . GLN B 1 241 ? -53.911 20.443  -10.751 1.00 100.02 ? 260 GLN D CG  1 
ATOM   3836  C CD  . GLN B 1 241 ? -54.143 19.426  -9.628  1.00 104.64 ? 260 GLN D CD  1 
ATOM   3837  O OE1 . GLN B 1 241 ? -53.367 19.350  -8.674  1.00 105.97 ? 260 GLN D OE1 1 
ATOM   3838  N NE2 . GLN B 1 241 ? -55.223 18.655  -9.733  1.00 101.42 ? 260 GLN D NE2 1 
ATOM   3839  N N   . LEU B 1 242 ? -52.552 23.508  -11.457 1.00 92.50  ? 261 LEU D N   1 
ATOM   3840  C CA  . LEU B 1 242 ? -52.204 24.640  -10.597 1.00 93.74  ? 261 LEU D CA  1 
ATOM   3841  C C   . LEU B 1 242 ? -53.343 24.957  -9.627  1.00 99.47  ? 261 LEU D C   1 
ATOM   3842  O O   . LEU B 1 242 ? -53.117 25.254  -8.453  1.00 102.86 ? 261 LEU D O   1 
ATOM   3843  C CB  . LEU B 1 242 ? -51.884 25.881  -11.432 1.00 90.43  ? 261 LEU D CB  1 
ATOM   3844  C CG  . LEU B 1 242 ? -51.743 27.184  -10.641 1.00 87.28  ? 261 LEU D CG  1 
ATOM   3845  C CD1 . LEU B 1 242 ? -50.646 27.065  -9.593  1.00 88.16  ? 261 LEU D CD1 1 
ATOM   3846  C CD2 . LEU B 1 242 ? -51.480 28.357  -11.573 1.00 84.36  ? 261 LEU D CD2 1 
ATOM   3847  N N   . TYR B 1 248 ? -54.536 36.017  -13.827 1.00 105.72 ? 267 TYR D N   1 
ATOM   3848  C CA  . TYR B 1 248 ? -53.102 35.857  -14.051 1.00 101.09 ? 267 TYR D CA  1 
ATOM   3849  C C   . TYR B 1 248 ? -52.787 35.638  -15.530 1.00 96.54  ? 267 TYR D C   1 
ATOM   3850  O O   . TYR B 1 248 ? -53.670 35.276  -16.314 1.00 96.94  ? 267 TYR D O   1 
ATOM   3851  C CB  . TYR B 1 248 ? -52.560 34.687  -13.232 1.00 100.23 ? 267 TYR D CB  1 
ATOM   3852  C CG  . TYR B 1 248 ? -52.955 33.332  -13.775 1.00 98.55  ? 267 TYR D CG  1 
ATOM   3853  C CD1 . TYR B 1 248 ? -52.013 32.492  -14.358 1.00 94.06  ? 267 TYR D CD1 1 
ATOM   3854  C CD2 . TYR B 1 248 ? -54.272 32.894  -13.717 1.00 101.82 ? 267 TYR D CD2 1 
ATOM   3855  C CE1 . TYR B 1 248 ? -52.374 31.245  -14.860 1.00 92.76  ? 267 TYR D CE1 1 
ATOM   3856  C CE2 . TYR B 1 248 ? -54.641 31.654  -14.217 1.00 100.53 ? 267 TYR D CE2 1 
ATOM   3857  C CZ  . TYR B 1 248 ? -53.691 30.834  -14.788 1.00 95.97  ? 267 TYR D CZ  1 
ATOM   3858  O OH  . TYR B 1 248 ? -54.056 29.602  -15.283 1.00 94.95  ? 267 TYR D OH  1 
ATOM   3859  N N   . THR B 1 249 ? -51.526 35.863  -15.899 1.00 92.57  ? 268 THR D N   1 
ATOM   3860  C CA  . THR B 1 249 ? -51.046 35.653  -17.269 1.00 88.14  ? 268 THR D CA  1 
ATOM   3861  C C   . THR B 1 249 ? -49.922 34.609  -17.319 1.00 83.86  ? 268 THR D C   1 
ATOM   3862  O O   . THR B 1 249 ? -49.108 34.510  -16.390 1.00 83.74  ? 268 THR D O   1 
ATOM   3863  C CB  . THR B 1 249 ? -50.569 36.978  -17.948 1.00 96.87  ? 268 THR D CB  1 
ATOM   3864  O OG1 . THR B 1 249 ? -49.872 37.802  -17.002 1.00 98.27  ? 268 THR D OG1 1 
ATOM   3865  C CG2 . THR B 1 249 ? -51.745 37.760  -18.496 1.00 100.37 ? 268 THR D CG2 1 
ATOM   3866  N N   . VAL B 1 250 ? -49.886 33.830  -18.401 1.00 80.75  ? 269 VAL D N   1 
ATOM   3867  C CA  . VAL B 1 250 ? -48.886 32.776  -18.555 1.00 76.69  ? 269 VAL D CA  1 
ATOM   3868  C C   . VAL B 1 250 ? -48.107 32.954  -19.839 1.00 72.69  ? 269 VAL D C   1 
ATOM   3869  O O   . VAL B 1 250 ? -48.562 33.617  -20.772 1.00 73.08  ? 269 VAL D O   1 
ATOM   3870  C CB  . VAL B 1 250 ? -49.518 31.363  -18.625 1.00 68.78  ? 269 VAL D CB  1 
ATOM   3871  C CG1 . VAL B 1 250 ? -48.592 30.321  -18.012 1.00 67.03  ? 269 VAL D CG1 1 
ATOM   3872  C CG2 . VAL B 1 250 ? -50.848 31.337  -17.942 1.00 73.43  ? 269 VAL D CG2 1 
ATOM   3873  N N   . GLN B 1 251 ? -46.922 32.350  -19.870 1.00 69.14  ? 270 GLN D N   1 
ATOM   3874  C CA  . GLN B 1 251 ? -46.196 32.104  -21.104 1.00 64.92  ? 270 GLN D CA  1 
ATOM   3875  C C   . GLN B 1 251 ? -45.629 30.689  -21.002 1.00 62.86  ? 270 GLN D C   1 
ATOM   3876  O O   . GLN B 1 251 ? -45.264 30.246  -19.920 1.00 64.01  ? 270 GLN D O   1 
ATOM   3877  C CB  . GLN B 1 251 ? -45.072 33.119  -21.281 1.00 63.03  ? 270 GLN D CB  1 
ATOM   3878  C CG  . GLN B 1 251 ? -45.470 34.542  -20.970 1.00 65.56  ? 270 GLN D CG  1 
ATOM   3879  C CD  . GLN B 1 251 ? -44.530 35.550  -21.572 1.00 64.03  ? 270 GLN D CD  1 
ATOM   3880  O OE1 . GLN B 1 251 ? -44.906 36.287  -22.475 1.00 64.51  ? 270 GLN D OE1 1 
ATOM   3881  N NE2 . GLN B 1 251 ? -43.298 35.591  -21.080 1.00 62.65  ? 270 GLN D NE2 1 
ATOM   3882  N N   . ILE B 1 252 ? -45.581 29.969  -22.113 1.00 60.42  ? 271 ILE D N   1 
ATOM   3883  C CA  . ILE B 1 252 ? -44.961 28.652  -22.146 1.00 58.56  ? 271 ILE D CA  1 
ATOM   3884  C C   . ILE B 1 252 ? -43.910 28.668  -23.270 1.00 45.73  ? 271 ILE D C   1 
ATOM   3885  O O   . ILE B 1 252 ? -43.935 29.560  -24.107 1.00 45.22  ? 271 ILE D O   1 
ATOM   3886  C CB  . ILE B 1 252 ? -46.033 27.553  -22.357 1.00 50.67  ? 271 ILE D CB  1 
ATOM   3887  C CG1 . ILE B 1 252 ? -45.427 26.147  -22.257 1.00 52.51  ? 271 ILE D CG1 1 
ATOM   3888  C CG2 . ILE B 1 252 ? -46.762 27.762  -23.676 1.00 50.66  ? 271 ILE D CG2 1 
ATOM   3889  C CD1 . ILE B 1 252 ? -46.430 25.013  -22.390 1.00 51.63  ? 271 ILE D CD1 1 
ATOM   3890  N N   . ARG B 1 253 ? -42.964 27.731  -23.260 1.00 44.02  ? 272 ARG D N   1 
ATOM   3891  C CA  . ARG B 1 253 ? -41.998 27.580  -24.360 1.00 41.15  ? 272 ARG D CA  1 
ATOM   3892  C C   . ARG B 1 253 ? -41.410 26.174  -24.367 1.00 40.40  ? 272 ARG D C   1 
ATOM   3893  O O   . ARG B 1 253 ? -41.329 25.535  -23.323 1.00 41.92  ? 272 ARG D O   1 
ATOM   3894  C CB  . ARG B 1 253 ? -40.886 28.632  -24.294 1.00 39.70  ? 272 ARG D CB  1 
ATOM   3895  C CG  . ARG B 1 253 ? -39.610 28.170  -23.641 1.00 38.87  ? 272 ARG D CG  1 
ATOM   3896  C CD  . ARG B 1 253 ? -38.603 29.302  -23.560 1.00 38.02  ? 272 ARG D CD  1 
ATOM   3897  N NE  . ARG B 1 253 ? -37.487 28.988  -22.669 1.00 38.28  ? 272 ARG D NE  1 
ATOM   3898  C CZ  . ARG B 1 253 ? -36.507 29.829  -22.361 1.00 38.20  ? 272 ARG D CZ  1 
ATOM   3899  N NH1 . ARG B 1 253 ? -36.469 31.047  -22.863 1.00 37.73  ? 272 ARG D NH1 1 
ATOM   3900  N NH2 . ARG B 1 253 ? -35.559 29.445  -21.540 1.00 39.03  ? 272 ARG D NH2 1 
ATOM   3901  N N   . ALA B 1 254 ? -41.040 25.671  -25.540 1.00 38.72  ? 273 ALA D N   1 
ATOM   3902  C CA  . ALA B 1 254 ? -40.580 24.286  -25.636 1.00 38.53  ? 273 ALA D CA  1 
ATOM   3903  C C   . ALA B 1 254 ? -39.088 24.212  -25.910 1.00 36.45  ? 273 ALA D C   1 
ATOM   3904  O O   . ALA B 1 254 ? -38.532 25.100  -26.517 1.00 36.31  ? 273 ALA D O   1 
ATOM   3905  C CB  . ALA B 1 254 ? -41.351 23.549  -26.714 1.00 39.05  ? 273 ALA D CB  1 
ATOM   3906  N N   . ARG B 1 255 ? -38.435 23.157  -25.462 1.00 36.89  ? 274 ARG D N   1 
ATOM   3907  C CA  . ARG B 1 255 ? -37.011 22.994  -25.697 1.00 38.11  ? 274 ARG D CA  1 
ATOM   3908  C C   . ARG B 1 255 ? -36.793 21.528  -25.917 1.00 39.19  ? 274 ARG D C   1 
ATOM   3909  O O   . ARG B 1 255 ? -37.249 20.730  -25.115 1.00 41.40  ? 274 ARG D O   1 
ATOM   3910  C CB  . ARG B 1 255 ? -36.212 23.406  -24.468 1.00 36.12  ? 274 ARG D CB  1 
ATOM   3911  C CG  . ARG B 1 255 ? -36.630 24.724  -23.874 1.00 36.64  ? 274 ARG D CG  1 
ATOM   3912  C CD  . ARG B 1 255 ? -35.859 25.022  -22.638 1.00 37.81  ? 274 ARG D CD  1 
ATOM   3913  N NE  . ARG B 1 255 ? -34.467 25.231  -22.973 1.00 40.00  ? 274 ARG D NE  1 
ATOM   3914  C CZ  . ARG B 1 255 ? -33.734 26.212  -22.479 1.00 40.27  ? 274 ARG D CZ  1 
ATOM   3915  N NH1 . ARG B 1 255 ? -34.285 27.045  -21.614 1.00 41.80  ? 274 ARG D NH1 1 
ATOM   3916  N NH2 . ARG B 1 255 ? -32.463 26.346  -22.836 1.00 35.75  ? 274 ARG D NH2 1 
ATOM   3917  N N   . GLU B 1 256 ? -36.102 21.150  -26.984 1.00 38.40  ? 275 GLU D N   1 
ATOM   3918  C CA  . GLU B 1 256 ? -35.870 19.735  -27.218 1.00 40.58  ? 275 GLU D CA  1 
ATOM   3919  C C   . GLU B 1 256 ? -34.433 19.427  -26.856 1.00 40.84  ? 275 GLU D C   1 
ATOM   3920  O O   . GLU B 1 256 ? -33.569 20.253  -27.046 1.00 39.33  ? 275 GLU D O   1 
ATOM   3921  C CB  . GLU B 1 256 ? -36.218 19.365  -28.658 1.00 40.97  ? 275 GLU D CB  1 
ATOM   3922  C CG  . GLU B 1 256 ? -35.503 20.180  -29.716 1.00 39.53  ? 275 GLU D CG  1 
ATOM   3923  C CD  . GLU B 1 256 ? -34.124 19.624  -30.025 1.00 40.03  ? 275 GLU D CD  1 
ATOM   3924  O OE1 . GLU B 1 256 ? -33.986 18.378  -30.074 1.00 41.93  ? 275 GLU D OE1 1 
ATOM   3925  O OE2 . GLU B 1 256 ? -33.170 20.427  -30.193 1.00 38.80  ? 275 GLU D OE2 1 
ATOM   3926  N N   . ARG B 1 257 ? -34.165 18.263  -26.291 1.00 43.39  ? 276 ARG D N   1 
ATOM   3927  C CA  . ARG B 1 257 ? -32.854 18.056  -25.674 1.00 44.50  ? 276 ARG D CA  1 
ATOM   3928  C C   . ARG B 1 257 ? -31.922 17.203  -26.516 1.00 44.44  ? 276 ARG D C   1 
ATOM   3929  O O   . ARG B 1 257 ? -30.972 16.619  -26.018 1.00 46.35  ? 276 ARG D O   1 
ATOM   3930  C CB  . ARG B 1 257 ? -32.975 17.515  -24.237 1.00 48.23  ? 276 ARG D CB  1 
ATOM   3931  C CG  . ARG B 1 257 ? -33.711 16.181  -24.107 1.00 51.38  ? 276 ARG D CG  1 
ATOM   3932  C CD  . ARG B 1 257 ? -32.917 15.152  -23.294 1.00 54.92  ? 276 ARG D CD  1 
ATOM   3933  N NE  . ARG B 1 257 ? -33.404 13.787  -23.504 1.00 57.98  ? 276 ARG D NE  1 
ATOM   3934  C CZ  . ARG B 1 257 ? -34.613 13.342  -23.141 1.00 60.29  ? 276 ARG D CZ  1 
ATOM   3935  N NH1 . ARG B 1 257 ? -35.493 14.154  -22.550 1.00 59.97  ? 276 ARG D NH1 1 
ATOM   3936  N NH2 . ARG B 1 257 ? -34.955 12.075  -23.370 1.00 63.03  ? 276 ARG D NH2 1 
ATOM   3937  N N   . VAL B 1 258 ? -32.183 17.158  -27.808 1.00 42.76  ? 277 VAL D N   1 
ATOM   3938  C CA  . VAL B 1 258 ? -31.270 16.498  -28.721 1.00 42.77  ? 277 VAL D CA  1 
ATOM   3939  C C   . VAL B 1 258 ? -30.315 17.533  -29.307 1.00 35.85  ? 277 VAL D C   1 
ATOM   3940  O O   . VAL B 1 258 ? -29.133 17.257  -29.484 1.00 36.29  ? 277 VAL D O   1 
ATOM   3941  C CB  . VAL B 1 258 ? -32.044 15.760  -29.818 1.00 38.86  ? 277 VAL D CB  1 
ATOM   3942  C CG1 . VAL B 1 258 ? -31.128 14.887  -30.635 1.00 39.95  ? 277 VAL D CG1 1 
ATOM   3943  C CG2 . VAL B 1 258 ? -33.139 14.929  -29.180 1.00 41.26  ? 277 VAL D CG2 1 
ATOM   3944  N N   . TYR B 1 259 ? -30.824 18.733  -29.570 1.00 33.70  ? 278 TYR D N   1 
ATOM   3945  C CA  . TYR B 1 259 ? -30.021 19.795  -30.161 1.00 31.64  ? 278 TYR D CA  1 
ATOM   3946  C C   . TYR B 1 259 ? -30.101 21.101  -29.394 1.00 34.72  ? 278 TYR D C   1 
ATOM   3947  O O   . TYR B 1 259 ? -29.519 22.108  -29.830 1.00 33.14  ? 278 TYR D O   1 
ATOM   3948  C CB  . TYR B 1 259 ? -30.483 20.064  -31.579 1.00 30.42  ? 278 TYR D CB  1 
ATOM   3949  C CG  . TYR B 1 259 ? -30.479 18.838  -32.444 1.00 31.81  ? 278 TYR D CG  1 
ATOM   3950  C CD1 . TYR B 1 259 ? -29.288 18.323  -32.950 1.00 32.33  ? 278 TYR D CD1 1 
ATOM   3951  C CD2 . TYR B 1 259 ? -31.665 18.181  -32.740 1.00 33.06  ? 278 TYR D CD2 1 
ATOM   3952  C CE1 . TYR B 1 259 ? -29.281 17.191  -33.711 1.00 34.07  ? 278 TYR D CE1 1 
ATOM   3953  C CE2 . TYR B 1 259 ? -31.674 17.045  -33.507 1.00 34.84  ? 278 TYR D CE2 1 
ATOM   3954  C CZ  . TYR B 1 259 ? -30.484 16.553  -33.996 1.00 37.55  ? 278 TYR D CZ  1 
ATOM   3955  O OH  . TYR B 1 259 ? -30.503 15.417  -34.767 1.00 37.56  ? 278 TYR D OH  1 
ATOM   3956  N N   . GLU B 1 260 ? -30.811 21.080  -28.257 1.00 31.73  ? 279 GLU D N   1 
ATOM   3957  C CA  . GLU B 1 260 ? -31.111 22.277  -27.465 1.00 31.33  ? 279 GLU D CA  1 
ATOM   3958  C C   . GLU B 1 260 ? -31.759 23.389  -28.296 1.00 29.54  ? 279 GLU D C   1 
ATOM   3959  O O   . GLU B 1 260 ? -31.505 24.581  -28.096 1.00 28.82  ? 279 GLU D O   1 
ATOM   3960  C CB  . GLU B 1 260 ? -29.885 22.774  -26.686 1.00 31.83  ? 279 GLU D CB  1 
ATOM   3961  C CG  . GLU B 1 260 ? -29.436 21.838  -25.548 1.00 36.48  ? 279 GLU D CG  1 
ATOM   3962  C CD  . GLU B 1 260 ? -30.504 21.581  -24.439 1.00 40.25  ? 279 GLU D CD  1 
ATOM   3963  O OE1 . GLU B 1 260 ? -31.234 22.516  -24.038 1.00 36.00  ? 279 GLU D OE1 1 
ATOM   3964  O OE2 . GLU B 1 260 ? -30.598 20.426  -23.965 1.00 42.70  ? 279 GLU D OE2 1 
ATOM   3965  N N   . PHE B 1 261 ? -32.589 22.980  -29.249 1.00 29.30  ? 280 PHE D N   1 
ATOM   3966  C CA  . PHE B 1 261 ? -33.427 23.923  -29.979 1.00 34.40  ? 280 PHE D CA  1 
ATOM   3967  C C   . PHE B 1 261 ? -34.614 24.293  -29.071 1.00 35.59  ? 280 PHE D C   1 
ATOM   3968  O O   . PHE B 1 261 ? -35.023 23.499  -28.208 1.00 31.04  ? 280 PHE D O   1 
ATOM   3969  C CB  . PHE B 1 261 ? -33.928 23.318  -31.304 1.00 28.51  ? 280 PHE D CB  1 
ATOM   3970  C CG  . PHE B 1 261 ? -32.836 23.042  -32.313 1.00 28.44  ? 280 PHE D CG  1 
ATOM   3971  C CD1 . PHE B 1 261 ? -32.916 21.943  -33.156 1.00 28.62  ? 280 PHE D CD1 1 
ATOM   3972  C CD2 . PHE B 1 261 ? -31.743 23.887  -32.435 1.00 26.44  ? 280 PHE D CD2 1 
ATOM   3973  C CE1 . PHE B 1 261 ? -31.914 21.694  -34.090 1.00 28.25  ? 280 PHE D CE1 1 
ATOM   3974  C CE2 . PHE B 1 261 ? -30.751 23.635  -33.390 1.00 25.99  ? 280 PHE D CE2 1 
ATOM   3975  C CZ  . PHE B 1 261 ? -30.839 22.537  -34.199 1.00 26.90  ? 280 PHE D CZ  1 
ATOM   3976  N N   . LEU B 1 262 ? -35.159 25.493  -29.260 1.00 29.17  ? 281 LEU D N   1 
ATOM   3977  C CA  . LEU B 1 262 ? -36.254 25.954  -28.431 1.00 32.31  ? 281 LEU D CA  1 
ATOM   3978  C C   . LEU B 1 262 ? -37.153 26.924  -29.128 1.00 32.26  ? 281 LEU D C   1 
ATOM   3979  O O   . LEU B 1 262 ? -36.717 27.613  -30.023 1.00 31.28  ? 281 LEU D O   1 
ATOM   3980  C CB  . LEU B 1 262 ? -35.755 26.568  -27.104 1.00 33.12  ? 281 LEU D CB  1 
ATOM   3981  C CG  . LEU B 1 262 ? -34.648 27.600  -26.809 1.00 32.42  ? 281 LEU D CG  1 
ATOM   3982  C CD1 . LEU B 1 262 ? -34.221 28.442  -27.965 1.00 30.71  ? 281 LEU D CD1 1 
ATOM   3983  C CD2 . LEU B 1 262 ? -35.173 28.489  -25.694 1.00 34.20  ? 281 LEU D CD2 1 
ATOM   3984  N N   . SER B 1 263 ? -38.412 26.985  -28.701 1.00 34.03  ? 282 SER D N   1 
ATOM   3985  C CA  . SER B 1 263 ? -39.382 27.921  -29.281 1.00 35.11  ? 282 SER D CA  1 
ATOM   3986  C C   . SER B 1 263 ? -39.322 29.286  -28.622 1.00 35.44  ? 282 SER D C   1 
ATOM   3987  O O   . SER B 1 263 ? -38.738 29.449  -27.547 1.00 35.34  ? 282 SER D O   1 
ATOM   3988  C CB  . SER B 1 263 ? -40.811 27.395  -29.126 1.00 37.70  ? 282 SER D CB  1 
ATOM   3989  O OG  . SER B 1 263 ? -41.296 27.606  -27.799 1.00 39.27  ? 282 SER D OG  1 
ATOM   3990  N N   . ALA B 1 264 ? -39.959 30.257  -29.267 1.00 36.44  ? 283 ALA D N   1 
ATOM   3991  C CA  . ALA B 1 264 ? -40.197 31.554  -28.653 1.00 37.80  ? 283 ALA D CA  1 
ATOM   3992  C C   . ALA B 1 264 ? -41.096 31.387  -27.430 1.00 40.31  ? 283 ALA D C   1 
ATOM   3993  O O   . ALA B 1 264 ? -41.660 30.320  -27.200 1.00 40.94  ? 283 ALA D O   1 
ATOM   3994  C CB  . ALA B 1 264 ? -40.835 32.488  -29.635 1.00 38.64  ? 283 ALA D CB  1 
ATOM   3995  N N   . TRP B 1 265 ? -41.217 32.439  -26.635 1.00 42.23  ? 284 TRP D N   1 
ATOM   3996  C CA  . TRP B 1 265 ? -42.216 32.449  -25.587 1.00 45.50  ? 284 TRP D CA  1 
ATOM   3997  C C   . TRP B 1 265 ? -43.598 32.641  -26.210 1.00 48.36  ? 284 TRP D C   1 
ATOM   3998  O O   . TRP B 1 265 ? -43.790 33.473  -27.093 1.00 48.42  ? 284 TRP D O   1 
ATOM   3999  C CB  . TRP B 1 265 ? -41.935 33.559  -24.569 1.00 47.02  ? 284 TRP D CB  1 
ATOM   4000  C CG  . TRP B 1 265 ? -40.836 33.226  -23.633 1.00 46.32  ? 284 TRP D CG  1 
ATOM   4001  C CD1 . TRP B 1 265 ? -39.596 33.765  -23.607 1.00 45.12  ? 284 TRP D CD1 1 
ATOM   4002  C CD2 . TRP B 1 265 ? -40.874 32.255  -22.585 1.00 47.37  ? 284 TRP D CD2 1 
ATOM   4003  N NE1 . TRP B 1 265 ? -38.852 33.194  -22.610 1.00 45.27  ? 284 TRP D NE1 1 
ATOM   4004  C CE2 . TRP B 1 265 ? -39.618 32.263  -21.966 1.00 46.70  ? 284 TRP D CE2 1 
ATOM   4005  C CE3 . TRP B 1 265 ? -41.858 31.388  -22.104 1.00 49.24  ? 284 TRP D CE3 1 
ATOM   4006  C CZ2 . TRP B 1 265 ? -39.312 31.442  -20.894 1.00 48.02  ? 284 TRP D CZ2 1 
ATOM   4007  C CZ3 . TRP B 1 265 ? -41.554 30.572  -21.040 1.00 50.25  ? 284 TRP D CZ3 1 
ATOM   4008  C CH2 . TRP B 1 265 ? -40.290 30.603  -20.444 1.00 49.72  ? 284 TRP D CH2 1 
ATOM   4009  N N   . SER B 1 266 ? -44.553 31.854  -25.741 1.00 51.28  ? 285 SER D N   1 
ATOM   4010  C CA  . SER B 1 266 ? -45.944 32.004  -26.143 1.00 55.39  ? 285 SER D CA  1 
ATOM   4011  C C   . SER B 1 266 ? -46.472 33.376  -25.739 1.00 59.60  ? 285 SER D C   1 
ATOM   4012  O O   . SER B 1 266 ? -46.075 33.921  -24.710 1.00 60.26  ? 285 SER D O   1 
ATOM   4013  C CB  . SER B 1 266 ? -46.791 30.943  -25.450 1.00 56.78  ? 285 SER D CB  1 
ATOM   4014  O OG  . SER B 1 266 ? -46.942 31.282  -24.094 1.00 58.30  ? 285 SER D OG  1 
ATOM   4015  N N   . THR B 1 267 ? -47.366 33.926  -26.552 1.00 63.01  ? 286 THR D N   1 
ATOM   4016  C CA  . THR B 1 267 ? -48.031 35.180  -26.212 1.00 67.50  ? 286 THR D CA  1 
ATOM   4017  C C   . THR B 1 267 ? -48.757 35.090  -24.851 1.00 71.07  ? 286 THR D C   1 
ATOM   4018  O O   . THR B 1 267 ? -49.474 34.121  -24.575 1.00 72.19  ? 286 THR D O   1 
ATOM   4019  C CB  . THR B 1 267 ? -48.993 35.666  -27.355 1.00 72.10  ? 286 THR D CB  1 
ATOM   4020  O OG1 . THR B 1 267 ? -50.128 34.793  -27.468 1.00 74.07  ? 286 THR D OG1 1 
ATOM   4021  C CG2 . THR B 1 267 ? -48.250 35.709  -28.689 1.00 69.72  ? 286 THR D CG2 1 
ATOM   4022  N N   . PRO B 1 268 ? -48.532 36.091  -23.988 1.00 73.13  ? 287 PRO D N   1 
ATOM   4023  C CA  . PRO B 1 268 ? -49.136 36.190  -22.659 1.00 76.81  ? 287 PRO D CA  1 
ATOM   4024  C C   . PRO B 1 268 ? -50.628 35.913  -22.689 1.00 81.63  ? 287 PRO D C   1 
ATOM   4025  O O   . PRO B 1 268 ? -51.406 36.810  -23.035 1.00 84.84  ? 287 PRO D O   1 
ATOM   4026  C CB  . PRO B 1 268 ? -48.894 37.652  -22.287 1.00 78.51  ? 287 PRO D CB  1 
ATOM   4027  C CG  . PRO B 1 268 ? -47.616 37.974  -22.944 1.00 74.91  ? 287 PRO D CG  1 
ATOM   4028  C CD  . PRO B 1 268 ? -47.592 37.196  -24.240 1.00 72.17  ? 287 PRO D CD  1 
ATOM   4029  N N   . GLN B 1 269 ? -51.020 34.689  -22.343 1.00 82.86  ? 288 GLN D N   1 
ATOM   4030  C CA  . GLN B 1 269 ? -52.434 34.340  -22.254 1.00 88.27  ? 288 GLN D CA  1 
ATOM   4031  C C   . GLN B 1 269 ? -53.037 34.827  -20.941 1.00 93.99  ? 288 GLN D C   1 
ATOM   4032  O O   . GLN B 1 269 ? -52.505 34.537  -19.863 1.00 93.68  ? 288 GLN D O   1 
ATOM   4033  C CB  . GLN B 1 269 ? -52.638 32.834  -22.397 1.00 86.75  ? 288 GLN D CB  1 
ATOM   4034  C CG  . GLN B 1 269 ? -52.372 32.318  -23.789 1.00 84.12  ? 288 GLN D CG  1 
ATOM   4035  C CD  . GLN B 1 269 ? -52.800 30.875  -23.969 1.00 84.08  ? 288 GLN D CD  1 
ATOM   4036  O OE1 . GLN B 1 269 ? -52.124 30.094  -24.643 1.00 81.17  ? 288 GLN D OE1 1 
ATOM   4037  N NE2 . GLN B 1 269 ? -53.929 30.515  -23.375 1.00 87.66  ? 288 GLN D NE2 1 
ATOM   4038  N N   . ARG B 1 270 ? -54.154 35.557  -21.045 1.00 99.37  ? 289 ARG D N   1 
ATOM   4039  C CA  . ARG B 1 270 ? -54.832 36.165  -19.892 1.00 104.46 ? 289 ARG D CA  1 
ATOM   4040  C C   . ARG B 1 270 ? -56.017 35.332  -19.400 1.00 108.47 ? 289 ARG D C   1 
ATOM   4041  O O   . ARG B 1 270 ? -57.127 35.449  -19.926 1.00 111.87 ? 289 ARG D O   1 
ATOM   4042  C CB  . ARG B 1 270 ? -55.308 37.584  -20.240 1.00 107.75 ? 289 ARG D CB  1 
ATOM   4043  C CG  . ARG B 1 270 ? -54.346 38.367  -21.145 1.00 104.45 ? 289 ARG D CG  1 
ATOM   4044  C CD  . ARG B 1 270 ? -54.754 39.841  -21.304 1.00 107.72 ? 289 ARG D CD  1 
ATOM   4045  N NE  . ARG B 1 270 ? -53.764 40.598  -22.079 1.00 104.20 ? 289 ARG D NE  1 
ATOM   4046  C CZ  . ARG B 1 270 ? -53.761 41.925  -22.210 1.00 105.80 ? 289 ARG D CZ  1 
ATOM   4047  N NH1 . ARG B 1 270 ? -54.702 42.656  -21.612 1.00 110.79 ? 289 ARG D NH1 1 
ATOM   4048  N NH2 . ARG B 1 270 ? -52.812 42.520  -22.935 1.00 102.89 ? 289 ARG D NH2 1 
ATOM   4049  N N   . PHE B 1 271 ? -55.779 34.493  -18.394 1.00 108.50 ? 290 PHE D N   1 
ATOM   4050  C CA  . PHE B 1 271 ? -56.843 33.671  -17.820 1.00 111.54 ? 290 PHE D CA  1 
ATOM   4051  C C   . PHE B 1 271 ? -57.523 34.387  -16.658 1.00 116.44 ? 290 PHE D C   1 
ATOM   4052  O O   . PHE B 1 271 ? -57.464 33.931  -15.518 1.00 117.62 ? 290 PHE D O   1 
ATOM   4053  C CB  . PHE B 1 271 ? -56.308 32.315  -17.349 1.00 108.70 ? 290 PHE D CB  1 
ATOM   4054  C CG  . PHE B 1 271 ? -56.218 31.278  -18.438 1.00 105.65 ? 290 PHE D CG  1 
ATOM   4055  C CD1 . PHE B 1 271 ? -57.307 30.476  -18.742 1.00 87.03  ? 290 PHE D CD1 1 
ATOM   4056  C CD2 . PHE B 1 271 ? -55.038 31.091  -19.148 1.00 79.56  ? 290 PHE D CD2 1 
ATOM   4057  C CE1 . PHE B 1 271 ? -57.228 29.513  -19.736 1.00 84.82  ? 290 PHE D CE1 1 
ATOM   4058  C CE2 . PHE B 1 271 ? -54.960 30.133  -20.136 1.00 77.31  ? 290 PHE D CE2 1 
ATOM   4059  C CZ  . PHE B 1 271 ? -56.054 29.344  -20.430 1.00 79.98  ? 290 PHE D CZ  1 
ATOM   4060  N N   . GLU C 2 1   ? 20.528  14.762  -32.023 1.00 87.37  ? 1   GLU A N   1 
ATOM   4061  C CA  . GLU C 2 1   ? 19.110  14.406  -32.092 1.00 84.54  ? 1   GLU A CA  1 
ATOM   4062  C C   . GLU C 2 1   ? 18.205  15.608  -32.387 1.00 81.36  ? 1   GLU A C   1 
ATOM   4063  O O   . GLU C 2 1   ? 18.656  16.757  -32.332 1.00 80.86  ? 1   GLU A O   1 
ATOM   4064  C CB  . GLU C 2 1   ? 18.663  13.750  -30.788 1.00 82.86  ? 1   GLU A CB  1 
ATOM   4065  C CG  . GLU C 2 1   ? 18.214  14.737  -29.720 1.00 78.84  ? 1   GLU A CG  1 
ATOM   4066  C CD  . GLU C 2 1   ? 17.646  14.039  -28.504 1.00 77.41  ? 1   GLU A CD  1 
ATOM   4067  O OE1 . GLU C 2 1   ? 17.948  12.839  -28.318 1.00 79.80  ? 1   GLU A OE1 1 
ATOM   4068  O OE2 . GLU C 2 1   ? 16.894  14.683  -27.740 1.00 74.18  ? 1   GLU A OE2 1 
ATOM   4069  N N   . VAL C 2 2   ? 16.928  15.321  -32.674 1.00 79.36  ? 2   VAL A N   1 
ATOM   4070  C CA  . VAL C 2 2   ? 15.926  16.324  -33.087 1.00 76.19  ? 2   VAL A CA  1 
ATOM   4071  C C   . VAL C 2 2   ? 15.640  17.421  -32.050 1.00 73.32  ? 2   VAL A C   1 
ATOM   4072  O O   . VAL C 2 2   ? 15.220  17.138  -30.929 1.00 63.08  ? 2   VAL A O   1 
ATOM   4073  C CB  . VAL C 2 2   ? 14.583  15.663  -33.458 1.00 74.50  ? 2   VAL A CB  1 
ATOM   4074  C CG1 . VAL C 2 2   ? 13.605  16.708  -34.003 1.00 71.70  ? 2   VAL A CG1 1 
ATOM   4075  C CG2 . VAL C 2 2   ? 14.798  14.544  -34.453 1.00 77.38  ? 2   VAL A CG2 1 
ATOM   4076  N N   . GLN C 2 3   ? 15.847  18.672  -32.451 1.00 63.83  ? 3   GLN A N   1 
ATOM   4077  C CA  . GLN C 2 3   ? 15.808  19.791  -31.527 1.00 65.95  ? 3   GLN A CA  1 
ATOM   4078  C C   . GLN C 2 3   ? 15.435  21.087  -32.211 1.00 64.42  ? 3   GLN A C   1 
ATOM   4079  O O   . GLN C 2 3   ? 16.151  21.557  -33.088 1.00 62.23  ? 3   GLN A O   1 
ATOM   4080  C CB  . GLN C 2 3   ? 17.160  19.978  -30.849 1.00 68.04  ? 3   GLN A CB  1 
ATOM   4081  C CG  . GLN C 2 3   ? 17.408  19.071  -29.655 1.00 68.71  ? 3   GLN A CG  1 
ATOM   4082  C CD  . GLN C 2 3   ? 18.401  19.678  -28.692 1.00 69.23  ? 3   GLN A CD  1 
ATOM   4083  O OE1 . GLN C 2 3   ? 19.414  19.061  -28.348 1.00 71.66  ? 3   GLN A OE1 1 
ATOM   4084  N NE2 . GLN C 2 3   ? 18.115  20.905  -28.251 1.00 66.90  ? 3   GLN A NE2 1 
ATOM   4085  N N   . LEU C 2 4   ? 14.319  21.667  -31.774 1.00 60.86  ? 4   LEU A N   1 
ATOM   4086  C CA  . LEU C 2 4   ? 13.835  22.937  -32.285 1.00 59.10  ? 4   LEU A CA  1 
ATOM   4087  C C   . LEU C 2 4   ? 14.154  24.019  -31.267 1.00 57.87  ? 4   LEU A C   1 
ATOM   4088  O O   . LEU C 2 4   ? 13.818  23.869  -30.094 1.00 56.37  ? 4   LEU A O   1 
ATOM   4089  C CB  . LEU C 2 4   ? 12.324  22.870  -32.503 1.00 56.57  ? 4   LEU A CB  1 
ATOM   4090  C CG  . LEU C 2 4   ? 11.752  22.168  -33.743 1.00 57.16  ? 4   LEU A CG  1 
ATOM   4091  C CD1 . LEU C 2 4   ? 11.911  20.661  -33.693 1.00 58.55  ? 4   LEU A CD1 1 
ATOM   4092  C CD2 . LEU C 2 4   ? 10.289  22.520  -33.900 1.00 54.55  ? 4   LEU A CD2 1 
ATOM   4093  N N   . VAL C 2 5   ? 14.798  25.102  -31.700 1.00 58.52  ? 5   VAL A N   1 
ATOM   4094  C CA  . VAL C 2 5   ? 15.224  26.156  -30.774 1.00 57.12  ? 5   VAL A CA  1 
ATOM   4095  C C   . VAL C 2 5   ? 14.727  27.542  -31.176 1.00 56.89  ? 5   VAL A C   1 
ATOM   4096  O O   . VAL C 2 5   ? 15.042  28.035  -32.263 1.00 58.98  ? 5   VAL A O   1 
ATOM   4097  C CB  . VAL C 2 5   ? 16.762  26.204  -30.626 1.00 59.56  ? 5   VAL A CB  1 
ATOM   4098  C CG1 . VAL C 2 5   ? 17.171  27.305  -29.670 1.00 56.89  ? 5   VAL A CG1 1 
ATOM   4099  C CG2 . VAL C 2 5   ? 17.296  24.866  -30.150 1.00 58.99  ? 5   VAL A CG2 1 
ATOM   4100  N N   . GLN C 2 6   ? 13.977  28.175  -30.274 1.00 54.66  ? 6   GLN A N   1 
ATOM   4101  C CA  . GLN C 2 6   ? 13.291  29.430  -30.563 1.00 50.19  ? 6   GLN A CA  1 
ATOM   4102  C C   . GLN C 2 6   ? 13.965  30.652  -29.963 1.00 50.49  ? 6   GLN A C   1 
ATOM   4103  O O   . GLN C 2 6   ? 14.754  30.536  -29.031 1.00 50.89  ? 6   GLN A O   1 
ATOM   4104  C CB  . GLN C 2 6   ? 11.849  29.371  -30.054 1.00 47.43  ? 6   GLN A CB  1 
ATOM   4105  C CG  . GLN C 2 6   ? 10.961  28.394  -30.804 1.00 48.59  ? 6   GLN A CG  1 
ATOM   4106  C CD  . GLN C 2 6   ? 9.537   28.427  -30.319 1.00 45.87  ? 6   GLN A CD  1 
ATOM   4107  O OE1 . GLN C 2 6   ? 9.102   27.539  -29.586 1.00 44.23  ? 6   GLN A OE1 1 
ATOM   4108  N NE2 . GLN C 2 6   ? 8.797   29.461  -30.720 1.00 45.10  ? 6   GLN A NE2 1 
ATOM   4109  N N   . SER C 2 7   ? 13.626  31.821  -30.503 1.00 50.43  ? 7   SER A N   1 
ATOM   4110  C CA  . SER C 2 7   ? 14.142  33.100  -30.020 1.00 50.80  ? 7   SER A CA  1 
ATOM   4111  C C   . SER C 2 7   ? 13.719  33.404  -28.565 1.00 52.71  ? 7   SER A C   1 
ATOM   4112  O O   . SER C 2 7   ? 12.883  32.701  -27.979 1.00 50.87  ? 7   SER A O   1 
ATOM   4113  C CB  . SER C 2 7   ? 13.788  34.246  -31.002 1.00 51.51  ? 7   SER A CB  1 
ATOM   4114  O OG  . SER C 2 7   ? 12.581  34.941  -30.695 1.00 49.45  ? 7   SER A OG  1 
ATOM   4115  N N   . GLY C 2 8   ? 14.316  34.439  -27.981 1.00 49.13  ? 8   GLY A N   1 
ATOM   4116  C CA  . GLY C 2 8   ? 14.058  34.796  -26.600 1.00 47.48  ? 8   GLY A CA  1 
ATOM   4117  C C   . GLY C 2 8   ? 12.756  35.532  -26.414 1.00 45.58  ? 8   GLY A C   1 
ATOM   4118  O O   . GLY C 2 8   ? 12.065  35.853  -27.378 1.00 45.57  ? 8   GLY A O   1 
ATOM   4119  N N   . ALA C 2 9   ? 12.419  35.803  -25.160 1.00 51.48  ? 9   ALA A N   1 
ATOM   4120  C CA  . ALA C 2 9   ? 11.159  36.452  -24.835 1.00 42.45  ? 9   ALA A CA  1 
ATOM   4121  C C   . ALA C 2 9   ? 11.126  37.858  -25.391 1.00 52.00  ? 9   ALA A C   1 
ATOM   4122  O O   . ALA C 2 9   ? 12.151  38.481  -25.563 1.00 45.08  ? 9   ALA A O   1 
ATOM   4123  C CB  . ALA C 2 9   ? 10.919  36.461  -23.336 1.00 41.13  ? 9   ALA A CB  1 
ATOM   4124  N N   . GLU C 2 10  ? 9.928   38.339  -25.689 1.00 51.05  ? 10  GLU A N   1 
ATOM   4125  C CA  . GLU C 2 10  ? 9.742   39.680  -26.201 1.00 52.32  ? 10  GLU A CA  1 
ATOM   4126  C C   . GLU C 2 10  ? 8.794   40.437  -25.282 1.00 51.02  ? 10  GLU A C   1 
ATOM   4127  O O   . GLU C 2 10  ? 7.871   39.855  -24.693 1.00 49.34  ? 10  GLU A O   1 
ATOM   4128  C CB  . GLU C 2 10  ? 9.181   39.636  -27.627 1.00 53.41  ? 10  GLU A CB  1 
ATOM   4129  C CG  . GLU C 2 10  ? 10.036  38.864  -28.635 1.00 55.12  ? 10  GLU A CG  1 
ATOM   4130  C CD  . GLU C 2 10  ? 11.252  39.648  -29.146 1.00 58.01  ? 10  GLU A CD  1 
ATOM   4131  O OE1 . GLU C 2 10  ? 11.328  40.888  -28.939 1.00 58.84  ? 10  GLU A OE1 1 
ATOM   4132  O OE2 . GLU C 2 10  ? 12.143  39.014  -29.764 1.00 59.62  ? 10  GLU A OE2 1 
ATOM   4133  N N   . VAL C 2 11  ? 9.063   41.729  -25.132 1.00 51.90  ? 11  VAL A N   1 
ATOM   4134  C CA  . VAL C 2 11  ? 8.133   42.654  -24.501 1.00 50.87  ? 11  VAL A CA  1 
ATOM   4135  C C   . VAL C 2 11  ? 7.991   43.843  -25.432 1.00 44.38  ? 11  VAL A C   1 
ATOM   4136  O O   . VAL C 2 11  ? 8.915   44.646  -25.607 1.00 47.33  ? 11  VAL A O   1 
ATOM   4137  C CB  . VAL C 2 11  ? 8.627   43.152  -23.141 1.00 42.47  ? 11  VAL A CB  1 
ATOM   4138  C CG1 . VAL C 2 11  ? 7.605   44.091  -22.535 1.00 42.04  ? 11  VAL A CG1 1 
ATOM   4139  C CG2 . VAL C 2 11  ? 8.947   41.985  -22.221 1.00 41.17  ? 11  VAL A CG2 1 
ATOM   4140  N N   . LYS C 2 12  ? 6.837   43.949  -26.060 1.00 44.04  ? 12  LYS A N   1 
ATOM   4141  C CA  . LYS C 2 12  ? 6.668   44.959  -27.079 1.00 45.95  ? 12  LYS A CA  1 
ATOM   4142  C C   . LYS C 2 12  ? 5.599   45.940  -26.652 1.00 45.88  ? 12  LYS A C   1 
ATOM   4143  O O   . LYS C 2 12  ? 4.987   45.770  -25.596 1.00 44.30  ? 12  LYS A O   1 
ATOM   4144  C CB  . LYS C 2 12  ? 6.342   44.299  -28.413 1.00 46.26  ? 12  LYS A CB  1 
ATOM   4145  C CG  . LYS C 2 12  ? 7.519   43.545  -29.014 1.00 47.14  ? 12  LYS A CG  1 
ATOM   4146  C CD  . LYS C 2 12  ? 8.640   44.510  -29.373 1.00 56.61  ? 12  LYS A CD  1 
ATOM   4147  C CE  . LYS C 2 12  ? 9.683   43.893  -30.282 1.00 51.28  ? 12  LYS A CE  1 
ATOM   4148  N NZ  . LYS C 2 12  ? 10.680  44.920  -30.652 1.00 54.09  ? 12  LYS A NZ  1 
ATOM   4149  N N   . LYS C 2 13  ? 5.421   46.989  -27.450 1.00 47.89  ? 13  LYS A N   1 
ATOM   4150  C CA  . LYS C 2 13  ? 4.309   47.914  -27.285 1.00 48.72  ? 13  LYS A CA  1 
ATOM   4151  C C   . LYS C 2 13  ? 3.298   47.706  -28.406 1.00 48.49  ? 13  LYS A C   1 
ATOM   4152  O O   . LYS C 2 13  ? 3.669   47.321  -29.507 1.00 49.33  ? 13  LYS A O   1 
ATOM   4153  C CB  . LYS C 2 13  ? 4.812   49.356  -27.260 1.00 50.74  ? 13  LYS A CB  1 
ATOM   4154  C CG  . LYS C 2 13  ? 5.285   49.785  -25.889 1.00 50.33  ? 13  LYS A CG  1 
ATOM   4155  C CD  . LYS C 2 13  ? 6.210   50.964  -25.964 1.00 52.91  ? 13  LYS A CD  1 
ATOM   4156  C CE  . LYS C 2 13  ? 6.932   51.167  -24.653 1.00 52.43  ? 13  LYS A CE  1 
ATOM   4157  N NZ  . LYS C 2 13  ? 5.965   51.432  -23.561 1.00 54.03  ? 13  LYS A NZ  1 
ATOM   4158  N N   . PRO C 2 14  ? 2.008   47.921  -28.121 1.00 47.83  ? 14  PRO A N   1 
ATOM   4159  C CA  . PRO C 2 14  ? 1.019   47.826  -29.195 1.00 51.17  ? 14  PRO A CA  1 
ATOM   4160  C C   . PRO C 2 14  ? 1.430   48.694  -30.376 1.00 54.01  ? 14  PRO A C   1 
ATOM   4161  O O   . PRO C 2 14  ? 1.733   49.872  -30.190 1.00 56.08  ? 14  PRO A O   1 
ATOM   4162  C CB  . PRO C 2 14  ? -0.241  48.385  -28.552 1.00 48.06  ? 14  PRO A CB  1 
ATOM   4163  C CG  . PRO C 2 14  ? -0.085  48.097  -27.115 1.00 46.34  ? 14  PRO A CG  1 
ATOM   4164  C CD  . PRO C 2 14  ? 1.385   48.199  -26.820 1.00 46.75  ? 14  PRO A CD  1 
ATOM   4165  N N   . GLY C 2 15  ? 1.484   48.102  -31.566 1.00 54.27  ? 15  GLY A N   1 
ATOM   4166  C CA  . GLY C 2 15  ? 1.822   48.834  -32.768 1.00 57.04  ? 15  GLY A CA  1 
ATOM   4167  C C   . GLY C 2 15  ? 3.160   48.439  -33.353 1.00 58.03  ? 15  GLY A C   1 
ATOM   4168  O O   . GLY C 2 15  ? 3.365   48.532  -34.570 1.00 60.24  ? 15  GLY A O   1 
ATOM   4169  N N   . GLU C 2 16  ? 4.076   48.008  -32.490 1.00 56.65  ? 16  GLU A N   1 
ATOM   4170  C CA  . GLU C 2 16  ? 5.401   47.588  -32.933 1.00 57.60  ? 16  GLU A CA  1 
ATOM   4171  C C   . GLU C 2 16  ? 5.315   46.299  -33.733 1.00 56.61  ? 16  GLU A C   1 
ATOM   4172  O O   . GLU C 2 16  ? 4.374   45.520  -33.576 1.00 54.51  ? 16  GLU A O   1 
ATOM   4173  C CB  . GLU C 2 16  ? 6.344   47.413  -31.742 1.00 54.25  ? 16  GLU A CB  1 
ATOM   4174  C CG  . GLU C 2 16  ? 6.264   48.556  -30.764 1.00 56.28  ? 16  GLU A CG  1 
ATOM   4175  C CD  . GLU C 2 16  ? 7.541   48.777  -29.994 1.00 56.76  ? 16  GLU A CD  1 
ATOM   4176  O OE1 . GLU C 2 16  ? 7.980   47.853  -29.278 1.00 54.87  ? 16  GLU A OE1 1 
ATOM   4177  O OE2 . GLU C 2 16  ? 8.098   49.889  -30.108 1.00 59.27  ? 16  GLU A OE2 1 
ATOM   4178  N N   . SER C 2 17  ? 6.287   46.085  -34.612 1.00 58.36  ? 17  SER A N   1 
ATOM   4179  C CA  . SER C 2 17  ? 6.337   44.845  -35.361 1.00 57.80  ? 17  SER A CA  1 
ATOM   4180  C C   . SER C 2 17  ? 7.214   43.874  -34.600 1.00 56.44  ? 17  SER A C   1 
ATOM   4181  O O   . SER C 2 17  ? 7.900   44.262  -33.660 1.00 56.48  ? 17  SER A O   1 
ATOM   4182  C CB  . SER C 2 17  ? 6.852   45.067  -36.790 1.00 60.89  ? 17  SER A CB  1 
ATOM   4183  O OG  . SER C 2 17  ? 8.187   45.529  -36.815 1.00 63.12  ? 17  SER A OG  1 
ATOM   4184  N N   . LEU C 2 18  ? 7.179   42.609  -34.996 1.00 55.55  ? 18  LEU A N   1 
ATOM   4185  C CA  . LEU C 2 18  ? 7.957   41.587  -34.318 1.00 54.43  ? 18  LEU A CA  1 
ATOM   4186  C C   . LEU C 2 18  ? 8.156   40.370  -35.209 1.00 54.53  ? 18  LEU A C   1 
ATOM   4187  O O   . LEU C 2 18  ? 7.222   39.908  -35.861 1.00 51.87  ? 18  LEU A O   1 
ATOM   4188  C CB  . LEU C 2 18  ? 7.253   41.181  -33.031 1.00 51.72  ? 18  LEU A CB  1 
ATOM   4189  C CG  . LEU C 2 18  ? 7.980   40.169  -32.163 1.00 50.66  ? 18  LEU A CG  1 
ATOM   4190  C CD1 . LEU C 2 18  ? 9.408   40.610  -31.984 1.00 52.37  ? 18  LEU A CD1 1 
ATOM   4191  C CD2 . LEU C 2 18  ? 7.258   40.061  -30.824 1.00 48.24  ? 18  LEU A CD2 1 
ATOM   4192  N N   . LYS C 2 19  ? 9.383   39.865  -35.264 1.00 55.37  ? 19  LYS A N   1 
ATOM   4193  C CA  . LYS C 2 19  ? 9.617   38.612  -35.965 1.00 55.37  ? 19  LYS A CA  1 
ATOM   4194  C C   . LYS C 2 19  ? 10.341  37.649  -35.059 1.00 54.23  ? 19  LYS A C   1 
ATOM   4195  O O   . LYS C 2 19  ? 11.541  37.770  -34.873 1.00 55.92  ? 19  LYS A O   1 
ATOM   4196  C CB  . LYS C 2 19  ? 10.407  38.809  -37.263 1.00 58.46  ? 19  LYS A CB  1 
ATOM   4197  C CG  . LYS C 2 19  ? 10.174  37.684  -38.274 1.00 58.75  ? 19  LYS A CG  1 
ATOM   4198  C CD  . LYS C 2 19  ? 11.188  37.675  -39.397 1.00 62.01  ? 19  LYS A CD  1 
ATOM   4199  C CE  . LYS C 2 19  ? 11.294  39.015  -40.093 1.00 64.37  ? 19  LYS A CE  1 
ATOM   4200  N NZ  . LYS C 2 19  ? 12.589  39.108  -40.848 1.00 67.97  ? 19  LYS A NZ  1 
ATOM   4201  N N   . ILE C 2 20  ? 9.618   36.701  -34.481 1.00 51.57  ? 20  ILE A N   1 
ATOM   4202  C CA  . ILE C 2 20  ? 10.277  35.677  -33.689 1.00 50.68  ? 20  ILE A CA  1 
ATOM   4203  C C   . ILE C 2 20  ? 10.720  34.526  -34.594 1.00 52.14  ? 20  ILE A C   1 
ATOM   4204  O O   . ILE C 2 20  ? 10.153  34.320  -35.665 1.00 52.78  ? 20  ILE A O   1 
ATOM   4205  C CB  . ILE C 2 20  ? 9.376   35.167  -32.560 1.00 47.42  ? 20  ILE A CB  1 
ATOM   4206  C CG1 . ILE C 2 20  ? 8.416   34.111  -33.090 1.00 46.23  ? 20  ILE A CG1 1 
ATOM   4207  C CG2 . ILE C 2 20  ? 8.662   36.328  -31.894 1.00 46.10  ? 20  ILE A CG2 1 
ATOM   4208  C CD1 . ILE C 2 20  ? 7.313   33.786  -32.140 1.00 43.70  ? 20  ILE A CD1 1 
ATOM   4209  N N   . SER C 2 21  ? 11.749  33.793  -34.176 1.00 52.87  ? 21  SER A N   1 
ATOM   4210  C CA  . SER C 2 21  ? 12.292  32.715  -35.006 1.00 54.65  ? 21  SER A CA  1 
ATOM   4211  C C   . SER C 2 21  ? 12.351  31.383  -34.272 1.00 53.50  ? 21  SER A C   1 
ATOM   4212  O O   . SER C 2 21  ? 12.289  31.330  -33.047 1.00 51.92  ? 21  SER A O   1 
ATOM   4213  C CB  . SER C 2 21  ? 13.688  33.075  -35.534 1.00 57.87  ? 21  SER A CB  1 
ATOM   4214  O OG  . SER C 2 21  ? 14.662  32.988  -34.515 1.00 57.23  ? 21  SER A OG  1 
ATOM   4215  N N   . CYS C 2 22  ? 12.463  30.312  -35.044 1.00 54.58  ? 22  CYS A N   1 
ATOM   4216  C CA  . CYS C 2 22  ? 12.642  28.973  -34.514 1.00 54.56  ? 22  CYS A CA  1 
ATOM   4217  C C   . CYS C 2 22  ? 13.576  28.229  -35.457 1.00 58.19  ? 22  CYS A C   1 
ATOM   4218  O O   . CYS C 2 22  ? 13.302  28.158  -36.653 1.00 59.68  ? 22  CYS A O   1 
ATOM   4219  C CB  . CYS C 2 22  ? 11.301  28.260  -34.474 1.00 52.33  ? 22  CYS A CB  1 
ATOM   4220  S SG  . CYS C 2 22  ? 11.426  26.478  -34.219 1.00 63.45  ? 22  CYS A SG  1 
ATOM   4221  N N   . LYS C 2 23  ? 14.686  27.685  -34.961 1.00 59.94  ? 23  LYS A N   1 
ATOM   4222  C CA  . LYS C 2 23  ? 15.603  26.990  -35.866 1.00 61.29  ? 23  LYS A CA  1 
ATOM   4223  C C   . LYS C 2 23  ? 15.604  25.498  -35.598 1.00 61.52  ? 23  LYS A C   1 
ATOM   4224  O O   . LYS C 2 23  ? 15.953  25.071  -34.510 1.00 61.04  ? 23  LYS A O   1 
ATOM   4225  C CB  . LYS C 2 23  ? 17.021  27.591  -35.807 1.00 64.22  ? 23  LYS A CB  1 
ATOM   4226  C CG  . LYS C 2 23  ? 18.107  26.792  -36.556 1.00 67.53  ? 23  LYS A CG  1 
ATOM   4227  C CD  . LYS C 2 23  ? 19.357  27.639  -36.862 1.00 70.57  ? 23  LYS A CD  1 
ATOM   4228  C CE  . LYS C 2 23  ? 20.648  26.817  -36.882 1.00 73.79  ? 23  LYS A CE  1 
ATOM   4229  N NZ  . LYS C 2 23  ? 20.554  25.558  -37.666 1.00 75.34  ? 23  LYS A NZ  1 
ATOM   4230  N N   . GLY C 2 24  ? 15.183  24.718  -36.591 1.00 62.36  ? 24  GLY A N   1 
ATOM   4231  C CA  . GLY C 2 24  ? 15.203  23.266  -36.501 1.00 63.10  ? 24  GLY A CA  1 
ATOM   4232  C C   . GLY C 2 24  ? 16.572  22.679  -36.829 1.00 72.38  ? 24  GLY A C   1 
ATOM   4233  O O   . GLY C 2 24  ? 17.280  23.203  -37.684 1.00 74.82  ? 24  GLY A O   1 
ATOM   4234  N N   . SER C 2 25  ? 16.954  21.604  -36.142 1.00 67.47  ? 25  SER A N   1 
ATOM   4235  C CA  . SER C 2 25  ? 18.192  20.886  -36.449 1.00 71.22  ? 25  SER A CA  1 
ATOM   4236  C C   . SER C 2 25  ? 18.081  19.393  -36.127 1.00 71.95  ? 25  SER A C   1 
ATOM   4237  O O   . SER C 2 25  ? 17.233  18.975  -35.356 1.00 69.54  ? 25  SER A O   1 
ATOM   4238  C CB  . SER C 2 25  ? 19.387  21.510  -35.727 1.00 72.47  ? 25  SER A CB  1 
ATOM   4239  O OG  . SER C 2 25  ? 19.322  21.291  -34.330 1.00 77.48  ? 25  SER A OG  1 
ATOM   4240  N N   . GLY C 2 26  ? 18.926  18.579  -36.740 1.00 75.55  ? 26  GLY A N   1 
ATOM   4241  C CA  . GLY C 2 26  ? 18.868  17.150  -36.504 1.00 76.74  ? 26  GLY A CA  1 
ATOM   4242  C C   . GLY C 2 26  ? 17.903  16.437  -37.427 1.00 76.50  ? 26  GLY A C   1 
ATOM   4243  O O   . GLY C 2 26  ? 17.517  15.297  -37.172 1.00 76.74  ? 26  GLY A O   1 
ATOM   4244  N N   . TYR C 2 27  ? 17.509  17.113  -38.502 1.00 76.19  ? 27  TYR A N   1 
ATOM   4245  C CA  . TYR C 2 27  ? 16.694  16.495  -39.540 1.00 79.62  ? 27  TYR A CA  1 
ATOM   4246  C C   . TYR C 2 27  ? 16.680  17.319  -40.830 1.00 80.27  ? 27  TYR A C   1 
ATOM   4247  O O   . TYR C 2 27  ? 17.077  18.487  -40.851 1.00 79.76  ? 27  TYR A O   1 
ATOM   4248  C CB  . TYR C 2 27  ? 15.269  16.271  -39.040 1.00 76.47  ? 27  TYR A CB  1 
ATOM   4249  C CG  . TYR C 2 27  ? 14.515  17.550  -38.756 1.00 73.73  ? 27  TYR A CG  1 
ATOM   4250  C CD1 . TYR C 2 27  ? 13.600  18.065  -39.680 1.00 72.78  ? 27  TYR A CD1 1 
ATOM   4251  C CD2 . TYR C 2 27  ? 14.718  18.248  -37.571 1.00 72.34  ? 27  TYR A CD2 1 
ATOM   4252  C CE1 . TYR C 2 27  ? 12.911  19.237  -39.429 1.00 70.25  ? 27  TYR A CE1 1 
ATOM   4253  C CE2 . TYR C 2 27  ? 14.027  19.421  -37.306 1.00 69.77  ? 27  TYR A CE2 1 
ATOM   4254  C CZ  . TYR C 2 27  ? 13.126  19.908  -38.238 1.00 68.81  ? 27  TYR A CZ  1 
ATOM   4255  O OH  . TYR C 2 27  ? 12.452  21.073  -37.971 1.00 66.45  ? 27  TYR A OH  1 
ATOM   4256  N N   . SER C 2 28  ? 16.230  16.693  -41.910 1.00 81.83  ? 28  SER A N   1 
ATOM   4257  C CA  . SER C 2 28  ? 16.042  17.392  -43.172 1.00 83.26  ? 28  SER A CA  1 
ATOM   4258  C C   . SER C 2 28  ? 14.838  18.337  -43.085 1.00 79.36  ? 28  SER A C   1 
ATOM   4259  O O   . SER C 2 28  ? 13.683  17.899  -43.001 1.00 77.39  ? 28  SER A O   1 
ATOM   4260  C CB  . SER C 2 28  ? 15.877  16.388  -44.315 1.00 86.55  ? 28  SER A CB  1 
ATOM   4261  O OG  . SER C 2 28  ? 15.061  15.301  -43.908 1.00 85.50  ? 28  SER A OG  1 
ATOM   4262  N N   . PHE C 2 29  ? 15.127  19.635  -43.107 1.00 79.19  ? 29  PHE A N   1 
ATOM   4263  C CA  . PHE C 2 29  ? 14.146  20.684  -42.829 1.00 77.69  ? 29  PHE A CA  1 
ATOM   4264  C C   . PHE C 2 29  ? 12.997  20.733  -43.835 1.00 76.17  ? 29  PHE A C   1 
ATOM   4265  O O   . PHE C 2 29  ? 11.955  21.319  -43.561 1.00 73.06  ? 29  PHE A O   1 
ATOM   4266  C CB  . PHE C 2 29  ? 14.869  22.035  -42.795 1.00 80.14  ? 29  PHE A CB  1 
ATOM   4267  C CG  . PHE C 2 29  ? 14.021  23.199  -42.325 1.00 75.87  ? 29  PHE A CG  1 
ATOM   4268  C CD1 . PHE C 2 29  ? 13.856  23.456  -40.971 1.00 72.83  ? 29  PHE A CD1 1 
ATOM   4269  C CD2 . PHE C 2 29  ? 13.447  24.071  -43.238 1.00 69.27  ? 29  PHE A CD2 1 
ATOM   4270  C CE1 . PHE C 2 29  ? 13.112  24.533  -40.545 1.00 64.05  ? 29  PHE A CE1 1 
ATOM   4271  C CE2 . PHE C 2 29  ? 12.703  25.148  -42.812 1.00 66.70  ? 29  PHE A CE2 1 
ATOM   4272  C CZ  . PHE C 2 29  ? 12.539  25.380  -41.464 1.00 64.09  ? 29  PHE A CZ  1 
ATOM   4273  N N   . THR C 2 30  ? 13.187  20.118  -44.997 1.00 78.76  ? 30  THR A N   1 
ATOM   4274  C CA  . THR C 2 30  ? 12.184  20.181  -46.049 1.00 73.47  ? 30  THR A CA  1 
ATOM   4275  C C   . THR C 2 30  ? 11.324  18.934  -46.128 1.00 74.81  ? 30  THR A C   1 
ATOM   4276  O O   . THR C 2 30  ? 10.424  18.863  -46.956 1.00 74.47  ? 30  THR A O   1 
ATOM   4277  C CB  . THR C 2 30  ? 12.826  20.405  -47.431 1.00 77.23  ? 30  THR A CB  1 
ATOM   4278  O OG1 . THR C 2 30  ? 13.826  19.403  -47.661 1.00 81.24  ? 30  THR A OG1 1 
ATOM   4279  C CG2 . THR C 2 30  ? 13.454  21.786  -47.513 1.00 78.05  ? 30  THR A CG2 1 
ATOM   4280  N N   . ASP C 2 31  ? 11.583  17.952  -45.276 1.00 74.70  ? 31  ASP A N   1 
ATOM   4281  C CA  . ASP C 2 31  ? 10.889  16.678  -45.418 1.00 74.92  ? 31  ASP A CA  1 
ATOM   4282  C C   . ASP C 2 31  ? 9.723   16.530  -44.449 1.00 71.15  ? 31  ASP A C   1 
ATOM   4283  O O   . ASP C 2 31  ? 9.050   15.496  -44.402 1.00 70.85  ? 31  ASP A O   1 
ATOM   4284  C CB  . ASP C 2 31  ? 11.865  15.505  -45.313 1.00 78.42  ? 31  ASP A CB  1 
ATOM   4285  C CG  . ASP C 2 31  ? 12.747  15.354  -46.562 1.00 82.86  ? 31  ASP A CG  1 
ATOM   4286  O OD1 . ASP C 2 31  ? 12.323  15.764  -47.669 1.00 83.46  ? 31  ASP A OD1 1 
ATOM   4287  O OD2 . ASP C 2 31  ? 13.868  14.818  -46.430 1.00 85.84  ? 31  ASP A OD2 1 
ATOM   4288  N N   . TYR C 2 32  ? 9.478   17.588  -43.692 1.00 68.51  ? 32  TYR A N   1 
ATOM   4289  C CA  . TYR C 2 32  ? 8.331   17.640  -42.819 1.00 62.73  ? 32  TYR A CA  1 
ATOM   4290  C C   . TYR C 2 32  ? 7.648   18.983  -42.948 1.00 63.90  ? 32  TYR A C   1 
ATOM   4291  O O   . TYR C 2 32  ? 8.116   19.869  -43.673 1.00 61.93  ? 32  TYR A O   1 
ATOM   4292  C CB  . TYR C 2 32  ? 8.754   17.448  -41.376 1.00 61.70  ? 32  TYR A CB  1 
ATOM   4293  C CG  . TYR C 2 32  ? 9.386   16.113  -41.090 1.00 67.83  ? 32  TYR A CG  1 
ATOM   4294  C CD1 . TYR C 2 32  ? 8.611   15.028  -40.696 1.00 63.06  ? 32  TYR A CD1 1 
ATOM   4295  C CD2 . TYR C 2 32  ? 10.770  15.939  -41.197 1.00 70.62  ? 32  TYR A CD2 1 
ATOM   4296  C CE1 . TYR C 2 32  ? 9.191   13.799  -40.425 1.00 68.84  ? 32  TYR A CE1 1 
ATOM   4297  C CE2 . TYR C 2 32  ? 11.364  14.716  -40.931 1.00 72.71  ? 32  TYR A CE2 1 
ATOM   4298  C CZ  . TYR C 2 32  ? 10.574  13.643  -40.544 1.00 71.91  ? 32  TYR A CZ  1 
ATOM   4299  O OH  . TYR C 2 32  ? 11.171  12.421  -40.279 1.00 70.70  ? 32  TYR A OH  1 
ATOM   4300  N N   . TYR C 2 33  ? 6.532   19.120  -42.230 1.00 60.76  ? 33  TYR A N   1 
ATOM   4301  C CA  . TYR C 2 33  ? 5.837   20.390  -42.115 1.00 55.62  ? 33  TYR A CA  1 
ATOM   4302  C C   . TYR C 2 33  ? 6.347   21.145  -40.897 1.00 54.35  ? 33  TYR A C   1 
ATOM   4303  O O   . TYR C 2 33  ? 6.790   20.537  -39.926 1.00 54.16  ? 33  TYR A O   1 
ATOM   4304  C CB  . TYR C 2 33  ? 4.358   20.150  -41.945 1.00 53.34  ? 33  TYR A CB  1 
ATOM   4305  C CG  . TYR C 2 33  ? 3.592   19.925  -43.205 1.00 54.05  ? 33  TYR A CG  1 
ATOM   4306  C CD1 . TYR C 2 33  ? 2.990   20.982  -43.854 1.00 53.55  ? 33  TYR A CD1 1 
ATOM   4307  C CD2 . TYR C 2 33  ? 3.425   18.651  -43.724 1.00 55.31  ? 33  TYR A CD2 1 
ATOM   4308  C CE1 . TYR C 2 33  ? 2.260   20.786  -44.990 1.00 54.27  ? 33  TYR A CE1 1 
ATOM   4309  C CE2 . TYR C 2 33  ? 2.703   18.444  -44.872 1.00 56.00  ? 33  TYR A CE2 1 
ATOM   4310  C CZ  . TYR C 2 33  ? 2.124   19.522  -45.499 1.00 55.44  ? 33  TYR A CZ  1 
ATOM   4311  O OH  . TYR C 2 33  ? 1.403   19.355  -46.649 1.00 56.24  ? 33  TYR A OH  1 
ATOM   4312  N N   . MET C 2 34  ? 6.298   22.469  -40.946 1.00 53.66  ? 34  MET A N   1 
ATOM   4313  C CA  . MET C 2 34  ? 6.531   23.245  -39.732 1.00 56.34  ? 34  MET A CA  1 
ATOM   4314  C C   . MET C 2 34  ? 5.214   23.886  -39.259 1.00 53.58  ? 34  MET A C   1 
ATOM   4315  O O   . MET C 2 34  ? 4.399   24.325  -40.085 1.00 49.15  ? 34  MET A O   1 
ATOM   4316  C CB  . MET C 2 34  ? 7.654   24.276  -39.904 1.00 53.62  ? 34  MET A CB  1 
ATOM   4317  C CG  . MET C 2 34  ? 9.045   23.657  -40.017 1.00 58.19  ? 34  MET A CG  1 
ATOM   4318  S SD  . MET C 2 34  ? 9.607   22.680  -38.596 1.00 64.52  ? 34  MET A SD  1 
ATOM   4319  C CE  . MET C 2 34  ? 9.977   23.985  -37.431 1.00 54.27  ? 34  MET A CE  1 
ATOM   4320  N N   . LYS C 2 35  ? 5.009   23.905  -37.937 1.00 47.50  ? 35  LYS A N   1 
ATOM   4321  C CA  . LYS C 2 35  ? 3.744   24.330  -37.343 1.00 45.09  ? 35  LYS A CA  1 
ATOM   4322  C C   . LYS C 2 35  ? 3.919   25.430  -36.297 1.00 45.34  ? 35  LYS A C   1 
ATOM   4323  O O   . LYS C 2 35  ? 4.990   25.587  -35.725 1.00 44.50  ? 35  LYS A O   1 
ATOM   4324  C CB  . LYS C 2 35  ? 3.052   23.123  -36.708 1.00 44.08  ? 35  LYS A CB  1 
ATOM   4325  C CG  . LYS C 2 35  ? 3.255   21.825  -37.474 1.00 45.74  ? 35  LYS A CG  1 
ATOM   4326  C CD  . LYS C 2 35  ? 2.684   20.631  -36.727 1.00 45.04  ? 35  LYS A CD  1 
ATOM   4327  C CE  . LYS C 2 35  ? 1.182   20.680  -36.672 1.00 43.28  ? 35  LYS A CE  1 
ATOM   4328  N NZ  . LYS C 2 35  ? 0.580   20.295  -37.971 1.00 49.91  ? 35  LYS A NZ  1 
ATOM   4329  N N   . TRP C 2 36  ? 2.857   26.196  -36.052 1.00 43.85  ? 36  TRP A N   1 
ATOM   4330  C CA  . TRP C 2 36  ? 2.829   27.139  -34.928 1.00 40.92  ? 36  TRP A CA  1 
ATOM   4331  C C   . TRP C 2 36  ? 1.539   27.019  -34.140 1.00 38.95  ? 36  TRP A C   1 
ATOM   4332  O O   . TRP C 2 36  ? 0.483   26.721  -34.694 1.00 38.53  ? 36  TRP A O   1 
ATOM   4333  C CB  . TRP C 2 36  ? 3.031   28.588  -35.376 1.00 41.47  ? 36  TRP A CB  1 
ATOM   4334  C CG  . TRP C 2 36  ? 4.418   28.873  -35.918 1.00 44.04  ? 36  TRP A CG  1 
ATOM   4335  C CD1 . TRP C 2 36  ? 4.854   28.690  -37.203 1.00 45.81  ? 36  TRP A CD1 1 
ATOM   4336  C CD2 . TRP C 2 36  ? 5.536   29.401  -35.192 1.00 44.51  ? 36  TRP A CD2 1 
ATOM   4337  N NE1 . TRP C 2 36  ? 6.161   29.068  -37.313 1.00 47.45  ? 36  TRP A NE1 1 
ATOM   4338  C CE2 . TRP C 2 36  ? 6.606   29.504  -36.093 1.00 46.73  ? 36  TRP A CE2 1 
ATOM   4339  C CE3 . TRP C 2 36  ? 5.733   29.798  -33.864 1.00 43.34  ? 36  TRP A CE3 1 
ATOM   4340  C CZ2 . TRP C 2 36  ? 7.857   29.985  -35.713 1.00 48.05  ? 36  TRP A CZ2 1 
ATOM   4341  C CZ3 . TRP C 2 36  ? 6.976   30.264  -33.488 1.00 44.31  ? 36  TRP A CZ3 1 
ATOM   4342  C CH2 . TRP C 2 36  ? 8.020   30.359  -34.410 1.00 46.68  ? 36  TRP A CH2 1 
ATOM   4343  N N   . ALA C 2 37  ? 1.656   27.249  -32.839 1.00 37.92  ? 37  ALA A N   1 
ATOM   4344  C CA  . ALA C 2 37  ? 0.539   27.243  -31.922 1.00 36.29  ? 37  ALA A CA  1 
ATOM   4345  C C   . ALA C 2 37  ? 0.824   28.244  -30.817 1.00 35.61  ? 37  ALA A C   1 
ATOM   4346  O O   . ALA C 2 37  ? 1.975   28.497  -30.486 1.00 36.28  ? 37  ALA A O   1 
ATOM   4347  C CB  . ALA C 2 37  ? 0.356   25.862  -31.342 1.00 36.07  ? 37  ALA A CB  1 
ATOM   4348  N N   . ARG C 2 38  ? -0.220  28.836  -30.251 1.00 34.44  ? 38  ARG A N   1 
ATOM   4349  C CA  . ARG C 2 38  ? -0.007  29.640  -29.064 1.00 33.84  ? 38  ARG A CA  1 
ATOM   4350  C C   . ARG C 2 38  ? -0.662  29.066  -27.836 1.00 32.84  ? 38  ARG A C   1 
ATOM   4351  O O   . ARG C 2 38  ? -1.615  28.304  -27.921 1.00 32.45  ? 38  ARG A O   1 
ATOM   4352  C CB  . ARG C 2 38  ? -0.439  31.076  -29.257 1.00 33.76  ? 38  ARG A CB  1 
ATOM   4353  C CG  . ARG C 2 38  ? -1.849  31.303  -29.644 1.00 33.26  ? 38  ARG A CG  1 
ATOM   4354  C CD  . ARG C 2 38  ? -2.119  32.789  -29.573 1.00 33.43  ? 38  ARG A CD  1 
ATOM   4355  N NE  . ARG C 2 38  ? -3.544  33.060  -29.524 1.00 36.43  ? 38  ARG A NE  1 
ATOM   4356  C CZ  . ARG C 2 38  ? -4.075  34.268  -29.644 1.00 36.88  ? 38  ARG A CZ  1 
ATOM   4357  N NH1 . ARG C 2 38  ? -3.272  35.318  -29.819 1.00 37.77  ? 38  ARG A NH1 1 
ATOM   4358  N NH2 . ARG C 2 38  ? -5.397  34.424  -29.571 1.00 33.00  ? 38  ARG A NH2 1 
ATOM   4359  N N   . GLN C 2 39  ? -0.120  29.416  -26.684 1.00 32.62  ? 39  GLN A N   1 
ATOM   4360  C CA  . GLN C 2 39  ? -0.728  29.014  -25.438 1.00 42.73  ? 39  GLN A CA  1 
ATOM   4361  C C   . GLN C 2 39  ? -1.062  30.243  -24.657 1.00 42.38  ? 39  GLN A C   1 
ATOM   4362  O O   . GLN C 2 39  ? -0.232  31.120  -24.463 1.00 42.16  ? 39  GLN A O   1 
ATOM   4363  C CB  . GLN C 2 39  ? 0.177   28.113  -24.625 1.00 32.34  ? 39  GLN A CB  1 
ATOM   4364  C CG  . GLN C 2 39  ? -0.517  27.590  -23.424 1.00 31.88  ? 39  GLN A CG  1 
ATOM   4365  C CD  . GLN C 2 39  ? 0.227   26.472  -22.795 1.00 32.61  ? 39  GLN A CD  1 
ATOM   4366  O OE1 . GLN C 2 39  ? 1.457   26.463  -22.789 1.00 36.67  ? 39  GLN A OE1 1 
ATOM   4367  N NE2 . GLN C 2 39  ? -0.507  25.500  -22.265 1.00 32.67  ? 39  GLN A NE2 1 
ATOM   4368  N N   . MET C 2 40  ? -2.303  30.315  -24.226 1.00 43.04  ? 40  MET A N   1 
ATOM   4369  C CA  . MET C 2 40  ? -2.745  31.495  -23.544 1.00 44.54  ? 40  MET A CA  1 
ATOM   4370  C C   . MET C 2 40  ? -3.134  31.091  -22.155 1.00 45.85  ? 40  MET A C   1 
ATOM   4371  O O   . MET C 2 40  ? -3.555  29.960  -21.925 1.00 46.16  ? 40  MET A O   1 
ATOM   4372  C CB  . MET C 2 40  ? -3.902  32.123  -24.302 1.00 44.60  ? 40  MET A CB  1 
ATOM   4373  C CG  . MET C 2 40  ? -3.441  32.735  -25.598 1.00 45.19  ? 40  MET A CG  1 
ATOM   4374  S SD  . MET C 2 40  ? -4.407  34.171  -26.035 1.00 50.03  ? 40  MET A SD  1 
ATOM   4375  C CE  . MET C 2 40  ? -5.992  33.366  -26.348 1.00 46.16  ? 40  MET A CE  1 
ATOM   4376  N N   . PRO C 2 41  ? -2.963  32.010  -21.207 1.00 46.84  ? 41  PRO A N   1 
ATOM   4377  C CA  . PRO C 2 41  ? -3.301  31.764  -19.796 1.00 46.62  ? 41  PRO A CA  1 
ATOM   4378  C C   . PRO C 2 41  ? -4.759  31.401  -19.705 1.00 45.69  ? 41  PRO A C   1 
ATOM   4379  O O   . PRO C 2 41  ? -5.578  32.252  -20.024 1.00 45.32  ? 41  PRO A O   1 
ATOM   4380  C CB  . PRO C 2 41  ? -3.116  33.132  -19.142 1.00 47.61  ? 41  PRO A CB  1 
ATOM   4381  C CG  . PRO C 2 41  ? -2.305  33.962  -20.114 1.00 48.27  ? 41  PRO A CG  1 
ATOM   4382  C CD  . PRO C 2 41  ? -2.544  33.398  -21.484 1.00 47.85  ? 41  PRO A CD  1 
ATOM   4383  N N   . GLY C 2 42  ? -5.100  30.177  -19.325 1.00 45.91  ? 42  GLY A N   1 
ATOM   4384  C CA  . GLY C 2 42  ? -6.504  29.849  -19.099 1.00 46.64  ? 42  GLY A CA  1 
ATOM   4385  C C   . GLY C 2 42  ? -7.279  29.554  -20.371 1.00 47.27  ? 42  GLY A C   1 
ATOM   4386  O O   . GLY C 2 42  ? -8.448  29.156  -20.344 1.00 47.06  ? 42  GLY A O   1 
ATOM   4387  N N   . LYS C 2 43  ? -6.619  29.776  -21.507 1.00 48.30  ? 43  LYS A N   1 
ATOM   4388  C CA  . LYS C 2 43  ? -7.034  29.141  -22.759 1.00 49.80  ? 43  LYS A CA  1 
ATOM   4389  C C   . LYS C 2 43  ? -6.129  27.924  -23.097 1.00 41.20  ? 43  LYS A C   1 
ATOM   4390  O O   . LYS C 2 43  ? -4.955  27.816  -22.666 1.00 41.24  ? 43  LYS A O   1 
ATOM   4391  C CB  . LYS C 2 43  ? -7.116  30.155  -23.927 1.00 50.85  ? 43  LYS A CB  1 
ATOM   4392  C CG  . LYS C 2 43  ? -8.284  29.908  -24.884 1.00 51.20  ? 43  LYS A CG  1 
ATOM   4393  C CD  . LYS C 2 43  ? -9.309  28.917  -24.260 1.00 81.49  ? 43  LYS A CD  1 
ATOM   4394  C CE  . LYS C 2 43  ? -10.396 29.576  -23.349 1.00 119.13 ? 43  LYS A CE  1 
ATOM   4395  N NZ  . LYS C 2 43  ? -11.668 29.961  -24.047 1.00 119.37 ? 43  LYS A NZ  1 
ATOM   4396  N N   . GLY C 2 44  ? -6.691  26.988  -23.849 1.00 41.22  ? 44  GLY A N   1 
ATOM   4397  C CA  . GLY C 2 44  ? -5.922  25.839  -24.268 1.00 40.78  ? 44  GLY A CA  1 
ATOM   4398  C C   . GLY C 2 44  ? -4.792  26.281  -25.169 1.00 39.98  ? 44  GLY A C   1 
ATOM   4399  O O   . GLY C 2 44  ? -4.272  27.404  -25.107 1.00 39.40  ? 44  GLY A O   1 
ATOM   4400  N N   . LEU C 2 45  ? -4.398  25.348  -26.005 1.00 40.29  ? 45  LEU A N   1 
ATOM   4401  C CA  . LEU C 2 45  ? -3.516  25.638  -27.089 1.00 40.24  ? 45  LEU A CA  1 
ATOM   4402  C C   . LEU C 2 45  ? -4.396  25.826  -28.310 1.00 40.22  ? 45  LEU A C   1 
ATOM   4403  O O   . LEU C 2 45  ? -5.421  25.162  -28.454 1.00 40.08  ? 45  LEU A O   1 
ATOM   4404  C CB  . LEU C 2 45  ? -2.592  24.446  -27.272 1.00 40.79  ? 45  LEU A CB  1 
ATOM   4405  C CG  . LEU C 2 45  ? -1.768  24.186  -26.029 1.00 41.00  ? 45  LEU A CG  1 
ATOM   4406  C CD1 . LEU C 2 45  ? -1.723  22.711  -25.754 1.00 33.99  ? 45  LEU A CD1 1 
ATOM   4407  C CD2 . LEU C 2 45  ? -0.395  24.742  -26.295 1.00 33.69  ? 45  LEU A CD2 1 
ATOM   4408  N N   . GLU C 2 46  ? -4.032  26.750  -29.181 1.00 40.64  ? 46  GLU A N   1 
ATOM   4409  C CA  . GLU C 2 46  ? -4.653  26.761  -30.492 1.00 41.21  ? 46  GLU A CA  1 
ATOM   4410  C C   . GLU C 2 46  ? -3.598  26.703  -31.573 1.00 42.07  ? 46  GLU A C   1 
ATOM   4411  O O   . GLU C 2 46  ? -2.570  27.382  -31.499 1.00 42.16  ? 46  GLU A O   1 
ATOM   4412  C CB  . GLU C 2 46  ? -5.614  27.937  -30.677 1.00 41.37  ? 46  GLU A CB  1 
ATOM   4413  C CG  . GLU C 2 46  ? -5.086  29.280  -30.252 1.00 42.15  ? 46  GLU A CG  1 
ATOM   4414  C CD  . GLU C 2 46  ? -6.209  30.289  -29.978 1.00 42.59  ? 46  GLU A CD  1 
ATOM   4415  O OE1 . GLU C 2 46  ? -7.350  30.039  -30.472 1.00 42.54  ? 46  GLU A OE1 1 
ATOM   4416  O OE2 . GLU C 2 46  ? -5.942  31.311  -29.260 1.00 42.80  ? 46  GLU A OE2 1 
ATOM   4417  N N   . TRP C 2 47  ? -3.850  25.839  -32.551 1.00 42.80  ? 47  TRP A N   1 
ATOM   4418  C CA  . TRP C 2 47  ? -3.019  25.733  -33.738 1.00 44.05  ? 47  TRP A CA  1 
ATOM   4419  C C   . TRP C 2 47  ? -3.163  27.008  -34.550 1.00 35.70  ? 47  TRP A C   1 
ATOM   4420  O O   . TRP C 2 47  ? -4.265  27.502  -34.739 1.00 35.21  ? 47  TRP A O   1 
ATOM   4421  C CB  . TRP C 2 47  ? -3.470  24.530  -34.546 1.00 35.94  ? 47  TRP A CB  1 
ATOM   4422  C CG  . TRP C 2 47  ? -2.884  24.411  -35.910 1.00 37.40  ? 47  TRP A CG  1 
ATOM   4423  C CD1 . TRP C 2 47  ? -1.624  23.981  -36.232 1.00 38.73  ? 47  TRP A CD1 1 
ATOM   4424  C CD2 . TRP C 2 47  ? -3.546  24.677  -37.150 1.00 37.94  ? 47  TRP A CD2 1 
ATOM   4425  N NE1 . TRP C 2 47  ? -1.460  23.983  -37.588 1.00 40.10  ? 47  TRP A NE1 1 
ATOM   4426  C CE2 . TRP C 2 47  ? -2.620  24.409  -38.181 1.00 39.62  ? 47  TRP A CE2 1 
ATOM   4427  C CE3 . TRP C 2 47  ? -4.828  25.132  -37.489 1.00 37.35  ? 47  TRP A CE3 1 
ATOM   4428  C CZ2 . TRP C 2 47  ? -2.934  24.567  -39.531 1.00 40.71  ? 47  TRP A CZ2 1 
ATOM   4429  C CZ3 . TRP C 2 47  ? -5.140  25.292  -38.828 1.00 44.55  ? 47  TRP A CZ3 1 
ATOM   4430  C CH2 . TRP C 2 47  ? -4.188  25.009  -39.837 1.00 40.05  ? 47  TRP A CH2 1 
ATOM   4431  N N   . MET C 2 48  ? -2.045  27.561  -35.000 1.00 36.76  ? 48  MET A N   1 
ATOM   4432  C CA  . MET C 2 48  ? -2.068  28.787  -35.777 1.00 37.48  ? 48  MET A CA  1 
ATOM   4433  C C   . MET C 2 48  ? -1.924  28.518  -37.265 1.00 39.01  ? 48  MET A C   1 
ATOM   4434  O O   . MET C 2 48  ? -2.564  29.156  -38.091 1.00 39.51  ? 48  MET A O   1 
ATOM   4435  C CB  . MET C 2 48  ? -0.964  29.714  -35.313 1.00 37.94  ? 48  MET A CB  1 
ATOM   4436  C CG  . MET C 2 48  ? -1.192  30.224  -33.941 1.00 36.61  ? 48  MET A CG  1 
ATOM   4437  S SD  . MET C 2 48  ? 0.183   31.216  -33.405 1.00 41.30  ? 48  MET A SD  1 
ATOM   4438  C CE  . MET C 2 48  ? -0.045  32.665  -34.429 1.00 41.74  ? 48  MET A CE  1 
ATOM   4439  N N   . GLY C 2 49  ? -1.077  27.565  -37.606 1.00 39.96  ? 49  GLY A N   1 
ATOM   4440  C CA  . GLY C 2 49  ? -0.897  27.253  -38.998 1.00 42.95  ? 49  GLY A CA  1 
ATOM   4441  C C   . GLY C 2 49  ? 0.367   26.502  -39.348 1.00 44.82  ? 49  GLY A C   1 
ATOM   4442  O O   . GLY C 2 49  ? 1.286   26.377  -38.544 1.00 43.23  ? 49  GLY A O   1 
ATOM   4443  N N   . ASP C 2 50  ? 0.399   26.005  -40.577 1.00 46.68  ? 50  ASP A N   1 
ATOM   4444  C CA  . ASP C 2 50  ? 1.510   25.211  -41.043 1.00 49.01  ? 50  ASP A CA  1 
ATOM   4445  C C   . ASP C 2 50  ? 2.256   25.922  -42.150 1.00 51.49  ? 50  ASP A C   1 
ATOM   4446  O O   . ASP C 2 50  ? 1.727   26.819  -42.805 1.00 52.04  ? 50  ASP A O   1 
ATOM   4447  C CB  . ASP C 2 50  ? 1.015   23.877  -41.579 1.00 49.85  ? 50  ASP A CB  1 
ATOM   4448  C CG  . ASP C 2 50  ? 0.459   22.982  -40.506 1.00 48.70  ? 50  ASP A CG  1 
ATOM   4449  O OD1 . ASP C 2 50  ? -0.226  22.015  -40.877 1.00 49.07  ? 50  ASP A OD1 1 
ATOM   4450  O OD2 . ASP C 2 50  ? 0.695   23.231  -39.307 1.00 47.61  ? 50  ASP A OD2 1 
ATOM   4451  N N   . ILE C 2 51  ? 3.491   25.507  -42.369 1.00 53.22  ? 51  ILE A N   1 
ATOM   4452  C CA  . ILE C 2 51  ? 4.207   25.954  -43.550 1.00 55.73  ? 51  ILE A CA  1 
ATOM   4453  C C   . ILE C 2 51  ? 4.938   24.796  -44.191 1.00 55.64  ? 51  ILE A C   1 
ATOM   4454  O O   . ILE C 2 51  ? 5.429   23.906  -43.497 1.00 55.48  ? 51  ILE A O   1 
ATOM   4455  C CB  . ILE C 2 51  ? 5.174   27.100  -43.235 1.00 54.32  ? 51  ILE A CB  1 
ATOM   4456  C CG1 . ILE C 2 51  ? 5.651   27.755  -44.529 1.00 57.15  ? 51  ILE A CG1 1 
ATOM   4457  C CG2 . ILE C 2 51  ? 6.329   26.613  -42.400 1.00 54.72  ? 51  ILE A CG2 1 
ATOM   4458  C CD1 . ILE C 2 51  ? 6.279   29.091  -44.313 1.00 57.91  ? 51  ILE A CD1 1 
ATOM   4459  N N   . ILE C 2 52  ? 4.959   24.789  -45.521 1.00 57.81  ? 52  ILE A N   1 
ATOM   4460  C CA  . ILE C 2 52  ? 5.769   23.831  -46.271 1.00 64.74  ? 52  ILE A CA  1 
ATOM   4461  C C   . ILE C 2 52  ? 7.142   24.445  -46.528 1.00 67.49  ? 52  ILE A C   1 
ATOM   4462  O O   . ILE C 2 52  ? 7.257   25.428  -47.251 1.00 68.96  ? 52  ILE A O   1 
ATOM   4463  C CB  . ILE C 2 52  ? 5.099   23.424  -47.596 1.00 65.86  ? 52  ILE A CB  1 
ATOM   4464  C CG1 . ILE C 2 52  ? 3.973   22.431  -47.319 1.00 59.80  ? 52  ILE A CG1 1 
ATOM   4465  C CG2 . ILE C 2 52  ? 6.110   22.796  -48.535 1.00 65.28  ? 52  ILE A CG2 1 
ATOM   4466  C CD1 . ILE C 2 52  ? 3.033   22.187  -48.479 1.00 60.44  ? 52  ILE A CD1 1 
ATOM   4467  N N   . PRO C 2 53  ? 8.187   23.881  -45.911 1.00 63.91  ? 53  PRO A N   1 
ATOM   4468  C CA  . PRO C 2 53  ? 9.514   24.500  -45.962 1.00 66.25  ? 53  PRO A CA  1 
ATOM   4469  C C   . PRO C 2 53  ? 10.086  24.546  -47.375 1.00 69.93  ? 53  PRO A C   1 
ATOM   4470  O O   . PRO C 2 53  ? 10.724  25.536  -47.743 1.00 71.74  ? 53  PRO A O   1 
ATOM   4471  C CB  . PRO C 2 53  ? 10.356  23.581  -45.075 1.00 66.50  ? 53  PRO A CB  1 
ATOM   4472  C CG  . PRO C 2 53  ? 9.357   22.893  -44.186 1.00 63.82  ? 53  PRO A CG  1 
ATOM   4473  C CD  . PRO C 2 53  ? 8.176   22.677  -45.066 1.00 62.82  ? 53  PRO A CD  1 
ATOM   4474  N N   . SER C 2 54  ? 9.841   23.494  -48.153 1.00 74.67  ? 54  SER A N   1 
ATOM   4475  C CA  . SER C 2 54  ? 10.416  23.382  -49.491 1.00 78.46  ? 54  SER A CA  1 
ATOM   4476  C C   . SER C 2 54  ? 10.008  24.560  -50.378 1.00 79.27  ? 54  SER A C   1 
ATOM   4477  O O   . SER C 2 54  ? 10.861  25.200  -51.000 1.00 82.26  ? 54  SER A O   1 
ATOM   4478  C CB  . SER C 2 54  ? 10.091  22.021  -50.141 1.00 76.02  ? 54  SER A CB  1 
ATOM   4479  O OG  . SER C 2 54  ? 9.009   22.096  -51.050 1.00 75.68  ? 54  SER A OG  1 
ATOM   4480  N N   . ASN C 2 55  ? 8.718   24.879  -50.404 1.00 76.76  ? 55  ASN A N   1 
ATOM   4481  C CA  . ASN C 2 55  ? 8.251   25.937  -51.294 1.00 77.72  ? 55  ASN A CA  1 
ATOM   4482  C C   . ASN C 2 55  ? 7.608   27.144  -50.616 1.00 71.79  ? 55  ASN A C   1 
ATOM   4483  O O   . ASN C 2 55  ? 7.383   28.162  -51.256 1.00 74.53  ? 55  ASN A O   1 
ATOM   4484  C CB  . ASN C 2 55  ? 7.345   25.372  -52.394 1.00 78.37  ? 55  ASN A CB  1 
ATOM   4485  C CG  . ASN C 2 55  ? 6.070   24.778  -51.852 1.00 71.48  ? 55  ASN A CG  1 
ATOM   4486  O OD1 . ASN C 2 55  ? 6.003   23.588  -51.557 1.00 70.81  ? 55  ASN A OD1 1 
ATOM   4487  N ND2 . ASN C 2 55  ? 5.045   25.606  -51.727 1.00 69.50  ? 55  ASN A ND2 1 
ATOM   4488  N N   . GLY C 2 56  ? 7.317   27.038  -49.329 1.00 68.61  ? 56  GLY A N   1 
ATOM   4489  C CA  . GLY C 2 56  ? 6.818   28.183  -48.585 1.00 68.94  ? 56  GLY A CA  1 
ATOM   4490  C C   . GLY C 2 56  ? 5.317   28.395  -48.617 1.00 64.15  ? 56  GLY A C   1 
ATOM   4491  O O   . GLY C 2 56  ? 4.834   29.458  -48.226 1.00 62.97  ? 56  GLY A O   1 
ATOM   4492  N N   . ALA C 2 57  ? 4.578   27.396  -49.090 1.00 63.71  ? 57  ALA A N   1 
ATOM   4493  C CA  . ALA C 2 57  ? 3.123   27.459  -49.045 1.00 61.49  ? 57  ALA A CA  1 
ATOM   4494  C C   . ALA C 2 57  ? 2.649   27.277  -47.605 1.00 59.44  ? 57  ALA A C   1 
ATOM   4495  O O   . ALA C 2 57  ? 3.189   26.448  -46.862 1.00 57.48  ? 57  ALA A O   1 
ATOM   4496  C CB  . ALA C 2 57  ? 2.516   26.410  -49.937 1.00 62.14  ? 57  ALA A CB  1 
ATOM   4497  N N   . THR C 2 58  ? 1.643   28.061  -47.221 1.00 57.54  ? 58  THR A N   1 
ATOM   4498  C CA  . THR C 2 58  ? 1.174   28.111  -45.840 1.00 54.31  ? 58  THR A CA  1 
ATOM   4499  C C   . THR C 2 58  ? -0.294  27.757  -45.730 1.00 52.23  ? 58  THR A C   1 
ATOM   4500  O O   . THR C 2 58  ? -1.098  28.119  -46.586 1.00 52.77  ? 58  THR A O   1 
ATOM   4501  C CB  . THR C 2 58  ? 1.322   29.515  -45.258 1.00 53.77  ? 58  THR A CB  1 
ATOM   4502  O OG1 . THR C 2 58  ? 0.558   30.418  -46.054 1.00 54.64  ? 58  THR A OG1 1 
ATOM   4503  C CG2 . THR C 2 58  ? 2.769   29.959  -45.267 1.00 55.66  ? 58  THR A CG2 1 
ATOM   4504  N N   . PHE C 2 59  ? -0.620  27.045  -44.657 1.00 50.13  ? 59  PHE A N   1 
ATOM   4505  C CA  . PHE C 2 59  ? -1.984  26.769  -44.238 1.00 47.33  ? 59  PHE A CA  1 
ATOM   4506  C C   . PHE C 2 59  ? -2.231  27.497  -42.916 1.00 48.59  ? 59  PHE A C   1 
ATOM   4507  O O   . PHE C 2 59  ? -1.492  27.305  -41.962 1.00 44.72  ? 59  PHE A O   1 
ATOM   4508  C CB  . PHE C 2 59  ? -2.150  25.284  -43.972 1.00 46.72  ? 59  PHE A CB  1 
ATOM   4509  C CG  . PHE C 2 59  ? -1.705  24.406  -45.092 1.00 48.78  ? 59  PHE A CG  1 
ATOM   4510  C CD1 . PHE C 2 59  ? -2.625  23.895  -45.986 1.00 49.19  ? 59  PHE A CD1 1 
ATOM   4511  C CD2 . PHE C 2 59  ? -0.367  24.061  -45.236 1.00 50.45  ? 59  PHE A CD2 1 
ATOM   4512  C CE1 . PHE C 2 59  ? -2.228  23.070  -47.004 1.00 51.20  ? 59  PHE A CE1 1 
ATOM   4513  C CE2 . PHE C 2 59  ? 0.045   23.240  -46.246 1.00 52.57  ? 59  PHE A CE2 1 
ATOM   4514  C CZ  . PHE C 2 59  ? -0.885  22.743  -47.139 1.00 57.47  ? 59  PHE A CZ  1 
ATOM   4515  N N   . TYR C 2 60  ? -3.269  28.321  -42.846 1.00 47.40  ? 60  TYR A N   1 
ATOM   4516  C CA  . TYR C 2 60  ? -3.595  29.017  -41.604 1.00 45.31  ? 60  TYR A CA  1 
ATOM   4517  C C   . TYR C 2 60  ? -4.917  28.585  -41.014 1.00 43.81  ? 60  TYR A C   1 
ATOM   4518  O O   . TYR C 2 60  ? -5.857  28.252  -41.736 1.00 44.38  ? 60  TYR A O   1 
ATOM   4519  C CB  . TYR C 2 60  ? -3.740  30.510  -41.847 1.00 45.61  ? 60  TYR A CB  1 
ATOM   4520  C CG  . TYR C 2 60  ? -2.462  31.205  -42.115 1.00 46.78  ? 60  TYR A CG  1 
ATOM   4521  C CD1 . TYR C 2 60  ? -1.672  31.651  -41.076 1.00 46.08  ? 60  TYR A CD1 1 
ATOM   4522  C CD2 . TYR C 2 60  ? -2.048  31.434  -43.407 1.00 48.88  ? 60  TYR A CD2 1 
ATOM   4523  C CE1 . TYR C 2 60  ? -0.502  32.300  -41.320 1.00 47.73  ? 60  TYR A CE1 1 
ATOM   4524  C CE2 . TYR C 2 60  ? -0.888  32.076  -43.659 1.00 50.62  ? 60  TYR A CE2 1 
ATOM   4525  C CZ  . TYR C 2 60  ? -0.110  32.506  -42.620 1.00 49.99  ? 60  TYR A CZ  1 
ATOM   4526  O OH  . TYR C 2 60  ? 1.075   33.141  -42.886 1.00 51.87  ? 60  TYR A OH  1 
ATOM   4527  N N   . ASN C 2 61  ? -4.983  28.634  -39.691 1.00 41.99  ? 61  ASN A N   1 
ATOM   4528  C CA  . ASN C 2 61  ? -6.240  28.711  -38.974 1.00 40.32  ? 61  ASN A CA  1 
ATOM   4529  C C   . ASN C 2 61  ? -6.890  30.055  -39.353 1.00 40.45  ? 61  ASN A C   1 
ATOM   4530  O O   . ASN C 2 61  ? -6.250  31.098  -39.255 1.00 40.90  ? 61  ASN A O   1 
ATOM   4531  C CB  . ASN C 2 61  ? -5.933  28.616  -37.469 1.00 39.19  ? 61  ASN A CB  1 
ATOM   4532  C CG  . ASN C 2 61  ? -7.167  28.730  -36.581 1.00 38.10  ? 61  ASN A CG  1 
ATOM   4533  O OD1 . ASN C 2 61  ? -8.268  29.027  -37.028 1.00 38.21  ? 61  ASN A OD1 1 
ATOM   4534  N ND2 . ASN C 2 61  ? -6.964  28.517  -35.292 1.00 37.31  ? 61  ASN A ND2 1 
ATOM   4535  N N   . GLN C 2 62  ? -8.145  30.032  -39.799 1.00 40.52  ? 62  GLN A N   1 
ATOM   4536  C CA  . GLN C 2 62  ? -8.808  31.236  -40.318 1.00 41.62  ? 62  GLN A CA  1 
ATOM   4537  C C   . GLN C 2 62  ? -8.726  32.436  -39.387 1.00 39.26  ? 62  GLN A C   1 
ATOM   4538  O O   . GLN C 2 62  ? -8.614  33.571  -39.854 1.00 40.54  ? 62  GLN A O   1 
ATOM   4539  C CB  . GLN C 2 62  ? -10.261 30.958  -40.715 1.00 41.94  ? 62  GLN A CB  1 
ATOM   4540  C CG  . GLN C 2 62  ? -10.991 32.170  -41.335 1.00 44.04  ? 62  GLN A CG  1 
ATOM   4541  C CD  . GLN C 2 62  ? -10.307 32.725  -42.608 1.00 46.81  ? 62  GLN A CD  1 
ATOM   4542  O OE1 . GLN C 2 62  ? -9.816  31.966  -43.461 1.00 47.68  ? 62  GLN A OE1 1 
ATOM   4543  N NE2 . GLN C 2 62  ? -10.276 34.057  -42.730 1.00 48.14  ? 62  GLN A NE2 1 
ATOM   4544  N N   . LYS C 2 63  ? -8.743  32.169  -38.081 1.00 37.76  ? 63  LYS A N   1 
ATOM   4545  C CA  . LYS C 2 63  ? -8.698  33.196  -37.037 1.00 41.02  ? 63  LYS A CA  1 
ATOM   4546  C C   . LYS C 2 63  ? -7.400  34.016  -37.015 1.00 41.90  ? 63  LYS A C   1 
ATOM   4547  O O   . LYS C 2 63  ? -7.407  35.188  -36.675 1.00 42.28  ? 63  LYS A O   1 
ATOM   4548  C CB  . LYS C 2 63  ? -8.935  32.537  -35.685 1.00 39.57  ? 63  LYS A CB  1 
ATOM   4549  C CG  . LYS C 2 63  ? -8.570  33.365  -34.491 1.00 39.45  ? 63  LYS A CG  1 
ATOM   4550  C CD  . LYS C 2 63  ? -8.921  32.632  -33.185 1.00 38.63  ? 63  LYS A CD  1 
ATOM   4551  C CE  . LYS C 2 63  ? -8.351  33.411  -31.980 1.00 38.63  ? 63  LYS A CE  1 
ATOM   4552  N NZ  . LYS C 2 63  ? -8.798  32.948  -30.639 1.00 37.77  ? 63  LYS A NZ  1 
ATOM   4553  N N   . PHE C 2 64  ? -6.293  33.405  -37.411 1.00 42.69  ? 64  PHE A N   1 
ATOM   4554  C CA  . PHE C 2 64  ? -5.005  34.078  -37.398 1.00 44.29  ? 64  PHE A CA  1 
ATOM   4555  C C   . PHE C 2 64  ? -4.603  34.629  -38.769 1.00 47.40  ? 64  PHE A C   1 
ATOM   4556  O O   . PHE C 2 64  ? -3.601  35.330  -38.890 1.00 48.37  ? 64  PHE A O   1 
ATOM   4557  C CB  . PHE C 2 64  ? -3.922  33.118  -36.902 1.00 43.57  ? 64  PHE A CB  1 
ATOM   4558  C CG  . PHE C 2 64  ? -4.100  32.689  -35.481 1.00 41.80  ? 64  PHE A CG  1 
ATOM   4559  C CD1 . PHE C 2 64  ? -3.799  33.552  -34.441 1.00 41.37  ? 64  PHE A CD1 1 
ATOM   4560  C CD2 . PHE C 2 64  ? -4.552  31.418  -35.183 1.00 40.77  ? 64  PHE A CD2 1 
ATOM   4561  C CE1 . PHE C 2 64  ? -3.966  33.160  -33.134 1.00 39.99  ? 64  PHE A CE1 1 
ATOM   4562  C CE2 . PHE C 2 64  ? -4.716  31.020  -33.874 1.00 39.46  ? 64  PHE A CE2 1 
ATOM   4563  C CZ  . PHE C 2 64  ? -4.430  31.890  -32.851 1.00 39.09  ? 64  PHE A CZ  1 
ATOM   4564  N N   . LYS C 2 65  ? -5.395  34.321  -39.791 1.00 49.18  ? 65  LYS A N   1 
ATOM   4565  C CA  . LYS C 2 65  ? -5.065  34.676  -41.164 1.00 52.43  ? 65  LYS A CA  1 
ATOM   4566  C C   . LYS C 2 65  ? -4.669  36.139  -41.381 1.00 55.40  ? 65  LYS A C   1 
ATOM   4567  O O   . LYS C 2 65  ? -3.563  36.427  -41.844 1.00 57.34  ? 65  LYS A O   1 
ATOM   4568  C CB  . LYS C 2 65  ? -6.201  34.286  -42.096 1.00 52.96  ? 65  LYS A CB  1 
ATOM   4569  C CG  . LYS C 2 65  ? -5.904  34.543  -43.565 1.00 55.50  ? 65  LYS A CG  1 
ATOM   4570  C CD  . LYS C 2 65  ? -4.714  33.743  -44.065 1.00 56.31  ? 65  LYS A CD  1 
ATOM   4571  C CE  . LYS C 2 65  ? -5.129  32.687  -45.089 1.00 56.74  ? 65  LYS A CE  1 
ATOM   4572  N NZ  . LYS C 2 65  ? -5.726  33.280  -46.296 1.00 58.54  ? 65  LYS A NZ  1 
ATOM   4573  N N   . GLY C 2 66  ? -5.539  37.078  -41.043 1.00 56.34  ? 66  GLY A N   1 
ATOM   4574  C CA  . GLY C 2 66  ? -5.173  38.469  -41.262 1.00 59.17  ? 66  GLY A CA  1 
ATOM   4575  C C   . GLY C 2 66  ? -4.094  39.020  -40.337 1.00 59.47  ? 66  GLY A C   1 
ATOM   4576  O O   . GLY C 2 66  ? -3.574  40.110  -40.557 1.00 60.91  ? 66  GLY A O   1 
ATOM   4577  N N   . GLN C 2 67  ? -3.753  38.250  -39.309 1.00 58.13  ? 67  GLN A N   1 
ATOM   4578  C CA  . GLN C 2 67  ? -3.099  38.780  -38.112 1.00 58.14  ? 67  GLN A CA  1 
ATOM   4579  C C   . GLN C 2 67  ? -1.598  38.568  -38.081 1.00 58.90  ? 67  GLN A C   1 
ATOM   4580  O O   . GLN C 2 67  ? -0.820  39.479  -37.798 1.00 60.06  ? 67  GLN A O   1 
ATOM   4581  C CB  . GLN C 2 67  ? -3.690  38.095  -36.880 1.00 56.23  ? 67  GLN A CB  1 
ATOM   4582  C CG  . GLN C 2 67  ? -5.196  37.981  -36.921 1.00 55.85  ? 67  GLN A CG  1 
ATOM   4583  C CD  . GLN C 2 67  ? -5.857  39.327  -36.770 1.00 57.09  ? 67  GLN A CD  1 
ATOM   4584  O OE1 . GLN C 2 67  ? -6.256  39.950  -37.758 1.00 58.87  ? 67  GLN A OE1 1 
ATOM   4585  N NE2 . GLN C 2 67  ? -5.970  39.795  -35.524 1.00 56.27  ? 67  GLN A NE2 1 
ATOM   4586  N N   . VAL C 2 68  ? -1.194  37.338  -38.331 1.00 58.44  ? 68  VAL A N   1 
ATOM   4587  C CA  . VAL C 2 68  ? 0.204   37.012  -38.273 1.00 59.00  ? 68  VAL A CA  1 
ATOM   4588  C C   . VAL C 2 68  ? 0.565   36.406  -39.606 1.00 47.44  ? 68  VAL A C   1 
ATOM   4589  O O   . VAL C 2 68  ? -0.306  35.946  -40.346 1.00 47.40  ? 68  VAL A O   1 
ATOM   4590  C CB  . VAL C 2 68  ? 0.489   36.030  -37.134 1.00 43.78  ? 68  VAL A CB  1 
ATOM   4591  C CG1 . VAL C 2 68  ? 0.093   34.637  -37.532 1.00 43.04  ? 68  VAL A CG1 1 
ATOM   4592  C CG2 . VAL C 2 68  ? 1.951   36.075  -36.741 1.00 44.55  ? 68  VAL A CG2 1 
ATOM   4593  N N   . THR C 2 69  ? 1.850   36.445  -39.933 1.00 51.70  ? 69  THR A N   1 
ATOM   4594  C CA  . THR C 2 69  ? 2.328   35.831  -41.155 1.00 50.96  ? 69  THR A CA  1 
ATOM   4595  C C   . THR C 2 69  ? 3.474   34.864  -40.870 1.00 51.07  ? 69  THR A C   1 
ATOM   4596  O O   . THR C 2 69  ? 4.418   35.192  -40.163 1.00 57.37  ? 69  THR A O   1 
ATOM   4597  C CB  . THR C 2 69  ? 2.654   36.889  -42.256 1.00 53.94  ? 69  THR A CB  1 
ATOM   4598  O OG1 . THR C 2 69  ? 3.363   36.261  -43.324 1.00 56.01  ? 69  THR A OG1 1 
ATOM   4599  C CG2 . THR C 2 69  ? 3.459   38.052  -41.701 1.00 54.95  ? 69  THR A CG2 1 
ATOM   4600  N N   . ILE C 2 70  ? 3.344   33.652  -41.395 1.00 51.00  ? 70  ILE A N   1 
ATOM   4601  C CA  . ILE C 2 70  ? 4.326   32.597  -41.220 1.00 51.36  ? 70  ILE A CA  1 
ATOM   4602  C C   . ILE C 2 70  ? 5.242   32.527  -42.446 1.00 61.16  ? 70  ILE A C   1 
ATOM   4603  O O   . ILE C 2 70  ? 4.759   32.583  -43.581 1.00 55.73  ? 70  ILE A O   1 
ATOM   4604  C CB  . ILE C 2 70  ? 3.614   31.259  -41.070 1.00 49.74  ? 70  ILE A CB  1 
ATOM   4605  C CG1 . ILE C 2 70  ? 2.852   31.210  -39.748 1.00 49.20  ? 70  ILE A CG1 1 
ATOM   4606  C CG2 . ILE C 2 70  ? 4.590   30.130  -41.146 1.00 50.73  ? 70  ILE A CG2 1 
ATOM   4607  C CD1 . ILE C 2 70  ? 2.052   29.957  -39.557 1.00 45.50  ? 70  ILE A CD1 1 
ATOM   4608  N N   . SER C 2 71  ? 6.556   32.414  -42.225 1.00 62.55  ? 71  SER A N   1 
ATOM   4609  C CA  . SER C 2 71  ? 7.522   32.282  -43.323 1.00 59.06  ? 71  SER A CA  1 
ATOM   4610  C C   . SER C 2 71  ? 8.624   31.248  -43.039 1.00 64.58  ? 71  SER A C   1 
ATOM   4611  O O   . SER C 2 71  ? 8.865   30.884  -41.894 1.00 58.24  ? 71  SER A O   1 
ATOM   4612  C CB  . SER C 2 71  ? 8.119   33.643  -43.688 1.00 61.64  ? 71  SER A CB  1 
ATOM   4613  O OG  . SER C 2 71  ? 8.223   34.470  -42.546 1.00 60.35  ? 71  SER A OG  1 
ATOM   4614  N N   . ALA C 2 72  ? 9.275   30.760  -44.094 1.00 64.00  ? 72  ALA A N   1 
ATOM   4615  C CA  . ALA C 2 72  ? 10.353  29.783  -43.948 1.00 64.06  ? 72  ALA A CA  1 
ATOM   4616  C C   . ALA C 2 72  ? 11.597  30.247  -44.664 1.00 74.90  ? 72  ALA A C   1 
ATOM   4617  O O   . ALA C 2 72  ? 11.529  31.065  -45.579 1.00 69.62  ? 72  ALA A O   1 
ATOM   4618  C CB  . ALA C 2 72  ? 9.938   28.423  -44.469 1.00 64.08  ? 72  ALA A CB  1 
ATOM   4619  N N   . ASP C 2 73  ? 12.734  29.709  -44.232 1.00 75.94  ? 73  ASP A N   1 
ATOM   4620  C CA  . ASP C 2 73  ? 14.038  29.979  -44.839 1.00 79.88  ? 73  ASP A CA  1 
ATOM   4621  C C   . ASP C 2 73  ? 14.834  28.677  -44.822 1.00 81.74  ? 73  ASP A C   1 
ATOM   4622  O O   . ASP C 2 73  ? 15.629  28.436  -43.912 1.00 81.70  ? 73  ASP A O   1 
ATOM   4623  C CB  . ASP C 2 73  ? 14.760  31.084  -44.062 1.00 80.13  ? 73  ASP A CB  1 
ATOM   4624  C CG  . ASP C 2 73  ? 16.117  31.436  -44.647 1.00 84.41  ? 73  ASP A CG  1 
ATOM   4625  O OD1 . ASP C 2 73  ? 16.500  30.903  -45.717 1.00 87.22  ? 73  ASP A OD1 1 
ATOM   4626  O OD2 . ASP C 2 73  ? 16.808  32.270  -44.023 1.00 85.03  ? 73  ASP A OD2 1 
ATOM   4627  N N   . LYS C 2 74  ? 14.604  27.841  -45.833 1.00 83.73  ? 74  LYS A N   1 
ATOM   4628  C CA  . LYS C 2 74  ? 15.157  26.486  -45.870 1.00 85.57  ? 74  LYS A CA  1 
ATOM   4629  C C   . LYS C 2 74  ? 16.694  26.408  -45.827 1.00 80.61  ? 74  LYS A C   1 
ATOM   4630  O O   . LYS C 2 74  ? 17.253  25.369  -45.469 1.00 81.42  ? 74  LYS A O   1 
ATOM   4631  C CB  . LYS C 2 74  ? 14.604  25.717  -47.077 1.00 87.44  ? 74  LYS A CB  1 
ATOM   4632  C CG  . LYS C 2 74  ? 14.464  26.557  -48.342 1.00 90.31  ? 74  LYS A CG  1 
ATOM   4633  C CD  . LYS C 2 74  ? 14.777  25.750  -49.615 1.00 94.26  ? 74  LYS A CD  1 
ATOM   4634  C CE  . LYS C 2 74  ? 13.723  24.681  -49.895 1.00 92.84  ? 74  LYS A CE  1 
ATOM   4635  N NZ  . LYS C 2 74  ? 14.086  23.755  -51.013 1.00 86.07  ? 74  LYS A NZ  1 
ATOM   4636  N N   . SER C 2 75  ? 17.368  27.502  -46.180 1.00 84.09  ? 75  SER A N   1 
ATOM   4637  C CA  . SER C 2 75  ? 18.830  27.543  -46.155 1.00 87.56  ? 75  SER A CA  1 
ATOM   4638  C C   . SER C 2 75  ? 19.381  27.531  -44.726 1.00 85.98  ? 75  SER A C   1 
ATOM   4639  O O   . SER C 2 75  ? 20.391  26.883  -44.446 1.00 88.21  ? 75  SER A O   1 
ATOM   4640  C CB  . SER C 2 75  ? 19.366  28.752  -46.933 1.00 89.26  ? 75  SER A CB  1 
ATOM   4641  O OG  . SER C 2 75  ? 18.821  29.968  -46.448 1.00 87.95  ? 75  SER A OG  1 
ATOM   4642  N N   . ILE C 2 76  ? 18.720  28.238  -43.817 1.00 82.24  ? 76  ILE A N   1 
ATOM   4643  C CA  . ILE C 2 76  ? 19.167  28.225  -42.433 1.00 80.48  ? 76  ILE A CA  1 
ATOM   4644  C C   . ILE C 2 76  ? 18.233  27.433  -41.520 1.00 75.75  ? 76  ILE A C   1 
ATOM   4645  O O   . ILE C 2 76  ? 18.320  27.544  -40.298 1.00 73.77  ? 76  ILE A O   1 
ATOM   4646  C CB  . ILE C 2 76  ? 19.412  29.648  -41.879 1.00 79.81  ? 76  ILE A CB  1 
ATOM   4647  C CG1 . ILE C 2 76  ? 18.152  30.502  -41.999 1.00 76.29  ? 76  ILE A CG1 1 
ATOM   4648  C CG2 . ILE C 2 76  ? 20.588  30.306  -42.593 1.00 83.19  ? 76  ILE A CG2 1 
ATOM   4649  C CD1 . ILE C 2 76  ? 18.314  31.897  -41.448 1.00 75.79  ? 76  ILE A CD1 1 
ATOM   4650  N N   . SER C 2 77  ? 17.356  26.631  -42.120 1.00 75.00  ? 77  SER A N   1 
ATOM   4651  C CA  . SER C 2 77  ? 16.461  25.746  -41.366 1.00 75.91  ? 77  SER A CA  1 
ATOM   4652  C C   . SER C 2 77  ? 15.561  26.475  -40.341 1.00 68.06  ? 77  SER A C   1 
ATOM   4653  O O   . SER C 2 77  ? 15.564  26.149  -39.158 1.00 66.27  ? 77  SER A O   1 
ATOM   4654  C CB  . SER C 2 77  ? 17.265  24.632  -40.674 1.00 72.97  ? 77  SER A CB  1 
ATOM   4655  O OG  . SER C 2 77  ? 17.709  23.651  -41.594 1.00 76.00  ? 77  SER A OG  1 
ATOM   4656  N N   . THR C 2 78  ? 14.762  27.430  -40.801 1.00 66.97  ? 78  THR A N   1 
ATOM   4657  C CA  . THR C 2 78  ? 14.118  28.341  -39.874 1.00 64.05  ? 78  THR A CA  1 
ATOM   4658  C C   . THR C 2 78  ? 12.742  28.858  -40.302 1.00 72.03  ? 78  THR A C   1 
ATOM   4659  O O   . THR C 2 78  ? 12.539  29.220  -41.465 1.00 63.63  ? 78  THR A O   1 
ATOM   4660  C CB  . THR C 2 78  ? 15.039  29.523  -39.590 1.00 65.34  ? 78  THR A CB  1 
ATOM   4661  O OG1 . THR C 2 78  ? 16.200  29.044  -38.908 1.00 74.23  ? 78  THR A OG1 1 
ATOM   4662  C CG2 . THR C 2 78  ? 14.361  30.536  -38.719 1.00 62.64  ? 78  THR A CG2 1 
ATOM   4663  N N   . THR C 2 79  ? 11.809  28.872  -39.339 1.00 58.88  ? 79  THR A N   1 
ATOM   4664  C CA  . THR C 2 79  ? 10.506  29.515  -39.485 1.00 60.28  ? 79  THR A CA  1 
ATOM   4665  C C   . THR C 2 79  ? 10.416  30.790  -38.663 1.00 55.61  ? 79  THR A C   1 
ATOM   4666  O O   . THR C 2 79  ? 11.074  30.942  -37.641 1.00 55.20  ? 79  THR A O   1 
ATOM   4667  C CB  . THR C 2 79  ? 9.372   28.604  -39.021 1.00 57.75  ? 79  THR A CB  1 
ATOM   4668  O OG1 . THR C 2 79  ? 9.929   27.499  -38.311 1.00 57.85  ? 79  THR A OG1 1 
ATOM   4669  C CG2 . THR C 2 79  ? 8.592   28.077  -40.198 1.00 58.23  ? 79  THR A CG2 1 
ATOM   4670  N N   . TYR C 2 80  ? 9.577   31.704  -39.117 1.00 55.63  ? 80  TYR A N   1 
ATOM   4671  C CA  . TYR C 2 80  ? 9.359   32.937  -38.402 1.00 54.74  ? 80  TYR A CA  1 
ATOM   4672  C C   . TYR C 2 80  ? 7.877   33.163  -38.239 1.00 52.75  ? 80  TYR A C   1 
ATOM   4673  O O   . TYR C 2 80  ? 7.085   32.757  -39.080 1.00 52.96  ? 80  TYR A O   1 
ATOM   4674  C CB  . TYR C 2 80  ? 9.965   34.106  -39.160 1.00 57.39  ? 80  TYR A CB  1 
ATOM   4675  C CG  . TYR C 2 80  ? 11.437  33.931  -39.434 1.00 60.33  ? 80  TYR A CG  1 
ATOM   4676  C CD1 . TYR C 2 80  ? 12.391  34.375  -38.525 1.00 60.66  ? 80  TYR A CD1 1 
ATOM   4677  C CD2 . TYR C 2 80  ? 11.876  33.312  -40.595 1.00 62.76  ? 80  TYR A CD2 1 
ATOM   4678  C CE1 . TYR C 2 80  ? 13.730  34.208  -38.767 1.00 63.31  ? 80  TYR A CE1 1 
ATOM   4679  C CE2 . TYR C 2 80  ? 13.215  33.138  -40.842 1.00 65.56  ? 80  TYR A CE2 1 
ATOM   4680  C CZ  . TYR C 2 80  ? 14.143  33.593  -39.930 1.00 65.92  ? 80  TYR A CZ  1 
ATOM   4681  O OH  . TYR C 2 80  ? 15.494  33.424  -40.186 1.00 69.01  ? 80  TYR A OH  1 
ATOM   4682  N N   . LEU C 2 81  ? 7.514   33.803  -37.136 1.00 49.98  ? 81  LEU A N   1 
ATOM   4683  C CA  . LEU C 2 81  ? 6.194   34.349  -36.963 1.00 51.89  ? 81  LEU A CA  1 
ATOM   4684  C C   . LEU C 2 81  ? 6.401   35.834  -37.074 1.00 53.34  ? 81  LEU A C   1 
ATOM   4685  O O   . LEU C 2 81  ? 7.385   36.346  -36.570 1.00 54.06  ? 81  LEU A O   1 
ATOM   4686  C CB  . LEU C 2 81  ? 5.668   34.001  -35.584 1.00 45.73  ? 81  LEU A CB  1 
ATOM   4687  C CG  . LEU C 2 81  ? 4.274   33.403  -35.586 1.00 46.36  ? 81  LEU A CG  1 
ATOM   4688  C CD1 . LEU C 2 81  ? 4.245   32.195  -36.485 1.00 48.12  ? 81  LEU A CD1 1 
ATOM   4689  C CD2 . LEU C 2 81  ? 3.881   33.027  -34.181 1.00 45.35  ? 81  LEU A CD2 1 
ATOM   4690  N N   . GLN C 2 82  ? 5.492   36.535  -37.735 1.00 54.13  ? 82  GLN A N   1 
ATOM   4691  C CA  . GLN C 2 82  ? 5.696   37.958  -37.970 1.00 56.35  ? 82  GLN A CA  1 
ATOM   4692  C C   . GLN C 2 82  ? 4.410   38.756  -37.846 1.00 55.63  ? 82  GLN A C   1 
ATOM   4693  O O   . GLN C 2 82  ? 3.404   38.431  -38.470 1.00 55.25  ? 82  GLN A O   1 
ATOM   4694  C CB  . GLN C 2 82  ? 6.290   38.175  -39.356 1.00 59.94  ? 82  GLN A CB  1 
ATOM   4695  C CG  . GLN C 2 82  ? 7.332   39.270  -39.397 1.00 62.78  ? 82  GLN A CG  1 
ATOM   4696  C CD  . GLN C 2 82  ? 6.876   40.497  -40.157 1.00 64.96  ? 82  GLN A CD  1 
ATOM   4697  O OE1 . GLN C 2 82  ? 5.704   40.608  -40.543 1.00 64.42  ? 82  GLN A OE1 1 
ATOM   4698  N NE2 . GLN C 2 82  ? 7.808   41.429  -40.391 1.00 67.58  ? 82  GLN A NE2 1 
ATOM   4699  N N   . TRP C 2 83  ? 4.440   39.799  -37.032 1.00 55.76  ? 83  TRP A N   1 
ATOM   4700  C CA  . TRP C 2 83  ? 3.322   40.718  -36.971 1.00 56.03  ? 83  TRP A CA  1 
ATOM   4701  C C   . TRP C 2 83  ? 3.842   42.028  -37.511 1.00 59.34  ? 83  TRP A C   1 
ATOM   4702  O O   . TRP C 2 83  ? 4.991   42.381  -37.258 1.00 60.71  ? 83  TRP A O   1 
ATOM   4703  C CB  . TRP C 2 83  ? 2.817   40.916  -35.536 1.00 53.65  ? 83  TRP A CB  1 
ATOM   4704  C CG  . TRP C 2 83  ? 2.400   39.655  -34.839 1.00 50.90  ? 83  TRP A CG  1 
ATOM   4705  C CD1 . TRP C 2 83  ? 1.128   39.161  -34.721 1.00 49.23  ? 83  TRP A CD1 1 
ATOM   4706  C CD2 . TRP C 2 83  ? 3.256   38.727  -34.152 1.00 49.73  ? 83  TRP A CD2 1 
ATOM   4707  N NE1 . TRP C 2 83  ? 1.143   37.982  -34.011 1.00 47.28  ? 83  TRP A NE1 1 
ATOM   4708  C CE2 . TRP C 2 83  ? 2.435   37.694  -33.650 1.00 47.49  ? 83  TRP A CE2 1 
ATOM   4709  C CE3 . TRP C 2 83  ? 4.640   38.665  -33.922 1.00 50.62  ? 83  TRP A CE3 1 
ATOM   4710  C CZ2 . TRP C 2 83  ? 2.950   36.612  -32.938 1.00 46.16  ? 83  TRP A CZ2 1 
ATOM   4711  C CZ3 . TRP C 2 83  ? 5.146   37.596  -33.215 1.00 44.32  ? 83  TRP A CZ3 1 
ATOM   4712  C CH2 . TRP C 2 83  ? 4.301   36.582  -32.727 1.00 47.16  ? 83  TRP A CH2 1 
ATOM   4713  N N   . SER C 2 84  ? 3.014   42.739  -38.271 1.00 60.75  ? 84  SER A N   1 
ATOM   4714  C CA  . SER C 2 84  ? 3.378   44.089  -38.682 1.00 63.54  ? 84  SER A CA  1 
ATOM   4715  C C   . SER C 2 84  ? 2.839   45.090  -37.655 1.00 63.29  ? 84  SER A C   1 
ATOM   4716  O O   . SER C 2 84  ? 3.395   46.179  -37.481 1.00 65.05  ? 84  SER A O   1 
ATOM   4717  C CB  . SER C 2 84  ? 2.897   44.401  -40.109 1.00 65.49  ? 84  SER A CB  1 
ATOM   4718  O OG  . SER C 2 84  ? 1.482   44.384  -40.224 1.00 64.25  ? 84  SER A OG  1 
ATOM   4719  N N   . SER C 2 85  ? 1.772   44.704  -36.954 1.00 61.25  ? 85  SER A N   1 
ATOM   4720  C CA  . SER C 2 85  ? 1.198   45.572  -35.930 1.00 61.16  ? 85  SER A CA  1 
ATOM   4721  C C   . SER C 2 85  ? 0.577   44.817  -34.748 1.00 58.10  ? 85  SER A C   1 
ATOM   4722  O O   . SER C 2 85  ? -0.513  44.255  -34.872 1.00 57.10  ? 85  SER A O   1 
ATOM   4723  C CB  . SER C 2 85  ? 0.163   46.490  -36.553 1.00 63.31  ? 85  SER A CB  1 
ATOM   4724  O OG  . SER C 2 85  ? 0.193   47.746  -35.916 1.00 64.86  ? 85  SER A OG  1 
ATOM   4725  N N   . LEU C 2 86  ? 1.262   44.856  -33.601 1.00 56.80  ? 86  LEU A N   1 
ATOM   4726  C CA  . LEU C 2 86  ? 0.924   44.038  -32.420 1.00 53.77  ? 86  LEU A CA  1 
ATOM   4727  C C   . LEU C 2 86  ? -0.216  44.562  -31.538 1.00 45.54  ? 86  LEU A C   1 
ATOM   4728  O O   . LEU C 2 86  ? -0.219  45.707  -31.111 1.00 46.65  ? 86  LEU A O   1 
ATOM   4729  C CB  . LEU C 2 86  ? 2.174   43.814  -31.560 1.00 45.94  ? 86  LEU A CB  1 
ATOM   4730  C CG  . LEU C 2 86  ? 3.170   42.767  -32.034 1.00 45.93  ? 86  LEU A CG  1 
ATOM   4731  C CD1 . LEU C 2 86  ? 4.464   42.854  -31.251 1.00 46.15  ? 86  LEU A CD1 1 
ATOM   4732  C CD2 . LEU C 2 86  ? 2.541   41.403  -31.888 1.00 43.84  ? 86  LEU A CD2 1 
ATOM   4733  N N   . LYS C 2 87  ? -1.174  43.698  -31.248 1.00 43.70  ? 87  LYS A N   1 
ATOM   4734  C CA  . LYS C 2 87  ? -2.313  44.093  -30.438 1.00 44.90  ? 87  LYS A CA  1 
ATOM   4735  C C   . LYS C 2 87  ? -2.152  43.414  -29.083 1.00 44.56  ? 87  LYS A C   1 
ATOM   4736  O O   . LYS C 2 87  ? -1.393  42.452  -28.965 1.00 44.02  ? 87  LYS A O   1 
ATOM   4737  C CB  . LYS C 2 87  ? -3.634  43.715  -31.138 1.00 46.81  ? 87  LYS A CB  1 
ATOM   4738  C CG  . LYS C 2 87  ? -3.669  44.117  -32.620 1.00 44.83  ? 87  LYS A CG  1 
ATOM   4739  C CD  . LYS C 2 87  ? -4.943  43.738  -33.338 1.00 52.89  ? 87  LYS A CD  1 
ATOM   4740  C CE  . LYS C 2 87  ? -5.168  42.232  -33.352 1.00 50.96  ? 87  LYS A CE  1 
ATOM   4741  N NZ  . LYS C 2 87  ? -6.621  41.907  -33.592 1.00 50.65  ? 87  LYS A NZ  1 
ATOM   4742  N N   . ALA C 2 88  ? -2.837  43.917  -28.057 1.00 45.07  ? 88  ALA A N   1 
ATOM   4743  C CA  . ALA C 2 88  ? -2.650  43.385  -26.709 1.00 43.79  ? 88  ALA A CA  1 
ATOM   4744  C C   . ALA C 2 88  ? -3.183  41.971  -26.626 1.00 42.18  ? 88  ALA A C   1 
ATOM   4745  O O   . ALA C 2 88  ? -2.764  41.175  -25.787 1.00 40.88  ? 88  ALA A O   1 
ATOM   4746  C CB  . ALA C 2 88  ? -3.331  44.257  -25.696 1.00 44.14  ? 88  ALA A CB  1 
ATOM   4747  N N   . SER C 2 89  ? -4.119  41.670  -27.515 1.00 42.39  ? 89  SER A N   1 
ATOM   4748  C CA  . SER C 2 89  ? -4.657  40.333  -27.630 1.00 41.18  ? 89  SER A CA  1 
ATOM   4749  C C   . SER C 2 89  ? -3.559  39.343  -28.046 1.00 40.83  ? 89  SER A C   1 
ATOM   4750  O O   . SER C 2 89  ? -3.709  38.149  -27.846 1.00 40.19  ? 89  SER A O   1 
ATOM   4751  C CB  . SER C 2 89  ? -5.813  40.313  -28.638 1.00 41.88  ? 89  SER A CB  1 
ATOM   4752  O OG  . SER C 2 89  ? -5.337  40.428  -29.984 1.00 43.19  ? 89  SER A OG  1 
ATOM   4753  N N   . ASP C 2 90  ? -2.459  39.833  -28.616 1.00 41.59  ? 90  ASP A N   1 
ATOM   4754  C CA  . ASP C 2 90  ? -1.396  38.952  -29.112 1.00 41.09  ? 90  ASP A CA  1 
ATOM   4755  C C   . ASP C 2 90  ? -0.501  38.360  -28.026 1.00 38.96  ? 90  ASP A C   1 
ATOM   4756  O O   . ASP C 2 90  ? 0.312   37.497  -28.322 1.00 38.42  ? 90  ASP A O   1 
ATOM   4757  C CB  . ASP C 2 90  ? -0.525  39.662  -30.156 1.00 43.79  ? 90  ASP A CB  1 
ATOM   4758  C CG  . ASP C 2 90  ? -1.275  39.978  -31.439 1.00 45.66  ? 90  ASP A CG  1 
ATOM   4759  O OD1 . ASP C 2 90  ? -0.663  40.561  -32.367 1.00 47.38  ? 90  ASP A OD1 1 
ATOM   4760  O OD2 . ASP C 2 90  ? -2.483  39.646  -31.519 1.00 45.52  ? 90  ASP A OD2 1 
ATOM   4761  N N   . THR C 2 91  ? -0.649  38.813  -26.781 1.00 38.15  ? 91  THR A N   1 
ATOM   4762  C CA  . THR C 2 91  ? 0.117   38.273  -25.649 1.00 34.71  ? 91  THR A CA  1 
ATOM   4763  C C   . THR C 2 91  ? -0.128  36.785  -25.463 1.00 33.64  ? 91  THR A C   1 
ATOM   4764  O O   . THR C 2 91  ? -1.266  36.362  -25.312 1.00 33.44  ? 91  THR A O   1 
ATOM   4765  C CB  . THR C 2 91  ? -0.230  38.991  -24.343 1.00 34.38  ? 91  THR A CB  1 
ATOM   4766  O OG1 . THR C 2 91  ? 0.100   40.371  -24.473 1.00 35.58  ? 91  THR A OG1 1 
ATOM   4767  C CG2 . THR C 2 91  ? 0.537   38.418  -23.186 1.00 33.79  ? 91  THR A CG2 1 
ATOM   4768  N N   . ALA C 2 92  ? 0.948   36.001  -25.476 1.00 38.36  ? 92  ALA A N   1 
ATOM   4769  C CA  . ALA C 2 92  ? 0.874   34.539  -25.439 1.00 33.19  ? 92  ALA A CA  1 
ATOM   4770  C C   . ALA C 2 92  ? 2.256   33.952  -25.480 1.00 33.86  ? 92  ALA A C   1 
ATOM   4771  O O   . ALA C 2 92  ? 3.248   34.657  -25.639 1.00 34.80  ? 92  ALA A O   1 
ATOM   4772  C CB  . ALA C 2 92  ? 0.084   34.002  -26.619 1.00 33.19  ? 92  ALA A CB  1 
ATOM   4773  N N   . MET C 2 93  ? 2.295   32.638  -25.346 1.00 33.59  ? 93  MET A N   1 
ATOM   4774  C CA  . MET C 2 93  ? 3.511   31.871  -25.497 1.00 34.47  ? 93  MET A CA  1 
ATOM   4775  C C   . MET C 2 93  ? 3.370   31.211  -26.851 1.00 38.95  ? 93  MET A C   1 
ATOM   4776  O O   . MET C 2 93  ? 2.346   30.604  -27.138 1.00 34.40  ? 93  MET A O   1 
ATOM   4777  C CB  . MET C 2 93  ? 3.590   30.808  -24.411 1.00 34.07  ? 93  MET A CB  1 
ATOM   4778  C CG  . MET C 2 93  ? 4.689   29.810  -24.602 1.00 35.16  ? 93  MET A CG  1 
ATOM   4779  S SD  . MET C 2 93  ? 6.246   30.527  -24.088 1.00 42.63  ? 93  MET A SD  1 
ATOM   4780  C CE  . MET C 2 93  ? 6.265   30.094  -22.348 1.00 35.68  ? 93  MET A CE  1 
ATOM   4781  N N   . TYR C 2 94  ? 4.380   31.346  -27.699 1.00 41.11  ? 94  TYR A N   1 
ATOM   4782  C CA  . TYR C 2 94  ? 4.277   30.828  -29.052 1.00 37.21  ? 94  TYR A CA  1 
ATOM   4783  C C   . TYR C 2 94  ? 5.213   29.668  -29.288 1.00 38.33  ? 94  TYR A C   1 
ATOM   4784  O O   . TYR C 2 94  ? 6.421   29.797  -29.157 1.00 39.99  ? 94  TYR A O   1 
ATOM   4785  C CB  . TYR C 2 94  ? 4.511   31.946  -30.052 1.00 38.27  ? 94  TYR A CB  1 
ATOM   4786  C CG  . TYR C 2 94  ? 3.368   32.917  -30.061 1.00 37.42  ? 94  TYR A CG  1 
ATOM   4787  C CD1 . TYR C 2 94  ? 2.250   32.669  -30.832 1.00 37.05  ? 94  TYR A CD1 1 
ATOM   4788  C CD2 . TYR C 2 94  ? 3.389   34.066  -29.278 1.00 37.14  ? 94  TYR A CD2 1 
ATOM   4789  C CE1 . TYR C 2 94  ? 1.183   33.553  -30.853 1.00 36.52  ? 94  TYR A CE1 1 
ATOM   4790  C CE2 . TYR C 2 94  ? 2.317   34.961  -29.279 1.00 36.64  ? 94  TYR A CE2 1 
ATOM   4791  C CZ  . TYR C 2 94  ? 1.213   34.689  -30.074 1.00 40.07  ? 94  TYR A CZ  1 
ATOM   4792  O OH  . TYR C 2 94  ? 0.125   35.534  -30.119 1.00 40.71  ? 94  TYR A OH  1 
ATOM   4793  N N   . TYR C 2 95  ? 4.638   28.522  -29.624 1.00 38.16  ? 95  TYR A N   1 
ATOM   4794  C CA  . TYR C 2 95  ? 5.416   27.323  -29.872 1.00 39.39  ? 95  TYR A CA  1 
ATOM   4795  C C   . TYR C 2 95  ? 5.506   27.083  -31.361 1.00 40.68  ? 95  TYR A C   1 
ATOM   4796  O O   . TYR C 2 95  ? 4.555   27.319  -32.086 1.00 40.16  ? 95  TYR A O   1 
ATOM   4797  C CB  . TYR C 2 95  ? 4.773   26.105  -29.203 1.00 38.66  ? 95  TYR A CB  1 
ATOM   4798  C CG  . TYR C 2 95  ? 4.847   26.109  -27.694 1.00 39.15  ? 95  TYR A CG  1 
ATOM   4799  C CD1 . TYR C 2 95  ? 6.025   25.774  -27.044 1.00 40.17  ? 95  TYR A CD1 1 
ATOM   4800  C CD2 . TYR C 2 95  ? 3.733   26.440  -26.913 1.00 37.47  ? 95  TYR A CD2 1 
ATOM   4801  C CE1 . TYR C 2 95  ? 6.110   25.772  -25.666 1.00 39.63  ? 95  TYR A CE1 1 
ATOM   4802  C CE2 . TYR C 2 95  ? 3.811   26.438  -25.523 1.00 36.97  ? 95  TYR A CE2 1 
ATOM   4803  C CZ  . TYR C 2 95  ? 5.008   26.092  -24.908 1.00 38.07  ? 95  TYR A CZ  1 
ATOM   4804  O OH  . TYR C 2 95  ? 5.133   26.071  -23.539 1.00 37.76  ? 95  TYR A OH  1 
ATOM   4805  N N   . CYS C 2 96  ? 6.665   26.636  -31.818 1.00 42.56  ? 96  CYS A N   1 
ATOM   4806  C CA  . CYS C 2 96  ? 6.737   26.015  -33.122 1.00 46.10  ? 96  CYS A CA  1 
ATOM   4807  C C   . CYS C 2 96  ? 6.868   24.513  -32.921 1.00 46.59  ? 96  CYS A C   1 
ATOM   4808  O O   . CYS C 2 96  ? 7.300   24.045  -31.868 1.00 44.52  ? 96  CYS A O   1 
ATOM   4809  C CB  . CYS C 2 96  ? 7.869   26.593  -33.987 1.00 48.40  ? 96  CYS A CB  1 
ATOM   4810  S SG  . CYS C 2 96  ? 9.542   26.217  -33.477 1.00 71.07  ? 96  CYS A SG  1 
ATOM   4811  N N   . ALA C 2 97  ? 6.437   23.764  -33.921 1.00 47.17  ? 97  ALA A N   1 
ATOM   4812  C CA  . ALA C 2 97  ? 6.553   22.325  -33.876 1.00 46.24  ? 97  ALA A CA  1 
ATOM   4813  C C   . ALA C 2 97  ? 6.872   21.778  -35.257 1.00 50.26  ? 97  ALA A C   1 
ATOM   4814  O O   . ALA C 2 97  ? 6.744   22.473  -36.264 1.00 48.73  ? 97  ALA A O   1 
ATOM   4815  C CB  . ALA C 2 97  ? 5.295   21.708  -33.348 1.00 44.57  ? 97  ALA A CB  1 
ATOM   4816  N N   . ARG C 2 98  ? 7.298   20.525  -35.290 1.00 49.85  ? 98  ARG A N   1 
ATOM   4817  C CA  . ARG C 2 98  ? 7.552   19.851  -36.543 1.00 52.00  ? 98  ARG A CA  1 
ATOM   4818  C C   . ARG C 2 98  ? 6.542   18.721  -36.677 1.00 51.56  ? 98  ARG A C   1 
ATOM   4819  O O   . ARG C 2 98  ? 6.188   18.071  -35.688 1.00 50.81  ? 98  ARG A O   1 
ATOM   4820  C CB  . ARG C 2 98  ? 8.989   19.329  -36.570 1.00 58.30  ? 98  ARG A CB  1 
ATOM   4821  C CG  . ARG C 2 98  ? 9.469   18.807  -37.924 1.00 57.48  ? 98  ARG A CG  1 
ATOM   4822  C CD  . ARG C 2 98  ? 9.384   17.299  -37.955 1.00 58.80  ? 98  ARG A CD  1 
ATOM   4823  N NE  . ARG C 2 98  ? 10.652  16.630  -37.696 1.00 61.48  ? 98  ARG A NE  1 
ATOM   4824  C CZ  . ARG C 2 98  ? 10.747  15.413  -37.177 1.00 62.50  ? 98  ARG A CZ  1 
ATOM   4825  N NH1 . ARG C 2 98  ? 9.651   14.743  -36.847 1.00 61.02  ? 98  ARG A NH1 1 
ATOM   4826  N NH2 . ARG C 2 98  ? 11.939  14.869  -36.981 1.00 71.08  ? 98  ARG A NH2 1 
ATOM   4827  N N   . SER C 2 99  ? 6.066   18.499  -37.896 1.00 52.29  ? 99  SER A N   1 
ATOM   4828  C CA  . SER C 2 99  ? 5.056   17.480  -38.144 1.00 51.99  ? 99  SER A CA  1 
ATOM   4829  C C   . SER C 2 99  ? 5.598   16.073  -37.924 1.00 59.59  ? 99  SER A C   1 
ATOM   4830  O O   . SER C 2 99  ? 6.718   15.889  -37.478 1.00 61.04  ? 99  SER A O   1 
ATOM   4831  C CB  . SER C 2 99  ? 4.498   17.608  -39.561 1.00 56.47  ? 99  SER A CB  1 
ATOM   4832  O OG  . SER C 2 99  ? 5.526   17.453  -40.542 1.00 59.32  ? 99  SER A OG  1 
ATOM   4833  N N   . HIS C 2 100 ? 4.789   15.075  -38.237 1.00 59.77  ? 100 HIS A N   1 
ATOM   4834  C CA  . HIS C 2 100 ? 5.228   13.694  -38.163 1.00 61.95  ? 100 HIS A CA  1 
ATOM   4835  C C   . HIS C 2 100 ? 5.212   13.095  -39.571 1.00 64.15  ? 100 HIS A C   1 
ATOM   4836  O O   . HIS C 2 100 ? 4.448   13.534  -40.443 1.00 63.15  ? 100 HIS A O   1 
ATOM   4837  C CB  . HIS C 2 100 ? 4.306   12.916  -37.237 1.00 60.79  ? 100 HIS A CB  1 
ATOM   4838  C CG  . HIS C 2 100 ? 4.860   11.605  -36.778 1.00 63.09  ? 100 HIS A CG  1 
ATOM   4839  N ND1 . HIS C 2 100 ? 4.745   10.448  -37.518 1.00 65.24  ? 100 HIS A ND1 1 
ATOM   4840  C CD2 . HIS C 2 100 ? 5.498   11.261  -35.635 1.00 63.73  ? 100 HIS A CD2 1 
ATOM   4841  C CE1 . HIS C 2 100 ? 5.301   9.450   -36.855 1.00 67.21  ? 100 HIS A CE1 1 
ATOM   4842  N NE2 . HIS C 2 100 ? 5.767   9.917   -35.709 1.00 66.33  ? 100 HIS A NE2 1 
ATOM   4843  N N   . LEU C 2 101 ? 6.074   12.107  -39.793 1.00 67.33  ? 101 LEU A N   1 
ATOM   4844  C CA  . LEU C 2 101 ? 6.185   11.448  -41.085 1.00 69.99  ? 101 LEU A CA  1 
ATOM   4845  C C   . LEU C 2 101 ? 4.826   10.869  -41.486 1.00 68.90  ? 101 LEU A C   1 
ATOM   4846  O O   . LEU C 2 101 ? 4.423   10.913  -42.653 1.00 69.43  ? 101 LEU A O   1 
ATOM   4847  C CB  . LEU C 2 101 ? 7.227   10.337  -40.993 1.00 73.36  ? 101 LEU A CB  1 
ATOM   4848  C CG  . LEU C 2 101 ? 7.936   9.911   -42.274 1.00 76.86  ? 101 LEU A CG  1 
ATOM   4849  C CD1 . LEU C 2 101 ? 8.930   10.976  -42.714 1.00 77.67  ? 101 LEU A CD1 1 
ATOM   4850  C CD2 . LEU C 2 101 ? 8.621   8.579   -42.051 1.00 80.12  ? 101 LEU A CD2 1 
ATOM   4851  N N   . LEU C 2 102 ? 4.118   10.355  -40.485 1.00 67.12  ? 102 LEU A N   1 
ATOM   4852  C CA  . LEU C 2 102 ? 2.847   9.672   -40.682 1.00 66.08  ? 102 LEU A CA  1 
ATOM   4853  C C   . LEU C 2 102 ? 1.647   10.600  -40.830 1.00 63.31  ? 102 LEU A C   1 
ATOM   4854  O O   . LEU C 2 102 ? 0.575   10.154  -41.238 1.00 63.01  ? 102 LEU A O   1 
ATOM   4855  C CB  . LEU C 2 102 ? 2.573   8.738   -39.503 1.00 65.89  ? 102 LEU A CB  1 
ATOM   4856  C CG  . LEU C 2 102 ? 3.263   7.378   -39.451 1.00 68.87  ? 102 LEU A CG  1 
ATOM   4857  C CD1 . LEU C 2 102 ? 3.257   6.912   -38.006 1.00 68.55  ? 102 LEU A CD1 1 
ATOM   4858  C CD2 . LEU C 2 102 ? 2.557   6.369   -40.356 1.00 70.11  ? 102 LEU A CD2 1 
ATOM   4859  N N   . ARG C 2 103 ? 1.807   11.880  -40.510 1.00 61.79  ? 103 ARG A N   1 
ATOM   4860  C CA  . ARG C 2 103 ? 0.637   12.732  -40.338 1.00 59.27  ? 103 ARG A CA  1 
ATOM   4861  C C   . ARG C 2 103 ? 0.972   14.231  -40.283 1.00 58.07  ? 103 ARG A C   1 
ATOM   4862  O O   . ARG C 2 103 ? 1.796   14.665  -39.486 1.00 57.56  ? 103 ARG A O   1 
ATOM   4863  C CB  . ARG C 2 103 ? -0.059  12.284  -39.063 1.00 51.93  ? 103 ARG A CB  1 
ATOM   4864  C CG  . ARG C 2 103 ? -1.488  12.659  -38.968 1.00 52.47  ? 103 ARG A CG  1 
ATOM   4865  C CD  . ARG C 2 103 ? -2.415  11.808  -39.816 1.00 53.23  ? 103 ARG A CD  1 
ATOM   4866  N NE  . ARG C 2 103 ? -3.771  12.286  -39.574 1.00 51.24  ? 103 ARG A NE  1 
ATOM   4867  C CZ  . ARG C 2 103 ? -4.298  13.362  -40.155 1.00 50.18  ? 103 ARG A CZ  1 
ATOM   4868  N NH1 . ARG C 2 103 ? -3.593  14.049  -41.058 1.00 51.10  ? 103 ARG A NH1 1 
ATOM   4869  N NH2 . ARG C 2 103 ? -5.533  13.750  -39.842 1.00 48.38  ? 103 ARG A NH2 1 
ATOM   4870  N N   . ALA C 2 104 ? 0.327   15.021  -41.130 1.00 57.87  ? 104 ALA A N   1 
ATOM   4871  C CA  . ALA C 2 104 ? 0.622   16.453  -41.210 1.00 57.64  ? 104 ALA A CA  1 
ATOM   4872  C C   . ALA C 2 104 ? 0.250   17.274  -39.955 1.00 55.73  ? 104 ALA A C   1 
ATOM   4873  O O   . ALA C 2 104 ? 0.873   18.293  -39.659 1.00 55.41  ? 104 ALA A O   1 
ATOM   4874  C CB  . ALA C 2 104 ? -0.058  17.045  -42.430 1.00 57.79  ? 104 ALA A CB  1 
ATOM   4875  N N   . SER C 2 105 ? -0.763  16.818  -39.223 1.00 54.57  ? 105 SER A N   1 
ATOM   4876  C CA  . SER C 2 105 ? -1.440  17.626  -38.211 1.00 44.17  ? 105 SER A CA  1 
ATOM   4877  C C   . SER C 2 105 ? -0.870  17.389  -36.833 1.00 43.81  ? 105 SER A C   1 
ATOM   4878  O O   . SER C 2 105 ? -1.283  18.030  -35.861 1.00 42.15  ? 105 SER A O   1 
ATOM   4879  C CB  . SER C 2 105 ? -2.921  17.279  -38.202 1.00 43.09  ? 105 SER A CB  1 
ATOM   4880  O OG  . SER C 2 105 ? -3.077  15.890  -37.973 1.00 44.01  ? 105 SER A OG  1 
ATOM   4881  N N   . TRP C 2 106 ? 0.075   16.461  -36.762 1.00 45.56  ? 106 TRP A N   1 
ATOM   4882  C CA  . TRP C 2 106 ? 0.711   16.081  -35.508 1.00 47.74  ? 106 TRP A CA  1 
ATOM   4883  C C   . TRP C 2 106 ? 1.828   17.040  -35.088 1.00 47.62  ? 106 TRP A C   1 
ATOM   4884  O O   . TRP C 2 106 ? 2.737   17.321  -35.867 1.00 47.03  ? 106 TRP A O   1 
ATOM   4885  C CB  . TRP C 2 106 ? 1.280   14.663  -35.608 1.00 47.97  ? 106 TRP A CB  1 
ATOM   4886  C CG  . TRP C 2 106 ? 0.234   13.582  -35.594 1.00 51.83  ? 106 TRP A CG  1 
ATOM   4887  C CD1 . TRP C 2 106 ? -1.124  13.748  -35.589 1.00 46.52  ? 106 TRP A CD1 1 
ATOM   4888  C CD2 . TRP C 2 106 ? 0.464   12.165  -35.585 1.00 53.88  ? 106 TRP A CD2 1 
ATOM   4889  N NE1 . TRP C 2 106 ? -1.751  12.522  -35.584 1.00 47.46  ? 106 TRP A NE1 1 
ATOM   4890  C CE2 . TRP C 2 106 ? -0.799  11.535  -35.575 1.00 53.39  ? 106 TRP A CE2 1 
ATOM   4891  C CE3 . TRP C 2 106 ? 1.613   11.367  -35.591 1.00 52.69  ? 106 TRP A CE3 1 
ATOM   4892  C CZ2 . TRP C 2 106 ? -0.940  10.146  -35.570 1.00 55.26  ? 106 TRP A CZ2 1 
ATOM   4893  C CZ3 . TRP C 2 106 ? 1.469   9.995   -35.583 1.00 54.59  ? 106 TRP A CZ3 1 
ATOM   4894  C CH2 . TRP C 2 106 ? 0.207   9.398   -35.574 1.00 54.05  ? 106 TRP A CH2 1 
ATOM   4895  N N   . PHE C 2 107 ? 1.756   17.543  -33.855 1.00 45.92  ? 107 PHE A N   1 
ATOM   4896  C CA  . PHE C 2 107 ? 2.881   18.277  -33.290 1.00 45.76  ? 107 PHE A CA  1 
ATOM   4897  C C   . PHE C 2 107 ? 3.821   17.236  -32.706 1.00 47.85  ? 107 PHE A C   1 
ATOM   4898  O O   . PHE C 2 107 ? 3.657   16.827  -31.559 1.00 47.92  ? 107 PHE A O   1 
ATOM   4899  C CB  . PHE C 2 107 ? 2.431   19.200  -32.169 1.00 43.77  ? 107 PHE A CB  1 
ATOM   4900  C CG  . PHE C 2 107 ? 1.555   20.345  -32.607 1.00 42.25  ? 107 PHE A CG  1 
ATOM   4901  C CD1 . PHE C 2 107 ? 0.246   20.133  -32.998 1.00 41.29  ? 107 PHE A CD1 1 
ATOM   4902  C CD2 . PHE C 2 107 ? 2.026   21.646  -32.557 1.00 40.34  ? 107 PHE A CD2 1 
ATOM   4903  C CE1 . PHE C 2 107 ? -0.559  21.197  -33.370 1.00 40.03  ? 107 PHE A CE1 1 
ATOM   4904  C CE2 . PHE C 2 107 ? 1.232   22.702  -32.925 1.00 39.19  ? 107 PHE A CE2 1 
ATOM   4905  C CZ  . PHE C 2 107 ? -0.063  22.481  -33.335 1.00 38.43  ? 107 PHE A CZ  1 
ATOM   4906  N N   . ALA C 2 108 ? 4.801   16.790  -33.488 1.00 49.32  ? 108 ALA A N   1 
ATOM   4907  C CA  . ALA C 2 108 ? 5.643   15.685  -33.049 1.00 50.49  ? 108 ALA A CA  1 
ATOM   4908  C C   . ALA C 2 108 ? 6.875   16.128  -32.254 1.00 51.15  ? 108 ALA A C   1 
ATOM   4909  O O   . ALA C 2 108 ? 7.341   15.419  -31.366 1.00 52.16  ? 108 ALA A O   1 
ATOM   4910  C CB  . ALA C 2 108 ? 6.028   14.843  -34.215 1.00 52.86  ? 108 ALA A CB  1 
ATOM   4911  N N   . TYR C 2 109 ? 7.400   17.303  -32.570 1.00 50.76  ? 109 TYR A N   1 
ATOM   4912  C CA  . TYR C 2 109 ? 8.475   17.866  -31.769 1.00 55.64  ? 109 TYR A CA  1 
ATOM   4913  C C   . TYR C 2 109 ? 8.251   19.358  -31.612 1.00 49.19  ? 109 TYR A C   1 
ATOM   4914  O O   . TYR C 2 109 ? 7.993   20.055  -32.577 1.00 48.89  ? 109 TYR A O   1 
ATOM   4915  C CB  . TYR C 2 109 ? 9.857   17.552  -32.365 1.00 58.65  ? 109 TYR A CB  1 
ATOM   4916  C CG  . TYR C 2 109 ? 10.190  16.068  -32.376 1.00 61.30  ? 109 TYR A CG  1 
ATOM   4917  C CD1 . TYR C 2 109 ? 10.928  15.488  -31.350 1.00 62.62  ? 109 TYR A CD1 1 
ATOM   4918  C CD2 . TYR C 2 109 ? 9.747   15.241  -33.411 1.00 62.66  ? 109 TYR A CD2 1 
ATOM   4919  C CE1 . TYR C 2 109 ? 11.217  14.126  -31.355 1.00 65.15  ? 109 TYR A CE1 1 
ATOM   4920  C CE2 . TYR C 2 109 ? 10.026  13.884  -33.421 1.00 65.06  ? 109 TYR A CE2 1 
ATOM   4921  C CZ  . TYR C 2 109 ? 10.763  13.332  -32.394 1.00 66.47  ? 109 TYR A CZ  1 
ATOM   4922  O OH  . TYR C 2 109 ? 11.042  11.982  -32.418 1.00 69.37  ? 109 TYR A OH  1 
ATOM   4923  N N   . TRP C 2 110 ? 8.337   19.824  -30.371 1.00 52.04  ? 110 TRP A N   1 
ATOM   4924  C CA  . TRP C 2 110 ? 7.988   21.185  -30.002 1.00 46.07  ? 110 TRP A CA  1 
ATOM   4925  C C   . TRP C 2 110 ? 9.240   21.961  -29.659 1.00 46.96  ? 110 TRP A C   1 
ATOM   4926  O O   . TRP C 2 110 ? 10.142  21.422  -29.037 1.00 48.32  ? 110 TRP A O   1 
ATOM   4927  C CB  . TRP C 2 110 ? 7.121   21.162  -28.749 1.00 44.20  ? 110 TRP A CB  1 
ATOM   4928  C CG  . TRP C 2 110 ? 5.790   20.548  -28.921 1.00 43.19  ? 110 TRP A CG  1 
ATOM   4929  C CD1 . TRP C 2 110 ? 5.504   19.227  -29.057 1.00 44.16  ? 110 TRP A CD1 1 
ATOM   4930  C CD2 . TRP C 2 110 ? 4.542   21.237  -28.948 1.00 41.19  ? 110 TRP A CD2 1 
ATOM   4931  N NE1 . TRP C 2 110 ? 4.154   19.049  -29.186 1.00 42.84  ? 110 TRP A NE1 1 
ATOM   4932  C CE2 . TRP C 2 110 ? 3.540   20.273  -29.122 1.00 41.02  ? 110 TRP A CE2 1 
ATOM   4933  C CE3 . TRP C 2 110 ? 4.177   22.581  -28.852 1.00 39.75  ? 110 TRP A CE3 1 
ATOM   4934  C CZ2 . TRP C 2 110 ? 2.193   20.609  -29.191 1.00 43.62  ? 110 TRP A CZ2 1 
ATOM   4935  C CZ3 . TRP C 2 110 ? 2.847   22.914  -28.925 1.00 38.24  ? 110 TRP A CZ3 1 
ATOM   4936  C CH2 . TRP C 2 110 ? 1.869   21.935  -29.093 1.00 42.26  ? 110 TRP A CH2 1 
ATOM   4937  N N   . GLY C 2 111 ? 9.283   23.233  -30.041 1.00 46.34  ? 111 GLY A N   1 
ATOM   4938  C CA  . GLY C 2 111 ? 10.290  24.144  -29.539 1.00 46.83  ? 111 GLY A CA  1 
ATOM   4939  C C   . GLY C 2 111 ? 10.071  24.390  -28.050 1.00 47.44  ? 111 GLY A C   1 
ATOM   4940  O O   . GLY C 2 111 ? 9.152   23.841  -27.439 1.00 45.97  ? 111 GLY A O   1 
ATOM   4941  N N   . GLN C 2 112 ? 10.923  25.210  -27.446 1.00 47.86  ? 112 GLN A N   1 
ATOM   4942  C CA  . GLN C 2 112 ? 10.807  25.481  -26.023 1.00 46.56  ? 112 GLN A CA  1 
ATOM   4943  C C   . GLN C 2 112 ? 9.823   26.614  -25.767 1.00 44.62  ? 112 GLN A C   1 
ATOM   4944  O O   . GLN C 2 112 ? 9.520   26.917  -24.623 1.00 43.84  ? 112 GLN A O   1 
ATOM   4945  C CB  . GLN C 2 112 ? 12.157  25.854  -25.444 1.00 47.73  ? 112 GLN A CB  1 
ATOM   4946  C CG  . GLN C 2 112 ? 12.435  27.346  -25.470 1.00 47.38  ? 112 GLN A CG  1 
ATOM   4947  C CD  . GLN C 2 112 ? 13.278  27.805  -26.654 1.00 49.34  ? 112 GLN A CD  1 
ATOM   4948  O OE1 . GLN C 2 112 ? 13.399  27.110  -27.671 1.00 48.56  ? 112 GLN A OE1 1 
ATOM   4949  N NE2 . GLN C 2 112 ? 13.866  28.990  -26.520 1.00 47.66  ? 112 GLN A NE2 1 
ATOM   4950  N N   . GLY C 2 113 ? 9.331   27.243  -26.831 1.00 44.04  ? 113 GLY A N   1 
ATOM   4951  C CA  . GLY C 2 113 ? 8.378   28.330  -26.695 1.00 42.23  ? 113 GLY A CA  1 
ATOM   4952  C C   . GLY C 2 113 ? 9.000   29.706  -26.547 1.00 42.39  ? 113 GLY A C   1 
ATOM   4953  O O   . GLY C 2 113 ? 10.072  29.848  -25.976 1.00 43.71  ? 113 GLY A O   1 
ATOM   4954  N N   . THR C 2 114 ? 8.313   30.720  -27.061 1.00 41.33  ? 114 THR A N   1 
ATOM   4955  C CA  . THR C 2 114 ? 8.707   32.121  -26.928 1.00 41.31  ? 114 THR A CA  1 
ATOM   4956  C C   . THR C 2 114 ? 7.591   32.904  -26.220 1.00 39.77  ? 114 THR A C   1 
ATOM   4957  O O   . THR C 2 114 ? 6.442   32.891  -26.661 1.00 39.01  ? 114 THR A O   1 
ATOM   4958  C CB  . THR C 2 114 ? 8.950   32.748  -28.323 1.00 42.43  ? 114 THR A CB  1 
ATOM   4959  O OG1 . THR C 2 114 ? 10.171  32.246  -28.880 1.00 44.37  ? 114 THR A OG1 1 
ATOM   4960  C CG2 . THR C 2 114 ? 9.036   34.248  -28.229 1.00 42.60  ? 114 THR A CG2 1 
ATOM   4961  N N   . MET C 2 115 ? 7.894   33.576  -25.117 1.00 38.35  ? 115 MET A N   1 
ATOM   4962  C CA  . MET C 2 115 ? 6.851   34.383  -24.507 1.00 40.12  ? 115 MET A CA  1 
ATOM   4963  C C   . MET C 2 115 ? 6.790   35.765  -25.152 1.00 40.87  ? 115 MET A C   1 
ATOM   4964  O O   . MET C 2 115 ? 7.758   36.516  -25.128 1.00 42.16  ? 115 MET A O   1 
ATOM   4965  C CB  . MET C 2 115 ? 7.027   34.514  -23.000 1.00 36.47  ? 115 MET A CB  1 
ATOM   4966  C CG  . MET C 2 115 ? 5.891   35.296  -22.339 1.00 35.35  ? 115 MET A CG  1 
ATOM   4967  S SD  . MET C 2 115 ? 4.238   34.503  -22.373 1.00 46.93  ? 115 MET A SD  1 
ATOM   4968  C CE  . MET C 2 115 ? 4.293   33.525  -20.863 1.00 57.95  ? 115 MET A CE  1 
ATOM   4969  N N   . VAL C 2 116 ? 5.656   36.107  -25.742 1.00 40.26  ? 116 VAL A N   1 
ATOM   4970  C CA  . VAL C 2 116 ? 5.489   37.457  -26.241 1.00 41.21  ? 116 VAL A CA  1 
ATOM   4971  C C   . VAL C 2 116 ? 4.527   38.206  -25.321 1.00 40.75  ? 116 VAL A C   1 
ATOM   4972  O O   . VAL C 2 116 ? 3.380   37.779  -25.142 1.00 40.05  ? 116 VAL A O   1 
ATOM   4973  C CB  . VAL C 2 116 ? 4.967   37.462  -27.681 1.00 41.68  ? 116 VAL A CB  1 
ATOM   4974  C CG1 . VAL C 2 116 ? 4.704   38.876  -28.161 1.00 39.72  ? 116 VAL A CG1 1 
ATOM   4975  C CG2 . VAL C 2 116 ? 5.946   36.766  -28.594 1.00 39.94  ? 116 VAL A CG2 1 
ATOM   4976  N N   . THR C 2 117 ? 5.003   39.302  -24.722 1.00 41.16  ? 117 THR A N   1 
ATOM   4977  C CA  . THR C 2 117 ? 4.151   40.182  -23.921 1.00 40.40  ? 117 THR A CA  1 
ATOM   4978  C C   . THR C 2 117 ? 3.889   41.490  -24.662 1.00 41.33  ? 117 THR A C   1 
ATOM   4979  O O   . THR C 2 117 ? 4.820   42.143  -25.119 1.00 42.70  ? 117 THR A O   1 
ATOM   4980  C CB  . THR C 2 117 ? 4.792   40.518  -22.559 1.00 40.37  ? 117 THR A CB  1 
ATOM   4981  O OG1 . THR C 2 117 ? 4.870   39.336  -21.757 1.00 39.42  ? 117 THR A OG1 1 
ATOM   4982  C CG2 . THR C 2 117 ? 3.949   41.533  -21.833 1.00 40.16  ? 117 THR A CG2 1 
ATOM   4983  N N   . VAL C 2 118 ? 2.625   41.878  -24.790 1.00 40.80  ? 118 VAL A N   1 
ATOM   4984  C CA  . VAL C 2 118 ? 2.310   43.159  -25.424 1.00 41.86  ? 118 VAL A CA  1 
ATOM   4985  C C   . VAL C 2 118 ? 1.522   44.042  -24.470 1.00 41.31  ? 118 VAL A C   1 
ATOM   4986  O O   . VAL C 2 118 ? 0.390   43.738  -24.140 1.00 40.23  ? 118 VAL A O   1 
ATOM   4987  C CB  . VAL C 2 118 ? 1.533   43.001  -26.773 1.00 40.75  ? 118 VAL A CB  1 
ATOM   4988  C CG1 . VAL C 2 118 ? 1.348   44.365  -27.449 1.00 42.91  ? 118 VAL A CG1 1 
ATOM   4989  C CG2 . VAL C 2 118 ? 2.255   42.048  -27.725 1.00 40.76  ? 118 VAL A CG2 1 
ATOM   4990  N N   . SER C 2 119 ? 2.128   45.137  -24.034 1.00 42.42  ? 119 SER A N   1 
ATOM   4991  C CA  . SER C 2 119 ? 1.497   46.032  -23.081 1.00 41.04  ? 119 SER A CA  1 
ATOM   4992  C C   . SER C 2 119 ? 1.925   47.471  -23.353 1.00 45.44  ? 119 SER A C   1 
ATOM   4993  O O   . SER C 2 119 ? 2.874   47.704  -24.094 1.00 46.69  ? 119 SER A O   1 
ATOM   4994  C CB  . SER C 2 119 ? 1.848   45.603  -21.659 1.00 39.85  ? 119 SER A CB  1 
ATOM   4995  O OG  . SER C 2 119 ? 1.924   46.707  -20.790 1.00 40.77  ? 119 SER A OG  1 
ATOM   4996  N N   . SER C 2 120 ? 1.211   48.435  -22.778 1.00 46.13  ? 120 SER A N   1 
ATOM   4997  C CA  . SER C 2 120 ? 1.535   49.853  -22.945 1.00 48.09  ? 120 SER A CA  1 
ATOM   4998  C C   . SER C 2 120 ? 2.351   50.343  -21.771 1.00 48.30  ? 120 SER A C   1 
ATOM   4999  O O   . SER C 2 120 ? 2.730   51.517  -21.710 1.00 48.48  ? 120 SER A O   1 
ATOM   5000  C CB  . SER C 2 120 ? 0.272   50.705  -23.057 1.00 47.43  ? 120 SER A CB  1 
ATOM   5001  O OG  . SER C 2 120 ? -0.201  50.754  -24.390 1.00 50.92  ? 120 SER A OG  1 
ATOM   5002  N N   . ALA C 2 121 ? 2.595   49.438  -20.825 1.00 46.41  ? 121 ALA A N   1 
ATOM   5003  C CA  . ALA C 2 121 ? 3.412   49.749  -19.663 1.00 46.17  ? 121 ALA A CA  1 
ATOM   5004  C C   . ALA C 2 121 ? 4.874   49.896  -20.096 1.00 47.20  ? 121 ALA A C   1 
ATOM   5005  O O   . ALA C 2 121 ? 5.339   49.195  -21.000 1.00 47.05  ? 121 ALA A O   1 
ATOM   5006  C CB  . ALA C 2 121 ? 3.256   48.666  -18.609 1.00 43.64  ? 121 ALA A CB  1 
ATOM   5007  N N   . SER C 2 122 ? 5.602   50.816  -19.482 1.00 48.33  ? 122 SER A N   1 
ATOM   5008  C CA  . SER C 2 122 ? 7.019   50.896  -19.791 1.00 49.64  ? 122 SER A CA  1 
ATOM   5009  C C   . SER C 2 122 ? 7.878   50.461  -18.609 1.00 48.86  ? 122 SER A C   1 
ATOM   5010  O O   . SER C 2 122 ? 7.435   50.485  -17.454 1.00 48.21  ? 122 SER A O   1 
ATOM   5011  C CB  . SER C 2 122 ? 7.406   52.280  -20.295 1.00 52.76  ? 122 SER A CB  1 
ATOM   5012  O OG  . SER C 2 122 ? 6.890   53.281  -19.446 1.00 53.90  ? 122 SER A OG  1 
ATOM   5013  N N   . THR C 2 123 ? 9.096   50.034  -18.914 1.00 49.10  ? 123 THR A N   1 
ATOM   5014  C CA  . THR C 2 123 ? 9.984   49.484  -17.910 1.00 47.03  ? 123 THR A CA  1 
ATOM   5015  C C   . THR C 2 123 ? 10.100  50.391  -16.683 1.00 47.63  ? 123 THR A C   1 
ATOM   5016  O O   . THR C 2 123 ? 10.542  51.533  -16.770 1.00 53.98  ? 123 THR A O   1 
ATOM   5017  C CB  . THR C 2 123 ? 11.372  49.158  -18.505 1.00 48.12  ? 123 THR A CB  1 
ATOM   5018  O OG1 . THR C 2 123 ? 11.213  48.305  -19.641 1.00 47.68  ? 123 THR A OG1 1 
ATOM   5019  C CG2 . THR C 2 123 ? 12.232  48.445  -17.492 1.00 47.43  ? 123 THR A CG2 1 
ATOM   5020  N N   . LYS C 2 124 ? 9.626   49.875  -15.557 1.00 46.23  ? 124 LYS A N   1 
ATOM   5021  C CA  . LYS C 2 124 ? 9.796   50.498  -14.265 1.00 46.51  ? 124 LYS A CA  1 
ATOM   5022  C C   . LYS C 2 124 ? 10.433  49.441  -13.404 1.00 45.36  ? 124 LYS A C   1 
ATOM   5023  O O   . LYS C 2 124 ? 10.143  48.257  -13.564 1.00 43.88  ? 124 LYS A O   1 
ATOM   5024  C CB  . LYS C 2 124 ? 8.450   50.885  -13.680 1.00 46.05  ? 124 LYS A CB  1 
ATOM   5025  C CG  . LYS C 2 124 ? 8.508   51.376  -12.248 1.00 46.38  ? 124 LYS A CG  1 
ATOM   5026  C CD  . LYS C 2 124 ? 7.120   51.804  -11.777 1.00 53.60  ? 124 LYS A CD  1 
ATOM   5027  C CE  . LYS C 2 124 ? 7.188   52.726  -10.555 1.00 54.79  ? 124 LYS A CE  1 
ATOM   5028  N NZ  . LYS C 2 124 ? 5.852   53.351  -10.240 1.00 55.35  ? 124 LYS A NZ  1 
ATOM   5029  N N   . GLY C 2 125 ? 11.332  49.858  -12.521 1.00 46.22  ? 125 GLY A N   1 
ATOM   5030  C CA  . GLY C 2 125 ? 11.935  48.935  -11.582 1.00 45.42  ? 125 GLY A CA  1 
ATOM   5031  C C   . GLY C 2 125 ? 11.072  48.782  -10.344 1.00 45.48  ? 125 GLY A C   1 
ATOM   5032  O O   . GLY C 2 125 ? 10.372  49.720  -9.945  1.00 45.01  ? 125 GLY A O   1 
ATOM   5033  N N   . PRO C 2 126 ? 11.123  47.598  -9.723  1.00 44.45  ? 126 PRO A N   1 
ATOM   5034  C CA  . PRO C 2 126 ? 10.353  47.307  -8.515  1.00 43.88  ? 126 PRO A CA  1 
ATOM   5035  C C   . PRO C 2 126 ? 10.820  48.131  -7.329  1.00 45.29  ? 126 PRO A C   1 
ATOM   5036  O O   . PRO C 2 126 ? 11.980  48.521  -7.261  1.00 46.45  ? 126 PRO A O   1 
ATOM   5037  C CB  . PRO C 2 126 ? 10.654  45.830  -8.258  1.00 42.76  ? 126 PRO A CB  1 
ATOM   5038  C CG  . PRO C 2 126 ? 11.970  45.596  -8.882  1.00 43.39  ? 126 PRO A CG  1 
ATOM   5039  C CD  . PRO C 2 126 ? 12.004  46.480  -10.095 1.00 44.19  ? 126 PRO A CD  1 
ATOM   5040  N N   . SER C 2 127 ? 9.904   48.406  -6.413  1.00 45.37  ? 127 SER A N   1 
ATOM   5041  C CA  . SER C 2 127 ? 10.254  48.986  -5.138  1.00 46.66  ? 127 SER A CA  1 
ATOM   5042  C C   . SER C 2 127 ? 9.979   47.917  -4.096  1.00 45.71  ? 127 SER A C   1 
ATOM   5043  O O   . SER C 2 127 ? 9.056   47.113  -4.245  1.00 44.88  ? 127 SER A O   1 
ATOM   5044  C CB  . SER C 2 127 ? 9.443   50.251  -4.868  1.00 48.36  ? 127 SER A CB  1 
ATOM   5045  O OG  . SER C 2 127 ? 8.376   49.990  -3.973  1.00 48.45  ? 127 SER A OG  1 
ATOM   5046  N N   . VAL C 2 128 ? 10.780  47.908  -3.042  1.00 46.18  ? 128 VAL A N   1 
ATOM   5047  C CA  . VAL C 2 128 ? 10.872  46.751  -2.171  1.00 45.58  ? 128 VAL A CA  1 
ATOM   5048  C C   . VAL C 2 128 ? 10.646  47.062  -0.682  1.00 46.77  ? 128 VAL A C   1 
ATOM   5049  O O   . VAL C 2 128 ? 11.280  47.952  -0.115  1.00 48.28  ? 128 VAL A O   1 
ATOM   5050  C CB  . VAL C 2 128 ? 12.225  46.089  -2.369  1.00 45.40  ? 128 VAL A CB  1 
ATOM   5051  C CG1 . VAL C 2 128 ? 12.524  45.167  -1.228  1.00 45.59  ? 128 VAL A CG1 1 
ATOM   5052  C CG2 . VAL C 2 128 ? 12.235  45.343  -3.685  1.00 43.45  ? 128 VAL A CG2 1 
ATOM   5053  N N   . PHE C 2 129 ? 9.739   46.323  -0.050  1.00 46.24  ? 129 PHE A N   1 
ATOM   5054  C CA  . PHE C 2 129 ? 9.408   46.574  1.338   1.00 47.13  ? 129 PHE A CA  1 
ATOM   5055  C C   . PHE C 2 129 ? 9.504   45.310  2.190   1.00 45.84  ? 129 PHE A C   1 
ATOM   5056  O O   . PHE C 2 129 ? 9.233   44.209  1.716   1.00 44.91  ? 129 PHE A O   1 
ATOM   5057  C CB  . PHE C 2 129 ? 8.022   47.191  1.439   1.00 45.99  ? 129 PHE A CB  1 
ATOM   5058  C CG  . PHE C 2 129 ? 7.838   48.414  0.580   1.00 48.92  ? 129 PHE A CG  1 
ATOM   5059  C CD1 . PHE C 2 129 ? 8.450   49.612  0.911   1.00 50.22  ? 129 PHE A CD1 1 
ATOM   5060  C CD2 . PHE C 2 129 ? 7.039   48.368  -0.560  1.00 47.98  ? 129 PHE A CD2 1 
ATOM   5061  C CE1 . PHE C 2 129 ? 8.277   50.740  0.116   1.00 50.97  ? 129 PHE A CE1 1 
ATOM   5062  C CE2 . PHE C 2 129 ? 6.856   49.489  -1.358  1.00 45.78  ? 129 PHE A CE2 1 
ATOM   5063  C CZ  . PHE C 2 129 ? 7.471   50.675  -1.021  1.00 50.02  ? 129 PHE A CZ  1 
ATOM   5064  N N   . PRO C 2 130 ? 9.911   45.473  3.460   1.00 55.65  ? 130 PRO A N   1 
ATOM   5065  C CA  . PRO C 2 130 ? 10.094  44.355  4.382   1.00 47.63  ? 130 PRO A CA  1 
ATOM   5066  C C   . PRO C 2 130 ? 8.769   43.788  4.803   1.00 61.73  ? 130 PRO A C   1 
ATOM   5067  O O   . PRO C 2 130 ? 7.821   44.543  5.008   1.00 62.52  ? 130 PRO A O   1 
ATOM   5068  C CB  . PRO C 2 130 ? 10.732  45.017  5.607   1.00 49.25  ? 130 PRO A CB  1 
ATOM   5069  C CG  . PRO C 2 130 ? 11.219  46.332  5.153   1.00 49.46  ? 130 PRO A CG  1 
ATOM   5070  C CD  . PRO C 2 130 ? 10.283  46.753  4.082   1.00 48.41  ? 130 PRO A CD  1 
ATOM   5071  N N   . LEU C 2 131 ? 8.696   42.474  4.942   1.00 60.18  ? 131 LEU A N   1 
ATOM   5072  C CA  . LEU C 2 131 ? 7.581   41.858  5.650   1.00 58.03  ? 131 LEU A CA  1 
ATOM   5073  C C   . LEU C 2 131 ? 8.127   41.358  6.975   1.00 60.76  ? 131 LEU A C   1 
ATOM   5074  O O   . LEU C 2 131 ? 8.490   40.198  7.104   1.00 61.52  ? 131 LEU A O   1 
ATOM   5075  C CB  . LEU C 2 131 ? 6.971   40.717  4.832   1.00 51.14  ? 131 LEU A CB  1 
ATOM   5076  C CG  . LEU C 2 131 ? 6.337   41.143  3.506   1.00 45.39  ? 131 LEU A CG  1 
ATOM   5077  C CD1 . LEU C 2 131 ? 5.765   39.954  2.785   1.00 44.46  ? 131 LEU A CD1 1 
ATOM   5078  C CD2 . LEU C 2 131 ? 5.272   42.201  3.745   1.00 45.82  ? 131 LEU A CD2 1 
ATOM   5079  N N   . ALA C 2 132 ? 8.214   42.256  7.947   1.00 62.13  ? 132 ALA A N   1 
ATOM   5080  C CA  . ALA C 2 132 ? 8.794   41.948  9.247   1.00 63.45  ? 132 ALA A CA  1 
ATOM   5081  C C   . ALA C 2 132 ? 7.843   41.135  10.119  1.00 64.27  ? 132 ALA A C   1 
ATOM   5082  O O   . ALA C 2 132 ? 6.621   41.307  10.040  1.00 63.79  ? 132 ALA A O   1 
ATOM   5083  C CB  . ALA C 2 132 ? 9.179   43.239  9.962   1.00 64.51  ? 132 ALA A CB  1 
ATOM   5084  N N   . PRO C 2 133 ? 8.404   40.258  10.974  1.00 65.75  ? 133 PRO A N   1 
ATOM   5085  C CA  . PRO C 2 133 ? 7.610   39.474  11.938  1.00 67.45  ? 133 PRO A CA  1 
ATOM   5086  C C   . PRO C 2 133 ? 7.384   40.193  13.268  1.00 69.43  ? 133 PRO A C   1 
ATOM   5087  O O   . PRO C 2 133 ? 8.142   39.926  14.196  1.00 70.99  ? 133 PRO A O   1 
ATOM   5088  C CB  . PRO C 2 133 ? 8.461   38.211  12.152  1.00 68.22  ? 133 PRO A CB  1 
ATOM   5089  C CG  . PRO C 2 133 ? 9.884   38.584  11.703  1.00 67.46  ? 133 PRO A CG  1 
ATOM   5090  C CD  . PRO C 2 133 ? 9.847   39.967  11.081  1.00 66.03  ? 133 PRO A CD  1 
ATOM   5091  N N   . GLY C 2 141 ? 7.538   29.802  17.987  1.00 54.07  ? 141 GLY A N   1 
ATOM   5092  C CA  . GLY C 2 141 ? 8.520   28.766  17.680  1.00 54.02  ? 141 GLY A CA  1 
ATOM   5093  C C   . GLY C 2 141 ? 9.014   28.711  16.232  1.00 52.33  ? 141 GLY A C   1 
ATOM   5094  O O   . GLY C 2 141 ? 10.100  28.201  15.941  1.00 52.54  ? 141 GLY A O   1 
ATOM   5095  N N   . THR C 2 142 ? 8.210   29.234  15.312  1.00 50.84  ? 142 THR A N   1 
ATOM   5096  C CA  . THR C 2 142 ? 8.617   29.320  13.920  1.00 49.35  ? 142 THR A CA  1 
ATOM   5097  C C   . THR C 2 142 ? 8.185   30.663  13.326  1.00 48.63  ? 142 THR A C   1 
ATOM   5098  O O   . THR C 2 142 ? 6.999   30.897  13.083  1.00 48.00  ? 142 THR A O   1 
ATOM   5099  C CB  . THR C 2 142 ? 8.040   28.144  13.103  1.00 48.28  ? 142 THR A CB  1 
ATOM   5100  O OG1 . THR C 2 142 ? 8.361   26.909  13.763  1.00 49.69  ? 142 THR A OG1 1 
ATOM   5101  C CG2 . THR C 2 142 ? 8.589   28.144  11.666  1.00 46.90  ? 142 THR A CG2 1 
ATOM   5102  N N   . ALA C 2 143 ? 9.155   31.543  13.100  1.00 49.10  ? 143 ALA A N   1 
ATOM   5103  C CA  . ALA C 2 143 ? 8.872   32.872  12.588  1.00 48.86  ? 143 ALA A CA  1 
ATOM   5104  C C   . ALA C 2 143 ? 8.849   32.864  11.079  1.00 47.25  ? 143 ALA A C   1 
ATOM   5105  O O   . ALA C 2 143 ? 9.476   32.015  10.444  1.00 46.84  ? 143 ALA A O   1 
ATOM   5106  C CB  . ALA C 2 143 ? 9.913   33.860  13.077  1.00 50.74  ? 143 ALA A CB  1 
ATOM   5107  N N   . ALA C 2 144 ? 8.130   33.828  10.517  1.00 46.71  ? 144 ALA A N   1 
ATOM   5108  C CA  . ALA C 2 144 ? 8.078   34.021  9.089   1.00 37.53  ? 144 ALA A CA  1 
ATOM   5109  C C   . ALA C 2 144 ? 8.422   35.463  8.816   1.00 44.52  ? 144 ALA A C   1 
ATOM   5110  O O   . ALA C 2 144 ? 8.000   36.358  9.554   1.00 39.50  ? 144 ALA A O   1 
ATOM   5111  C CB  . ALA C 2 144 ? 6.697   33.693  8.563   1.00 36.35  ? 144 ALA A CB  1 
ATOM   5112  N N   . LEU C 2 145 ? 9.210   35.681  7.769   1.00 43.70  ? 145 LEU A N   1 
ATOM   5113  C CA  . LEU C 2 145 ? 9.487   37.027  7.280   1.00 44.64  ? 145 LEU A CA  1 
ATOM   5114  C C   . LEU C 2 145 ? 9.543   37.016  5.760   1.00 43.36  ? 145 LEU A C   1 
ATOM   5115  O O   . LEU C 2 145 ? 9.519   35.946  5.157   1.00 42.66  ? 145 LEU A O   1 
ATOM   5116  C CB  . LEU C 2 145 ? 10.780  37.586  7.874   1.00 47.07  ? 145 LEU A CB  1 
ATOM   5117  C CG  . LEU C 2 145 ? 11.970  36.644  7.816   1.00 47.65  ? 145 LEU A CG  1 
ATOM   5118  C CD1 . LEU C 2 145 ? 12.814  36.918  6.586   1.00 47.73  ? 145 LEU A CD1 1 
ATOM   5119  C CD2 . LEU C 2 145 ? 12.783  36.768  9.086   1.00 50.10  ? 145 LEU A CD2 1 
ATOM   5120  N N   . GLY C 2 146 ? 9.600   38.195  5.142   1.00 43.37  ? 146 GLY A N   1 
ATOM   5121  C CA  . GLY C 2 146 ? 9.547   38.266  3.696   1.00 41.94  ? 146 GLY A CA  1 
ATOM   5122  C C   . GLY C 2 146 ? 9.901   39.596  3.069   1.00 42.82  ? 146 GLY A C   1 
ATOM   5123  O O   . GLY C 2 146 ? 10.358  40.521  3.734   1.00 38.98  ? 146 GLY A O   1 
ATOM   5124  N N   . CYS C 2 147 ? 9.689   39.676  1.760   1.00 41.78  ? 147 CYS A N   1 
ATOM   5125  C CA  . CYS C 2 147 ? 9.923   40.900  0.991   1.00 42.67  ? 147 CYS A CA  1 
ATOM   5126  C C   . CYS C 2 147 ? 8.735   41.167  0.082   1.00 41.04  ? 147 CYS A C   1 
ATOM   5127  O O   . CYS C 2 147 ? 8.273   40.272  -0.624  1.00 39.24  ? 147 CYS A O   1 
ATOM   5128  C CB  . CYS C 2 147 ? 11.200  40.788  0.142   1.00 43.49  ? 147 CYS A CB  1 
ATOM   5129  S SG  . CYS C 2 147 ? 12.705  41.233  1.023   1.00 85.19  ? 147 CYS A SG  1 
ATOM   5130  N N   . LEU C 2 148 ? 8.247   42.399  0.102   1.00 42.10  ? 148 LEU A N   1 
ATOM   5131  C CA  . LEU C 2 148 ? 7.150   42.789  -0.766  1.00 41.60  ? 148 LEU A CA  1 
ATOM   5132  C C   . LEU C 2 148 ? 7.704   43.479  -1.999  1.00 42.03  ? 148 LEU A C   1 
ATOM   5133  O O   . LEU C 2 148 ? 8.204   44.600  -1.910  1.00 43.88  ? 148 LEU A O   1 
ATOM   5134  C CB  . LEU C 2 148 ? 6.218   43.746  -0.044  1.00 43.36  ? 148 LEU A CB  1 
ATOM   5135  C CG  . LEU C 2 148 ? 4.945   43.906  -0.855  1.00 43.27  ? 148 LEU A CG  1 
ATOM   5136  C CD1 . LEU C 2 148 ? 4.225   42.551  -0.917  1.00 41.52  ? 148 LEU A CD1 1 
ATOM   5137  C CD2 . LEU C 2 148 ? 4.060   44.977  -0.270  1.00 45.66  ? 148 LEU A CD2 1 
ATOM   5138  N N   . VAL C 2 149 ? 7.630   42.823  -3.154  1.00 40.61  ? 149 VAL A N   1 
ATOM   5139  C CA  . VAL C 2 149 ? 8.226   43.408  -4.357  1.00 41.11  ? 149 VAL A CA  1 
ATOM   5140  C C   . VAL C 2 149 ? 7.172   44.126  -5.207  1.00 41.21  ? 149 VAL A C   1 
ATOM   5141  O O   . VAL C 2 149 ? 6.429   43.494  -5.954  1.00 39.95  ? 149 VAL A O   1 
ATOM   5142  C CB  . VAL C 2 149 ? 8.999   42.355  -5.171  1.00 39.97  ? 149 VAL A CB  1 
ATOM   5143  C CG1 . VAL C 2 149 ? 9.700   43.004  -6.348  1.00 36.30  ? 149 VAL A CG1 1 
ATOM   5144  C CG2 . VAL C 2 149 ? 10.018  41.649  -4.283  1.00 35.52  ? 149 VAL A CG2 1 
ATOM   5145  N N   . LYS C 2 150 ? 7.105   45.448  -5.092  1.00 42.92  ? 150 LYS A N   1 
ATOM   5146  C CA  . LYS C 2 150 ? 5.986   46.169  -5.697  1.00 43.63  ? 150 LYS A CA  1 
ATOM   5147  C C   . LYS C 2 150 ? 6.293   46.938  -6.988  1.00 45.10  ? 150 LYS A C   1 
ATOM   5148  O O   . LYS C 2 150 ? 7.368   47.509  -7.148  1.00 46.57  ? 150 LYS A O   1 
ATOM   5149  C CB  . LYS C 2 150 ? 5.307   47.090  -4.676  1.00 44.97  ? 150 LYS A CB  1 
ATOM   5150  C CG  . LYS C 2 150 ? 3.899   46.651  -4.345  1.00 44.21  ? 150 LYS A CG  1 
ATOM   5151  C CD  . LYS C 2 150 ? 3.225   47.569  -3.327  1.00 46.86  ? 150 LYS A CD  1 
ATOM   5152  C CE  . LYS C 2 150 ? 1.769   47.948  -3.723  1.00 57.39  ? 150 LYS A CE  1 
ATOM   5153  N NZ  . LYS C 2 150 ? 0.736   46.900  -3.387  1.00 56.30  ? 150 LYS A NZ  1 
ATOM   5154  N N   . ASP C 2 151 ? 5.337   46.903  -7.913  1.00 44.77  ? 151 ASP A N   1 
ATOM   5155  C CA  . ASP C 2 151 ? 5.237   47.866  -9.010  1.00 46.29  ? 151 ASP A CA  1 
ATOM   5156  C C   . ASP C 2 151 ? 6.367   47.908  -10.015 1.00 46.00  ? 151 ASP A C   1 
ATOM   5157  O O   . ASP C 2 151 ? 7.037   48.932  -10.169 1.00 47.83  ? 151 ASP A O   1 
ATOM   5158  C CB  . ASP C 2 151 ? 4.987   49.256  -8.456  1.00 49.66  ? 151 ASP A CB  1 
ATOM   5159  C CG  . ASP C 2 151 ? 3.605   49.395  -7.893  1.00 51.17  ? 151 ASP A CG  1 
ATOM   5160  O OD1 . ASP C 2 151 ? 3.190   48.521  -7.096  1.00 50.19  ? 151 ASP A OD1 1 
ATOM   5161  O OD2 . ASP C 2 151 ? 2.909   50.357  -8.271  1.00 53.68  ? 151 ASP A OD2 1 
ATOM   5162  N N   . TYR C 2 152 ? 6.539   46.803  -10.728 1.00 44.19  ? 152 TYR A N   1 
ATOM   5163  C CA  . TYR C 2 152 ? 7.583   46.704  -11.725 1.00 44.58  ? 152 TYR A CA  1 
ATOM   5164  C C   . TYR C 2 152 ? 7.049   46.224  -13.068 1.00 44.05  ? 152 TYR A C   1 
ATOM   5165  O O   . TYR C 2 152 ? 5.992   45.619  -13.148 1.00 43.00  ? 152 TYR A O   1 
ATOM   5166  C CB  . TYR C 2 152 ? 8.685   45.769  -11.246 1.00 39.01  ? 152 TYR A CB  1 
ATOM   5167  C CG  . TYR C 2 152 ? 8.246   44.349  -11.063 1.00 37.02  ? 152 TYR A CG  1 
ATOM   5168  C CD1 . TYR C 2 152 ? 8.266   43.450  -12.121 1.00 39.69  ? 152 TYR A CD1 1 
ATOM   5169  C CD2 . TYR C 2 152 ? 7.828   43.895  -9.832  1.00 36.07  ? 152 TYR A CD2 1 
ATOM   5170  C CE1 . TYR C 2 152 ? 7.856   42.142  -11.955 1.00 35.12  ? 152 TYR A CE1 1 
ATOM   5171  C CE2 . TYR C 2 152 ? 7.427   42.594  -9.664  1.00 34.58  ? 152 TYR A CE2 1 
ATOM   5172  C CZ  . TYR C 2 152 ? 7.440   41.731  -10.721 1.00 34.16  ? 152 TYR A CZ  1 
ATOM   5173  O OH  . TYR C 2 152 ? 7.034   40.446  -10.541 1.00 33.13  ? 152 TYR A OH  1 
ATOM   5174  N N   . PHE C 2 153 ? 7.800   46.497  -14.122 1.00 45.10  ? 153 PHE A N   1 
ATOM   5175  C CA  . PHE C 2 153 ? 7.461   46.022  -15.443 1.00 44.89  ? 153 PHE A CA  1 
ATOM   5176  C C   . PHE C 2 153 ? 8.731   45.897  -16.272 1.00 46.05  ? 153 PHE A C   1 
ATOM   5177  O O   . PHE C 2 153 ? 9.548   46.801  -16.289 1.00 47.72  ? 153 PHE A O   1 
ATOM   5178  C CB  . PHE C 2 153 ? 6.484   46.977  -16.132 1.00 45.84  ? 153 PHE A CB  1 
ATOM   5179  C CG  . PHE C 2 153 ? 6.067   46.503  -17.484 1.00 45.69  ? 153 PHE A CG  1 
ATOM   5180  C CD1 . PHE C 2 153 ? 5.151   45.465  -17.613 1.00 44.27  ? 153 PHE A CD1 1 
ATOM   5181  C CD2 . PHE C 2 153 ? 6.624   47.052  -18.626 1.00 47.10  ? 153 PHE A CD2 1 
ATOM   5182  C CE1 . PHE C 2 153 ? 4.782   45.000  -18.858 1.00 44.60  ? 153 PHE A CE1 1 
ATOM   5183  C CE2 . PHE C 2 153 ? 6.260   46.594  -19.873 1.00 47.31  ? 153 PHE A CE2 1 
ATOM   5184  C CZ  . PHE C 2 153 ? 5.332   45.566  -19.989 1.00 46.16  ? 153 PHE A CZ  1 
ATOM   5185  N N   . PRO C 2 154 ? 8.907   44.767  -16.956 1.00 45.64  ? 154 PRO A N   1 
ATOM   5186  C CA  . PRO C 2 154 ? 8.003   43.631  -16.874 1.00 39.17  ? 154 PRO A CA  1 
ATOM   5187  C C   . PRO C 2 154 ? 8.558   42.516  -16.005 1.00 45.35  ? 154 PRO A C   1 
ATOM   5188  O O   . PRO C 2 154 ? 9.514   42.703  -15.239 1.00 38.52  ? 154 PRO A O   1 
ATOM   5189  C CB  . PRO C 2 154 ? 7.971   43.149  -18.320 1.00 45.83  ? 154 PRO A CB  1 
ATOM   5190  C CG  . PRO C 2 154 ? 9.347   43.390  -18.800 1.00 41.75  ? 154 PRO A CG  1 
ATOM   5191  C CD  . PRO C 2 154 ? 9.829   44.638  -18.096 1.00 42.36  ? 154 PRO A CD  1 
ATOM   5192  N N   . GLU C 2 155 ? 7.915   41.359  -16.134 1.00 44.13  ? 155 GLU A N   1 
ATOM   5193  C CA  . GLU C 2 155 ? 8.433   40.091  -15.668 1.00 43.63  ? 155 GLU A CA  1 
ATOM   5194  C C   . GLU C 2 155 ? 9.686   39.807  -16.464 1.00 44.96  ? 155 GLU A C   1 
ATOM   5195  O O   . GLU C 2 155 ? 9.806   40.254  -17.593 1.00 46.06  ? 155 GLU A O   1 
ATOM   5196  C CB  . GLU C 2 155 ? 7.413   39.005  -15.970 1.00 43.76  ? 155 GLU A CB  1 
ATOM   5197  C CG  . GLU C 2 155 ? 6.114   39.139  -15.210 1.00 43.02  ? 155 GLU A CG  1 
ATOM   5198  C CD  . GLU C 2 155 ? 5.950   38.025  -14.188 1.00 42.72  ? 155 GLU A CD  1 
ATOM   5199  O OE1 . GLU C 2 155 ? 5.166   37.081  -14.458 1.00 42.96  ? 155 GLU A OE1 1 
ATOM   5200  O OE2 . GLU C 2 155 ? 6.629   38.081  -13.127 1.00 42.60  ? 155 GLU A OE2 1 
ATOM   5201  N N   . PRO C 2 156 ? 10.633  39.058  -15.889 1.00 45.42  ? 156 PRO A N   1 
ATOM   5202  C CA  . PRO C 2 156 ? 10.643  38.461  -14.551 1.00 44.27  ? 156 PRO A CA  1 
ATOM   5203  C C   . PRO C 2 156 ? 11.316  39.323  -13.484 1.00 44.15  ? 156 PRO A C   1 
ATOM   5204  O O   . PRO C 2 156 ? 11.883  40.384  -13.739 1.00 45.77  ? 156 PRO A O   1 
ATOM   5205  C CB  . PRO C 2 156 ? 11.470  37.189  -14.755 1.00 45.49  ? 156 PRO A CB  1 
ATOM   5206  C CG  . PRO C 2 156 ? 11.937  37.225  -16.220 1.00 47.52  ? 156 PRO A CG  1 
ATOM   5207  C CD  . PRO C 2 156 ? 11.790  38.610  -16.671 1.00 47.57  ? 156 PRO A CD  1 
ATOM   5208  N N   . VAL C 2 157 ? 11.238  38.847  -12.257 1.00 42.57  ? 157 VAL A N   1 
ATOM   5209  C CA  . VAL C 2 157 ? 11.974  39.439  -11.157 1.00 42.74  ? 157 VAL A CA  1 
ATOM   5210  C C   . VAL C 2 157 ? 12.435  38.244  -10.330 1.00 42.83  ? 157 VAL A C   1 
ATOM   5211  O O   . VAL C 2 157 ? 11.676  37.303  -10.125 1.00 41.30  ? 157 VAL A O   1 
ATOM   5212  C CB  . VAL C 2 157 ? 11.094  40.438  -10.360 1.00 36.25  ? 157 VAL A CB  1 
ATOM   5213  C CG1 . VAL C 2 157 ? 10.642  39.865  -9.032  1.00 35.05  ? 157 VAL A CG1 1 
ATOM   5214  C CG2 . VAL C 2 157 ? 11.833  41.740  -10.150 1.00 37.78  ? 157 VAL A CG2 1 
ATOM   5215  N N   . THR C 2 158 ? 13.687  38.223  -9.908  1.00 44.80  ? 158 THR A N   1 
ATOM   5216  C CA  . THR C 2 158 ? 14.150  37.078  -9.139  1.00 45.02  ? 158 THR A CA  1 
ATOM   5217  C C   . THR C 2 158 ? 14.488  37.469  -7.706  1.00 45.29  ? 158 THR A C   1 
ATOM   5218  O O   . THR C 2 158 ? 15.012  38.552  -7.453  1.00 40.28  ? 158 THR A O   1 
ATOM   5219  C CB  . THR C 2 158 ? 15.336  36.378  -9.817  1.00 46.75  ? 158 THR A CB  1 
ATOM   5220  O OG1 . THR C 2 158 ? 16.267  37.358  -10.295 1.00 48.23  ? 158 THR A OG1 1 
ATOM   5221  C CG2 . THR C 2 158 ? 14.848  35.549  -10.990 1.00 41.92  ? 158 THR A CG2 1 
ATOM   5222  N N   . VAL C 2 159 ? 14.148  36.597  -6.764  1.00 38.36  ? 159 VAL A N   1 
ATOM   5223  C CA  . VAL C 2 159 ? 14.450  36.854  -5.375  1.00 38.56  ? 159 VAL A CA  1 
ATOM   5224  C C   . VAL C 2 159 ? 15.208  35.698  -4.767  1.00 46.96  ? 159 VAL A C   1 
ATOM   5225  O O   . VAL C 2 159 ? 14.736  34.569  -4.785  1.00 46.43  ? 159 VAL A O   1 
ATOM   5226  C CB  . VAL C 2 159 ? 13.190  37.073  -4.522  1.00 36.53  ? 159 VAL A CB  1 
ATOM   5227  C CG1 . VAL C 2 159 ? 13.607  37.597  -3.142  1.00 38.90  ? 159 VAL A CG1 1 
ATOM   5228  C CG2 . VAL C 2 159 ? 12.245  38.046  -5.186  1.00 35.53  ? 159 VAL A CG2 1 
ATOM   5229  N N   . SER C 2 160 ? 16.383  35.982  -4.231  1.00 41.90  ? 160 SER A N   1 
ATOM   5230  C CA  . SER C 2 160 ? 17.092  35.012  -3.429  1.00 46.21  ? 160 SER A CA  1 
ATOM   5231  C C   . SER C 2 160 ? 17.191  35.615  -2.056  1.00 46.49  ? 160 SER A C   1 
ATOM   5232  O O   . SER C 2 160 ? 16.914  36.802  -1.879  1.00 46.27  ? 160 SER A O   1 
ATOM   5233  C CB  . SER C 2 160 ? 18.488  34.737  -3.989  1.00 46.58  ? 160 SER A CB  1 
ATOM   5234  O OG  . SER C 2 160 ? 19.235  35.935  -4.162  1.00 48.25  ? 160 SER A OG  1 
ATOM   5235  N N   . TRP C 2 161 ? 17.573  34.807  -1.076  1.00 47.30  ? 161 TRP A N   1 
ATOM   5236  C CA  . TRP C 2 161 ? 17.705  35.304  0.278   1.00 44.85  ? 161 TRP A CA  1 
ATOM   5237  C C   . TRP C 2 161 ? 19.114  35.019  0.650   1.00 48.13  ? 161 TRP A C   1 
ATOM   5238  O O   . TRP C 2 161 ? 19.618  33.960  0.290   1.00 58.45  ? 161 TRP A O   1 
ATOM   5239  C CB  . TRP C 2 161 ? 16.760  34.560  1.219   1.00 44.20  ? 161 TRP A CB  1 
ATOM   5240  C CG  . TRP C 2 161 ? 15.344  34.972  1.045   1.00 41.59  ? 161 TRP A CG  1 
ATOM   5241  C CD1 . TRP C 2 161 ? 14.439  34.458  0.168   1.00 38.58  ? 161 TRP A CD1 1 
ATOM   5242  C CD2 . TRP C 2 161 ? 14.674  36.011  1.751   1.00 41.08  ? 161 TRP A CD2 1 
ATOM   5243  N NE1 . TRP C 2 161 ? 13.243  35.108  0.288   1.00 36.82  ? 161 TRP A NE1 1 
ATOM   5244  C CE2 . TRP C 2 161 ? 13.358  36.068  1.256   1.00 38.85  ? 161 TRP A CE2 1 
ATOM   5245  C CE3 . TRP C 2 161 ? 15.055  36.894  2.767   1.00 42.68  ? 161 TRP A CE3 1 
ATOM   5246  C CZ2 . TRP C 2 161 ? 12.420  36.981  1.732   1.00 38.18  ? 161 TRP A CZ2 1 
ATOM   5247  C CZ3 . TRP C 2 161 ? 14.120  37.807  3.235   1.00 41.98  ? 161 TRP A CZ3 1 
ATOM   5248  C CH2 . TRP C 2 161 ? 12.822  37.843  2.714   1.00 39.76  ? 161 TRP A CH2 1 
ATOM   5249  N N   . ASN C 2 162 ? 19.748  35.956  1.357   1.00 51.20  ? 162 ASN A N   1 
ATOM   5250  C CA  . ASN C 2 162 ? 21.132  35.806  1.796   1.00 53.70  ? 162 ASN A CA  1 
ATOM   5251  C C   . ASN C 2 162 ? 22.026  35.275  0.686   1.00 56.99  ? 162 ASN A C   1 
ATOM   5252  O O   . ASN C 2 162 ? 22.798  34.345  0.894   1.00 58.20  ? 162 ASN A O   1 
ATOM   5253  C CB  . ASN C 2 162 ? 21.201  34.927  3.036   1.00 54.23  ? 162 ASN A CB  1 
ATOM   5254  C CG  . ASN C 2 162 ? 20.510  35.567  4.215   1.00 53.08  ? 162 ASN A CG  1 
ATOM   5255  O OD1 . ASN C 2 162 ? 20.280  36.769  4.205   1.00 52.92  ? 162 ASN A OD1 1 
ATOM   5256  N ND2 . ASN C 2 162 ? 20.176  34.780  5.233   1.00 52.63  ? 162 ASN A ND2 1 
ATOM   5257  N N   . SER C 2 163 ? 21.857  35.857  -0.502  1.00 56.33  ? 163 SER A N   1 
ATOM   5258  C CA  . SER C 2 163 ? 22.646  35.542  -1.687  1.00 58.50  ? 163 SER A CA  1 
ATOM   5259  C C   . SER C 2 163 ? 22.764  34.046  -1.991  1.00 59.17  ? 163 SER A C   1 
ATOM   5260  O O   . SER C 2 163 ? 23.839  33.562  -2.358  1.00 62.77  ? 163 SER A O   1 
ATOM   5261  C CB  . SER C 2 163 ? 24.029  36.179  -1.566  1.00 62.76  ? 163 SER A CB  1 
ATOM   5262  O OG  . SER C 2 163 ? 23.904  37.561  -1.281  1.00 62.60  ? 163 SER A OG  1 
ATOM   5263  N N   . GLY C 2 164 ? 21.661  33.321  -1.829  1.00 56.08  ? 164 GLY A N   1 
ATOM   5264  C CA  . GLY C 2 164 ? 21.628  31.902  -2.125  1.00 55.66  ? 164 GLY A CA  1 
ATOM   5265  C C   . GLY C 2 164 ? 21.829  30.980  -0.933  1.00 56.65  ? 164 GLY A C   1 
ATOM   5266  O O   . GLY C 2 164 ? 21.494  29.799  -1.006  1.00 56.62  ? 164 GLY A O   1 
ATOM   5267  N N   . ALA C 2 165 ? 22.379  31.500  0.161   1.00 57.86  ? 165 ALA A N   1 
ATOM   5268  C CA  . ALA C 2 165 ? 22.685  30.668  1.328   1.00 59.31  ? 165 ALA A CA  1 
ATOM   5269  C C   . ALA C 2 165 ? 21.426  30.109  2.005   1.00 63.27  ? 165 ALA A C   1 
ATOM   5270  O O   . ALA C 2 165 ? 21.458  29.040  2.599   1.00 64.21  ? 165 ALA A O   1 
ATOM   5271  C CB  . ALA C 2 165 ? 23.513  31.449  2.323   1.00 61.53  ? 165 ALA A CB  1 
ATOM   5272  N N   . LEU C 2 166 ? 20.320  30.846  1.908   1.00 59.81  ? 166 LEU A N   1 
ATOM   5273  C CA  . LEU C 2 166 ? 19.061  30.472  2.533   1.00 49.62  ? 166 LEU A CA  1 
ATOM   5274  C C   . LEU C 2 166 ? 18.052  30.073  1.458   1.00 52.97  ? 166 LEU A C   1 
ATOM   5275  O O   . LEU C 2 166 ? 17.551  30.922  0.716   1.00 51.15  ? 166 LEU A O   1 
ATOM   5276  C CB  . LEU C 2 166 ? 18.533  31.642  3.363   1.00 48.03  ? 166 LEU A CB  1 
ATOM   5277  C CG  . LEU C 2 166 ? 17.217  31.415  4.107   1.00 45.46  ? 166 LEU A CG  1 
ATOM   5278  C CD1 . LEU C 2 166 ? 17.257  30.123  4.859   1.00 46.37  ? 166 LEU A CD1 1 
ATOM   5279  C CD2 . LEU C 2 166 ? 16.928  32.556  5.050   1.00 45.05  ? 166 LEU A CD2 1 
ATOM   5280  N N   . THR C 2 167 ? 17.774  28.774  1.358   1.00 53.36  ? 167 THR A N   1 
ATOM   5281  C CA  . THR C 2 167 ? 16.841  28.261  0.346   1.00 51.82  ? 167 THR A CA  1 
ATOM   5282  C C   . THR C 2 167 ? 15.715  27.411  0.955   1.00 50.29  ? 167 THR A C   1 
ATOM   5283  O O   . THR C 2 167 ? 14.629  27.306  0.380   1.00 48.59  ? 167 THR A O   1 
ATOM   5284  C CB  . THR C 2 167 ? 17.559  27.458  -0.760  1.00 54.35  ? 167 THR A CB  1 
ATOM   5285  O OG1 . THR C 2 167 ? 18.351  26.416  -0.175  1.00 57.35  ? 167 THR A OG1 1 
ATOM   5286  C CG2 . THR C 2 167 ? 18.454  28.367  -1.559  1.00 55.71  ? 167 THR A CG2 1 
ATOM   5287  N N   . SER C 2 168 ? 15.983  26.816  2.116   1.00 50.95  ? 168 SER A N   1 
ATOM   5288  C CA  . SER C 2 168 ? 14.998  26.017  2.823   1.00 49.62  ? 168 SER A CA  1 
ATOM   5289  C C   . SER C 2 168 ? 13.863  26.908  3.270   1.00 46.62  ? 168 SER A C   1 
ATOM   5290  O O   . SER C 2 168 ? 14.099  27.970  3.843   1.00 46.45  ? 168 SER A O   1 
ATOM   5291  C CB  . SER C 2 168 ? 15.628  25.379  4.062   1.00 51.57  ? 168 SER A CB  1 
ATOM   5292  O OG  . SER C 2 168 ? 15.719  23.972  3.919   1.00 53.70  ? 168 SER A OG  1 
ATOM   5293  N N   . GLY C 2 169 ? 12.633  26.477  3.017   1.00 44.74  ? 169 GLY A N   1 
ATOM   5294  C CA  . GLY C 2 169 ? 11.469  27.166  3.537   1.00 42.31  ? 169 GLY A CA  1 
ATOM   5295  C C   . GLY C 2 169 ? 11.103  28.436  2.794   1.00 40.58  ? 169 GLY A C   1 
ATOM   5296  O O   . GLY C 2 169 ? 10.190  29.165  3.204   1.00 39.55  ? 169 GLY A O   1 
ATOM   5297  N N   . VAL C 2 170 ? 11.816  28.715  1.709   1.00 40.59  ? 170 VAL A N   1 
ATOM   5298  C CA  . VAL C 2 170 ? 11.495  29.867  0.882   1.00 38.92  ? 170 VAL A CA  1 
ATOM   5299  C C   . VAL C 2 170 ? 10.331  29.541  -0.055  1.00 37.71  ? 170 VAL A C   1 
ATOM   5300  O O   . VAL C 2 170 ? 10.199  28.397  -0.501  1.00 38.46  ? 170 VAL A O   1 
ATOM   5301  C CB  . VAL C 2 170 ? 12.718  30.326  0.075   1.00 39.70  ? 170 VAL A CB  1 
ATOM   5302  C CG1 . VAL C 2 170 ? 12.346  31.467  -0.896  1.00 38.25  ? 170 VAL A CG1 1 
ATOM   5303  C CG2 . VAL C 2 170 ? 13.817  30.742  1.028   1.00 41.02  ? 170 VAL A CG2 1 
ATOM   5304  N N   . HIS C 2 171 ? 9.479   30.542  -0.300  1.00 35.88  ? 171 HIS A N   1 
ATOM   5305  C CA  . HIS C 2 171 ? 8.400   30.468  -1.274  1.00 34.63  ? 171 HIS A CA  1 
ATOM   5306  C C   . HIS C 2 171 ? 8.299   31.820  -1.894  1.00 33.70  ? 171 HIS A C   1 
ATOM   5307  O O   . HIS C 2 171 ? 8.028   32.801  -1.216  1.00 31.37  ? 171 HIS A O   1 
ATOM   5308  C CB  . HIS C 2 171 ? 7.051   30.208  -0.610  1.00 33.96  ? 171 HIS A CB  1 
ATOM   5309  C CG  . HIS C 2 171 ? 6.895   28.832  -0.044  1.00 35.17  ? 171 HIS A CG  1 
ATOM   5310  N ND1 . HIS C 2 171 ? 6.910   27.697  -0.828  1.00 36.26  ? 171 HIS A ND1 1 
ATOM   5311  C CD2 . HIS C 2 171 ? 6.683   28.414  1.229   1.00 35.50  ? 171 HIS A CD2 1 
ATOM   5312  C CE1 . HIS C 2 171 ? 6.735   26.635  -0.057  1.00 37.23  ? 171 HIS A CE1 1 
ATOM   5313  N NE2 . HIS C 2 171 ? 6.592   27.042  1.192   1.00 36.71  ? 171 HIS A NE2 1 
ATOM   5314  N N   . THR C 2 172 ? 8.494   31.890  -3.194  1.00 33.44  ? 172 THR A N   1 
ATOM   5315  C CA  . THR C 2 172 ? 8.251   33.141  -3.896  1.00 33.39  ? 172 THR A CA  1 
ATOM   5316  C C   . THR C 2 172 ? 6.982   33.004  -4.755  1.00 32.45  ? 172 THR A C   1 
ATOM   5317  O O   . THR C 2 172 ? 6.837   32.062  -5.520  1.00 31.45  ? 172 THR A O   1 
ATOM   5318  C CB  . THR C 2 172 ? 9.475   33.569  -4.729  1.00 32.41  ? 172 THR A CB  1 
ATOM   5319  O OG1 . THR C 2 172 ? 10.612  33.724  -3.867  1.00 33.34  ? 172 THR A OG1 1 
ATOM   5320  C CG2 . THR C 2 172 ? 9.206   34.884  -5.436  1.00 32.04  ? 172 THR A CG2 1 
ATOM   5321  N N   . PHE C 2 173 ? 6.051   33.937  -4.606  1.00 32.02  ? 173 PHE A N   1 
ATOM   5322  C CA  . PHE C 2 173 ? 4.751   33.795  -5.251  1.00 32.14  ? 173 PHE A CA  1 
ATOM   5323  C C   . PHE C 2 173 ? 4.748   34.306  -6.691  1.00 32.59  ? 173 PHE A C   1 
ATOM   5324  O O   . PHE C 2 173 ? 5.571   35.160  -7.058  1.00 33.01  ? 173 PHE A O   1 
ATOM   5325  C CB  . PHE C 2 173 ? 3.661   34.477  -4.407  1.00 31.72  ? 173 PHE A CB  1 
ATOM   5326  C CG  . PHE C 2 173 ? 3.513   33.878  -3.039  1.00 31.67  ? 173 PHE A CG  1 
ATOM   5327  C CD1 . PHE C 2 173 ? 2.739   32.748  -2.846  1.00 32.08  ? 173 PHE A CD1 1 
ATOM   5328  C CD2 . PHE C 2 173 ? 4.175   34.426  -1.947  1.00 31.76  ? 173 PHE A CD2 1 
ATOM   5329  C CE1 . PHE C 2 173 ? 2.606   32.178  -1.581  1.00 32.40  ? 173 PHE A CE1 1 
ATOM   5330  C CE2 . PHE C 2 173 ? 4.048   33.866  -0.683  1.00 32.13  ? 173 PHE A CE2 1 
ATOM   5331  C CZ  . PHE C 2 173 ? 3.266   32.733  -0.498  1.00 32.35  ? 173 PHE A CZ  1 
ATOM   5332  N N   . PRO C 2 174 ? 3.848   33.752  -7.519  1.00 32.78  ? 174 PRO A N   1 
ATOM   5333  C CA  . PRO C 2 174 ? 3.548   34.268  -8.851  1.00 31.11  ? 174 PRO A CA  1 
ATOM   5334  C C   . PRO C 2 174 ? 3.262   35.749  -8.788  1.00 35.50  ? 174 PRO A C   1 
ATOM   5335  O O   . PRO C 2 174 ? 2.575   36.196  -7.875  1.00 35.47  ? 174 PRO A O   1 
ATOM   5336  C CB  . PRO C 2 174 ? 2.265   33.534  -9.214  1.00 31.75  ? 174 PRO A CB  1 
ATOM   5337  C CG  . PRO C 2 174 ? 2.381   32.247  -8.550  1.00 32.03  ? 174 PRO A CG  1 
ATOM   5338  C CD  . PRO C 2 174 ? 3.166   32.475  -7.271  1.00 31.19  ? 174 PRO A CD  1 
ATOM   5339  N N   . ALA C 2 175 ? 3.805   36.507  -9.730  1.00 35.81  ? 175 ALA A N   1 
ATOM   5340  C CA  . ALA C 2 175 ? 3.463   37.911  -9.839  1.00 36.37  ? 175 ALA A CA  1 
ATOM   5341  C C   . ALA C 2 175 ? 1.997   38.037  -10.259 1.00 37.34  ? 175 ALA A C   1 
ATOM   5342  O O   . ALA C 2 175 ? 1.465   37.144  -10.937 1.00 37.80  ? 175 ALA A O   1 
ATOM   5343  C CB  . ALA C 2 175 ? 4.354   38.584  -10.848 1.00 36.86  ? 175 ALA A CB  1 
ATOM   5344  N N   . VAL C 2 176 ? 1.351   39.127  -9.838  1.00 38.04  ? 176 VAL A N   1 
ATOM   5345  C CA  . VAL C 2 176 ? -0.011  39.460  -10.272 1.00 39.40  ? 176 VAL A CA  1 
ATOM   5346  C C   . VAL C 2 176 ? 0.024   40.820  -10.947 1.00 40.64  ? 176 VAL A C   1 
ATOM   5347  O O   . VAL C 2 176 ? 0.762   41.705  -10.519 1.00 40.87  ? 176 VAL A O   1 
ATOM   5348  C CB  . VAL C 2 176 ? -1.065  39.475  -9.102  1.00 34.75  ? 176 VAL A CB  1 
ATOM   5349  C CG1 . VAL C 2 176 ? -0.853  38.293  -8.159  1.00 33.17  ? 176 VAL A CG1 1 
ATOM   5350  C CG2 . VAL C 2 176 ? -1.013  40.787  -8.334  1.00 34.83  ? 176 VAL A CG2 1 
ATOM   5351  N N   . LEU C 2 177 ? -0.753  40.969  -12.015 1.00 41.99  ? 177 LEU A N   1 
ATOM   5352  C CA  . LEU C 2 177 ? -0.784  42.186  -12.805 1.00 43.72  ? 177 LEU A CA  1 
ATOM   5353  C C   . LEU C 2 177 ? -1.827  43.087  -12.210 1.00 46.00  ? 177 LEU A C   1 
ATOM   5354  O O   . LEU C 2 177 ? -3.002  42.748  -12.201 1.00 47.36  ? 177 LEU A O   1 
ATOM   5355  C CB  . LEU C 2 177 ? -1.158  41.839  -14.243 1.00 37.37  ? 177 LEU A CB  1 
ATOM   5356  C CG  . LEU C 2 177 ? -1.253  42.908  -15.333 1.00 38.82  ? 177 LEU A CG  1 
ATOM   5357  C CD1 . LEU C 2 177 ? -0.071  43.821  -15.287 1.00 38.61  ? 177 LEU A CD1 1 
ATOM   5358  C CD2 . LEU C 2 177 ? -1.333  42.252  -16.701 1.00 39.29  ? 177 LEU A CD2 1 
ATOM   5359  N N   . GLN C 2 178 ? -1.408  44.226  -11.685 1.00 46.87  ? 178 GLN A N   1 
ATOM   5360  C CA  . GLN C 2 178 ? -2.360  45.156  -11.106 1.00 49.37  ? 178 GLN A CA  1 
ATOM   5361  C C   . GLN C 2 178 ? -2.971  45.942  -12.250 1.00 50.88  ? 178 GLN A C   1 
ATOM   5362  O O   . GLN C 2 178 ? -2.459  45.884  -13.359 1.00 50.20  ? 178 GLN A O   1 
ATOM   5363  C CB  . GLN C 2 178 ? -1.669  46.064  -10.095 1.00 50.74  ? 178 GLN A CB  1 
ATOM   5364  C CG  . GLN C 2 178 ? -1.144  45.328  -8.862  1.00 49.87  ? 178 GLN A CG  1 
ATOM   5365  C CD  . GLN C 2 178 ? 0.026   46.071  -8.213  1.00 50.89  ? 178 GLN A CD  1 
ATOM   5366  O OE1 . GLN C 2 178 ? 0.742   46.840  -8.884  1.00 51.73  ? 178 GLN A OE1 1 
ATOM   5367  N NE2 . GLN C 2 178 ? 0.218   45.860  -6.900  1.00 50.90  ? 178 GLN A NE2 1 
ATOM   5368  N N   . SER C 2 179 ? -4.067  46.655  -12.002 1.00 53.45  ? 179 SER A N   1 
ATOM   5369  C CA  . SER C 2 179 ? -4.769  47.348  -13.091 1.00 55.69  ? 179 SER A CA  1 
ATOM   5370  C C   . SER C 2 179 ? -3.950  48.487  -13.700 1.00 56.21  ? 179 SER A C   1 
ATOM   5371  O O   . SER C 2 179 ? -4.200  48.915  -14.833 1.00 49.89  ? 179 SER A O   1 
ATOM   5372  C CB  . SER C 2 179 ? -6.177  47.812  -12.671 1.00 51.00  ? 179 SER A CB  1 
ATOM   5373  O OG  . SER C 2 179 ? -6.247  48.168  -11.302 1.00 60.19  ? 179 SER A OG  1 
ATOM   5374  N N   . SER C 2 180 ? -2.961  48.945  -12.934 1.00 55.31  ? 180 SER A N   1 
ATOM   5375  C CA  . SER C 2 180 ? -1.972  49.942  -13.364 1.00 55.76  ? 180 SER A CA  1 
ATOM   5376  C C   . SER C 2 180 ? -1.158  49.501  -14.583 1.00 53.85  ? 180 SER A C   1 
ATOM   5377  O O   . SER C 2 180 ? -0.635  50.326  -15.332 1.00 54.83  ? 180 SER A O   1 
ATOM   5378  C CB  . SER C 2 180 ? -1.019  50.238  -12.203 1.00 48.27  ? 180 SER A CB  1 
ATOM   5379  O OG  . SER C 2 180 ? -0.541  49.036  -11.602 1.00 47.83  ? 180 SER A OG  1 
ATOM   5380  N N   . GLY C 2 181 ? -1.041  48.190  -14.763 1.00 51.41  ? 181 GLY A N   1 
ATOM   5381  C CA  . GLY C 2 181 ? -0.260  47.619  -15.844 1.00 49.99  ? 181 GLY A CA  1 
ATOM   5382  C C   . GLY C 2 181 ? 1.031   47.015  -15.331 1.00 47.72  ? 181 GLY A C   1 
ATOM   5383  O O   . GLY C 2 181 ? 1.748   46.350  -16.089 1.00 46.97  ? 181 GLY A O   1 
ATOM   5384  N N   . LEU C 2 182 ? 1.298   47.246  -14.040 1.00 46.82  ? 182 LEU A N   1 
ATOM   5385  C CA  . LEU C 2 182 ? 2.529   46.822  -13.366 1.00 44.61  ? 182 LEU A CA  1 
ATOM   5386  C C   . LEU C 2 182 ? 2.326   45.554  -12.547 1.00 42.01  ? 182 LEU A C   1 
ATOM   5387  O O   . LEU C 2 182 ? 1.214   45.228  -12.167 1.00 42.11  ? 182 LEU A O   1 
ATOM   5388  C CB  . LEU C 2 182 ? 3.039   47.941  -12.442 1.00 45.78  ? 182 LEU A CB  1 
ATOM   5389  C CG  . LEU C 2 182 ? 3.354   49.300  -13.077 1.00 47.94  ? 182 LEU A CG  1 
ATOM   5390  C CD1 . LEU C 2 182 ? 3.763   50.299  -12.030 1.00 45.44  ? 182 LEU A CD1 1 
ATOM   5391  C CD2 . LEU C 2 182 ? 4.449   49.155  -14.104 1.00 43.43  ? 182 LEU A CD2 1 
ATOM   5392  N N   . TYR C 2 183 ? 3.402   44.842  -12.251 1.00 40.03  ? 183 TYR A N   1 
ATOM   5393  C CA  . TYR C 2 183 ? 3.274   43.602  -11.506 1.00 37.92  ? 183 TYR A CA  1 
ATOM   5394  C C   . TYR C 2 183 ? 3.648   43.832  -10.061 1.00 37.77  ? 183 TYR A C   1 
ATOM   5395  O O   . TYR C 2 183 ? 4.307   44.819  -9.745  1.00 38.82  ? 183 TYR A O   1 
ATOM   5396  C CB  . TYR C 2 183 ? 4.161   42.523  -12.107 1.00 36.68  ? 183 TYR A CB  1 
ATOM   5397  C CG  . TYR C 2 183 ? 3.734   42.086  -13.469 1.00 36.91  ? 183 TYR A CG  1 
ATOM   5398  C CD1 . TYR C 2 183 ? 2.871   41.016  -13.634 1.00 36.74  ? 183 TYR A CD1 1 
ATOM   5399  C CD2 . TYR C 2 183 ? 4.185   42.739  -14.598 1.00 38.06  ? 183 TYR A CD2 1 
ATOM   5400  C CE1 . TYR C 2 183 ? 2.455   40.611  -14.899 1.00 37.60  ? 183 TYR A CE1 1 
ATOM   5401  C CE2 . TYR C 2 183 ? 3.781   42.341  -15.863 1.00 38.90  ? 183 TYR A CE2 1 
ATOM   5402  C CZ  . TYR C 2 183 ? 2.922   41.275  -16.002 1.00 38.73  ? 183 TYR A CZ  1 
ATOM   5403  O OH  . TYR C 2 183 ? 2.528   40.871  -17.247 1.00 39.94  ? 183 TYR A OH  1 
ATOM   5404  N N   . SER C 2 184 ? 3.207   42.932  -9.188  1.00 36.87  ? 184 SER A N   1 
ATOM   5405  C CA  . SER C 2 184 ? 3.613   42.925  -7.785  1.00 37.19  ? 184 SER A CA  1 
ATOM   5406  C C   . SER C 2 184 ? 3.742   41.490  -7.351  1.00 36.03  ? 184 SER A C   1 
ATOM   5407  O O   . SER C 2 184 ? 3.095   40.621  -7.918  1.00 35.93  ? 184 SER A O   1 
ATOM   5408  C CB  . SER C 2 184 ? 2.574   43.612  -6.901  1.00 38.79  ? 184 SER A CB  1 
ATOM   5409  O OG  . SER C 2 184 ? 2.804   45.009  -6.826  1.00 40.97  ? 184 SER A OG  1 
ATOM   5410  N N   . LEU C 2 185 ? 4.573   41.232  -6.357  1.00 35.55  ? 185 LEU A N   1 
ATOM   5411  C CA  . LEU C 2 185 ? 4.663   39.901  -5.788  1.00 34.60  ? 185 LEU A CA  1 
ATOM   5412  C C   . LEU C 2 185 ? 5.348   39.969  -4.419  1.00 35.42  ? 185 LEU A C   1 
ATOM   5413  O O   . LEU C 2 185 ? 5.867   41.020  -4.003  1.00 36.94  ? 185 LEU A O   1 
ATOM   5414  C CB  . LEU C 2 185 ? 5.406   38.934  -6.736  1.00 33.78  ? 185 LEU A CB  1 
ATOM   5415  C CG  . LEU C 2 185 ? 6.924   38.943  -7.040  1.00 34.09  ? 185 LEU A CG  1 
ATOM   5416  C CD1 . LEU C 2 185 ? 7.883   38.578  -5.880  1.00 34.03  ? 185 LEU A CD1 1 
ATOM   5417  C CD2 . LEU C 2 185 ? 7.173   37.975  -8.163  1.00 34.17  ? 185 LEU A CD2 1 
ATOM   5418  N N   . SER C 2 186 ? 5.389   38.848  -3.719  1.00 34.60  ? 186 SER A N   1 
ATOM   5419  C CA  . SER C 2 186 ? 6.120   38.837  -2.489  1.00 35.14  ? 186 SER A CA  1 
ATOM   5420  C C   . SER C 2 186 ? 6.784   37.503  -2.383  1.00 34.89  ? 186 SER A C   1 
ATOM   5421  O O   . SER C 2 186 ? 6.362   36.550  -3.030  1.00 34.26  ? 186 SER A O   1 
ATOM   5422  C CB  . SER C 2 186 ? 5.181   39.067  -1.321  1.00 35.87  ? 186 SER A CB  1 
ATOM   5423  O OG  . SER C 2 186 ? 4.260   38.005  -1.255  1.00 35.55  ? 186 SER A OG  1 
ATOM   5424  N N   . SER C 2 187 ? 7.844   37.453  -1.581  1.00 35.87  ? 187 SER A N   1 
ATOM   5425  C CA  . SER C 2 187 ? 8.650   36.255  -1.393  1.00 36.18  ? 187 SER A CA  1 
ATOM   5426  C C   . SER C 2 187 ? 8.757   36.066  0.110   1.00 36.76  ? 187 SER A C   1 
ATOM   5427  O O   . SER C 2 187 ? 9.102   37.011  0.830   1.00 37.84  ? 187 SER A O   1 
ATOM   5428  C CB  . SER C 2 187 ? 10.043  36.470  -2.012  1.00 37.29  ? 187 SER A CB  1 
ATOM   5429  O OG  . SER C 2 187 ? 10.844  35.302  -2.001  1.00 37.86  ? 187 SER A OG  1 
ATOM   5430  N N   . VAL C 2 188 ? 8.446   34.869  0.600   1.00 36.30  ? 188 VAL A N   1 
ATOM   5431  C CA  . VAL C 2 188 ? 8.473   34.632  2.048   1.00 36.60  ? 188 VAL A CA  1 
ATOM   5432  C C   . VAL C 2 188 ? 9.339   33.436  2.448   1.00 36.97  ? 188 VAL A C   1 
ATOM   5433  O O   . VAL C 2 188 ? 9.683   32.577  1.612   1.00 37.03  ? 188 VAL A O   1 
ATOM   5434  C CB  . VAL C 2 188 ? 7.051   34.446  2.633   1.00 35.96  ? 188 VAL A CB  1 
ATOM   5435  C CG1 . VAL C 2 188 ? 6.171   35.598  2.228   1.00 31.95  ? 188 VAL A CG1 1 
ATOM   5436  C CG2 . VAL C 2 188 ? 6.445   33.134  2.155   1.00 31.51  ? 188 VAL A CG2 1 
ATOM   5437  N N   . VAL C 2 189 ? 9.680   33.392  3.734   1.00 37.10  ? 189 VAL A N   1 
ATOM   5438  C CA  . VAL C 2 189 ? 10.453  32.289  4.295   1.00 37.23  ? 189 VAL A CA  1 
ATOM   5439  C C   . VAL C 2 189 ? 10.159  32.094  5.777   1.00 38.19  ? 189 VAL A C   1 
ATOM   5440  O O   . VAL C 2 189 ? 9.922   33.063  6.508   1.00 36.07  ? 189 VAL A O   1 
ATOM   5441  C CB  . VAL C 2 189 ? 11.982  32.475  4.084   1.00 37.10  ? 189 VAL A CB  1 
ATOM   5442  C CG1 . VAL C 2 189 ? 12.492  33.702  4.812   1.00 37.65  ? 189 VAL A CG1 1 
ATOM   5443  C CG2 . VAL C 2 189 ? 12.723  31.235  4.549   1.00 39.75  ? 189 VAL A CG2 1 
ATOM   5444  N N   . THR C 2 190 ? 10.154  30.837  6.209   1.00 36.14  ? 190 THR A N   1 
ATOM   5445  C CA  . THR C 2 190 ? 10.043  30.542  7.627   1.00 42.07  ? 190 THR A CA  1 
ATOM   5446  C C   . THR C 2 190 ? 11.402  30.187  8.197   1.00 44.00  ? 190 THR A C   1 
ATOM   5447  O O   . THR C 2 190 ? 12.146  29.404  7.613   1.00 44.69  ? 190 THR A O   1 
ATOM   5448  C CB  . THR C 2 190 ? 9.051   29.403  7.940   1.00 36.83  ? 190 THR A CB  1 
ATOM   5449  O OG1 . THR C 2 190 ? 9.282   28.301  7.054   1.00 37.74  ? 190 THR A OG1 1 
ATOM   5450  C CG2 . THR C 2 190 ? 7.622   29.890  7.819   1.00 35.76  ? 190 THR A CG2 1 
ATOM   5451  N N   . VAL C 2 191 ? 11.712  30.774  9.348   1.00 45.47  ? 191 VAL A N   1 
ATOM   5452  C CA  . VAL C 2 191 ? 12.970  30.536  10.042  1.00 48.02  ? 191 VAL A CA  1 
ATOM   5453  C C   . VAL C 2 191 ? 12.674  30.288  11.518  1.00 49.78  ? 191 VAL A C   1 
ATOM   5454  O O   . VAL C 2 191 ? 11.561  30.545  11.979  1.00 49.07  ? 191 VAL A O   1 
ATOM   5455  C CB  . VAL C 2 191 ? 13.923  31.738  9.874   1.00 48.77  ? 191 VAL A CB  1 
ATOM   5456  C CG1 . VAL C 2 191 ? 14.238  31.937  8.403   1.00 47.89  ? 191 VAL A CG1 1 
ATOM   5457  C CG2 . VAL C 2 191 ? 13.305  33.001  10.455  1.00 48.43  ? 191 VAL A CG2 1 
ATOM   5458  N N   . PRO C 2 192 ? 13.656  29.766  12.265  1.00 52.44  ? 192 PRO A N   1 
ATOM   5459  C CA  . PRO C 2 192 ? 13.412  29.566  13.700  1.00 54.12  ? 192 PRO A CA  1 
ATOM   5460  C C   . PRO C 2 192 ? 13.297  30.876  14.478  1.00 55.32  ? 192 PRO A C   1 
ATOM   5461  O O   . PRO C 2 192 ? 14.024  31.829  14.206  1.00 56.13  ? 192 PRO A O   1 
ATOM   5462  C CB  . PRO C 2 192 ? 14.652  28.780  14.156  1.00 56.60  ? 192 PRO A CB  1 
ATOM   5463  C CG  . PRO C 2 192 ? 15.156  28.114  12.940  1.00 56.12  ? 192 PRO A CG  1 
ATOM   5464  C CD  . PRO C 2 192 ? 14.878  29.080  11.817  1.00 54.07  ? 192 PRO A CD  1 
ATOM   5465  N N   . SER C 2 193 ? 12.389  30.907  15.446  1.00 55.97  ? 193 SER A N   1 
ATOM   5466  C CA  . SER C 2 193 ? 12.147  32.107  16.244  1.00 57.48  ? 193 SER A CA  1 
ATOM   5467  C C   . SER C 2 193 ? 13.391  32.539  17.011  1.00 60.97  ? 193 SER A C   1 
ATOM   5468  O O   . SER C 2 193 ? 13.642  33.734  17.177  1.00 62.46  ? 193 SER A O   1 
ATOM   5469  C CB  . SER C 2 193 ? 10.995  31.872  17.225  1.00 57.55  ? 193 SER A CB  1 
ATOM   5470  O OG  . SER C 2 193 ? 9.731   31.928  16.587  1.00 55.38  ? 193 SER A OG  1 
ATOM   5471  N N   . SER C 2 194 ? 14.159  31.558  17.484  1.00 62.76  ? 194 SER A N   1 
ATOM   5472  C CA  . SER C 2 194 ? 15.402  31.821  18.213  1.00 66.46  ? 194 SER A CA  1 
ATOM   5473  C C   . SER C 2 194 ? 16.426  32.594  17.376  1.00 67.88  ? 194 SER A C   1 
ATOM   5474  O O   . SER C 2 194 ? 17.111  33.486  17.881  1.00 70.56  ? 194 SER A O   1 
ATOM   5475  C CB  . SER C 2 194 ? 16.022  30.511  18.736  1.00 67.60  ? 194 SER A CB  1 
ATOM   5476  O OG  . SER C 2 194 ? 16.180  29.527  17.721  1.00 65.86  ? 194 SER A OG  1 
ATOM   5477  N N   . SER C 2 195 ? 16.503  32.253  16.089  1.00 66.33  ? 195 SER A N   1 
ATOM   5478  C CA  . SER C 2 195 ? 17.521  32.793  15.185  1.00 67.62  ? 195 SER A CA  1 
ATOM   5479  C C   . SER C 2 195 ? 17.332  34.283  14.900  1.00 68.23  ? 195 SER A C   1 
ATOM   5480  O O   . SER C 2 195 ? 18.236  34.945  14.376  1.00 69.82  ? 195 SER A O   1 
ATOM   5481  C CB  . SER C 2 195 ? 17.505  32.029  13.858  1.00 65.48  ? 195 SER A CB  1 
ATOM   5482  O OG  . SER C 2 195 ? 16.423  32.454  13.048  1.00 62.44  ? 195 SER A OG  1 
ATOM   5483  N N   . LEU C 2 196 ? 16.162  34.798  15.273  1.00 67.40  ? 196 LEU A N   1 
ATOM   5484  C CA  . LEU C 2 196 ? 15.675  36.089  14.806  1.00 67.06  ? 196 LEU A CA  1 
ATOM   5485  C C   . LEU C 2 196 ? 16.586  37.274  15.070  1.00 70.38  ? 196 LEU A C   1 
ATOM   5486  O O   . LEU C 2 196 ? 16.915  38.017  14.146  1.00 70.47  ? 196 LEU A O   1 
ATOM   5487  C CB  . LEU C 2 196 ? 14.302  36.365  15.397  1.00 66.20  ? 196 LEU A CB  1 
ATOM   5488  C CG  . LEU C 2 196 ? 13.371  36.978  14.366  1.00 63.96  ? 196 LEU A CG  1 
ATOM   5489  C CD1 . LEU C 2 196 ? 13.411  36.135  13.106  1.00 61.14  ? 196 LEU A CD1 1 
ATOM   5490  C CD2 . LEU C 2 196 ? 11.955  37.085  14.916  1.00 63.49  ? 196 LEU A CD2 1 
ATOM   5491  N N   . GLY C 2 197 ? 16.977  37.459  16.329  1.00 73.36  ? 197 GLY A N   1 
ATOM   5492  C CA  . GLY C 2 197 ? 17.780  38.606  16.709  1.00 76.79  ? 197 GLY A CA  1 
ATOM   5493  C C   . GLY C 2 197 ? 19.259  38.285  16.726  1.00 79.41  ? 197 GLY A C   1 
ATOM   5494  O O   . GLY C 2 197 ? 20.041  38.949  17.414  1.00 83.30  ? 197 GLY A O   1 
ATOM   5495  N N   . THR C 2 198 ? 19.646  37.257  15.973  1.00 77.79  ? 198 THR A N   1 
ATOM   5496  C CA  . THR C 2 198 ? 21.050  36.845  15.892  1.00 80.53  ? 198 THR A CA  1 
ATOM   5497  C C   . THR C 2 198 ? 21.543  36.649  14.451  1.00 79.24  ? 198 THR A C   1 
ATOM   5498  O O   . THR C 2 198 ? 22.664  37.032  14.126  1.00 82.17  ? 198 THR A O   1 
ATOM   5499  C CB  . THR C 2 198 ? 21.339  35.578  16.746  1.00 85.35  ? 198 THR A CB  1 
ATOM   5500  O OG1 . THR C 2 198 ? 22.313  34.762  16.084  1.00 86.20  ? 198 THR A OG1 1 
ATOM   5501  C CG2 . THR C 2 198 ? 20.066  34.763  16.972  1.00 82.00  ? 198 THR A CG2 1 
ATOM   5502  N N   . GLN C 2 199 ? 20.707  36.054  13.600  1.00 75.10  ? 199 GLN A N   1 
ATOM   5503  C CA  . GLN C 2 199 ? 21.020  35.919  12.181  1.00 73.53  ? 199 GLN A CA  1 
ATOM   5504  C C   . GLN C 2 199 ? 20.347  37.030  11.381  1.00 71.62  ? 199 GLN A C   1 
ATOM   5505  O O   . GLN C 2 199 ? 19.159  37.311  11.562  1.00 69.27  ? 199 GLN A O   1 
ATOM   5506  C CB  . GLN C 2 199 ? 20.579  34.552  11.655  1.00 70.75  ? 199 GLN A CB  1 
ATOM   5507  C CG  . GLN C 2 199 ? 20.481  34.470  10.124  1.00 68.63  ? 199 GLN A CG  1 
ATOM   5508  C CD  . GLN C 2 199 ? 21.835  34.312  9.443   1.00 71.28  ? 199 GLN A CD  1 
ATOM   5509  O OE1 . GLN C 2 199 ? 22.652  33.484  9.848   1.00 73.64  ? 199 GLN A OE1 1 
ATOM   5510  N NE2 . GLN C 2 199 ? 22.077  35.110  8.402   1.00 71.22  ? 199 GLN A NE2 1 
ATOM   5511  N N   . THR C 2 200 ? 21.110  37.663  10.496  1.00 73.00  ? 200 THR A N   1 
ATOM   5512  C CA  . THR C 2 200 ? 20.572  38.718  9.635   1.00 71.47  ? 200 THR A CA  1 
ATOM   5513  C C   . THR C 2 200 ? 19.975  38.162  8.331   1.00 67.77  ? 200 THR A C   1 
ATOM   5514  O O   . THR C 2 200 ? 20.578  37.324  7.666   1.00 68.06  ? 200 THR A O   1 
ATOM   5515  C CB  . THR C 2 200 ? 21.633  39.813  9.351   1.00 64.54  ? 200 THR A CB  1 
ATOM   5516  O OG1 . THR C 2 200 ? 22.937  39.225  9.348   1.00 68.86  ? 200 THR A OG1 1 
ATOM   5517  C CG2 . THR C 2 200 ? 21.596  40.899  10.428  1.00 66.10  ? 200 THR A CG2 1 
ATOM   5518  N N   . TYR C 2 201 ? 18.774  38.621  7.989   1.00 64.82  ? 201 TYR A N   1 
ATOM   5519  C CA  . TYR C 2 201 ? 18.056  38.119  6.814   1.00 61.70  ? 201 TYR A CA  1 
ATOM   5520  C C   . TYR C 2 201 ? 17.904  39.182  5.719   1.00 50.26  ? 201 TYR A C   1 
ATOM   5521  O O   . TYR C 2 201 ? 17.281  40.221  5.928   1.00 50.25  ? 201 TYR A O   1 
ATOM   5522  C CB  . TYR C 2 201 ? 16.697  37.532  7.221   1.00 47.86  ? 201 TYR A CB  1 
ATOM   5523  C CG  . TYR C 2 201 ? 16.823  36.282  8.069   1.00 48.05  ? 201 TYR A CG  1 
ATOM   5524  C CD1 . TYR C 2 201 ? 16.734  36.338  9.453   1.00 53.28  ? 201 TYR A CD1 1 
ATOM   5525  C CD2 . TYR C 2 201 ? 17.063  35.047  7.489   1.00 48.10  ? 201 TYR A CD2 1 
ATOM   5526  C CE1 . TYR C 2 201 ? 16.869  35.192  10.236  1.00 53.01  ? 201 TYR A CE1 1 
ATOM   5527  C CE2 . TYR C 2 201 ? 17.199  33.901  8.261   1.00 48.72  ? 201 TYR A CE2 1 
ATOM   5528  C CZ  . TYR C 2 201 ? 17.101  33.977  9.631   1.00 49.05  ? 201 TYR A CZ  1 
ATOM   5529  O OH  . TYR C 2 201 ? 17.236  32.837  10.390  1.00 49.79  ? 201 TYR A OH  1 
ATOM   5530  N N   . ILE C 2 202 ? 18.498  38.920  4.558   1.00 50.34  ? 202 ILE A N   1 
ATOM   5531  C CA  . ILE C 2 202 ? 18.483  39.882  3.460   1.00 53.22  ? 202 ILE A CA  1 
ATOM   5532  C C   . ILE C 2 202 ? 17.930  39.286  2.148   1.00 50.89  ? 202 ILE A C   1 
ATOM   5533  O O   . ILE C 2 202 ? 18.373  38.236  1.685   1.00 50.74  ? 202 ILE A O   1 
ATOM   5534  C CB  . ILE C 2 202 ? 19.885  40.503  3.209   1.00 53.98  ? 202 ILE A CB  1 
ATOM   5535  C CG1 . ILE C 2 202 ? 20.561  40.891  4.523   1.00 57.05  ? 202 ILE A CG1 1 
ATOM   5536  C CG2 . ILE C 2 202 ? 19.792  41.702  2.275   1.00 54.38  ? 202 ILE A CG2 1 
ATOM   5537  C CD1 . ILE C 2 202 ? 21.696  39.938  4.942   1.00 60.42  ? 202 ILE A CD1 1 
ATOM   5538  N N   . CYS C 2 203 ? 16.952  39.962  1.553   1.00 49.63  ? 203 CYS A N   1 
ATOM   5539  C CA  . CYS C 2 203 ? 16.378  39.487  0.299   1.00 48.01  ? 203 CYS A CA  1 
ATOM   5540  C C   . CYS C 2 203 ? 16.997  40.197  -0.912  1.00 49.52  ? 203 CYS A C   1 
ATOM   5541  O O   . CYS C 2 203 ? 17.128  41.429  -0.959  1.00 51.14  ? 203 CYS A O   1 
ATOM   5542  C CB  . CYS C 2 203 ? 14.846  39.609  0.303   1.00 45.52  ? 203 CYS A CB  1 
ATOM   5543  S SG  . CYS C 2 203 ? 14.173  41.142  -0.369  1.00 102.10 ? 203 CYS A SG  1 
ATOM   5544  N N   . ASN C 2 204 ? 17.392  39.405  -1.894  1.00 49.16  ? 204 ASN A N   1 
ATOM   5545  C CA  . ASN C 2 204 ? 18.020  39.951  -3.081  1.00 50.07  ? 204 ASN A CA  1 
ATOM   5546  C C   . ASN C 2 204 ? 17.072  39.948  -4.268  1.00 47.29  ? 204 ASN A C   1 
ATOM   5547  O O   . ASN C 2 204 ? 16.802  38.909  -4.860  1.00 45.94  ? 204 ASN A O   1 
ATOM   5548  C CB  . ASN C 2 204 ? 19.290  39.166  -3.378  1.00 52.57  ? 204 ASN A CB  1 
ATOM   5549  C CG  . ASN C 2 204 ? 20.130  38.981  -2.144  1.00 54.69  ? 204 ASN A CG  1 
ATOM   5550  O OD1 . ASN C 2 204 ? 20.422  37.859  -1.717  1.00 54.97  ? 204 ASN A OD1 1 
ATOM   5551  N ND2 . ASN C 2 204 ? 20.494  40.092  -1.534  1.00 56.46  ? 204 ASN A ND2 1 
ATOM   5552  N N   . VAL C 2 205 ? 16.566  41.128  -4.602  1.00 46.88  ? 205 VAL A N   1 
ATOM   5553  C CA  . VAL C 2 205 ? 15.624  41.273  -5.694  1.00 42.50  ? 205 VAL A CA  1 
ATOM   5554  C C   . VAL C 2 205 ? 16.336  41.808  -6.915  1.00 46.61  ? 205 VAL A C   1 
ATOM   5555  O O   . VAL C 2 205 ? 16.844  42.920  -6.908  1.00 48.58  ? 205 VAL A O   1 
ATOM   5556  C CB  . VAL C 2 205 ? 14.494  42.244  -5.333  1.00 41.41  ? 205 VAL A CB  1 
ATOM   5557  C CG1 . VAL C 2 205 ? 13.498  42.325  -6.467  1.00 43.19  ? 205 VAL A CG1 1 
ATOM   5558  C CG2 . VAL C 2 205 ? 13.804  41.800  -4.071  1.00 40.12  ? 205 VAL A CG2 1 
ATOM   5559  N N   . ASN C 2 206 ? 16.372  41.015  -7.971  1.00 46.28  ? 206 ASN A N   1 
ATOM   5560  C CA  . ASN C 2 206 ? 16.964  41.471  -9.209  1.00 48.32  ? 206 ASN A CA  1 
ATOM   5561  C C   . ASN C 2 206 ? 15.922  41.647  -10.322 1.00 46.44  ? 206 ASN A C   1 
ATOM   5562  O O   . ASN C 2 206 ? 15.018  40.832  -10.471 1.00 44.12  ? 206 ASN A O   1 
ATOM   5563  C CB  . ASN C 2 206 ? 18.067  40.515  -9.632  1.00 51.15  ? 206 ASN A CB  1 
ATOM   5564  C CG  . ASN C 2 206 ? 18.895  41.064  -10.776 1.00 54.93  ? 206 ASN A CG  1 
ATOM   5565  O OD1 . ASN C 2 206 ? 19.652  42.035  -10.617 1.00 57.60  ? 206 ASN A OD1 1 
ATOM   5566  N ND2 . ASN C 2 206 ? 18.755  40.449  -11.947 1.00 55.41  ? 206 ASN A ND2 1 
ATOM   5567  N N   . HIS C 2 207 ? 16.041  42.732  -11.082 1.00 47.62  ? 207 HIS A N   1 
ATOM   5568  C CA  . HIS C 2 207 ? 15.118  43.023  -12.180 1.00 46.26  ? 207 HIS A CA  1 
ATOM   5569  C C   . HIS C 2 207 ? 15.884  43.377  -13.445 1.00 48.50  ? 207 HIS A C   1 
ATOM   5570  O O   . HIS C 2 207 ? 16.064  44.560  -13.740 1.00 50.15  ? 207 HIS A O   1 
ATOM   5571  C CB  . HIS C 2 207 ? 14.203  44.197  -11.829 1.00 45.55  ? 207 HIS A CB  1 
ATOM   5572  C CG  . HIS C 2 207 ? 13.098  44.407  -12.817 1.00 44.71  ? 207 HIS A CG  1 
ATOM   5573  N ND1 . HIS C 2 207 ? 12.715  45.659  -13.261 1.00 43.55  ? 207 HIS A ND1 1 
ATOM   5574  C CD2 . HIS C 2 207 ? 12.287  43.526  -13.450 1.00 43.30  ? 207 HIS A CD2 1 
ATOM   5575  C CE1 . HIS C 2 207 ? 11.720  45.536  -14.116 1.00 42.53  ? 207 HIS A CE1 1 
ATOM   5576  N NE2 . HIS C 2 207 ? 11.435  44.250  -14.247 1.00 41.02  ? 207 HIS A NE2 1 
ATOM   5577  N N   . LYS C 2 208 ? 16.327  42.369  -14.193 1.00 49.12  ? 208 LYS A N   1 
ATOM   5578  C CA  . LYS C 2 208 ? 17.184  42.630  -15.352 1.00 50.31  ? 208 LYS A CA  1 
ATOM   5579  C C   . LYS C 2 208 ? 16.706  43.721  -16.339 1.00 56.59  ? 208 LYS A C   1 
ATOM   5580  O O   . LYS C 2 208 ? 17.465  44.653  -16.601 1.00 59.09  ? 208 LYS A O   1 
ATOM   5581  C CB  . LYS C 2 208 ? 17.633  41.340  -16.053 1.00 51.46  ? 208 LYS A CB  1 
ATOM   5582  C CG  . LYS C 2 208 ? 18.720  40.604  -15.284 1.00 53.18  ? 208 LYS A CG  1 
ATOM   5583  C CD  . LYS C 2 208 ? 19.469  39.586  -16.136 1.00 55.91  ? 208 LYS A CD  1 
ATOM   5584  C CE  . LYS C 2 208 ? 20.785  39.154  -15.472 1.00 58.79  ? 208 LYS A CE  1 
ATOM   5585  N NZ  . LYS C 2 208 ? 21.755  38.482  -16.414 1.00 62.78  ? 208 LYS A NZ  1 
ATOM   5586  N N   . PRO C 2 209 ? 15.454  43.638  -16.851 1.00 54.48  ? 209 PRO A N   1 
ATOM   5587  C CA  . PRO C 2 209 ? 14.927  44.665  -17.771 1.00 49.10  ? 209 PRO A CA  1 
ATOM   5588  C C   . PRO C 2 209 ? 15.187  46.130  -17.399 1.00 62.75  ? 209 PRO A C   1 
ATOM   5589  O O   . PRO C 2 209 ? 15.253  46.981  -18.291 1.00 64.47  ? 209 PRO A O   1 
ATOM   5590  C CB  . PRO C 2 209 ? 13.430  44.406  -17.739 1.00 46.39  ? 209 PRO A CB  1 
ATOM   5591  C CG  . PRO C 2 209 ? 13.322  42.927  -17.534 1.00 45.17  ? 209 PRO A CG  1 
ATOM   5592  C CD  . PRO C 2 209 ? 14.493  42.526  -16.677 1.00 46.13  ? 209 PRO A CD  1 
ATOM   5593  N N   . SER C 2 210 ? 15.336  46.431  -16.114 1.00 62.53  ? 210 SER A N   1 
ATOM   5594  C CA  . SER C 2 210 ? 15.526  47.817  -15.698 1.00 64.48  ? 210 SER A CA  1 
ATOM   5595  C C   . SER C 2 210 ? 16.904  48.074  -15.104 1.00 66.94  ? 210 SER A C   1 
ATOM   5596  O O   . SER C 2 210 ? 17.188  49.194  -14.664 1.00 69.11  ? 210 SER A O   1 
ATOM   5597  C CB  . SER C 2 210 ? 14.480  48.194  -14.662 1.00 49.98  ? 210 SER A CB  1 
ATOM   5598  O OG  . SER C 2 210 ? 14.688  47.451  -13.477 1.00 48.80  ? 210 SER A OG  1 
ATOM   5599  N N   . ASN C 2 211 ? 17.753  47.045  -15.102 1.00 66.58  ? 211 ASN A N   1 
ATOM   5600  C CA  . ASN C 2 211 ? 18.989  47.070  -14.323 1.00 68.23  ? 211 ASN A CA  1 
ATOM   5601  C C   . ASN C 2 211 ? 18.688  47.543  -12.911 1.00 67.39  ? 211 ASN A C   1 
ATOM   5602  O O   . ASN C 2 211 ? 19.026  48.663  -12.526 1.00 69.62  ? 211 ASN A O   1 
ATOM   5603  C CB  . ASN C 2 211 ? 20.047  47.986  -14.949 1.00 71.89  ? 211 ASN A CB  1 
ATOM   5604  C CG  . ASN C 2 211 ? 20.545  47.484  -16.294 1.00 72.97  ? 211 ASN A CG  1 
ATOM   5605  O OD1 . ASN C 2 211 ? 19.982  46.543  -16.875 1.00 70.75  ? 211 ASN A OD1 1 
ATOM   5606  N ND2 . ASN C 2 211 ? 21.605  48.123  -16.807 1.00 76.66  ? 211 ASN A ND2 1 
ATOM   5607  N N   . THR C 2 212 ? 18.010  46.702  -12.150 1.00 64.56  ? 212 THR A N   1 
ATOM   5608  C CA  . THR C 2 212 ? 17.702  47.044  -10.785 1.00 63.82  ? 212 THR A CA  1 
ATOM   5609  C C   . THR C 2 212 ? 18.141  45.875  -9.942  1.00 63.45  ? 212 THR A C   1 
ATOM   5610  O O   . THR C 2 212 ? 17.940  44.714  -10.305 1.00 61.94  ? 212 THR A O   1 
ATOM   5611  C CB  . THR C 2 212 ? 16.209  47.364  -10.596 1.00 60.54  ? 212 THR A CB  1 
ATOM   5612  O OG1 . THR C 2 212 ? 15.963  48.701  -11.035 1.00 62.05  ? 212 THR A OG1 1 
ATOM   5613  C CG2 . THR C 2 212 ? 15.817  47.273  -9.149  1.00 59.27  ? 212 THR A CG2 1 
ATOM   5614  N N   . LYS C 2 213 ? 18.813  46.196  -8.846  1.00 65.07  ? 213 LYS A N   1 
ATOM   5615  C CA  . LYS C 2 213 ? 19.249  45.200  -7.889  1.00 64.29  ? 213 LYS A CA  1 
ATOM   5616  C C   . LYS C 2 213 ? 19.099  45.832  -6.526  1.00 64.52  ? 213 LYS A C   1 
ATOM   5617  O O   . LYS C 2 213 ? 19.677  46.875  -6.241  1.00 67.49  ? 213 LYS A O   1 
ATOM   5618  C CB  . LYS C 2 213 ? 20.698  44.778  -8.149  1.00 67.24  ? 213 LYS A CB  1 
ATOM   5619  C CG  . LYS C 2 213 ? 21.021  43.356  -7.692  1.00 66.35  ? 213 LYS A CG  1 
ATOM   5620  C CD  . LYS C 2 213 ? 22.377  42.895  -8.210  1.00 69.62  ? 213 LYS A CD  1 
ATOM   5621  C CE  . LYS C 2 213 ? 22.480  43.003  -9.735  1.00 70.10  ? 213 LYS A CE  1 
ATOM   5622  N NZ  . LYS C 2 213 ? 23.773  42.455  -10.244 1.00 73.67  ? 213 LYS A NZ  1 
ATOM   5623  N N   . VAL C 2 214 ? 18.280  45.219  -5.697  1.00 61.74  ? 214 VAL A N   1 
ATOM   5624  C CA  . VAL C 2 214 ? 18.013  45.765  -4.393  1.00 62.12  ? 214 VAL A CA  1 
ATOM   5625  C C   . VAL C 2 214 ? 18.314  44.686  -3.398  1.00 61.92  ? 214 VAL A C   1 
ATOM   5626  O O   . VAL C 2 214 ? 17.908  43.538  -3.574  1.00 59.93  ? 214 VAL A O   1 
ATOM   5627  C CB  . VAL C 2 214 ? 16.535  46.162  -4.237  1.00 59.24  ? 214 VAL A CB  1 
ATOM   5628  C CG1 . VAL C 2 214 ? 16.255  46.598  -2.819  1.00 59.80  ? 214 VAL A CG1 1 
ATOM   5629  C CG2 . VAL C 2 214 ? 16.175  47.258  -5.215  1.00 59.85  ? 214 VAL A CG2 1 
ATOM   5630  N N   . ASP C 2 215 ? 19.045  45.044  -2.359  1.00 64.27  ? 215 ASP A N   1 
ATOM   5631  C CA  . ASP C 2 215 ? 19.156  44.170  -1.219  1.00 63.81  ? 215 ASP A CA  1 
ATOM   5632  C C   . ASP C 2 215 ? 18.352  44.845  -0.134  1.00 64.16  ? 215 ASP A C   1 
ATOM   5633  O O   . ASP C 2 215 ? 18.496  46.038  0.080   1.00 66.53  ? 215 ASP A O   1 
ATOM   5634  C CB  . ASP C 2 215 ? 20.617  44.023  -0.825  1.00 67.02  ? 215 ASP A CB  1 
ATOM   5635  C CG  . ASP C 2 215 ? 21.477  43.518  -1.975  1.00 68.02  ? 215 ASP A CG  1 
ATOM   5636  O OD1 . ASP C 2 215 ? 21.081  42.509  -2.612  1.00 65.53  ? 215 ASP A OD1 1 
ATOM   5637  O OD2 . ASP C 2 215 ? 22.535  44.140  -2.255  1.00 71.62  ? 215 ASP A OD2 1 
ATOM   5638  N N   . LYS C 2 216 ? 17.472  44.108  0.521   1.00 62.45  ? 216 LYS A N   1 
ATOM   5639  C CA  . LYS C 2 216 ? 16.707  44.693  1.611   1.00 63.77  ? 216 LYS A CA  1 
ATOM   5640  C C   . LYS C 2 216 ? 16.820  43.849  2.878   1.00 65.16  ? 216 LYS A C   1 
ATOM   5641  O O   . LYS C 2 216 ? 16.372  42.704  2.915   1.00 62.98  ? 216 LYS A O   1 
ATOM   5642  C CB  . LYS C 2 216 ? 15.236  44.889  1.217   1.00 60.74  ? 216 LYS A CB  1 
ATOM   5643  C CG  . LYS C 2 216 ? 14.330  45.439  2.339   1.00 60.78  ? 216 LYS A CG  1 
ATOM   5644  C CD  . LYS C 2 216 ? 14.558  46.932  2.607   1.00 63.82  ? 216 LYS A CD  1 
ATOM   5645  C CE  . LYS C 2 216 ? 14.233  47.795  1.390   1.00 63.64  ? 216 LYS A CE  1 
ATOM   5646  N NZ  . LYS C 2 216 ? 14.394  49.250  1.637   1.00 67.20  ? 216 LYS A NZ  1 
ATOM   5647  N N   . LYS C 2 217 ? 17.426  44.421  3.913   1.00 69.05  ? 217 LYS A N   1 
ATOM   5648  C CA  . LYS C 2 217 ? 17.547  43.743  5.196   1.00 70.16  ? 217 LYS A CA  1 
ATOM   5649  C C   . LYS C 2 217 ? 16.178  43.675  5.859   1.00 69.60  ? 217 LYS A C   1 
ATOM   5650  O O   . LYS C 2 217 ? 15.394  44.622  5.772   1.00 70.06  ? 217 LYS A O   1 
ATOM   5651  C CB  . LYS C 2 217 ? 18.535  44.489  6.086   1.00 73.89  ? 217 LYS A CB  1 
ATOM   5652  C CG  . LYS C 2 217 ? 18.685  43.922  7.484   1.00 74.42  ? 217 LYS A CG  1 
ATOM   5653  C CD  . LYS C 2 217 ? 19.312  44.967  8.380   1.00 78.42  ? 217 LYS A CD  1 
ATOM   5654  C CE  . LYS C 2 217 ? 19.552  44.469  9.787   1.00 79.70  ? 217 LYS A CE  1 
ATOM   5655  N NZ  . LYS C 2 217 ? 20.222  45.550  10.590  1.00 84.52  ? 217 LYS A NZ  1 
ATOM   5656  N N   . VAL C 2 218 ? 15.888  42.549  6.503   1.00 69.19  ? 218 VAL A N   1 
ATOM   5657  C CA  . VAL C 2 218 ? 14.595  42.348  7.150   1.00 68.60  ? 218 VAL A CA  1 
ATOM   5658  C C   . VAL C 2 218 ? 14.753  41.968  8.612   1.00 70.61  ? 218 VAL A C   1 
ATOM   5659  O O   . VAL C 2 218 ? 15.405  40.981  8.939   1.00 70.69  ? 218 VAL A O   1 
ATOM   5660  C CB  . VAL C 2 218 ? 13.766  41.255  6.434   1.00 64.97  ? 218 VAL A CB  1 
ATOM   5661  C CG1 . VAL C 2 218 ? 12.491  40.924  7.226   1.00 63.75  ? 218 VAL A CG1 1 
ATOM   5662  C CG2 . VAL C 2 218 ? 13.443  41.682  5.004   1.00 63.54  ? 218 VAL A CG2 1 
ATOM   5663  N N   . GLU C 2 219 ? 14.153  42.755  9.494   1.00 72.42  ? 219 GLU A N   1 
ATOM   5664  C CA  . GLU C 2 219 ? 14.172  42.437  10.918  1.00 74.18  ? 219 GLU A CA  1 
ATOM   5665  C C   . GLU C 2 219 ? 12.934  43.005  11.591  1.00 74.95  ? 219 GLU A C   1 
ATOM   5666  O O   . GLU C 2 219 ? 12.400  44.033  11.154  1.00 75.18  ? 219 GLU A O   1 
ATOM   5667  C CB  . GLU C 2 219 ? 15.424  42.994  11.575  1.00 77.82  ? 219 GLU A CB  1 
ATOM   5668  C CG  . GLU C 2 219 ? 15.568  44.472  11.399  1.00 80.23  ? 219 GLU A CG  1 
ATOM   5669  C CD  . GLU C 2 219 ? 16.811  44.971  12.057  1.00 84.24  ? 219 GLU A CD  1 
ATOM   5670  O OE1 . GLU C 2 219 ? 17.160  46.151  11.847  1.00 87.11  ? 219 GLU A OE1 1 
ATOM   5671  O OE2 . GLU C 2 219 ? 17.441  44.175  12.793  1.00 84.95  ? 219 GLU A OE2 1 
ATOM   5672  N N   . PRO C 2 220 ? 12.467  42.329  12.654  1.00 75.59  ? 220 PRO A N   1 
ATOM   5673  C CA  . PRO C 2 220 ? 11.178  42.650  13.291  1.00 76.40  ? 220 PRO A CA  1 
ATOM   5674  C C   . PRO C 2 220 ? 11.221  43.923  14.124  1.00 80.49  ? 220 PRO A C   1 
ATOM   5675  O O   . PRO C 2 220 ? 12.135  44.727  13.943  1.00 82.48  ? 220 PRO A O   1 
ATOM   5676  C CB  . PRO C 2 220 ? 10.919  41.434  14.183  1.00 75.87  ? 220 PRO A CB  1 
ATOM   5677  C CG  . PRO C 2 220 ? 12.288  40.893  14.478  1.00 76.68  ? 220 PRO A CG  1 
ATOM   5678  C CD  . PRO C 2 220 ? 13.107  41.141  13.247  1.00 75.49  ? 220 PRO A CD  1 
ATOM   5679  N N   . LYS C 2 221 ? 10.236  44.092  15.008  1.00 82.33  ? 221 LYS A N   1 
ATOM   5680  C CA  . LYS C 2 221 ? 10.155  45.228  15.943  1.00 87.06  ? 221 LYS A CA  1 
ATOM   5681  C C   . LYS C 2 221 ? 10.480  46.590  15.303  1.00 88.70  ? 221 LYS A C   1 
ATOM   5682  O O   . LYS C 2 221 ? 11.157  47.439  15.889  1.00 92.32  ? 221 LYS A O   1 
ATOM   5683  C CB  . LYS C 2 221 ? 11.016  44.979  17.196  1.00 90.41  ? 221 LYS A CB  1 
ATOM   5684  C CG  . LYS C 2 221 ? 10.649  45.873  18.373  1.00 95.93  ? 221 LYS A CG  1 
ATOM   5685  C CD  . LYS C 2 221 ? 11.504  45.632  19.599  1.00 99.52  ? 221 LYS A CD  1 
ATOM   5686  C CE  . LYS C 2 221 ? 11.271  46.741  20.608  1.00 105.63 ? 221 LYS A CE  1 
ATOM   5687  N NZ  . LYS C 2 221 ? 9.859   47.221  20.578  1.00 106.58 ? 221 LYS A NZ  1 
ATOM   5688  N N   . ASP D 3 1   ? -16.327 24.655  -35.403 1.00 30.23  ? 1   ASP B N   1 
ATOM   5689  C CA  . ASP D 3 1   ? -15.329 23.634  -35.123 1.00 29.95  ? 1   ASP B CA  1 
ATOM   5690  C C   . ASP D 3 1   ? -15.818 22.597  -34.097 1.00 28.83  ? 1   ASP B C   1 
ATOM   5691  O O   . ASP D 3 1   ? -16.856 22.745  -33.498 1.00 28.12  ? 1   ASP B O   1 
ATOM   5692  C CB  . ASP D 3 1   ? -14.008 24.260  -34.648 1.00 32.69  ? 1   ASP B CB  1 
ATOM   5693  C CG  . ASP D 3 1   ? -13.762 25.662  -35.215 1.00 32.64  ? 1   ASP B CG  1 
ATOM   5694  O OD1 . ASP D 3 1   ? -14.198 25.956  -36.347 1.00 34.67  ? 1   ASP B OD1 1 
ATOM   5695  O OD2 . ASP D 3 1   ? -13.122 26.479  -34.508 1.00 33.02  ? 1   ASP B OD2 1 
ATOM   5696  N N   . ILE D 3 2   ? -15.051 21.541  -33.902 1.00 31.62  ? 2   ILE B N   1 
ATOM   5697  C CA  . ILE D 3 2   ? -15.409 20.504  -32.964 1.00 31.11  ? 2   ILE B CA  1 
ATOM   5698  C C   . ILE D 3 2   ? -15.023 20.981  -31.572 1.00 30.28  ? 2   ILE B C   1 
ATOM   5699  O O   . ILE D 3 2   ? -13.920 21.495  -31.385 1.00 30.33  ? 2   ILE B O   1 
ATOM   5700  C CB  . ILE D 3 2   ? -14.621 19.223  -33.270 1.00 32.14  ? 2   ILE B CB  1 
ATOM   5701  C CG1 . ILE D 3 2   ? -15.257 18.456  -34.435 1.00 33.82  ? 2   ILE B CG1 1 
ATOM   5702  C CG2 . ILE D 3 2   ? -14.520 18.322  -32.043 1.00 31.44  ? 2   ILE B CG2 1 
ATOM   5703  C CD1 . ILE D 3 2   ? -14.291 17.526  -35.162 1.00 35.21  ? 2   ILE B CD1 1 
ATOM   5704  N N   . VAL D 3 3   ? -15.938 20.828  -30.608 1.00 29.66  ? 3   VAL B N   1 
ATOM   5705  C CA  . VAL D 3 3   ? -15.684 21.158  -29.220 1.00 24.20  ? 3   VAL B CA  1 
ATOM   5706  C C   . VAL D 3 3   ? -15.060 19.977  -28.507 1.00 24.08  ? 3   VAL B C   1 
ATOM   5707  O O   . VAL D 3 3   ? -15.611 18.882  -28.476 1.00 24.53  ? 3   VAL B O   1 
ATOM   5708  C CB  . VAL D 3 3   ? -17.006 21.563  -28.507 1.00 29.18  ? 3   VAL B CB  1 
ATOM   5709  C CG1 . VAL D 3 3   ? -16.833 21.590  -27.003 1.00 22.36  ? 3   VAL B CG1 1 
ATOM   5710  C CG2 . VAL D 3 3   ? -17.471 22.903  -28.999 1.00 23.66  ? 3   VAL B CG2 1 
ATOM   5711  N N   . MET D 3 4   ? -13.897 20.205  -27.924 1.00 23.66  ? 4   MET B N   1 
ATOM   5712  C CA  . MET D 3 4   ? -13.228 19.175  -27.125 1.00 23.66  ? 4   MET B CA  1 
ATOM   5713  C C   . MET D 3 4   ? -13.343 19.464  -25.622 1.00 22.49  ? 4   MET B C   1 
ATOM   5714  O O   . MET D 3 4   ? -12.981 20.525  -25.122 1.00 21.80  ? 4   MET B O   1 
ATOM   5715  C CB  . MET D 3 4   ? -11.770 19.056  -27.559 1.00 25.98  ? 4   MET B CB  1 
ATOM   5716  C CG  . MET D 3 4   ? -11.633 18.811  -29.025 1.00 25.75  ? 4   MET B CG  1 
ATOM   5717  S SD  . MET D 3 4   ? -12.271 17.180  -29.410 1.00 33.87  ? 4   MET B SD  1 
ATOM   5718  C CE  . MET D 3 4   ? -11.010 16.182  -28.634 1.00 27.40  ? 4   MET B CE  1 
ATOM   5719  N N   . THR D 3 5   ? -13.872 18.510  -24.893 1.00 25.29  ? 5   THR B N   1 
ATOM   5720  C CA  . THR D 3 5   ? -14.237 18.780  -23.531 1.00 24.54  ? 5   THR B CA  1 
ATOM   5721  C C   . THR D 3 5   ? -13.622 17.748  -22.635 1.00 24.88  ? 5   THR B C   1 
ATOM   5722  O O   . THR D 3 5   ? -14.064 16.607  -22.620 1.00 22.53  ? 5   THR B O   1 
ATOM   5723  C CB  . THR D 3 5   ? -15.758 18.735  -23.406 1.00 24.95  ? 5   THR B CB  1 
ATOM   5724  O OG1 . THR D 3 5   ? -16.308 19.638  -24.363 1.00 25.45  ? 5   THR B OG1 1 
ATOM   5725  C CG2 . THR D 3 5   ? -16.226 19.156  -22.016 1.00 24.27  ? 5   THR B CG2 1 
ATOM   5726  N N   . GLN D 3 6   ? -12.591 18.134  -21.897 1.00 21.55  ? 6   GLN B N   1 
ATOM   5727  C CA  . GLN D 3 6   ? -12.037 17.224  -20.897 1.00 24.42  ? 6   GLN B CA  1 
ATOM   5728  C C   . GLN D 3 6   ? -12.743 17.347  -19.551 1.00 23.54  ? 6   GLN B C   1 
ATOM   5729  O O   . GLN D 3 6   ? -13.239 18.407  -19.185 1.00 20.54  ? 6   GLN B O   1 
ATOM   5730  C CB  . GLN D 3 6   ? -10.549 17.460  -20.696 1.00 25.00  ? 6   GLN B CB  1 
ATOM   5731  C CG  . GLN D 3 6   ? -9.798  17.503  -21.983 1.00 26.04  ? 6   GLN B CG  1 
ATOM   5732  C CD  . GLN D 3 6   ? -8.339  17.783  -21.800 1.00 26.62  ? 6   GLN B CD  1 
ATOM   5733  O OE1 . GLN D 3 6   ? -7.770  18.662  -22.461 1.00 23.33  ? 6   GLN B OE1 1 
ATOM   5734  N NE2 . GLN D 3 6   ? -7.709  17.024  -20.913 1.00 23.90  ? 6   GLN B NE2 1 
ATOM   5735  N N   . SER D 3 7   ? -12.782 16.242  -18.823 1.00 23.93  ? 7   SER B N   1 
ATOM   5736  C CA  . SER D 3 7   ? -13.141 16.276  -17.425 1.00 23.86  ? 7   SER B CA  1 
ATOM   5737  C C   . SER D 3 7   ? -12.329 15.252  -16.619 1.00 24.56  ? 7   SER B C   1 
ATOM   5738  O O   . SER D 3 7   ? -12.078 14.140  -17.079 1.00 25.69  ? 7   SER B O   1 
ATOM   5739  C CB  . SER D 3 7   ? -14.647 16.093  -17.246 1.00 24.45  ? 7   SER B CB  1 
ATOM   5740  O OG  . SER D 3 7   ? -15.014 14.729  -17.277 1.00 25.94  ? 7   SER B OG  1 
ATOM   5741  N N   . PRO D 3 8   ? -11.920 15.618  -15.404 1.00 24.32  ? 8   PRO B N   1 
ATOM   5742  C CA  . PRO D 3 8   ? -12.212 16.888  -14.746 1.00 23.79  ? 8   PRO B CA  1 
ATOM   5743  C C   . PRO D 3 8   ? -11.284 17.973  -15.225 1.00 23.94  ? 8   PRO B C   1 
ATOM   5744  O O   . PRO D 3 8   ? -10.545 17.746  -16.171 1.00 24.22  ? 8   PRO B O   1 
ATOM   5745  C CB  . PRO D 3 8   ? -11.936 16.582  -13.280 1.00 22.23  ? 8   PRO B CB  1 
ATOM   5746  C CG  . PRO D 3 8   ? -10.905 15.517  -13.313 1.00 26.85  ? 8   PRO B CG  1 
ATOM   5747  C CD  . PRO D 3 8   ? -11.122 14.719  -14.552 1.00 23.73  ? 8   PRO B CD  1 
ATOM   5748  N N   . ASP D 3 9   ? -11.322 19.137  -14.591 1.00 24.05  ? 9   ASP B N   1 
ATOM   5749  C CA  . ASP D 3 9   ? -10.362 20.178  -14.920 1.00 24.65  ? 9   ASP B CA  1 
ATOM   5750  C C   . ASP D 3 9   ? -9.108  19.965  -14.106 1.00 25.12  ? 9   ASP B C   1 
ATOM   5751  O O   . ASP D 3 9   ? -8.011  20.224  -14.585 1.00 25.41  ? 9   ASP B O   1 
ATOM   5752  C CB  . ASP D 3 9   ? -10.946 21.562  -14.692 1.00 25.39  ? 9   ASP B CB  1 
ATOM   5753  C CG  . ASP D 3 9   ? -12.179 21.800  -15.530 1.00 26.82  ? 9   ASP B CG  1 
ATOM   5754  O OD1 . ASP D 3 9   ? -12.142 21.597  -16.785 1.00 27.36  ? 9   ASP B OD1 1 
ATOM   5755  O OD2 . ASP D 3 9   ? -13.212 22.154  -14.922 1.00 27.53  ? 9   ASP B OD2 1 
ATOM   5756  N N   . SER D 3 10  ? -9.276  19.473  -12.880 1.00 25.53  ? 10  SER B N   1 
ATOM   5757  C CA  . SER D 3 10  ? -8.140  19.074  -12.064 1.00 26.53  ? 10  SER B CA  1 
ATOM   5758  C C   . SER D 3 10  ? -8.490  17.869  -11.235 1.00 27.36  ? 10  SER B C   1 
ATOM   5759  O O   . SER D 3 10  ? -9.632  17.721  -10.816 1.00 27.16  ? 10  SER B O   1 
ATOM   5760  C CB  . SER D 3 10  ? -7.696  20.201  -11.151 1.00 26.57  ? 10  SER B CB  1 
ATOM   5761  O OG  . SER D 3 10  ? -8.819  20.747  -10.497 1.00 26.45  ? 10  SER B OG  1 
ATOM   5762  N N   . LEU D 3 11  ? -7.517  16.983  -11.029 1.00 28.39  ? 11  LEU B N   1 
ATOM   5763  C CA  . LEU D 3 11  ? -7.691  15.925  -10.052 1.00 25.61  ? 11  LEU B CA  1 
ATOM   5764  C C   . LEU D 3 11  ? -6.407  15.650  -9.311  1.00 29.30  ? 11  LEU B C   1 
ATOM   5765  O O   . LEU D 3 11  ? -5.318  15.767  -9.864  1.00 27.30  ? 11  LEU B O   1 
ATOM   5766  C CB  . LEU D 3 11  ? -8.239  14.639  -10.658 1.00 29.26  ? 11  LEU B CB  1 
ATOM   5767  C CG  . LEU D 3 11  ? -7.215  13.738  -11.321 1.00 30.38  ? 11  LEU B CG  1 
ATOM   5768  C CD1 . LEU D 3 11  ? -7.777  12.362  -11.562 1.00 28.37  ? 11  LEU B CD1 1 
ATOM   5769  C CD2 . LEU D 3 11  ? -6.836  14.386  -12.611 1.00 29.53  ? 11  LEU B CD2 1 
ATOM   5770  N N   . ALA D 3 12  ? -6.558  15.315  -8.039  1.00 27.84  ? 12  ALA B N   1 
ATOM   5771  C CA  . ALA D 3 12  ? -5.431  14.956  -7.208  1.00 29.41  ? 12  ALA B CA  1 
ATOM   5772  C C   . ALA D 3 12  ? -5.409  13.457  -6.928  1.00 31.06  ? 12  ALA B C   1 
ATOM   5773  O O   . ALA D 3 12  ? -6.375  12.887  -6.435  1.00 31.34  ? 12  ALA B O   1 
ATOM   5774  C CB  . ALA D 3 12  ? -5.491  15.720  -5.933  1.00 29.59  ? 12  ALA B CB  1 
ATOM   5775  N N   . VAL D 3 13  ? -4.298  12.811  -7.233  1.00 32.37  ? 13  VAL B N   1 
ATOM   5776  C CA  . VAL D 3 13  ? -4.218  11.383  -6.993  1.00 35.62  ? 13  VAL B CA  1 
ATOM   5777  C C   . VAL D 3 13  ? -3.001  11.037  -6.128  1.00 38.46  ? 13  VAL B C   1 
ATOM   5778  O O   . VAL D 3 13  ? -1.935  11.589  -6.332  1.00 38.40  ? 13  VAL B O   1 
ATOM   5779  C CB  . VAL D 3 13  ? -4.216  10.605  -8.334  1.00 35.79  ? 13  VAL B CB  1 
ATOM   5780  C CG1 . VAL D 3 13  ? -4.007  9.113   -8.117  1.00 37.70  ? 13  VAL B CG1 1 
ATOM   5781  C CG2 . VAL D 3 13  ? -5.509  10.846  -9.067  1.00 33.43  ? 13  VAL B CG2 1 
ATOM   5782  N N   . SER D 3 14  ? -3.183  10.152  -5.150  1.00 38.00  ? 14  SER B N   1 
ATOM   5783  C CA  . SER D 3 14  ? -2.086  9.649   -4.321  1.00 40.35  ? 14  SER B CA  1 
ATOM   5784  C C   . SER D 3 14  ? -1.047  8.926   -5.161  1.00 46.03  ? 14  SER B C   1 
ATOM   5785  O O   . SER D 3 14  ? -1.392  8.259   -6.129  1.00 46.00  ? 14  SER B O   1 
ATOM   5786  C CB  . SER D 3 14  ? -2.608  8.653   -3.290  1.00 42.18  ? 14  SER B CB  1 
ATOM   5787  O OG  . SER D 3 14  ? -3.364  9.285   -2.280  1.00 41.56  ? 14  SER B OG  1 
ATOM   5788  N N   . LEU D 3 15  ? 0.221   9.049   -4.780  1.00 43.17  ? 15  LEU B N   1 
ATOM   5789  C CA  . LEU D 3 15  ? 1.283   8.297   -5.425  1.00 45.00  ? 15  LEU B CA  1 
ATOM   5790  C C   . LEU D 3 15  ? 0.960   6.814   -5.408  1.00 54.49  ? 15  LEU B C   1 
ATOM   5791  O O   . LEU D 3 15  ? 0.676   6.246   -4.351  1.00 56.05  ? 15  LEU B O   1 
ATOM   5792  C CB  . LEU D 3 15  ? 2.601   8.543   -4.709  1.00 46.76  ? 15  LEU B CB  1 
ATOM   5793  C CG  . LEU D 3 15  ? 3.099   9.973   -4.853  1.00 45.26  ? 15  LEU B CG  1 
ATOM   5794  C CD1 . LEU D 3 15  ? 4.199   10.257  -3.880  1.00 47.01  ? 15  LEU B CD1 1 
ATOM   5795  C CD2 . LEU D 3 15  ? 3.606   10.128  -6.250  1.00 44.69  ? 15  LEU B CD2 1 
ATOM   5796  N N   . GLY D 3 16  ? 0.976   6.196   -6.587  1.00 54.49  ? 16  GLY B N   1 
ATOM   5797  C CA  . GLY D 3 16  ? 0.783   4.760   -6.714  1.00 56.33  ? 16  GLY B CA  1 
ATOM   5798  C C   . GLY D 3 16  ? -0.638  4.372   -7.044  1.00 54.94  ? 16  GLY B C   1 
ATOM   5799  O O   . GLY D 3 16  ? -0.922  3.229   -7.393  1.00 56.60  ? 16  GLY B O   1 
ATOM   5800  N N   . GLU D 3 17  ? -1.540  5.333   -6.936  1.00 52.22  ? 17  GLU B N   1 
ATOM   5801  C CA  . GLU D 3 17  ? -2.934  5.108   -7.288  1.00 51.20  ? 17  GLU B CA  1 
ATOM   5802  C C   . GLU D 3 17  ? -3.212  5.369   -8.780  1.00 49.41  ? 17  GLU B C   1 
ATOM   5803  O O   . GLU D 3 17  ? -2.357  5.901   -9.490  1.00 48.59  ? 17  GLU B O   1 
ATOM   5804  C CB  . GLU D 3 17  ? -3.822  5.987   -6.413  1.00 49.87  ? 17  GLU B CB  1 
ATOM   5805  C CG  . GLU D 3 17  ? -3.694  5.704   -4.936  1.00 51.94  ? 17  GLU B CG  1 
ATOM   5806  C CD  . GLU D 3 17  ? -4.572  4.551   -4.487  1.00 53.97  ? 17  GLU B CD  1 
ATOM   5807  O OE1 . GLU D 3 17  ? -5.807  4.768   -4.385  1.00 52.95  ? 17  GLU B OE1 1 
ATOM   5808  O OE2 . GLU D 3 17  ? -4.032  3.439   -4.251  1.00 56.68  ? 17  GLU B OE2 1 
ATOM   5809  N N   . ARG D 3 18  ? -4.408  4.988   -9.241  1.00 48.82  ? 18  ARG B N   1 
ATOM   5810  C CA  . ARG D 3 18  ? -4.818  5.155   -10.648 1.00 47.57  ? 18  ARG B CA  1 
ATOM   5811  C C   . ARG D 3 18  ? -5.428  6.526   -10.940 1.00 44.49  ? 18  ARG B C   1 
ATOM   5812  O O   . ARG D 3 18  ? -6.185  7.044   -10.134 1.00 43.54  ? 18  ARG B O   1 
ATOM   5813  C CB  . ARG D 3 18  ? -5.795  4.052   -11.053 1.00 49.00  ? 18  ARG B CB  1 
ATOM   5814  C CG  . ARG D 3 18  ? -6.781  4.442   -12.129 1.00 47.92  ? 18  ARG B CG  1 
ATOM   5815  C CD  . ARG D 3 18  ? -7.234  3.221   -12.933 1.00 50.64  ? 18  ARG B CD  1 
ATOM   5816  N NE  . ARG D 3 18  ? -8.229  2.395   -12.239 1.00 52.70  ? 18  ARG B NE  1 
ATOM   5817  C CZ  . ARG D 3 18  ? -9.551  2.530   -12.373 1.00 52.32  ? 18  ARG B CZ  1 
ATOM   5818  N NH1 . ARG D 3 18  ? -10.052 3.467   -13.178 1.00 50.26  ? 18  ARG B NH1 1 
ATOM   5819  N NH2 . ARG D 3 18  ? -10.381 1.733   -11.703 1.00 53.86  ? 18  ARG B NH2 1 
ATOM   5820  N N   . ALA D 3 19  ? -5.081  7.118   -12.080 1.00 43.41  ? 19  ALA B N   1 
ATOM   5821  C CA  . ALA D 3 19  ? -5.645  8.403   -12.491 1.00 34.63  ? 19  ALA B CA  1 
ATOM   5822  C C   . ALA D 3 19  ? -6.480  8.247   -13.764 1.00 33.98  ? 19  ALA B C   1 
ATOM   5823  O O   . ALA D 3 19  ? -6.089  7.570   -14.696 1.00 35.15  ? 19  ALA B O   1 
ATOM   5824  C CB  . ALA D 3 19  ? -4.551  9.404   -12.701 1.00 33.98  ? 19  ALA B CB  1 
ATOM   5825  N N   . THR D 3 20  ? -7.645  8.867   -13.802 1.00 32.31  ? 20  THR B N   1 
ATOM   5826  C CA  . THR D 3 20  ? -8.504  8.762   -14.974 1.00 35.19  ? 20  THR B CA  1 
ATOM   5827  C C   . THR D 3 20  ? -8.938  10.126  -15.497 1.00 32.68  ? 20  THR B C   1 
ATOM   5828  O O   . THR D 3 20  ? -9.646  10.842  -14.804 1.00 31.43  ? 20  THR B O   1 
ATOM   5829  C CB  . THR D 3 20  ? -9.803  7.983   -14.661 1.00 36.10  ? 20  THR B CB  1 
ATOM   5830  O OG1 . THR D 3 20  ? -9.505  6.656   -14.190 1.00 38.49  ? 20  THR B OG1 1 
ATOM   5831  C CG2 . THR D 3 20  ? -10.658 7.895   -15.911 1.00 35.92  ? 20  THR B CG2 1 
ATOM   5832  N N   . ILE D 3 21  ? -8.533  10.470  -16.721 1.00 32.21  ? 21  ILE B N   1 
ATOM   5833  C CA  . ILE D 3 21  ? -9.019  11.680  -17.399 1.00 30.24  ? 21  ILE B CA  1 
ATOM   5834  C C   . ILE D 3 21  ? -9.875  11.386  -18.649 1.00 30.23  ? 21  ILE B C   1 
ATOM   5835  O O   . ILE D 3 21  ? -9.472  10.597  -19.496 1.00 31.68  ? 21  ILE B O   1 
ATOM   5836  C CB  . ILE D 3 21  ? -7.856  12.570  -17.839 1.00 29.83  ? 21  ILE B CB  1 
ATOM   5837  C CG1 . ILE D 3 21  ? -6.937  12.899  -16.662 1.00 29.67  ? 21  ILE B CG1 1 
ATOM   5838  C CG2 . ILE D 3 21  ? -8.388  13.851  -18.483 1.00 28.33  ? 21  ILE B CG2 1 
ATOM   5839  C CD1 . ILE D 3 21  ? -5.580  13.314  -17.126 1.00 29.93  ? 21  ILE B CD1 1 
ATOM   5840  N N   . ASN D 3 22  ? -11.041 12.023  -18.775 1.00 28.80  ? 22  ASN B N   1 
ATOM   5841  C CA  . ASN D 3 22  ? -11.883 11.805  -19.957 1.00 28.95  ? 22  ASN B CA  1 
ATOM   5842  C C   . ASN D 3 22  ? -11.767 12.904  -21.004 1.00 28.12  ? 22  ASN B C   1 
ATOM   5843  O O   . ASN D 3 22  ? -11.555 14.064  -20.673 1.00 26.95  ? 22  ASN B O   1 
ATOM   5844  C CB  . ASN D 3 22  ? -13.368 11.616  -19.594 1.00 28.53  ? 22  ASN B CB  1 
ATOM   5845  C CG  . ASN D 3 22  ? -13.605 10.481  -18.597 1.00 29.42  ? 22  ASN B CG  1 
ATOM   5846  O OD1 . ASN D 3 22  ? -13.428 9.307   -18.896 1.00 31.03  ? 22  ASN B OD1 1 
ATOM   5847  N ND2 . ASN D 3 22  ? -14.032 10.842  -17.415 1.00 28.61  ? 22  ASN B ND2 1 
ATOM   5848  N N   . CYS D 3 23  ? -11.906 12.534  -22.272 1.00 29.00  ? 23  CYS B N   1 
ATOM   5849  C CA  . CYS D 3 23  ? -11.991 13.525  -23.348 1.00 28.41  ? 23  CYS B CA  1 
ATOM   5850  C C   . CYS D 3 23  ? -13.201 13.262  -24.218 1.00 28.82  ? 23  CYS B C   1 
ATOM   5851  O O   . CYS D 3 23  ? -13.334 12.161  -24.744 1.00 30.51  ? 23  CYS B O   1 
ATOM   5852  C CB  . CYS D 3 23  ? -10.754 13.486  -24.242 1.00 29.31  ? 23  CYS B CB  1 
ATOM   5853  S SG  . CYS D 3 23  ? -10.593 14.944  -25.266 1.00 39.45  ? 23  CYS B SG  1 
ATOM   5854  N N   . GLU D 3 24  ? -14.068 14.264  -24.382 1.00 27.47  ? 24  GLU B N   1 
ATOM   5855  C CA  . GLU D 3 24  ? -15.254 14.144  -25.248 1.00 27.81  ? 24  GLU B CA  1 
ATOM   5856  C C   . GLU D 3 24  ? -15.238 15.048  -26.490 1.00 27.77  ? 24  GLU B C   1 
ATOM   5857  O O   . GLU D 3 24  ? -14.795 16.202  -26.440 1.00 27.18  ? 24  GLU B O   1 
ATOM   5858  C CB  . GLU D 3 24  ? -16.516 14.416  -24.442 1.00 27.27  ? 24  GLU B CB  1 
ATOM   5859  C CG  . GLU D 3 24  ? -16.779 13.367  -23.376 1.00 28.37  ? 24  GLU B CG  1 
ATOM   5860  C CD  . GLU D 3 24  ? -18.065 13.634  -22.608 1.00 28.52  ? 24  GLU B CD  1 
ATOM   5861  O OE1 . GLU D 3 24  ? -18.164 14.718  -21.996 1.00 27.40  ? 24  GLU B OE1 1 
ATOM   5862  O OE2 . GLU D 3 24  ? -18.985 12.774  -22.640 1.00 29.82  ? 24  GLU B OE2 1 
ATOM   5863  N N   . SER D 3 25  ? -15.731 14.544  -27.615 1.00 28.73  ? 25  SER B N   1 
ATOM   5864  C CA  . SER D 3 25  ? -15.914 15.430  -28.765 1.00 27.05  ? 25  SER B CA  1 
ATOM   5865  C C   . SER D 3 25  ? -17.367 15.535  -29.179 1.00 27.29  ? 25  SER B C   1 
ATOM   5866  O O   . SER D 3 25  ? -18.139 14.631  -28.946 1.00 27.87  ? 25  SER B O   1 
ATOM   5867  C CB  . SER D 3 25  ? -15.057 14.998  -29.943 1.00 28.53  ? 25  SER B CB  1 
ATOM   5868  O OG  . SER D 3 25  ? -15.234 13.627  -30.177 1.00 29.99  ? 25  SER B OG  1 
ATOM   5869  N N   . SER D 3 26  ? -17.716 16.654  -29.800 1.00 27.02  ? 26  SER B N   1 
ATOM   5870  C CA  . SER D 3 26  ? -19.070 16.916  -30.257 1.00 29.86  ? 26  SER B CA  1 
ATOM   5871  C C   . SER D 3 26  ? -19.329 16.338  -31.650 1.00 32.00  ? 26  SER B C   1 
ATOM   5872  O O   . SER D 3 26  ? -20.348 16.635  -32.274 1.00 33.26  ? 26  SER B O   1 
ATOM   5873  C CB  . SER D 3 26  ? -19.296 18.418  -30.302 1.00 28.92  ? 26  SER B CB  1 
ATOM   5874  O OG  . SER D 3 26  ? -18.191 19.066  -30.903 1.00 26.67  ? 26  SER B OG  1 
ATOM   5875  N N   . GLN D 3 27  ? -18.387 15.543  -32.147 1.00 32.50  ? 27  GLN B N   1 
ATOM   5876  C CA  . GLN D 3 27  ? -18.513 14.879  -33.423 1.00 33.85  ? 27  GLN B CA  1 
ATOM   5877  C C   . GLN D 3 27  ? -17.623 13.666  -33.300 1.00 33.95  ? 27  GLN B C   1 
ATOM   5878  O O   . GLN D 3 27  ? -16.705 13.685  -32.535 1.00 32.81  ? 27  GLN B O   1 
ATOM   5879  C CB  . GLN D 3 27  ? -18.036 15.788  -34.555 1.00 35.05  ? 27  GLN B CB  1 
ATOM   5880  C CG  . GLN D 3 27  ? -18.248 15.182  -35.937 1.00 38.17  ? 27  GLN B CG  1 
ATOM   5881  C CD  . GLN D 3 27  ? -17.146 15.527  -36.947 1.00 39.78  ? 27  GLN B CD  1 
ATOM   5882  O OE1 . GLN D 3 27  ? -16.830 16.705  -37.173 1.00 39.37  ? 27  GLN B OE1 1 
ATOM   5883  N NE2 . GLN D 3 27  ? -16.572 14.490  -37.575 1.00 41.68  ? 27  GLN B NE2 1 
ATOM   5884  N N   . SER D 3 28  ? -17.902 12.598  -34.029 1.00 35.98  ? 28  SER B N   1 
ATOM   5885  C CA  . SER D 3 28  ? -17.098 11.398  -33.911 1.00 36.23  ? 28  SER B CA  1 
ATOM   5886  C C   . SER D 3 28  ? -15.738 11.676  -34.492 1.00 36.73  ? 28  SER B C   1 
ATOM   5887  O O   . SER D 3 28  ? -15.613 12.399  -35.464 1.00 38.46  ? 28  SER B O   1 
ATOM   5888  C CB  . SER D 3 28  ? -17.757 10.228  -34.632 1.00 38.53  ? 28  SER B CB  1 
ATOM   5889  O OG  . SER D 3 28  ? -16.959 9.062   -34.559 1.00 40.00  ? 28  SER B OG  1 
ATOM   5890  N N   . LEU D 3 29  ? -14.709 11.130  -33.873 1.00 36.77  ? 29  LEU B N   1 
ATOM   5891  C CA  . LEU D 3 29  ? -13.363 11.264  -34.397 1.00 37.56  ? 29  LEU B CA  1 
ATOM   5892  C C   . LEU D 3 29  ? -12.970 9.937   -35.035 1.00 40.16  ? 29  LEU B C   1 
ATOM   5893  O O   . LEU D 3 29  ? -11.798 9.691   -35.328 1.00 41.28  ? 29  LEU B O   1 
ATOM   5894  C CB  . LEU D 3 29  ? -12.381 11.629  -33.279 1.00 36.06  ? 29  LEU B CB  1 
ATOM   5895  C CG  . LEU D 3 29  ? -12.619 12.921  -32.500 1.00 33.65  ? 29  LEU B CG  1 
ATOM   5896  C CD1 . LEU D 3 29  ? -11.496 13.157  -31.510 1.00 32.71  ? 29  LEU B CD1 1 
ATOM   5897  C CD2 . LEU D 3 29  ? -12.774 14.113  -33.428 1.00 33.45  ? 29  LEU B CD2 1 
ATOM   5898  N N   . LEU D 3 30  ? -13.965 9.073   -35.220 1.00 41.31  ? 30  LEU B N   1 
ATOM   5899  C CA  . LEU D 3 30  ? -13.748 7.796   -35.888 1.00 54.43  ? 30  LEU B CA  1 
ATOM   5900  C C   . LEU D 3 30  ? -13.781 7.975   -37.396 1.00 56.40  ? 30  LEU B C   1 
ATOM   5901  O O   . LEU D 3 30  ? -14.682 8.635   -37.934 1.00 45.55  ? 30  LEU B O   1 
ATOM   5902  C CB  . LEU D 3 30  ? -14.800 6.779   -35.469 1.00 44.87  ? 30  LEU B CB  1 
ATOM   5903  C CG  . LEU D 3 30  ? -14.547 5.365   -35.963 1.00 47.93  ? 30  LEU B CG  1 
ATOM   5904  C CD1 . LEU D 3 30  ? -13.166 4.931   -35.589 1.00 48.59  ? 30  LEU B CD1 1 
ATOM   5905  C CD2 . LEU D 3 30  ? -15.566 4.432   -35.364 1.00 48.54  ? 30  LEU B CD2 1 
ATOM   5906  N N   . ASN D 3 31  ? -12.778 7.405   -38.063 1.00 58.62  ? 31  ASN B N   1 
ATOM   5907  C CA  . ASN D 3 31  ? -12.705 7.352   -39.528 1.00 61.15  ? 31  ASN B CA  1 
ATOM   5908  C C   . ASN D 3 31  ? -13.274 6.028   -40.021 1.00 63.51  ? 31  ASN B C   1 
ATOM   5909  O O   . ASN D 3 31  ? -12.662 4.980   -39.826 1.00 65.16  ? 31  ASN B O   1 
ATOM   5910  C CB  . ASN D 3 31  ? -11.253 7.495   -39.979 1.00 62.83  ? 31  ASN B CB  1 
ATOM   5911  C CG  . ASN D 3 31  ? -11.095 7.563   -41.496 1.00 66.06  ? 31  ASN B CG  1 
ATOM   5912  O OD1 . ASN D 3 31  ? -12.028 7.292   -42.258 1.00 67.80  ? 31  ASN B OD1 1 
ATOM   5913  N ND2 . ASN D 3 31  ? -9.890  7.917   -41.941 1.00 67.02  ? 31  ASN B ND2 1 
ATOM   5914  N N   . SER D 3 32  ? -14.435 6.091   -40.670 1.00 63.76  ? 32  SER B N   1 
ATOM   5915  C CA  . SER D 3 32  ? -15.176 4.898   -41.106 1.00 66.02  ? 32  SER B CA  1 
ATOM   5916  C C   . SER D 3 32  ? -14.357 3.924   -41.942 1.00 68.80  ? 32  SER B C   1 
ATOM   5917  O O   . SER D 3 32  ? -14.578 2.722   -41.879 1.00 70.60  ? 32  SER B O   1 
ATOM   5918  C CB  . SER D 3 32  ? -16.450 5.297   -41.867 1.00 66.88  ? 32  SER B CB  1 
ATOM   5919  O OG  . SER D 3 32  ? -17.270 6.156   -41.071 1.00 64.40  ? 32  SER B OG  1 
ATOM   5920  N N   . GLY D 3 33  ? -13.407 4.452   -42.707 1.00 69.59  ? 33  GLY B N   1 
ATOM   5921  C CA  . GLY D 3 33  ? -12.534 3.631   -43.525 1.00 64.05  ? 33  GLY B CA  1 
ATOM   5922  C C   . GLY D 3 33  ? -11.592 2.752   -42.722 1.00 71.59  ? 33  GLY B C   1 
ATOM   5923  O O   . GLY D 3 33  ? -11.784 1.538   -42.643 1.00 73.54  ? 33  GLY B O   1 
ATOM   5924  N N   . ASN D 3 34  ? -10.580 3.367   -42.113 1.00 69.91  ? 34  ASN B N   1 
ATOM   5925  C CA  . ASN D 3 34  ? -9.518  2.625   -41.435 1.00 71.12  ? 34  ASN B CA  1 
ATOM   5926  C C   . ASN D 3 34  ? -9.828  2.197   -39.988 1.00 69.22  ? 34  ASN B C   1 
ATOM   5927  O O   . ASN D 3 34  ? -9.018  1.533   -39.349 1.00 70.14  ? 34  ASN B O   1 
ATOM   5928  C CB  . ASN D 3 34  ? -8.185  3.394   -41.507 1.00 71.33  ? 34  ASN B CB  1 
ATOM   5929  C CG  . ASN D 3 34  ? -8.206  4.699   -40.706 1.00 68.21  ? 34  ASN B CG  1 
ATOM   5930  O OD1 . ASN D 3 34  ? -9.227  5.060   -40.106 1.00 66.28  ? 34  ASN B OD1 1 
ATOM   5931  N ND2 . ASN D 3 34  ? -7.072  5.401   -40.679 1.00 67.72  ? 34  ASN B ND2 1 
ATOM   5932  N N   . GLN D 3 35  ? -10.989 2.588   -39.477 1.00 66.88  ? 35  GLN B N   1 
ATOM   5933  C CA  . GLN D 3 35  ? -11.404 2.229   -38.118 1.00 65.19  ? 35  GLN B CA  1 
ATOM   5934  C C   . GLN D 3 35  ? -10.490 2.794   -37.009 1.00 62.97  ? 35  GLN B C   1 
ATOM   5935  O O   . GLN D 3 35  ? -10.458 2.284   -35.889 1.00 62.73  ? 35  GLN B O   1 
ATOM   5936  C CB  . GLN D 3 35  ? -11.594 0.709   -37.995 1.00 67.96  ? 35  GLN B CB  1 
ATOM   5937  C CG  . GLN D 3 35  ? -12.908 0.191   -38.593 1.00 69.50  ? 35  GLN B CG  1 
ATOM   5938  C CD  . GLN D 3 35  ? -14.133 0.651   -37.800 1.00 67.02  ? 35  GLN B CD  1 
ATOM   5939  O OE1 . GLN D 3 35  ? -14.834 1.591   -38.196 1.00 65.47  ? 35  GLN B OE1 1 
ATOM   5940  N NE2 . GLN D 3 35  ? -14.388 -0.007  -36.666 1.00 66.74  ? 35  GLN B NE2 1 
ATOM   5941  N N   . LYS D 3 36  ? -9.769  3.866   -37.331 1.00 61.42  ? 36  LYS B N   1 
ATOM   5942  C CA  . LYS D 3 36  ? -8.913  4.562   -36.374 1.00 58.80  ? 36  LYS B CA  1 
ATOM   5943  C C   . LYS D 3 36  ? -9.576  5.828   -35.835 1.00 55.04  ? 36  LYS B C   1 
ATOM   5944  O O   . LYS D 3 36  ? -10.301 6.524   -36.544 1.00 54.13  ? 36  LYS B O   1 
ATOM   5945  C CB  . LYS D 3 36  ? -7.586  4.951   -37.028 1.00 59.81  ? 36  LYS B CB  1 
ATOM   5946  C CG  . LYS D 3 36  ? -6.466  3.937   -36.917 1.00 62.34  ? 36  LYS B CG  1 
ATOM   5947  C CD  . LYS D 3 36  ? -5.300  4.317   -37.850 1.00 63.89  ? 36  LYS B CD  1 
ATOM   5948  C CE  . LYS D 3 36  ? -3.925  3.921   -37.270 1.00 64.99  ? 36  LYS B CE  1 
ATOM   5949  N NZ  . LYS D 3 36  ? -3.699  2.447   -37.134 1.00 67.87  ? 36  LYS B NZ  1 
ATOM   5950  N N   . ASN D 3 37  ? -9.294  6.136   -34.576 1.00 53.13  ? 37  ASN B N   1 
ATOM   5951  C CA  . ASN D 3 37  ? -9.808  7.346   -33.948 1.00 50.08  ? 37  ASN B CA  1 
ATOM   5952  C C   . ASN D 3 37  ? -8.755  8.433   -33.946 1.00 49.03  ? 37  ASN B C   1 
ATOM   5953  O O   . ASN D 3 37  ? -7.672  8.257   -33.394 1.00 43.05  ? 37  ASN B O   1 
ATOM   5954  C CB  . ASN D 3 37  ? -10.225 7.057   -32.514 1.00 48.64  ? 37  ASN B CB  1 
ATOM   5955  C CG  . ASN D 3 37  ? -11.453 6.204   -32.429 1.00 43.17  ? 37  ASN B CG  1 
ATOM   5956  O OD1 . ASN D 3 37  ? -12.564 6.698   -32.557 1.00 42.07  ? 37  ASN B OD1 1 
ATOM   5957  N ND2 . ASN D 3 37  ? -11.265 4.913   -32.191 1.00 45.21  ? 37  ASN B ND2 1 
ATOM   5958  N N   . TYR D 3 38  ? -9.080  9.566   -34.547 1.00 41.71  ? 38  TYR B N   1 
ATOM   5959  C CA  . TYR D 3 38  ? -8.113  10.643  -34.689 1.00 40.99  ? 38  TYR B CA  1 
ATOM   5960  C C   . TYR D 3 38  ? -8.001  11.563  -33.454 1.00 38.38  ? 38  TYR B C   1 
ATOM   5961  O O   . TYR D 3 38  ? -8.350  12.743  -33.497 1.00 36.84  ? 38  TYR B O   1 
ATOM   5962  C CB  . TYR D 3 38  ? -8.411  11.414  -35.971 1.00 41.52  ? 38  TYR B CB  1 
ATOM   5963  C CG  . TYR D 3 38  ? -7.975  10.644  -37.198 1.00 45.36  ? 38  TYR B CG  1 
ATOM   5964  C CD1 . TYR D 3 38  ? -6.832  11.006  -37.897 1.00 45.79  ? 38  TYR B CD1 1 
ATOM   5965  C CD2 . TYR D 3 38  ? -8.680  9.530   -37.635 1.00 46.23  ? 38  TYR B CD2 1 
ATOM   5966  C CE1 . TYR D 3 38  ? -6.429  10.305  -39.013 1.00 50.51  ? 38  TYR B CE1 1 
ATOM   5967  C CE2 . TYR D 3 38  ? -8.280  8.820   -38.746 1.00 49.17  ? 38  TYR B CE2 1 
ATOM   5968  C CZ  . TYR D 3 38  ? -7.151  9.207   -39.438 1.00 51.65  ? 38  TYR B CZ  1 
ATOM   5969  O OH  . TYR D 3 38  ? -6.735  8.494   -40.557 1.00 55.41  ? 38  TYR B OH  1 
ATOM   5970  N N   . LEU D 3 39  ? -7.494  11.010  -32.356 1.00 38.41  ? 39  LEU B N   1 
ATOM   5971  C CA  . LEU D 3 39  ? -7.498  11.695  -31.060 1.00 36.17  ? 39  LEU B CA  1 
ATOM   5972  C C   . LEU D 3 39  ? -6.096  11.692  -30.450 1.00 36.66  ? 39  LEU B C   1 
ATOM   5973  O O   . LEU D 3 39  ? -5.527  10.625  -30.211 1.00 38.42  ? 39  LEU B O   1 
ATOM   5974  C CB  . LEU D 3 39  ? -8.493  10.981  -30.137 1.00 35.27  ? 39  LEU B CB  1 
ATOM   5975  C CG  . LEU D 3 39  ? -8.816  11.481  -28.728 1.00 33.20  ? 39  LEU B CG  1 
ATOM   5976  C CD1 . LEU D 3 39  ? -7.744  11.063  -27.725 1.00 33.51  ? 39  LEU B CD1 1 
ATOM   5977  C CD2 . LEU D 3 39  ? -9.008  12.977  -28.743 1.00 31.38  ? 39  LEU B CD2 1 
ATOM   5978  N N   . THR D 3 40  ? -5.527  12.864  -30.199 1.00 35.01  ? 40  THR B N   1 
ATOM   5979  C CA  . THR D 3 40  ? -4.141  12.914  -29.707 1.00 37.58  ? 40  THR B CA  1 
ATOM   5980  C C   . THR D 3 40  ? -4.078  13.391  -28.252 1.00 33.82  ? 40  THR B C   1 
ATOM   5981  O O   . THR D 3 40  ? -4.757  14.342  -27.894 1.00 37.37  ? 40  THR B O   1 
ATOM   5982  C CB  . THR D 3 40  ? -3.223  13.823  -30.595 1.00 44.39  ? 40  THR B CB  1 
ATOM   5983  O OG1 . THR D 3 40  ? -3.270  13.394  -31.963 1.00 38.04  ? 40  THR B OG1 1 
ATOM   5984  C CG2 . THR D 3 40  ? -1.786  13.790  -30.097 1.00 37.07  ? 40  THR B CG2 1 
ATOM   5985  N N   . TRP D 3 41  ? -3.286  12.720  -27.418 1.00 34.58  ? 41  TRP B N   1 
ATOM   5986  C CA  . TRP D 3 41  ? -3.042  13.178  -26.046 1.00 33.29  ? 41  TRP B CA  1 
ATOM   5987  C C   . TRP D 3 41  ? -1.645  13.798  -25.891 1.00 33.80  ? 41  TRP B C   1 
ATOM   5988  O O   . TRP D 3 41  ? -0.641  13.205  -26.283 1.00 35.72  ? 41  TRP B O   1 
ATOM   5989  C CB  . TRP D 3 41  ? -3.163  12.022  -25.054 1.00 33.89  ? 41  TRP B CB  1 
ATOM   5990  C CG  . TRP D 3 41  ? -4.546  11.516  -24.757 1.00 36.96  ? 41  TRP B CG  1 
ATOM   5991  C CD1 . TRP D 3 41  ? -5.151  10.400  -25.277 1.00 34.45  ? 41  TRP B CD1 1 
ATOM   5992  C CD2 . TRP D 3 41  ? -5.480  12.079  -23.831 1.00 35.01  ? 41  TRP B CD2 1 
ATOM   5993  N NE1 . TRP D 3 41  ? -6.406  10.247  -24.745 1.00 33.41  ? 41  TRP B NE1 1 
ATOM   5994  C CE2 . TRP D 3 41  ? -6.635  11.264  -23.855 1.00 35.15  ? 41  TRP B CE2 1 
ATOM   5995  C CE3 . TRP D 3 41  ? -5.456  13.192  -22.986 1.00 29.60  ? 41  TRP B CE3 1 
ATOM   5996  C CZ2 . TRP D 3 41  ? -7.750  11.532  -23.065 1.00 30.02  ? 41  TRP B CZ2 1 
ATOM   5997  C CZ3 . TRP D 3 41  ? -6.564  13.458  -22.213 1.00 28.22  ? 41  TRP B CZ3 1 
ATOM   5998  C CH2 . TRP D 3 41  ? -7.690  12.627  -22.244 1.00 28.43  ? 41  TRP B CH2 1 
ATOM   5999  N N   . TYR D 3 42  ? -1.583  14.985  -25.311 1.00 32.28  ? 42  TYR B N   1 
ATOM   6000  C CA  . TYR D 3 42  ? -0.312  15.617  -24.966 1.00 33.41  ? 42  TYR B CA  1 
ATOM   6001  C C   . TYR D 3 42  ? -0.088  15.705  -23.438 1.00 32.95  ? 42  TYR B C   1 
ATOM   6002  O O   . TYR D 3 42  ? -1.024  15.659  -22.658 1.00 32.00  ? 42  TYR B O   1 
ATOM   6003  C CB  . TYR D 3 42  ? -0.263  17.020  -25.560 1.00 32.60  ? 42  TYR B CB  1 
ATOM   6004  C CG  . TYR D 3 42  ? -0.263  17.039  -27.059 1.00 33.60  ? 42  TYR B CG  1 
ATOM   6005  C CD1 . TYR D 3 42  ? 0.934   17.002  -27.777 1.00 35.67  ? 42  TYR B CD1 1 
ATOM   6006  C CD2 . TYR D 3 42  ? -1.454  17.105  -27.766 1.00 32.68  ? 42  TYR B CD2 1 
ATOM   6007  C CE1 . TYR D 3 42  ? 0.930   17.023  -29.172 1.00 36.92  ? 42  TYR B CE1 1 
ATOM   6008  C CE2 . TYR D 3 42  ? -1.470  17.140  -29.147 1.00 33.93  ? 42  TYR B CE2 1 
ATOM   6009  C CZ  . TYR D 3 42  ? -0.283  17.092  -29.851 1.00 36.14  ? 42  TYR B CZ  1 
ATOM   6010  O OH  . TYR D 3 42  ? -0.311  17.116  -31.232 1.00 37.66  ? 42  TYR B OH  1 
ATOM   6011  N N   . GLN D 3 43  ? 1.155   15.840  -23.008 1.00 33.07  ? 43  GLN B N   1 
ATOM   6012  C CA  . GLN D 3 43  ? 1.437   16.005  -21.599 1.00 32.66  ? 43  GLN B CA  1 
ATOM   6013  C C   . GLN D 3 43  ? 2.324   17.232  -21.503 1.00 32.61  ? 43  GLN B C   1 
ATOM   6014  O O   . GLN D 3 43  ? 3.302   17.321  -22.230 1.00 39.28  ? 43  GLN B O   1 
ATOM   6015  C CB  . GLN D 3 43  ? 2.160   14.771  -21.078 1.00 34.50  ? 43  GLN B CB  1 
ATOM   6016  C CG  . GLN D 3 43  ? 2.635   14.875  -19.654 1.00 37.14  ? 43  GLN B CG  1 
ATOM   6017  C CD  . GLN D 3 43  ? 3.788   13.936  -19.348 1.00 39.70  ? 43  GLN B CD  1 
ATOM   6018  O OE1 . GLN D 3 43  ? 4.867   14.043  -19.944 1.00 41.26  ? 43  GLN B OE1 1 
ATOM   6019  N NE2 . GLN D 3 43  ? 3.574   13.018  -18.406 1.00 37.52  ? 43  GLN B NE2 1 
ATOM   6020  N N   . GLN D 3 44  ? 1.973   18.201  -20.655 1.00 31.20  ? 44  GLN B N   1 
ATOM   6021  C CA  . GLN D 3 44  ? 2.815   19.384  -20.479 1.00 35.08  ? 44  GLN B CA  1 
ATOM   6022  C C   . GLN D 3 44  ? 3.235   19.622  -19.028 1.00 35.38  ? 44  GLN B C   1 
ATOM   6023  O O   . GLN D 3 44  ? 2.504   20.231  -18.250 1.00 34.21  ? 44  GLN B O   1 
ATOM   6024  C CB  . GLN D 3 44  ? 2.139   20.624  -21.032 1.00 30.05  ? 44  GLN B CB  1 
ATOM   6025  C CG  . GLN D 3 44  ? 2.980   21.864  -20.899 1.00 30.42  ? 44  GLN B CG  1 
ATOM   6026  C CD  . GLN D 3 44  ? 2.338   23.071  -21.532 1.00 29.48  ? 44  GLN B CD  1 
ATOM   6027  O OE1 . GLN D 3 44  ? 1.130   23.174  -21.579 1.00 31.86  ? 44  GLN B OE1 1 
ATOM   6028  N NE2 . GLN D 3 44  ? 3.141   23.992  -22.023 1.00 30.35  ? 44  GLN B NE2 1 
ATOM   6029  N N   . LYS D 3 45  ? 4.417   19.130  -18.672 1.00 37.26  ? 45  LYS B N   1 
ATOM   6030  C CA  . LYS D 3 45  ? 4.996   19.353  -17.353 1.00 37.93  ? 45  LYS B CA  1 
ATOM   6031  C C   . LYS D 3 45  ? 5.316   20.831  -17.215 1.00 38.18  ? 45  LYS B C   1 
ATOM   6032  O O   . LYS D 3 45  ? 5.448   21.521  -18.219 1.00 38.49  ? 45  LYS B O   1 
ATOM   6033  C CB  . LYS D 3 45  ? 6.260   18.509  -17.204 1.00 39.76  ? 45  LYS B CB  1 
ATOM   6034  C CG  . LYS D 3 45  ? 5.970   17.043  -17.377 1.00 40.04  ? 45  LYS B CG  1 
ATOM   6035  C CD  . LYS D 3 45  ? 7.185   16.186  -17.474 1.00 42.16  ? 45  LYS B CD  1 
ATOM   6036  C CE  . LYS D 3 45  ? 6.752   14.746  -17.403 1.00 42.81  ? 45  LYS B CE  1 
ATOM   6037  N NZ  . LYS D 3 45  ? 7.871   13.795  -17.576 1.00 45.68  ? 45  LYS B NZ  1 
ATOM   6038  N N   . PRO D 3 46  ? 5.431   21.336  -15.973 1.00 38.26  ? 46  PRO B N   1 
ATOM   6039  C CA  . PRO D 3 46  ? 5.666   22.787  -15.797 1.00 37.94  ? 46  PRO B CA  1 
ATOM   6040  C C   . PRO D 3 46  ? 6.955   23.322  -16.469 1.00 39.33  ? 46  PRO B C   1 
ATOM   6041  O O   . PRO D 3 46  ? 8.005   22.700  -16.352 1.00 41.02  ? 46  PRO B O   1 
ATOM   6042  C CB  . PRO D 3 46  ? 5.742   22.952  -14.271 1.00 38.04  ? 46  PRO B CB  1 
ATOM   6043  C CG  . PRO D 3 46  ? 5.022   21.745  -13.707 1.00 37.66  ? 46  PRO B CG  1 
ATOM   6044  C CD  . PRO D 3 46  ? 5.240   20.631  -14.687 1.00 38.35  ? 46  PRO B CD  1 
ATOM   6045  N N   . GLY D 3 47  ? 6.849   24.454  -17.162 1.00 38.77  ? 47  GLY B N   1 
ATOM   6046  C CA  . GLY D 3 47  ? 7.981   25.128  -17.783 1.00 40.22  ? 47  GLY B CA  1 
ATOM   6047  C C   . GLY D 3 47  ? 8.334   24.678  -19.194 1.00 41.09  ? 47  GLY B C   1 
ATOM   6048  O O   . GLY D 3 47  ? 9.215   25.247  -19.837 1.00 42.48  ? 47  GLY B O   1 
ATOM   6049  N N   . GLN D 3 48  ? 7.628   23.664  -19.681 1.00 40.23  ? 48  GLN B N   1 
ATOM   6050  C CA  . GLN D 3 48  ? 8.024   22.933  -20.863 1.00 41.11  ? 48  GLN B CA  1 
ATOM   6051  C C   . GLN D 3 48  ? 6.917   22.948  -21.877 1.00 39.27  ? 48  GLN B C   1 
ATOM   6052  O O   . GLN D 3 48  ? 5.775   23.098  -21.512 1.00 37.39  ? 48  GLN B O   1 
ATOM   6053  C CB  . GLN D 3 48  ? 8.288   21.502  -20.449 1.00 43.07  ? 48  GLN B CB  1 
ATOM   6054  C CG  . GLN D 3 48  ? 9.228   21.444  -19.284 1.00 45.55  ? 48  GLN B CG  1 
ATOM   6055  C CD  . GLN D 3 48  ? 9.982   20.149  -19.219 1.00 48.76  ? 48  GLN B CD  1 
ATOM   6056  O OE1 . GLN D 3 48  ? 9.439   19.079  -19.527 1.00 49.27  ? 48  GLN B OE1 1 
ATOM   6057  N NE2 . GLN D 3 48  ? 11.249  20.228  -18.830 1.00 51.04  ? 48  GLN B NE2 1 
ATOM   6058  N N   . PRO D 3 49  ? 7.238   22.773  -23.163 1.00 40.18  ? 49  PRO B N   1 
ATOM   6059  C CA  . PRO D 3 49  ? 6.134   22.651  -24.107 1.00 40.00  ? 49  PRO B CA  1 
ATOM   6060  C C   . PRO D 3 49  ? 5.398   21.338  -23.853 1.00 40.11  ? 49  PRO B C   1 
ATOM   6061  O O   . PRO D 3 49  ? 5.903   20.487  -23.109 1.00 35.65  ? 49  PRO B O   1 
ATOM   6062  C CB  . PRO D 3 49  ? 6.866   22.563  -25.446 1.00 41.45  ? 49  PRO B CB  1 
ATOM   6063  C CG  . PRO D 3 49  ? 8.119   21.899  -25.116 1.00 39.21  ? 49  PRO B CG  1 
ATOM   6064  C CD  . PRO D 3 49  ? 8.528   22.510  -23.817 1.00 42.06  ? 49  PRO B CD  1 
ATOM   6065  N N   . PRO D 3 50  ? 4.228   21.151  -24.485 1.00 37.82  ? 50  PRO B N   1 
ATOM   6066  C CA  . PRO D 3 50  ? 3.609   19.828  -24.424 1.00 36.27  ? 50  PRO B CA  1 
ATOM   6067  C C   . PRO D 3 50  ? 4.481   18.799  -25.138 1.00 37.77  ? 50  PRO B C   1 
ATOM   6068  O O   . PRO D 3 50  ? 5.253   19.161  -26.027 1.00 39.44  ? 50  PRO B O   1 
ATOM   6069  C CB  . PRO D 3 50  ? 2.295   20.026  -25.194 1.00 35.30  ? 50  PRO B CB  1 
ATOM   6070  C CG  . PRO D 3 50  ? 2.067   21.480  -25.226 1.00 31.49  ? 50  PRO B CG  1 
ATOM   6071  C CD  . PRO D 3 50  ? 3.410   22.101  -25.254 1.00 32.83  ? 50  PRO B CD  1 
ATOM   6072  N N   . LYS D 3 51  ? 4.363   17.536  -24.756 1.00 38.41  ? 51  LYS B N   1 
ATOM   6073  C CA  . LYS D 3 51  ? 4.979   16.445  -25.503 1.00 40.07  ? 51  LYS B CA  1 
ATOM   6074  C C   . LYS D 3 51  ? 3.871   15.459  -25.887 1.00 39.65  ? 51  LYS B C   1 
ATOM   6075  O O   . LYS D 3 51  ? 2.997   15.168  -25.077 1.00 38.42  ? 51  LYS B O   1 
ATOM   6076  C CB  . LYS D 3 51  ? 6.041   15.749  -24.640 1.00 41.79  ? 51  LYS B CB  1 
ATOM   6077  C CG  . LYS D 3 51  ? 6.665   14.524  -25.309 1.00 45.07  ? 51  LYS B CG  1 
ATOM   6078  C CD  . LYS D 3 51  ? 7.809   13.892  -24.506 1.00 47.37  ? 51  LYS B CD  1 
ATOM   6079  C CE  . LYS D 3 51  ? 8.775   13.096  -25.430 1.00 75.74  ? 51  LYS B CE  1 
ATOM   6080  N NZ  . LYS D 3 51  ? 8.099   12.126  -26.367 1.00 76.50  ? 51  LYS B NZ  1 
ATOM   6081  N N   . PRO D 3 52  ? 3.879   14.953  -27.130 1.00 41.22  ? 52  PRO B N   1 
ATOM   6082  C CA  . PRO D 3 52  ? 2.882   13.920  -27.466 1.00 39.81  ? 52  PRO B CA  1 
ATOM   6083  C C   . PRO D 3 52  ? 2.993   12.731  -26.522 1.00 41.92  ? 52  PRO B C   1 
ATOM   6084  O O   . PRO D 3 52  ? 4.075   12.398  -26.091 1.00 43.70  ? 52  PRO B O   1 
ATOM   6085  C CB  . PRO D 3 52  ? 3.270   13.496  -28.885 1.00 41.95  ? 52  PRO B CB  1 
ATOM   6086  C CG  . PRO D 3 52  ? 4.726   13.951  -29.038 1.00 46.11  ? 52  PRO B CG  1 
ATOM   6087  C CD  . PRO D 3 52  ? 4.799   15.230  -28.247 1.00 41.56  ? 52  PRO B CD  1 
ATOM   6088  N N   . LEU D 3 53  ? 1.883   12.097  -26.202 1.00 41.04  ? 53  LEU B N   1 
ATOM   6089  C CA  . LEU D 3 53  ? 1.886   10.998  -25.257 1.00 41.90  ? 53  LEU B CA  1 
ATOM   6090  C C   . LEU D 3 53  ? 1.199   9.778   -25.872 1.00 43.09  ? 53  LEU B C   1 
ATOM   6091  O O   . LEU D 3 53  ? 1.657   8.658   -25.706 1.00 45.37  ? 53  LEU B O   1 
ATOM   6092  C CB  . LEU D 3 53  ? 1.162   11.435  -23.986 1.00 40.12  ? 53  LEU B CB  1 
ATOM   6093  C CG  . LEU D 3 53  ? 1.468   10.802  -22.627 1.00 41.07  ? 53  LEU B CG  1 
ATOM   6094  C CD1 . LEU D 3 53  ? 2.818   11.228  -22.097 1.00 41.90  ? 53  LEU B CD1 1 
ATOM   6095  C CD2 . LEU D 3 53  ? 0.371   11.186  -21.627 1.00 39.16  ? 53  LEU B CD2 1 
ATOM   6096  N N   . ILE D 3 54  ? 0.103   9.993   -26.591 1.00 41.89  ? 54  ILE B N   1 
ATOM   6097  C CA  . ILE D 3 54  ? -0.599  8.900   -27.255 1.00 42.16  ? 54  ILE B CA  1 
ATOM   6098  C C   . ILE D 3 54  ? -1.182  9.370   -28.581 1.00 41.93  ? 54  ILE B C   1 
ATOM   6099  O O   . ILE D 3 54  ? -1.674  10.483  -28.683 1.00 40.42  ? 54  ILE B O   1 
ATOM   6100  C CB  . ILE D 3 54  ? -1.714  8.327   -26.353 1.00 44.28  ? 54  ILE B CB  1 
ATOM   6101  C CG1 . ILE D 3 54  ? -1.123  7.334   -25.355 1.00 45.76  ? 54  ILE B CG1 1 
ATOM   6102  C CG2 . ILE D 3 54  ? -2.808  7.655   -27.169 1.00 41.80  ? 54  ILE B CG2 1 
ATOM   6103  C CD1 . ILE D 3 54  ? -1.991  7.093   -24.143 1.00 44.52  ? 54  ILE B CD1 1 
ATOM   6104  N N   . TYR D 3 55  ? -1.097  8.531   -29.607 1.00 49.14  ? 55  TYR B N   1 
ATOM   6105  C CA  . TYR D 3 55  ? -1.678  8.854   -30.906 1.00 49.48  ? 55  TYR B CA  1 
ATOM   6106  C C   . TYR D 3 55  ? -2.770  7.860   -31.272 1.00 50.55  ? 55  TYR B C   1 
ATOM   6107  O O   . TYR D 3 55  ? -2.821  6.754   -30.732 1.00 51.61  ? 55  TYR B O   1 
ATOM   6108  C CB  . TYR D 3 55  ? -0.622  8.816   -31.994 1.00 46.69  ? 55  TYR B CB  1 
ATOM   6109  C CG  . TYR D 3 55  ? 0.372   9.936   -31.997 1.00 46.14  ? 55  TYR B CG  1 
ATOM   6110  C CD1 . TYR D 3 55  ? -0.024  11.246  -32.182 1.00 44.09  ? 55  TYR B CD1 1 
ATOM   6111  C CD2 . TYR D 3 55  ? 1.723   9.668   -31.878 1.00 47.98  ? 55  TYR B CD2 1 
ATOM   6112  C CE1 . TYR D 3 55  ? 0.902   12.269  -32.201 1.00 43.84  ? 55  TYR B CE1 1 
ATOM   6113  C CE2 . TYR D 3 55  ? 2.652   10.671  -31.915 1.00 47.74  ? 55  TYR B CE2 1 
ATOM   6114  C CZ  . TYR D 3 55  ? 2.249   11.970  -32.066 1.00 51.99  ? 55  TYR B CZ  1 
ATOM   6115  O OH  . TYR D 3 55  ? 3.214   12.955  -32.090 1.00 51.96  ? 55  TYR B OH  1 
ATOM   6116  N N   . TRP D 3 56  ? -3.617  8.254   -32.218 1.00 50.61  ? 56  TRP B N   1 
ATOM   6117  C CA  . TRP D 3 56  ? -4.773  7.455   -32.628 1.00 51.80  ? 56  TRP B CA  1 
ATOM   6118  C C   . TRP D 3 56  ? -5.534  6.933   -31.424 1.00 50.99  ? 56  TRP B C   1 
ATOM   6119  O O   . TRP D 3 56  ? -5.892  5.752   -31.391 1.00 52.62  ? 56  TRP B O   1 
ATOM   6120  C CB  . TRP D 3 56  ? -4.389  6.232   -33.458 1.00 55.25  ? 56  TRP B CB  1 
ATOM   6121  C CG  . TRP D 3 56  ? -3.356  6.395   -34.535 1.00 57.26  ? 56  TRP B CG  1 
ATOM   6122  C CD1 . TRP D 3 56  ? -2.099  5.852   -34.552 1.00 59.47  ? 56  TRP B CD1 1 
ATOM   6123  C CD2 . TRP D 3 56  ? -3.506  7.094   -35.769 1.00 57.53  ? 56  TRP B CD2 1 
ATOM   6124  N NE1 . TRP D 3 56  ? -1.452  6.186   -35.714 1.00 61.16  ? 56  TRP B NE1 1 
ATOM   6125  C CE2 . TRP D 3 56  ? -2.293  6.951   -36.480 1.00 60.05  ? 56  TRP B CE2 1 
ATOM   6126  C CE3 . TRP D 3 56  ? -4.543  7.826   -36.345 1.00 56.06  ? 56  TRP B CE3 1 
ATOM   6127  C CZ2 . TRP D 3 56  ? -2.092  7.521   -37.734 1.00 61.02  ? 56  TRP B CZ2 1 
ATOM   6128  C CZ3 . TRP D 3 56  ? -4.346  8.381   -37.581 1.00 57.10  ? 56  TRP B CZ3 1 
ATOM   6129  C CH2 . TRP D 3 56  ? -3.132  8.233   -38.266 1.00 59.55  ? 56  TRP B CH2 1 
ATOM   6130  N N   . ALA D 3 57  ? -5.738  7.796   -30.428 1.00 48.46  ? 57  ALA B N   1 
ATOM   6131  C CA  . ALA D 3 57  ? -6.483  7.440   -29.230 1.00 47.18  ? 57  ALA B CA  1 
ATOM   6132  C C   . ALA D 3 57  ? -5.837  6.359   -28.339 1.00 48.61  ? 57  ALA B C   1 
ATOM   6133  O O   . ALA D 3 57  ? -5.928  6.441   -27.123 1.00 47.88  ? 57  ALA B O   1 
ATOM   6134  C CB  . ALA D 3 57  ? -7.926  7.063   -29.586 1.00 47.09  ? 57  ALA B CB  1 
ATOM   6135  N N   . SER D 3 58  ? -5.185  5.353   -28.906 1.00 50.90  ? 58  SER B N   1 
ATOM   6136  C CA  . SER D 3 58  ? -4.684  4.273   -28.056 1.00 52.35  ? 58  SER B CA  1 
ATOM   6137  C C   . SER D 3 58  ? -3.219  3.859   -28.262 1.00 54.54  ? 58  SER B C   1 
ATOM   6138  O O   . SER D 3 58  ? -2.681  3.098   -27.463 1.00 55.84  ? 58  SER B O   1 
ATOM   6139  C CB  . SER D 3 58  ? -5.596  3.053   -28.163 1.00 54.03  ? 58  SER B CB  1 
ATOM   6140  O OG  . SER D 3 58  ? -5.794  2.679   -29.520 1.00 55.71  ? 58  SER B OG  1 
ATOM   6141  N N   . THR D 3 59  ? -2.575  4.365   -29.312 1.00 49.58  ? 59  THR B N   1 
ATOM   6142  C CA  . THR D 3 59  ? -1.182  4.024   -29.613 1.00 56.54  ? 59  THR B CA  1 
ATOM   6143  C C   . THR D 3 59  ? -0.142  4.888   -28.881 1.00 55.41  ? 59  THR B C   1 
ATOM   6144  O O   . THR D 3 59  ? -0.077  6.098   -29.090 1.00 53.50  ? 59  THR B O   1 
ATOM   6145  C CB  . THR D 3 59  ? -0.927  4.157   -31.124 1.00 58.10  ? 59  THR B CB  1 
ATOM   6146  O OG1 . THR D 3 59  ? -1.871  3.352   -31.841 1.00 59.47  ? 59  THR B OG1 1 
ATOM   6147  C CG2 . THR D 3 59  ? 0.485   3.730   -31.465 1.00 56.29  ? 59  THR B CG2 1 
ATOM   6148  N N   . ARG D 3 60  ? 0.693   4.278   -28.045 1.00 56.88  ? 60  ARG B N   1 
ATOM   6149  C CA  . ARG D 3 60  ? 1.694   5.065   -27.318 1.00 56.13  ? 60  ARG B CA  1 
ATOM   6150  C C   . ARG D 3 60  ? 2.834   5.560   -28.203 1.00 57.57  ? 60  ARG B C   1 
ATOM   6151  O O   . ARG D 3 60  ? 3.275   4.860   -29.115 1.00 60.22  ? 60  ARG B O   1 
ATOM   6152  C CB  . ARG D 3 60  ? 2.265   4.288   -26.132 1.00 57.45  ? 60  ARG B CB  1 
ATOM   6153  C CG  . ARG D 3 60  ? 1.446   4.382   -24.867 1.00 55.49  ? 60  ARG B CG  1 
ATOM   6154  C CD  . ARG D 3 60  ? 2.001   3.470   -23.785 1.00 57.54  ? 60  ARG B CD  1 
ATOM   6155  N NE  . ARG D 3 60  ? 2.039   2.086   -24.235 1.00 61.00  ? 60  ARG B NE  1 
ATOM   6156  C CZ  . ARG D 3 60  ? 2.921   1.179   -23.814 1.00 64.21  ? 60  ARG B CZ  1 
ATOM   6157  N NH1 . ARG D 3 60  ? 3.837   1.504   -22.908 1.00 64.37  ? 60  ARG B NH1 1 
ATOM   6158  N NH2 . ARG D 3 60  ? 2.890   -0.060  -24.300 1.00 67.28  ? 60  ARG B NH2 1 
ATOM   6159  N N   . GLU D 3 61  ? 3.296   6.777   -27.931 1.00 56.07  ? 61  GLU B N   1 
ATOM   6160  C CA  . GLU D 3 61  ? 4.499   7.297   -28.554 1.00 57.82  ? 61  GLU B CA  1 
ATOM   6161  C C   . GLU D 3 61  ? 5.687   6.606   -27.899 1.00 60.55  ? 61  GLU B C   1 
ATOM   6162  O O   . GLU D 3 61  ? 5.639   6.270   -26.710 1.00 60.09  ? 61  GLU B O   1 
ATOM   6163  C CB  . GLU D 3 61  ? 4.589   8.813   -28.372 1.00 55.60  ? 61  GLU B CB  1 
ATOM   6164  C CG  . GLU D 3 61  ? 5.903   9.442   -28.840 1.00 57.45  ? 61  GLU B CG  1 
ATOM   6165  C CD  . GLU D 3 61  ? 6.102   9.398   -30.363 1.00 59.64  ? 61  GLU B CD  1 
ATOM   6166  O OE1 . GLU D 3 61  ? 5.245   9.920   -31.095 1.00 58.41  ? 61  GLU B OE1 1 
ATOM   6167  O OE2 . GLU D 3 61  ? 7.125   8.853   -30.834 1.00 62.75  ? 61  GLU B OE2 1 
ATOM   6168  N N   . SER D 3 62  ? 6.740   6.365   -28.681 1.00 63.63  ? 62  SER B N   1 
ATOM   6169  C CA  . SER D 3 62  ? 7.954   5.731   -28.166 1.00 66.57  ? 62  SER B CA  1 
ATOM   6170  C C   . SER D 3 62  ? 8.552   6.518   -26.994 1.00 65.46  ? 62  SER B C   1 
ATOM   6171  O O   . SER D 3 62  ? 8.758   7.734   -27.072 1.00 63.64  ? 62  SER B O   1 
ATOM   6172  C CB  . SER D 3 62  ? 8.991   5.533   -29.277 1.00 69.56  ? 62  SER B CB  1 
ATOM   6173  O OG  . SER D 3 62  ? 9.167   6.723   -30.019 1.00 68.38  ? 62  SER B OG  1 
ATOM   6174  N N   . GLY D 3 63  ? 8.807   5.810   -25.901 1.00 66.70  ? 63  GLY B N   1 
ATOM   6175  C CA  . GLY D 3 63  ? 9.377   6.415   -24.715 1.00 66.23  ? 63  GLY B CA  1 
ATOM   6176  C C   . GLY D 3 63  ? 8.340   6.681   -23.637 1.00 64.03  ? 63  GLY B C   1 
ATOM   6177  O O   . GLY D 3 63  ? 8.687   7.120   -22.535 1.00 63.58  ? 63  GLY B O   1 
ATOM   6178  N N   . VAL D 3 64  ? 7.069   6.430   -23.949 1.00 62.72  ? 64  VAL B N   1 
ATOM   6179  C CA  . VAL D 3 64  ? 6.008   6.611   -22.962 1.00 60.13  ? 64  VAL B CA  1 
ATOM   6180  C C   . VAL D 3 64  ? 5.807   5.331   -22.151 1.00 53.37  ? 64  VAL B C   1 
ATOM   6181  O O   . VAL D 3 64  ? 5.582   4.267   -22.717 1.00 55.32  ? 64  VAL B O   1 
ATOM   6182  C CB  . VAL D 3 64  ? 4.682   7.098   -23.608 1.00 49.27  ? 64  VAL B CB  1 
ATOM   6183  C CG1 . VAL D 3 64  ? 3.565   7.149   -22.585 1.00 47.14  ? 64  VAL B CG1 1 
ATOM   6184  C CG2 . VAL D 3 64  ? 4.871   8.470   -24.228 1.00 47.62  ? 64  VAL B CG2 1 
ATOM   6185  N N   . PRO D 3 65  ? 5.911   5.437   -20.819 1.00 52.82  ? 65  PRO B N   1 
ATOM   6186  C CA  . PRO D 3 65  ? 5.822   4.292   -19.919 1.00 54.59  ? 65  PRO B CA  1 
ATOM   6187  C C   . PRO D 3 65  ? 4.556   3.463   -20.060 1.00 62.29  ? 65  PRO B C   1 
ATOM   6188  O O   . PRO D 3 65  ? 3.563   3.854   -20.667 1.00 60.07  ? 65  PRO B O   1 
ATOM   6189  C CB  . PRO D 3 65  ? 5.863   4.935   -18.534 1.00 53.10  ? 65  PRO B CB  1 
ATOM   6190  C CG  . PRO D 3 65  ? 6.612   6.179   -18.734 1.00 51.98  ? 65  PRO B CG  1 
ATOM   6191  C CD  . PRO D 3 65  ? 6.226   6.675   -20.088 1.00 50.83  ? 65  PRO B CD  1 
ATOM   6192  N N   . ASP D 3 66  ? 4.631   2.296   -19.440 1.00 64.66  ? 66  ASP B N   1 
ATOM   6193  C CA  . ASP D 3 66  ? 3.631   1.235   -19.479 1.00 65.54  ? 66  ASP B CA  1 
ATOM   6194  C C   . ASP D 3 66  ? 2.294   1.637   -18.841 1.00 61.80  ? 66  ASP B C   1 
ATOM   6195  O O   . ASP D 3 66  ? 1.247   1.058   -19.132 1.00 61.30  ? 66  ASP B O   1 
ATOM   6196  C CB  . ASP D 3 66  ? 4.245   0.037   -18.728 1.00 69.90  ? 66  ASP B CB  1 
ATOM   6197  C CG  . ASP D 3 66  ? 3.548   -1.269  -19.022 1.00 72.82  ? 66  ASP B CG  1 
ATOM   6198  O OD1 . ASP D 3 66  ? 2.691   -1.281  -19.933 1.00 72.13  ? 66  ASP B OD1 1 
ATOM   6199  O OD2 . ASP D 3 66  ? 3.869   -2.282  -18.346 1.00 75.89  ? 66  ASP B OD2 1 
ATOM   6200  N N   . ARG D 3 67  ? 2.351   2.637   -17.970 1.00 59.55  ? 67  ARG B N   1 
ATOM   6201  C CA  . ARG D 3 67  ? 1.246   2.956   -17.083 1.00 57.41  ? 67  ARG B CA  1 
ATOM   6202  C C   . ARG D 3 67  ? 0.270   3.947   -17.710 1.00 54.38  ? 67  ARG B C   1 
ATOM   6203  O O   . ARG D 3 67  ? -0.853  4.122   -17.223 1.00 52.82  ? 67  ARG B O   1 
ATOM   6204  C CB  . ARG D 3 67  ? 1.770   3.468   -15.744 1.00 50.09  ? 67  ARG B CB  1 
ATOM   6205  C CG  . ARG D 3 67  ? 2.665   4.684   -15.835 1.00 48.88  ? 67  ARG B CG  1 
ATOM   6206  C CD  . ARG D 3 67  ? 3.221   5.051   -14.462 1.00 49.01  ? 67  ARG B CD  1 
ATOM   6207  N NE  . ARG D 3 67  ? 3.982   6.298   -14.482 1.00 52.04  ? 67  ARG B NE  1 
ATOM   6208  C CZ  . ARG D 3 67  ? 5.241   6.405   -14.904 1.00 53.53  ? 67  ARG B CZ  1 
ATOM   6209  N NH1 . ARG D 3 67  ? 5.892   5.334   -15.352 1.00 52.18  ? 67  ARG B NH1 1 
ATOM   6210  N NH2 . ARG D 3 67  ? 5.851   7.586   -14.881 1.00 52.31  ? 67  ARG B NH2 1 
ATOM   6211  N N   . PHE D 3 68  ? 0.695   4.588   -18.794 1.00 53.61  ? 68  PHE B N   1 
ATOM   6212  C CA  . PHE D 3 68  ? -0.211  5.408   -19.577 1.00 51.04  ? 68  PHE B CA  1 
ATOM   6213  C C   . PHE D 3 68  ? -0.906  4.528   -20.593 1.00 52.16  ? 68  PHE B C   1 
ATOM   6214  O O   . PHE D 3 68  ? -0.302  3.645   -21.182 1.00 54.65  ? 68  PHE B O   1 
ATOM   6215  C CB  . PHE D 3 68  ? 0.540   6.517   -20.291 1.00 50.14  ? 68  PHE B CB  1 
ATOM   6216  C CG  . PHE D 3 68  ? 1.219   7.471   -19.370 1.00 49.31  ? 68  PHE B CG  1 
ATOM   6217  C CD1 . PHE D 3 68  ? 0.620   8.663   -19.025 1.00 46.75  ? 68  PHE B CD1 1 
ATOM   6218  C CD2 . PHE D 3 68  ? 2.470   7.174   -18.839 1.00 51.42  ? 68  PHE B CD2 1 
ATOM   6219  C CE1 . PHE D 3 68  ? 1.261   9.544   -18.168 1.00 46.22  ? 68  PHE B CE1 1 
ATOM   6220  C CE2 . PHE D 3 68  ? 3.124   8.060   -17.973 1.00 50.68  ? 68  PHE B CE2 1 
ATOM   6221  C CZ  . PHE D 3 68  ? 2.526   9.240   -17.640 1.00 48.05  ? 68  PHE B CZ  1 
ATOM   6222  N N   . SER D 3 69  ? -2.192  4.768   -20.785 1.00 50.58  ? 69  SER B N   1 
ATOM   6223  C CA  . SER D 3 69  ? -2.990  4.040   -21.763 1.00 51.54  ? 69  SER B CA  1 
ATOM   6224  C C   . SER D 3 69  ? -4.136  4.936   -22.182 1.00 48.82  ? 69  SER B C   1 
ATOM   6225  O O   . SER D 3 69  ? -4.783  5.586   -21.346 1.00 46.67  ? 69  SER B O   1 
ATOM   6226  C CB  . SER D 3 69  ? -3.536  2.751   -21.161 1.00 53.60  ? 69  SER B CB  1 
ATOM   6227  O OG  . SER D 3 69  ? -3.566  2.836   -19.743 1.00 53.27  ? 69  SER B OG  1 
ATOM   6228  N N   . GLY D 3 70  ? -4.364  4.991   -23.484 1.00 49.04  ? 70  GLY B N   1 
ATOM   6229  C CA  . GLY D 3 70  ? -5.484  5.732   -24.020 1.00 46.86  ? 70  GLY B CA  1 
ATOM   6230  C C   . GLY D 3 70  ? -6.501  4.757   -24.550 1.00 48.05  ? 70  GLY B C   1 
ATOM   6231  O O   . GLY D 3 70  ? -6.144  3.746   -25.145 1.00 50.71  ? 70  GLY B O   1 
ATOM   6232  N N   . SER D 3 71  ? -7.774  5.043   -24.326 1.00 46.54  ? 71  SER B N   1 
ATOM   6233  C CA  . SER D 3 71  ? -8.825  4.150   -24.793 1.00 41.59  ? 71  SER B CA  1 
ATOM   6234  C C   . SER D 3 71  ? -10.011 4.943   -25.302 1.00 44.16  ? 71  SER B C   1 
ATOM   6235  O O   . SER D 3 71  ? -9.927  6.167   -25.486 1.00 37.86  ? 71  SER B O   1 
ATOM   6236  C CB  . SER D 3 71  ? -9.258  3.199   -23.675 1.00 42.51  ? 71  SER B CB  1 
ATOM   6237  O OG  . SER D 3 71  ? -9.497  3.905   -22.466 1.00 40.46  ? 71  SER B OG  1 
ATOM   6238  N N   . GLY D 3 72  ? -11.108 4.229   -25.532 1.00 45.01  ? 72  GLY B N   1 
ATOM   6239  C CA  . GLY D 3 72  ? -12.346 4.835   -25.975 1.00 43.75  ? 72  GLY B CA  1 
ATOM   6240  C C   . GLY D 3 72  ? -12.456 4.950   -27.478 1.00 44.72  ? 72  GLY B C   1 
ATOM   6241  O O   . GLY D 3 72  ? -11.544 4.574   -28.216 1.00 46.36  ? 72  GLY B O   1 
ATOM   6242  N N   . SER D 3 73  ? -13.579 5.491   -27.933 1.00 43.86  ? 73  SER B N   1 
ATOM   6243  C CA  . SER D 3 73  ? -13.849 5.590   -29.359 1.00 44.67  ? 73  SER B CA  1 
ATOM   6244  C C   . SER D 3 73  ? -14.952 6.587   -29.654 1.00 42.64  ? 73  SER B C   1 
ATOM   6245  O O   . SER D 3 73  ? -15.823 6.827   -28.822 1.00 41.49  ? 73  SER B O   1 
ATOM   6246  C CB  . SER D 3 73  ? -14.268 4.233   -29.903 1.00 47.58  ? 73  SER B CB  1 
ATOM   6247  O OG  . SER D 3 73  ? -14.448 4.299   -31.305 1.00 49.01  ? 73  SER B OG  1 
ATOM   6248  N N   . GLY D 3 74  ? -14.911 7.156   -30.852 1.00 42.40  ? 74  GLY B N   1 
ATOM   6249  C CA  . GLY D 3 74  ? -16.006 7.960   -31.358 1.00 41.13  ? 74  GLY B CA  1 
ATOM   6250  C C   . GLY D 3 74  ? -16.033 9.362   -30.796 1.00 35.45  ? 74  GLY B C   1 
ATOM   6251  O O   . GLY D 3 74  ? -15.397 10.273  -31.339 1.00 34.89  ? 74  GLY B O   1 
ATOM   6252  N N   . THR D 3 75  ? -16.778 9.536   -29.708 1.00 38.57  ? 75  THR B N   1 
ATOM   6253  C CA  . THR D 3 75  ? -16.809 10.818  -29.023 1.00 36.55  ? 75  THR B CA  1 
ATOM   6254  C C   . THR D 3 75  ? -16.346 10.720  -27.559 1.00 36.02  ? 75  THR B C   1 
ATOM   6255  O O   . THR D 3 75  ? -16.295 11.731  -26.854 1.00 34.41  ? 75  THR B O   1 
ATOM   6256  C CB  . THR D 3 75  ? -18.204 11.441  -29.094 1.00 35.60  ? 75  THR B CB  1 
ATOM   6257  O OG1 . THR D 3 75  ? -19.147 10.564  -28.478 1.00 31.78  ? 75  THR B OG1 1 
ATOM   6258  C CG2 . THR D 3 75  ? -18.596 11.649  -30.536 1.00 32.31  ? 75  THR B CG2 1 
ATOM   6259  N N   . ASP D 3 76  ? -15.980 9.512   -27.124 1.00 37.31  ? 76  ASP B N   1 
ATOM   6260  C CA  . ASP D 3 76  ? -15.712 9.229   -25.708 1.00 36.84  ? 76  ASP B CA  1 
ATOM   6261  C C   . ASP D 3 76  ? -14.317 8.653   -25.442 1.00 36.93  ? 76  ASP B C   1 
ATOM   6262  O O   . ASP D 3 76  ? -14.098 7.444   -25.578 1.00 38.81  ? 76  ASP B O   1 
ATOM   6263  C CB  . ASP D 3 76  ? -16.760 8.247   -25.194 1.00 39.00  ? 76  ASP B CB  1 
ATOM   6264  C CG  . ASP D 3 76  ? -16.959 8.336   -23.693 1.00 39.48  ? 76  ASP B CG  1 
ATOM   6265  O OD1 . ASP D 3 76  ? -17.532 9.369   -23.248 1.00 38.52  ? 76  ASP B OD1 1 
ATOM   6266  O OD2 . ASP D 3 76  ? -16.576 7.374   -22.968 1.00 41.00  ? 76  ASP B OD2 1 
ATOM   6267  N N   . PHE D 3 77  ? -13.380 9.502   -25.038 1.00 35.17  ? 77  PHE B N   1 
ATOM   6268  C CA  . PHE D 3 77  ? -12.000 9.051   -24.883 1.00 35.97  ? 77  PHE B CA  1 
ATOM   6269  C C   . PHE D 3 77  ? -11.442 9.156   -23.436 1.00 34.23  ? 77  PHE B C   1 
ATOM   6270  O O   . PHE D 3 77  ? -11.797 10.065  -22.679 1.00 32.42  ? 77  PHE B O   1 
ATOM   6271  C CB  . PHE D 3 77  ? -11.108 9.763   -25.914 1.00 35.88  ? 77  PHE B CB  1 
ATOM   6272  C CG  . PHE D 3 77  ? -11.543 9.542   -27.358 1.00 33.32  ? 77  PHE B CG  1 
ATOM   6273  C CD1 . PHE D 3 77  ? -11.093 8.437   -28.076 1.00 35.63  ? 77  PHE B CD1 1 
ATOM   6274  C CD2 . PHE D 3 77  ? -12.401 10.436  -27.987 1.00 32.33  ? 77  PHE B CD2 1 
ATOM   6275  C CE1 . PHE D 3 77  ? -11.488 8.221   -29.381 1.00 39.09  ? 77  PHE B CE1 1 
ATOM   6276  C CE2 . PHE D 3 77  ? -12.796 10.240  -29.273 1.00 33.54  ? 77  PHE B CE2 1 
ATOM   6277  C CZ  . PHE D 3 77  ? -12.346 9.121   -29.986 1.00 38.63  ? 77  PHE B CZ  1 
ATOM   6278  N N   . THR D 3 78  ? -10.573 8.221   -23.060 1.00 35.87  ? 78  THR B N   1 
ATOM   6279  C CA  . THR D 3 78  ? -9.997  8.189   -21.714 1.00 36.13  ? 78  THR B CA  1 
ATOM   6280  C C   . THR D 3 78  ? -8.479  8.046   -21.679 1.00 37.42  ? 78  THR B C   1 
ATOM   6281  O O   . THR D 3 78  ? -7.923  7.139   -22.304 1.00 39.81  ? 78  THR B O   1 
ATOM   6282  C CB  . THR D 3 78  ? -10.575 7.019   -20.883 1.00 37.78  ? 78  THR B CB  1 
ATOM   6283  O OG1 . THR D 3 78  ? -11.940 7.291   -20.562 1.00 37.26  ? 78  THR B OG1 1 
ATOM   6284  C CG2 . THR D 3 78  ? -9.834  6.864   -19.588 1.00 37.98  ? 78  THR B CG2 1 
ATOM   6285  N N   . LEU D 3 79  ? -7.811  8.921   -20.929 1.00 36.17  ? 79  LEU B N   1 
ATOM   6286  C CA  . LEU D 3 79  ? -6.405  8.727   -20.596 1.00 37.31  ? 79  LEU B CA  1 
ATOM   6287  C C   . LEU D 3 79  ? -6.325  8.077   -19.228 1.00 38.54  ? 79  LEU B C   1 
ATOM   6288  O O   . LEU D 3 79  ? -6.950  8.550   -18.274 1.00 37.60  ? 79  LEU B O   1 
ATOM   6289  C CB  . LEU D 3 79  ? -5.670  10.057  -20.543 1.00 35.50  ? 79  LEU B CB  1 
ATOM   6290  C CG  . LEU D 3 79  ? -4.177  9.846   -20.337 1.00 36.61  ? 79  LEU B CG  1 
ATOM   6291  C CD1 . LEU D 3 79  ? -3.649  9.082   -21.511 1.00 38.50  ? 79  LEU B CD1 1 
ATOM   6292  C CD2 . LEU D 3 79  ? -3.462  11.162  -20.208 1.00 32.59  ? 79  LEU B CD2 1 
ATOM   6293  N N   . THR D 3 80  ? -5.570  6.995   -19.107 1.00 40.71  ? 80  THR B N   1 
ATOM   6294  C CA  . THR D 3 80  ? -5.509  6.321   -17.817 1.00 41.48  ? 80  THR B CA  1 
ATOM   6295  C C   . THR D 3 80  ? -4.086  6.173   -17.347 1.00 42.08  ? 80  THR B C   1 
ATOM   6296  O O   . THR D 3 80  ? -3.226  5.754   -18.109 1.00 43.57  ? 80  THR B O   1 
ATOM   6297  C CB  . THR D 3 80  ? -6.141  4.922   -17.863 1.00 44.01  ? 80  THR B CB  1 
ATOM   6298  O OG1 . THR D 3 80  ? -7.392  4.970   -18.565 1.00 43.27  ? 80  THR B OG1 1 
ATOM   6299  C CG2 . THR D 3 80  ? -6.354  4.393   -16.447 1.00 44.83  ? 80  THR B CG2 1 
ATOM   6300  N N   . ILE D 3 81  ? -3.841  6.523   -16.093 1.00 41.31  ? 81  ILE B N   1 
ATOM   6301  C CA  . ILE D 3 81  ? -2.527  6.321   -15.499 1.00 42.98  ? 81  ILE B CA  1 
ATOM   6302  C C   . ILE D 3 81  ? -2.614  5.295   -14.385 1.00 44.92  ? 81  ILE B C   1 
ATOM   6303  O O   . ILE D 3 81  ? -3.085  5.606   -13.303 1.00 41.09  ? 81  ILE B O   1 
ATOM   6304  C CB  . ILE D 3 81  ? -1.947  7.612   -14.936 1.00 41.37  ? 81  ILE B CB  1 
ATOM   6305  C CG1 . ILE D 3 81  ? -2.034  8.719   -15.978 1.00 36.75  ? 81  ILE B CG1 1 
ATOM   6306  C CG2 . ILE D 3 81  ? -0.510  7.368   -14.470 1.00 40.51  ? 81  ILE B CG2 1 
ATOM   6307  C CD1 . ILE D 3 81  ? -1.208  9.893   -15.666 1.00 35.89  ? 81  ILE B CD1 1 
ATOM   6308  N N   . SER D 3 82  ? -2.153  4.077   -14.657 1.00 47.66  ? 82  SER B N   1 
ATOM   6309  C CA  . SER D 3 82  ? -2.420  2.943   -13.777 1.00 49.85  ? 82  SER B CA  1 
ATOM   6310  C C   . SER D 3 82  ? -1.835  3.076   -12.386 1.00 50.79  ? 82  SER B C   1 
ATOM   6311  O O   . SER D 3 82  ? -2.352  2.477   -11.451 1.00 51.99  ? 82  SER B O   1 
ATOM   6312  C CB  . SER D 3 82  ? -1.919  1.657   -14.397 1.00 52.78  ? 82  SER B CB  1 
ATOM   6313  O OG  . SER D 3 82  ? -0.541  1.780   -14.650 1.00 54.00  ? 82  SER B OG  1 
ATOM   6314  N N   . SER D 3 83  ? -0.755  3.836   -12.244 1.00 50.42  ? 83  SER B N   1 
ATOM   6315  C CA  . SER D 3 83  ? -0.167  4.054   -10.928 1.00 51.05  ? 83  SER B CA  1 
ATOM   6316  C C   . SER D 3 83  ? 0.732   5.278   -10.933 1.00 49.93  ? 83  SER B C   1 
ATOM   6317  O O   . SER D 3 83  ? 1.844   5.258   -11.466 1.00 51.22  ? 83  SER B O   1 
ATOM   6318  C CB  . SER D 3 83  ? 0.622   2.839   -10.474 1.00 54.47  ? 83  SER B CB  1 
ATOM   6319  O OG  . SER D 3 83  ? 1.658   2.594   -11.392 1.00 56.03  ? 83  SER B OG  1 
ATOM   6320  N N   . LEU D 3 84  ? 0.232   6.338   -10.315 1.00 47.62  ? 84  LEU B N   1 
ATOM   6321  C CA  . LEU D 3 84  ? 0.854   7.642   -10.377 1.00 45.74  ? 84  LEU B CA  1 
ATOM   6322  C C   . LEU D 3 84  ? 2.267   7.636   -9.829  1.00 47.33  ? 84  LEU B C   1 
ATOM   6323  O O   . LEU D 3 84  ? 2.534   7.080   -8.772  1.00 48.75  ? 84  LEU B O   1 
ATOM   6324  C CB  . LEU D 3 84  ? 0.008   8.646   -9.603  1.00 43.47  ? 84  LEU B CB  1 
ATOM   6325  C CG  . LEU D 3 84  ? 0.362   10.088  -9.888  1.00 41.69  ? 84  LEU B CG  1 
ATOM   6326  C CD1 . LEU D 3 84  ? -0.021  10.379  -11.318 1.00 40.39  ? 84  LEU B CD1 1 
ATOM   6327  C CD2 . LEU D 3 84  ? -0.381  10.980  -8.950  1.00 40.24  ? 84  LEU B CD2 1 
ATOM   6328  N N   . GLN D 3 85  ? 3.168   8.264   -10.572 1.00 47.37  ? 85  GLN B N   1 
ATOM   6329  C CA  . GLN D 3 85  ? 4.506   8.554   -10.095 1.00 49.03  ? 85  GLN B CA  1 
ATOM   6330  C C   . GLN D 3 85  ? 4.654   10.066  -9.998  1.00 46.67  ? 85  GLN B C   1 
ATOM   6331  O O   . GLN D 3 85  ? 3.902   10.817  -10.622 1.00 43.97  ? 85  GLN B O   1 
ATOM   6332  C CB  . GLN D 3 85  ? 5.548   7.933   -11.029 1.00 51.82  ? 85  GLN B CB  1 
ATOM   6333  C CG  . GLN D 3 85  ? 5.351   6.427   -11.181 1.00 54.72  ? 85  GLN B CG  1 
ATOM   6334  C CD  . GLN D 3 85  ? 6.526   5.697   -11.818 1.00 58.25  ? 85  GLN B CD  1 
ATOM   6335  O OE1 . GLN D 3 85  ? 7.613   6.258   -12.029 1.00 59.06  ? 85  GLN B OE1 1 
ATOM   6336  N NE2 . GLN D 3 85  ? 6.309   4.422   -12.126 1.00 60.46  ? 85  GLN B NE2 1 
ATOM   6337  N N   . ALA D 3 86  ? 5.617   10.522  -9.209  1.00 47.98  ? 86  ALA B N   1 
ATOM   6338  C CA  . ALA D 3 86  ? 5.691   11.938  -8.886  1.00 46.55  ? 86  ALA B CA  1 
ATOM   6339  C C   . ALA D 3 86  ? 5.989   12.781  -10.113 1.00 45.80  ? 86  ALA B C   1 
ATOM   6340  O O   . ALA D 3 86  ? 5.779   14.001  -10.097 1.00 44.47  ? 86  ALA B O   1 
ATOM   6341  C CB  . ALA D 3 86  ? 6.704   12.198  -7.792  1.00 48.06  ? 86  ALA B CB  1 
ATOM   6342  N N   . GLU D 3 87  ? 6.456   12.121  -11.172 1.00 46.96  ? 87  GLU B N   1 
ATOM   6343  C CA  . GLU D 3 87  ? 6.915   12.789  -12.384 1.00 46.77  ? 87  GLU B CA  1 
ATOM   6344  C C   . GLU D 3 87  ? 5.793   12.827  -13.411 1.00 45.29  ? 87  GLU B C   1 
ATOM   6345  O O   . GLU D 3 87  ? 5.953   13.372  -14.512 1.00 44.85  ? 87  GLU B O   1 
ATOM   6346  C CB  . GLU D 3 87  ? 8.090   12.040  -12.980 1.00 49.36  ? 87  GLU B CB  1 
ATOM   6347  C CG  . GLU D 3 87  ? 7.637   10.874  -13.810 1.00 50.37  ? 87  GLU B CG  1 
ATOM   6348  C CD  . GLU D 3 87  ? 8.613   9.746   -13.799 1.00 53.97  ? 87  GLU B CD  1 
ATOM   6349  O OE1 . GLU D 3 87  ? 9.318   9.596   -12.765 1.00 55.73  ? 87  GLU B OE1 1 
ATOM   6350  O OE2 . GLU D 3 87  ? 8.663   9.017   -14.828 1.00 55.14  ? 87  GLU B OE2 1 
ATOM   6351  N N   . ASP D 3 88  ? 4.658   12.239  -13.048 1.00 44.61  ? 88  ASP B N   1 
ATOM   6352  C CA  . ASP D 3 88  ? 3.477   12.284  -13.901 1.00 42.83  ? 88  ASP B CA  1 
ATOM   6353  C C   . ASP D 3 88  ? 2.628   13.519  -13.680 1.00 39.83  ? 88  ASP B C   1 
ATOM   6354  O O   . ASP D 3 88  ? 1.574   13.627  -14.259 1.00 38.38  ? 88  ASP B O   1 
ATOM   6355  C CB  . ASP D 3 88  ? 2.628   11.029  -13.727 1.00 43.99  ? 88  ASP B CB  1 
ATOM   6356  C CG  . ASP D 3 88  ? 3.382   9.771   -14.107 1.00 47.43  ? 88  ASP B CG  1 
ATOM   6357  O OD1 . ASP D 3 88  ? 4.232   9.855   -15.037 1.00 48.64  ? 88  ASP B OD1 1 
ATOM   6358  O OD2 . ASP D 3 88  ? 3.141   8.709   -13.471 1.00 48.96  ? 88  ASP B OD2 1 
ATOM   6359  N N   . VAL D 3 89  ? 3.077   14.455  -12.858 1.00 39.38  ? 89  VAL B N   1 
ATOM   6360  C CA  . VAL D 3 89  ? 2.276   15.646  -12.642 1.00 37.43  ? 89  VAL B CA  1 
ATOM   6361  C C   . VAL D 3 89  ? 2.426   16.642  -13.802 1.00 36.59  ? 89  VAL B C   1 
ATOM   6362  O O   . VAL D 3 89  ? 3.533   17.020  -14.183 1.00 37.61  ? 89  VAL B O   1 
ATOM   6363  C CB  . VAL D 3 89  ? 2.546   16.324  -11.266 1.00 33.65  ? 89  VAL B CB  1 
ATOM   6364  C CG1 . VAL D 3 89  ? 2.300   15.349  -10.145 1.00 34.68  ? 89  VAL B CG1 1 
ATOM   6365  C CG2 . VAL D 3 89  ? 3.929   16.873  -11.206 1.00 34.90  ? 89  VAL B CG2 1 
ATOM   6366  N N   . ALA D 3 90  ? 1.305   17.072  -14.357 1.00 30.83  ? 90  ALA B N   1 
ATOM   6367  C CA  . ALA D 3 90  ? 1.351   17.877  -15.558 1.00 32.17  ? 90  ALA B CA  1 
ATOM   6368  C C   . ALA D 3 90  ? -0.046  18.313  -15.896 1.00 30.50  ? 90  ALA B C   1 
ATOM   6369  O O   . ALA D 3 90  ? -1.003  17.929  -15.225 1.00 29.94  ? 90  ALA B O   1 
ATOM   6370  C CB  . ALA D 3 90  ? 1.917   17.050  -16.723 1.00 33.41  ? 90  ALA B CB  1 
ATOM   6371  N N   . VAL D 3 91  ? -0.168  19.111  -16.950 1.00 29.79  ? 91  VAL B N   1 
ATOM   6372  C CA  . VAL D 3 91  ? -1.464  19.289  -17.578 1.00 28.43  ? 91  VAL B CA  1 
ATOM   6373  C C   . VAL D 3 91  ? -1.522  18.371  -18.800 1.00 27.05  ? 91  VAL B C   1 
ATOM   6374  O O   . VAL D 3 91  ? -0.696  18.478  -19.697 1.00 30.66  ? 91  VAL B O   1 
ATOM   6375  C CB  . VAL D 3 91  ? -1.718  20.745  -17.973 1.00 25.46  ? 91  VAL B CB  1 
ATOM   6376  C CG1 . VAL D 3 91  ? -3.074  20.854  -18.659 1.00 24.34  ? 91  VAL B CG1 1 
ATOM   6377  C CG2 . VAL D 3 91  ? -1.652  21.631  -16.758 1.00 25.09  ? 91  VAL B CG2 1 
ATOM   6378  N N   . TYR D 3 92  ? -2.476  17.451  -18.800 1.00 26.84  ? 92  TYR B N   1 
ATOM   6379  C CA  . TYR D 3 92  ? -2.774  16.596  -19.944 1.00 27.46  ? 92  TYR B CA  1 
ATOM   6380  C C   . TYR D 3 92  ? -3.816  17.240  -20.876 1.00 26.88  ? 92  TYR B C   1 
ATOM   6381  O O   . TYR D 3 92  ? -4.867  17.724  -20.425 1.00 25.08  ? 92  TYR B O   1 
ATOM   6382  C CB  . TYR D 3 92  ? -3.208  15.218  -19.453 1.00 28.17  ? 92  TYR B CB  1 
ATOM   6383  C CG  . TYR D 3 92  ? -2.088  14.550  -18.705 1.00 29.66  ? 92  TYR B CG  1 
ATOM   6384  C CD1 . TYR D 3 92  ? -1.783  14.913  -17.400 1.00 34.85  ? 92  TYR B CD1 1 
ATOM   6385  C CD2 . TYR D 3 92  ? -1.299  13.598  -19.311 1.00 31.51  ? 92  TYR B CD2 1 
ATOM   6386  C CE1 . TYR D 3 92  ? -0.736  14.329  -16.716 1.00 31.01  ? 92  TYR B CE1 1 
ATOM   6387  C CE2 . TYR D 3 92  ? -0.253  13.007  -18.638 1.00 33.10  ? 92  TYR B CE2 1 
ATOM   6388  C CZ  . TYR D 3 92  ? 0.027   13.379  -17.340 1.00 32.83  ? 92  TYR B CZ  1 
ATOM   6389  O OH  . TYR D 3 92  ? 1.075   12.792  -16.672 1.00 34.61  ? 92  TYR B OH  1 
ATOM   6390  N N   . TYR D 3 93  ? -3.500  17.303  -22.168 1.00 27.01  ? 93  TYR B N   1 
ATOM   6391  C CA  . TYR D 3 93  ? -4.412  17.901  -23.151 1.00 26.28  ? 93  TYR B CA  1 
ATOM   6392  C C   . TYR D 3 93  ? -4.942  16.831  -24.060 1.00 27.12  ? 93  TYR B C   1 
ATOM   6393  O O   . TYR D 3 93  ? -4.339  15.791  -24.190 1.00 36.33  ? 93  TYR B O   1 
ATOM   6394  C CB  . TYR D 3 93  ? -3.722  18.962  -24.010 1.00 26.55  ? 93  TYR B CB  1 
ATOM   6395  C CG  . TYR D 3 93  ? -3.440  20.245  -23.277 1.00 25.72  ? 93  TYR B CG  1 
ATOM   6396  C CD1 . TYR D 3 93  ? -4.374  21.265  -23.254 1.00 24.55  ? 93  TYR B CD1 1 
ATOM   6397  C CD2 . TYR D 3 93  ? -2.237  20.429  -22.603 1.00 26.33  ? 93  TYR B CD2 1 
ATOM   6398  C CE1 . TYR D 3 93  ? -4.123  22.442  -22.578 1.00 28.68  ? 93  TYR B CE1 1 
ATOM   6399  C CE2 . TYR D 3 93  ? -1.965  21.593  -21.938 1.00 30.45  ? 93  TYR B CE2 1 
ATOM   6400  C CZ  . TYR D 3 93  ? -2.913  22.603  -21.917 1.00 29.32  ? 93  TYR B CZ  1 
ATOM   6401  O OH  . TYR D 3 93  ? -2.651  23.775  -21.244 1.00 28.94  ? 93  TYR B OH  1 
ATOM   6402  N N   . CYS D 3 94  ? -6.078  17.058  -24.685 1.00 26.49  ? 94  CYS B N   1 
ATOM   6403  C CA  . CYS D 3 94  ? -6.440  16.168  -25.764 1.00 33.87  ? 94  CYS B CA  1 
ATOM   6404  C C   . CYS D 3 94  ? -6.550  17.003  -27.043 1.00 27.75  ? 94  CYS B C   1 
ATOM   6405  O O   . CYS D 3 94  ? -6.769  18.205  -26.976 1.00 26.73  ? 94  CYS B O   1 
ATOM   6406  C CB  . CYS D 3 94  ? -7.697  15.366  -25.429 1.00 27.31  ? 94  CYS B CB  1 
ATOM   6407  S SG  . CYS D 3 94  ? -9.124  16.359  -25.116 1.00 41.20  ? 94  CYS B SG  1 
ATOM   6408  N N   . GLN D 3 95  ? -6.328  16.400  -28.200 1.00 29.26  ? 95  GLN B N   1 
ATOM   6409  C CA  . GLN D 3 95  ? -6.438  17.164  -29.435 1.00 29.64  ? 95  GLN B CA  1 
ATOM   6410  C C   . GLN D 3 95  ? -7.324  16.466  -30.452 1.00 30.58  ? 95  GLN B C   1 
ATOM   6411  O O   . GLN D 3 95  ? -7.172  15.274  -30.723 1.00 31.95  ? 95  GLN B O   1 
ATOM   6412  C CB  . GLN D 3 95  ? -5.065  17.486  -30.052 1.00 33.74  ? 95  GLN B CB  1 
ATOM   6413  C CG  . GLN D 3 95  ? -5.078  18.725  -30.959 1.00 34.11  ? 95  GLN B CG  1 
ATOM   6414  C CD  . GLN D 3 95  ? -3.937  18.795  -32.002 1.00 36.71  ? 95  GLN B CD  1 
ATOM   6415  O OE1 . GLN D 3 95  ? -3.271  17.793  -32.344 1.00 38.71  ? 95  GLN B OE1 1 
ATOM   6416  N NE2 . GLN D 3 95  ? -3.729  19.993  -32.529 1.00 36.88  ? 95  GLN B NE2 1 
ATOM   6417  N N   . ASN D 3 96  ? -8.277  17.232  -30.972 1.00 29.97  ? 96  ASN B N   1 
ATOM   6418  C CA  . ASN D 3 96  ? -8.976  16.902  -32.201 1.00 31.14  ? 96  ASN B CA  1 
ATOM   6419  C C   . ASN D 3 96  ? -7.989  16.777  -33.370 1.00 33.97  ? 96  ASN B C   1 
ATOM   6420  O O   . ASN D 3 96  ? -7.418  17.764  -33.828 1.00 33.21  ? 96  ASN B O   1 
ATOM   6421  C CB  . ASN D 3 96  ? -9.964  18.015  -32.510 1.00 30.25  ? 96  ASN B CB  1 
ATOM   6422  C CG  . ASN D 3 96  ? -10.648 17.821  -33.831 1.00 32.85  ? 96  ASN B CG  1 
ATOM   6423  O OD1 . ASN D 3 96  ? -10.702 16.708  -34.345 1.00 33.01  ? 96  ASN B OD1 1 
ATOM   6424  N ND2 . ASN D 3 96  ? -11.174 18.903  -34.395 1.00 31.45  ? 96  ASN B ND2 1 
ATOM   6425  N N   . ASP D 3 97  ? -7.781  15.563  -33.850 1.00 35.62  ? 97  ASP B N   1 
ATOM   6426  C CA  . ASP D 3 97  ? -6.899  15.364  -34.989 1.00 37.86  ? 97  ASP B CA  1 
ATOM   6427  C C   . ASP D 3 97  ? -7.664  15.048  -36.289 1.00 38.90  ? 97  ASP B C   1 
ATOM   6428  O O   . ASP D 3 97  ? -7.079  14.943  -37.341 1.00 40.58  ? 97  ASP B O   1 
ATOM   6429  C CB  . ASP D 3 97  ? -5.912  14.246  -34.686 1.00 39.77  ? 97  ASP B CB  1 
ATOM   6430  C CG  . ASP D 3 97  ? -4.630  14.396  -35.449 1.00 42.04  ? 97  ASP B CG  1 
ATOM   6431  O OD1 . ASP D 3 97  ? -3.918  15.382  -35.134 1.00 41.83  ? 97  ASP B OD1 1 
ATOM   6432  O OD2 . ASP D 3 97  ? -4.342  13.542  -36.323 1.00 44.11  ? 97  ASP B OD2 1 
ATOM   6433  N N   . TYR D 3 98  ? -8.975  14.881  -36.191 1.00 38.16  ? 98  TYR B N   1 
ATOM   6434  C CA  . TYR D 3 98  ? -9.791  14.526  -37.334 1.00 39.28  ? 98  TYR B CA  1 
ATOM   6435  C C   . TYR D 3 98  ? -9.882  15.691  -38.305 1.00 39.61  ? 98  TYR B C   1 
ATOM   6436  O O   . TYR D 3 98  ? -9.663  15.533  -39.501 1.00 45.56  ? 98  TYR B O   1 
ATOM   6437  C CB  . TYR D 3 98  ? -11.193 14.114  -36.887 1.00 38.44  ? 98  TYR B CB  1 
ATOM   6438  C CG  . TYR D 3 98  ? -11.998 13.443  -37.980 1.00 40.42  ? 98  TYR B CG  1 
ATOM   6439  C CD1 . TYR D 3 98  ? -12.678 14.189  -38.933 1.00 40.90  ? 98  TYR B CD1 1 
ATOM   6440  C CD2 . TYR D 3 98  ? -12.072 12.060  -38.064 1.00 42.04  ? 98  TYR B CD2 1 
ATOM   6441  C CE1 . TYR D 3 98  ? -13.393 13.586  -39.919 1.00 42.87  ? 98  TYR B CE1 1 
ATOM   6442  C CE2 . TYR D 3 98  ? -12.802 11.448  -39.055 1.00 44.04  ? 98  TYR B CE2 1 
ATOM   6443  C CZ  . TYR D 3 98  ? -13.457 12.215  -39.982 1.00 44.44  ? 98  TYR B CZ  1 
ATOM   6444  O OH  . TYR D 3 98  ? -14.191 11.605  -40.982 1.00 50.14  ? 98  TYR B OH  1 
ATOM   6445  N N   . SER D 3 99  ? -10.194 16.870  -37.793 1.00 37.75  ? 99  SER B N   1 
ATOM   6446  C CA  . SER D 3 99  ? -10.498 17.979  -38.664 1.00 38.15  ? 99  SER B CA  1 
ATOM   6447  C C   . SER D 3 99  ? -9.738  19.246  -38.329 1.00 37.19  ? 99  SER B C   1 
ATOM   6448  O O   . SER D 3 99  ? -9.400  19.500  -37.169 1.00 35.50  ? 99  SER B O   1 
ATOM   6449  C CB  . SER D 3 99  ? -11.997 18.254  -38.637 1.00 37.41  ? 99  SER B CB  1 
ATOM   6450  O OG  . SER D 3 99  ? -12.290 19.487  -39.245 1.00 37.57  ? 99  SER B OG  1 
ATOM   6451  N N   . TYR D 3 100 ? -9.461  20.022  -39.373 1.00 38.52  ? 100 TYR B N   1 
ATOM   6452  C CA  . TYR D 3 100 ? -9.117  21.422  -39.244 1.00 37.87  ? 100 TYR B CA  1 
ATOM   6453  C C   . TYR D 3 100 ? -10.204 21.986  -38.348 1.00 35.85  ? 100 TYR B C   1 
ATOM   6454  O O   . TYR D 3 100 ? -11.361 21.623  -38.499 1.00 35.79  ? 100 TYR B O   1 
ATOM   6455  C CB  . TYR D 3 100 ? -9.110  22.096  -40.646 1.00 47.86  ? 100 TYR B CB  1 
ATOM   6456  C CG  . TYR D 3 100 ? -9.224  23.605  -40.603 1.00 47.54  ? 100 TYR B CG  1 
ATOM   6457  C CD1 . TYR D 3 100 ? -8.143  24.437  -40.908 1.00 48.49  ? 100 TYR B CD1 1 
ATOM   6458  C CD2 . TYR D 3 100 ? -10.431 24.204  -40.235 1.00 46.47  ? 100 TYR B CD2 1 
ATOM   6459  C CE1 . TYR D 3 100 ? -8.290  25.847  -40.822 1.00 48.40  ? 100 TYR B CE1 1 
ATOM   6460  C CE2 . TYR D 3 100 ? -10.584 25.568  -40.126 1.00 46.26  ? 100 TYR B CE2 1 
ATOM   6461  C CZ  . TYR D 3 100 ? -9.539  26.397  -40.418 1.00 47.20  ? 100 TYR B CZ  1 
ATOM   6462  O OH  . TYR D 3 100 ? -9.805  27.753  -40.299 1.00 46.94  ? 100 TYR B OH  1 
ATOM   6463  N N   . PRO D 3 101 ? -9.865  22.901  -37.429 1.00 34.38  ? 101 PRO B N   1 
ATOM   6464  C CA  . PRO D 3 101 ? -8.572  23.482  -37.071 1.00 34.31  ? 101 PRO B CA  1 
ATOM   6465  C C   . PRO D 3 101 ? -7.888  22.803  -35.883 1.00 33.16  ? 101 PRO B C   1 
ATOM   6466  O O   . PRO D 3 101 ? -7.175  23.473  -35.141 1.00 32.42  ? 101 PRO B O   1 
ATOM   6467  C CB  . PRO D 3 101 ? -8.953  24.912  -36.684 1.00 33.41  ? 101 PRO B CB  1 
ATOM   6468  C CG  . PRO D 3 101 ? -10.279 24.754  -36.067 1.00 32.07  ? 101 PRO B CG  1 
ATOM   6469  C CD  . PRO D 3 101 ? -10.976 23.677  -36.845 1.00 33.01  ? 101 PRO B CD  1 
ATOM   6470  N N   . TYR D 3 102 ? -8.102  21.504  -35.711 1.00 33.23  ? 102 TYR B N   1 
ATOM   6471  C CA  . TYR D 3 102 ? -7.316  20.707  -34.761 1.00 34.84  ? 102 TYR B CA  1 
ATOM   6472  C C   . TYR D 3 102 ? -7.304  21.314  -33.360 1.00 32.90  ? 102 TYR B C   1 
ATOM   6473  O O   . TYR D 3 102 ? -6.253  21.665  -32.821 1.00 32.70  ? 102 TYR B O   1 
ATOM   6474  C CB  . TYR D 3 102 ? -5.893  20.500  -35.293 1.00 34.39  ? 102 TYR B CB  1 
ATOM   6475  C CG  . TYR D 3 102 ? -5.868  20.308  -36.790 1.00 36.52  ? 102 TYR B CG  1 
ATOM   6476  C CD1 . TYR D 3 102 ? -6.230  19.102  -37.361 1.00 37.75  ? 102 TYR B CD1 1 
ATOM   6477  C CD2 . TYR D 3 102 ? -5.519  21.354  -37.633 1.00 37.49  ? 102 TYR B CD2 1 
ATOM   6478  C CE1 . TYR D 3 102 ? -6.234  18.936  -38.738 1.00 40.72  ? 102 TYR B CE1 1 
ATOM   6479  C CE2 . TYR D 3 102 ? -5.515  21.202  -39.001 1.00 39.62  ? 102 TYR B CE2 1 
ATOM   6480  C CZ  . TYR D 3 102 ? -5.868  19.987  -39.560 1.00 41.67  ? 102 TYR B CZ  1 
ATOM   6481  O OH  . TYR D 3 102 ? -5.867  19.840  -40.938 1.00 43.18  ? 102 TYR B OH  1 
ATOM   6482  N N   . THR D 3 103 ? -8.499  21.430  -32.791 1.00 29.50  ? 103 THR B N   1 
ATOM   6483  C CA  . THR D 3 103 ? -8.721  22.144  -31.549 1.00 27.82  ? 103 THR B CA  1 
ATOM   6484  C C   . THR D 3 103 ? -8.236  21.338  -30.355 1.00 27.15  ? 103 THR B C   1 
ATOM   6485  O O   . THR D 3 103 ? -8.315  20.107  -30.324 1.00 27.59  ? 103 THR B O   1 
ATOM   6486  C CB  . THR D 3 103 ? -10.226 22.439  -31.362 1.00 30.76  ? 103 THR B CB  1 
ATOM   6487  O OG1 . THR D 3 103 ? -10.932 21.202  -31.319 1.00 30.88  ? 103 THR B OG1 1 
ATOM   6488  C CG2 . THR D 3 103 ? -10.775 23.239  -32.533 1.00 27.80  ? 103 THR B CG2 1 
ATOM   6489  N N   . PHE D 3 104 ? -7.745  22.038  -29.350 1.00 26.24  ? 104 PHE B N   1 
ATOM   6490  C CA  . PHE D 3 104 ? -7.322  21.348  -28.147 1.00 27.83  ? 104 PHE B CA  1 
ATOM   6491  C C   . PHE D 3 104 ? -8.418  21.230  -27.063 1.00 24.35  ? 104 PHE B C   1 
ATOM   6492  O O   . PHE D 3 104 ? -9.387  21.975  -27.022 1.00 23.64  ? 104 PHE B O   1 
ATOM   6493  C CB  . PHE D 3 104 ? -6.062  22.004  -27.583 1.00 27.91  ? 104 PHE B CB  1 
ATOM   6494  C CG  . PHE D 3 104 ? -4.849  21.854  -28.456 1.00 27.31  ? 104 PHE B CG  1 
ATOM   6495  C CD1 . PHE D 3 104 ? -3.894  20.897  -28.173 1.00 28.16  ? 104 PHE B CD1 1 
ATOM   6496  C CD2 . PHE D 3 104 ? -4.658  22.680  -29.564 1.00 33.33  ? 104 PHE B CD2 1 
ATOM   6497  C CE1 . PHE D 3 104 ? -2.774  20.773  -28.978 1.00 30.76  ? 104 PHE B CE1 1 
ATOM   6498  C CE2 . PHE D 3 104 ? -3.539  22.569  -30.362 1.00 29.74  ? 104 PHE B CE2 1 
ATOM   6499  C CZ  . PHE D 3 104 ? -2.596  21.617  -30.069 1.00 30.56  ? 104 PHE B CZ  1 
ATOM   6500  N N   . GLY D 3 105 ? -8.260  20.249  -26.201 1.00 24.24  ? 105 GLY B N   1 
ATOM   6501  C CA  . GLY D 3 105 ? -9.072  20.183  -25.015 1.00 26.77  ? 105 GLY B CA  1 
ATOM   6502  C C   . GLY D 3 105 ? -8.646  21.328  -24.122 1.00 22.40  ? 105 GLY B C   1 
ATOM   6503  O O   . GLY D 3 105 ? -7.622  21.979  -24.354 1.00 22.81  ? 105 GLY B O   1 
ATOM   6504  N N   . GLN D 3 106 ? -9.444  21.600  -23.107 1.00 21.48  ? 106 GLN B N   1 
ATOM   6505  C CA  . GLN D 3 106 ? -9.147  22.728  -22.249 1.00 23.07  ? 106 GLN B CA  1 
ATOM   6506  C C   . GLN D 3 106 ? -8.023  22.379  -21.258 1.00 21.20  ? 106 GLN B C   1 
ATOM   6507  O O   . GLN D 3 106 ? -7.408  23.261  -20.687 1.00 21.14  ? 106 GLN B O   1 
ATOM   6508  C CB  . GLN D 3 106 ? -10.416 23.243  -21.561 1.00 20.13  ? 106 GLN B CB  1 
ATOM   6509  C CG  . GLN D 3 106 ? -10.739 22.580  -20.237 1.00 27.27  ? 106 GLN B CG  1 
ATOM   6510  C CD  . GLN D 3 106 ? -11.612 21.341  -20.332 1.00 27.36  ? 106 GLN B CD  1 
ATOM   6511  O OE1 . GLN D 3 106 ? -11.628 20.626  -21.339 1.00 20.40  ? 106 GLN B OE1 1 
ATOM   6512  N NE2 . GLN D 3 106 ? -12.339 21.071  -19.250 1.00 27.14  ? 106 GLN B NE2 1 
ATOM   6513  N N   . GLY D 3 107 ? -7.745  21.090  -21.093 1.00 21.69  ? 107 GLY B N   1 
ATOM   6514  C CA  . GLY D 3 107 ? -6.642  20.642  -20.267 1.00 25.68  ? 107 GLY B CA  1 
ATOM   6515  C C   . GLY D 3 107 ? -7.053  20.188  -18.878 1.00 25.33  ? 107 GLY B C   1 
ATOM   6516  O O   . GLY D 3 107 ? -7.848  20.848  -18.222 1.00 24.76  ? 107 GLY B O   1 
ATOM   6517  N N   . THR D 3 108 ? -6.514  19.056  -18.437 1.00 26.05  ? 108 THR B N   1 
ATOM   6518  C CA  . THR D 3 108 ? -6.734  18.544  -17.085 1.00 22.83  ? 108 THR B CA  1 
ATOM   6519  C C   . THR D 3 108 ? -5.432  18.620  -16.301 1.00 23.60  ? 108 THR B C   1 
ATOM   6520  O O   . THR D 3 108 ? -4.420  18.110  -16.735 1.00 24.64  ? 108 THR B O   1 
ATOM   6521  C CB  . THR D 3 108 ? -7.209  17.076  -17.100 1.00 23.51  ? 108 THR B CB  1 
ATOM   6522  O OG1 . THR D 3 108 ? -8.532  16.997  -17.629 1.00 22.89  ? 108 THR B OG1 1 
ATOM   6523  C CG2 . THR D 3 108 ? -7.217  16.504  -15.727 1.00 23.95  ? 108 THR B CG2 1 
ATOM   6524  N N   . LYS D 3 109 ? -5.472  19.271  -15.143 1.00 23.28  ? 109 LYS B N   1 
ATOM   6525  C CA  . LYS D 3 109 ? -4.299  19.403  -14.282 1.00 24.15  ? 109 LYS B CA  1 
ATOM   6526  C C   . LYS D 3 109 ? -4.228  18.286  -13.247 1.00 26.03  ? 109 LYS B C   1 
ATOM   6527  O O   . LYS D 3 109 ? -5.128  18.141  -12.439 1.00 25.89  ? 109 LYS B O   1 
ATOM   6528  C CB  . LYS D 3 109 ? -4.318  20.759  -13.587 1.00 23.62  ? 109 LYS B CB  1 
ATOM   6529  C CG  . LYS D 3 109 ? -3.075  21.099  -12.808 1.00 25.74  ? 109 LYS B CG  1 
ATOM   6530  C CD  . LYS D 3 109 ? -3.070  22.567  -12.501 1.00 25.49  ? 109 LYS B CD  1 
ATOM   6531  C CE  . LYS D 3 109 ? -1.833  22.981  -11.742 1.00 27.19  ? 109 LYS B CE  1 
ATOM   6532  N NZ  . LYS D 3 109 ? -1.571  24.466  -11.872 1.00 27.65  ? 109 LYS B NZ  1 
ATOM   6533  N N   . LEU D 3 110 ? -3.159  17.504  -13.276 1.00 26.41  ? 110 LEU B N   1 
ATOM   6534  C CA  . LEU D 3 110 ? -2.993  16.400  -12.338 1.00 27.63  ? 110 LEU B CA  1 
ATOM   6535  C C   . LEU D 3 110 ? -1.946  16.679  -11.252 1.00 32.39  ? 110 LEU B C   1 
ATOM   6536  O O   . LEU D 3 110 ? -0.827  17.130  -11.522 1.00 29.28  ? 110 LEU B O   1 
ATOM   6537  C CB  . LEU D 3 110 ? -2.641  15.133  -13.095 1.00 28.83  ? 110 LEU B CB  1 
ATOM   6538  C CG  . LEU D 3 110 ? -2.433  13.797  -12.397 1.00 30.50  ? 110 LEU B CG  1 
ATOM   6539  C CD1 . LEU D 3 110 ? -3.646  13.366  -11.634 1.00 30.14  ? 110 LEU B CD1 1 
ATOM   6540  C CD2 . LEU D 3 110 ? -2.095  12.771  -13.465 1.00 31.66  ? 110 LEU B CD2 1 
ATOM   6541  N N   . GLU D 3 111 ? -2.333  16.415  -10.011 1.00 32.60  ? 111 GLU B N   1 
ATOM   6542  C CA  . GLU D 3 111 ? -1.487  16.715  -8.888  1.00 33.46  ? 111 GLU B CA  1 
ATOM   6543  C C   . GLU D 3 111 ? -1.462  15.589  -7.879  1.00 34.43  ? 111 GLU B C   1 
ATOM   6544  O O   . GLU D 3 111 ? -2.316  14.710  -7.895  1.00 33.86  ? 111 GLU B O   1 
ATOM   6545  C CB  . GLU D 3 111 ? -1.935  18.017  -8.252  1.00 32.88  ? 111 GLU B CB  1 
ATOM   6546  C CG  . GLU D 3 111 ? -1.490  19.214  -9.051  1.00 32.86  ? 111 GLU B CG  1 
ATOM   6547  C CD  . GLU D 3 111 ? -2.196  20.514  -8.670  1.00 32.89  ? 111 GLU B CD  1 
ATOM   6548  O OE1 . GLU D 3 111 ? -1.491  21.441  -8.178  1.00 33.58  ? 111 GLU B OE1 1 
ATOM   6549  O OE2 . GLU D 3 111 ? -3.445  20.614  -8.892  1.00 32.25  ? 111 GLU B OE2 1 
ATOM   6550  N N   . ILE D 3 112 ? -0.456  15.612  -7.009  1.00 35.84  ? 112 ILE B N   1 
ATOM   6551  C CA  . ILE D 3 112 ? -0.350  14.627  -5.949  1.00 37.21  ? 112 ILE B CA  1 
ATOM   6552  C C   . ILE D 3 112 ? -1.343  14.946  -4.862  1.00 34.47  ? 112 ILE B C   1 
ATOM   6553  O O   . ILE D 3 112 ? -1.412  16.069  -4.381  1.00 33.82  ? 112 ILE B O   1 
ATOM   6554  C CB  . ILE D 3 112 ? 1.035   14.611  -5.282  1.00 39.40  ? 112 ILE B CB  1 
ATOM   6555  C CG1 . ILE D 3 112 ? 2.127   14.319  -6.307  1.00 37.66  ? 112 ILE B CG1 1 
ATOM   6556  C CG2 . ILE D 3 112 ? 1.058   13.593  -4.149  1.00 38.87  ? 112 ILE B CG2 1 
ATOM   6557  C CD1 . ILE D 3 112 ? 1.799   13.143  -7.213  1.00 39.17  ? 112 ILE B CD1 1 
ATOM   6558  N N   . LYS D 3 113 ? -2.121  13.940  -4.499  1.00 38.56  ? 113 LYS B N   1 
ATOM   6559  C CA  . LYS D 3 113 ? -2.913  13.965  -3.291  1.00 38.83  ? 113 LYS B CA  1 
ATOM   6560  C C   . LYS D 3 113 ? -2.083  13.483  -2.096  1.00 38.32  ? 113 LYS B C   1 
ATOM   6561  O O   . LYS D 3 113 ? -1.473  12.402  -2.135  1.00 38.90  ? 113 LYS B O   1 
ATOM   6562  C CB  . LYS D 3 113 ? -4.118  13.057  -3.459  1.00 40.97  ? 113 LYS B CB  1 
ATOM   6563  C CG  . LYS D 3 113 ? -5.163  13.299  -2.444  1.00 41.74  ? 113 LYS B CG  1 
ATOM   6564  C CD  . LYS D 3 113 ? -6.055  12.105  -2.318  1.00 44.04  ? 113 LYS B CD  1 
ATOM   6565  C CE  . LYS D 3 113 ? -7.034  12.341  -1.188  1.00 52.54  ? 113 LYS B CE  1 
ATOM   6566  N NZ  . LYS D 3 113 ? -7.040  13.812  -0.884  1.00 51.28  ? 113 LYS B NZ  1 
ATOM   6567  N N   . ARG D 3 114 ? -2.072  14.296  -1.041  1.00 37.55  ? 114 ARG B N   1 
ATOM   6568  C CA  . ARG D 3 114 ? -1.473  13.929  0.245   1.00 37.57  ? 114 ARG B CA  1 
ATOM   6569  C C   . ARG D 3 114 ? -2.461  14.091  1.420   1.00 38.61  ? 114 ARG B C   1 
ATOM   6570  O O   . ARG D 3 114 ? -3.614  14.499  1.237   1.00 43.96  ? 114 ARG B O   1 
ATOM   6571  C CB  . ARG D 3 114 ? -0.202  14.740  0.488   1.00 36.06  ? 114 ARG B CB  1 
ATOM   6572  C CG  . ARG D 3 114 ? -0.323  16.238  0.260   1.00 34.92  ? 114 ARG B CG  1 
ATOM   6573  C CD  . ARG D 3 114 ? 0.652   16.935  1.147   1.00 34.16  ? 114 ARG B CD  1 
ATOM   6574  N NE  . ARG D 3 114 ? 0.465   16.429  2.504   1.00 39.56  ? 114 ARG B NE  1 
ATOM   6575  C CZ  . ARG D 3 114 ? 1.364   16.437  3.485   1.00 35.43  ? 114 ARG B CZ  1 
ATOM   6576  N NH1 . ARG D 3 114 ? 2.585   16.931  3.314   1.00 34.57  ? 114 ARG B NH1 1 
ATOM   6577  N NH2 . ARG D 3 114 ? 1.014   15.941  4.654   1.00 36.83  ? 114 ARG B NH2 1 
ATOM   6578  N N   . THR D 3 115 ? -2.025  13.770  2.628   1.00 39.07  ? 115 THR B N   1 
ATOM   6579  C CA  . THR D 3 115 ? -2.904  13.933  3.776   1.00 40.45  ? 115 THR B CA  1 
ATOM   6580  C C   . THR D 3 115 ? -3.109  15.388  4.091   1.00 39.77  ? 115 THR B C   1 
ATOM   6581  O O   . THR D 3 115 ? -2.398  16.247  3.612   1.00 38.15  ? 115 THR B O   1 
ATOM   6582  C CB  . THR D 3 115 ? -2.424  13.181  5.028   1.00 41.62  ? 115 THR B CB  1 
ATOM   6583  O OG1 . THR D 3 115 ? -1.020  13.409  5.247   1.00 40.49  ? 115 THR B OG1 1 
ATOM   6584  C CG2 . THR D 3 115 ? -2.694  11.692  4.863   1.00 43.08  ? 115 THR B CG2 1 
ATOM   6585  N N   . VAL D 3 116 ? -4.112  15.667  4.893   1.00 41.56  ? 116 VAL B N   1 
ATOM   6586  C CA  . VAL D 3 116 ? -4.515  17.039  5.106   1.00 41.54  ? 116 VAL B CA  1 
ATOM   6587  C C   . VAL D 3 116 ? -3.504  17.717  6.008   1.00 40.77  ? 116 VAL B C   1 
ATOM   6588  O O   . VAL D 3 116 ? -3.095  17.150  7.011   1.00 41.68  ? 116 VAL B O   1 
ATOM   6589  C CB  . VAL D 3 116 ? -5.931  17.091  5.724   1.00 44.36  ? 116 VAL B CB  1 
ATOM   6590  C CG1 . VAL D 3 116 ? -6.231  18.470  6.298   1.00 44.92  ? 116 VAL B CG1 1 
ATOM   6591  C CG2 . VAL D 3 116 ? -6.988  16.666  4.680   1.00 45.15  ? 116 VAL B CG2 1 
ATOM   6592  N N   . ALA D 3 117 ? -3.073  18.910  5.627   1.00 39.33  ? 117 ALA B N   1 
ATOM   6593  C CA  . ALA D 3 117 ? -2.201  19.702  6.480   1.00 38.89  ? 117 ALA B CA  1 
ATOM   6594  C C   . ALA D 3 117 ? -2.781  21.106  6.650   1.00 42.96  ? 117 ALA B C   1 
ATOM   6595  O O   . ALA D 3 117 ? -3.055  21.788  5.672   1.00 42.07  ? 117 ALA B O   1 
ATOM   6596  C CB  . ALA D 3 117 ? -0.820  19.760  5.902   1.00 37.08  ? 117 ALA B CB  1 
ATOM   6597  N N   . ALA D 3 118 ? -2.990  21.534  7.891   1.00 44.87  ? 118 ALA B N   1 
ATOM   6598  C CA  . ALA D 3 118 ? -3.476  22.888  8.142   1.00 44.62  ? 118 ALA B CA  1 
ATOM   6599  C C   . ALA D 3 118 ? -2.353  23.891  7.871   1.00 42.01  ? 118 ALA B C   1 
ATOM   6600  O O   . ALA D 3 118 ? -1.181  23.591  8.103   1.00 39.25  ? 118 ALA B O   1 
ATOM   6601  C CB  . ALA D 3 118 ? -3.989  23.017  9.570   1.00 44.38  ? 118 ALA B CB  1 
ATOM   6602  N N   . PRO D 3 119 ? -2.704  25.077  7.347   1.00 41.64  ? 119 PRO B N   1 
ATOM   6603  C CA  . PRO D 3 119 ? -1.675  26.088  7.118   1.00 40.72  ? 119 PRO B CA  1 
ATOM   6604  C C   . PRO D 3 119 ? -1.166  26.616  8.442   1.00 42.31  ? 119 PRO B C   1 
ATOM   6605  O O   . PRO D 3 119 ? -1.767  26.383  9.487   1.00 42.02  ? 119 PRO B O   1 
ATOM   6606  C CB  . PRO D 3 119 ? -2.437  27.195  6.390   1.00 38.27  ? 119 PRO B CB  1 
ATOM   6607  C CG  . PRO D 3 119 ? -3.816  27.033  6.843   1.00 40.35  ? 119 PRO B CG  1 
ATOM   6608  C CD  . PRO D 3 119 ? -4.029  25.555  6.930   1.00 40.53  ? 119 PRO B CD  1 
ATOM   6609  N N   . SER D 3 120 ? -0.039  27.305  8.395   1.00 41.33  ? 120 SER B N   1 
ATOM   6610  C CA  . SER D 3 120 ? 0.424   28.059  9.539   1.00 42.76  ? 120 SER B CA  1 
ATOM   6611  C C   . SER D 3 120 ? 0.246   29.485  9.091   1.00 42.83  ? 120 SER B C   1 
ATOM   6612  O O   . SER D 3 120 ? 0.786   29.874  8.060   1.00 41.07  ? 120 SER B O   1 
ATOM   6613  C CB  . SER D 3 120 ? 1.890   27.766  9.843   1.00 41.86  ? 120 SER B CB  1 
ATOM   6614  O OG  . SER D 3 120 ? 2.106   26.375  9.951   1.00 41.50  ? 120 SER B OG  1 
ATOM   6615  N N   . VAL D 3 121 ? -0.527  30.260  9.843   1.00 45.10  ? 121 VAL B N   1 
ATOM   6616  C CA  . VAL D 3 121 ? -0.901  31.581  9.381   1.00 42.81  ? 121 VAL B CA  1 
ATOM   6617  C C   . VAL D 3 121 ? -0.048  32.691  9.982   1.00 43.81  ? 121 VAL B C   1 
ATOM   6618  O O   . VAL D 3 121 ? 0.383   32.600  11.112  1.00 45.60  ? 121 VAL B O   1 
ATOM   6619  C CB  . VAL D 3 121 ? -2.363  31.816  9.616   1.00 44.74  ? 121 VAL B CB  1 
ATOM   6620  C CG1 . VAL D 3 121 ? -2.817  32.963  8.770   1.00 44.44  ? 121 VAL B CG1 1 
ATOM   6621  C CG2 . VAL D 3 121 ? -3.113  30.562  9.244   1.00 44.28  ? 121 VAL B CG2 1 
ATOM   6622  N N   . PHE D 3 122 ? 0.217   33.722  9.189   1.00 43.43  ? 122 PHE B N   1 
ATOM   6623  C CA  . PHE D 3 122 ? 1.135   34.791  9.559   1.00 44.35  ? 122 PHE B CA  1 
ATOM   6624  C C   . PHE D 3 122 ? 0.618   36.104  9.018   1.00 45.00  ? 122 PHE B C   1 
ATOM   6625  O O   . PHE D 3 122 ? 0.192   36.164  7.876   1.00 43.64  ? 122 PHE B O   1 
ATOM   6626  C CB  . PHE D 3 122 ? 2.524   34.536  8.959   1.00 42.25  ? 122 PHE B CB  1 
ATOM   6627  C CG  . PHE D 3 122 ? 3.190   33.299  9.486   1.00 41.95  ? 122 PHE B CG  1 
ATOM   6628  C CD1 . PHE D 3 122 ? 3.887   33.331  10.688  1.00 43.90  ? 122 PHE B CD1 1 
ATOM   6629  C CD2 . PHE D 3 122 ? 3.107   32.098  8.793   1.00 39.88  ? 122 PHE B CD2 1 
ATOM   6630  C CE1 . PHE D 3 122 ? 4.487   32.199  11.184  1.00 43.78  ? 122 PHE B CE1 1 
ATOM   6631  C CE2 . PHE D 3 122 ? 3.704   30.970  9.286   1.00 39.91  ? 122 PHE B CE2 1 
ATOM   6632  C CZ  . PHE D 3 122 ? 4.399   31.026  10.492  1.00 41.88  ? 122 PHE B CZ  1 
ATOM   6633  N N   . ILE D 3 123 ? 0.676   37.165  9.808   1.00 46.35  ? 123 ILE B N   1 
ATOM   6634  C CA  . ILE D 3 123 ? 0.251   38.446  9.287   1.00 46.92  ? 123 ILE B CA  1 
ATOM   6635  C C   . ILE D 3 123 ? 1.325   39.521  9.429   1.00 47.55  ? 123 ILE B C   1 
ATOM   6636  O O   . ILE D 3 123 ? 1.917   39.684  10.495  1.00 51.82  ? 123 ILE B O   1 
ATOM   6637  C CB  . ILE D 3 123 ? -1.080  38.876  9.921   1.00 52.62  ? 123 ILE B CB  1 
ATOM   6638  C CG1 . ILE D 3 123 ? -1.482  40.270  9.456   1.00 50.71  ? 123 ILE B CG1 1 
ATOM   6639  C CG2 . ILE D 3 123 ? -1.000  38.825  11.431  1.00 55.51  ? 123 ILE B CG2 1 
ATOM   6640  C CD1 . ILE D 3 123 ? -2.854  40.632  9.892   1.00 53.46  ? 123 ILE B CD1 1 
ATOM   6641  N N   . PHE D 3 124 ? 1.577   40.241  8.338   1.00 46.25  ? 124 PHE B N   1 
ATOM   6642  C CA  . PHE D 3 124 ? 2.562   41.320  8.309   1.00 46.90  ? 124 PHE B CA  1 
ATOM   6643  C C   . PHE D 3 124 ? 1.917   42.691  8.107   1.00 48.57  ? 124 PHE B C   1 
ATOM   6644  O O   . PHE D 3 124 ? 1.166   42.900  7.152   1.00 50.08  ? 124 PHE B O   1 
ATOM   6645  C CB  . PHE D 3 124 ? 3.555   41.103  7.173   1.00 44.39  ? 124 PHE B CB  1 
ATOM   6646  C CG  . PHE D 3 124 ? 4.215   39.761  7.183   1.00 44.54  ? 124 PHE B CG  1 
ATOM   6647  C CD1 . PHE D 3 124 ? 5.419   39.576  7.835   1.00 43.41  ? 124 PHE B CD1 1 
ATOM   6648  C CD2 . PHE D 3 124 ? 3.646   38.693  6.518   1.00 42.66  ? 124 PHE B CD2 1 
ATOM   6649  C CE1 . PHE D 3 124 ? 6.032   38.355  7.842   1.00 42.22  ? 124 PHE B CE1 1 
ATOM   6650  C CE2 . PHE D 3 124 ? 4.264   37.467  6.516   1.00 39.61  ? 124 PHE B CE2 1 
ATOM   6651  C CZ  . PHE D 3 124 ? 5.460   37.300  7.184   1.00 40.28  ? 124 PHE B CZ  1 
ATOM   6652  N N   . PRO D 3 125 ? 2.231   43.642  8.994   1.00 61.21  ? 125 PRO B N   1 
ATOM   6653  C CA  . PRO D 3 125 ? 1.710   45.000  8.842   1.00 63.11  ? 125 PRO B CA  1 
ATOM   6654  C C   . PRO D 3 125 ? 2.502   45.729  7.758   1.00 61.79  ? 125 PRO B C   1 
ATOM   6655  O O   . PRO D 3 125 ? 3.554   45.248  7.356   1.00 59.95  ? 125 PRO B O   1 
ATOM   6656  C CB  . PRO D 3 125 ? 1.959   45.614  10.224  1.00 66.59  ? 125 PRO B CB  1 
ATOM   6657  C CG  . PRO D 3 125 ? 3.169   44.912  10.733  1.00 65.97  ? 125 PRO B CG  1 
ATOM   6658  C CD  . PRO D 3 125 ? 3.128   43.513  10.158  1.00 62.86  ? 125 PRO B CD  1 
ATOM   6659  N N   . PRO D 3 126 ? 1.993   46.867  7.273   1.00 63.06  ? 126 PRO B N   1 
ATOM   6660  C CA  . PRO D 3 126 ? 2.705   47.603  6.226   1.00 62.29  ? 126 PRO B CA  1 
ATOM   6661  C C   . PRO D 3 126 ? 4.059   48.067  6.715   1.00 63.52  ? 126 PRO B C   1 
ATOM   6662  O O   . PRO D 3 126 ? 4.197   48.398  7.893   1.00 66.01  ? 126 PRO B O   1 
ATOM   6663  C CB  . PRO D 3 126 ? 1.817   48.832  5.999   1.00 64.39  ? 126 PRO B CB  1 
ATOM   6664  C CG  . PRO D 3 126 ? 0.468   48.429  6.482   1.00 65.42  ? 126 PRO B CG  1 
ATOM   6665  C CD  . PRO D 3 126 ? 0.716   47.508  7.633   1.00 65.58  ? 126 PRO B CD  1 
ATOM   6666  N N   . SER D 3 127 ? 5.044   48.103  5.827   1.00 62.27  ? 127 SER B N   1 
ATOM   6667  C CA  . SER D 3 127 ? 6.350   48.645  6.187   1.00 63.87  ? 127 SER B CA  1 
ATOM   6668  C C   . SER D 3 127 ? 6.190   50.119  6.511   1.00 67.50  ? 127 SER B C   1 
ATOM   6669  O O   . SER D 3 127 ? 5.239   50.754  6.064   1.00 68.06  ? 127 SER B O   1 
ATOM   6670  C CB  . SER D 3 127 ? 7.323   48.488  5.026   1.00 61.98  ? 127 SER B CB  1 
ATOM   6671  O OG  . SER D 3 127 ? 6.834   49.160  3.878   1.00 61.61  ? 127 SER B OG  1 
ATOM   6672  N N   . ASP D 3 128 ? 7.114   50.667  7.287   1.00 70.66  ? 128 ASP B N   1 
ATOM   6673  C CA  . ASP D 3 128 ? 7.092   52.093  7.558   1.00 74.71  ? 128 ASP B CA  1 
ATOM   6674  C C   . ASP D 3 128 ? 7.458   52.853  6.301   1.00 74.42  ? 128 ASP B C   1 
ATOM   6675  O O   . ASP D 3 128 ? 6.993   53.967  6.062   1.00 76.17  ? 128 ASP B O   1 
ATOM   6676  C CB  . ASP D 3 128 ? 8.075   52.444  8.668   1.00 77.84  ? 128 ASP B CB  1 
ATOM   6677  C CG  . ASP D 3 128 ? 7.381   52.741  9.976   1.00 81.22  ? 128 ASP B CG  1 
ATOM   6678  O OD1 . ASP D 3 128 ? 6.770   53.827  10.090  1.00 83.68  ? 128 ASP B OD1 1 
ATOM   6679  O OD2 . ASP D 3 128 ? 7.440   51.886  10.886  1.00 81.64  ? 128 ASP B OD2 1 
ATOM   6680  N N   . GLU D 3 129 ? 8.304   52.227  5.497   1.00 72.17  ? 129 GLU B N   1 
ATOM   6681  C CA  . GLU D 3 129 ? 8.820   52.850  4.293   1.00 71.56  ? 129 GLU B CA  1 
ATOM   6682  C C   . GLU D 3 129 ? 7.695   53.124  3.322   1.00 70.73  ? 129 GLU B C   1 
ATOM   6683  O O   . GLU D 3 129 ? 7.574   54.229  2.794   1.00 72.15  ? 129 GLU B O   1 
ATOM   6684  C CB  . GLU D 3 129 ? 9.858   51.936  3.644   1.00 69.07  ? 129 GLU B CB  1 
ATOM   6685  C CG  . GLU D 3 129 ? 10.607  52.568  2.494   1.00 68.69  ? 129 GLU B CG  1 
ATOM   6686  C CD  . GLU D 3 129 ? 11.745  51.693  2.002   1.00 66.88  ? 129 GLU B CD  1 
ATOM   6687  O OE1 . GLU D 3 129 ? 11.700  50.452  2.224   1.00 64.73  ? 129 GLU B OE1 1 
ATOM   6688  O OE2 . GLU D 3 129 ? 12.690  52.258  1.402   1.00 67.96  ? 129 GLU B OE2 1 
ATOM   6689  N N   . GLN D 3 130 ? 6.864   52.110  3.104   1.00 68.88  ? 130 GLN B N   1 
ATOM   6690  C CA  . GLN D 3 130 ? 5.807   52.201  2.123   1.00 68.34  ? 130 GLN B CA  1 
ATOM   6691  C C   . GLN D 3 130 ? 4.855   53.305  2.494   1.00 71.09  ? 130 GLN B C   1 
ATOM   6692  O O   . GLN D 3 130 ? 4.366   54.025  1.625   1.00 72.23  ? 130 GLN B O   1 
ATOM   6693  C CB  . GLN D 3 130 ? 5.050   50.885  2.024   1.00 51.57  ? 130 GLN B CB  1 
ATOM   6694  C CG  . GLN D 3 130 ? 4.044   50.875  0.893   1.00 53.61  ? 130 GLN B CG  1 
ATOM   6695  C CD  . GLN D 3 130 ? 3.310   49.566  0.776   1.00 51.55  ? 130 GLN B CD  1 
ATOM   6696  O OE1 . GLN D 3 130 ? 3.160   48.829  1.749   1.00 48.46  ? 130 GLN B OE1 1 
ATOM   6697  N NE2 . GLN D 3 130 ? 2.848   49.264  -0.427  1.00 50.37  ? 130 GLN B NE2 1 
ATOM   6698  N N   . LEU D 3 131 ? 4.599   53.443  3.791   1.00 72.47  ? 131 LEU B N   1 
ATOM   6699  C CA  . LEU D 3 131 ? 3.639   54.426  4.275   1.00 74.91  ? 131 LEU B CA  1 
ATOM   6700  C C   . LEU D 3 131 ? 4.062   55.861  3.958   1.00 76.58  ? 131 LEU B C   1 
ATOM   6701  O O   . LEU D 3 131 ? 3.223   56.721  3.707   1.00 78.31  ? 131 LEU B O   1 
ATOM   6702  C CB  . LEU D 3 131 ? 3.370   54.239  5.770   1.00 76.90  ? 131 LEU B CB  1 
ATOM   6703  C CG  . LEU D 3 131 ? 2.479   53.054  6.144   1.00 61.92  ? 131 LEU B CG  1 
ATOM   6704  C CD1 . LEU D 3 131 ? 1.950   53.202  7.557   1.00 64.93  ? 131 LEU B CD1 1 
ATOM   6705  C CD2 . LEU D 3 131 ? 1.334   52.929  5.162   1.00 60.93  ? 131 LEU B CD2 1 
ATOM   6706  N N   . LYS D 3 132 ? 5.366   56.110  3.948   1.00 76.12  ? 132 LYS B N   1 
ATOM   6707  C CA  . LYS D 3 132 ? 5.878   57.424  3.569   1.00 77.97  ? 132 LYS B CA  1 
ATOM   6708  C C   . LYS D 3 132 ? 5.530   57.763  2.114   1.00 77.15  ? 132 LYS B C   1 
ATOM   6709  O O   . LYS D 3 132 ? 5.516   58.938  1.732   1.00 79.66  ? 132 LYS B O   1 
ATOM   6710  C CB  . LYS D 3 132 ? 7.392   57.509  3.802   1.00 77.89  ? 132 LYS B CB  1 
ATOM   6711  C CG  . LYS D 3 132 ? 7.792   57.492  5.276   1.00 79.60  ? 132 LYS B CG  1 
ATOM   6712  C CD  . LYS D 3 132 ? 9.307   57.627  5.481   1.00 80.10  ? 132 LYS B CD  1 
ATOM   6713  C CE  . LYS D 3 132 ? 10.078  56.530  4.741   1.00 76.44  ? 132 LYS B CE  1 
ATOM   6714  N NZ  . LYS D 3 132 ? 11.469  56.306  5.251   1.00 77.02  ? 132 LYS B NZ  1 
ATOM   6715  N N   . SER D 3 133 ? 5.233   56.734  1.316   1.00 73.77  ? 133 SER B N   1 
ATOM   6716  C CA  . SER D 3 133 ? 4.962   56.912  -0.111  1.00 72.50  ? 133 SER B CA  1 
ATOM   6717  C C   . SER D 3 133 ? 3.492   56.731  -0.473  1.00 72.27  ? 133 SER B C   1 
ATOM   6718  O O   . SER D 3 133 ? 3.143   56.663  -1.651  1.00 71.54  ? 133 SER B O   1 
ATOM   6719  C CB  . SER D 3 133 ? 5.809   55.958  -0.952  1.00 69.40  ? 133 SER B CB  1 
ATOM   6720  O OG  . SER D 3 133 ? 5.163   54.703  -1.092  1.00 66.77  ? 133 SER B OG  1 
ATOM   6721  N N   . GLY D 3 134 ? 2.635   56.626  0.534   1.00 73.19  ? 134 GLY B N   1 
ATOM   6722  C CA  . GLY D 3 134 ? 1.212   56.805  0.312   1.00 74.26  ? 134 GLY B CA  1 
ATOM   6723  C C   . GLY D 3 134 ? 0.377   55.617  -0.119  1.00 71.96  ? 134 GLY B C   1 
ATOM   6724  O O   . GLY D 3 134 ? -0.682  55.800  -0.715  1.00 73.13  ? 134 GLY B O   1 
ATOM   6725  N N   . THR D 3 135 ? 0.840   54.404  0.159   1.00 68.91  ? 135 THR B N   1 
ATOM   6726  C CA  . THR D 3 135 ? -0.036  53.231  0.095   1.00 66.63  ? 135 THR B CA  1 
ATOM   6727  C C   . THR D 3 135 ? 0.215   52.362  1.326   1.00 65.03  ? 135 THR B C   1 
ATOM   6728  O O   . THR D 3 135 ? 1.228   52.517  2.008   1.00 64.95  ? 135 THR B O   1 
ATOM   6729  C CB  . THR D 3 135 ? 0.151   52.372  -1.195  1.00 66.87  ? 135 THR B CB  1 
ATOM   6730  O OG1 . THR D 3 135 ? 1.493   51.877  -1.251  1.00 65.12  ? 135 THR B OG1 1 
ATOM   6731  C CG2 . THR D 3 135 ? -0.146  53.165  -2.465  1.00 67.89  ? 135 THR B CG2 1 
ATOM   6732  N N   . ALA D 3 136 ? -0.717  51.461  1.616   1.00 64.04  ? 136 ALA B N   1 
ATOM   6733  C CA  . ALA D 3 136 ? -0.507  50.461  2.655   1.00 62.74  ? 136 ALA B CA  1 
ATOM   6734  C C   . ALA D 3 136 ? -0.821  49.082  2.095   1.00 59.96  ? 136 ALA B C   1 
ATOM   6735  O O   . ALA D 3 136 ? -1.862  48.880  1.475   1.00 59.92  ? 136 ALA B O   1 
ATOM   6736  C CB  . ALA D 3 136 ? -1.364  50.751  3.866   1.00 65.27  ? 136 ALA B CB  1 
ATOM   6737  N N   . SER D 3 137 ? 0.109   48.150  2.285   1.00 57.82  ? 137 SER B N   1 
ATOM   6738  C CA  . SER D 3 137 ? -0.098  46.752  1.923   1.00 55.52  ? 137 SER B CA  1 
ATOM   6739  C C   . SER D 3 137 ? -0.048  45.938  3.201   1.00 55.21  ? 137 SER B C   1 
ATOM   6740  O O   . SER D 3 137 ? 0.842   46.126  4.035   1.00 55.85  ? 137 SER B O   1 
ATOM   6741  C CB  . SER D 3 137 ? 0.994   46.262  0.975   1.00 53.60  ? 137 SER B CB  1 
ATOM   6742  O OG  . SER D 3 137 ? 0.885   46.844  -0.305  1.00 53.87  ? 137 SER B OG  1 
ATOM   6743  N N   . VAL D 3 138 ? -1.012  45.044  3.364   1.00 54.46  ? 138 VAL B N   1 
ATOM   6744  C CA  . VAL D 3 138 ? -1.063  44.206  4.547   1.00 54.06  ? 138 VAL B CA  1 
ATOM   6745  C C   . VAL D 3 138 ? -1.209  42.793  4.063   1.00 51.70  ? 138 VAL B C   1 
ATOM   6746  O O   . VAL D 3 138 ? -2.223  42.465  3.458   1.00 51.83  ? 138 VAL B O   1 
ATOM   6747  C CB  . VAL D 3 138 ? -2.286  44.535  5.391   1.00 56.35  ? 138 VAL B CB  1 
ATOM   6748  C CG1 . VAL D 3 138 ? -2.245  43.761  6.686   1.00 56.91  ? 138 VAL B CG1 1 
ATOM   6749  C CG2 . VAL D 3 138 ? -2.348  46.022  5.659   1.00 58.82  ? 138 VAL B CG2 1 
ATOM   6750  N N   . VAL D 3 139 ? -0.208  41.954  4.305   1.00 49.96  ? 139 VAL B N   1 
ATOM   6751  C CA  . VAL D 3 139 ? -0.241  40.605  3.748   1.00 47.83  ? 139 VAL B CA  1 
ATOM   6752  C C   . VAL D 3 139 ? -0.391  39.492  4.787   1.00 48.00  ? 139 VAL B C   1 
ATOM   6753  O O   . VAL D 3 139 ? 0.314   39.448  5.783   1.00 48.79  ? 139 VAL B O   1 
ATOM   6754  C CB  . VAL D 3 139 ? 0.920   40.328  2.722   1.00 39.34  ? 139 VAL B CB  1 
ATOM   6755  C CG1 . VAL D 3 139 ? 1.708   41.591  2.408   1.00 39.92  ? 139 VAL B CG1 1 
ATOM   6756  C CG2 . VAL D 3 139 ? 1.831   39.219  3.185   1.00 38.13  ? 139 VAL B CG2 1 
ATOM   6757  N N   . CYS D 3 140 ? -1.357  38.619  4.534   1.00 47.69  ? 140 CYS B N   1 
ATOM   6758  C CA  . CYS D 3 140 ? -1.614  37.426  5.322   1.00 47.81  ? 140 CYS B CA  1 
ATOM   6759  C C   . CYS D 3 140 ? -0.939  36.302  4.572   1.00 39.03  ? 140 CYS B C   1 
ATOM   6760  O O   . CYS D 3 140 ? -0.810  36.355  3.354   1.00 38.53  ? 140 CYS B O   1 
ATOM   6761  C CB  . CYS D 3 140 ? -3.122  37.172  5.368   1.00 49.25  ? 140 CYS B CB  1 
ATOM   6762  S SG  . CYS D 3 140 ? -3.706  35.852  6.429   1.00 62.99  ? 140 CYS B SG  1 
ATOM   6763  N N   . LEU D 3 141 ? -0.495  35.283  5.286   1.00 42.04  ? 141 LEU B N   1 
ATOM   6764  C CA  . LEU D 3 141 ? 0.211   34.192  4.634   1.00 40.05  ? 141 LEU B CA  1 
ATOM   6765  C C   . LEU D 3 141 ? -0.215  32.847  5.213   1.00 40.24  ? 141 LEU B C   1 
ATOM   6766  O O   . LEU D 3 141 ? -0.177  32.635  6.420   1.00 38.25  ? 141 LEU B O   1 
ATOM   6767  C CB  . LEU D 3 141 ? 1.729   34.407  4.708   1.00 35.97  ? 141 LEU B CB  1 
ATOM   6768  C CG  . LEU D 3 141 ? 2.638   33.182  4.644   1.00 34.77  ? 141 LEU B CG  1 
ATOM   6769  C CD1 . LEU D 3 141 ? 2.625   32.569  3.276   1.00 35.38  ? 141 LEU B CD1 1 
ATOM   6770  C CD2 . LEU D 3 141 ? 4.042   33.546  5.029   1.00 34.98  ? 141 LEU B CD2 1 
ATOM   6771  N N   . LEU D 3 142 ? -0.664  31.959  4.331   1.00 39.02  ? 142 LEU B N   1 
ATOM   6772  C CA  . LEU D 3 142 ? -0.999  30.606  4.729   1.00 35.93  ? 142 LEU B CA  1 
ATOM   6773  C C   . LEU D 3 142 ? 0.095   29.703  4.182   1.00 37.75  ? 142 LEU B C   1 
ATOM   6774  O O   . LEU D 3 142 ? 0.310   29.639  2.979   1.00 32.96  ? 142 LEU B O   1 
ATOM   6775  C CB  . LEU D 3 142 ? -2.347  30.178  4.172   1.00 36.45  ? 142 LEU B CB  1 
ATOM   6776  C CG  . LEU D 3 142 ? -3.571  31.082  3.986   1.00 37.97  ? 142 LEU B CG  1 
ATOM   6777  C CD1 . LEU D 3 142 ? -4.800  30.235  4.181   1.00 39.39  ? 142 LEU B CD1 1 
ATOM   6778  C CD2 . LEU D 3 142 ? -3.629  32.297  4.862   1.00 39.55  ? 142 LEU B CD2 1 
ATOM   6779  N N   . ASN D 3 143 ? 0.802   29.015  5.067   1.00 37.95  ? 143 ASN B N   1 
ATOM   6780  C CA  . ASN D 3 143 ? 1.991   28.285  4.664   1.00 33.29  ? 143 ASN B CA  1 
ATOM   6781  C C   . ASN D 3 143 ? 1.878   26.779  4.825   1.00 33.30  ? 143 ASN B C   1 
ATOM   6782  O O   . ASN D 3 143 ? 1.446   26.283  5.850   1.00 34.58  ? 143 ASN B O   1 
ATOM   6783  C CB  . ASN D 3 143 ? 3.187   28.812  5.447   1.00 38.73  ? 143 ASN B CB  1 
ATOM   6784  C CG  . ASN D 3 143 ? 4.498   28.618  4.722   1.00 32.73  ? 143 ASN B CG  1 
ATOM   6785  O OD1 . ASN D 3 143 ? 4.580   28.740  3.496   1.00 31.58  ? 143 ASN B OD1 1 
ATOM   6786  N ND2 . ASN D 3 143 ? 5.540   28.317  5.481   1.00 34.94  ? 143 ASN B ND2 1 
ATOM   6787  N N   . ASN D 3 144 ? 2.262   26.078  3.770   1.00 32.10  ? 144 ASN B N   1 
ATOM   6788  C CA  . ASN D 3 144 ? 2.380   24.615  3.710   1.00 32.07  ? 144 ASN B CA  1 
ATOM   6789  C C   . ASN D 3 144 ? 1.146   23.821  4.041   1.00 32.97  ? 144 ASN B C   1 
ATOM   6790  O O   . ASN D 3 144 ? 1.183   22.967  4.915   1.00 38.13  ? 144 ASN B O   1 
ATOM   6791  C CB  . ASN D 3 144 ? 3.551   24.090  4.555   1.00 33.54  ? 144 ASN B CB  1 
ATOM   6792  C CG  . ASN D 3 144 ? 4.892   24.537  4.041   1.00 33.55  ? 144 ASN B CG  1 
ATOM   6793  O OD1 . ASN D 3 144 ? 5.116   25.710  3.790   1.00 33.64  ? 144 ASN B OD1 1 
ATOM   6794  N ND2 . ASN D 3 144 ? 5.783   23.595  3.861   1.00 33.30  ? 144 ASN B ND2 1 
ATOM   6795  N N   . PHE D 3 145 ? 0.072   24.084  3.317   1.00 32.96  ? 145 PHE B N   1 
ATOM   6796  C CA  . PHE D 3 145 ? -1.209  23.435  3.547   1.00 34.16  ? 145 PHE B CA  1 
ATOM   6797  C C   . PHE D 3 145 ? -1.656  22.553  2.359   1.00 37.56  ? 145 PHE B C   1 
ATOM   6798  O O   . PHE D 3 145 ? -1.237  22.756  1.206   1.00 36.43  ? 145 PHE B O   1 
ATOM   6799  C CB  . PHE D 3 145 ? -2.271  24.496  3.873   1.00 35.27  ? 145 PHE B CB  1 
ATOM   6800  C CG  . PHE D 3 145 ? -2.499  25.511  2.773   1.00 34.58  ? 145 PHE B CG  1 
ATOM   6801  C CD1 . PHE D 3 145 ? -3.528  25.338  1.841   1.00 35.05  ? 145 PHE B CD1 1 
ATOM   6802  C CD2 . PHE D 3 145 ? -1.706  26.648  2.680   1.00 33.79  ? 145 PHE B CD2 1 
ATOM   6803  C CE1 . PHE D 3 145 ? -3.754  26.273  0.833   1.00 34.76  ? 145 PHE B CE1 1 
ATOM   6804  C CE2 . PHE D 3 145 ? -1.921  27.587  1.671   1.00 33.40  ? 145 PHE B CE2 1 
ATOM   6805  C CZ  . PHE D 3 145 ? -2.948  27.400  0.753   1.00 35.84  ? 145 PHE B CZ  1 
ATOM   6806  N N   . TYR D 3 146 ? -2.487  21.557  2.648   1.00 35.05  ? 146 TYR B N   1 
ATOM   6807  C CA  . TYR D 3 146 ? -3.130  20.751  1.621   1.00 35.35  ? 146 TYR B CA  1 
ATOM   6808  C C   . TYR D 3 146 ? -4.465  20.298  2.173   1.00 37.33  ? 146 TYR B C   1 
ATOM   6809  O O   . TYR D 3 146 ? -4.544  19.833  3.312   1.00 38.35  ? 146 TYR B O   1 
ATOM   6810  C CB  . TYR D 3 146 ? -2.285  19.540  1.261   1.00 34.84  ? 146 TYR B CB  1 
ATOM   6811  C CG  . TYR D 3 146 ? -2.832  18.779  0.100   1.00 39.25  ? 146 TYR B CG  1 
ATOM   6812  C CD1 . TYR D 3 146 ? -2.466  19.118  -1.186  1.00 38.03  ? 146 TYR B CD1 1 
ATOM   6813  C CD2 . TYR D 3 146 ? -3.745  17.740  0.278   1.00 36.89  ? 146 TYR B CD2 1 
ATOM   6814  C CE1 . TYR D 3 146 ? -2.979  18.457  -2.258  1.00 38.71  ? 146 TYR B CE1 1 
ATOM   6815  C CE2 . TYR D 3 146 ? -4.251  17.059  -0.804  1.00 37.66  ? 146 TYR B CE2 1 
ATOM   6816  C CZ  . TYR D 3 146 ? -3.866  17.431  -2.075  1.00 40.49  ? 146 TYR B CZ  1 
ATOM   6817  O OH  . TYR D 3 146 ? -4.349  16.794  -3.194  1.00 41.67  ? 146 TYR B OH  1 
ATOM   6818  N N   . PRO D 3 147 ? -5.527  20.402  1.362   1.00 39.83  ? 147 PRO B N   1 
ATOM   6819  C CA  . PRO D 3 147 ? -5.529  20.747  -0.064  1.00 37.56  ? 147 PRO B CA  1 
ATOM   6820  C C   . PRO D 3 147 ? -5.493  22.242  -0.343  1.00 38.28  ? 147 PRO B C   1 
ATOM   6821  O O   . PRO D 3 147 ? -5.399  23.027  0.604   1.00 36.99  ? 147 PRO B O   1 
ATOM   6822  C CB  . PRO D 3 147 ? -6.841  20.140  -0.566  1.00 39.55  ? 147 PRO B CB  1 
ATOM   6823  C CG  . PRO D 3 147 ? -7.512  19.518  0.647   1.00 41.21  ? 147 PRO B CG  1 
ATOM   6824  C CD  . PRO D 3 147 ? -6.885  20.125  1.846   1.00 40.53  ? 147 PRO B CD  1 
ATOM   6825  N N   . ARG D 3 148 ? -5.573  22.617  -1.625  1.00 37.96  ? 148 ARG B N   1 
ATOM   6826  C CA  . ARG D 3 148 ? -5.396  24.004  -2.045  1.00 37.38  ? 148 ARG B CA  1 
ATOM   6827  C C   . ARG D 3 148 ? -6.562  24.895  -1.622  1.00 39.17  ? 148 ARG B C   1 
ATOM   6828  O O   . ARG D 3 148 ? -6.388  26.097  -1.409  1.00 38.97  ? 148 ARG B O   1 
ATOM   6829  C CB  . ARG D 3 148 ? -5.176  24.095  -3.556  1.00 37.21  ? 148 ARG B CB  1 
ATOM   6830  C CG  . ARG D 3 148 ? -4.734  25.480  -4.025  1.00 37.08  ? 148 ARG B CG  1 
ATOM   6831  C CD  . ARG D 3 148 ? -4.944  25.712  -5.528  1.00 38.63  ? 148 ARG B CD  1 
ATOM   6832  N NE  . ARG D 3 148 ? -4.015  24.939  -6.359  1.00 38.67  ? 148 ARG B NE  1 
ATOM   6833  C CZ  . ARG D 3 148 ? -4.329  23.811  -7.003  1.00 40.02  ? 148 ARG B CZ  1 
ATOM   6834  N NH1 . ARG D 3 148 ? -5.567  23.300  -6.935  1.00 41.69  ? 148 ARG B NH1 1 
ATOM   6835  N NH2 . ARG D 3 148 ? -3.399  23.188  -7.720  1.00 39.68  ? 148 ARG B NH2 1 
ATOM   6836  N N   . GLU D 3 149 ? -7.747  24.302  -1.488  1.00 41.27  ? 149 GLU B N   1 
ATOM   6837  C CA  . GLU D 3 149 ? -8.957  25.065  -1.140  1.00 43.70  ? 149 GLU B CA  1 
ATOM   6838  C C   . GLU D 3 149 ? -8.969  25.628  0.313   1.00 47.20  ? 149 GLU B C   1 
ATOM   6839  O O   . GLU D 3 149 ? -9.044  24.894  1.308   1.00 47.62  ? 149 GLU B O   1 
ATOM   6840  C CB  . GLU D 3 149 ? -10.242 24.288  -1.543  1.00 64.62  ? 149 GLU B CB  1 
ATOM   6841  C CG  . GLU D 3 149 ? -11.301 24.070  -0.448  1.00 67.16  ? 149 GLU B CG  1 
ATOM   6842  C CD  . GLU D 3 149 ? -12.695 24.665  -0.779  1.00 90.27  ? 149 GLU B CD  1 
ATOM   6843  O OE1 . GLU D 3 149 ? -12.944 25.027  -1.961  1.00 90.75  ? 149 GLU B OE1 1 
ATOM   6844  O OE2 . GLU D 3 149 ? -13.547 24.768  0.147   1.00 92.39  ? 149 GLU B OE2 1 
ATOM   6845  N N   . ALA D 3 150 ? -8.871  26.953  0.392   1.00 47.46  ? 150 ALA B N   1 
ATOM   6846  C CA  . ALA D 3 150 ? -8.788  27.687  1.647   1.00 48.50  ? 150 ALA B CA  1 
ATOM   6847  C C   . ALA D 3 150 ? -9.593  28.983  1.572   1.00 50.90  ? 150 ALA B C   1 
ATOM   6848  O O   . ALA D 3 150 ? -9.884  29.486  0.485   1.00 51.07  ? 150 ALA B O   1 
ATOM   6849  C CB  . ALA D 3 150 ? -7.355  28.008  1.950   1.00 46.21  ? 150 ALA B CB  1 
ATOM   6850  N N   . LYS D 3 151 ? -9.938  29.533  2.732   1.00 53.08  ? 151 LYS B N   1 
ATOM   6851  C CA  . LYS D 3 151 ? -10.722 30.759  2.793   1.00 55.62  ? 151 LYS B CA  1 
ATOM   6852  C C   . LYS D 3 151 ? -9.990  31.787  3.639   1.00 55.96  ? 151 LYS B C   1 
ATOM   6853  O O   . LYS D 3 151 ? -9.643  31.531  4.784   1.00 56.38  ? 151 LYS B O   1 
ATOM   6854  C CB  . LYS D 3 151 ? -12.102 30.471  3.377   1.00 59.05  ? 151 LYS B CB  1 
ATOM   6855  C CG  . LYS D 3 151 ? -13.058 31.662  3.358   1.00 61.89  ? 151 LYS B CG  1 
ATOM   6856  C CD  . LYS D 3 151 ? -14.432 31.285  3.924   1.00 65.63  ? 151 LYS B CD  1 
ATOM   6857  C CE  . LYS D 3 151 ? -15.276 32.520  4.233   1.00 68.80  ? 151 LYS B CE  1 
ATOM   6858  N NZ  . LYS D 3 151 ? -16.522 32.159  4.953   1.00 72.81  ? 151 LYS B NZ  1 
ATOM   6859  N N   . VAL D 3 152 ? -9.740  32.947  3.060   1.00 56.23  ? 152 VAL B N   1 
ATOM   6860  C CA  . VAL D 3 152 ? -8.954  33.974  3.716   1.00 56.87  ? 152 VAL B CA  1 
ATOM   6861  C C   . VAL D 3 152 ? -9.765  35.238  3.647   1.00 59.94  ? 152 VAL B C   1 
ATOM   6862  O O   . VAL D 3 152 ? -9.928  35.797  2.567   1.00 59.66  ? 152 VAL B O   1 
ATOM   6863  C CB  . VAL D 3 152 ? -7.646  34.229  2.952   1.00 54.20  ? 152 VAL B CB  1 
ATOM   6864  C CG1 . VAL D 3 152 ? -6.961  35.491  3.454   1.00 54.47  ? 152 VAL B CG1 1 
ATOM   6865  C CG2 . VAL D 3 152 ? -6.732  33.018  3.036   1.00 52.08  ? 152 VAL B CG2 1 
ATOM   6866  N N   . GLN D 3 153 ? -10.294 35.681  4.786   1.00 63.09  ? 153 GLN B N   1 
ATOM   6867  C CA  . GLN D 3 153 ? -11.167 36.851  4.812   1.00 66.11  ? 153 GLN B CA  1 
ATOM   6868  C C   . GLN D 3 153 ? -10.568 37.935  5.683   1.00 66.40  ? 153 GLN B C   1 
ATOM   6869  O O   . GLN D 3 153 ? -10.158 37.670  6.803   1.00 66.48  ? 153 GLN B O   1 
ATOM   6870  C CB  . GLN D 3 153 ? -12.577 36.475  5.287   1.00 70.31  ? 153 GLN B CB  1 
ATOM   6871  C CG  . GLN D 3 153 ? -12.633 35.308  6.274   1.00 71.14  ? 153 GLN B CG  1 
ATOM   6872  C CD  . GLN D 3 153 ? -14.026 35.108  6.871   1.00 75.56  ? 153 GLN B CD  1 
ATOM   6873  O OE1 . GLN D 3 153 ? -15.038 35.434  6.242   1.00 77.81  ? 153 GLN B OE1 1 
ATOM   6874  N NE2 . GLN D 3 153 ? -14.081 34.585  8.097   1.00 77.10  ? 153 GLN B NE2 1 
ATOM   6875  N N   . TRP D 3 154 ? -10.508 39.150  5.148   1.00 67.04  ? 154 TRP B N   1 
ATOM   6876  C CA  . TRP D 3 154 ? -9.862  40.266  5.829   1.00 57.80  ? 154 TRP B CA  1 
ATOM   6877  C C   . TRP D 3 154 ? -10.865 41.088  6.595   1.00 68.69  ? 154 TRP B C   1 
ATOM   6878  O O   . TRP D 3 154 ? -11.714 41.748  5.992   1.00 74.96  ? 154 TRP B O   1 
ATOM   6879  C CB  . TRP D 3 154 ? -9.176  41.194  4.825   1.00 58.45  ? 154 TRP B CB  1 
ATOM   6880  C CG  . TRP D 3 154 ? -7.837  40.729  4.350   1.00 52.45  ? 154 TRP B CG  1 
ATOM   6881  C CD1 . TRP D 3 154 ? -7.562  40.103  3.175   1.00 49.96  ? 154 TRP B CD1 1 
ATOM   6882  C CD2 . TRP D 3 154 ? -6.593  40.862  5.035   1.00 51.27  ? 154 TRP B CD2 1 
ATOM   6883  N NE1 . TRP D 3 154 ? -6.226  39.833  3.085   1.00 47.31  ? 154 TRP B NE1 1 
ATOM   6884  C CE2 . TRP D 3 154 ? -5.604  40.293  4.214   1.00 54.39  ? 154 TRP B CE2 1 
ATOM   6885  C CE3 . TRP D 3 154 ? -6.216  41.403  6.261   1.00 52.97  ? 154 TRP B CE3 1 
ATOM   6886  C CZ2 . TRP D 3 154 ? -4.262  40.249  4.585   1.00 46.49  ? 154 TRP B CZ2 1 
ATOM   6887  C CZ3 . TRP D 3 154 ? -4.885  41.360  6.624   1.00 51.41  ? 154 TRP B CZ3 1 
ATOM   6888  C CH2 . TRP D 3 154 ? -3.926  40.786  5.795   1.00 48.21  ? 154 TRP B CH2 1 
ATOM   6889  N N   . LYS D 3 155 ? -10.770 41.069  7.920   1.00 72.22  ? 155 LYS B N   1 
ATOM   6890  C CA  . LYS D 3 155 ? -11.642 41.897  8.744   1.00 71.64  ? 155 LYS B CA  1 
ATOM   6891  C C   . LYS D 3 155 ? -10.822 43.024  9.328   1.00 69.21  ? 155 LYS B C   1 
ATOM   6892  O O   . LYS D 3 155 ? -9.623  42.878  9.534   1.00 70.19  ? 155 LYS B O   1 
ATOM   6893  C CB  . LYS D 3 155 ? -12.270 41.067  9.866   1.00 71.88  ? 155 LYS B CB  1 
ATOM   6894  C CG  . LYS D 3 155 ? -13.365 40.109  9.411   1.00 72.09  ? 155 LYS B CG  1 
ATOM   6895  C CD  . LYS D 3 155 ? -13.441 38.878  10.310  1.00 72.48  ? 155 LYS B CD  1 
ATOM   6896  C CE  . LYS D 3 155 ? -14.782 38.153  10.173  1.00 74.81  ? 155 LYS B CE  1 
ATOM   6897  N NZ  . LYS D 3 155 ? -15.936 38.949  10.696  1.00 79.86  ? 155 LYS B NZ  1 
ATOM   6898  N N   . VAL D 3 156 ? -11.460 44.157  9.576   1.00 83.67  ? 156 VAL B N   1 
ATOM   6899  C CA  . VAL D 3 156 ? -10.807 45.235  10.311  1.00 85.28  ? 156 VAL B CA  1 
ATOM   6900  C C   . VAL D 3 156 ? -11.812 46.017  11.183  1.00 90.54  ? 156 VAL B C   1 
ATOM   6901  O O   . VAL D 3 156 ? -12.764 46.630  10.679  1.00 82.26  ? 156 VAL B O   1 
ATOM   6902  C CB  . VAL D 3 156 ? -9.955  46.143  9.386   1.00 72.17  ? 156 VAL B CB  1 
ATOM   6903  C CG1 . VAL D 3 156 ? -10.568 46.233  8.013   1.00 71.11  ? 156 VAL B CG1 1 
ATOM   6904  C CG2 . VAL D 3 156 ? -9.772  47.508  10.001  1.00 75.32  ? 156 VAL B CG2 1 
ATOM   6905  N N   . ASP D 3 157 ? -11.572 45.967  12.495  1.00 92.58  ? 157 ASP B N   1 
ATOM   6906  C CA  . ASP D 3 157 ? -12.517 46.418  13.520  1.00 97.78  ? 157 ASP B CA  1 
ATOM   6907  C C   . ASP D 3 157 ? -13.848 45.709  13.342  1.00 99.02  ? 157 ASP B C   1 
ATOM   6908  O O   . ASP D 3 157 ? -14.909 46.325  13.394  1.00 103.05 ? 157 ASP B O   1 
ATOM   6909  C CB  . ASP D 3 157 ? -12.678 47.934  13.508  1.00 91.01  ? 157 ASP B CB  1 
ATOM   6910  C CG  . ASP D 3 157 ? -11.429 48.645  13.967  1.00 90.45  ? 157 ASP B CG  1 
ATOM   6911  O OD1 . ASP D 3 157 ? -11.138 48.594  15.177  1.00 93.54  ? 157 ASP B OD1 1 
ATOM   6912  O OD2 . ASP D 3 157 ? -10.738 49.253  13.126  1.00 88.71  ? 157 ASP B OD2 1 
ATOM   6913  N N   . ASN D 3 158 ? -13.754 44.401  13.118  1.00 95.62  ? 158 ASN B N   1 
ATOM   6914  C CA  . ASN D 3 158 ? -14.897 43.540  12.839  1.00 96.43  ? 158 ASN B CA  1 
ATOM   6915  C C   . ASN D 3 158 ? -15.660 43.916  11.562  1.00 96.43  ? 158 ASN B C   1 
ATOM   6916  O O   . ASN D 3 158 ? -16.764 43.423  11.334  1.00 98.46  ? 158 ASN B O   1 
ATOM   6917  C CB  . ASN D 3 158 ? -15.845 43.464  14.048  1.00 101.66 ? 158 ASN B CB  1 
ATOM   6918  C CG  . ASN D 3 158 ? -15.589 42.240  14.935  1.00 101.09 ? 158 ASN B CG  1 
ATOM   6919  O OD1 . ASN D 3 158 ? -14.588 41.534  14.782  1.00 96.77  ? 158 ASN B OD1 1 
ATOM   6920  N ND2 . ASN D 3 158 ? -16.505 41.991  15.872  1.00 105.82 ? 158 ASN B ND2 1 
ATOM   6921  N N   . ALA D 3 159 ? -15.072 44.776  10.729  1.00 94.53  ? 159 ALA B N   1 
ATOM   6922  C CA  . ALA D 3 159 ? -15.682 45.142  9.449   1.00 94.60  ? 159 ALA B CA  1 
ATOM   6923  C C   . ALA D 3 159 ? -15.095 44.314  8.303   1.00 90.25  ? 159 ALA B C   1 
ATOM   6924  O O   . ALA D 3 159 ? -13.930 44.490  7.934   1.00 86.97  ? 159 ALA B O   1 
ATOM   6925  C CB  . ALA D 3 159 ? -15.512 46.634  9.174   1.00 95.78  ? 159 ALA B CB  1 
ATOM   6926  N N   . LEU D 3 160 ? -15.896 43.402  7.753   1.00 90.64  ? 160 LEU B N   1 
ATOM   6927  C CA  . LEU D 3 160 ? -15.463 42.562  6.633   1.00 86.84  ? 160 LEU B CA  1 
ATOM   6928  C C   . LEU D 3 160 ? -15.009 43.400  5.440   1.00 85.40  ? 160 LEU B C   1 
ATOM   6929  O O   . LEU D 3 160 ? -15.699 44.346  5.042   1.00 88.41  ? 160 LEU B O   1 
ATOM   6930  C CB  . LEU D 3 160 ? -16.588 41.621  6.192   1.00 88.15  ? 160 LEU B CB  1 
ATOM   6931  C CG  . LEU D 3 160 ? -16.441 40.140  6.522   1.00 86.40  ? 160 LEU B CG  1 
ATOM   6932  C CD1 . LEU D 3 160 ? -17.685 39.393  6.109   1.00 88.62  ? 160 LEU B CD1 1 
ATOM   6933  C CD2 . LEU D 3 160 ? -15.191 39.538  5.851   1.00 81.29  ? 160 LEU B CD2 1 
ATOM   6934  N N   . GLN D 3 161 ? -13.851 43.054  4.877   1.00 80.95  ? 161 GLN B N   1 
ATOM   6935  C CA  . GLN D 3 161 ? -13.336 43.750  3.705   1.00 79.11  ? 161 GLN B CA  1 
ATOM   6936  C C   . GLN D 3 161 ? -13.572 42.960  2.436   1.00 77.25  ? 161 GLN B C   1 
ATOM   6937  O O   . GLN D 3 161 ? -13.384 41.739  2.415   1.00 75.38  ? 161 GLN B O   1 
ATOM   6938  C CB  . GLN D 3 161 ? -11.837 44.004  3.839   1.00 75.99  ? 161 GLN B CB  1 
ATOM   6939  C CG  . GLN D 3 161 ? -11.475 45.024  4.890   1.00 77.98  ? 161 GLN B CG  1 
ATOM   6940  C CD  . GLN D 3 161 ? -11.992 46.415  4.572   1.00 80.97  ? 161 GLN B CD  1 
ATOM   6941  O OE1 . GLN D 3 161 ? -12.160 47.239  5.471   1.00 83.92  ? 161 GLN B OE1 1 
ATOM   6942  N NE2 . GLN D 3 161 ? -12.242 46.689  3.289   1.00 80.49  ? 161 GLN B NE2 1 
ATOM   6943  N N   . SER D 3 162 ? -13.961 43.657  1.371   1.00 77.95  ? 162 SER B N   1 
ATOM   6944  C CA  . SER D 3 162 ? -14.044 43.018  0.061   1.00 75.92  ? 162 SER B CA  1 
ATOM   6945  C C   . SER D 3 162 ? -13.789 43.957  -1.118  1.00 75.40  ? 162 SER B C   1 
ATOM   6946  O O   . SER D 3 162 ? -14.071 45.155  -1.047  1.00 77.89  ? 162 SER B O   1 
ATOM   6947  C CB  . SER D 3 162 ? -15.359 42.252  -0.104  1.00 78.39  ? 162 SER B CB  1 
ATOM   6948  O OG  . SER D 3 162 ? -15.297 41.027  0.609   1.00 77.16  ? 162 SER B OG  1 
ATOM   6949  N N   . GLY D 3 163 ? -13.228 43.386  -2.187  1.00 72.30  ? 163 GLY B N   1 
ATOM   6950  C CA  . GLY D 3 163 ? -12.925 44.107  -3.410  1.00 71.67  ? 163 GLY B CA  1 
ATOM   6951  C C   . GLY D 3 163 ? -11.483 44.563  -3.486  1.00 68.39  ? 163 GLY B C   1 
ATOM   6952  O O   . GLY D 3 163 ? -10.970 44.874  -4.571  1.00 67.47  ? 163 GLY B O   1 
ATOM   6953  N N   . ASN D 3 164 ? -10.821 44.589  -2.331  1.00 66.89  ? 164 ASN B N   1 
ATOM   6954  C CA  . ASN D 3 164 ? -9.500  45.197  -2.220  1.00 64.53  ? 164 ASN B CA  1 
ATOM   6955  C C   . ASN D 3 164 ? -8.402  44.226  -1.754  1.00 60.90  ? 164 ASN B C   1 
ATOM   6956  O O   . ASN D 3 164 ? -7.514  44.591  -0.982  1.00 60.18  ? 164 ASN B O   1 
ATOM   6957  C CB  . ASN D 3 164 ? -9.582  46.405  -1.285  1.00 66.71  ? 164 ASN B CB  1 
ATOM   6958  C CG  . ASN D 3 164 ? -10.096 46.036  0.090   1.00 67.92  ? 164 ASN B CG  1 
ATOM   6959  O OD1 . ASN D 3 164 ? -10.589 44.926  0.306   1.00 67.43  ? 164 ASN B OD1 1 
ATOM   6960  N ND2 . ASN D 3 164 ? -9.974  46.962  1.033   1.00 69.76  ? 164 ASN B ND2 1 
ATOM   6961  N N   . SER D 3 165 ? -8.454  42.988  -2.225  1.00 58.81  ? 165 SER B N   1 
ATOM   6962  C CA  . SER D 3 165 ? -7.468  42.015  -1.801  1.00 55.59  ? 165 SER B CA  1 
ATOM   6963  C C   . SER D 3 165 ? -7.286  40.957  -2.870  1.00 53.55  ? 165 SER B C   1 
ATOM   6964  O O   . SER D 3 165 ? -8.257  40.523  -3.489  1.00 54.77  ? 165 SER B O   1 
ATOM   6965  C CB  . SER D 3 165 ? -7.886  41.379  -0.475  1.00 56.10  ? 165 SER B CB  1 
ATOM   6966  O OG  . SER D 3 165 ? -8.790  40.315  -0.683  1.00 49.58  ? 165 SER B OG  1 
ATOM   6967  N N   . GLN D 3 166 ? -6.039  40.557  -3.089  1.00 50.74  ? 166 GLN B N   1 
ATOM   6968  C CA  . GLN D 3 166 ? -5.702  39.556  -4.095  1.00 49.05  ? 166 GLN B CA  1 
ATOM   6969  C C   . GLN D 3 166 ? -4.931  38.424  -3.459  1.00 46.73  ? 166 GLN B C   1 
ATOM   6970  O O   . GLN D 3 166 ? -4.318  38.594  -2.420  1.00 46.34  ? 166 GLN B O   1 
ATOM   6971  C CB  . GLN D 3 166 ? -4.826  40.174  -5.180  1.00 48.63  ? 166 GLN B CB  1 
ATOM   6972  C CG  . GLN D 3 166 ? -5.473  41.334  -5.915  1.00 51.22  ? 166 GLN B CG  1 
ATOM   6973  C CD  . GLN D 3 166 ? -4.450  42.194  -6.635  1.00 51.07  ? 166 GLN B CD  1 
ATOM   6974  O OE1 . GLN D 3 166 ? -3.247  41.929  -6.551  1.00 49.17  ? 166 GLN B OE1 1 
ATOM   6975  N NE2 . GLN D 3 166 ? -4.918  43.241  -7.333  1.00 53.10  ? 166 GLN B NE2 1 
ATOM   6976  N N   . GLU D 3 167 ? -4.934  37.267  -4.094  1.00 45.51  ? 167 GLU B N   1 
ATOM   6977  C CA  . GLU D 3 167 ? -4.132  36.158  -3.603  1.00 43.50  ? 167 GLU B CA  1 
ATOM   6978  C C   . GLU D 3 167 ? -3.162  35.625  -4.665  1.00 42.04  ? 167 GLU B C   1 
ATOM   6979  O O   . GLU D 3 167 ? -3.373  35.811  -5.867  1.00 42.90  ? 167 GLU B O   1 
ATOM   6980  C CB  . GLU D 3 167 ? -5.040  35.035  -3.120  1.00 44.05  ? 167 GLU B CB  1 
ATOM   6981  C CG  . GLU D 3 167 ? -5.989  35.471  -2.047  1.00 46.24  ? 167 GLU B CG  1 
ATOM   6982  C CD  . GLU D 3 167 ? -7.055  34.429  -1.719  1.00 47.75  ? 167 GLU B CD  1 
ATOM   6983  O OE1 . GLU D 3 167 ? -7.017  33.312  -2.307  1.00 46.75  ? 167 GLU B OE1 1 
ATOM   6984  O OE2 . GLU D 3 167 ? -7.939  34.750  -0.867  1.00 50.06  ? 167 GLU B OE2 1 
ATOM   6985  N N   . SER D 3 168 ? -2.086  34.984  -4.221  1.00 40.07  ? 168 SER B N   1 
ATOM   6986  C CA  . SER D 3 168 ? -1.320  34.137  -5.112  1.00 38.93  ? 168 SER B CA  1 
ATOM   6987  C C   . SER D 3 168 ? -1.162  32.803  -4.422  1.00 32.68  ? 168 SER B C   1 
ATOM   6988  O O   . SER D 3 168 ? -0.988  32.751  -3.228  1.00 45.88  ? 168 SER B O   1 
ATOM   6989  C CB  . SER D 3 168 ? 0.046   34.739  -5.437  1.00 38.30  ? 168 SER B CB  1 
ATOM   6990  O OG  . SER D 3 168 ? -0.046  36.105  -5.788  1.00 39.38  ? 168 SER B OG  1 
ATOM   6991  N N   . VAL D 3 169 ? -1.251  31.719  -5.164  1.00 32.52  ? 169 VAL B N   1 
ATOM   6992  C CA  . VAL D 3 169 ? -0.955  30.416  -4.619  1.00 31.78  ? 169 VAL B CA  1 
ATOM   6993  C C   . VAL D 3 169 ? 0.372   29.961  -5.236  1.00 30.87  ? 169 VAL B C   1 
ATOM   6994  O O   . VAL D 3 169 ? 0.678   30.304  -6.369  1.00 31.18  ? 169 VAL B O   1 
ATOM   6995  C CB  . VAL D 3 169 ? -2.071  29.409  -4.995  1.00 32.66  ? 169 VAL B CB  1 
ATOM   6996  C CG1 . VAL D 3 169 ? -1.894  28.123  -4.244  1.00 33.09  ? 169 VAL B CG1 1 
ATOM   6997  C CG2 . VAL D 3 169 ? -3.396  29.966  -4.691  1.00 34.08  ? 169 VAL B CG2 1 
ATOM   6998  N N   . THR D 3 170 ? 1.172   29.191  -4.526  1.00 30.10  ? 170 THR B N   1 
ATOM   6999  C CA  . THR D 3 170 ? 2.319   28.592  -5.203  1.00 31.93  ? 170 THR B CA  1 
ATOM   7000  C C   . THR D 3 170 ? 1.869   27.297  -5.836  1.00 32.37  ? 170 THR B C   1 
ATOM   7001  O O   . THR D 3 170 ? 0.779   26.837  -5.574  1.00 32.89  ? 170 THR B O   1 
ATOM   7002  C CB  . THR D 3 170 ? 3.507   28.321  -4.259  1.00 29.10  ? 170 THR B CB  1 
ATOM   7003  O OG1 . THR D 3 170 ? 3.148   27.331  -3.291  1.00 29.03  ? 170 THR B OG1 1 
ATOM   7004  C CG2 . THR D 3 170 ? 3.935   29.592  -3.565  1.00 29.04  ? 170 THR B CG2 1 
ATOM   7005  N N   . GLU D 3 171 ? 2.694   26.712  -6.682  1.00 32.77  ? 171 GLU B N   1 
ATOM   7006  C CA  . GLU D 3 171 ? 2.384   25.392  -7.203  1.00 33.91  ? 171 GLU B CA  1 
ATOM   7007  C C   . GLU D 3 171 ? 2.704   24.345  -6.154  1.00 34.06  ? 171 GLU B C   1 
ATOM   7008  O O   . GLU D 3 171 ? 3.324   24.652  -5.152  1.00 33.75  ? 171 GLU B O   1 
ATOM   7009  C CB  . GLU D 3 171 ? 3.196   25.125  -8.452  1.00 34.80  ? 171 GLU B CB  1 
ATOM   7010  C CG  . GLU D 3 171 ? 2.858   26.048  -9.559  1.00 36.01  ? 171 GLU B CG  1 
ATOM   7011  C CD  . GLU D 3 171 ? 1.423   25.881  -9.995  1.00 37.48  ? 171 GLU B CD  1 
ATOM   7012  O OE1 . GLU D 3 171 ? 0.987   24.714  -10.160 1.00 38.29  ? 171 GLU B OE1 1 
ATOM   7013  O OE2 . GLU D 3 171 ? 0.737   26.914  -10.161 1.00 37.93  ? 171 GLU B OE2 1 
ATOM   7014  N N   . GLN D 3 172 ? 2.298   23.106  -6.375  1.00 35.10  ? 172 GLN B N   1 
ATOM   7015  C CA  . GLN D 3 172 ? 2.543   22.075  -5.383  1.00 35.56  ? 172 GLN B CA  1 
ATOM   7016  C C   . GLN D 3 172 ? 4.034   21.863  -5.210  1.00 36.57  ? 172 GLN B C   1 
ATOM   7017  O O   . GLN D 3 172 ? 4.755   21.698  -6.202  1.00 37.29  ? 172 GLN B O   1 
ATOM   7018  C CB  . GLN D 3 172 ? 1.866   20.777  -5.796  1.00 36.20  ? 172 GLN B CB  1 
ATOM   7019  C CG  . GLN D 3 172 ? 1.599   19.838  -4.665  1.00 36.16  ? 172 GLN B CG  1 
ATOM   7020  C CD  . GLN D 3 172 ? 0.857   18.614  -5.122  1.00 37.38  ? 172 GLN B CD  1 
ATOM   7021  O OE1 . GLN D 3 172 ? 0.947   18.225  -6.293  1.00 38.46  ? 172 GLN B OE1 1 
ATOM   7022  N NE2 . GLN D 3 172 ? 0.106   17.999  -4.215  1.00 37.40  ? 172 GLN B NE2 1 
ATOM   7023  N N   . ASP D 3 173 ? 4.487   21.872  -3.953  1.00 37.23  ? 173 ASP B N   1 
ATOM   7024  C CA  . ASP D 3 173 ? 5.896   21.656  -3.615  1.00 38.60  ? 173 ASP B CA  1 
ATOM   7025  C C   . ASP D 3 173 ? 6.385   20.282  -4.068  1.00 40.65  ? 173 ASP B C   1 
ATOM   7026  O O   . ASP D 3 173 ? 5.632   19.300  -4.084  1.00 41.19  ? 173 ASP B O   1 
ATOM   7027  C CB  . ASP D 3 173 ? 6.133   21.827  -2.097  1.00 38.59  ? 173 ASP B CB  1 
ATOM   7028  C CG  . ASP D 3 173 ? 7.636   21.968  -1.724  1.00 42.02  ? 173 ASP B CG  1 
ATOM   7029  O OD1 . ASP D 3 173 ? 8.176   23.082  -1.937  1.00 42.12  ? 173 ASP B OD1 1 
ATOM   7030  O OD2 . ASP D 3 173 ? 8.264   20.993  -1.215  1.00 42.31  ? 173 ASP B OD2 1 
ATOM   7031  N N   . SER D 3 174 ? 7.661   20.204  -4.416  1.00 42.29  ? 174 SER B N   1 
ATOM   7032  C CA  . SER D 3 174 ? 8.198   18.976  -4.982  1.00 44.67  ? 174 SER B CA  1 
ATOM   7033  C C   . SER D 3 174 ? 8.569   17.951  -3.936  1.00 45.99  ? 174 SER B C   1 
ATOM   7034  O O   . SER D 3 174 ? 8.728   16.777  -4.251  1.00 47.24  ? 174 SER B O   1 
ATOM   7035  C CB  . SER D 3 174 ? 9.384   19.278  -5.889  1.00 46.02  ? 174 SER B CB  1 
ATOM   7036  O OG  . SER D 3 174 ? 8.932   19.874  -7.100  1.00 46.52  ? 174 SER B OG  1 
ATOM   7037  N N   . LYS D 3 175 ? 8.684   18.394  -2.691  1.00 46.12  ? 175 LYS B N   1 
ATOM   7038  C CA  . LYS D 3 175 ? 9.116   17.515  -1.612  1.00 47.49  ? 175 LYS B CA  1 
ATOM   7039  C C   . LYS D 3 175 ? 7.949   17.118  -0.746  1.00 47.17  ? 175 LYS B C   1 
ATOM   7040  O O   . LYS D 3 175 ? 7.667   15.936  -0.617  1.00 47.96  ? 175 LYS B O   1 
ATOM   7041  C CB  . LYS D 3 175 ? 10.208  18.181  -0.777  1.00 48.44  ? 175 LYS B CB  1 
ATOM   7042  C CG  . LYS D 3 175 ? 11.387  18.634  -1.634  1.00 49.80  ? 175 LYS B CG  1 
ATOM   7043  C CD  . LYS D 3 175 ? 12.202  19.748  -0.981  1.00 50.58  ? 175 LYS B CD  1 
ATOM   7044  C CE  . LYS D 3 175 ? 13.297  19.209  -0.050  1.00 52.69  ? 175 LYS B CE  1 
ATOM   7045  N NZ  . LYS D 3 175 ? 12.741  18.461  1.136   1.00 53.08  ? 175 LYS B NZ  1 
ATOM   7046  N N   . ASP D 3 176 ? 7.263   18.103  -0.171  1.00 46.35  ? 176 ASP B N   1 
ATOM   7047  C CA  . ASP D 3 176 ? 6.145   17.828  0.740   1.00 46.69  ? 176 ASP B CA  1 
ATOM   7048  C C   . ASP D 3 176 ? 4.726   17.925  0.105   1.00 38.38  ? 176 ASP B C   1 
ATOM   7049  O O   . ASP D 3 176 ? 3.707   17.753  0.794   1.00 38.97  ? 176 ASP B O   1 
ATOM   7050  C CB  . ASP D 3 176 ? 6.253   18.675  2.018   1.00 46.98  ? 176 ASP B CB  1 
ATOM   7051  C CG  . ASP D 3 176 ? 6.195   20.167  1.746   1.00 46.59  ? 176 ASP B CG  1 
ATOM   7052  O OD1 . ASP D 3 176 ? 6.403   20.565  0.591   1.00 46.39  ? 176 ASP B OD1 1 
ATOM   7053  O OD2 . ASP D 3 176 ? 5.954   20.961  2.679   1.00 46.80  ? 176 ASP B OD2 1 
ATOM   7054  N N   . SER D 3 177 ? 4.676   18.169  -1.205  1.00 37.48  ? 177 SER B N   1 
ATOM   7055  C CA  . SER D 3 177 ? 3.419   18.254  -1.960  1.00 36.72  ? 177 SER B CA  1 
ATOM   7056  C C   . SER D 3 177 ? 2.413   19.264  -1.430  1.00 35.99  ? 177 SER B C   1 
ATOM   7057  O O   . SER D 3 177 ? 1.234   19.066  -1.619  1.00 36.57  ? 177 SER B O   1 
ATOM   7058  C CB  . SER D 3 177 ? 2.740   16.880  -2.065  1.00 37.27  ? 177 SER B CB  1 
ATOM   7059  O OG  . SER D 3 177 ? 3.664   15.880  -2.442  1.00 37.66  ? 177 SER B OG  1 
ATOM   7060  N N   . THR D 3 178 ? 2.852   20.341  -0.780  1.00 35.20  ? 178 THR B N   1 
ATOM   7061  C CA  . THR D 3 178 ? 1.900   21.320  -0.208  1.00 34.93  ? 178 THR B CA  1 
ATOM   7062  C C   . THR D 3 178 ? 1.829   22.567  -1.065  1.00 34.05  ? 178 THR B C   1 
ATOM   7063  O O   . THR D 3 178 ? 2.562   22.686  -2.033  1.00 34.01  ? 178 THR B O   1 
ATOM   7064  C CB  . THR D 3 178 ? 2.264   21.763  1.251   1.00 38.24  ? 178 THR B CB  1 
ATOM   7065  O OG1 . THR D 3 178 ? 3.288   22.767  1.224   1.00 37.71  ? 178 THR B OG1 1 
ATOM   7066  C CG2 . THR D 3 178 ? 2.742   20.596  2.067   1.00 38.87  ? 178 THR B CG2 1 
ATOM   7067  N N   . TYR D 3 179 ? 0.951   23.498  -0.707  1.00 33.73  ? 179 TYR B N   1 
ATOM   7068  C CA  . TYR D 3 179 ? 0.849   24.773  -1.419  1.00 32.60  ? 179 TYR B CA  1 
ATOM   7069  C C   . TYR D 3 179 ? 1.013   25.870  -0.392  1.00 32.28  ? 179 TYR B C   1 
ATOM   7070  O O   . TYR D 3 179 ? 0.796   25.641  0.796   1.00 32.99  ? 179 TYR B O   1 
ATOM   7071  C CB  . TYR D 3 179 ? -0.524  24.947  -2.073  1.00 32.79  ? 179 TYR B CB  1 
ATOM   7072  C CG  . TYR D 3 179 ? -0.964  23.841  -2.984  1.00 33.00  ? 179 TYR B CG  1 
ATOM   7073  C CD1 . TYR D 3 179 ? -1.645  22.747  -2.488  1.00 33.66  ? 179 TYR B CD1 1 
ATOM   7074  C CD2 . TYR D 3 179 ? -0.736  23.902  -4.343  1.00 33.19  ? 179 TYR B CD2 1 
ATOM   7075  C CE1 . TYR D 3 179 ? -2.070  21.726  -3.313  1.00 34.50  ? 179 TYR B CE1 1 
ATOM   7076  C CE2 . TYR D 3 179 ? -1.181  22.889  -5.196  1.00 34.17  ? 179 TYR B CE2 1 
ATOM   7077  C CZ  . TYR D 3 179 ? -1.843  21.797  -4.672  1.00 34.83  ? 179 TYR B CZ  1 
ATOM   7078  O OH  . TYR D 3 179 ? -2.288  20.772  -5.492  1.00 36.02  ? 179 TYR B OH  1 
ATOM   7079  N N   . SER D 3 180 ? 1.371   27.067  -0.836  1.00 31.45  ? 180 SER B N   1 
ATOM   7080  C CA  . SER D 3 180 ? 1.359   28.202  0.070   1.00 31.59  ? 180 SER B CA  1 
ATOM   7081  C C   . SER D 3 180 ? 0.694   29.407  -0.575  1.00 31.85  ? 180 SER B C   1 
ATOM   7082  O O   . SER D 3 180 ? 0.803   29.618  -1.775  1.00 31.53  ? 180 SER B O   1 
ATOM   7083  C CB  . SER D 3 180 ? 2.765   28.524  0.561   1.00 29.96  ? 180 SER B CB  1 
ATOM   7084  O OG  . SER D 3 180 ? 3.318   27.392  1.204   1.00 30.01  ? 180 SER B OG  1 
ATOM   7085  N N   . LEU D 3 181 ? 0.009   30.194  0.234   1.00 31.58  ? 181 LEU B N   1 
ATOM   7086  C CA  . LEU D 3 181 ? -0.808  31.272  -0.273  1.00 35.85  ? 181 LEU B CA  1 
ATOM   7087  C C   . LEU D 3 181 ? -0.535  32.605  0.418   1.00 36.79  ? 181 LEU B C   1 
ATOM   7088  O O   . LEU D 3 181 ? -0.421  32.675  1.654   1.00 37.58  ? 181 LEU B O   1 
ATOM   7089  C CB  . LEU D 3 181 ? -2.277  30.906  -0.067  1.00 36.98  ? 181 LEU B CB  1 
ATOM   7090  C CG  . LEU D 3 181 ? -3.338  31.857  -0.600  1.00 38.33  ? 181 LEU B CG  1 
ATOM   7091  C CD1 . LEU D 3 181 ? -4.467  31.012  -1.084  1.00 35.82  ? 181 LEU B CD1 1 
ATOM   7092  C CD2 . LEU D 3 181 ? -3.811  32.813  0.462   1.00 36.39  ? 181 LEU B CD2 1 
ATOM   7093  N N   . SER D 3 182 ? -0.468  33.666  -0.379  1.00 36.80  ? 182 SER B N   1 
ATOM   7094  C CA  . SER D 3 182 ? -0.343  35.013  0.154   1.00 37.45  ? 182 SER B CA  1 
ATOM   7095  C C   . SER D 3 182 ? -1.570  35.793  -0.245  1.00 38.67  ? 182 SER B C   1 
ATOM   7096  O O   . SER D 3 182 ? -1.992  35.742  -1.400  1.00 38.62  ? 182 SER B O   1 
ATOM   7097  C CB  . SER D 3 182 ? 0.894   35.701  -0.413  1.00 36.76  ? 182 SER B CB  1 
ATOM   7098  O OG  . SER D 3 182 ? 0.633   36.309  -1.667  1.00 36.96  ? 182 SER B OG  1 
ATOM   7099  N N   . SER D 3 183 ? -2.151  36.512  0.704   1.00 40.26  ? 183 SER B N   1 
ATOM   7100  C CA  . SER D 3 183 ? -3.269  37.387  0.400   1.00 38.74  ? 183 SER B CA  1 
ATOM   7101  C C   . SER D 3 183 ? -2.885  38.821  0.717   1.00 39.74  ? 183 SER B C   1 
ATOM   7102  O O   . SER D 3 183 ? -2.425  39.099  1.806   1.00 40.27  ? 183 SER B O   1 
ATOM   7103  C CB  . SER D 3 183 ? -4.480  36.981  1.214   1.00 40.46  ? 183 SER B CB  1 
ATOM   7104  O OG  . SER D 3 183 ? -5.481  37.966  1.099   1.00 42.65  ? 183 SER B OG  1 
ATOM   7105  N N   . THR D 3 184 ? -3.049  39.735  -0.229  1.00 40.25  ? 184 THR B N   1 
ATOM   7106  C CA  . THR D 3 184 ? -2.593  41.105  0.002   1.00 41.26  ? 184 THR B CA  1 
ATOM   7107  C C   . THR D 3 184 ? -3.719  42.144  -0.030  1.00 52.51  ? 184 THR B C   1 
ATOM   7108  O O   . THR D 3 184 ? -4.293  42.466  -1.091  1.00 52.99  ? 184 THR B O   1 
ATOM   7109  C CB  . THR D 3 184 ? -1.452  41.505  -0.955  1.00 39.99  ? 184 THR B CB  1 
ATOM   7110  O OG1 . THR D 3 184 ? -0.376  40.581  -0.808  1.00 38.11  ? 184 THR B OG1 1 
ATOM   7111  C CG2 . THR D 3 184 ? -0.948  42.901  -0.654  1.00 41.24  ? 184 THR B CG2 1 
ATOM   7112  N N   . LEU D 3 185 ? -4.029  42.660  1.156   1.00 54.24  ? 185 LEU B N   1 
ATOM   7113  C CA  . LEU D 3 185 ? -5.039  43.692  1.310   1.00 57.14  ? 185 LEU B CA  1 
ATOM   7114  C C   . LEU D 3 185 ? -4.352  45.029  1.189   1.00 58.02  ? 185 LEU B C   1 
ATOM   7115  O O   . LEU D 3 185 ? -3.559  45.409  2.056   1.00 58.34  ? 185 LEU B O   1 
ATOM   7116  C CB  . LEU D 3 185 ? -5.701  43.584  2.680   1.00 59.38  ? 185 LEU B CB  1 
ATOM   7117  C CG  . LEU D 3 185 ? -6.602  44.765  3.048   1.00 63.02  ? 185 LEU B CG  1 
ATOM   7118  C CD1 . LEU D 3 185 ? -7.832  44.727  2.189   1.00 64.51  ? 185 LEU B CD1 1 
ATOM   7119  C CD2 . LEU D 3 185 ? -6.970  44.760  4.518   1.00 65.24  ? 185 LEU B CD2 1 
ATOM   7120  N N   . THR D 3 186 ? -4.644  45.742  0.113   1.00 58.76  ? 186 THR B N   1 
ATOM   7121  C CA  . THR D 3 186 ? -3.955  46.993  -0.155  1.00 59.59  ? 186 THR B CA  1 
ATOM   7122  C C   . THR D 3 186 ? -4.860  48.201  0.041   1.00 62.92  ? 186 THR B C   1 
ATOM   7123  O O   . THR D 3 186 ? -5.869  48.351  -0.642  1.00 64.34  ? 186 THR B O   1 
ATOM   7124  C CB  . THR D 3 186 ? -3.327  46.986  -1.552  1.00 58.16  ? 186 THR B CB  1 
ATOM   7125  O OG1 . THR D 3 186 ? -4.153  46.215  -2.429  1.00 57.97  ? 186 THR B OG1 1 
ATOM   7126  C CG2 . THR D 3 186 ? -1.961  46.313  -1.507  1.00 55.64  ? 186 THR B CG2 1 
ATOM   7127  N N   . LEU D 3 187 ? -4.496  49.044  1.005   1.00 64.58  ? 187 LEU B N   1 
ATOM   7128  C CA  . LEU D 3 187 ? -5.221  50.279  1.292   1.00 68.14  ? 187 LEU B CA  1 
ATOM   7129  C C   . LEU D 3 187 ? -4.304  51.483  1.118   1.00 69.25  ? 187 LEU B C   1 
ATOM   7130  O O   . LEU D 3 187 ? -3.080  51.355  1.159   1.00 67.41  ? 187 LEU B O   1 
ATOM   7131  C CB  . LEU D 3 187 ? -5.743  50.281  2.727   1.00 70.04  ? 187 LEU B CB  1 
ATOM   7132  C CG  . LEU D 3 187 ? -6.162  48.945  3.325   1.00 68.86  ? 187 LEU B CG  1 
ATOM   7133  C CD1 . LEU D 3 187 ? -6.615  49.155  4.751   1.00 71.71  ? 187 LEU B CD1 1 
ATOM   7134  C CD2 . LEU D 3 187 ? -7.264  48.313  2.502   1.00 68.89  ? 187 LEU B CD2 1 
ATOM   7135  N N   . SER D 3 188 ? -4.901  52.656  0.932   1.00 72.53  ? 188 SER B N   1 
ATOM   7136  C CA  . SER D 3 188 ? -4.138  53.893  0.869   1.00 74.14  ? 188 SER B CA  1 
ATOM   7137  C C   . SER D 3 188 ? -3.563  54.189  2.248   1.00 75.54  ? 188 SER B C   1 
ATOM   7138  O O   . SER D 3 188 ? -4.081  53.701  3.262   1.00 76.24  ? 188 SER B O   1 
ATOM   7139  C CB  . SER D 3 188 ? -5.040  55.048  0.455   1.00 77.70  ? 188 SER B CB  1 
ATOM   7140  O OG  . SER D 3 188 ? -5.785  55.512  1.570   1.00 81.01  ? 188 SER B OG  1 
ATOM   7141  N N   . LYS D 3 189 ? -2.495  54.988  2.277   1.00 76.32  ? 189 LYS B N   1 
ATOM   7142  C CA  . LYS D 3 189 ? -1.903  55.448  3.528   1.00 78.40  ? 189 LYS B CA  1 
ATOM   7143  C C   . LYS D 3 189 ? -2.962  56.094  4.401   1.00 82.21  ? 189 LYS B C   1 
ATOM   7144  O O   . LYS D 3 189 ? -3.209  55.645  5.521   1.00 83.05  ? 189 LYS B O   1 
ATOM   7145  C CB  . LYS D 3 189 ? -0.785  56.459  3.260   1.00 79.36  ? 189 LYS B CB  1 
ATOM   7146  C CG  . LYS D 3 189 ? -0.247  57.139  4.518   1.00 82.23  ? 189 LYS B CG  1 
ATOM   7147  C CD  . LYS D 3 189 ? 0.571   58.378  4.174   1.00 84.12  ? 189 LYS B CD  1 
ATOM   7148  C CE  . LYS D 3 189 ? 1.078   59.094  5.426   1.00 87.60  ? 189 LYS B CE  1 
ATOM   7149  N NZ  . LYS D 3 189 ? 1.990   58.234  6.232   1.00 86.32  ? 189 LYS B NZ  1 
ATOM   7150  N N   . ALA D 3 190 ? -3.589  57.140  3.863   1.00 84.81  ? 190 ALA B N   1 
ATOM   7151  C CA  . ALA D 3 190 ? -4.592  57.939  4.573   1.00 89.24  ? 190 ALA B CA  1 
ATOM   7152  C C   . ALA D 3 190 ? -5.696  57.099  5.230   1.00 90.00  ? 190 ALA B C   1 
ATOM   7153  O O   . ALA D 3 190 ? -6.137  57.390  6.345   1.00 93.07  ? 190 ALA B O   1 
ATOM   7154  C CB  . ALA D 3 190 ? -5.198  58.969  3.624   1.00 91.23  ? 190 ALA B CB  1 
ATOM   7155  N N   . ASP D 3 191 ? -6.115  56.047  4.532   1.00 87.17  ? 191 ASP B N   1 
ATOM   7156  C CA  . ASP D 3 191 ? -7.207  55.180  4.973   1.00 87.76  ? 191 ASP B CA  1 
ATOM   7157  C C   . ASP D 3 191 ? -6.772  54.173  6.052   1.00 86.58  ? 191 ASP B C   1 
ATOM   7158  O O   . ASP D 3 191 ? -7.548  53.836  6.950   1.00 88.73  ? 191 ASP B O   1 
ATOM   7159  C CB  . ASP D 3 191 ? -7.790  54.443  3.757   1.00 85.61  ? 191 ASP B CB  1 
ATOM   7160  C CG  . ASP D 3 191 ? -9.261  54.119  3.916   1.00 88.15  ? 191 ASP B CG  1 
ATOM   7161  O OD1 . ASP D 3 191 ? -10.105 55.001  3.621   1.00 91.52  ? 191 ASP B OD1 1 
ATOM   7162  O OD2 . ASP D 3 191 ? -9.567  52.976  4.329   1.00 86.95  ? 191 ASP B OD2 1 
ATOM   7163  N N   . TYR D 3 192 ? -5.532  53.701  5.948   1.00 83.75  ? 192 TYR B N   1 
ATOM   7164  C CA  . TYR D 3 192 ? -4.973  52.721  6.881   1.00 82.94  ? 192 TYR B CA  1 
ATOM   7165  C C   . TYR D 3 192 ? -4.933  53.239  8.322   1.00 86.25  ? 192 TYR B C   1 
ATOM   7166  O O   . TYR D 3 192 ? -5.136  52.480  9.278   1.00 86.80  ? 192 TYR B O   1 
ATOM   7167  C CB  . TYR D 3 192 ? -3.565  52.288  6.405   1.00 79.86  ? 192 TYR B CB  1 
ATOM   7168  C CG  . TYR D 3 192 ? -2.713  51.487  7.392   1.00 79.23  ? 192 TYR B CG  1 
ATOM   7169  C CD1 . TYR D 3 192 ? -1.632  52.075  8.046   1.00 80.43  ? 192 TYR B CD1 1 
ATOM   7170  C CD2 . TYR D 3 192 ? -2.971  50.142  7.640   1.00 77.57  ? 192 TYR B CD2 1 
ATOM   7171  C CE1 . TYR D 3 192 ? -0.848  51.351  8.933   1.00 79.92  ? 192 TYR B CE1 1 
ATOM   7172  C CE2 . TYR D 3 192 ? -2.192  49.411  8.530   1.00 76.95  ? 192 TYR B CE2 1 
ATOM   7173  C CZ  . TYR D 3 192 ? -1.133  50.021  9.170   1.00 78.24  ? 192 TYR B CZ  1 
ATOM   7174  O OH  . TYR D 3 192 ? -0.360  49.298  10.049  1.00 78.12  ? 192 TYR B OH  1 
ATOM   7175  N N   . GLU D 3 193 ? -4.676  54.533  8.473   1.00 88.61  ? 193 GLU B N   1 
ATOM   7176  C CA  . GLU D 3 193 ? -4.554  55.128  9.798   1.00 92.16  ? 193 GLU B CA  1 
ATOM   7177  C C   . GLU D 3 193 ? -5.919  55.450  10.408  1.00 95.98  ? 193 GLU B C   1 
ATOM   7178  O O   . GLU D 3 193 ? -5.995  55.913  11.547  1.00 99.57  ? 193 GLU B O   1 
ATOM   7179  C CB  . GLU D 3 193 ? -3.691  56.392  9.739   1.00 93.85  ? 193 GLU B CB  1 
ATOM   7180  C CG  . GLU D 3 193 ? -2.289  56.169  9.186   1.00 90.33  ? 193 GLU B CG  1 
ATOM   7181  C CD  . GLU D 3 193 ? -1.528  57.468  8.960   1.00 91.96  ? 193 GLU B CD  1 
ATOM   7182  O OE1 . GLU D 3 193 ? -1.941  58.514  9.514   1.00 96.12  ? 193 GLU B OE1 1 
ATOM   7183  O OE2 . GLU D 3 193 ? -0.517  57.444  8.220   1.00 89.33  ? 193 GLU B OE2 1 
ATOM   7184  N N   . LYS D 3 194 ? -6.988  55.213  9.645   1.00 95.51  ? 194 LYS B N   1 
ATOM   7185  C CA  . LYS D 3 194 ? -8.352  55.422  10.138  1.00 99.46  ? 194 LYS B CA  1 
ATOM   7186  C C   . LYS D 3 194 ? -8.774  54.314  11.107  1.00 99.86  ? 194 LYS B C   1 
ATOM   7187  O O   . LYS D 3 194 ? -9.449  54.574  12.105  1.00 104.51 ? 194 LYS B O   1 
ATOM   7188  C CB  . LYS D 3 194 ? -9.359  55.526  8.982   1.00 99.17  ? 194 LYS B CB  1 
ATOM   7189  C CG  . LYS D 3 194 ? -9.191  56.757  8.102   1.00 99.71  ? 194 LYS B CG  1 
ATOM   7190  C CD  . LYS D 3 194 ? -10.498 57.154  7.406   1.00 102.01 ? 194 LYS B CD  1 
ATOM   7191  C CE  . LYS D 3 194 ? -10.979 56.105  6.408   1.00 98.71  ? 194 LYS B CE  1 
ATOM   7192  N NZ  . LYS D 3 194 ? -12.193 56.542  5.650   1.00 101.33 ? 194 LYS B NZ  1 
ATOM   7193  N N   . HIS D 3 195 ? -8.366  53.084  10.811  1.00 95.09  ? 195 HIS B N   1 
ATOM   7194  C CA  . HIS D 3 195 ? -8.711  51.944  11.647  1.00 94.69  ? 195 HIS B CA  1 
ATOM   7195  C C   . HIS D 3 195 ? -7.536  51.517  12.530  1.00 93.02  ? 195 HIS B C   1 
ATOM   7196  O O   . HIS D 3 195 ? -6.418  52.004  12.363  1.00 91.33  ? 195 HIS B O   1 
ATOM   7197  C CB  . HIS D 3 195 ? -9.183  50.785  10.776  1.00 91.42  ? 195 HIS B CB  1 
ATOM   7198  C CG  . HIS D 3 195 ? -10.505 51.021  10.110  1.00 93.45  ? 195 HIS B CG  1 
ATOM   7199  N ND1 . HIS D 3 195 ? -11.710 50.832  10.756  1.00 97.30  ? 195 HIS B ND1 1 
ATOM   7200  C CD2 . HIS D 3 195 ? -10.811 51.414  8.851   1.00 92.39  ? 195 HIS B CD2 1 
ATOM   7201  C CE1 . HIS D 3 195 ? -12.700 51.104  9.925   1.00 98.53  ? 195 HIS B CE1 1 
ATOM   7202  N NE2 . HIS D 3 195 ? -12.182 51.459  8.763   1.00 95.62  ? 195 HIS B NE2 1 
ATOM   7203  N N   . LYS D 3 196 ? -7.787  50.609  13.469  1.00 93.92  ? 196 LYS B N   1 
ATOM   7204  C CA  . LYS D 3 196 ? -6.782  50.280  14.478  1.00 94.09  ? 196 LYS B CA  1 
ATOM   7205  C C   . LYS D 3 196 ? -6.382  48.805  14.528  1.00 90.69  ? 196 LYS B C   1 
ATOM   7206  O O   . LYS D 3 196 ? -5.195  48.488  14.649  1.00 88.48  ? 196 LYS B O   1 
ATOM   7207  C CB  . LYS D 3 196 ? -7.228  50.760  15.866  1.00 90.95  ? 196 LYS B CB  1 
ATOM   7208  C CG  . LYS D 3 196 ? -7.008  52.261  16.119  1.00 100.12 ? 196 LYS B CG  1 
ATOM   7209  C CD  . LYS D 3 196 ? -8.082  53.151  15.470  1.00 102.18 ? 196 LYS B CD  1 
ATOM   7210  C CE  . LYS D 3 196 ? -7.634  54.613  15.390  1.00 98.73  ? 196 LYS B CE  1 
ATOM   7211  N NZ  . LYS D 3 196 ? -8.643  55.506  14.747  1.00 101.01 ? 196 LYS B NZ  1 
ATOM   7212  N N   . VAL D 3 197 ? -7.360  47.907  14.444  1.00 90.54  ? 197 VAL B N   1 
ATOM   7213  C CA  . VAL D 3 197 ? -7.069  46.471  14.475  1.00 87.67  ? 197 VAL B CA  1 
ATOM   7214  C C   . VAL D 3 197 ? -7.375  45.771  13.143  1.00 83.63  ? 197 VAL B C   1 
ATOM   7215  O O   . VAL D 3 197 ? -8.518  45.742  12.688  1.00 84.87  ? 197 VAL B O   1 
ATOM   7216  C CB  . VAL D 3 197 ? -7.778  45.749  15.663  1.00 86.35  ? 197 VAL B CB  1 
ATOM   7217  C CG1 . VAL D 3 197 ? -9.239  46.135  15.737  1.00 90.22  ? 197 VAL B CG1 1 
ATOM   7218  C CG2 . VAL D 3 197 ? -7.623  44.238  15.557  1.00 83.23  ? 197 VAL B CG2 1 
ATOM   7219  N N   . TYR D 3 198 ? -6.333  45.225  12.520  1.00 79.01  ? 198 TYR B N   1 
ATOM   7220  C CA  . TYR D 3 198 ? -6.459  44.480  11.267  1.00 74.79  ? 198 TYR B CA  1 
ATOM   7221  C C   . TYR D 3 198 ? -6.281  42.979  11.527  1.00 72.73  ? 198 TYR B C   1 
ATOM   7222  O O   . TYR D 3 198 ? -5.398  42.564  12.279  1.00 72.36  ? 198 TYR B O   1 
ATOM   7223  C CB  . TYR D 3 198 ? -5.435  44.979  10.225  1.00 71.47  ? 198 TYR B CB  1 
ATOM   7224  C CG  . TYR D 3 198 ? -5.617  46.433  9.815   1.00 73.01  ? 198 TYR B CG  1 
ATOM   7225  C CD1 . TYR D 3 198 ? -6.324  46.773  8.664   1.00 72.34  ? 198 TYR B CD1 1 
ATOM   7226  C CD2 . TYR D 3 198 ? -5.094  47.469  10.590  1.00 75.39  ? 198 TYR B CD2 1 
ATOM   7227  C CE1 . TYR D 3 198 ? -6.504  48.109  8.297   1.00 74.07  ? 198 TYR B CE1 1 
ATOM   7228  C CE2 . TYR D 3 198 ? -5.270  48.804  10.232  1.00 77.05  ? 198 TYR B CE2 1 
ATOM   7229  C CZ  . TYR D 3 198 ? -5.975  49.117  9.089   1.00 76.33  ? 198 TYR B CZ  1 
ATOM   7230  O OH  . TYR D 3 198 ? -6.144  50.437  8.741   1.00 78.23  ? 198 TYR B OH  1 
ATOM   7231  N N   . ALA D 3 199 ? -7.123  42.168  10.903  1.00 71.77  ? 199 ALA B N   1 
ATOM   7232  C CA  . ALA D 3 199 ? -7.112  40.741  11.146  1.00 62.38  ? 199 ALA B CA  1 
ATOM   7233  C C   . ALA D 3 199 ? -7.423  40.021  9.857   1.00 62.56  ? 199 ALA B C   1 
ATOM   7234  O O   . ALA D 3 199 ? -8.074  40.580  8.983   1.00 59.67  ? 199 ALA B O   1 
ATOM   7235  C CB  . ALA D 3 199 ? -8.158  40.384  12.199  1.00 66.15  ? 199 ALA B CB  1 
ATOM   7236  N N   . CYS D 3 200 ? -6.966  38.778  9.743   1.00 60.04  ? 200 CYS B N   1 
ATOM   7237  C CA  . CYS D 3 200 ? -7.424  37.891  8.675   1.00 57.91  ? 200 CYS B CA  1 
ATOM   7238  C C   . CYS D 3 200 ? -7.850  36.532  9.243   1.00 58.04  ? 200 CYS B C   1 
ATOM   7239  O O   . CYS D 3 200 ? -7.089  35.890  9.955   1.00 57.30  ? 200 CYS B O   1 
ATOM   7240  C CB  . CYS D 3 200 ? -6.368  37.747  7.557   1.00 54.32  ? 200 CYS B CB  1 
ATOM   7241  S SG  . CYS D 3 200 ? -4.982  36.591  7.838   1.00 81.86  ? 200 CYS B SG  1 
ATOM   7242  N N   . GLU D 3 201 ? -9.082  36.117  8.952   1.00 59.28  ? 201 GLU B N   1 
ATOM   7243  C CA  . GLU D 3 201 ? -9.570  34.811  9.392   1.00 59.80  ? 201 GLU B CA  1 
ATOM   7244  C C   . GLU D 3 201 ? -9.352  33.764  8.318   1.00 56.00  ? 201 GLU B C   1 
ATOM   7245  O O   . GLU D 3 201 ? -9.800  33.929  7.189   1.00 55.20  ? 201 GLU B O   1 
ATOM   7246  C CB  . GLU D 3 201 ? -11.065 34.851  9.733   1.00 64.20  ? 201 GLU B CB  1 
ATOM   7247  C CG  . GLU D 3 201 ? -11.424 35.582  11.009  1.00 68.66  ? 201 GLU B CG  1 
ATOM   7248  C CD  . GLU D 3 201 ? -12.601 34.932  11.739  1.00 72.81  ? 201 GLU B CD  1 
ATOM   7249  O OE1 . GLU D 3 201 ? -12.499 33.716  12.033  1.00 72.45  ? 201 GLU B OE1 1 
ATOM   7250  O OE2 . GLU D 3 201 ? -13.615 35.626  12.014  1.00 76.48  ? 201 GLU B OE2 1 
ATOM   7251  N N   . VAL D 3 202 ? -8.698  32.674  8.683   1.00 54.20  ? 202 VAL B N   1 
ATOM   7252  C CA  . VAL D 3 202 ? -8.449  31.595  7.743   1.00 50.34  ? 202 VAL B CA  1 
ATOM   7253  C C   . VAL D 3 202 ? -9.298  30.400  8.103   1.00 51.88  ? 202 VAL B C   1 
ATOM   7254  O O   . VAL D 3 202 ? -9.366  30.023  9.261   1.00 53.73  ? 202 VAL B O   1 
ATOM   7255  C CB  . VAL D 3 202 ? -6.970  31.126  7.780   1.00 52.03  ? 202 VAL B CB  1 
ATOM   7256  C CG1 . VAL D 3 202 ? -6.777  29.891  6.920   1.00 49.08  ? 202 VAL B CG1 1 
ATOM   7257  C CG2 . VAL D 3 202 ? -6.029  32.237  7.369   1.00 46.06  ? 202 VAL B CG2 1 
ATOM   7258  N N   . THR D 3 203 ? -9.939  29.797  7.110   1.00 52.55  ? 203 THR B N   1 
ATOM   7259  C CA  . THR D 3 203 ? -10.692 28.572  7.331   1.00 52.81  ? 203 THR B CA  1 
ATOM   7260  C C   . THR D 3 203 ? -10.254 27.559  6.284   1.00 50.18  ? 203 THR B C   1 
ATOM   7261  O O   . THR D 3 203 ? -9.980  27.935  5.148   1.00 50.17  ? 203 THR B O   1 
ATOM   7262  C CB  . THR D 3 203 ? -12.232 28.822  7.346   1.00 58.23  ? 203 THR B CB  1 
ATOM   7263  O OG1 . THR D 3 203 ? -12.905 27.829  6.568   1.00 58.43  ? 203 THR B OG1 1 
ATOM   7264  C CG2 . THR D 3 203 ? -12.577 30.217  6.823   1.00 57.01  ? 203 THR B CG2 1 
ATOM   7265  N N   . HIS D 3 204 ? -10.163 26.290  6.685   1.00 50.23  ? 204 HIS B N   1 
ATOM   7266  C CA  . HIS D 3 204 ? -9.508  25.233  5.906   1.00 47.84  ? 204 HIS B CA  1 
ATOM   7267  C C   . HIS D 3 204 ? -9.713  23.904  6.645   1.00 49.08  ? 204 HIS B C   1 
ATOM   7268  O O   . HIS D 3 204 ? -9.762  23.883  7.872   1.00 50.83  ? 204 HIS B O   1 
ATOM   7269  C CB  . HIS D 3 204 ? -8.004  25.560  5.739   1.00 49.69  ? 204 HIS B CB  1 
ATOM   7270  C CG  . HIS D 3 204 ? -7.195  24.488  5.063   1.00 42.77  ? 204 HIS B CG  1 
ATOM   7271  N ND1 . HIS D 3 204 ? -6.552  23.487  5.761   1.00 42.56  ? 204 HIS B ND1 1 
ATOM   7272  C CD2 . HIS D 3 204 ? -6.888  24.290  3.758   1.00 41.04  ? 204 HIS B CD2 1 
ATOM   7273  C CE1 . HIS D 3 204 ? -5.912  22.706  4.912   1.00 42.99  ? 204 HIS B CE1 1 
ATOM   7274  N NE2 . HIS D 3 204 ? -6.103  23.167  3.687   1.00 41.38  ? 204 HIS B NE2 1 
ATOM   7275  N N   . GLN D 3 205 ? -9.828  22.795  5.920   1.00 48.49  ? 205 GLN B N   1 
ATOM   7276  C CA  . GLN D 3 205 ? -10.205 21.546  6.576   1.00 50.24  ? 205 GLN B CA  1 
ATOM   7277  C C   . GLN D 3 205 ? -9.165  20.943  7.522   1.00 49.75  ? 205 GLN B C   1 
ATOM   7278  O O   . GLN D 3 205 ? -9.477  20.011  8.255   1.00 51.80  ? 205 GLN B O   1 
ATOM   7279  C CB  . GLN D 3 205 ? -10.675 20.504  5.570   1.00 50.33  ? 205 GLN B CB  1 
ATOM   7280  C CG  . GLN D 3 205 ? -9.648  20.125  4.575   1.00 47.93  ? 205 GLN B CG  1 
ATOM   7281  C CD  . GLN D 3 205 ? -10.191 19.149  3.564   1.00 48.89  ? 205 GLN B CD  1 
ATOM   7282  O OE1 . GLN D 3 205 ? -10.096 17.931  3.760   1.00 49.55  ? 205 GLN B OE1 1 
ATOM   7283  N NE2 . GLN D 3 205 ? -10.780 19.675  2.467   1.00 49.04  ? 205 GLN B NE2 1 
ATOM   7284  N N   . GLY D 3 206 ? -7.936  21.449  7.508   1.00 47.39  ? 206 GLY B N   1 
ATOM   7285  C CA  . GLY D 3 206 ? -6.958  21.021  8.490   1.00 47.07  ? 206 GLY B CA  1 
ATOM   7286  C C   . GLY D 3 206 ? -7.196  21.706  9.823   1.00 49.42  ? 206 GLY B C   1 
ATOM   7287  O O   . GLY D 3 206 ? -6.794  21.223  10.880  1.00 50.68  ? 206 GLY B O   1 
ATOM   7288  N N   . LEU D 3 207 ? -7.846  22.859  9.757   1.00 50.27  ? 207 LEU B N   1 
ATOM   7289  C CA  . LEU D 3 207 ? -8.179  23.621  10.943  1.00 52.92  ? 207 LEU B CA  1 
ATOM   7290  C C   . LEU D 3 207 ? -9.589  23.244  11.439  1.00 58.19  ? 207 LEU B C   1 
ATOM   7291  O O   . LEU D 3 207 ? -10.576 23.363  10.704  1.00 58.79  ? 207 LEU B O   1 
ATOM   7292  C CB  . LEU D 3 207 ? -8.086  25.119  10.633  1.00 52.82  ? 207 LEU B CB  1 
ATOM   7293  C CG  . LEU D 3 207 ? -6.767  25.678  10.086  1.00 49.21  ? 207 LEU B CG  1 
ATOM   7294  C CD1 . LEU D 3 207 ? -7.009  26.953  9.274   1.00 48.45  ? 207 LEU B CD1 1 
ATOM   7295  C CD2 . LEU D 3 207 ? -5.775  25.939  11.202  1.00 49.79  ? 207 LEU B CD2 1 
ATOM   7296  N N   . SER D 3 208 ? -9.671  22.762  12.672  1.00 59.06  ? 208 SER B N   1 
ATOM   7297  C CA  . SER D 3 208 ? -10.947 22.411  13.282  1.00 67.97  ? 208 SER B CA  1 
ATOM   7298  C C   . SER D 3 208 ? -11.836 23.648  13.340  1.00 69.99  ? 208 SER B C   1 
ATOM   7299  O O   . SER D 3 208 ? -12.984 23.643  12.907  1.00 71.81  ? 208 SER B O   1 
ATOM   7300  C CB  . SER D 3 208 ? -10.704 21.889  14.695  1.00 70.69  ? 208 SER B CB  1 
ATOM   7301  O OG  . SER D 3 208 ? -9.850  22.777  15.403  1.00 70.69  ? 208 SER B OG  1 
ATOM   7302  N N   . SER D 3 209 ? -11.280 24.718  13.881  1.00 69.98  ? 209 SER B N   1 
ATOM   7303  C CA  . SER D 3 209 ? -11.965 25.990  13.945  1.00 71.95  ? 209 SER B CA  1 
ATOM   7304  C C   . SER D 3 209 ? -11.110 27.016  13.215  1.00 68.88  ? 209 SER B C   1 
ATOM   7305  O O   . SER D 3 209 ? -9.880  26.963  13.291  1.00 66.54  ? 209 SER B O   1 
ATOM   7306  C CB  . SER D 3 209 ? -12.159 26.399  15.407  1.00 75.88  ? 209 SER B CB  1 
ATOM   7307  O OG  . SER D 3 209 ? -12.362 27.793  15.517  1.00 77.05  ? 209 SER B OG  1 
ATOM   7308  N N   . PRO D 3 210 ? -11.756 27.946  12.494  1.00 69.07  ? 210 PRO B N   1 
ATOM   7309  C CA  . PRO D 3 210 ? -11.056 29.025  11.785  1.00 66.41  ? 210 PRO B CA  1 
ATOM   7310  C C   . PRO D 3 210 ? -10.074 29.778  12.689  1.00 66.76  ? 210 PRO B C   1 
ATOM   7311  O O   . PRO D 3 210 ? -10.440 30.182  13.806  1.00 70.10  ? 210 PRO B O   1 
ATOM   7312  C CB  . PRO D 3 210 ? -12.195 29.960  11.370  1.00 68.57  ? 210 PRO B CB  1 
ATOM   7313  C CG  . PRO D 3 210 ? -13.391 29.077  11.267  1.00 70.81  ? 210 PRO B CG  1 
ATOM   7314  C CD  . PRO D 3 210 ? -13.218 28.006  12.306  1.00 72.02  ? 210 PRO B CD  1 
ATOM   7315  N N   . VAL D 3 211 ? -8.840  29.954  12.218  1.00 63.71  ? 211 VAL B N   1 
ATOM   7316  C CA  . VAL D 3 211 ? -7.868  30.755  12.954  1.00 64.31  ? 211 VAL B CA  1 
ATOM   7317  C C   . VAL D 3 211 ? -7.753  32.169  12.395  1.00 64.52  ? 211 VAL B C   1 
ATOM   7318  O O   . VAL D 3 211 ? -7.807  32.387  11.184  1.00 62.27  ? 211 VAL B O   1 
ATOM   7319  C CB  . VAL D 3 211 ? -6.493  30.106  13.009  1.00 61.37  ? 211 VAL B CB  1 
ATOM   7320  C CG1 . VAL D 3 211 ? -6.627  28.671  13.440  1.00 61.73  ? 211 VAL B CG1 1 
ATOM   7321  C CG2 . VAL D 3 211 ? -5.820  30.193  11.659  1.00 57.53  ? 211 VAL B CG2 1 
ATOM   7322  N N   . THR D 3 212 ? -7.627  33.123  13.312  1.00 67.76  ? 212 THR B N   1 
ATOM   7323  C CA  . THR D 3 212 ? -7.573  34.540  12.997  1.00 68.79  ? 212 THR B CA  1 
ATOM   7324  C C   . THR D 3 212 ? -6.231  35.009  13.488  1.00 68.73  ? 212 THR B C   1 
ATOM   7325  O O   . THR D 3 212 ? -5.790  34.611  14.567  1.00 70.46  ? 212 THR B O   1 
ATOM   7326  C CB  . THR D 3 212 ? -8.646  35.348  13.781  1.00 65.31  ? 212 THR B CB  1 
ATOM   7327  O OG1 . THR D 3 212 ? -9.922  34.710  13.662  1.00 67.83  ? 212 THR B OG1 1 
ATOM   7328  C CG2 . THR D 3 212 ? -8.741  36.784  13.270  1.00 65.66  ? 212 THR B CG2 1 
ATOM   7329  N N   . LYS D 3 213 ? -5.570  35.847  12.705  1.00 67.04  ? 213 LYS B N   1 
ATOM   7330  C CA  . LYS D 3 213 ? -4.352  36.475  13.181  1.00 67.35  ? 213 LYS B CA  1 
ATOM   7331  C C   . LYS D 3 213 ? -4.427  37.988  13.002  1.00 69.29  ? 213 LYS B C   1 
ATOM   7332  O O   . LYS D 3 213 ? -4.768  38.481  11.921  1.00 67.90  ? 213 LYS B O   1 
ATOM   7333  C CB  . LYS D 3 213 ? -3.126  35.824  12.553  1.00 63.46  ? 213 LYS B CB  1 
ATOM   7334  C CG  . LYS D 3 213 ? -3.070  34.352  12.914  1.00 62.78  ? 213 LYS B CG  1 
ATOM   7335  C CD  . LYS D 3 213 ? -1.705  33.782  12.804  1.00 60.60  ? 213 LYS B CD  1 
ATOM   7336  C CE  . LYS D 3 213 ? -0.725  34.416  13.767  1.00 62.43  ? 213 LYS B CE  1 
ATOM   7337  N NZ  . LYS D 3 213 ? -1.002  34.041  15.174  1.00 65.87  ? 213 LYS B NZ  1 
ATOM   7338  N N   . SER D 3 214 ? -4.144  38.703  14.095  1.00 72.94  ? 214 SER B N   1 
ATOM   7339  C CA  . SER D 3 214 ? -4.469  40.121  14.228  1.00 75.90  ? 214 SER B CA  1 
ATOM   7340  C C   . SER D 3 214 ? -3.251  40.933  14.602  1.00 77.23  ? 214 SER B C   1 
ATOM   7341  O O   . SER D 3 214 ? -2.268  40.398  15.110  1.00 76.73  ? 214 SER B O   1 
ATOM   7342  C CB  . SER D 3 214 ? -5.517  40.333  15.328  1.00 79.98  ? 214 SER B CB  1 
ATOM   7343  O OG  . SER D 3 214 ? -6.653  39.508  15.150  1.00 79.96  ? 214 SER B OG  1 
ATOM   7344  N N   . PHE D 3 215 ? -3.332  42.235  14.349  1.00 79.10  ? 215 PHE B N   1 
ATOM   7345  C CA  . PHE D 3 215 ? -2.364  43.193  14.874  1.00 81.27  ? 215 PHE B CA  1 
ATOM   7346  C C   . PHE D 3 215 ? -3.001  44.563  15.063  1.00 85.25  ? 215 PHE B C   1 
ATOM   7347  O O   . PHE D 3 215 ? -3.924  44.939  14.342  1.00 85.27  ? 215 PHE B O   1 
ATOM   7348  C CB  . PHE D 3 215 ? -1.120  43.299  13.979  1.00 77.74  ? 215 PHE B CB  1 
ATOM   7349  C CG  . PHE D 3 215 ? -1.337  44.062  12.682  1.00 75.48  ? 215 PHE B CG  1 
ATOM   7350  C CD1 . PHE D 3 215 ? -1.164  45.442  12.624  1.00 76.94  ? 215 PHE B CD1 1 
ATOM   7351  C CD2 . PHE D 3 215 ? -1.662  43.393  11.511  1.00 71.89  ? 215 PHE B CD2 1 
ATOM   7352  C CE1 . PHE D 3 215 ? -1.344  46.142  11.433  1.00 75.18  ? 215 PHE B CE1 1 
ATOM   7353  C CE2 . PHE D 3 215 ? -1.837  44.085  10.317  1.00 70.27  ? 215 PHE B CE2 1 
ATOM   7354  C CZ  . PHE D 3 215 ? -1.681  45.465  10.283  1.00 71.98  ? 215 PHE B CZ  1 
ATOM   7355  N N   . ASN D 3 216 ? -2.507  45.306  16.043  1.00 89.04  ? 216 ASN B N   1 
ATOM   7356  C CA  . ASN D 3 216 ? -2.935  46.682  16.227  1.00 92.67  ? 216 ASN B CA  1 
ATOM   7357  C C   . ASN D 3 216 ? -1.809  47.608  15.782  1.00 91.95  ? 216 ASN B C   1 
ATOM   7358  O O   . ASN D 3 216 ? -0.634  47.241  15.853  1.00 90.49  ? 216 ASN B O   1 
ATOM   7359  C CB  . ASN D 3 216 ? -3.323  46.936  17.688  1.00 97.75  ? 216 ASN B CB  1 
ATOM   7360  C CG  . ASN D 3 216 ? -4.473  46.051  18.156  1.00 98.93  ? 216 ASN B CG  1 
ATOM   7361  O OD1 . ASN D 3 216 ? -4.625  44.914  17.708  1.00 95.76  ? 216 ASN B OD1 1 
ATOM   7362  N ND2 . ASN D 3 216 ? -5.289  46.574  19.059  1.00 103.82 ? 216 ASN B ND2 1 
ATOM   7363  N N   . ARG D 3 217 ? -2.155  48.804  15.320  1.00 93.15  ? 217 ARG B N   1 
ATOM   7364  C CA  . ARG D 3 217 ? -1.146  49.725  14.801  1.00 92.18  ? 217 ARG B CA  1 
ATOM   7365  C C   . ARG D 3 217 ? -0.130  50.231  15.843  1.00 95.31  ? 217 ARG B C   1 
ATOM   7366  O O   . ARG D 3 217 ? 0.689   51.099  15.546  1.00 95.41  ? 217 ARG B O   1 
ATOM   7367  C CB  . ARG D 3 217 ? -1.813  50.904  14.096  1.00 92.90  ? 217 ARG B CB  1 
ATOM   7368  C CG  . ARG D 3 217 ? -2.396  50.569  12.735  1.00 89.18  ? 217 ARG B CG  1 
ATOM   7369  C CD  . ARG D 3 217 ? -3.129  51.773  12.137  1.00 90.97  ? 217 ARG B CD  1 
ATOM   7370  N NE  . ARG D 3 217 ? -2.485  53.040  12.485  1.00 93.56  ? 217 ARG B NE  1 
ATOM   7371  C CZ  . ARG D 3 217 ? -2.995  53.944  13.320  1.00 98.12  ? 217 ARG B CZ  1 
ATOM   7372  N NH1 . ARG D 3 217 ? -4.173  53.738  13.894  1.00 100.74 ? 217 ARG B NH1 1 
ATOM   7373  N NH2 . ARG D 3 217 ? -2.326  55.058  13.576  1.00 100.35 ? 217 ARG B NH2 1 
ATOM   7374  N N   . GLY D 3 218 ? -0.166  49.681  17.051  1.00 98.16  ? 218 GLY B N   1 
ATOM   7375  C CA  . GLY D 3 218 ? 0.731   50.130  18.100  1.00 102.10 ? 218 GLY B CA  1 
ATOM   7376  C C   . GLY D 3 218 ? 1.530   49.019  18.755  1.00 101.95 ? 218 GLY B C   1 
ATOM   7377  O O   . GLY D 3 218 ? 1.343   48.736  19.943  1.00 105.44 ? 218 GLY B O   1 
ATOM   7378  N N   . GLU D 3 219 ? 2.409   48.389  17.975  1.00 98.10  ? 219 GLU B N   1 
ATOM   7379  C CA  . GLU D 3 219 ? 3.343   47.387  18.486  1.00 97.85  ? 219 GLU B CA  1 
ATOM   7380  C C   . GLU D 3 219 ? 4.120   47.933  19.692  1.00 102.70 ? 219 GLU B C   1 
ATOM   7381  O O   . GLU D 3 219 ? 4.465   47.197  20.623  1.00 104.48 ? 219 GLU B O   1 
ATOM   7382  C CB  . GLU D 3 219 ? 4.306   46.955  17.372  1.00 93.29  ? 219 GLU B CB  1 
ATOM   7383  C CG  . GLU D 3 219 ? 5.331   45.901  17.775  1.00 92.53  ? 219 GLU B CG  1 
ATOM   7384  C CD  . GLU D 3 219 ? 6.530   46.486  18.518  1.00 95.69  ? 219 GLU B CD  1 
ATOM   7385  O OE1 . GLU D 3 219 ? 6.843   47.682  18.309  1.00 97.01  ? 219 GLU B OE1 1 
ATOM   7386  O OE2 . GLU D 3 219 ? 7.146   45.754  19.327  1.00 97.09  ? 219 GLU B OE2 1 
ATOM   7387  N N   . GLU E 2 1   ? 52.403  -9.307  16.808  1.00 80.66  ? 1   GLU H N   1 
ATOM   7388  C CA  . GLU E 2 1   ? 52.857  -9.087  15.440  1.00 78.66  ? 1   GLU H CA  1 
ATOM   7389  C C   . GLU E 2 1   ? 53.380  -7.648  15.295  1.00 74.53  ? 1   GLU H C   1 
ATOM   7390  O O   . GLU E 2 1   ? 53.991  -7.113  16.223  1.00 74.94  ? 1   GLU H O   1 
ATOM   7391  C CB  . GLU E 2 1   ? 51.705  -9.369  14.461  1.00 77.74  ? 1   GLU H CB  1 
ATOM   7392  C CG  . GLU E 2 1   ? 52.089  -10.228 13.244  1.00 79.89  ? 1   GLU H CG  1 
ATOM   7393  C CD  . GLU E 2 1   ? 52.458  -9.401  11.992  1.00 76.87  ? 1   GLU H CD  1 
ATOM   7394  O OE1 . GLU E 2 1   ? 51.871  -8.310  11.775  1.00 73.13  ? 1   GLU H OE1 1 
ATOM   7395  O OE2 . GLU E 2 1   ? 53.337  -9.850  11.217  1.00 78.43  ? 1   GLU H OE2 1 
ATOM   7396  N N   . VAL E 2 2   ? 53.158  -7.032  14.134  1.00 70.99  ? 2   VAL H N   1 
ATOM   7397  C CA  . VAL E 2 2   ? 53.377  -5.597  13.963  1.00 66.77  ? 2   VAL H CA  1 
ATOM   7398  C C   . VAL E 2 2   ? 52.252  -4.809  14.654  1.00 63.95  ? 2   VAL H C   1 
ATOM   7399  O O   . VAL E 2 2   ? 51.062  -5.100  14.490  1.00 63.33  ? 2   VAL H O   1 
ATOM   7400  C CB  . VAL E 2 2   ? 53.461  -5.193  12.466  1.00 51.94  ? 2   VAL H CB  1 
ATOM   7401  C CG1 . VAL E 2 2   ? 53.320  -3.679  12.285  1.00 44.91  ? 2   VAL H CG1 1 
ATOM   7402  C CG2 . VAL E 2 2   ? 54.757  -5.671  11.860  1.00 53.81  ? 2   VAL H CG2 1 
ATOM   7403  N N   . GLN E 2 3   ? 52.640  -3.805  15.431  1.00 62.40  ? 3   GLN H N   1 
ATOM   7404  C CA  . GLN E 2 3   ? 51.699  -3.102  16.283  1.00 60.55  ? 3   GLN H CA  1 
ATOM   7405  C C   . GLN E 2 3   ? 51.899  -1.593  16.230  1.00 56.90  ? 3   GLN H C   1 
ATOM   7406  O O   . GLN E 2 3   ? 52.973  -1.084  16.545  1.00 56.78  ? 3   GLN H O   1 
ATOM   7407  C CB  . GLN E 2 3   ? 51.873  -3.575  17.723  1.00 63.60  ? 3   GLN H CB  1 
ATOM   7408  C CG  . GLN E 2 3   ? 50.690  -3.290  18.596  1.00 63.08  ? 3   GLN H CG  1 
ATOM   7409  C CD  . GLN E 2 3   ? 49.853  -4.517  18.796  1.00 65.44  ? 3   GLN H CD  1 
ATOM   7410  O OE1 . GLN E 2 3   ? 50.359  -5.561  19.227  1.00 68.85  ? 3   GLN H OE1 1 
ATOM   7411  N NE2 . GLN E 2 3   ? 48.563  -4.416  18.469  1.00 63.91  ? 3   GLN H NE2 1 
ATOM   7412  N N   . LEU E 2 4   ? 50.854  -0.876  15.845  1.00 54.34  ? 4   LEU H N   1 
ATOM   7413  C CA  . LEU E 2 4   ? 50.896  0.577   15.890  1.00 52.08  ? 4   LEU H CA  1 
ATOM   7414  C C   . LEU E 2 4   ? 49.827  1.061   16.845  1.00 51.87  ? 4   LEU H C   1 
ATOM   7415  O O   . LEU E 2 4   ? 48.642  0.863   16.601  1.00 51.41  ? 4   LEU H O   1 
ATOM   7416  C CB  . LEU E 2 4   ? 50.734  1.189   14.492  1.00 35.54  ? 4   LEU H CB  1 
ATOM   7417  C CG  . LEU E 2 4   ? 52.016  1.361   13.667  1.00 35.42  ? 4   LEU H CG  1 
ATOM   7418  C CD1 . LEU E 2 4   ? 52.645  0.049   13.277  1.00 37.74  ? 4   LEU H CD1 1 
ATOM   7419  C CD2 . LEU E 2 4   ? 51.732  2.145   12.447  1.00 36.66  ? 4   LEU H CD2 1 
ATOM   7420  N N   . VAL E 2 5   ? 50.254  1.652   17.959  1.00 38.10  ? 5   VAL H N   1 
ATOM   7421  C CA  . VAL E 2 5   ? 49.325  2.082   18.998  1.00 40.47  ? 5   VAL H CA  1 
ATOM   7422  C C   . VAL E 2 5   ? 49.423  3.575   19.169  1.00 38.65  ? 5   VAL H C   1 
ATOM   7423  O O   . VAL E 2 5   ? 50.487  4.096   19.497  1.00 39.16  ? 5   VAL H O   1 
ATOM   7424  C CB  . VAL E 2 5   ? 49.603  1.411   20.361  1.00 41.23  ? 5   VAL H CB  1 
ATOM   7425  C CG1 . VAL E 2 5   ? 48.634  1.934   21.407  1.00 41.37  ? 5   VAL H CG1 1 
ATOM   7426  C CG2 . VAL E 2 5   ? 49.498  -0.082  20.243  1.00 43.55  ? 5   VAL H CG2 1 
ATOM   7427  N N   . GLN E 2 6   ? 48.306  4.258   18.952  1.00 36.86  ? 6   GLN H N   1 
ATOM   7428  C CA  . GLN E 2 6   ? 48.289  5.710   18.967  1.00 35.23  ? 6   GLN H CA  1 
ATOM   7429  C C   . GLN E 2 6   ? 47.745  6.210   20.281  1.00 34.05  ? 6   GLN H C   1 
ATOM   7430  O O   . GLN E 2 6   ? 46.937  5.532   20.904  1.00 35.52  ? 6   GLN H O   1 
ATOM   7431  C CB  . GLN E 2 6   ? 47.413  6.252   17.827  1.00 33.17  ? 6   GLN H CB  1 
ATOM   7432  C CG  . GLN E 2 6   ? 47.867  5.854   16.462  1.00 30.12  ? 6   GLN H CG  1 
ATOM   7433  C CD  . GLN E 2 6   ? 47.089  6.539   15.376  1.00 28.36  ? 6   GLN H CD  1 
ATOM   7434  O OE1 . GLN E 2 6   ? 46.676  5.906   14.413  1.00 28.10  ? 6   GLN H OE1 1 
ATOM   7435  N NE2 . GLN E 2 6   ? 46.894  7.844   15.513  1.00 27.47  ? 6   GLN H NE2 1 
ATOM   7436  N N   . SER E 2 7   ? 48.199  7.394   20.682  1.00 33.73  ? 7   SER H N   1 
ATOM   7437  C CA  . SER E 2 7   ? 47.647  8.144   21.801  1.00 34.51  ? 7   SER H CA  1 
ATOM   7438  C C   . SER E 2 7   ? 46.119  8.100   21.807  1.00 34.09  ? 7   SER H C   1 
ATOM   7439  O O   . SER E 2 7   ? 45.484  7.952   20.762  1.00 38.68  ? 7   SER H O   1 
ATOM   7440  C CB  . SER E 2 7   ? 48.164  9.592   21.749  1.00 33.74  ? 7   SER H CB  1 
ATOM   7441  O OG  . SER E 2 7   ? 47.118  10.539  21.555  1.00 32.68  ? 7   SER H OG  1 
ATOM   7442  N N   . GLY E 2 8   ? 45.521  8.206   22.985  1.00 35.61  ? 8   GLY H N   1 
ATOM   7443  C CA  . GLY E 2 8   ? 44.072  8.215   23.099  1.00 35.60  ? 8   GLY H CA  1 
ATOM   7444  C C   . GLY E 2 8   ? 43.377  9.434   22.519  1.00 34.06  ? 8   GLY H C   1 
ATOM   7445  O O   . GLY E 2 8   ? 44.026  10.385  22.102  1.00 33.83  ? 8   GLY H O   1 
ATOM   7446  N N   . ALA E 2 9   ? 42.050  9.400   22.505  1.00 34.20  ? 9   ALA H N   1 
ATOM   7447  C CA  . ALA E 2 9   ? 41.237  10.448  21.910  1.00 33.18  ? 9   ALA H CA  1 
ATOM   7448  C C   . ALA E 2 9   ? 41.429  11.771  22.630  1.00 36.96  ? 9   ALA H C   1 
ATOM   7449  O O   . ALA E 2 9   ? 41.732  11.802  23.805  1.00 38.57  ? 9   ALA H O   1 
ATOM   7450  C CB  . ALA E 2 9   ? 39.791  10.042  21.918  1.00 33.83  ? 9   ALA H CB  1 
ATOM   7451  N N   . GLU E 2 10  ? 41.248  12.872  21.926  1.00 36.16  ? 10  GLU H N   1 
ATOM   7452  C CA  . GLU E 2 10  ? 41.542  14.172  22.493  1.00 37.37  ? 10  GLU H CA  1 
ATOM   7453  C C   . GLU E 2 10  ? 40.386  15.131  22.293  1.00 37.43  ? 10  GLU H C   1 
ATOM   7454  O O   . GLU E 2 10  ? 39.875  15.256  21.184  1.00 36.88  ? 10  GLU H O   1 
ATOM   7455  C CB  . GLU E 2 10  ? 42.783  14.744  21.809  1.00 37.32  ? 10  GLU H CB  1 
ATOM   7456  C CG  . GLU E 2 10  ? 44.020  13.859  21.930  1.00 38.18  ? 10  GLU H CG  1 
ATOM   7457  C CD  . GLU E 2 10  ? 44.899  14.213  23.130  1.00 40.82  ? 10  GLU H CD  1 
ATOM   7458  O OE1 . GLU E 2 10  ? 44.419  14.927  24.059  1.00 42.50  ? 10  GLU H OE1 1 
ATOM   7459  O OE2 . GLU E 2 10  ? 46.080  13.773  23.135  1.00 41.24  ? 10  GLU H OE2 1 
ATOM   7460  N N   . VAL E 2 11  ? 39.964  15.808  23.351  1.00 38.54  ? 11  VAL H N   1 
ATOM   7461  C CA  . VAL E 2 11  ? 38.993  16.878  23.196  1.00 39.20  ? 11  VAL H CA  1 
ATOM   7462  C C   . VAL E 2 11  ? 39.688  18.175  23.536  1.00 40.06  ? 11  VAL H C   1 
ATOM   7463  O O   . VAL E 2 11  ? 40.292  18.295  24.590  1.00 41.32  ? 11  VAL H O   1 
ATOM   7464  C CB  . VAL E 2 11  ? 37.731  16.686  24.054  1.00 38.31  ? 11  VAL H CB  1 
ATOM   7465  C CG1 . VAL E 2 11  ? 36.762  17.811  23.806  1.00 39.38  ? 11  VAL H CG1 1 
ATOM   7466  C CG2 . VAL E 2 11  ? 37.074  15.340  23.762  1.00 37.77  ? 11  VAL H CG2 1 
ATOM   7467  N N   . LYS E 2 12  ? 39.638  19.134  22.619  1.00 37.03  ? 12  LYS H N   1 
ATOM   7468  C CA  . LYS E 2 12  ? 40.373  20.378  22.772  1.00 37.99  ? 12  LYS H CA  1 
ATOM   7469  C C   . LYS E 2 12  ? 39.553  21.578  22.301  1.00 39.19  ? 12  LYS H C   1 
ATOM   7470  O O   . LYS E 2 12  ? 38.533  21.427  21.637  1.00 38.95  ? 12  LYS H O   1 
ATOM   7471  C CB  . LYS E 2 12  ? 41.730  20.296  22.063  1.00 36.48  ? 12  LYS H CB  1 
ATOM   7472  C CG  . LYS E 2 12  ? 42.741  19.370  22.765  1.00 36.19  ? 12  LYS H CG  1 
ATOM   7473  C CD  . LYS E 2 12  ? 43.884  20.142  23.427  1.00 37.52  ? 12  LYS H CD  1 
ATOM   7474  C CE  . LYS E 2 12  ? 44.503  19.401  24.626  1.00 42.08  ? 12  LYS H CE  1 
ATOM   7475  N NZ  . LYS E 2 12  ? 44.070  19.934  25.986  1.00 41.13  ? 12  LYS H NZ  1 
ATOM   7476  N N   . LYS E 2 13  ? 39.983  22.772  22.682  1.00 40.87  ? 13  LYS H N   1 
ATOM   7477  C CA  . LYS E 2 13  ? 39.255  23.981  22.348  1.00 42.64  ? 13  LYS H CA  1 
ATOM   7478  C C   . LYS E 2 13  ? 40.095  24.758  21.359  1.00 42.28  ? 13  LYS H C   1 
ATOM   7479  O O   . LYS E 2 13  ? 41.303  24.561  21.315  1.00 41.26  ? 13  LYS H O   1 
ATOM   7480  C CB  . LYS E 2 13  ? 38.983  24.810  23.608  1.00 45.56  ? 13  LYS H CB  1 
ATOM   7481  C CG  . LYS E 2 13  ? 38.394  24.027  24.776  1.00 46.22  ? 13  LYS H CG  1 
ATOM   7482  C CD  . LYS E 2 13  ? 37.198  24.762  25.382  1.00 50.49  ? 13  LYS H CD  1 
ATOM   7483  C CE  . LYS E 2 13  ? 37.026  24.492  26.893  1.00 52.44  ? 13  LYS H CE  1 
ATOM   7484  N NZ  . LYS E 2 13  ? 37.201  23.064  27.284  1.00 49.31  ? 13  LYS H NZ  1 
ATOM   7485  N N   . PRO E 2 14  ? 39.459  25.620  20.539  1.00 49.77  ? 14  PRO H N   1 
ATOM   7486  C CA  . PRO E 2 14  ? 40.194  26.381  19.517  1.00 43.34  ? 14  PRO H CA  1 
ATOM   7487  C C   . PRO E 2 14  ? 41.287  27.268  20.119  1.00 51.17  ? 14  PRO H C   1 
ATOM   7488  O O   . PRO E 2 14  ? 41.039  28.059  21.044  1.00 47.41  ? 14  PRO H O   1 
ATOM   7489  C CB  . PRO E 2 14  ? 39.110  27.251  18.883  1.00 45.31  ? 14  PRO H CB  1 
ATOM   7490  C CG  . PRO E 2 14  ? 37.857  26.523  19.121  1.00 45.12  ? 14  PRO H CG  1 
ATOM   7491  C CD  . PRO E 2 14  ? 38.007  25.866  20.458  1.00 51.87  ? 14  PRO H CD  1 
ATOM   7492  N N   . GLY E 2 15  ? 42.497  27.124  19.586  1.00 49.79  ? 15  GLY H N   1 
ATOM   7493  C CA  . GLY E 2 15  ? 43.620  27.922  20.015  1.00 45.00  ? 15  GLY H CA  1 
ATOM   7494  C C   . GLY E 2 15  ? 44.605  27.099  20.795  1.00 43.90  ? 15  GLY H C   1 
ATOM   7495  O O   . GLY E 2 15  ? 45.730  27.516  21.041  1.00 46.67  ? 15  GLY H O   1 
ATOM   7496  N N   . GLU E 2 16  ? 44.181  25.917  21.196  1.00 42.31  ? 16  GLU H N   1 
ATOM   7497  C CA  . GLU E 2 16  ? 45.028  25.089  22.028  1.00 42.83  ? 16  GLU H CA  1 
ATOM   7498  C C   . GLU E 2 16  ? 46.015  24.326  21.153  1.00 39.50  ? 16  GLU H C   1 
ATOM   7499  O O   . GLU E 2 16  ? 45.659  23.867  20.068  1.00 37.70  ? 16  GLU H O   1 
ATOM   7500  C CB  . GLU E 2 16  ? 44.184  24.148  22.906  1.00 42.76  ? 16  GLU H CB  1 
ATOM   7501  C CG  . GLU E 2 16  ? 43.303  24.865  23.947  1.00 45.88  ? 16  GLU H CG  1 
ATOM   7502  C CD  . GLU E 2 16  ? 42.788  23.925  25.065  1.00 46.99  ? 16  GLU H CD  1 
ATOM   7503  O OE1 . GLU E 2 16  ? 42.297  22.823  24.733  1.00 45.11  ? 16  GLU H OE1 1 
ATOM   7504  O OE2 . GLU E 2 16  ? 42.880  24.276  26.284  1.00 49.86  ? 16  GLU H OE2 1 
ATOM   7505  N N   . SER E 2 17  ? 47.261  24.221  21.616  1.00 39.93  ? 17  SER H N   1 
ATOM   7506  C CA  . SER E 2 17  ? 48.245  23.340  20.999  1.00 38.14  ? 17  SER H CA  1 
ATOM   7507  C C   . SER E 2 17  ? 47.814  21.904  21.250  1.00 36.62  ? 17  SER H C   1 
ATOM   7508  O O   . SER E 2 17  ? 46.905  21.660  22.033  1.00 42.34  ? 17  SER H O   1 
ATOM   7509  C CB  . SER E 2 17  ? 49.604  23.543  21.635  1.00 39.54  ? 17  SER H CB  1 
ATOM   7510  O OG  . SER E 2 17  ? 49.685  22.793  22.838  1.00 40.23  ? 17  SER H OG  1 
ATOM   7511  N N   . LEU E 2 18  ? 48.456  20.955  20.584  1.00 34.97  ? 18  LEU H N   1 
ATOM   7512  C CA  . LEU E 2 18  ? 48.240  19.545  20.870  1.00 33.99  ? 18  LEU H CA  1 
ATOM   7513  C C   . LEU E 2 18  ? 49.306  18.751  20.174  1.00 35.84  ? 18  LEU H C   1 
ATOM   7514  O O   . LEU E 2 18  ? 49.658  19.041  19.047  1.00 35.10  ? 18  LEU H O   1 
ATOM   7515  C CB  . LEU E 2 18  ? 46.857  19.058  20.427  1.00 32.85  ? 18  LEU H CB  1 
ATOM   7516  C CG  . LEU E 2 18  ? 46.650  17.540  20.299  1.00 31.66  ? 18  LEU H CG  1 
ATOM   7517  C CD1 . LEU E 2 18  ? 46.819  16.807  21.605  1.00 32.90  ? 18  LEU H CD1 1 
ATOM   7518  C CD2 . LEU E 2 18  ? 45.275  17.203  19.720  1.00 30.86  ? 18  LEU H CD2 1 
ATOM   7519  N N   . LYS E 2 19  ? 49.849  17.773  20.877  1.00 36.18  ? 19  LYS H N   1 
ATOM   7520  C CA  . LYS E 2 19  ? 50.727  16.783  20.286  1.00 35.41  ? 19  LYS H CA  1 
ATOM   7521  C C   . LYS E 2 19  ? 50.080  15.418  20.526  1.00 34.88  ? 19  LYS H C   1 
ATOM   7522  O O   . LYS E 2 19  ? 49.571  15.149  21.609  1.00 36.04  ? 19  LYS H O   1 
ATOM   7523  C CB  . LYS E 2 19  ? 52.146  16.852  20.886  1.00 34.18  ? 19  LYS H CB  1 
ATOM   7524  C CG  . LYS E 2 19  ? 53.125  15.867  20.254  1.00 33.72  ? 19  LYS H CG  1 
ATOM   7525  C CD  . LYS E 2 19  ? 54.446  15.731  20.995  1.00 35.79  ? 19  LYS H CD  1 
ATOM   7526  C CE  . LYS E 2 19  ? 55.409  16.888  20.729  1.00 39.35  ? 19  LYS H CE  1 
ATOM   7527  N NZ  . LYS E 2 19  ? 56.810  16.440  20.497  1.00 37.65  ? 19  LYS H NZ  1 
ATOM   7528  N N   . ILE E 2 20  ? 50.058  14.570  19.505  1.00 33.38  ? 20  ILE H N   1 
ATOM   7529  C CA  . ILE E 2 20  ? 49.602  13.198  19.688  1.00 33.20  ? 20  ILE H CA  1 
ATOM   7530  C C   . ILE E 2 20  ? 50.661  12.258  19.173  1.00 30.62  ? 20  ILE H C   1 
ATOM   7531  O O   . ILE E 2 20  ? 51.553  12.673  18.448  1.00 30.24  ? 20  ILE H O   1 
ATOM   7532  C CB  . ILE E 2 20  ? 48.277  12.918  19.001  1.00 31.81  ? 20  ILE H CB  1 
ATOM   7533  C CG1 . ILE E 2 20  ? 48.394  13.146  17.486  1.00 27.80  ? 20  ILE H CG1 1 
ATOM   7534  C CG2 . ILE E 2 20  ? 47.200  13.770  19.636  1.00 32.28  ? 20  ILE H CG2 1 
ATOM   7535  C CD1 . ILE E 2 20  ? 47.137  12.840  16.720  1.00 26.84  ? 20  ILE H CD1 1 
ATOM   7536  N N   . SER E 2 21  ? 50.554  10.992  19.558  1.00 31.36  ? 21  SER H N   1 
ATOM   7537  C CA  . SER E 2 21  ? 51.645  10.055  19.366  1.00 32.18  ? 21  SER H CA  1 
ATOM   7538  C C   . SER E 2 21  ? 51.189  8.717   18.803  1.00 35.11  ? 21  SER H C   1 
ATOM   7539  O O   . SER E 2 21  ? 50.037  8.320   18.921  1.00 31.67  ? 21  SER H O   1 
ATOM   7540  C CB  . SER E 2 21  ? 52.430  9.854   20.683  1.00 40.74  ? 21  SER H CB  1 
ATOM   7541  O OG  . SER E 2 21  ? 51.657  9.233   21.704  1.00 35.87  ? 21  SER H OG  1 
ATOM   7542  N N   . CYS E 2 22  ? 52.128  8.044   18.166  1.00 35.39  ? 22  CYS H N   1 
ATOM   7543  C CA  . CYS E 2 22  ? 51.941  6.686   17.708  1.00 36.03  ? 22  CYS H CA  1 
ATOM   7544  C C   . CYS E 2 22  ? 53.244  5.970   18.051  1.00 38.18  ? 22  CYS H C   1 
ATOM   7545  O O   . CYS E 2 22  ? 54.324  6.522   17.834  1.00 38.45  ? 22  CYS H O   1 
ATOM   7546  C CB  . CYS E 2 22  ? 51.687  6.676   16.205  1.00 34.39  ? 22  CYS H CB  1 
ATOM   7547  S SG  . CYS E 2 22  ? 51.564  5.055   15.481  1.00 54.08  ? 22  CYS H SG  1 
ATOM   7548  N N   . LYS E 2 23  ? 53.141  4.779   18.635  1.00 40.05  ? 23  LYS H N   1 
ATOM   7549  C CA  . LYS E 2 23  ? 54.308  3.982   18.973  1.00 39.39  ? 23  LYS H CA  1 
ATOM   7550  C C   . LYS E 2 23  ? 54.246  2.688   18.175  1.00 40.50  ? 23  LYS H C   1 
ATOM   7551  O O   . LYS E 2 23  ? 53.200  2.026   18.111  1.00 40.47  ? 23  LYS H O   1 
ATOM   7552  C CB  . LYS E 2 23  ? 54.349  3.700   20.485  1.00 41.98  ? 23  LYS H CB  1 
ATOM   7553  C CG  . LYS E 2 23  ? 55.572  2.906   20.996  1.00 45.89  ? 23  LYS H CG  1 
ATOM   7554  C CD  . LYS E 2 23  ? 55.563  2.749   22.529  1.00 48.81  ? 23  LYS H CD  1 
ATOM   7555  C CE  . LYS E 2 23  ? 56.864  2.157   23.098  1.00 52.46  ? 23  LYS H CE  1 
ATOM   7556  N NZ  . LYS E 2 23  ? 57.500  3.076   24.090  1.00 53.07  ? 23  LYS H NZ  1 
ATOM   7557  N N   . GLY E 2 24  ? 55.363  2.322   17.561  1.00 41.48  ? 24  GLY H N   1 
ATOM   7558  C CA  . GLY E 2 24  ? 55.412  1.096   16.789  1.00 42.57  ? 24  GLY H CA  1 
ATOM   7559  C C   . GLY E 2 24  ? 56.300  0.032   17.401  1.00 46.31  ? 24  GLY H C   1 
ATOM   7560  O O   . GLY E 2 24  ? 57.443  0.303   17.749  1.00 47.88  ? 24  GLY H O   1 
ATOM   7561  N N   . SER E 2 25  ? 55.769  -1.181  17.532  1.00 48.12  ? 25  SER H N   1 
ATOM   7562  C CA  . SER E 2 25  ? 56.550  -2.330  17.976  1.00 51.63  ? 25  SER H CA  1 
ATOM   7563  C C   . SER E 2 25  ? 56.399  -3.499  16.990  1.00 57.72  ? 25  SER H C   1 
ATOM   7564  O O   . SER E 2 25  ? 55.485  -3.516  16.157  1.00 55.48  ? 25  SER H O   1 
ATOM   7565  C CB  . SER E 2 25  ? 56.104  -2.767  19.360  1.00 54.04  ? 25  SER H CB  1 
ATOM   7566  O OG  . SER E 2 25  ? 54.782  -3.266  19.301  1.00 53.45  ? 25  SER H OG  1 
ATOM   7567  N N   . GLY E 2 26  ? 57.299  -4.473  17.087  1.00 61.30  ? 26  GLY H N   1 
ATOM   7568  C CA  . GLY E 2 26  ? 57.261  -5.637  16.217  1.00 63.06  ? 26  GLY H CA  1 
ATOM   7569  C C   . GLY E 2 26  ? 58.269  -5.582  15.080  1.00 63.12  ? 26  GLY H C   1 
ATOM   7570  O O   . GLY E 2 26  ? 58.594  -6.594  14.460  1.00 65.68  ? 26  GLY H O   1 
ATOM   7571  N N   . TYR E 2 27  ? 58.774  -4.392  14.800  1.00 60.64  ? 27  TYR H N   1 
ATOM   7572  C CA  . TYR E 2 27  ? 59.633  -4.208  13.655  1.00 55.01  ? 27  TYR H CA  1 
ATOM   7573  C C   . TYR E 2 27  ? 60.700  -3.223  14.044  1.00 58.71  ? 27  TYR H C   1 
ATOM   7574  O O   . TYR E 2 27  ? 60.560  -2.521  15.058  1.00 54.15  ? 27  TYR H O   1 
ATOM   7575  C CB  . TYR E 2 27  ? 58.823  -3.670  12.467  1.00 55.92  ? 27  TYR H CB  1 
ATOM   7576  C CG  . TYR E 2 27  ? 58.198  -2.297  12.696  1.00 52.28  ? 27  TYR H CG  1 
ATOM   7577  C CD1 . TYR E 2 27  ? 58.832  -1.128  12.257  1.00 50.44  ? 27  TYR H CD1 1 
ATOM   7578  C CD2 . TYR E 2 27  ? 56.977  -2.168  13.348  1.00 46.44  ? 27  TYR H CD2 1 
ATOM   7579  C CE1 . TYR E 2 27  ? 58.274  0.106   12.473  1.00 42.87  ? 27  TYR H CE1 1 
ATOM   7580  C CE2 . TYR E 2 27  ? 56.418  -0.933  13.554  1.00 43.47  ? 27  TYR H CE2 1 
ATOM   7581  C CZ  . TYR E 2 27  ? 57.070  0.191   13.114  1.00 41.76  ? 27  TYR H CZ  1 
ATOM   7582  O OH  . TYR E 2 27  ? 56.499  1.411   13.340  1.00 50.92  ? 27  TYR H OH  1 
ATOM   7583  N N   . SER E 2 28  ? 61.763  -3.170  13.245  1.00 59.35  ? 28  SER H N   1 
ATOM   7584  C CA  . SER E 2 28  ? 62.815  -2.201  13.476  1.00 59.31  ? 28  SER H CA  1 
ATOM   7585  C C   . SER E 2 28  ? 62.323  -0.831  13.020  1.00 55.26  ? 28  SER H C   1 
ATOM   7586  O O   . SER E 2 28  ? 62.039  -0.619  11.845  1.00 53.28  ? 28  SER H O   1 
ATOM   7587  C CB  . SER E 2 28  ? 64.087  -2.603  12.745  1.00 61.76  ? 28  SER H CB  1 
ATOM   7588  O OG  . SER E 2 28  ? 65.187  -1.894  13.279  1.00 62.92  ? 28  SER H OG  1 
ATOM   7589  N N   . PHE E 2 29  ? 62.209  0.095   13.963  1.00 54.37  ? 29  PHE H N   1 
ATOM   7590  C CA  . PHE E 2 29  ? 61.554  1.361   13.699  1.00 46.67  ? 29  PHE H CA  1 
ATOM   7591  C C   . PHE E 2 29  ? 62.178  2.113   12.547  1.00 46.33  ? 29  PHE H C   1 
ATOM   7592  O O   . PHE E 2 29  ? 61.509  2.898   11.890  1.00 43.72  ? 29  PHE H O   1 
ATOM   7593  C CB  . PHE E 2 29  ? 61.588  2.242   14.938  1.00 46.61  ? 29  PHE H CB  1 
ATOM   7594  C CG  . PHE E 2 29  ? 60.624  3.390   14.892  1.00 43.28  ? 29  PHE H CG  1 
ATOM   7595  C CD1 . PHE E 2 29  ? 59.269  3.166   14.709  1.00 42.19  ? 29  PHE H CD1 1 
ATOM   7596  C CD2 . PHE E 2 29  ? 61.060  4.688   15.059  1.00 42.39  ? 29  PHE H CD2 1 
ATOM   7597  C CE1 . PHE E 2 29  ? 58.374  4.212   14.693  1.00 38.73  ? 29  PHE H CE1 1 
ATOM   7598  C CE2 . PHE E 2 29  ? 60.164  5.733   15.038  1.00 39.75  ? 29  PHE H CE2 1 
ATOM   7599  C CZ  . PHE E 2 29  ? 58.824  5.492   14.856  1.00 37.95  ? 29  PHE H CZ  1 
ATOM   7600  N N   . THR E 2 30  ? 63.457  1.879   12.292  1.00 48.50  ? 30  THR H N   1 
ATOM   7601  C CA  . THR E 2 30  ? 64.179  2.715   11.338  1.00 47.55  ? 30  THR H CA  1 
ATOM   7602  C C   . THR E 2 30  ? 64.289  2.156   9.921   1.00 47.44  ? 30  THR H C   1 
ATOM   7603  O O   . THR E 2 30  ? 64.963  2.742   9.084   1.00 47.46  ? 30  THR H O   1 
ATOM   7604  C CB  . THR E 2 30  ? 65.563  3.014   11.855  1.00 50.16  ? 30  THR H CB  1 
ATOM   7605  O OG1 . THR E 2 30  ? 66.096  1.815   12.420  1.00 53.85  ? 30  THR H OG1 1 
ATOM   7606  C CG2 . THR E 2 30  ? 65.464  4.050   12.931  1.00 48.78  ? 30  THR H CG2 1 
ATOM   7607  N N   . ASP E 2 31  ? 63.618  1.043   9.653   1.00 47.64  ? 31  ASP H N   1 
ATOM   7608  C CA  . ASP E 2 31  ? 63.704  0.408   8.351   1.00 48.09  ? 31  ASP H CA  1 
ATOM   7609  C C   . ASP E 2 31  ? 62.544  0.786   7.424   1.00 45.00  ? 31  ASP H C   1 
ATOM   7610  O O   . ASP E 2 31  ? 62.450  0.321   6.283   1.00 45.25  ? 31  ASP H O   1 
ATOM   7611  C CB  . ASP E 2 31  ? 63.827  -1.106  8.516   1.00 51.45  ? 31  ASP H CB  1 
ATOM   7612  C CG  . ASP E 2 31  ? 65.192  -1.521  9.045   1.00 55.53  ? 31  ASP H CG  1 
ATOM   7613  O OD1 . ASP E 2 31  ? 66.129  -0.690  8.951   1.00 55.95  ? 31  ASP H OD1 1 
ATOM   7614  O OD2 . ASP E 2 31  ? 65.339  -2.667  9.539   1.00 58.47  ? 31  ASP H OD2 1 
ATOM   7615  N N   . TYR E 2 32  ? 61.666  1.652   7.905   1.00 42.34  ? 32  TYR H N   1 
ATOM   7616  C CA  . TYR E 2 32  ? 60.498  2.021   7.134   1.00 39.51  ? 32  TYR H CA  1 
ATOM   7617  C C   . TYR E 2 32  ? 60.198  3.477   7.399   1.00 37.14  ? 32  TYR H C   1 
ATOM   7618  O O   . TYR E 2 32  ? 60.727  4.063   8.341   1.00 37.48  ? 32  TYR H O   1 
ATOM   7619  C CB  . TYR E 2 32  ? 59.295  1.156   7.541   1.00 39.40  ? 32  TYR H CB  1 
ATOM   7620  C CG  . TYR E 2 32  ? 59.534  -0.345  7.524   1.00 42.27  ? 32  TYR H CG  1 
ATOM   7621  C CD1 . TYR E 2 32  ? 59.244  -1.106  6.390   1.00 42.92  ? 32  TYR H CD1 1 
ATOM   7622  C CD2 . TYR E 2 32  ? 60.048  -1.002  8.641   1.00 44.72  ? 32  TYR H CD2 1 
ATOM   7623  C CE1 . TYR E 2 32  ? 59.469  -2.471  6.366   1.00 45.92  ? 32  TYR H CE1 1 
ATOM   7624  C CE2 . TYR E 2 32  ? 60.272  -2.365  8.626   1.00 47.78  ? 32  TYR H CE2 1 
ATOM   7625  C CZ  . TYR E 2 32  ? 59.983  -3.099  7.489   1.00 53.27  ? 32  TYR H CZ  1 
ATOM   7626  O OH  . TYR E 2 32  ? 60.207  -4.465  7.473   1.00 56.72  ? 32  TYR H OH  1 
ATOM   7627  N N   . TYR E 2 33  ? 59.349  4.060   6.561   1.00 35.06  ? 33  TYR H N   1 
ATOM   7628  C CA  . TYR E 2 33  ? 58.866  5.408   6.793   1.00 33.02  ? 33  TYR H CA  1 
ATOM   7629  C C   . TYR E 2 33  ? 57.682  5.306   7.746   1.00 32.05  ? 33  TYR H C   1 
ATOM   7630  O O   . TYR E 2 33  ? 56.996  4.293   7.767   1.00 32.45  ? 33  TYR H O   1 
ATOM   7631  C CB  . TYR E 2 33  ? 58.402  6.052   5.480   1.00 31.66  ? 33  TYR H CB  1 
ATOM   7632  C CG  . TYR E 2 33  ? 59.471  6.286   4.425   1.00 32.61  ? 33  TYR H CG  1 
ATOM   7633  C CD1 . TYR E 2 33  ? 59.779  7.570   4.002   1.00 31.95  ? 33  TYR H CD1 1 
ATOM   7634  C CD2 . TYR E 2 33  ? 60.148  5.227   3.831   1.00 34.46  ? 33  TYR H CD2 1 
ATOM   7635  C CE1 . TYR E 2 33  ? 60.739  7.792   3.055   1.00 33.03  ? 33  TYR H CE1 1 
ATOM   7636  C CE2 . TYR E 2 33  ? 61.109  5.449   2.872   1.00 35.52  ? 33  TYR H CE2 1 
ATOM   7637  C CZ  . TYR E 2 33  ? 61.398  6.735   2.495   1.00 34.76  ? 33  TYR H CZ  1 
ATOM   7638  O OH  . TYR E 2 33  ? 62.357  6.973   1.552   1.00 36.03  ? 33  TYR H OH  1 
ATOM   7639  N N   . MET E 2 34  ? 57.444  6.342   8.542   1.00 32.02  ? 34  MET H N   1 
ATOM   7640  C CA  . MET E 2 34  ? 56.172  6.491   9.256   1.00 30.72  ? 34  MET H CA  1 
ATOM   7641  C C   . MET E 2 34  ? 55.298  7.511   8.515   1.00 28.99  ? 34  MET H C   1 
ATOM   7642  O O   . MET E 2 34  ? 55.802  8.484   7.936   1.00 28.93  ? 34  MET H O   1 
ATOM   7643  C CB  . MET E 2 34  ? 56.395  6.945   10.693  1.00 30.41  ? 34  MET H CB  1 
ATOM   7644  C CG  . MET E 2 34  ? 57.020  5.899   11.583  1.00 32.57  ? 34  MET H CG  1 
ATOM   7645  S SD  . MET E 2 34  ? 56.114  4.338   11.602  1.00 38.85  ? 34  MET H SD  1 
ATOM   7646  C CE  . MET E 2 34  ? 54.551  4.851   12.318  1.00 31.74  ? 34  MET H CE  1 
ATOM   7647  N N   . LYS E 2 35  ? 53.994  7.283   8.499   1.00 28.03  ? 35  LYS H N   1 
ATOM   7648  C CA  . LYS E 2 35  ? 53.114  8.104   7.665   1.00 26.87  ? 35  LYS H CA  1 
ATOM   7649  C C   . LYS E 2 35  ? 51.951  8.602   8.515   1.00 26.43  ? 35  LYS H C   1 
ATOM   7650  O O   . LYS E 2 35  ? 51.643  7.999   9.543   1.00 27.05  ? 35  LYS H O   1 
ATOM   7651  C CB  . LYS E 2 35  ? 52.621  7.291   6.470   1.00 26.89  ? 35  LYS H CB  1 
ATOM   7652  C CG  . LYS E 2 35  ? 53.712  6.413   5.852   1.00 28.21  ? 35  LYS H CG  1 
ATOM   7653  C CD  . LYS E 2 35  ? 53.166  5.366   4.868   1.00 28.86  ? 35  LYS H CD  1 
ATOM   7654  C CE  . LYS E 2 35  ? 52.434  5.979   3.690   1.00 28.23  ? 35  LYS H CE  1 
ATOM   7655  N NZ  . LYS E 2 35  ? 53.269  7.004   2.971   1.00 28.32  ? 35  LYS H NZ  1 
ATOM   7656  N N   . TRP E 2 36  ? 51.329  9.707   8.119   1.00 25.53  ? 36  TRP H N   1 
ATOM   7657  C CA  . TRP E 2 36  ? 50.188  10.228  8.863   1.00 25.18  ? 36  TRP H CA  1 
ATOM   7658  C C   . TRP E 2 36  ? 49.084  10.611  7.890   1.00 25.11  ? 36  TRP H C   1 
ATOM   7659  O O   . TRP E 2 36  ? 49.332  11.257  6.875   1.00 25.10  ? 36  TRP H O   1 
ATOM   7660  C CB  . TRP E 2 36  ? 50.586  11.434  9.723   1.00 25.11  ? 36  TRP H CB  1 
ATOM   7661  C CG  . TRP E 2 36  ? 51.316  11.106  11.016  1.00 26.24  ? 36  TRP H CG  1 
ATOM   7662  C CD1 . TRP E 2 36  ? 52.677  11.026  11.215  1.00 27.14  ? 36  TRP H CD1 1 
ATOM   7663  C CD2 . TRP E 2 36  ? 50.721  10.849  12.297  1.00 26.81  ? 36  TRP H CD2 1 
ATOM   7664  N NE1 . TRP E 2 36  ? 52.958  10.727  12.543  1.00 27.99  ? 36  TRP H NE1 1 
ATOM   7665  C CE2 . TRP E 2 36  ? 51.773  10.612  13.219  1.00 27.93  ? 36  TRP H CE2 1 
ATOM   7666  C CE3 . TRP E 2 36  ? 49.404  10.780  12.752  1.00 26.53  ? 36  TRP H CE3 1 
ATOM   7667  C CZ2 . TRP E 2 36  ? 51.532  10.321  14.561  1.00 29.02  ? 36  TRP H CZ2 1 
ATOM   7668  C CZ3 . TRP E 2 36  ? 49.175  10.496  14.077  1.00 27.39  ? 36  TRP H CZ3 1 
ATOM   7669  C CH2 . TRP E 2 36  ? 50.231  10.265  14.970  1.00 28.62  ? 36  TRP H CH2 1 
ATOM   7670  N N   . ALA E 2 37  ? 47.859  10.206  8.203   1.00 25.47  ? 37  ALA H N   1 
ATOM   7671  C CA  . ALA E 2 37  ? 46.710  10.499  7.349   1.00 25.60  ? 37  ALA H CA  1 
ATOM   7672  C C   . ALA E 2 37  ? 45.551  11.020  8.174   1.00 26.50  ? 37  ALA H C   1 
ATOM   7673  O O   . ALA E 2 37  ? 45.345  10.583  9.289   1.00 26.61  ? 37  ALA H O   1 
ATOM   7674  C CB  . ALA E 2 37  ? 46.293  9.273   6.589   1.00 25.51  ? 37  ALA H CB  1 
ATOM   7675  N N   . ARG E 2 38  ? 44.814  11.971  7.617   1.00 27.65  ? 38  ARG H N   1 
ATOM   7676  C CA  . ARG E 2 38  ? 43.664  12.548  8.273   1.00 29.00  ? 38  ARG H CA  1 
ATOM   7677  C C   . ARG E 2 38  ? 42.427  11.990  7.619   1.00 31.09  ? 38  ARG H C   1 
ATOM   7678  O O   . ARG E 2 38  ? 42.439  11.717  6.436   1.00 31.56  ? 38  ARG H O   1 
ATOM   7679  C CB  . ARG E 2 38  ? 43.677  14.042  8.079   1.00 29.04  ? 38  ARG H CB  1 
ATOM   7680  C CG  . ARG E 2 38  ? 42.549  14.733  8.752   1.00 29.68  ? 38  ARG H CG  1 
ATOM   7681  C CD  . ARG E 2 38  ? 42.699  16.200  8.584   1.00 25.49  ? 38  ARG H CD  1 
ATOM   7682  N NE  . ARG E 2 38  ? 42.312  16.563  7.230   1.00 34.19  ? 38  ARG H NE  1 
ATOM   7683  C CZ  . ARG E 2 38  ? 42.237  17.803  6.766   1.00 35.19  ? 38  ARG H CZ  1 
ATOM   7684  N NH1 . ARG E 2 38  ? 42.531  18.839  7.538   1.00 35.60  ? 38  ARG H NH1 1 
ATOM   7685  N NH2 . ARG E 2 38  ? 41.858  17.998  5.517   1.00 36.29  ? 38  ARG H NH2 1 
ATOM   7686  N N   . GLN E 2 39  ? 41.368  11.797  8.395   1.00 32.92  ? 39  GLN H N   1 
ATOM   7687  C CA  . GLN E 2 39  ? 40.079  11.370  7.865   1.00 34.90  ? 39  GLN H CA  1 
ATOM   7688  C C   . GLN E 2 39  ? 38.969  12.157  8.530   1.00 36.77  ? 39  GLN H C   1 
ATOM   7689  O O   . GLN E 2 39  ? 38.596  11.902  9.667   1.00 36.97  ? 39  GLN H O   1 
ATOM   7690  C CB  . GLN E 2 39  ? 39.846  9.883   8.072   1.00 35.31  ? 39  GLN H CB  1 
ATOM   7691  C CG  . GLN E 2 39  ? 38.602  9.362   7.367   1.00 36.68  ? 39  GLN H CG  1 
ATOM   7692  C CD  . GLN E 2 39  ? 38.461  7.861   7.481   1.00 37.56  ? 39  GLN H CD  1 
ATOM   7693  O OE1 . GLN E 2 39  ? 38.890  7.268   8.469   1.00 37.53  ? 39  GLN H OE1 1 
ATOM   7694  N NE2 . GLN E 2 39  ? 37.865  7.233   6.472   1.00 28.75  ? 39  GLN H NE2 1 
ATOM   7695  N N   . MET E 2 40  ? 38.464  13.136  7.803   1.00 38.67  ? 40  MET H N   1 
ATOM   7696  C CA  . MET E 2 40  ? 37.371  13.925  8.276   1.00 41.65  ? 40  MET H CA  1 
ATOM   7697  C C   . MET E 2 40  ? 36.143  13.038  8.354   1.00 45.09  ? 40  MET H C   1 
ATOM   7698  O O   . MET E 2 40  ? 35.989  12.107  7.561   1.00 45.52  ? 40  MET H O   1 
ATOM   7699  C CB  . MET E 2 40  ? 37.127  15.090  7.334   1.00 42.10  ? 40  MET H CB  1 
ATOM   7700  C CG  . MET E 2 40  ? 37.133  16.412  8.056   1.00 42.53  ? 40  MET H CG  1 
ATOM   7701  S SD  . MET E 2 40  ? 38.692  17.262  7.879   1.00 56.46  ? 40  MET H SD  1 
ATOM   7702  C CE  . MET E 2 40  ? 38.564  17.714  6.153   1.00 73.74  ? 40  MET H CE  1 
ATOM   7703  N N   . PRO E 2 41  ? 35.276  13.302  9.347   1.00 47.81  ? 41  PRO H N   1 
ATOM   7704  C CA  . PRO E 2 41  ? 34.038  12.527  9.516   1.00 49.53  ? 41  PRO H CA  1 
ATOM   7705  C C   . PRO E 2 41  ? 33.288  12.406  8.197   1.00 51.08  ? 41  PRO H C   1 
ATOM   7706  O O   . PRO E 2 41  ? 33.041  13.435  7.560   1.00 51.96  ? 41  PRO H O   1 
ATOM   7707  C CB  . PRO E 2 41  ? 33.235  13.380  10.494  1.00 51.14  ? 41  PRO H CB  1 
ATOM   7708  C CG  . PRO E 2 41  ? 34.309  14.085  11.344  1.00 50.09  ? 41  PRO H CG  1 
ATOM   7709  C CD  . PRO E 2 41  ? 35.473  14.313  10.417  1.00 48.43  ? 41  PRO H CD  1 
ATOM   7710  N N   . GLY E 2 42  ? 32.985  11.180  7.773   1.00 51.64  ? 42  GLY H N   1 
ATOM   7711  C CA  . GLY E 2 42  ? 32.141  10.972  6.613   1.00 53.54  ? 42  GLY H CA  1 
ATOM   7712  C C   . GLY E 2 42  ? 32.788  11.239  5.254   1.00 53.80  ? 42  GLY H C   1 
ATOM   7713  O O   . GLY E 2 42  ? 32.129  11.175  4.190   1.00 55.41  ? 42  GLY H O   1 
ATOM   7714  N N   . LYS E 2 43  ? 34.086  11.525  5.264   1.00 52.39  ? 43  LYS H N   1 
ATOM   7715  C CA  . LYS E 2 43  ? 34.789  11.734  4.008   1.00 52.54  ? 43  LYS H CA  1 
ATOM   7716  C C   . LYS E 2 43  ? 35.871  10.692  3.837   1.00 50.11  ? 43  LYS H C   1 
ATOM   7717  O O   . LYS E 2 43  ? 35.972  9.745   4.618   1.00 49.35  ? 43  LYS H O   1 
ATOM   7718  C CB  . LYS E 2 43  ? 35.378  13.154  3.925   1.00 53.55  ? 43  LYS H CB  1 
ATOM   7719  C CG  . LYS E 2 43  ? 34.354  14.254  3.613   1.00 56.76  ? 43  LYS H CG  1 
ATOM   7720  C CD  . LYS E 2 43  ? 34.916  15.622  3.965   1.00 57.48  ? 43  LYS H CD  1 
ATOM   7721  C CE  . LYS E 2 43  ? 33.822  16.600  4.432   1.00 59.98  ? 43  LYS H CE  1 
ATOM   7722  N NZ  . LYS E 2 43  ? 34.417  17.728  5.247   1.00 59.88  ? 43  LYS H NZ  1 
ATOM   7723  N N   . GLY E 2 44  ? 36.665  10.881  2.788   1.00 48.94  ? 44  GLY H N   1 
ATOM   7724  C CA  . GLY E 2 44  ? 37.850  10.082  2.551   1.00 46.24  ? 44  GLY H CA  1 
ATOM   7725  C C   . GLY E 2 44  ? 39.103  10.552  3.294   1.00 42.44  ? 44  GLY H C   1 
ATOM   7726  O O   . GLY E 2 44  ? 39.134  11.598  3.970   1.00 41.63  ? 44  GLY H O   1 
ATOM   7727  N N   . LEU E 2 45  ? 40.140  9.739   3.142   1.00 39.90  ? 45  LEU H N   1 
ATOM   7728  C CA  . LEU E 2 45  ? 41.424  9.975   3.745   1.00 37.02  ? 45  LEU H CA  1 
ATOM   7729  C C   . LEU E 2 45  ? 42.254  10.938  2.936   1.00 35.63  ? 45  LEU H C   1 
ATOM   7730  O O   . LEU E 2 45  ? 42.092  11.024  1.724   1.00 36.43  ? 45  LEU H O   1 
ATOM   7731  C CB  . LEU E 2 45  ? 42.178  8.661   3.839   1.00 36.59  ? 45  LEU H CB  1 
ATOM   7732  C CG  . LEU E 2 45  ? 41.662  7.696   4.890   1.00 26.26  ? 45  LEU H CG  1 
ATOM   7733  C CD1 . LEU E 2 45  ? 41.091  6.465   4.230   1.00 27.51  ? 45  LEU H CD1 1 
ATOM   7734  C CD2 . LEU E 2 45  ? 42.797  7.337   5.834   1.00 26.22  ? 45  LEU H CD2 1 
ATOM   7735  N N   . GLU E 2 46  ? 43.148  11.651  3.619   1.00 33.74  ? 46  GLU H N   1 
ATOM   7736  C CA  . GLU E 2 46  ? 44.249  12.357  2.969   1.00 32.81  ? 46  GLU H CA  1 
ATOM   7737  C C   . GLU E 2 46  ? 45.570  11.981  3.618   1.00 31.64  ? 46  GLU H C   1 
ATOM   7738  O O   . GLU E 2 46  ? 45.664  11.894  4.841   1.00 31.14  ? 46  GLU H O   1 
ATOM   7739  C CB  . GLU E 2 46  ? 44.062  13.864  3.032   1.00 32.75  ? 46  GLU H CB  1 
ATOM   7740  C CG  . GLU E 2 46  ? 42.885  14.344  2.269   1.00 34.15  ? 46  GLU H CG  1 
ATOM   7741  C CD  . GLU E 2 46  ? 42.639  15.821  2.444   1.00 35.28  ? 46  GLU H CD  1 
ATOM   7742  O OE1 . GLU E 2 46  ? 43.150  16.596  1.596   1.00 36.34  ? 46  GLU H OE1 1 
ATOM   7743  O OE2 . GLU E 2 46  ? 41.946  16.208  3.429   1.00 35.33  ? 46  GLU H OE2 1 
ATOM   7744  N N   . TRP E 2 47  ? 46.580  11.741  2.798   1.00 31.53  ? 47  TRP H N   1 
ATOM   7745  C CA  . TRP E 2 47  ? 47.946  11.676  3.273   1.00 24.04  ? 47  TRP H CA  1 
ATOM   7746  C C   . TRP E 2 47  ? 48.415  13.064  3.701   1.00 23.97  ? 47  TRP H C   1 
ATOM   7747  O O   . TRP E 2 47  ? 48.159  14.057  3.033   1.00 24.52  ? 47  TRP H O   1 
ATOM   7748  C CB  . TRP E 2 47  ? 48.833  11.101  2.180   1.00 24.57  ? 47  TRP H CB  1 
ATOM   7749  C CG  . TRP E 2 47  ? 50.265  11.113  2.451   1.00 24.57  ? 47  TRP H CG  1 
ATOM   7750  C CD1 . TRP E 2 47  ? 50.944  10.268  3.272   1.00 26.95  ? 47  TRP H CD1 1 
ATOM   7751  C CD2 . TRP E 2 47  ? 51.244  11.981  1.865   1.00 27.78  ? 47  TRP H CD2 1 
ATOM   7752  N NE1 . TRP E 2 47  ? 52.293  10.571  3.262   1.00 27.32  ? 47  TRP H NE1 1 
ATOM   7753  C CE2 . TRP E 2 47  ? 52.504  11.620  2.410   1.00 27.78  ? 47  TRP H CE2 1 
ATOM   7754  C CE3 . TRP E 2 47  ? 51.180  13.042  0.965   1.00 25.60  ? 47  TRP H CE3 1 
ATOM   7755  C CZ2 . TRP E 2 47  ? 53.686  12.273  2.062   1.00 25.78  ? 47  TRP H CZ2 1 
ATOM   7756  C CZ3 . TRP E 2 47  ? 52.344  13.692  0.638   1.00 26.21  ? 47  TRP H CZ3 1 
ATOM   7757  C CH2 . TRP E 2 47  ? 53.586  13.307  1.185   1.00 26.26  ? 47  TRP H CH2 1 
ATOM   7758  N N   . MET E 2 48  ? 49.070  13.128  4.852   1.00 23.60  ? 48  MET H N   1 
ATOM   7759  C CA  . MET E 2 48  ? 49.601  14.390  5.364   1.00 23.81  ? 48  MET H CA  1 
ATOM   7760  C C   . MET E 2 48  ? 51.105  14.472  5.166   1.00 24.16  ? 48  MET H C   1 
ATOM   7761  O O   . MET E 2 48  ? 51.622  15.532  4.904   1.00 24.75  ? 48  MET H O   1 
ATOM   7762  C CB  . MET E 2 48  ? 49.279  14.592  6.864   1.00 23.60  ? 48  MET H CB  1 
ATOM   7763  C CG  . MET E 2 48  ? 47.809  14.437  7.236   1.00 36.13  ? 48  MET H CG  1 
ATOM   7764  S SD  . MET E 2 48  ? 47.400  14.498  9.010   1.00 28.07  ? 48  MET H SD  1 
ATOM   7765  C CE  . MET E 2 48  ? 47.608  16.242  9.289   1.00 24.22  ? 48  MET H CE  1 
ATOM   7766  N N   . GLY E 2 49  ? 51.807  13.356  5.313   1.00 24.10  ? 49  GLY H N   1 
ATOM   7767  C CA  . GLY E 2 49  ? 53.242  13.412  5.452   1.00 24.68  ? 49  GLY H CA  1 
ATOM   7768  C C   . GLY E 2 49  ? 53.899  12.098  5.789   1.00 26.49  ? 49  GLY H C   1 
ATOM   7769  O O   . GLY E 2 49  ? 53.261  11.206  6.338   1.00 26.72  ? 49  GLY H O   1 
ATOM   7770  N N   . ASP E 2 50  ? 55.175  11.978  5.427   1.00 27.73  ? 50  ASP H N   1 
ATOM   7771  C CA  . ASP E 2 50  ? 55.992  10.810  5.740   1.00 29.47  ? 50  ASP H CA  1 
ATOM   7772  C C   . ASP E 2 50  ? 57.164  11.293  6.565   1.00 30.13  ? 50  ASP H C   1 
ATOM   7773  O O   . ASP E 2 50  ? 57.626  12.419  6.402   1.00 30.21  ? 50  ASP H O   1 
ATOM   7774  C CB  . ASP E 2 50  ? 56.548  10.151  4.473   1.00 31.54  ? 50  ASP H CB  1 
ATOM   7775  C CG  . ASP E 2 50  ? 55.497  9.391   3.676   1.00 32.46  ? 50  ASP H CG  1 
ATOM   7776  O OD1 . ASP E 2 50  ? 54.535  8.855   4.272   1.00 32.29  ? 50  ASP H OD1 1 
ATOM   7777  O OD2 . ASP E 2 50  ? 55.641  9.325   2.430   1.00 33.34  ? 50  ASP H OD2 1 
ATOM   7778  N N   . ILE E 2 51  ? 57.669  10.449  7.447   1.00 30.86  ? 51  ILE H N   1 
ATOM   7779  C CA  . ILE E 2 51  ? 58.887  10.816  8.134   1.00 29.70  ? 51  ILE H CA  1 
ATOM   7780  C C   . ILE E 2 51  ? 59.835  9.647   8.105   1.00 31.30  ? 51  ILE H C   1 
ATOM   7781  O O   . ILE E 2 51  ? 59.407  8.500   8.132   1.00 31.45  ? 51  ILE H O   1 
ATOM   7782  C CB  . ILE E 2 51  ? 58.641  11.367  9.575   1.00 33.23  ? 51  ILE H CB  1 
ATOM   7783  C CG1 . ILE E 2 51  ? 59.955  11.892  10.148  1.00 34.86  ? 51  ILE H CG1 1 
ATOM   7784  C CG2 . ILE E 2 51  ? 57.942  10.342  10.500  1.00 29.78  ? 51  ILE H CG2 1 
ATOM   7785  C CD1 . ILE E 2 51  ? 59.799  12.626  11.431  1.00 35.26  ? 51  ILE H CD1 1 
ATOM   7786  N N   . ILE E 2 52  ? 61.119  9.945   7.971   1.00 32.77  ? 52  ILE H N   1 
ATOM   7787  C CA  . ILE E 2 52  ? 62.156  8.929   8.098   1.00 38.14  ? 52  ILE H CA  1 
ATOM   7788  C C   . ILE E 2 52  ? 62.698  8.958   9.525   1.00 42.39  ? 52  ILE H C   1 
ATOM   7789  O O   . ILE E 2 52  ? 63.338  9.921   9.935   1.00 40.27  ? 52  ILE H O   1 
ATOM   7790  C CB  . ILE E 2 52  ? 63.309  9.169   7.122   1.00 36.09  ? 52  ILE H CB  1 
ATOM   7791  C CG1 . ILE E 2 52  ? 62.845  8.945   5.683   1.00 35.19  ? 52  ILE H CG1 1 
ATOM   7792  C CG2 . ILE E 2 52  ? 64.500  8.293   7.484   1.00 38.74  ? 52  ILE H CG2 1 
ATOM   7793  C CD1 . ILE E 2 52  ? 63.619  9.756   4.667   1.00 35.79  ? 52  ILE H CD1 1 
ATOM   7794  N N   . PRO E 2 53  ? 62.415  7.908   10.295  1.00 40.31  ? 53  PRO H N   1 
ATOM   7795  C CA  . PRO E 2 53  ? 62.802  7.825   11.702  1.00 38.73  ? 53  PRO H CA  1 
ATOM   7796  C C   . PRO E 2 53  ? 64.309  7.893   11.891  1.00 41.95  ? 53  PRO H C   1 
ATOM   7797  O O   . PRO E 2 53  ? 64.777  8.506   12.852  1.00 43.14  ? 53  PRO H O   1 
ATOM   7798  C CB  . PRO E 2 53  ? 62.299  6.446   12.094  1.00 39.50  ? 53  PRO H CB  1 
ATOM   7799  C CG  . PRO E 2 53  ? 61.139  6.230   11.203  1.00 37.25  ? 53  PRO H CG  1 
ATOM   7800  C CD  . PRO E 2 53  ? 61.574  6.772   9.894   1.00 36.53  ? 53  PRO H CD  1 
ATOM   7801  N N   . SER E 2 54  ? 65.050  7.268   10.982  1.00 43.16  ? 54  SER H N   1 
ATOM   7802  C CA  . SER E 2 54  ? 66.493  7.176   11.091  1.00 46.30  ? 54  SER H CA  1 
ATOM   7803  C C   . SER E 2 54  ? 67.135  8.541   11.315  1.00 46.57  ? 54  SER H C   1 
ATOM   7804  O O   . SER E 2 54  ? 68.059  8.688   12.133  1.00 49.13  ? 54  SER H O   1 
ATOM   7805  C CB  . SER E 2 54  ? 67.073  6.515   9.846   1.00 47.59  ? 54  SER H CB  1 
ATOM   7806  O OG  . SER E 2 54  ? 67.843  7.442   9.103   1.00 47.96  ? 54  SER H OG  1 
ATOM   7807  N N   . ASN E 2 55  ? 66.615  9.547   10.625  1.00 43.45  ? 55  ASN H N   1 
ATOM   7808  C CA  . ASN E 2 55  ? 67.213  10.874  10.675  1.00 43.92  ? 55  ASN H CA  1 
ATOM   7809  C C   . ASN E 2 55  ? 66.255  12.034  10.805  1.00 41.70  ? 55  ASN H C   1 
ATOM   7810  O O   . ASN E 2 55  ? 66.684  13.181  10.787  1.00 42.22  ? 55  ASN H O   1 
ATOM   7811  C CB  . ASN E 2 55  ? 68.084  11.114  9.452   1.00 44.74  ? 55  ASN H CB  1 
ATOM   7812  C CG  . ASN E 2 55  ? 67.293  11.162  8.162   1.00 42.44  ? 55  ASN H CG  1 
ATOM   7813  O OD1 . ASN E 2 55  ? 66.051  11.137  8.142   1.00 40.12  ? 55  ASN H OD1 1 
ATOM   7814  N ND2 . ASN E 2 55  ? 68.018  11.232  7.063   1.00 43.37  ? 55  ASN H ND2 1 
ATOM   7815  N N   . GLY E 2 56  ? 64.963  11.733  10.887  1.00 39.50  ? 56  GLY H N   1 
ATOM   7816  C CA  . GLY E 2 56  ? 63.939  12.752  11.025  1.00 37.58  ? 56  GLY H CA  1 
ATOM   7817  C C   . GLY E 2 56  ? 63.537  13.555  9.803   1.00 36.11  ? 56  GLY H C   1 
ATOM   7818  O O   . GLY E 2 56  ? 62.777  14.510  9.936   1.00 38.54  ? 56  GLY H O   1 
ATOM   7819  N N   . ALA E 2 57  ? 64.031  13.189  8.622   1.00 36.37  ? 57  ALA H N   1 
ATOM   7820  C CA  . ALA E 2 57  ? 63.669  13.933  7.404   1.00 35.35  ? 57  ALA H CA  1 
ATOM   7821  C C   . ALA E 2 57  ? 62.182  13.780  7.094   1.00 33.85  ? 57  ALA H C   1 
ATOM   7822  O O   . ALA E 2 57  ? 61.611  12.709  7.274   1.00 33.20  ? 57  ALA H O   1 
ATOM   7823  C CB  . ALA E 2 57  ? 64.506  13.493  6.225   1.00 36.38  ? 57  ALA H CB  1 
ATOM   7824  N N   . THR E 2 58  ? 61.551  14.853  6.644   1.00 32.29  ? 58  THR H N   1 
ATOM   7825  C CA  . THR E 2 58  ? 60.117  14.832  6.365   1.00 30.50  ? 58  THR H CA  1 
ATOM   7826  C C   . THR E 2 58  ? 59.727  15.090  4.899   1.00 34.72  ? 58  THR H C   1 
ATOM   7827  O O   . THR E 2 58  ? 60.398  15.837  4.169   1.00 31.15  ? 58  THR H O   1 
ATOM   7828  C CB  . THR E 2 58  ? 59.398  15.898  7.194   1.00 33.04  ? 58  THR H CB  1 
ATOM   7829  O OG1 . THR E 2 58  ? 60.074  17.148  7.021   1.00 34.35  ? 58  THR H OG1 1 
ATOM   7830  C CG2 . THR E 2 58  ? 59.371  15.520  8.663   1.00 30.26  ? 58  THR H CG2 1 
ATOM   7831  N N   . PHE E 2 59  ? 58.610  14.491  4.495   1.00 28.87  ? 59  PHE H N   1 
ATOM   7832  C CA  . PHE E 2 59  ? 57.959  14.835  3.239   1.00 32.01  ? 59  PHE H CA  1 
ATOM   7833  C C   . PHE E 2 59  ? 56.503  15.154  3.538   1.00 27.45  ? 59  PHE H C   1 
ATOM   7834  O O   . PHE E 2 59  ? 55.777  14.279  3.925   1.00 26.59  ? 59  PHE H O   1 
ATOM   7835  C CB  . PHE E 2 59  ? 57.984  13.674  2.234   1.00 32.16  ? 59  PHE H CB  1 
ATOM   7836  C CG  . PHE E 2 59  ? 59.300  12.939  2.130   1.00 29.90  ? 59  PHE H CG  1 
ATOM   7837  C CD1 . PHE E 2 59  ? 60.037  12.988  0.954   1.00 33.65  ? 59  PHE H CD1 1 
ATOM   7838  C CD2 . PHE E 2 59  ? 59.768  12.148  3.169   1.00 30.15  ? 59  PHE H CD2 1 
ATOM   7839  C CE1 . PHE E 2 59  ? 61.233  12.285  0.832   1.00 35.70  ? 59  PHE H CE1 1 
ATOM   7840  C CE2 . PHE E 2 59  ? 60.960  11.447  3.055   1.00 34.18  ? 59  PHE H CE2 1 
ATOM   7841  C CZ  . PHE E 2 59  ? 61.697  11.511  1.886   1.00 32.80  ? 59  PHE H CZ  1 
ATOM   7842  N N   . TYR E 2 60  ? 56.069  16.387  3.329   1.00 27.72  ? 60  TYR H N   1 
ATOM   7843  C CA  . TYR E 2 60  ? 54.680  16.763  3.561   1.00 27.01  ? 60  TYR H CA  1 
ATOM   7844  C C   . TYR E 2 60  ? 53.845  16.924  2.296   1.00 34.66  ? 60  TYR H C   1 
ATOM   7845  O O   . TYR E 2 60  ? 54.313  17.416  1.257   1.00 35.79  ? 60  TYR H O   1 
ATOM   7846  C CB  . TYR E 2 60  ? 54.627  18.120  4.248   1.00 27.67  ? 60  TYR H CB  1 
ATOM   7847  C CG  . TYR E 2 60  ? 55.068  18.152  5.670   1.00 27.65  ? 60  TYR H CG  1 
ATOM   7848  C CD1 . TYR E 2 60  ? 54.179  17.878  6.700   1.00 28.56  ? 60  TYR H CD1 1 
ATOM   7849  C CD2 . TYR E 2 60  ? 56.369  18.483  5.990   1.00 28.72  ? 60  TYR H CD2 1 
ATOM   7850  C CE1 . TYR E 2 60  ? 54.598  17.926  8.021   1.00 29.02  ? 60  TYR H CE1 1 
ATOM   7851  C CE2 . TYR E 2 60  ? 56.789  18.530  7.276   1.00 29.06  ? 60  TYR H CE2 1 
ATOM   7852  C CZ  . TYR E 2 60  ? 55.914  18.261  8.307   1.00 30.17  ? 60  TYR H CZ  1 
ATOM   7853  O OH  . TYR E 2 60  ? 56.380  18.325  9.617   1.00 30.88  ? 60  TYR H OH  1 
ATOM   7854  N N   . ASN E 2 61  ? 52.581  16.566  2.400   1.00 26.49  ? 61  ASN H N   1 
ATOM   7855  C CA  . ASN E 2 61  ? 51.597  17.057  1.469   1.00 28.72  ? 61  ASN H CA  1 
ATOM   7856  C C   . ASN E 2 61  ? 51.547  18.558  1.699   1.00 29.91  ? 61  ASN H C   1 
ATOM   7857  O O   . ASN E 2 61  ? 51.407  18.997  2.828   1.00 27.85  ? 61  ASN H O   1 
ATOM   7858  C CB  . ASN E 2 61  ? 50.276  16.385  1.800   1.00 27.94  ? 61  ASN H CB  1 
ATOM   7859  C CG  . ASN E 2 61  ? 49.106  16.920  1.006   1.00 29.07  ? 61  ASN H CG  1 
ATOM   7860  O OD1 . ASN E 2 61  ? 49.082  18.079  0.578   1.00 28.36  ? 61  ASN H OD1 1 
ATOM   7861  N ND2 . ASN E 2 61  ? 48.090  16.074  0.846   1.00 28.52  ? 61  ASN H ND2 1 
ATOM   7862  N N   . GLN E 2 62  ? 51.659  19.350  0.641   1.00 31.60  ? 62  GLN H N   1 
ATOM   7863  C CA  . GLN E 2 62  ? 51.797  20.801  0.796   1.00 33.67  ? 62  GLN H CA  1 
ATOM   7864  C C   . GLN E 2 62  ? 50.622  21.458  1.492   1.00 33.75  ? 62  GLN H C   1 
ATOM   7865  O O   . GLN E 2 62  ? 50.760  22.513  2.102   1.00 34.60  ? 62  GLN H O   1 
ATOM   7866  C CB  . GLN E 2 62  ? 52.018  21.480  -0.555  1.00 36.58  ? 62  GLN H CB  1 
ATOM   7867  C CG  . GLN E 2 62  ? 52.382  22.971  -0.471  1.00 39.54  ? 62  GLN H CG  1 
ATOM   7868  C CD  . GLN E 2 62  ? 53.755  23.222  0.148   1.00 40.66  ? 62  GLN H CD  1 
ATOM   7869  O OE1 . GLN E 2 62  ? 54.575  22.294  0.302   1.00 39.94  ? 62  GLN H OE1 1 
ATOM   7870  N NE2 . GLN E 2 62  ? 54.014  24.483  0.514   1.00 42.62  ? 62  GLN H NE2 1 
ATOM   7871  N N   . LYS E 2 63  ? 49.460  20.834  1.388   1.00 33.37  ? 63  LYS H N   1 
ATOM   7872  C CA  . LYS E 2 63  ? 48.250  21.346  2.018   1.00 34.13  ? 63  LYS H CA  1 
ATOM   7873  C C   . LYS E 2 63  ? 48.405  21.444  3.528   1.00 33.73  ? 63  LYS H C   1 
ATOM   7874  O O   . LYS E 2 63  ? 47.824  22.327  4.170   1.00 34.95  ? 63  LYS H O   1 
ATOM   7875  C CB  . LYS E 2 63  ? 47.098  20.412  1.692   1.00 33.70  ? 63  LYS H CB  1 
ATOM   7876  C CG  . LYS E 2 63  ? 45.824  20.692  2.449   1.00 34.14  ? 63  LYS H CG  1 
ATOM   7877  C CD  . LYS E 2 63  ? 44.839  19.549  2.245   1.00 33.58  ? 63  LYS H CD  1 
ATOM   7878  C CE  . LYS E 2 63  ? 43.526  20.018  1.624   1.00 35.37  ? 63  LYS H CE  1 
ATOM   7879  N NZ  . LYS E 2 63  ? 42.422  19.179  2.146   1.00 34.72  ? 63  LYS H NZ  1 
ATOM   7880  N N   . PHE E 2 64  ? 49.206  20.532  4.078   1.00 32.23  ? 64  PHE H N   1 
ATOM   7881  C CA  . PHE E 2 64  ? 49.404  20.406  5.507   1.00 31.44  ? 64  PHE H CA  1 
ATOM   7882  C C   . PHE E 2 64  ? 50.728  20.978  5.959   1.00 32.31  ? 64  PHE H C   1 
ATOM   7883  O O   . PHE E 2 64  ? 50.987  21.048  7.168   1.00 32.54  ? 64  PHE H O   1 
ATOM   7884  C CB  . PHE E 2 64  ? 49.357  18.937  5.895   1.00 29.96  ? 64  PHE H CB  1 
ATOM   7885  C CG  . PHE E 2 64  ? 47.999  18.325  5.765   1.00 29.70  ? 64  PHE H CG  1 
ATOM   7886  C CD1 . PHE E 2 64  ? 47.072  18.455  6.774   1.00 29.53  ? 64  PHE H CD1 1 
ATOM   7887  C CD2 . PHE E 2 64  ? 47.640  17.634  4.612   1.00 29.90  ? 64  PHE H CD2 1 
ATOM   7888  C CE1 . PHE E 2 64  ? 45.806  17.899  6.647   1.00 29.66  ? 64  PHE H CE1 1 
ATOM   7889  C CE2 . PHE E 2 64  ? 46.367  17.060  4.478   1.00 29.86  ? 64  PHE H CE2 1 
ATOM   7890  C CZ  . PHE E 2 64  ? 45.443  17.197  5.497   1.00 29.73  ? 64  PHE H CZ  1 
ATOM   7891  N N   . LYS E 2 65  ? 51.558  21.385  4.999   1.00 33.04  ? 65  LYS H N   1 
ATOM   7892  C CA  . LYS E 2 65  ? 52.921  21.811  5.273   1.00 33.66  ? 65  LYS H CA  1 
ATOM   7893  C C   . LYS E 2 65  ? 53.051  22.829  6.398   1.00 35.47  ? 65  LYS H C   1 
ATOM   7894  O O   . LYS E 2 65  ? 53.670  22.536  7.444   1.00 35.94  ? 65  LYS H O   1 
ATOM   7895  C CB  . LYS E 2 65  ? 53.581  22.338  4.026   1.00 34.56  ? 65  LYS H CB  1 
ATOM   7896  C CG  . LYS E 2 65  ? 55.006  22.774  4.227   1.00 35.47  ? 65  LYS H CG  1 
ATOM   7897  C CD  . LYS E 2 65  ? 55.905  21.607  4.540   1.00 34.20  ? 65  LYS H CD  1 
ATOM   7898  C CE  . LYS E 2 65  ? 57.370  21.986  4.359   1.00 35.50  ? 65  LYS H CE  1 
ATOM   7899  N NZ  . LYS E 2 65  ? 57.693  22.391  2.980   1.00 36.54  ? 65  LYS H NZ  1 
ATOM   7900  N N   . GLY E 2 66  ? 52.481  24.013  6.248   1.00 37.03  ? 66  GLY H N   1 
ATOM   7901  C CA  . GLY E 2 66  ? 52.628  24.959  7.349   1.00 38.95  ? 66  GLY H CA  1 
ATOM   7902  C C   . GLY E 2 66  ? 51.843  24.692  8.653   1.00 38.81  ? 66  GLY H C   1 
ATOM   7903  O O   . GLY E 2 66  ? 52.045  25.376  9.642   1.00 34.89  ? 66  GLY H O   1 
ATOM   7904  N N   . GLN E 2 67  ? 50.957  23.696  8.663   1.00 37.39  ? 67  GLN H N   1 
ATOM   7905  C CA  . GLN E 2 67  ? 49.831  23.712  9.571   1.00 37.87  ? 67  GLN H CA  1 
ATOM   7906  C C   . GLN E 2 67  ? 49.999  22.721  10.683  1.00 36.72  ? 67  GLN H C   1 
ATOM   7907  O O   . GLN E 2 67  ? 49.281  22.775  11.687  1.00 37.01  ? 67  GLN H O   1 
ATOM   7908  C CB  . GLN E 2 67  ? 48.546  23.360  8.825   1.00 38.21  ? 67  GLN H CB  1 
ATOM   7909  C CG  . GLN E 2 67  ? 48.391  23.989  7.450   1.00 40.04  ? 67  GLN H CG  1 
ATOM   7910  C CD  . GLN E 2 67  ? 48.226  25.492  7.513   1.00 43.07  ? 67  GLN H CD  1 
ATOM   7911  O OE1 . GLN E 2 67  ? 47.421  26.006  8.298   1.00 44.09  ? 67  GLN H OE1 1 
ATOM   7912  N NE2 . GLN E 2 67  ? 49.000  26.214  6.685   1.00 44.69  ? 67  GLN H NE2 1 
ATOM   7913  N N   . VAL E 2 68  ? 50.933  21.800  10.501  1.00 35.71  ? 68  VAL H N   1 
ATOM   7914  C CA  . VAL E 2 68  ? 51.061  20.687  11.416  1.00 28.62  ? 68  VAL H CA  1 
ATOM   7915  C C   . VAL E 2 68  ? 52.482  20.189  11.300  1.00 28.61  ? 68  VAL H C   1 
ATOM   7916  O O   . VAL E 2 68  ? 53.081  20.270  10.238  1.00 31.81  ? 68  VAL H O   1 
ATOM   7917  C CB  . VAL E 2 68  ? 50.017  19.575  11.082  1.00 27.17  ? 68  VAL H CB  1 
ATOM   7918  C CG1 . VAL E 2 68  ? 50.448  18.740  9.879   1.00 26.27  ? 68  VAL H CG1 1 
ATOM   7919  C CG2 . VAL E 2 68  ? 49.762  18.700  12.290  1.00 33.31  ? 68  VAL H CG2 1 
ATOM   7920  N N   . THR E 2 69  ? 53.059  19.714  12.396  1.00 29.71  ? 69  THR H N   1 
ATOM   7921  C CA  . THR E 2 69  ? 54.436  19.246  12.312  1.00 29.93  ? 69  THR H CA  1 
ATOM   7922  C C   . THR E 2 69  ? 54.603  17.786  12.728  1.00 28.62  ? 69  THR H C   1 
ATOM   7923  O O   . THR E 2 69  ? 54.061  17.348  13.732  1.00 28.60  ? 69  THR H O   1 
ATOM   7924  C CB  . THR E 2 69  ? 55.472  20.222  12.996  1.00 34.38  ? 69  THR H CB  1 
ATOM   7925  O OG1 . THR E 2 69  ? 56.288  19.493  13.912  1.00 31.86  ? 69  THR H OG1 1 
ATOM   7926  C CG2 . THR E 2 69  ? 54.793  21.423  13.696  1.00 32.30  ? 69  THR H CG2 1 
ATOM   7927  N N   . ILE E 2 70  ? 55.323  17.036  11.894  1.00 28.69  ? 70  ILE H N   1 
ATOM   7928  C CA  . ILE E 2 70  ? 55.555  15.604  12.085  1.00 28.02  ? 70  ILE H CA  1 
ATOM   7929  C C   . ILE E 2 70  ? 56.966  15.446  12.605  1.00 29.55  ? 70  ILE H C   1 
ATOM   7930  O O   . ILE E 2 70  ? 57.868  16.149  12.162  1.00 30.39  ? 70  ILE H O   1 
ATOM   7931  C CB  . ILE E 2 70  ? 55.413  14.809  10.758  1.00 27.07  ? 70  ILE H CB  1 
ATOM   7932  C CG1 . ILE E 2 70  ? 54.033  15.002  10.156  1.00 25.90  ? 70  ILE H CG1 1 
ATOM   7933  C CG2 . ILE E 2 70  ? 55.657  13.325  10.941  1.00 27.19  ? 70  ILE H CG2 1 
ATOM   7934  C CD1 . ILE E 2 70  ? 53.827  14.177  8.933   1.00 25.71  ? 70  ILE H CD1 1 
ATOM   7935  N N   . SER E 2 71  ? 57.137  14.536  13.562  1.00 30.22  ? 71  SER H N   1 
ATOM   7936  C CA  . SER E 2 71  ? 58.400  14.340  14.259  1.00 32.13  ? 71  SER H CA  1 
ATOM   7937  C C   . SER E 2 71  ? 58.497  12.898  14.686  1.00 38.04  ? 71  SER H C   1 
ATOM   7938  O O   . SER E 2 71  ? 57.510  12.159  14.638  1.00 37.02  ? 71  SER H O   1 
ATOM   7939  C CB  . SER E 2 71  ? 58.462  15.219  15.493  1.00 33.40  ? 71  SER H CB  1 
ATOM   7940  O OG  . SER E 2 71  ? 57.271  15.051  16.241  1.00 35.90  ? 71  SER H OG  1 
ATOM   7941  N N   . ALA E 2 72  ? 59.684  12.490  15.096  1.00 39.92  ? 72  ALA H N   1 
ATOM   7942  C CA  . ALA E 2 72  ? 59.853  11.124  15.525  1.00 41.15  ? 72  ALA H CA  1 
ATOM   7943  C C   . ALA E 2 72  ? 60.964  10.997  16.553  1.00 44.15  ? 72  ALA H C   1 
ATOM   7944  O O   . ALA E 2 72  ? 61.896  11.800  16.602  1.00 45.63  ? 72  ALA H O   1 
ATOM   7945  C CB  . ALA E 2 72  ? 60.095  10.211  14.332  1.00 40.71  ? 72  ALA H CB  1 
ATOM   7946  N N   . ASP E 2 73  ? 60.839  9.983   17.397  1.00 45.20  ? 73  ASP H N   1 
ATOM   7947  C CA  . ASP E 2 73  ? 61.813  9.717   18.434  1.00 47.75  ? 73  ASP H CA  1 
ATOM   7948  C C   . ASP E 2 73  ? 62.199  8.265   18.265  1.00 48.60  ? 73  ASP H C   1 
ATOM   7949  O O   . ASP E 2 73  ? 61.532  7.384   18.797  1.00 48.91  ? 73  ASP H O   1 
ATOM   7950  C CB  . ASP E 2 73  ? 61.172  9.943   19.798  1.00 48.96  ? 73  ASP H CB  1 
ATOM   7951  C CG  . ASP E 2 73  ? 62.173  9.845   20.934  1.00 53.26  ? 73  ASP H CG  1 
ATOM   7952  O OD1 . ASP E 2 73  ? 63.349  9.480   20.676  1.00 55.39  ? 73  ASP H OD1 1 
ATOM   7953  O OD2 . ASP E 2 73  ? 61.781  10.114  22.098  1.00 54.66  ? 73  ASP H OD2 1 
ATOM   7954  N N   . LYS E 2 74  ? 63.252  8.008   17.501  1.00 49.40  ? 74  LYS H N   1 
ATOM   7955  C CA  . LYS E 2 74  ? 63.577  6.634   17.167  1.00 46.98  ? 74  LYS H CA  1 
ATOM   7956  C C   . LYS E 2 74  ? 63.875  5.749   18.381  1.00 53.24  ? 74  LYS H C   1 
ATOM   7957  O O   . LYS E 2 74  ? 63.666  4.533   18.327  1.00 54.23  ? 74  LYS H O   1 
ATOM   7958  C CB  . LYS E 2 74  ? 64.721  6.558   16.166  1.00 47.90  ? 74  LYS H CB  1 
ATOM   7959  C CG  . LYS E 2 74  ? 65.877  7.446   16.485  1.00 49.68  ? 74  LYS H CG  1 
ATOM   7960  C CD  . LYS E 2 74  ? 67.065  7.119   15.595  1.00 51.45  ? 74  LYS H CD  1 
ATOM   7961  C CE  . LYS E 2 74  ? 68.159  8.165   15.719  1.00 52.85  ? 74  LYS H CE  1 
ATOM   7962  N NZ  . LYS E 2 74  ? 69.262  7.875   14.774  1.00 54.45  ? 74  LYS H NZ  1 
ATOM   7963  N N   . SER E 2 75  ? 64.357  6.351   19.466  1.00 55.18  ? 75  SER H N   1 
ATOM   7964  C CA  . SER E 2 75  ? 64.750  5.587   20.646  1.00 59.11  ? 75  SER H CA  1 
ATOM   7965  C C   . SER E 2 75  ? 63.548  4.806   21.158  1.00 58.96  ? 75  SER H C   1 
ATOM   7966  O O   . SER E 2 75  ? 63.572  3.570   21.259  1.00 61.00  ? 75  SER H O   1 
ATOM   7967  C CB  . SER E 2 75  ? 65.283  6.514   21.743  1.00 61.08  ? 75  SER H CB  1 
ATOM   7968  O OG  . SER E 2 75  ? 64.245  7.286   22.326  1.00 59.22  ? 75  SER H OG  1 
ATOM   7969  N N   . ILE E 2 76  ? 62.482  5.541   21.449  1.00 56.64  ? 76  ILE H N   1 
ATOM   7970  C CA  . ILE E 2 76  ? 61.264  4.935   21.954  1.00 56.08  ? 76  ILE H CA  1 
ATOM   7971  C C   . ILE E 2 76  ? 60.276  4.530   20.848  1.00 53.29  ? 76  ILE H C   1 
ATOM   7972  O O   . ILE E 2 76  ? 59.119  4.256   21.136  1.00 52.33  ? 76  ILE H O   1 
ATOM   7973  C CB  . ILE E 2 76  ? 60.583  5.848   22.998  1.00 55.33  ? 76  ILE H CB  1 
ATOM   7974  C CG1 . ILE E 2 76  ? 60.295  7.224   22.411  1.00 51.93  ? 76  ILE H CG1 1 
ATOM   7975  C CG2 . ILE E 2 76  ? 61.472  5.995   24.222  1.00 59.01  ? 76  ILE H CG2 1 
ATOM   7976  C CD1 . ILE E 2 76  ? 59.258  8.006   23.179  1.00 50.80  ? 76  ILE H CD1 1 
ATOM   7977  N N   . SER E 2 77  ? 60.750  4.476   19.597  1.00 52.37  ? 77  SER H N   1 
ATOM   7978  C CA  . SER E 2 77  ? 59.968  4.029   18.433  1.00 45.83  ? 77  SER H CA  1 
ATOM   7979  C C   . SER E 2 77  ? 58.615  4.710   18.311  1.00 45.77  ? 77  SER H C   1 
ATOM   7980  O O   . SER E 2 77  ? 57.593  4.045   18.190  1.00 42.07  ? 77  SER H O   1 
ATOM   7981  C CB  . SER E 2 77  ? 59.761  2.512   18.455  1.00 47.79  ? 77  SER H CB  1 
ATOM   7982  O OG  . SER E 2 77  ? 60.986  1.805   18.542  1.00 51.06  ? 77  SER H OG  1 
ATOM   7983  N N   . THR E 2 78  ? 58.603  6.035   18.354  1.00 44.27  ? 78  THR H N   1 
ATOM   7984  C CA  . THR E 2 78  ? 57.339  6.766   18.325  1.00 42.17  ? 78  THR H CA  1 
ATOM   7985  C C   . THR E 2 78  ? 57.363  7.976   17.390  1.00 39.82  ? 78  THR H C   1 
ATOM   7986  O O   . THR E 2 78  ? 58.350  8.706   17.294  1.00 37.07  ? 78  THR H O   1 
ATOM   7987  C CB  . THR E 2 78  ? 56.911  7.273   19.725  1.00 43.63  ? 78  THR H CB  1 
ATOM   7988  O OG1 . THR E 2 78  ? 57.935  8.123   20.250  1.00 45.70  ? 78  THR H OG1 1 
ATOM   7989  C CG2 . THR E 2 78  ? 56.721  6.145   20.689  1.00 45.87  ? 78  THR H CG2 1 
ATOM   7990  N N   . THR E 2 79  ? 56.256  8.193   16.707  1.00 37.31  ? 79  THR H N   1 
ATOM   7991  C CA  . THR E 2 79  ? 56.153  9.371   15.887  1.00 35.54  ? 79  THR H CA  1 
ATOM   7992  C C   . THR E 2 79  ? 55.040  10.249  16.426  1.00 34.78  ? 79  THR H C   1 
ATOM   7993  O O   . THR E 2 79  ? 54.019  9.766   16.911  1.00 31.30  ? 79  THR H O   1 
ATOM   7994  C CB  . THR E 2 79  ? 55.983  9.047   14.374  1.00 31.07  ? 79  THR H CB  1 
ATOM   7995  O OG1 . THR E 2 79  ? 55.597  10.239  13.690  1.00 29.51  ? 79  THR H OG1 1 
ATOM   7996  C CG2 . THR E 2 79  ? 54.926  7.979   14.137  1.00 30.58  ? 79  THR H CG2 1 
ATOM   7997  N N   . TYR E 2 80  ? 55.254  11.549  16.344  1.00 34.56  ? 80  TYR H N   1 
ATOM   7998  C CA  . TYR E 2 80  ? 54.301  12.502  16.865  1.00 34.21  ? 80  TYR H CA  1 
ATOM   7999  C C   . TYR E 2 80  ? 53.808  13.414  15.755  1.00 32.64  ? 80  TYR H C   1 
ATOM   8000  O O   . TYR E 2 80  ? 54.514  13.677  14.791  1.00 32.56  ? 80  TYR H O   1 
ATOM   8001  C CB  . TYR E 2 80  ? 54.935  13.400  17.951  1.00 35.98  ? 80  TYR H CB  1 
ATOM   8002  C CG  . TYR E 2 80  ? 55.571  12.710  19.128  1.00 38.08  ? 80  TYR H CG  1 
ATOM   8003  C CD1 . TYR E 2 80  ? 54.827  12.376  20.244  1.00 39.04  ? 80  TYR H CD1 1 
ATOM   8004  C CD2 . TYR E 2 80  ? 56.931  12.430  19.137  1.00 39.70  ? 80  TYR H CD2 1 
ATOM   8005  C CE1 . TYR E 2 80  ? 55.412  11.762  21.331  1.00 41.60  ? 80  TYR H CE1 1 
ATOM   8006  C CE2 . TYR E 2 80  ? 57.536  11.814  20.211  1.00 42.24  ? 80  TYR H CE2 1 
ATOM   8007  C CZ  . TYR E 2 80  ? 56.777  11.481  21.318  1.00 43.40  ? 80  TYR H CZ  1 
ATOM   8008  O OH  . TYR E 2 80  ? 57.381  10.873  22.423  1.00 46.46  ? 80  TYR H OH  1 
ATOM   8009  N N   . LEU E 2 81  ? 52.617  13.948  15.969  1.00 32.02  ? 81  LEU H N   1 
ATOM   8010  C CA  . LEU E 2 81  ? 51.986  14.936  15.122  1.00 31.21  ? 81  LEU H CA  1 
ATOM   8011  C C   . LEU E 2 81  ? 51.606  16.085  16.028  1.00 32.37  ? 81  LEU H C   1 
ATOM   8012  O O   . LEU E 2 81  ? 50.949  15.873  17.019  1.00 33.00  ? 81  LEU H O   1 
ATOM   8013  C CB  . LEU E 2 81  ? 50.714  14.315  14.589  1.00 29.95  ? 81  LEU H CB  1 
ATOM   8014  C CG  . LEU E 2 81  ? 50.027  14.912  13.396  1.00 29.05  ? 81  LEU H CG  1 
ATOM   8015  C CD1 . LEU E 2 81  ? 51.058  15.047  12.270  1.00 29.07  ? 81  LEU H CD1 1 
ATOM   8016  C CD2 . LEU E 2 81  ? 48.876  13.990  13.027  1.00 28.14  ? 81  LEU H CD2 1 
ATOM   8017  N N   . GLN E 2 82  ? 52.007  17.307  15.733  1.00 33.08  ? 82  GLN H N   1 
ATOM   8018  C CA  . GLN E 2 82  ? 51.583  18.390  16.614  1.00 34.37  ? 82  GLN H CA  1 
ATOM   8019  C C   . GLN E 2 82  ? 51.133  19.675  15.922  1.00 33.93  ? 82  GLN H C   1 
ATOM   8020  O O   . GLN E 2 82  ? 51.685  20.099  14.902  1.00 33.58  ? 82  GLN H O   1 
ATOM   8021  C CB  . GLN E 2 82  ? 52.624  18.655  17.700  1.00 37.04  ? 82  GLN H CB  1 
ATOM   8022  C CG  . GLN E 2 82  ? 53.530  19.818  17.468  1.00 39.12  ? 82  GLN H CG  1 
ATOM   8023  C CD  . GLN E 2 82  ? 54.936  19.551  18.004  1.00 41.31  ? 82  GLN H CD  1 
ATOM   8024  O OE1 . GLN E 2 82  ? 55.176  19.532  19.243  1.00 42.99  ? 82  GLN H OE1 1 
ATOM   8025  N NE2 . GLN E 2 82  ? 55.887  19.336  17.072  1.00 41.09  ? 82  GLN H NE2 1 
ATOM   8026  N N   . TRP E 2 83  ? 50.081  20.254  16.474  1.00 34.30  ? 83  TRP H N   1 
ATOM   8027  C CA  . TRP E 2 83  ? 49.601  21.539  16.043  1.00 31.56  ? 83  TRP H CA  1 
ATOM   8028  C C   . TRP E 2 83  ? 49.953  22.466  17.178  1.00 37.09  ? 83  TRP H C   1 
ATOM   8029  O O   . TRP E 2 83  ? 50.005  22.045  18.323  1.00 37.65  ? 83  TRP H O   1 
ATOM   8030  C CB  . TRP E 2 83  ? 48.088  21.534  15.907  1.00 40.95  ? 83  TRP H CB  1 
ATOM   8031  C CG  . TRP E 2 83  ? 47.484  20.517  14.986  1.00 29.48  ? 83  TRP H CG  1 
ATOM   8032  C CD1 . TRP E 2 83  ? 47.013  20.737  13.747  1.00 29.06  ? 83  TRP H CD1 1 
ATOM   8033  C CD2 . TRP E 2 83  ? 47.226  19.144  15.275  1.00 32.88  ? 83  TRP H CD2 1 
ATOM   8034  N NE1 . TRP E 2 83  ? 46.496  19.595  13.218  1.00 27.72  ? 83  TRP H NE1 1 
ATOM   8035  C CE2 . TRP E 2 83  ? 46.608  18.594  14.135  1.00 27.27  ? 83  TRP H CE2 1 
ATOM   8036  C CE3 . TRP E 2 83  ? 47.463  18.320  16.386  1.00 28.52  ? 83  TRP H CE3 1 
ATOM   8037  C CZ2 . TRP E 2 83  ? 46.221  17.255  14.061  1.00 30.14  ? 83  TRP H CZ2 1 
ATOM   8038  C CZ3 . TRP E 2 83  ? 47.085  16.981  16.310  1.00 31.52  ? 83  TRP H CZ3 1 
ATOM   8039  C CH2 . TRP E 2 83  ? 46.463  16.463  15.157  1.00 30.37  ? 83  TRP H CH2 1 
ATOM   8040  N N   . SER E 2 84  ? 50.187  23.732  16.870  1.00 35.08  ? 84  SER H N   1 
ATOM   8041  C CA  . SER E 2 84  ? 50.531  24.680  17.902  1.00 37.42  ? 84  SER H CA  1 
ATOM   8042  C C   . SER E 2 84  ? 49.337  25.589  18.221  1.00 39.75  ? 84  SER H C   1 
ATOM   8043  O O   . SER E 2 84  ? 49.320  26.269  19.246  1.00 41.74  ? 84  SER H O   1 
ATOM   8044  C CB  . SER E 2 84  ? 51.787  25.463  17.510  1.00 38.76  ? 84  SER H CB  1 
ATOM   8045  O OG  . SER E 2 84  ? 51.502  26.515  16.616  1.00 39.66  ? 84  SER H OG  1 
ATOM   8046  N N   . SER E 2 85  ? 48.338  25.574  17.342  1.00 39.02  ? 85  SER H N   1 
ATOM   8047  C CA  . SER E 2 85  ? 47.097  26.320  17.527  1.00 40.66  ? 85  SER H CA  1 
ATOM   8048  C C   . SER E 2 85  ? 45.983  25.682  16.688  1.00 39.53  ? 85  SER H C   1 
ATOM   8049  O O   . SER E 2 85  ? 45.983  25.770  15.446  1.00 38.99  ? 85  SER H O   1 
ATOM   8050  C CB  . SER E 2 85  ? 47.276  27.779  17.130  1.00 43.10  ? 85  SER H CB  1 
ATOM   8051  O OG  . SER E 2 85  ? 46.157  28.542  17.537  1.00 45.13  ? 85  SER H OG  1 
ATOM   8052  N N   . LEU E 2 86  ? 45.049  25.028  17.376  1.00 39.23  ? 86  LEU H N   1 
ATOM   8053  C CA  . LEU E 2 86  ? 43.989  24.272  16.729  1.00 35.88  ? 86  LEU H CA  1 
ATOM   8054  C C   . LEU E 2 86  ? 42.853  25.143  16.219  1.00 41.12  ? 86  LEU H C   1 
ATOM   8055  O O   . LEU E 2 86  ? 42.646  26.267  16.683  1.00 43.55  ? 86  LEU H O   1 
ATOM   8056  C CB  . LEU E 2 86  ? 43.420  23.235  17.684  1.00 35.20  ? 86  LEU H CB  1 
ATOM   8057  C CG  . LEU E 2 86  ? 44.248  21.972  17.857  1.00 34.92  ? 86  LEU H CG  1 
ATOM   8058  C CD1 . LEU E 2 86  ? 43.752  21.176  19.048  1.00 35.18  ? 86  LEU H CD1 1 
ATOM   8059  C CD2 . LEU E 2 86  ? 44.181  21.150  16.603  1.00 31.57  ? 86  LEU H CD2 1 
ATOM   8060  N N   . LYS E 2 87  ? 42.124  24.601  15.247  1.00 40.00  ? 87  LYS H N   1 
ATOM   8061  C CA  . LYS E 2 87  ? 40.898  25.195  14.743  1.00 41.44  ? 87  LYS H CA  1 
ATOM   8062  C C   . LYS E 2 87  ? 39.776  24.149  14.832  1.00 40.45  ? 87  LYS H C   1 
ATOM   8063  O O   . LYS E 2 87  ? 40.036  22.939  14.842  1.00 35.00  ? 87  LYS H O   1 
ATOM   8064  C CB  . LYS E 2 87  ? 41.098  25.660  13.302  1.00 41.83  ? 87  LYS H CB  1 
ATOM   8065  C CG  . LYS E 2 87  ? 42.195  26.694  13.137  1.00 43.27  ? 87  LYS H CG  1 
ATOM   8066  C CD  . LYS E 2 87  ? 42.414  27.031  11.675  1.00 44.09  ? 87  LYS H CD  1 
ATOM   8067  C CE  . LYS E 2 87  ? 43.785  26.581  11.170  1.00 42.79  ? 87  LYS H CE  1 
ATOM   8068  N NZ  . LYS E 2 87  ? 44.866  27.559  11.529  1.00 44.31  ? 87  LYS H NZ  1 
ATOM   8069  N N   . ALA E 2 88  ? 38.537  24.616  14.925  1.00 38.88  ? 88  ALA H N   1 
ATOM   8070  C CA  . ALA E 2 88  ? 37.380  23.740  14.802  1.00 38.49  ? 88  ALA H CA  1 
ATOM   8071  C C   . ALA E 2 88  ? 37.473  22.867  13.533  1.00 38.20  ? 88  ALA H C   1 
ATOM   8072  O O   . ALA E 2 88  ? 36.984  21.731  13.509  1.00 35.60  ? 88  ALA H O   1 
ATOM   8073  C CB  . ALA E 2 88  ? 36.092  24.560  14.801  1.00 41.22  ? 88  ALA H CB  1 
ATOM   8074  N N   . SER E 2 89  ? 38.112  23.391  12.488  1.00 36.73  ? 89  SER H N   1 
ATOM   8075  C CA  . SER E 2 89  ? 38.287  22.638  11.249  1.00 35.35  ? 89  SER H CA  1 
ATOM   8076  C C   . SER E 2 89  ? 39.331  21.492  11.329  1.00 33.19  ? 89  SER H C   1 
ATOM   8077  O O   . SER E 2 89  ? 39.543  20.793  10.351  1.00 31.73  ? 89  SER H O   1 
ATOM   8078  C CB  . SER E 2 89  ? 38.590  23.589  10.090  1.00 38.93  ? 89  SER H CB  1 
ATOM   8079  O OG  . SER E 2 89  ? 39.913  24.086  10.150  1.00 38.72  ? 89  SER H OG  1 
ATOM   8080  N N   . ASP E 2 90  ? 39.962  21.289  12.487  1.00 32.15  ? 90  ASP H N   1 
ATOM   8081  C CA  . ASP E 2 90  ? 40.955  20.219  12.655  1.00 36.87  ? 90  ASP H CA  1 
ATOM   8082  C C   . ASP E 2 90  ? 40.335  18.945  13.232  1.00 29.47  ? 90  ASP H C   1 
ATOM   8083  O O   . ASP E 2 90  ? 41.011  17.920  13.397  1.00 28.21  ? 90  ASP H O   1 
ATOM   8084  C CB  . ASP E 2 90  ? 42.129  20.683  13.523  1.00 37.00  ? 90  ASP H CB  1 
ATOM   8085  C CG  . ASP E 2 90  ? 43.070  21.659  12.794  1.00 37.84  ? 90  ASP H CG  1 
ATOM   8086  O OD1 . ASP E 2 90  ? 43.391  21.411  11.602  1.00 37.35  ? 90  ASP H OD1 1 
ATOM   8087  O OD2 . ASP E 2 90  ? 43.496  22.665  13.428  1.00 39.11  ? 90  ASP H OD2 1 
ATOM   8088  N N   . THR E 2 91  ? 39.038  19.024  13.522  1.00 30.59  ? 91  THR H N   1 
ATOM   8089  C CA  . THR E 2 91  ? 38.270  17.875  14.001  1.00 32.20  ? 91  THR H CA  1 
ATOM   8090  C C   . THR E 2 91  ? 38.292  16.777  12.973  1.00 31.03  ? 91  THR H C   1 
ATOM   8091  O O   . THR E 2 91  ? 37.760  16.960  11.873  1.00 31.72  ? 91  THR H O   1 
ATOM   8092  C CB  . THR E 2 91  ? 36.782  18.207  14.203  1.00 33.89  ? 91  THR H CB  1 
ATOM   8093  O OG1 . THR E 2 91  ? 36.654  19.315  15.098  1.00 35.27  ? 91  THR H OG1 1 
ATOM   8094  C CG2 . THR E 2 91  ? 36.048  16.997  14.752  1.00 32.02  ? 91  THR H CG2 1 
ATOM   8095  N N   . ALA E 2 92  ? 38.872  15.638  13.339  1.00 29.74  ? 92  ALA H N   1 
ATOM   8096  C CA  . ALA E 2 92  ? 39.062  14.539  12.406  1.00 27.26  ? 92  ALA H CA  1 
ATOM   8097  C C   . ALA E 2 92  ? 39.714  13.387  13.116  1.00 30.02  ? 92  ALA H C   1 
ATOM   8098  O O   . ALA E 2 92  ? 40.351  13.581  14.128  1.00 30.12  ? 92  ALA H O   1 
ATOM   8099  C CB  . ALA E 2 92  ? 39.947  14.985  11.255  1.00 30.36  ? 92  ALA H CB  1 
ATOM   8100  N N   . MET E 2 93  ? 39.556  12.188  12.589  1.00 26.43  ? 93  MET H N   1 
ATOM   8101  C CA  . MET E 2 93  ? 40.373  11.059  12.992  1.00 26.08  ? 93  MET H CA  1 
ATOM   8102  C C   . MET E 2 93  ? 41.781  11.176  12.346  1.00 29.42  ? 93  MET H C   1 
ATOM   8103  O O   . MET E 2 93  ? 41.917  11.552  11.182  1.00 28.80  ? 93  MET H O   1 
ATOM   8104  C CB  . MET E 2 93  ? 39.695  9.776   12.532  1.00 26.55  ? 93  MET H CB  1 
ATOM   8105  C CG  . MET E 2 93  ? 40.328  8.513   13.027  1.00 26.81  ? 93  MET H CG  1 
ATOM   8106  S SD  . MET E 2 93  ? 39.997  8.250   14.766  1.00 30.86  ? 93  MET H SD  1 
ATOM   8107  C CE  . MET E 2 93  ? 38.296  7.738   14.766  1.00 29.24  ? 93  MET H CE  1 
ATOM   8108  N N   . TYR E 2 94  ? 42.837  10.863  13.082  1.00 25.05  ? 94  TYR H N   1 
ATOM   8109  C CA  . TYR E 2 94  ? 44.162  10.915  12.480  1.00 24.43  ? 94  TYR H CA  1 
ATOM   8110  C C   . TYR E 2 94  ? 44.832  9.560   12.590  1.00 33.51  ? 94  TYR H C   1 
ATOM   8111  O O   . TYR E 2 94  ? 44.939  9.003   13.687  1.00 34.24  ? 94  TYR H O   1 
ATOM   8112  C CB  . TYR E 2 94  ? 45.013  12.010  13.119  1.00 24.45  ? 94  TYR H CB  1 
ATOM   8113  C CG  . TYR E 2 94  ? 44.507  13.395  12.813  1.00 24.47  ? 94  TYR H CG  1 
ATOM   8114  C CD1 . TYR E 2 94  ? 45.095  14.168  11.834  1.00 24.16  ? 94  TYR H CD1 1 
ATOM   8115  C CD2 . TYR E 2 94  ? 43.428  13.926  13.494  1.00 27.72  ? 94  TYR H CD2 1 
ATOM   8116  C CE1 . TYR E 2 94  ? 44.630  15.431  11.547  1.00 24.62  ? 94  TYR H CE1 1 
ATOM   8117  C CE2 . TYR E 2 94  ? 42.947  15.189  13.202  1.00 28.46  ? 94  TYR H CE2 1 
ATOM   8118  C CZ  . TYR E 2 94  ? 43.560  15.931  12.226  1.00 25.36  ? 94  TYR H CZ  1 
ATOM   8119  O OH  . TYR E 2 94  ? 43.104  17.189  11.948  1.00 27.59  ? 94  TYR H OH  1 
ATOM   8120  N N   . TYR E 2 95  ? 45.264  9.013   11.459  1.00 24.45  ? 95  TYR H N   1 
ATOM   8121  C CA  . TYR E 2 95  ? 45.911  7.715   11.476  1.00 26.78  ? 95  TYR H CA  1 
ATOM   8122  C C   . TYR E 2 95  ? 47.394  7.908   11.253  1.00 26.70  ? 95  TYR H C   1 
ATOM   8123  O O   . TYR E 2 95  ? 47.799  8.819   10.529  1.00 25.94  ? 95  TYR H O   1 
ATOM   8124  C CB  . TYR E 2 95  ? 45.332  6.773   10.412  1.00 25.38  ? 95  TYR H CB  1 
ATOM   8125  C CG  . TYR E 2 95  ? 43.890  6.396   10.625  1.00 25.92  ? 95  TYR H CG  1 
ATOM   8126  C CD1 . TYR E 2 95  ? 43.544  5.311   11.427  1.00 27.13  ? 95  TYR H CD1 1 
ATOM   8127  C CD2 . TYR E 2 95  ? 42.875  7.121   10.027  1.00 27.52  ? 95  TYR H CD2 1 
ATOM   8128  C CE1 . TYR E 2 95  ? 42.223  4.964   11.648  1.00 29.71  ? 95  TYR H CE1 1 
ATOM   8129  C CE2 . TYR E 2 95  ? 41.542  6.790   10.240  1.00 28.61  ? 95  TYR H CE2 1 
ATOM   8130  C CZ  . TYR E 2 95  ? 41.219  5.704   11.050  1.00 29.57  ? 95  TYR H CZ  1 
ATOM   8131  O OH  . TYR E 2 95  ? 39.901  5.360   11.246  1.00 30.41  ? 95  TYR H OH  1 
ATOM   8132  N N   . CYS E 2 96  ? 48.196  7.077   11.911  1.00 27.48  ? 96  CYS H N   1 
ATOM   8133  C CA  . CYS E 2 96  ? 49.574  6.872   11.506  1.00 27.92  ? 96  CYS H CA  1 
ATOM   8134  C C   . CYS E 2 96  ? 49.677  5.495   10.861  1.00 29.06  ? 96  CYS H C   1 
ATOM   8135  O O   . CYS E 2 96  ? 48.917  4.579   11.187  1.00 30.15  ? 96  CYS H O   1 
ATOM   8136  C CB  . CYS E 2 96  ? 50.528  6.962   12.699  1.00 28.94  ? 96  CYS H CB  1 
ATOM   8137  S SG  . CYS E 2 96  ? 50.532  5.521   13.779  1.00 56.50  ? 96  CYS H SG  1 
ATOM   8138  N N   . ALA E 2 97  ? 50.608  5.334   9.939   1.00 29.11  ? 97  ALA H N   1 
ATOM   8139  C CA  . ALA E 2 97  ? 50.778  4.042   9.290   1.00 30.02  ? 97  ALA H CA  1 
ATOM   8140  C C   . ALA E 2 97  ? 52.248  3.818   9.126   1.00 31.18  ? 97  ALA H C   1 
ATOM   8141  O O   . ALA E 2 97  ? 53.023  4.770   9.232   1.00 31.08  ? 97  ALA H O   1 
ATOM   8142  C CB  . ALA E 2 97  ? 50.120  4.047   7.941   1.00 28.94  ? 97  ALA H CB  1 
ATOM   8143  N N   . ARG E 2 98  ? 52.665  2.589   8.853   1.00 32.76  ? 98  ARG H N   1 
ATOM   8144  C CA  . ARG E 2 98  ? 54.043  2.436   8.405   1.00 33.92  ? 98  ARG H CA  1 
ATOM   8145  C C   . ARG E 2 98  ? 54.123  1.863   6.997   1.00 34.40  ? 98  ARG H C   1 
ATOM   8146  O O   . ARG E 2 98  ? 53.241  1.115   6.585   1.00 34.63  ? 98  ARG H O   1 
ATOM   8147  C CB  . ARG E 2 98  ? 54.930  1.703   9.425   1.00 36.18  ? 98  ARG H CB  1 
ATOM   8148  C CG  . ARG E 2 98  ? 54.894  0.217   9.382   1.00 38.57  ? 98  ARG H CG  1 
ATOM   8149  C CD  . ARG E 2 98  ? 56.294  -0.362  9.390   1.00 41.04  ? 98  ARG H CD  1 
ATOM   8150  N NE  . ARG E 2 98  ? 56.395  -1.315  8.300   1.00 42.78  ? 98  ARG H NE  1 
ATOM   8151  C CZ  . ARG E 2 98  ? 56.366  -2.639  8.431   1.00 45.76  ? 98  ARG H CZ  1 
ATOM   8152  N NH1 . ARG E 2 98  ? 56.277  -3.198  9.630   1.00 47.42  ? 98  ARG H NH1 1 
ATOM   8153  N NH2 . ARG E 2 98  ? 56.452  -3.408  7.349   1.00 47.22  ? 98  ARG H NH2 1 
ATOM   8154  N N   . SER E 2 99  ? 55.169  2.251   6.265   1.00 34.80  ? 99  SER H N   1 
ATOM   8155  C CA  . SER E 2 99  ? 55.302  1.931   4.849   1.00 35.71  ? 99  SER H CA  1 
ATOM   8156  C C   . SER E 2 99  ? 55.682  0.467   4.586   1.00 38.37  ? 99  SER H C   1 
ATOM   8157  O O   . SER E 2 99  ? 55.991  -0.277  5.503   1.00 39.80  ? 99  SER H O   1 
ATOM   8158  C CB  . SER E 2 99  ? 56.300  2.882   4.190   1.00 35.91  ? 99  SER H CB  1 
ATOM   8159  O OG  . SER E 2 99  ? 57.644  2.497   4.442   1.00 38.08  ? 99  SER H OG  1 
ATOM   8160  N N   . HIS E 2 100 ? 55.627  0.056   3.326   1.00 39.49  ? 100 HIS H N   1 
ATOM   8161  C CA  . HIS E 2 100 ? 55.920  -1.324  2.943   1.00 42.50  ? 100 HIS H CA  1 
ATOM   8162  C C   . HIS E 2 100 ? 57.362  -1.404  2.504   1.00 44.92  ? 100 HIS H C   1 
ATOM   8163  O O   . HIS E 2 100 ? 57.933  -0.407  2.038   1.00 44.36  ? 100 HIS H O   1 
ATOM   8164  C CB  . HIS E 2 100 ? 55.006  -1.771  1.791   1.00 42.44  ? 100 HIS H CB  1 
ATOM   8165  C CG  . HIS E 2 100 ? 54.919  -3.254  1.619   1.00 45.16  ? 100 HIS H CG  1 
ATOM   8166  N ND1 . HIS E 2 100 ? 56.015  -4.044  1.337   1.00 47.82  ? 100 HIS H ND1 1 
ATOM   8167  C CD2 . HIS E 2 100 ? 53.859  -4.096  1.677   1.00 46.13  ? 100 HIS H CD2 1 
ATOM   8168  C CE1 . HIS E 2 100 ? 55.636  -5.305  1.238   1.00 50.33  ? 100 HIS H CE1 1 
ATOM   8169  N NE2 . HIS E 2 100 ? 54.332  -5.366  1.445   1.00 49.41  ? 100 HIS H NE2 1 
ATOM   8170  N N   . LEU E 2 101 ? 57.952  -2.584  2.648   1.00 48.19  ? 101 LEU H N   1 
ATOM   8171  C CA  . LEU E 2 101 ? 59.300  -2.832  2.171   1.00 50.87  ? 101 LEU H CA  1 
ATOM   8172  C C   . LEU E 2 101 ? 59.476  -2.440  0.686   1.00 50.72  ? 101 LEU H C   1 
ATOM   8173  O O   . LEU E 2 101 ? 60.562  -2.068  0.246   1.00 51.60  ? 101 LEU H O   1 
ATOM   8174  C CB  . LEU E 2 101 ? 59.616  -4.307  2.362   1.00 54.74  ? 101 LEU H CB  1 
ATOM   8175  C CG  . LEU E 2 101 ? 61.051  -4.733  2.059   1.00 58.02  ? 101 LEU H CG  1 
ATOM   8176  C CD1 . LEU E 2 101 ? 61.962  -4.358  3.226   1.00 58.60  ? 101 LEU H CD1 1 
ATOM   8177  C CD2 . LEU E 2 101 ? 61.127  -6.226  1.723   1.00 61.81  ? 101 LEU H CD2 1 
ATOM   8178  N N   . LEU E 2 102 ? 58.384  -2.513  -0.069  1.00 49.49  ? 102 LEU H N   1 
ATOM   8179  C CA  . LEU E 2 102 ? 58.393  -2.318  -1.514  1.00 48.91  ? 102 LEU H CA  1 
ATOM   8180  C C   . LEU E 2 102 ? 58.130  -0.886  -1.946  1.00 45.94  ? 102 LEU H C   1 
ATOM   8181  O O   . LEU E 2 102 ? 58.635  -0.454  -2.974  1.00 46.91  ? 102 LEU H O   1 
ATOM   8182  C CB  . LEU E 2 102 ? 57.340  -3.208  -2.174  1.00 49.65  ? 102 LEU H CB  1 
ATOM   8183  C CG  . LEU E 2 102 ? 57.503  -4.723  -2.114  1.00 52.79  ? 102 LEU H CG  1 
ATOM   8184  C CD1 . LEU E 2 102 ? 56.332  -5.378  -2.817  1.00 53.52  ? 102 LEU H CD1 1 
ATOM   8185  C CD2 . LEU E 2 102 ? 58.829  -5.152  -2.736  1.00 55.43  ? 102 LEU H CD2 1 
ATOM   8186  N N   . ARG E 2 103 ? 57.316  -0.158  -1.199  1.00 43.26  ? 103 ARG H N   1 
ATOM   8187  C CA  . ARG E 2 103 ? 56.947  1.193   -1.609  1.00 42.21  ? 103 ARG H CA  1 
ATOM   8188  C C   . ARG E 2 103 ? 56.798  2.091   -0.401  1.00 39.47  ? 103 ARG H C   1 
ATOM   8189  O O   . ARG E 2 103 ? 56.033  1.783   0.523   1.00 38.28  ? 103 ARG H O   1 
ATOM   8190  C CB  . ARG E 2 103 ? 55.619  1.200   -2.371  1.00 42.80  ? 103 ARG H CB  1 
ATOM   8191  C CG  . ARG E 2 103 ? 55.644  0.560   -3.725  1.00 43.91  ? 103 ARG H CG  1 
ATOM   8192  C CD  . ARG E 2 103 ? 56.198  1.508   -4.790  1.00 43.59  ? 103 ARG H CD  1 
ATOM   8193  N NE  . ARG E 2 103 ? 55.213  2.497   -5.190  1.00 37.63  ? 103 ARG H NE  1 
ATOM   8194  C CZ  . ARG E 2 103 ? 55.497  3.643   -5.791  1.00 37.13  ? 103 ARG H CZ  1 
ATOM   8195  N NH1 . ARG E 2 103 ? 56.748  3.965   -6.082  1.00 37.92  ? 103 ARG H NH1 1 
ATOM   8196  N NH2 . ARG E 2 103 ? 54.519  4.477   -6.092  1.00 42.03  ? 103 ARG H NH2 1 
ATOM   8197  N N   . ALA E 2 104 ? 57.495  3.223   -0.429  1.00 38.74  ? 104 ALA H N   1 
ATOM   8198  C CA  . ALA E 2 104 ? 57.406  4.190   0.653   1.00 37.32  ? 104 ALA H CA  1 
ATOM   8199  C C   . ALA E 2 104 ? 55.990  4.731   0.793   1.00 35.61  ? 104 ALA H C   1 
ATOM   8200  O O   . ALA E 2 104 ? 55.604  5.198   1.849   1.00 34.38  ? 104 ALA H O   1 
ATOM   8201  C CB  . ALA E 2 104 ? 58.394  5.322   0.440   1.00 37.27  ? 104 ALA H CB  1 
ATOM   8202  N N   . SER E 2 105 ? 55.206  4.630   -0.266  1.00 35.81  ? 105 SER H N   1 
ATOM   8203  C CA  . SER E 2 105 ? 53.901  5.271   -0.314  1.00 34.64  ? 105 SER H CA  1 
ATOM   8204  C C   . SER E 2 105 ? 52.722  4.369   0.058   1.00 34.43  ? 105 SER H C   1 
ATOM   8205  O O   . SER E 2 105 ? 51.586  4.845   0.138   1.00 33.85  ? 105 SER H O   1 
ATOM   8206  C CB  . SER E 2 105 ? 53.673  5.887   -1.704  1.00 35.57  ? 105 SER H CB  1 
ATOM   8207  O OG  . SER E 2 105 ? 54.041  5.005   -2.755  1.00 37.64  ? 105 SER H OG  1 
ATOM   8208  N N   . TRP E 2 106 ? 52.980  3.077   0.254   1.00 35.22  ? 106 TRP H N   1 
ATOM   8209  C CA  . TRP E 2 106 ? 51.940  2.142   0.697   1.00 35.14  ? 106 TRP H CA  1 
ATOM   8210  C C   . TRP E 2 106 ? 51.687  2.270   2.193   1.00 33.84  ? 106 TRP H C   1 
ATOM   8211  O O   . TRP E 2 106 ? 52.640  2.268   2.987   1.00 34.05  ? 106 TRP H O   1 
ATOM   8212  C CB  . TRP E 2 106 ? 52.359  0.690   0.420   1.00 37.57  ? 106 TRP H CB  1 
ATOM   8213  C CG  . TRP E 2 106 ? 52.345  0.271   -1.028  1.00 39.05  ? 106 TRP H CG  1 
ATOM   8214  C CD1 . TRP E 2 106 ? 52.039  1.045   -2.108  1.00 38.52  ? 106 TRP H CD1 1 
ATOM   8215  C CD2 . TRP E 2 106 ? 52.644  -1.029  -1.541  1.00 41.63  ? 106 TRP H CD2 1 
ATOM   8216  N NE1 . TRP E 2 106 ? 52.139  0.311   -3.259  1.00 40.54  ? 106 TRP H NE1 1 
ATOM   8217  C CE2 . TRP E 2 106 ? 52.510  -0.967  -2.939  1.00 42.51  ? 106 TRP H CE2 1 
ATOM   8218  C CE3 . TRP E 2 106 ? 53.020  -2.238  -0.955  1.00 43.66  ? 106 TRP H CE3 1 
ATOM   8219  C CZ2 . TRP E 2 106 ? 52.738  -2.065  -3.761  1.00 45.36  ? 106 TRP H CZ2 1 
ATOM   8220  C CZ3 . TRP E 2 106 ? 53.240  -3.332  -1.772  1.00 46.48  ? 106 TRP H CZ3 1 
ATOM   8221  C CH2 . TRP E 2 106 ? 53.098  -3.239  -3.159  1.00 47.25  ? 106 TRP H CH2 1 
ATOM   8222  N N   . PHE E 2 107 ? 50.421  2.364   2.593   1.00 32.84  ? 107 PHE H N   1 
ATOM   8223  C CA  . PHE E 2 107 ? 50.086  2.300   4.017   1.00 30.09  ? 107 PHE H CA  1 
ATOM   8224  C C   . PHE E 2 107 ? 49.900  0.858   4.436   1.00 31.95  ? 107 PHE H C   1 
ATOM   8225  O O   . PHE E 2 107 ? 48.778  0.420   4.560   1.00 34.58  ? 107 PHE H O   1 
ATOM   8226  C CB  . PHE E 2 107 ? 48.774  3.019   4.299   1.00 28.84  ? 107 PHE H CB  1 
ATOM   8227  C CG  . PHE E 2 107 ? 48.825  4.510   4.108   1.00 29.21  ? 107 PHE H CG  1 
ATOM   8228  C CD1 . PHE E 2 107 ? 49.022  5.061   2.856   1.00 27.19  ? 107 PHE H CD1 1 
ATOM   8229  C CD2 . PHE E 2 107 ? 48.619  5.365   5.176   1.00 28.08  ? 107 PHE H CD2 1 
ATOM   8230  C CE1 . PHE E 2 107 ? 49.037  6.442   2.676   1.00 26.16  ? 107 PHE H CE1 1 
ATOM   8231  C CE2 . PHE E 2 107 ? 48.648  6.742   5.005   1.00 26.59  ? 107 PHE H CE2 1 
ATOM   8232  C CZ  . PHE E 2 107 ? 48.854  7.277   3.748   1.00 25.73  ? 107 PHE H CZ  1 
ATOM   8233  N N   . ALA E 2 108 ? 50.974  0.114   4.660   1.00 33.47  ? 108 ALA H N   1 
ATOM   8234  C CA  . ALA E 2 108 ? 50.858  -1.335  4.867   1.00 35.85  ? 108 ALA H CA  1 
ATOM   8235  C C   . ALA E 2 108 ? 50.304  -1.751  6.234   1.00 44.55  ? 108 ALA H C   1 
ATOM   8236  O O   . ALA E 2 108 ? 49.698  -2.822  6.360   1.00 46.39  ? 108 ALA H O   1 
ATOM   8237  C CB  . ALA E 2 108 ? 52.187  -2.018  4.626   1.00 37.80  ? 108 ALA H CB  1 
ATOM   8238  N N   . TYR E 2 109 ? 50.531  -0.926  7.254   1.00 35.14  ? 109 TYR H N   1 
ATOM   8239  C CA  . TYR E 2 109 ? 50.049  -1.201  8.600   1.00 36.24  ? 109 TYR H CA  1 
ATOM   8240  C C   . TYR E 2 109 ? 49.471  0.078   9.198   1.00 34.26  ? 109 TYR H C   1 
ATOM   8241  O O   . TYR E 2 109 ? 50.009  1.148   8.932   1.00 31.94  ? 109 TYR H O   1 
ATOM   8242  C CB  . TYR E 2 109 ? 51.193  -1.742  9.463   1.00 37.65  ? 109 TYR H CB  1 
ATOM   8243  C CG  . TYR E 2 109 ? 51.592  -3.150  9.100   1.00 40.56  ? 109 TYR H CG  1 
ATOM   8244  C CD1 . TYR E 2 109 ? 50.975  -4.238  9.692   1.00 42.79  ? 109 TYR H CD1 1 
ATOM   8245  C CD2 . TYR E 2 109 ? 52.579  -3.394  8.151   1.00 41.38  ? 109 TYR H CD2 1 
ATOM   8246  C CE1 . TYR E 2 109 ? 51.334  -5.538  9.351   1.00 49.51  ? 109 TYR H CE1 1 
ATOM   8247  C CE2 . TYR E 2 109 ? 52.942  -4.693  7.800   1.00 44.40  ? 109 TYR H CE2 1 
ATOM   8248  C CZ  . TYR E 2 109 ? 52.311  -5.758  8.401   1.00 50.37  ? 109 TYR H CZ  1 
ATOM   8249  O OH  . TYR E 2 109 ? 52.659  -7.053  8.064   1.00 53.87  ? 109 TYR H OH  1 
ATOM   8250  N N   . TRP E 2 110 ? 48.386  -0.015  9.982   1.00 33.55  ? 110 TRP H N   1 
ATOM   8251  C CA  . TRP E 2 110 ? 47.756  1.193   10.535  1.00 31.72  ? 110 TRP H CA  1 
ATOM   8252  C C   . TRP E 2 110 ? 47.563  1.169   12.041  1.00 35.14  ? 110 TRP H C   1 
ATOM   8253  O O   . TRP E 2 110 ? 47.168  0.153   12.631  1.00 37.00  ? 110 TRP H O   1 
ATOM   8254  C CB  . TRP E 2 110 ? 46.388  1.463   9.909   1.00 30.87  ? 110 TRP H CB  1 
ATOM   8255  C CG  . TRP E 2 110 ? 46.371  1.700   8.422   1.00 30.18  ? 110 TRP H CG  1 
ATOM   8256  C CD1 . TRP E 2 110 ? 46.746  0.819   7.440   1.00 31.32  ? 110 TRP H CD1 1 
ATOM   8257  C CD2 . TRP E 2 110 ? 45.900  2.868   7.750   1.00 28.59  ? 110 TRP H CD2 1 
ATOM   8258  N NE1 . TRP E 2 110 ? 46.560  1.375   6.213   1.00 32.75  ? 110 TRP H NE1 1 
ATOM   8259  C CE2 . TRP E 2 110 ? 46.043  2.638   6.367   1.00 37.45  ? 110 TRP H CE2 1 
ATOM   8260  C CE3 . TRP E 2 110 ? 45.384  4.097   8.182   1.00 27.29  ? 110 TRP H CE3 1 
ATOM   8261  C CZ2 . TRP E 2 110 ? 45.689  3.598   5.404   1.00 27.88  ? 110 TRP H CZ2 1 
ATOM   8262  C CZ3 . TRP E 2 110 ? 45.023  5.045   7.229   1.00 30.70  ? 110 TRP H CZ3 1 
ATOM   8263  C CH2 . TRP E 2 110 ? 45.179  4.787   5.854   1.00 31.01  ? 110 TRP H CH2 1 
ATOM   8264  N N   . GLY E 2 111 ? 47.806  2.314   12.665  1.00 33.88  ? 111 GLY H N   1 
ATOM   8265  C CA  . GLY E 2 111 ? 47.460  2.489   14.059  1.00 34.43  ? 111 GLY H CA  1 
ATOM   8266  C C   . GLY E 2 111 ? 45.956  2.544   14.159  1.00 34.08  ? 111 GLY H C   1 
ATOM   8267  O O   . GLY E 2 111 ? 45.277  2.686   13.162  1.00 33.13  ? 111 GLY H O   1 
ATOM   8268  N N   . GLN E 2 112 ? 45.423  2.456   15.366  1.00 35.14  ? 112 GLN H N   1 
ATOM   8269  C CA  . GLN E 2 112 ? 43.982  2.340   15.523  1.00 35.18  ? 112 GLN H CA  1 
ATOM   8270  C C   . GLN E 2 112 ? 43.254  3.668   15.286  1.00 33.62  ? 112 GLN H C   1 
ATOM   8271  O O   . GLN E 2 112 ? 42.031  3.720   15.333  1.00 34.22  ? 112 GLN H O   1 
ATOM   8272  C CB  . GLN E 2 112 ? 43.638  1.755   16.902  1.00 36.78  ? 112 GLN H CB  1 
ATOM   8273  C CG  . GLN E 2 112 ? 43.451  2.782   18.022  1.00 36.23  ? 112 GLN H CG  1 
ATOM   8274  C CD  . GLN E 2 112 ? 44.718  3.078   18.808  1.00 36.57  ? 112 GLN H CD  1 
ATOM   8275  O OE1 . GLN E 2 112 ? 45.816  2.702   18.405  1.00 37.09  ? 112 GLN H OE1 1 
ATOM   8276  N NE2 . GLN E 2 112 ? 44.565  3.762   19.935  1.00 36.57  ? 112 GLN H NE2 1 
ATOM   8277  N N   . GLY E 2 113 ? 43.998  4.736   15.023  1.00 31.97  ? 113 GLY H N   1 
ATOM   8278  C CA  . GLY E 2 113 ? 43.399  6.053   14.862  1.00 30.54  ? 113 GLY H CA  1 
ATOM   8279  C C   . GLY E 2 113 ? 43.253  6.836   16.168  1.00 30.79  ? 113 GLY H C   1 
ATOM   8280  O O   . GLY E 2 113 ? 43.070  6.241   17.247  1.00 32.35  ? 113 GLY H O   1 
ATOM   8281  N N   . THR E 2 114 ? 43.335  8.164   16.064  1.00 29.23  ? 114 THR H N   1 
ATOM   8282  C CA  . THR E 2 114 ? 43.172  9.054   17.199  1.00 29.33  ? 114 THR H CA  1 
ATOM   8283  C C   . THR E 2 114 ? 42.162  10.134  16.858  1.00 29.03  ? 114 THR H C   1 
ATOM   8284  O O   . THR E 2 114 ? 42.399  10.938  15.972  1.00 28.57  ? 114 THR H O   1 
ATOM   8285  C CB  . THR E 2 114 ? 44.487  9.762   17.548  1.00 29.08  ? 114 THR H CB  1 
ATOM   8286  O OG1 . THR E 2 114 ? 45.416  8.831   18.120  1.00 30.29  ? 114 THR H OG1 1 
ATOM   8287  C CG2 . THR E 2 114 ? 44.228  10.870  18.526  1.00 29.49  ? 114 THR H CG2 1 
ATOM   8288  N N   . MET E 2 115 ? 41.039  10.166  17.562  1.00 29.83  ? 115 MET H N   1 
ATOM   8289  C CA  . MET E 2 115 ? 40.022  11.171  17.305  1.00 30.21  ? 115 MET H CA  1 
ATOM   8290  C C   . MET E 2 115 ? 40.411  12.484  17.931  1.00 31.04  ? 115 MET H C   1 
ATOM   8291  O O   . MET E 2 115 ? 40.575  12.565  19.142  1.00 32.83  ? 115 MET H O   1 
ATOM   8292  C CB  . MET E 2 115 ? 38.675  10.757  17.889  1.00 31.54  ? 115 MET H CB  1 
ATOM   8293  C CG  . MET E 2 115 ? 37.522  11.623  17.378  1.00 31.75  ? 115 MET H CG  1 
ATOM   8294  S SD  . MET E 2 115 ? 37.293  11.531  15.567  1.00 46.17  ? 115 MET H SD  1 
ATOM   8295  C CE  . MET E 2 115 ? 36.978  13.254  15.150  1.00 29.56  ? 115 MET H CE  1 
ATOM   8296  N N   . VAL E 2 116 ? 40.563  13.522  17.126  1.00 28.36  ? 116 VAL H N   1 
ATOM   8297  C CA  . VAL E 2 116 ? 40.761  14.836  17.703  1.00 29.04  ? 116 VAL H CA  1 
ATOM   8298  C C   . VAL E 2 116 ? 39.496  15.616  17.442  1.00 33.74  ? 116 VAL H C   1 
ATOM   8299  O O   . VAL E 2 116 ? 38.997  15.632  16.324  1.00 33.65  ? 116 VAL H O   1 
ATOM   8300  C CB  . VAL E 2 116 ? 41.943  15.555  17.080  1.00 28.31  ? 116 VAL H CB  1 
ATOM   8301  C CG1 . VAL E 2 116 ? 41.934  17.003  17.452  1.00 29.33  ? 116 VAL H CG1 1 
ATOM   8302  C CG2 . VAL E 2 116 ? 43.223  14.895  17.491  1.00 27.99  ? 116 VAL H CG2 1 
ATOM   8303  N N   . THR E 2 117 ? 38.961  16.242  18.476  1.00 34.78  ? 117 THR H N   1 
ATOM   8304  C CA  . THR E 2 117 ? 37.710  16.971  18.364  1.00 35.93  ? 117 THR H CA  1 
ATOM   8305  C C   . THR E 2 117 ? 37.965  18.375  18.882  1.00 36.94  ? 117 THR H C   1 
ATOM   8306  O O   . THR E 2 117 ? 38.420  18.559  20.015  1.00 37.95  ? 117 THR H O   1 
ATOM   8307  C CB  . THR E 2 117 ? 36.605  16.286  19.200  1.00 37.43  ? 117 THR H CB  1 
ATOM   8308  O OG1 . THR E 2 117 ? 36.457  14.915  18.775  1.00 36.88  ? 117 THR H OG1 1 
ATOM   8309  C CG2 . THR E 2 117 ? 35.278  17.040  19.097  1.00 38.88  ? 117 THR H CG2 1 
ATOM   8310  N N   . VAL E 2 118 ? 37.720  19.373  18.047  1.00 36.94  ? 118 VAL H N   1 
ATOM   8311  C CA  . VAL E 2 118 ? 37.942  20.738  18.476  1.00 37.89  ? 118 VAL H CA  1 
ATOM   8312  C C   . VAL E 2 118 ? 36.647  21.519  18.431  1.00 39.74  ? 118 VAL H C   1 
ATOM   8313  O O   . VAL E 2 118 ? 36.079  21.758  17.357  1.00 39.93  ? 118 VAL H O   1 
ATOM   8314  C CB  . VAL E 2 118 ? 38.993  21.441  17.626  1.00 37.35  ? 118 VAL H CB  1 
ATOM   8315  C CG1 . VAL E 2 118 ? 39.290  22.833  18.198  1.00 39.42  ? 118 VAL H CG1 1 
ATOM   8316  C CG2 . VAL E 2 118 ? 40.253  20.603  17.558  1.00 35.41  ? 118 VAL H CG2 1 
ATOM   8317  N N   . SER E 2 119 ? 36.191  21.907  19.616  1.00 39.67  ? 119 SER H N   1 
ATOM   8318  C CA  . SER E 2 119 ? 34.969  22.663  19.782  1.00 42.10  ? 119 SER H CA  1 
ATOM   8319  C C   . SER E 2 119 ? 35.172  23.747  20.850  1.00 47.88  ? 119 SER H C   1 
ATOM   8320  O O   . SER E 2 119 ? 36.072  23.654  21.689  1.00 47.50  ? 119 SER H O   1 
ATOM   8321  C CB  . SER E 2 119 ? 33.849  21.719  20.200  1.00 42.43  ? 119 SER H CB  1 
ATOM   8322  O OG  . SER E 2 119 ? 32.716  22.434  20.634  1.00 45.16  ? 119 SER H OG  1 
ATOM   8323  N N   . SER E 2 120 ? 34.321  24.766  20.816  1.00 50.49  ? 120 SER H N   1 
ATOM   8324  C CA  . SER E 2 120 ? 34.337  25.812  21.817  1.00 53.28  ? 120 SER H CA  1 
ATOM   8325  C C   . SER E 2 120 ? 33.507  25.368  23.002  1.00 54.75  ? 120 SER H C   1 
ATOM   8326  O O   . SER E 2 120 ? 33.549  25.996  24.057  1.00 57.09  ? 120 SER H O   1 
ATOM   8327  C CB  . SER E 2 120 ? 33.745  27.092  21.250  1.00 56.17  ? 120 SER H CB  1 
ATOM   8328  O OG  . SER E 2 120 ? 32.392  26.872  20.885  1.00 57.53  ? 120 SER H OG  1 
ATOM   8329  N N   . ALA E 2 121 ? 32.743  24.290  22.831  1.00 48.63  ? 121 ALA H N   1 
ATOM   8330  C CA  . ALA E 2 121 ? 31.919  23.758  23.918  1.00 43.95  ? 121 ALA H CA  1 
ATOM   8331  C C   . ALA E 2 121 ? 32.772  23.427  25.128  1.00 47.49  ? 121 ALA H C   1 
ATOM   8332  O O   . ALA E 2 121 ? 33.980  23.230  25.019  1.00 47.28  ? 121 ALA H O   1 
ATOM   8333  C CB  . ALA E 2 121 ? 31.128  22.533  23.474  1.00 40.75  ? 121 ALA H CB  1 
ATOM   8334  N N   . SER E 2 122 ? 32.127  23.387  26.283  1.00 48.21  ? 122 SER H N   1 
ATOM   8335  C CA  . SER E 2 122 ? 32.792  23.092  27.540  1.00 50.55  ? 122 SER H CA  1 
ATOM   8336  C C   . SER E 2 122 ? 31.975  21.992  28.188  1.00 48.86  ? 122 SER H C   1 
ATOM   8337  O O   . SER E 2 122 ? 30.774  21.899  27.937  1.00 46.63  ? 122 SER H O   1 
ATOM   8338  C CB  . SER E 2 122 ? 32.858  24.358  28.413  1.00 54.01  ? 122 SER H CB  1 
ATOM   8339  O OG  . SER E 2 122 ? 32.790  24.072  29.801  1.00 55.78  ? 122 SER H OG  1 
ATOM   8340  N N   . THR E 2 123 ? 32.623  21.144  28.986  1.00 50.29  ? 123 THR H N   1 
ATOM   8341  C CA  . THR E 2 123 ? 31.955  19.962  29.532  1.00 49.48  ? 123 THR H CA  1 
ATOM   8342  C C   . THR E 2 123 ? 30.619  20.307  30.200  1.00 49.55  ? 123 THR H C   1 
ATOM   8343  O O   . THR E 2 123 ? 30.528  21.198  31.059  1.00 52.46  ? 123 THR H O   1 
ATOM   8344  C CB  . THR E 2 123 ? 32.837  19.179  30.539  1.00 49.12  ? 123 THR H CB  1 
ATOM   8345  O OG1 . THR E 2 123 ? 34.126  18.935  29.980  1.00 49.74  ? 123 THR H OG1 1 
ATOM   8346  C CG2 . THR E 2 123 ? 32.193  17.861  30.876  1.00 47.61  ? 123 THR H CG2 1 
ATOM   8347  N N   . LYS E 2 124 ? 29.579  19.622  29.764  1.00 44.14  ? 124 LYS H N   1 
ATOM   8348  C CA  . LYS E 2 124 ? 28.294  19.655  30.429  1.00 44.08  ? 124 LYS H CA  1 
ATOM   8349  C C   . LYS E 2 124 ? 27.824  18.213  30.495  1.00 46.47  ? 124 LYS H C   1 
ATOM   8350  O O   . LYS E 2 124 ? 28.050  17.429  29.573  1.00 42.30  ? 124 LYS H O   1 
ATOM   8351  C CB  . LYS E 2 124 ? 27.283  20.544  29.689  1.00 42.86  ? 124 LYS H CB  1 
ATOM   8352  C CG  . LYS E 2 124 ? 25.863  20.443  30.242  1.00 42.62  ? 124 LYS H CG  1 
ATOM   8353  C CD  . LYS E 2 124 ? 24.936  21.533  29.733  1.00 42.47  ? 124 LYS H CD  1 
ATOM   8354  C CE  . LYS E 2 124 ? 23.536  21.379  30.322  1.00 48.80  ? 124 LYS H CE  1 
ATOM   8355  N NZ  . LYS E 2 124 ? 22.907  20.006  30.134  1.00 46.42  ? 124 LYS H NZ  1 
ATOM   8356  N N   . GLY E 2 125 ? 27.196  17.850  31.597  1.00 46.71  ? 125 GLY H N   1 
ATOM   8357  C CA  . GLY E 2 125 ? 26.764  16.484  31.774  1.00 42.28  ? 125 GLY H CA  1 
ATOM   8358  C C   . GLY E 2 125 ? 25.330  16.308  31.351  1.00 44.16  ? 125 GLY H C   1 
ATOM   8359  O O   . GLY E 2 125 ? 24.539  17.259  31.382  1.00 44.31  ? 125 GLY H O   1 
ATOM   8360  N N   . PRO E 2 126 ? 24.982  15.074  30.967  1.00 42.72  ? 126 PRO H N   1 
ATOM   8361  C CA  . PRO E 2 126 ? 23.686  14.715  30.384  1.00 36.17  ? 126 PRO H CA  1 
ATOM   8362  C C   . PRO E 2 126 ? 22.518  14.681  31.380  1.00 39.38  ? 126 PRO H C   1 
ATOM   8363  O O   . PRO E 2 126 ? 22.626  14.118  32.472  1.00 39.40  ? 126 PRO H O   1 
ATOM   8364  C CB  . PRO E 2 126 ? 23.940  13.302  29.881  1.00 34.61  ? 126 PRO H CB  1 
ATOM   8365  C CG  . PRO E 2 126 ? 24.970  12.746  30.860  1.00 36.84  ? 126 PRO H CG  1 
ATOM   8366  C CD  . PRO E 2 126 ? 25.887  13.910  31.073  1.00 38.48  ? 126 PRO H CD  1 
ATOM   8367  N N   . SER E 2 127 ? 21.402  15.283  30.992  1.00 36.68  ? 127 SER H N   1 
ATOM   8368  C CA  . SER E 2 127 ? 20.130  14.970  31.611  1.00 37.33  ? 127 SER H CA  1 
ATOM   8369  C C   . SER E 2 127 ? 19.603  13.684  30.985  1.00 35.18  ? 127 SER H C   1 
ATOM   8370  O O   . SER E 2 127 ? 19.762  13.471  29.802  1.00 34.40  ? 127 SER H O   1 
ATOM   8371  C CB  . SER E 2 127 ? 19.136  16.108  31.398  1.00 42.81  ? 127 SER H CB  1 
ATOM   8372  O OG  . SER E 2 127 ? 19.724  17.357  31.720  1.00 40.90  ? 127 SER H OG  1 
ATOM   8373  N N   . VAL E 2 128 ? 18.999  12.818  31.784  1.00 36.21  ? 128 VAL H N   1 
ATOM   8374  C CA  . VAL E 2 128 ? 18.443  11.565  31.283  1.00 34.63  ? 128 VAL H CA  1 
ATOM   8375  C C   . VAL E 2 128 ? 16.932  11.492  31.514  1.00 35.04  ? 128 VAL H C   1 
ATOM   8376  O O   . VAL E 2 128 ? 16.460  11.454  32.639  1.00 37.39  ? 128 VAL H O   1 
ATOM   8377  C CB  . VAL E 2 128 ? 19.107  10.344  31.931  1.00 35.65  ? 128 VAL H CB  1 
ATOM   8378  C CG1 . VAL E 2 128 ? 18.621  9.074   31.263  1.00 34.05  ? 128 VAL H CG1 1 
ATOM   8379  C CG2 . VAL E 2 128 ? 20.617  10.454  31.855  1.00 35.87  ? 128 VAL H CG2 1 
ATOM   8380  N N   . PHE E 2 129 ? 16.176  11.475  30.429  1.00 33.91  ? 129 PHE H N   1 
ATOM   8381  C CA  . PHE E 2 129 ? 14.729  11.508  30.520  1.00 33.48  ? 129 PHE H CA  1 
ATOM   8382  C C   . PHE E 2 129 ? 14.144  10.183  30.068  1.00 32.39  ? 129 PHE H C   1 
ATOM   8383  O O   . PHE E 2 129 ? 14.698  9.536   29.191  1.00 36.83  ? 129 PHE H O   1 
ATOM   8384  C CB  . PHE E 2 129 ? 14.216  12.645  29.656  1.00 33.42  ? 129 PHE H CB  1 
ATOM   8385  C CG  . PHE E 2 129 ? 14.700  13.998  30.090  1.00 34.99  ? 129 PHE H CG  1 
ATOM   8386  C CD1 . PHE E 2 129 ? 15.491  14.778  29.248  1.00 33.93  ? 129 PHE H CD1 1 
ATOM   8387  C CD2 . PHE E 2 129 ? 14.364  14.500  31.351  1.00 37.83  ? 129 PHE H CD2 1 
ATOM   8388  C CE1 . PHE E 2 129 ? 15.930  16.031  29.660  1.00 35.42  ? 129 PHE H CE1 1 
ATOM   8389  C CE2 . PHE E 2 129 ? 14.793  15.745  31.757  1.00 38.46  ? 129 PHE H CE2 1 
ATOM   8390  C CZ  . PHE E 2 129 ? 15.569  16.512  30.921  1.00 38.14  ? 129 PHE H CZ  1 
ATOM   8391  N N   . PRO E 2 130 ? 13.034  9.749   30.672  1.00 33.82  ? 130 PRO H N   1 
ATOM   8392  C CA  . PRO E 2 130 ? 12.510  8.479   30.170  1.00 39.04  ? 130 PRO H CA  1 
ATOM   8393  C C   . PRO E 2 130 ? 11.680  8.671   28.889  1.00 37.51  ? 130 PRO H C   1 
ATOM   8394  O O   . PRO E 2 130 ? 11.021  9.703   28.706  1.00 38.16  ? 130 PRO H O   1 
ATOM   8395  C CB  . PRO E 2 130 ? 11.636  7.995   31.312  1.00 35.50  ? 130 PRO H CB  1 
ATOM   8396  C CG  . PRO E 2 130 ? 11.146  9.242   31.937  1.00 37.17  ? 130 PRO H CG  1 
ATOM   8397  C CD  . PRO E 2 130 ? 12.230  10.281  31.780  1.00 36.50  ? 130 PRO H CD  1 
ATOM   8398  N N   . LEU E 2 131 ? 11.745  7.696   27.989  1.00 35.80  ? 131 LEU H N   1 
ATOM   8399  C CA  . LEU E 2 131 ? 10.821  7.648   26.885  1.00 28.41  ? 131 LEU H CA  1 
ATOM   8400  C C   . LEU E 2 131 ? 9.917   6.480   27.205  1.00 48.56  ? 131 LEU H C   1 
ATOM   8401  O O   . LEU E 2 131 ? 10.268  5.329   26.941  1.00 29.11  ? 131 LEU H O   1 
ATOM   8402  C CB  . LEU E 2 131 ? 11.556  7.392   25.575  1.00 26.23  ? 131 LEU H CB  1 
ATOM   8403  C CG  . LEU E 2 131 ? 12.632  8.388   25.174  1.00 25.23  ? 131 LEU H CG  1 
ATOM   8404  C CD1 . LEU E 2 131 ? 13.418  7.826   24.019  1.00 23.60  ? 131 LEU H CD1 1 
ATOM   8405  C CD2 . LEU E 2 131 ? 11.995  9.699   24.827  1.00 25.69  ? 131 LEU H CD2 1 
ATOM   8406  N N   . ALA E 2 132 ? 8.756   6.787   27.782  1.00 49.81  ? 132 ALA H N   1 
ATOM   8407  C CA  . ALA E 2 132 ? 7.920   5.780   28.437  1.00 51.31  ? 132 ALA H CA  1 
ATOM   8408  C C   . ALA E 2 132 ? 7.007   4.997   27.489  1.00 50.47  ? 132 ALA H C   1 
ATOM   8409  O O   . ALA E 2 132 ? 6.367   5.562   26.609  1.00 49.70  ? 132 ALA H O   1 
ATOM   8410  C CB  . ALA E 2 132 ? 7.123   6.410   29.558  1.00 35.59  ? 132 ALA H CB  1 
ATOM   8411  N N   . PRO E 2 133 ? 6.940   3.679   27.686  1.00 50.96  ? 133 PRO H N   1 
ATOM   8412  C CA  . PRO E 2 133 ? 6.116   2.799   26.853  1.00 51.07  ? 133 PRO H CA  1 
ATOM   8413  C C   . PRO E 2 133 ? 4.633   3.093   27.040  1.00 53.54  ? 133 PRO H C   1 
ATOM   8414  O O   . PRO E 2 133 ? 4.202   3.274   28.186  1.00 56.02  ? 133 PRO H O   1 
ATOM   8415  C CB  . PRO E 2 133 ? 6.433   1.414   27.405  1.00 51.96  ? 133 PRO H CB  1 
ATOM   8416  C CG  . PRO E 2 133 ? 6.820   1.670   28.837  1.00 53.66  ? 133 PRO H CG  1 
ATOM   8417  C CD  . PRO E 2 133 ? 7.562   2.963   28.815  1.00 52.32  ? 133 PRO H CD  1 
ATOM   8418  N N   . SER E 2 134 ? 3.865   3.132   25.945  1.00 53.35  ? 134 SER H N   1 
ATOM   8419  C CA  . SER E 2 134 ? 2.422   3.424   25.994  1.00 55.68  ? 134 SER H CA  1 
ATOM   8420  C C   . SER E 2 134 ? 1.575   2.180   26.301  1.00 56.91  ? 134 SER H C   1 
ATOM   8421  O O   . SER E 2 134 ? 1.887   1.074   25.841  1.00 55.80  ? 134 SER H O   1 
ATOM   8422  C CB  . SER E 2 134 ? 1.947   4.111   24.690  1.00 55.68  ? 134 SER H CB  1 
ATOM   8423  O OG  . SER E 2 134 ? 1.812   3.201   23.592  1.00 55.45  ? 134 SER H OG  1 
ATOM   8424  N N   . GLY E 2 141 ? 2.536   -7.522  19.272  1.00 40.56  ? 141 GLY H N   1 
ATOM   8425  C CA  . GLY E 2 141 ? 2.655   -7.867  20.677  1.00 41.73  ? 141 GLY H CA  1 
ATOM   8426  C C   . GLY E 2 141 ? 3.961   -7.419  21.325  1.00 42.12  ? 141 GLY H C   1 
ATOM   8427  O O   . GLY E 2 141 ? 4.459   -8.061  22.268  1.00 41.17  ? 141 GLY H O   1 
ATOM   8428  N N   . THR E 2 142 ? 4.526   -6.321  20.812  1.00 39.36  ? 142 THR H N   1 
ATOM   8429  C CA  . THR E 2 142 ? 5.751   -5.748  21.369  1.00 37.58  ? 142 THR H CA  1 
ATOM   8430  C C   . THR E 2 142 ? 5.569   -4.265  21.731  1.00 35.94  ? 142 THR H C   1 
ATOM   8431  O O   . THR E 2 142 ? 4.831   -3.552  21.068  1.00 35.32  ? 142 THR H O   1 
ATOM   8432  C CB  . THR E 2 142 ? 6.950   -5.871  20.386  1.00 42.12  ? 142 THR H CB  1 
ATOM   8433  O OG1 . THR E 2 142 ? 6.939   -4.766  19.485  1.00 40.41  ? 142 THR H OG1 1 
ATOM   8434  C CG2 . THR E 2 142 ? 6.902   -7.154  19.571  1.00 43.42  ? 142 THR H CG2 1 
ATOM   8435  N N   . ALA E 2 143 ? 6.247   -3.804  22.783  1.00 35.59  ? 143 ALA H N   1 
ATOM   8436  C CA  . ALA E 2 143 ? 6.263   -2.386  23.133  1.00 34.20  ? 143 ALA H CA  1 
ATOM   8437  C C   . ALA E 2 143 ? 7.665   -1.818  23.029  1.00 32.48  ? 143 ALA H C   1 
ATOM   8438  O O   . ALA E 2 143 ? 8.649   -2.515  23.283  1.00 33.08  ? 143 ALA H O   1 
ATOM   8439  C CB  . ALA E 2 143 ? 5.755   -2.178  24.514  1.00 34.32  ? 143 ALA H CB  1 
ATOM   8440  N N   . ALA E 2 144 ? 7.756   -0.541  22.672  1.00 30.65  ? 144 ALA H N   1 
ATOM   8441  C CA  . ALA E 2 144 ? 9.035   0.154   22.658  1.00 28.92  ? 144 ALA H CA  1 
ATOM   8442  C C   . ALA E 2 144 ? 9.126   1.170   23.810  1.00 29.00  ? 144 ALA H C   1 
ATOM   8443  O O   . ALA E 2 144 ? 8.195   1.952   24.029  1.00 29.52  ? 144 ALA H O   1 
ATOM   8444  C CB  . ALA E 2 144 ? 9.258   0.836   21.313  1.00 25.86  ? 144 ALA H CB  1 
ATOM   8445  N N   . LEU E 2 145 ? 10.244  1.149   24.532  1.00 28.74  ? 145 LEU H N   1 
ATOM   8446  C CA  . LEU E 2 145 ? 10.511  2.121   25.584  1.00 28.48  ? 145 LEU H CA  1 
ATOM   8447  C C   . LEU E 2 145 ? 11.976  2.546   25.467  1.00 27.35  ? 145 LEU H C   1 
ATOM   8448  O O   . LEU E 2 145 ? 12.769  1.881   24.797  1.00 35.34  ? 145 LEU H O   1 
ATOM   8449  C CB  . LEU E 2 145 ? 10.216  1.524   26.971  1.00 30.87  ? 145 LEU H CB  1 
ATOM   8450  C CG  . LEU E 2 145 ? 11.061  0.302   27.324  1.00 31.79  ? 145 LEU H CG  1 
ATOM   8451  C CD1 . LEU E 2 145 ? 12.200  0.681   28.268  1.00 32.42  ? 145 LEU H CD1 1 
ATOM   8452  C CD2 . LEU E 2 145 ? 10.217  -0.823  27.871  1.00 34.00  ? 145 LEU H CD2 1 
ATOM   8453  N N   . GLY E 2 146 ? 12.354  3.650   26.094  1.00 27.44  ? 146 GLY H N   1 
ATOM   8454  C CA  . GLY E 2 146 ? 13.714  4.117   25.909  1.00 27.75  ? 146 GLY H CA  1 
ATOM   8455  C C   . GLY E 2 146 ? 14.162  5.191   26.868  1.00 28.56  ? 146 GLY H C   1 
ATOM   8456  O O   . GLY E 2 146 ? 13.438  5.517   27.793  1.00 29.94  ? 146 GLY H O   1 
ATOM   8457  N N   . CYS E 2 147 ? 15.352  5.737   26.620  1.00 28.09  ? 147 CYS H N   1 
ATOM   8458  C CA  . CYS E 2 147 ? 15.934  6.838   27.410  1.00 29.12  ? 147 CYS H CA  1 
ATOM   8459  C C   . CYS E 2 147 ? 16.449  7.915   26.490  1.00 27.83  ? 147 CYS H C   1 
ATOM   8460  O O   . CYS E 2 147 ? 17.030  7.622   25.439  1.00 26.42  ? 147 CYS H O   1 
ATOM   8461  C CB  . CYS E 2 147 ? 17.128  6.372   28.242  1.00 30.29  ? 147 CYS H CB  1 
ATOM   8462  S SG  . CYS E 2 147 ? 16.675  5.668   29.798  1.00 80.39  ? 147 CYS H SG  1 
ATOM   8463  N N   . LEU E 2 148 ? 16.248  9.158   26.898  1.00 28.53  ? 148 LEU H N   1 
ATOM   8464  C CA  . LEU E 2 148 ? 16.691  10.288  26.119  1.00 25.72  ? 148 LEU H CA  1 
ATOM   8465  C C   . LEU E 2 148 ? 17.870  10.947  26.831  1.00 32.22  ? 148 LEU H C   1 
ATOM   8466  O O   . LEU E 2 148 ? 17.698  11.552  27.889  1.00 33.96  ? 148 LEU H O   1 
ATOM   8467  C CB  . LEU E 2 148 ? 15.535  11.268  25.949  1.00 25.90  ? 148 LEU H CB  1 
ATOM   8468  C CG  . LEU E 2 148 ? 15.887  12.668  25.440  1.00 25.75  ? 148 LEU H CG  1 
ATOM   8469  C CD1 . LEU E 2 148 ? 16.466  12.640  24.043  1.00 24.03  ? 148 LEU H CD1 1 
ATOM   8470  C CD2 . LEU E 2 148 ? 14.695  13.573  25.499  1.00 26.57  ? 148 LEU H CD2 1 
ATOM   8471  N N   . VAL E 2 149 ? 19.075  10.831  26.274  1.00 31.51  ? 149 VAL H N   1 
ATOM   8472  C CA  . VAL E 2 149 ? 20.241  11.437  26.925  1.00 32.70  ? 149 VAL H CA  1 
ATOM   8473  C C   . VAL E 2 149 ? 20.491  12.858  26.394  1.00 32.48  ? 149 VAL H C   1 
ATOM   8474  O O   . VAL E 2 149 ? 21.090  13.037  25.329  1.00 31.61  ? 149 VAL H O   1 
ATOM   8475  C CB  . VAL E 2 149 ? 21.497  10.535  26.805  1.00 29.06  ? 149 VAL H CB  1 
ATOM   8476  C CG1 . VAL E 2 149 ? 22.655  11.156  27.523  1.00 29.24  ? 149 VAL H CG1 1 
ATOM   8477  C CG2 . VAL E 2 149 ? 21.224  9.152   27.373  1.00 28.06  ? 149 VAL H CG2 1 
ATOM   8478  N N   . LYS E 2 150 ? 20.024  13.871  27.123  1.00 33.55  ? 150 LYS H N   1 
ATOM   8479  C CA  . LYS E 2 150 ? 19.990  15.222  26.556  1.00 33.68  ? 150 LYS H CA  1 
ATOM   8480  C C   . LYS E 2 150 ? 21.065  16.220  27.018  1.00 35.24  ? 150 LYS H C   1 
ATOM   8481  O O   . LYS E 2 150 ? 21.488  16.220  28.170  1.00 36.80  ? 150 LYS H O   1 
ATOM   8482  C CB  . LYS E 2 150 ? 18.604  15.838  26.739  1.00 34.41  ? 150 LYS H CB  1 
ATOM   8483  C CG  . LYS E 2 150 ? 18.097  16.642  25.542  1.00 33.51  ? 150 LYS H CG  1 
ATOM   8484  C CD  . LYS E 2 150 ? 17.557  17.983  25.991  1.00 35.53  ? 150 LYS H CD  1 
ATOM   8485  C CE  . LYS E 2 150 ? 17.084  18.812  24.831  1.00 35.21  ? 150 LYS H CE  1 
ATOM   8486  N NZ  . LYS E 2 150 ? 18.214  19.104  23.895  1.00 34.63  ? 150 LYS H NZ  1 
ATOM   8487  N N   . ASP E 2 151 ? 21.490  17.055  26.069  1.00 34.75  ? 151 ASP H N   1 
ATOM   8488  C CA  . ASP E 2 151 ? 22.414  18.177  26.276  1.00 36.41  ? 151 ASP H CA  1 
ATOM   8489  C C   . ASP E 2 151 ? 23.745  17.863  26.989  1.00 37.83  ? 151 ASP H C   1 
ATOM   8490  O O   . ASP E 2 151 ? 23.917  18.240  28.142  1.00 40.28  ? 151 ASP H O   1 
ATOM   8491  C CB  . ASP E 2 151 ? 21.685  19.333  26.970  1.00 38.61  ? 151 ASP H CB  1 
ATOM   8492  C CG  . ASP E 2 151 ? 20.665  20.031  26.058  1.00 38.51  ? 151 ASP H CG  1 
ATOM   8493  O OD1 . ASP E 2 151 ? 20.879  20.110  24.825  1.00 37.61  ? 151 ASP H OD1 1 
ATOM   8494  O OD2 . ASP E 2 151 ? 19.638  20.526  26.567  1.00 39.69  ? 151 ASP H OD2 1 
ATOM   8495  N N   . TYR E 2 152 ? 24.684  17.191  26.318  1.00 36.72  ? 152 TYR H N   1 
ATOM   8496  C CA  . TYR E 2 152 ? 25.980  16.871  26.941  1.00 38.58  ? 152 TYR H CA  1 
ATOM   8497  C C   . TYR E 2 152 ? 27.188  17.120  26.029  1.00 38.98  ? 152 TYR H C   1 
ATOM   8498  O O   . TYR E 2 152 ? 27.051  17.222  24.811  1.00 37.70  ? 152 TYR H O   1 
ATOM   8499  C CB  . TYR E 2 152 ? 26.028  15.425  27.436  1.00 33.30  ? 152 TYR H CB  1 
ATOM   8500  C CG  . TYR E 2 152 ? 26.010  14.399  26.332  1.00 31.08  ? 152 TYR H CG  1 
ATOM   8501  C CD1 . TYR E 2 152 ? 27.172  13.795  25.899  1.00 31.18  ? 152 TYR H CD1 1 
ATOM   8502  C CD2 . TYR E 2 152 ? 24.827  14.042  25.710  1.00 29.18  ? 152 TYR H CD2 1 
ATOM   8503  C CE1 . TYR E 2 152 ? 27.158  12.854  24.882  1.00 29.51  ? 152 TYR H CE1 1 
ATOM   8504  C CE2 . TYR E 2 152 ? 24.809  13.108  24.704  1.00 27.50  ? 152 TYR H CE2 1 
ATOM   8505  C CZ  . TYR E 2 152 ? 25.974  12.511  24.290  1.00 27.68  ? 152 TYR H CZ  1 
ATOM   8506  O OH  . TYR E 2 152 ? 25.951  11.571  23.261  1.00 27.99  ? 152 TYR H OH  1 
ATOM   8507  N N   . PHE E 2 153 ? 28.373  17.211  26.630  1.00 41.07  ? 153 PHE H N   1 
ATOM   8508  C CA  . PHE E 2 153 ? 29.602  17.366  25.874  1.00 36.00  ? 153 PHE H CA  1 
ATOM   8509  C C   . PHE E 2 153 ? 30.816  16.943  26.719  1.00 46.91  ? 153 PHE H C   1 
ATOM   8510  O O   . PHE E 2 153 ? 30.858  17.188  27.913  1.00 48.92  ? 153 PHE H O   1 
ATOM   8511  C CB  . PHE E 2 153 ? 29.750  18.816  25.420  1.00 36.93  ? 153 PHE H CB  1 
ATOM   8512  C CG  . PHE E 2 153 ? 30.961  19.051  24.586  1.00 40.08  ? 153 PHE H CG  1 
ATOM   8513  C CD1 . PHE E 2 153 ? 30.928  18.817  23.217  1.00 35.88  ? 153 PHE H CD1 1 
ATOM   8514  C CD2 . PHE E 2 153 ? 32.155  19.454  25.172  1.00 40.23  ? 153 PHE H CD2 1 
ATOM   8515  C CE1 . PHE E 2 153 ? 32.058  18.997  22.449  1.00 36.81  ? 153 PHE H CE1 1 
ATOM   8516  C CE2 . PHE E 2 153 ? 33.281  19.633  24.408  1.00 41.11  ? 153 PHE H CE2 1 
ATOM   8517  C CZ  . PHE E 2 153 ? 33.239  19.408  23.046  1.00 39.42  ? 153 PHE H CZ  1 
ATOM   8518  N N   . PRO E 2 154 ? 31.815  16.299  26.105  1.00 38.19  ? 154 PRO H N   1 
ATOM   8519  C CA  . PRO E 2 154 ? 31.880  15.863  24.719  1.00 40.62  ? 154 PRO H CA  1 
ATOM   8520  C C   . PRO E 2 154 ? 31.316  14.492  24.671  1.00 38.79  ? 154 PRO H C   1 
ATOM   8521  O O   . PRO E 2 154 ? 30.614  14.130  25.584  1.00 34.66  ? 154 PRO H O   1 
ATOM   8522  C CB  . PRO E 2 154 ? 33.390  15.808  24.455  1.00 42.52  ? 154 PRO H CB  1 
ATOM   8523  C CG  . PRO E 2 154 ? 33.954  15.411  25.728  1.00 40.21  ? 154 PRO H CG  1 
ATOM   8524  C CD  . PRO E 2 154 ? 33.105  16.102  26.781  1.00 40.77  ? 154 PRO H CD  1 
ATOM   8525  N N   . GLU E 2 155 ? 31.629  13.741  23.633  1.00 37.62  ? 155 GLU H N   1 
ATOM   8526  C CA  . GLU E 2 155 ? 31.311  12.334  23.615  1.00 37.14  ? 155 GLU H CA  1 
ATOM   8527  C C   . GLU E 2 155 ? 32.469  11.563  24.218  1.00 39.05  ? 155 GLU H C   1 
ATOM   8528  O O   . GLU E 2 155 ? 33.564  12.083  24.300  1.00 41.03  ? 155 GLU H O   1 
ATOM   8529  C CB  . GLU E 2 155 ? 31.105  11.908  22.194  1.00 36.37  ? 155 GLU H CB  1 
ATOM   8530  C CG  . GLU E 2 155 ? 29.940  12.549  21.575  1.00 35.83  ? 155 GLU H CG  1 
ATOM   8531  C CD  . GLU E 2 155 ? 29.731  11.982  20.211  1.00 35.92  ? 155 GLU H CD  1 
ATOM   8532  O OE1 . GLU E 2 155 ? 30.461  12.428  19.271  1.00 37.10  ? 155 GLU H OE1 1 
ATOM   8533  O OE2 . GLU E 2 155 ? 28.883  11.054  20.101  1.00 34.96  ? 155 GLU H OE2 1 
ATOM   8534  N N   . PRO E 2 156 ? 32.257  10.305  24.606  1.00 38.82  ? 156 PRO H N   1 
ATOM   8535  C CA  . PRO E 2 156 ? 31.052  9.486   24.483  1.00 36.85  ? 156 PRO H CA  1 
ATOM   8536  C C   . PRO E 2 156 ? 30.188  9.452   25.727  1.00 36.85  ? 156 PRO H C   1 
ATOM   8537  O O   . PRO E 2 156 ? 30.593  9.920   26.781  1.00 38.92  ? 156 PRO H O   1 
ATOM   8538  C CB  . PRO E 2 156 ? 31.626  8.097   24.247  1.00 37.70  ? 156 PRO H CB  1 
ATOM   8539  C CG  . PRO E 2 156 ? 32.919  8.115   25.007  1.00 40.48  ? 156 PRO H CG  1 
ATOM   8540  C CD  . PRO E 2 156 ? 33.449  9.501   24.919  1.00 40.99  ? 156 PRO H CD  1 
ATOM   8541  N N   . VAL E 2 157 ? 28.976  8.930   25.566  1.00 34.82  ? 157 VAL H N   1 
ATOM   8542  C CA  . VAL E 2 157 ? 28.205  8.343   26.654  1.00 34.97  ? 157 VAL H CA  1 
ATOM   8543  C C   . VAL E 2 157 ? 28.100  6.848   26.344  1.00 34.82  ? 157 VAL H C   1 
ATOM   8544  O O   . VAL E 2 157 ? 28.373  6.424   25.225  1.00 34.20  ? 157 VAL H O   1 
ATOM   8545  C CB  . VAL E 2 157 ? 26.777  8.904   26.756  1.00 33.24  ? 157 VAL H CB  1 
ATOM   8546  C CG1 . VAL E 2 157 ? 26.792  10.368  27.048  1.00 33.54  ? 157 VAL H CG1 1 
ATOM   8547  C CG2 . VAL E 2 157 ? 26.036  8.625   25.498  1.00 31.03  ? 157 VAL H CG2 1 
ATOM   8548  N N   . THR E 2 158 ? 27.729  6.040   27.324  1.00 35.81  ? 158 THR H N   1 
ATOM   8549  C CA  . THR E 2 158 ? 27.475  4.641   27.057  1.00 35.71  ? 158 THR H CA  1 
ATOM   8550  C C   . THR E 2 158 ? 26.126  4.413   27.659  1.00 35.51  ? 158 THR H C   1 
ATOM   8551  O O   . THR E 2 158 ? 25.776  5.081   28.625  1.00 36.71  ? 158 THR H O   1 
ATOM   8552  C CB  . THR E 2 158 ? 28.518  3.693   27.705  1.00 44.03  ? 158 THR H CB  1 
ATOM   8553  O OG1 . THR E 2 158 ? 28.993  4.252   28.937  1.00 46.23  ? 158 THR H OG1 1 
ATOM   8554  C CG2 . THR E 2 158 ? 29.703  3.473   26.772  1.00 44.26  ? 158 THR H CG2 1 
ATOM   8555  N N   . VAL E 2 159 ? 25.340  3.518   27.075  1.00 34.20  ? 159 VAL H N   1 
ATOM   8556  C CA  . VAL E 2 159 ? 24.066  3.162   27.683  1.00 34.05  ? 159 VAL H CA  1 
ATOM   8557  C C   . VAL E 2 159 ? 23.979  1.647   27.752  1.00 34.79  ? 159 VAL H C   1 
ATOM   8558  O O   . VAL E 2 159 ? 24.272  0.962   26.783  1.00 34.24  ? 159 VAL H O   1 
ATOM   8559  C CB  . VAL E 2 159 ? 22.843  3.756   26.916  1.00 35.37  ? 159 VAL H CB  1 
ATOM   8560  C CG1 . VAL E 2 159 ? 21.530  3.408   27.635  1.00 29.99  ? 159 VAL H CG1 1 
ATOM   8561  C CG2 . VAL E 2 159 ? 22.994  5.273   26.729  1.00 28.62  ? 159 VAL H CG2 1 
ATOM   8562  N N   . SER E 2 160 ? 23.619  1.119   28.910  1.00 36.34  ? 160 SER H N   1 
ATOM   8563  C CA  . SER E 2 160 ? 23.305  -0.287  28.996  1.00 35.90  ? 160 SER H CA  1 
ATOM   8564  C C   . SER E 2 160 ? 21.889  -0.336  29.521  1.00 35.97  ? 160 SER H C   1 
ATOM   8565  O O   . SER E 2 160 ? 21.422  0.635   30.091  1.00 35.86  ? 160 SER H O   1 
ATOM   8566  C CB  . SER E 2 160 ? 24.274  -1.021  29.929  1.00 38.90  ? 160 SER H CB  1 
ATOM   8567  O OG  . SER E 2 160 ? 24.178  -0.574  31.279  1.00 40.84  ? 160 SER H OG  1 
ATOM   8568  N N   . TRP E 2 161 ? 21.192  -1.444  29.307  1.00 36.36  ? 161 TRP H N   1 
ATOM   8569  C CA  . TRP E 2 161 ? 19.891  -1.633  29.929  1.00 37.09  ? 161 TRP H CA  1 
ATOM   8570  C C   . TRP E 2 161 ? 19.989  -2.746  30.954  1.00 43.97  ? 161 TRP H C   1 
ATOM   8571  O O   . TRP E 2 161 ? 20.632  -3.762  30.709  1.00 44.79  ? 161 TRP H O   1 
ATOM   8572  C CB  . TRP E 2 161 ? 18.811  -1.938  28.887  1.00 38.39  ? 161 TRP H CB  1 
ATOM   8573  C CG  . TRP E 2 161 ? 18.443  -0.740  28.085  1.00 34.71  ? 161 TRP H CG  1 
ATOM   8574  C CD1 . TRP E 2 161 ? 19.047  -0.302  26.939  1.00 30.81  ? 161 TRP H CD1 1 
ATOM   8575  C CD2 . TRP E 2 161 ? 17.415  0.201   28.384  1.00 32.20  ? 161 TRP H CD2 1 
ATOM   8576  N NE1 . TRP E 2 161 ? 18.455  0.850   26.503  1.00 29.08  ? 161 TRP H NE1 1 
ATOM   8577  C CE2 . TRP E 2 161 ? 17.446  1.185   27.370  1.00 33.86  ? 161 TRP H CE2 1 
ATOM   8578  C CE3 . TRP E 2 161 ? 16.466  0.305   29.397  1.00 33.72  ? 161 TRP H CE3 1 
ATOM   8579  C CZ2 . TRP E 2 161 ? 16.549  2.265   27.342  1.00 32.97  ? 161 TRP H CZ2 1 
ATOM   8580  C CZ3 . TRP E 2 161 ? 15.582  1.372   29.368  1.00 37.75  ? 161 TRP H CZ3 1 
ATOM   8581  C CH2 . TRP E 2 161 ? 15.627  2.339   28.345  1.00 30.57  ? 161 TRP H CH2 1 
ATOM   8582  N N   . ASN E 2 162 ? 19.360  -2.529  32.107  1.00 45.65  ? 162 ASN H N   1 
ATOM   8583  C CA  . ASN E 2 162 ? 19.383  -3.470  33.215  1.00 48.95  ? 162 ASN H CA  1 
ATOM   8584  C C   . ASN E 2 162 ? 20.774  -4.026  33.504  1.00 51.09  ? 162 ASN H C   1 
ATOM   8585  O O   . ASN E 2 162 ? 20.937  -5.208  33.796  1.00 53.74  ? 162 ASN H O   1 
ATOM   8586  C CB  . ASN E 2 162 ? 18.327  -4.555  33.029  1.00 46.16  ? 162 ASN H CB  1 
ATOM   8587  C CG  . ASN E 2 162 ? 16.902  -3.974  33.002  1.00 47.13  ? 162 ASN H CG  1 
ATOM   8588  O OD1 . ASN E 2 162 ? 16.690  -2.797  33.313  1.00 44.36  ? 162 ASN H OD1 1 
ATOM   8589  N ND2 . ASN E 2 162 ? 15.924  -4.800  32.632  1.00 45.39  ? 162 ASN H ND2 1 
ATOM   8590  N N   . SER E 2 163 ? 21.771  -3.147  33.415  1.00 50.24  ? 163 SER H N   1 
ATOM   8591  C CA  . SER E 2 163 ? 23.162  -3.483  33.748  1.00 52.17  ? 163 SER H CA  1 
ATOM   8592  C C   . SER E 2 163 ? 23.804  -4.508  32.811  1.00 48.30  ? 163 SER H C   1 
ATOM   8593  O O   . SER E 2 163 ? 24.786  -5.156  33.156  1.00 54.68  ? 163 SER H O   1 
ATOM   8594  C CB  . SER E 2 163 ? 23.279  -3.912  35.212  1.00 52.48  ? 163 SER H CB  1 
ATOM   8595  O OG  . SER E 2 163 ? 22.633  -2.962  36.032  1.00 52.86  ? 163 SER H OG  1 
ATOM   8596  N N   . GLY E 2 164 ? 23.252  -4.626  31.611  1.00 50.70  ? 164 GLY H N   1 
ATOM   8597  C CA  . GLY E 2 164 ? 23.784  -5.529  30.615  1.00 45.48  ? 164 GLY H CA  1 
ATOM   8598  C C   . GLY E 2 164 ? 23.006  -6.817  30.504  1.00 46.74  ? 164 GLY H C   1 
ATOM   8599  O O   . GLY E 2 164 ? 23.379  -7.685  29.733  1.00 47.13  ? 164 GLY H O   1 
ATOM   8600  N N   . ALA E 2 165 ? 21.936  -6.946  31.283  1.00 47.81  ? 165 ALA H N   1 
ATOM   8601  C CA  . ALA E 2 165 ? 21.065  -8.117  31.217  1.00 49.37  ? 165 ALA H CA  1 
ATOM   8602  C C   . ALA E 2 165 ? 20.054  -8.027  30.067  1.00 47.12  ? 165 ALA H C   1 
ATOM   8603  O O   . ALA E 2 165 ? 19.436  -9.032  29.709  1.00 48.40  ? 165 ALA H O   1 
ATOM   8604  C CB  . ALA E 2 165 ? 20.339  -8.322  32.533  1.00 51.66  ? 165 ALA H CB  1 
ATOM   8605  N N   . LEU E 2 166 ? 19.868  -6.826  29.515  1.00 43.93  ? 166 LEU H N   1 
ATOM   8606  C CA  . LEU E 2 166 ? 19.011  -6.630  28.358  1.00 41.23  ? 166 LEU H CA  1 
ATOM   8607  C C   . LEU E 2 166 ? 19.865  -6.099  27.210  1.00 39.32  ? 166 LEU H C   1 
ATOM   8608  O O   . LEU E 2 166 ? 20.403  -4.991  27.284  1.00 38.11  ? 166 LEU H O   1 
ATOM   8609  C CB  . LEU E 2 166 ? 17.876  -5.654  28.689  1.00 39.78  ? 166 LEU H CB  1 
ATOM   8610  C CG  . LEU E 2 166 ? 16.822  -5.468  27.592  1.00 37.73  ? 166 LEU H CG  1 
ATOM   8611  C CD1 . LEU E 2 166 ? 16.194  -6.794  27.242  1.00 38.90  ? 166 LEU H CD1 1 
ATOM   8612  C CD2 . LEU E 2 166 ? 15.771  -4.491  28.019  1.00 36.85  ? 166 LEU H CD2 1 
ATOM   8613  N N   . THR E 2 167 ? 20.012  -6.894  26.152  1.00 39.23  ? 167 THR H N   1 
ATOM   8614  C CA  . THR E 2 167 ? 20.818  -6.470  24.997  1.00 37.33  ? 167 THR H CA  1 
ATOM   8615  C C   . THR E 2 167 ? 20.098  -6.663  23.673  1.00 35.90  ? 167 THR H C   1 
ATOM   8616  O O   . THR E 2 167 ? 20.271  -5.880  22.744  1.00 33.69  ? 167 THR H O   1 
ATOM   8617  C CB  . THR E 2 167 ? 22.130  -7.230  24.936  1.00 39.17  ? 167 THR H CB  1 
ATOM   8618  O OG1 . THR E 2 167 ? 22.037  -8.391  25.771  1.00 42.23  ? 167 THR H OG1 1 
ATOM   8619  C CG2 . THR E 2 167 ? 23.235  -6.349  25.434  1.00 39.01  ? 167 THR H CG2 1 
ATOM   8620  N N   . SER E 2 168 ? 19.312  -7.735  23.609  1.00 37.41  ? 168 SER H N   1 
ATOM   8621  C CA  . SER E 2 168 ? 18.390  -8.000  22.523  1.00 36.40  ? 168 SER H CA  1 
ATOM   8622  C C   . SER E 2 168 ? 17.425  -6.842  22.313  1.00 34.22  ? 168 SER H C   1 
ATOM   8623  O O   . SER E 2 168 ? 16.731  -6.415  23.243  1.00 34.31  ? 168 SER H O   1 
ATOM   8624  C CB  . SER E 2 168 ? 17.595  -9.266  22.815  1.00 38.59  ? 168 SER H CB  1 
ATOM   8625  O OG  . SER E 2 168 ? 16.423  -9.311  22.023  1.00 37.90  ? 168 SER H OG  1 
ATOM   8626  N N   . GLY E 2 169 ? 17.388  -6.338  21.084  1.00 31.95  ? 169 GLY H N   1 
ATOM   8627  C CA  . GLY E 2 169 ? 16.399  -5.363  20.707  1.00 30.11  ? 169 GLY H CA  1 
ATOM   8628  C C   . GLY E 2 169 ? 16.809  -3.960  21.058  1.00 33.78  ? 169 GLY H C   1 
ATOM   8629  O O   . GLY E 2 169 ? 16.042  -3.025  20.855  1.00 32.46  ? 169 GLY H O   1 
ATOM   8630  N N   . VAL E 2 170 ? 18.021  -3.800  21.585  1.00 33.94  ? 170 VAL H N   1 
ATOM   8631  C CA  . VAL E 2 170 ? 18.481  -2.486  22.006  1.00 32.51  ? 170 VAL H CA  1 
ATOM   8632  C C   . VAL E 2 170 ? 19.082  -1.776  20.830  1.00 26.12  ? 170 VAL H C   1 
ATOM   8633  O O   . VAL E 2 170 ? 19.870  -2.374  20.116  1.00 31.53  ? 170 VAL H O   1 
ATOM   8634  C CB  . VAL E 2 170 ? 19.525  -2.580  23.127  1.00 28.96  ? 170 VAL H CB  1 
ATOM   8635  C CG1 . VAL E 2 170 ? 20.077  -1.199  23.494  1.00 27.97  ? 170 VAL H CG1 1 
ATOM   8636  C CG2 . VAL E 2 170 ? 18.916  -3.239  24.317  1.00 30.73  ? 170 VAL H CG2 1 
ATOM   8637  N N   . HIS E 2 171 ? 18.698  -0.516  20.637  1.00 24.59  ? 171 HIS H N   1 
ATOM   8638  C CA  . HIS E 2 171 ? 19.328  0.382   19.683  1.00 23.41  ? 171 HIS H CA  1 
ATOM   8639  C C   . HIS E 2 171 ? 19.766  1.669   20.346  1.00 26.51  ? 171 HIS H C   1 
ATOM   8640  O O   . HIS E 2 171 ? 18.925  2.457   20.811  1.00 26.25  ? 171 HIS H O   1 
ATOM   8641  C CB  . HIS E 2 171 ? 18.370  0.768   18.557  1.00 22.34  ? 171 HIS H CB  1 
ATOM   8642  C CG  . HIS E 2 171 ? 17.989  -0.382  17.684  1.00 31.34  ? 171 HIS H CG  1 
ATOM   8643  N ND1 . HIS E 2 171 ? 16.695  -0.839  17.589  1.00 23.26  ? 171 HIS H ND1 1 
ATOM   8644  C CD2 . HIS E 2 171 ? 18.750  -1.204  16.923  1.00 23.86  ? 171 HIS H CD2 1 
ATOM   8645  C CE1 . HIS E 2 171 ? 16.667  -1.888  16.780  1.00 35.29  ? 171 HIS H CE1 1 
ATOM   8646  N NE2 . HIS E 2 171 ? 17.898  -2.135  16.375  1.00 24.60  ? 171 HIS H NE2 1 
ATOM   8647  N N   . THR E 2 172 ? 21.073  1.907   20.377  1.00 26.31  ? 172 THR H N   1 
ATOM   8648  C CA  . THR E 2 172 ? 21.530  3.213   20.773  1.00 25.58  ? 172 THR H CA  1 
ATOM   8649  C C   . THR E 2 172 ? 21.916  3.990   19.511  1.00 24.58  ? 172 THR H C   1 
ATOM   8650  O O   . THR E 2 172 ? 22.670  3.525   18.672  1.00 25.20  ? 172 THR H O   1 
ATOM   8651  C CB  . THR E 2 172 ? 22.648  3.141   21.841  1.00 26.83  ? 172 THR H CB  1 
ATOM   8652  O OG1 . THR E 2 172 ? 22.173  2.414   22.978  1.00 25.37  ? 172 THR H OG1 1 
ATOM   8653  C CG2 . THR E 2 172 ? 23.022  4.519   22.305  1.00 24.08  ? 172 THR H CG2 1 
ATOM   8654  N N   . PHE E 2 173 ? 21.361  5.176   19.375  1.00 23.40  ? 173 PHE H N   1 
ATOM   8655  C CA  . PHE E 2 173 ? 21.518  5.958   18.175  1.00 22.60  ? 173 PHE H CA  1 
ATOM   8656  C C   . PHE E 2 173 ? 22.746  6.828   18.265  1.00 23.41  ? 173 PHE H C   1 
ATOM   8657  O O   . PHE E 2 173 ? 23.067  7.297   19.334  1.00 24.37  ? 173 PHE H O   1 
ATOM   8658  C CB  . PHE E 2 173 ? 20.295  6.854   17.977  1.00 21.52  ? 173 PHE H CB  1 
ATOM   8659  C CG  . PHE E 2 173 ? 19.098  6.115   17.555  1.00 21.17  ? 173 PHE H CG  1 
ATOM   8660  C CD1 . PHE E 2 173 ? 18.934  5.751   16.223  1.00 21.49  ? 173 PHE H CD1 1 
ATOM   8661  C CD2 . PHE E 2 173 ? 18.128  5.765   18.476  1.00 21.22  ? 173 PHE H CD2 1 
ATOM   8662  C CE1 . PHE E 2 173 ? 17.809  5.034   15.820  1.00 21.78  ? 173 PHE H CE1 1 
ATOM   8663  C CE2 . PHE E 2 173 ? 17.017  5.045   18.096  1.00 19.44  ? 173 PHE H CE2 1 
ATOM   8664  C CZ  . PHE E 2 173 ? 16.857  4.674   16.766  1.00 22.06  ? 173 PHE H CZ  1 
ATOM   8665  N N   . PRO E 2 174 ? 23.423  7.064   17.120  1.00 23.20  ? 174 PRO H N   1 
ATOM   8666  C CA  . PRO E 2 174 ? 24.493  8.067   17.026  1.00 23.46  ? 174 PRO H CA  1 
ATOM   8667  C C   . PRO E 2 174 ? 24.055  9.378   17.649  1.00 21.12  ? 174 PRO H C   1 
ATOM   8668  O O   . PRO E 2 174 ? 22.919  9.794   17.453  1.00 22.23  ? 174 PRO H O   1 
ATOM   8669  C CB  . PRO E 2 174 ? 24.643  8.247   15.523  1.00 21.30  ? 174 PRO H CB  1 
ATOM   8670  C CG  . PRO E 2 174 ? 24.263  6.940   14.962  1.00 21.27  ? 174 PRO H CG  1 
ATOM   8671  C CD  . PRO E 2 174 ? 23.205  6.372   15.828  1.00 22.80  ? 174 PRO H CD  1 
ATOM   8672  N N   . ALA E 2 175 ? 24.925  10.001  18.424  1.00 22.03  ? 175 ALA H N   1 
ATOM   8673  C CA  . ALA E 2 175 ? 24.592  11.276  19.022  1.00 28.88  ? 175 ALA H CA  1 
ATOM   8674  C C   . ALA E 2 175 ? 24.391  12.252  17.908  1.00 29.03  ? 175 ALA H C   1 
ATOM   8675  O O   . ALA E 2 175 ? 24.950  12.080  16.853  1.00 29.21  ? 175 ALA H O   1 
ATOM   8676  C CB  . ALA E 2 175 ? 25.715  11.737  19.896  1.00 30.12  ? 175 ALA H CB  1 
ATOM   8677  N N   . VAL E 2 176 ? 23.582  13.274  18.107  1.00 29.60  ? 176 VAL H N   1 
ATOM   8678  C CA  . VAL E 2 176 ? 23.571  14.354  17.125  1.00 30.41  ? 176 VAL H CA  1 
ATOM   8679  C C   . VAL E 2 176 ? 23.997  15.634  17.806  1.00 32.21  ? 176 VAL H C   1 
ATOM   8680  O O   . VAL E 2 176 ? 23.665  15.873  18.948  1.00 32.69  ? 176 VAL H O   1 
ATOM   8681  C CB  . VAL E 2 176 ? 22.215  14.527  16.369  1.00 26.71  ? 176 VAL H CB  1 
ATOM   8682  C CG1 . VAL E 2 176 ? 21.611  13.174  16.033  1.00 25.72  ? 176 VAL H CG1 1 
ATOM   8683  C CG2 . VAL E 2 176 ? 21.232  15.373  17.156  1.00 27.11  ? 176 VAL H CG2 1 
ATOM   8684  N N   . LEU E 2 177 ? 24.788  16.421  17.100  1.00 33.73  ? 177 LEU H N   1 
ATOM   8685  C CA  . LEU E 2 177 ? 25.257  17.686  17.596  1.00 35.90  ? 177 LEU H CA  1 
ATOM   8686  C C   . LEU E 2 177 ? 24.137  18.704  17.415  1.00 37.26  ? 177 LEU H C   1 
ATOM   8687  O O   . LEU E 2 177 ? 23.569  18.835  16.333  1.00 36.82  ? 177 LEU H O   1 
ATOM   8688  C CB  . LEU E 2 177 ? 26.536  18.092  16.857  1.00 35.90  ? 177 LEU H CB  1 
ATOM   8689  C CG  . LEU E 2 177 ? 27.263  19.383  17.265  1.00 35.72  ? 177 LEU H CG  1 
ATOM   8690  C CD1 . LEU E 2 177 ? 27.533  19.469  18.762  1.00 38.80  ? 177 LEU H CD1 1 
ATOM   8691  C CD2 . LEU E 2 177 ? 28.562  19.546  16.508  1.00 36.05  ? 177 LEU H CD2 1 
ATOM   8692  N N   . GLN E 2 178 ? 23.789  19.393  18.496  1.00 39.17  ? 178 GLN H N   1 
ATOM   8693  C CA  . GLN E 2 178 ? 22.760  20.425  18.444  1.00 40.67  ? 178 GLN H CA  1 
ATOM   8694  C C   . GLN E 2 178 ? 23.460  21.752  18.233  1.00 42.72  ? 178 GLN H C   1 
ATOM   8695  O O   . GLN E 2 178 ? 24.684  21.855  18.428  1.00 43.36  ? 178 GLN H O   1 
ATOM   8696  C CB  . GLN E 2 178 ? 21.945  20.459  19.738  1.00 41.54  ? 178 GLN H CB  1 
ATOM   8697  C CG  . GLN E 2 178 ? 21.519  19.089  20.231  1.00 40.53  ? 178 GLN H CG  1 
ATOM   8698  C CD  . GLN E 2 178 ? 20.591  19.177  21.423  1.00 41.90  ? 178 GLN H CD  1 
ATOM   8699  O OE1 . GLN E 2 178 ? 19.382  18.989  21.282  1.00 42.00  ? 178 GLN H OE1 1 
ATOM   8700  N NE2 . GLN E 2 178 ? 21.141  19.465  22.605  1.00 43.22  ? 178 GLN H NE2 1 
ATOM   8701  N N   . SER E 2 179 ? 22.694  22.761  17.830  1.00 43.83  ? 179 SER H N   1 
ATOM   8702  C CA  . SER E 2 179 ? 23.293  24.044  17.485  1.00 46.27  ? 179 SER H CA  1 
ATOM   8703  C C   . SER E 2 179 ? 23.974  24.668  18.707  1.00 47.84  ? 179 SER H C   1 
ATOM   8704  O O   . SER E 2 179 ? 24.929  25.448  18.571  1.00 49.82  ? 179 SER H O   1 
ATOM   8705  C CB  . SER E 2 179 ? 22.269  24.994  16.839  1.00 48.00  ? 179 SER H CB  1 
ATOM   8706  O OG  . SER E 2 179 ? 21.103  25.170  17.641  1.00 48.71  ? 179 SER H OG  1 
ATOM   8707  N N   . SER E 2 180 ? 23.510  24.285  19.896  1.00 47.20  ? 180 SER H N   1 
ATOM   8708  C CA  . SER E 2 180 ? 24.110  24.739  21.149  1.00 48.56  ? 180 SER H CA  1 
ATOM   8709  C C   . SER E 2 180 ? 25.518  24.176  21.382  1.00 48.57  ? 180 SER H C   1 
ATOM   8710  O O   . SER E 2 180 ? 26.122  24.408  22.427  1.00 50.51  ? 180 SER H O   1 
ATOM   8711  C CB  . SER E 2 180 ? 23.201  24.374  22.330  1.00 48.11  ? 180 SER H CB  1 
ATOM   8712  O OG  . SER E 2 180 ? 22.901  22.984  22.361  1.00 45.80  ? 180 SER H OG  1 
ATOM   8713  N N   . GLY E 2 181 ? 26.037  23.425  20.421  1.00 46.64  ? 181 GLY H N   1 
ATOM   8714  C CA  . GLY E 2 181 ? 27.340  22.819  20.579  1.00 46.55  ? 181 GLY H CA  1 
ATOM   8715  C C   . GLY E 2 181 ? 27.323  21.559  21.425  1.00 45.10  ? 181 GLY H C   1 
ATOM   8716  O O   . GLY E 2 181 ? 28.383  20.981  21.673  1.00 45.85  ? 181 GLY H O   1 
ATOM   8717  N N   . LEU E 2 182 ? 26.134  21.131  21.863  1.00 42.97  ? 182 LEU H N   1 
ATOM   8718  C CA  . LEU E 2 182 ? 25.990  19.981  22.763  1.00 40.99  ? 182 LEU H CA  1 
ATOM   8719  C C   . LEU E 2 182 ? 25.383  18.792  22.034  1.00 37.27  ? 182 LEU H C   1 
ATOM   8720  O O   . LEU E 2 182 ? 24.682  18.963  21.046  1.00 36.16  ? 182 LEU H O   1 
ATOM   8721  C CB  . LEU E 2 182 ? 25.067  20.330  23.930  1.00 42.07  ? 182 LEU H CB  1 
ATOM   8722  C CG  . LEU E 2 182 ? 25.319  21.455  24.946  1.00 44.59  ? 182 LEU H CG  1 
ATOM   8723  C CD1 . LEU E 2 182 ? 23.997  22.103  25.350  1.00 44.88  ? 182 LEU H CD1 1 
ATOM   8724  C CD2 . LEU E 2 182 ? 25.993  20.893  26.174  1.00 45.92  ? 182 LEU H CD2 1 
ATOM   8725  N N   . TYR E 2 183 ? 25.633  17.589  22.544  1.00 35.64  ? 183 TYR H N   1 
ATOM   8726  C CA  . TYR E 2 183 ? 25.128  16.352  21.950  1.00 33.00  ? 183 TYR H CA  1 
ATOM   8727  C C   . TYR E 2 183 ? 23.838  15.853  22.601  1.00 32.25  ? 183 TYR H C   1 
ATOM   8728  O O   . TYR E 2 183 ? 23.507  16.238  23.715  1.00 33.41  ? 183 TYR H O   1 
ATOM   8729  C CB  . TYR E 2 183 ? 26.189  15.264  22.043  1.00 32.66  ? 183 TYR H CB  1 
ATOM   8730  C CG  . TYR E 2 183 ? 27.373  15.520  21.159  1.00 33.14  ? 183 TYR H CG  1 
ATOM   8731  C CD1 . TYR E 2 183 ? 27.345  15.142  19.831  1.00 32.09  ? 183 TYR H CD1 1 
ATOM   8732  C CD2 . TYR E 2 183 ? 28.525  16.154  21.638  1.00 34.98  ? 183 TYR H CD2 1 
ATOM   8733  C CE1 . TYR E 2 183 ? 28.419  15.377  18.993  1.00 32.84  ? 183 TYR H CE1 1 
ATOM   8734  C CE2 . TYR E 2 183 ? 29.611  16.390  20.803  1.00 35.70  ? 183 TYR H CE2 1 
ATOM   8735  C CZ  . TYR E 2 183 ? 29.538  15.997  19.472  1.00 34.69  ? 183 TYR H CZ  1 
ATOM   8736  O OH  . TYR E 2 183 ? 30.568  16.194  18.588  1.00 35.76  ? 183 TYR H OH  1 
ATOM   8737  N N   . SER E 2 184 ? 23.117  14.990  21.891  1.00 30.65  ? 184 SER H N   1 
ATOM   8738  C CA  . SER E 2 184 ? 21.918  14.333  22.399  1.00 30.41  ? 184 SER H CA  1 
ATOM   8739  C C   . SER E 2 184 ? 21.816  12.979  21.774  1.00 29.04  ? 184 SER H C   1 
ATOM   8740  O O   . SER E 2 184 ? 22.119  12.833  20.603  1.00 28.64  ? 184 SER H O   1 
ATOM   8741  C CB  . SER E 2 184 ? 20.663  15.095  21.994  1.00 30.85  ? 184 SER H CB  1 
ATOM   8742  O OG  . SER E 2 184 ? 20.270  16.030  22.994  1.00 33.01  ? 184 SER H OG  1 
ATOM   8743  N N   . LEU E 2 185 ? 21.387  11.977  22.528  1.00 28.62  ? 185 LEU H N   1 
ATOM   8744  C CA  . LEU E 2 185 ? 21.064  10.693  21.912  1.00 27.04  ? 185 LEU H CA  1 
ATOM   8745  C C   . LEU E 2 185 ? 19.909  10.020  22.597  1.00 27.67  ? 185 LEU H C   1 
ATOM   8746  O O   . LEU E 2 185 ? 19.468  10.458  23.675  1.00 29.15  ? 185 LEU H O   1 
ATOM   8747  C CB  . LEU E 2 185 ? 22.267  9.743   21.859  1.00 26.51  ? 185 LEU H CB  1 
ATOM   8748  C CG  . LEU E 2 185 ? 22.939  9.043   23.044  1.00 27.11  ? 185 LEU H CG  1 
ATOM   8749  C CD1 . LEU E 2 185 ? 22.050  7.971   23.656  1.00 27.12  ? 185 LEU H CD1 1 
ATOM   8750  C CD2 . LEU E 2 185 ? 24.221  8.417   22.545  1.00 27.16  ? 185 LEU H CD2 1 
ATOM   8751  N N   . SER E 2 186 ? 19.440  8.937   21.982  1.00 26.89  ? 186 SER H N   1 
ATOM   8752  C CA  . SER E 2 186 ? 18.382  8.126   22.555  1.00 27.22  ? 186 SER H CA  1 
ATOM   8753  C C   . SER E 2 186 ? 18.767  6.695   22.501  1.00 26.72  ? 186 SER H C   1 
ATOM   8754  O O   . SER E 2 186 ? 19.424  6.258   21.580  1.00 26.20  ? 186 SER H O   1 
ATOM   8755  C CB  . SER E 2 186 ? 17.074  8.309   21.799  1.00 27.44  ? 186 SER H CB  1 
ATOM   8756  O OG  . SER E 2 186 ? 16.397  9.475   22.254  1.00 28.70  ? 186 SER H OG  1 
ATOM   8757  N N   . SER E 2 187 ? 18.368  5.953   23.509  1.00 27.39  ? 187 SER H N   1 
ATOM   8758  C CA  . SER E 2 187 ? 18.572  4.534   23.455  1.00 27.68  ? 187 SER H CA  1 
ATOM   8759  C C   . SER E 2 187 ? 17.198  3.925   23.606  1.00 27.81  ? 187 SER H C   1 
ATOM   8760  O O   . SER E 2 187 ? 16.500  4.226   24.576  1.00 28.68  ? 187 SER H O   1 
ATOM   8761  C CB  . SER E 2 187 ? 19.516  4.089   24.561  1.00 24.90  ? 187 SER H CB  1 
ATOM   8762  O OG  . SER E 2 187 ? 19.954  2.774   24.336  1.00 25.50  ? 187 SER H OG  1 
ATOM   8763  N N   . VAL E 2 188 ? 16.784  3.114   22.631  1.00 23.06  ? 188 VAL H N   1 
ATOM   8764  C CA  . VAL E 2 188 ? 15.471  2.467   22.709  1.00 30.88  ? 188 VAL H CA  1 
ATOM   8765  C C   . VAL E 2 188 ? 15.626  0.960   22.700  1.00 24.57  ? 188 VAL H C   1 
ATOM   8766  O O   . VAL E 2 188 ? 16.639  0.438   22.291  1.00 24.63  ? 188 VAL H O   1 
ATOM   8767  C CB  . VAL E 2 188 ? 14.513  2.887   21.555  1.00 22.48  ? 188 VAL H CB  1 
ATOM   8768  C CG1 . VAL E 2 188 ? 14.338  4.392   21.495  1.00 21.75  ? 188 VAL H CG1 1 
ATOM   8769  C CG2 . VAL E 2 188 ? 15.021  2.359   20.239  1.00 21.84  ? 188 VAL H CG2 1 
ATOM   8770  N N   . VAL E 2 189 ? 14.612  0.271   23.185  1.00 25.67  ? 189 VAL H N   1 
ATOM   8771  C CA  . VAL E 2 189 ? 14.595  -1.180  23.179  1.00 27.56  ? 189 VAL H CA  1 
ATOM   8772  C C   . VAL E 2 189 ? 13.151  -1.581  22.975  1.00 28.27  ? 189 VAL H C   1 
ATOM   8773  O O   . VAL E 2 189 ? 12.241  -0.873  23.410  1.00 27.52  ? 189 VAL H O   1 
ATOM   8774  C CB  . VAL E 2 189 ? 15.115  -1.775  24.520  1.00 30.61  ? 189 VAL H CB  1 
ATOM   8775  C CG1 . VAL E 2 189 ? 14.250  -1.323  25.681  1.00 29.91  ? 189 VAL H CG1 1 
ATOM   8776  C CG2 . VAL E 2 189 ? 15.150  -3.303  24.468  1.00 32.32  ? 189 VAL H CG2 1 
ATOM   8777  N N   . THR E 2 190 ? 12.920  -2.691  22.293  1.00 29.29  ? 190 THR H N   1 
ATOM   8778  C CA  . THR E 2 190 ? 11.557  -3.181  22.178  1.00 31.03  ? 190 THR H CA  1 
ATOM   8779  C C   . THR E 2 190 ? 11.431  -4.476  22.944  1.00 33.74  ? 190 THR H C   1 
ATOM   8780  O O   . THR E 2 190 ? 12.276  -5.360  22.830  1.00 34.78  ? 190 THR H O   1 
ATOM   8781  C CB  . THR E 2 190 ? 11.137  -3.399  20.732  1.00 31.04  ? 190 THR H CB  1 
ATOM   8782  O OG1 . THR E 2 190 ? 12.137  -4.182  20.075  1.00 31.86  ? 190 THR H OG1 1 
ATOM   8783  C CG2 . THR E 2 190 ? 10.985  -2.067  20.012  1.00 29.10  ? 190 THR H CG2 1 
ATOM   8784  N N   . VAL E 2 191 ? 10.369  -4.573  23.734  1.00 35.22  ? 191 VAL H N   1 
ATOM   8785  C CA  . VAL E 2 191 ? 10.178  -5.674  24.657  1.00 37.94  ? 191 VAL H CA  1 
ATOM   8786  C C   . VAL E 2 191 ? 8.860   -6.311  24.324  1.00 39.40  ? 191 VAL H C   1 
ATOM   8787  O O   . VAL E 2 191 ? 8.097   -5.744  23.544  1.00 38.45  ? 191 VAL H O   1 
ATOM   8788  C CB  . VAL E 2 191 ? 10.070  -5.133  26.086  1.00 39.22  ? 191 VAL H CB  1 
ATOM   8789  C CG1 . VAL E 2 191 ? 11.371  -4.436  26.491  1.00 38.27  ? 191 VAL H CG1 1 
ATOM   8790  C CG2 . VAL E 2 191 ? 8.859   -4.191  26.203  1.00 38.81  ? 191 VAL H CG2 1 
ATOM   8791  N N   . PRO E 2 192 ? 8.576   -7.496  24.901  1.00 42.04  ? 192 PRO H N   1 
ATOM   8792  C CA  . PRO E 2 192 ? 7.200   -8.025  24.868  1.00 43.82  ? 192 PRO H CA  1 
ATOM   8793  C C   . PRO E 2 192 ? 6.322   -7.082  25.669  1.00 44.12  ? 192 PRO H C   1 
ATOM   8794  O O   . PRO E 2 192 ? 6.743   -6.685  26.752  1.00 44.57  ? 192 PRO H O   1 
ATOM   8795  C CB  . PRO E 2 192 ? 7.319   -9.351  25.618  1.00 46.70  ? 192 PRO H CB  1 
ATOM   8796  C CG  . PRO E 2 192 ? 8.752   -9.729  25.487  1.00 46.24  ? 192 PRO H CG  1 
ATOM   8797  C CD  . PRO E 2 192 ? 9.528   -8.458  25.480  1.00 43.54  ? 192 PRO H CD  1 
ATOM   8798  N N   . SER E 2 193 ? 5.146   -6.713  25.171  1.00 44.21  ? 193 SER H N   1 
ATOM   8799  C CA  . SER E 2 193 ? 4.354   -5.695  25.866  1.00 44.45  ? 193 SER H CA  1 
ATOM   8800  C C   . SER E 2 193 ? 3.720   -6.233  27.142  1.00 47.31  ? 193 SER H C   1 
ATOM   8801  O O   . SER E 2 193 ? 3.400   -5.473  28.055  1.00 47.86  ? 193 SER H O   1 
ATOM   8802  C CB  . SER E 2 193 ? 3.291   -5.107  24.954  1.00 43.95  ? 193 SER H CB  1 
ATOM   8803  O OG  . SER E 2 193 ? 2.440   -6.131  24.512  1.00 46.20  ? 193 SER H OG  1 
ATOM   8804  N N   . SER E 2 194 ? 3.554   -7.549  27.204  1.00 49.35  ? 194 SER H N   1 
ATOM   8805  C CA  . SER E 2 194 ? 3.004   -8.187  28.396  1.00 52.74  ? 194 SER H CA  1 
ATOM   8806  C C   . SER E 2 194 ? 3.904   -7.978  29.614  1.00 53.80  ? 194 SER H C   1 
ATOM   8807  O O   . SER E 2 194 ? 3.446   -7.988  30.768  1.00 56.75  ? 194 SER H O   1 
ATOM   8808  C CB  . SER E 2 194 ? 2.787   -9.678  28.151  1.00 54.62  ? 194 SER H CB  1 
ATOM   8809  O OG  . SER E 2 194 ? 4.012   -10.359 27.996  1.00 53.95  ? 194 SER H OG  1 
ATOM   8810  N N   . SER E 2 195 ? 5.186   -7.765  29.357  1.00 51.58  ? 195 SER H N   1 
ATOM   8811  C CA  . SER E 2 195 ? 6.154   -7.702  30.428  1.00 52.37  ? 195 SER H CA  1 
ATOM   8812  C C   . SER E 2 195 ? 6.233   -6.329  31.071  1.00 51.41  ? 195 SER H C   1 
ATOM   8813  O O   . SER E 2 195 ? 6.940   -6.162  32.050  1.00 52.77  ? 195 SER H O   1 
ATOM   8814  C CB  . SER E 2 195 ? 7.522   -8.113  29.908  1.00 51.02  ? 195 SER H CB  1 
ATOM   8815  O OG  . SER E 2 195 ? 7.960   -7.199  28.929  1.00 47.68  ? 195 SER H OG  1 
ATOM   8816  N N   . LEU E 2 196 ? 5.501   -5.357  30.539  1.00 49.49  ? 196 LEU H N   1 
ATOM   8817  C CA  . LEU E 2 196 ? 5.589   -3.968  31.015  1.00 48.27  ? 196 LEU H CA  1 
ATOM   8818  C C   . LEU E 2 196 ? 5.471   -3.690  32.536  1.00 59.01  ? 196 LEU H C   1 
ATOM   8819  O O   . LEU E 2 196 ? 6.379   -3.093  33.133  1.00 59.13  ? 196 LEU H O   1 
ATOM   8820  C CB  . LEU E 2 196 ? 4.622   -3.081  30.245  1.00 46.56  ? 196 LEU H CB  1 
ATOM   8821  C CG  . LEU E 2 196 ? 5.221   -2.633  28.919  1.00 43.08  ? 196 LEU H CG  1 
ATOM   8822  C CD1 . LEU E 2 196 ? 4.237   -1.782  28.119  1.00 41.84  ? 196 LEU H CD1 1 
ATOM   8823  C CD2 . LEU E 2 196 ? 6.500   -1.876  29.204  1.00 41.60  ? 196 LEU H CD2 1 
ATOM   8824  N N   . GLY E 2 197 ? 4.368   -4.093  33.157  1.00 61.53  ? 197 GLY H N   1 
ATOM   8825  C CA  . GLY E 2 197 ? 4.180   -3.831  34.571  1.00 64.48  ? 197 GLY H CA  1 
ATOM   8826  C C   . GLY E 2 197 ? 4.846   -4.906  35.415  1.00 66.64  ? 197 GLY H C   1 
ATOM   8827  O O   . GLY E 2 197 ? 4.922   -4.804  36.641  1.00 69.51  ? 197 GLY H O   1 
ATOM   8828  N N   . THR E 2 198 ? 5.320   -5.947  34.732  1.00 65.12  ? 198 THR H N   1 
ATOM   8829  C CA  . THR E 2 198 ? 6.058   -7.063  35.332  1.00 66.55  ? 198 THR H CA  1 
ATOM   8830  C C   . THR E 2 198 ? 7.532   -6.716  35.496  1.00 64.37  ? 198 THR H C   1 
ATOM   8831  O O   . THR E 2 198 ? 8.027   -6.565  36.613  1.00 66.44  ? 198 THR H O   1 
ATOM   8832  C CB  . THR E 2 198 ? 6.007   -8.300  34.404  1.00 66.54  ? 198 THR H CB  1 
ATOM   8833  O OG1 . THR E 2 198 ? 4.665   -8.788  34.322  1.00 68.61  ? 198 THR H OG1 1 
ATOM   8834  C CG2 . THR E 2 198 ? 6.931   -9.406  34.896  1.00 68.83  ? 198 THR H CG2 1 
ATOM   8835  N N   . GLN E 2 199 ? 8.211   -6.590  34.353  1.00 60.42  ? 199 GLN H N   1 
ATOM   8836  C CA  . GLN E 2 199 ? 9.655   -6.391  34.261  1.00 58.51  ? 199 GLN H CA  1 
ATOM   8837  C C   . GLN E 2 199 ? 10.071  -4.944  34.456  1.00 56.53  ? 199 GLN H C   1 
ATOM   8838  O O   . GLN E 2 199 ? 9.439   -4.022  33.935  1.00 54.76  ? 199 GLN H O   1 
ATOM   8839  C CB  . GLN E 2 199 ? 10.138  -6.852  32.888  1.00 56.02  ? 199 GLN H CB  1 
ATOM   8840  C CG  . GLN E 2 199 ? 10.947  -8.119  32.915  1.00 58.08  ? 199 GLN H CG  1 
ATOM   8841  C CD  . GLN E 2 199 ? 12.302  -7.900  33.530  1.00 58.77  ? 199 GLN H CD  1 
ATOM   8842  O OE1 . GLN E 2 199 ? 12.779  -6.770  33.596  1.00 57.02  ? 199 GLN H OE1 1 
ATOM   8843  N NE2 . GLN E 2 199 ? 12.934  -8.979  33.991  1.00 61.56  ? 199 GLN H NE2 1 
ATOM   8844  N N   . THR E 2 200 ? 11.152  -4.746  35.196  1.00 57.37  ? 200 THR H N   1 
ATOM   8845  C CA  . THR E 2 200 ? 11.646  -3.402  35.438  1.00 56.39  ? 200 THR H CA  1 
ATOM   8846  C C   . THR E 2 200 ? 12.701  -3.025  34.411  1.00 53.55  ? 200 THR H C   1 
ATOM   8847  O O   . THR E 2 200 ? 13.678  -3.749  34.221  1.00 53.77  ? 200 THR H O   1 
ATOM   8848  C CB  . THR E 2 200 ? 12.213  -3.254  36.861  1.00 54.13  ? 200 THR H CB  1 
ATOM   8849  O OG1 . THR E 2 200 ? 11.139  -3.000  37.768  1.00 56.74  ? 200 THR H OG1 1 
ATOM   8850  C CG2 . THR E 2 200 ? 13.193  -2.097  36.943  1.00 52.76  ? 200 THR H CG2 1 
ATOM   8851  N N   . TYR E 2 201 ? 12.512  -1.896  33.737  1.00 51.05  ? 201 TYR H N   1 
ATOM   8852  C CA  . TYR E 2 201 ? 13.518  -1.461  32.774  1.00 48.22  ? 201 TYR H CA  1 
ATOM   8853  C C   . TYR E 2 201 ? 14.312  -0.252  33.286  1.00 48.04  ? 201 TYR H C   1 
ATOM   8854  O O   . TYR E 2 201 ? 13.750  0.769   33.662  1.00 42.10  ? 201 TYR H O   1 
ATOM   8855  C CB  . TYR E 2 201 ? 12.875  -1.245  31.387  1.00 45.41  ? 201 TYR H CB  1 
ATOM   8856  C CG  . TYR E 2 201 ? 12.308  -2.533  30.828  1.00 39.74  ? 201 TYR H CG  1 
ATOM   8857  C CD1 . TYR E 2 201 ? 13.132  -3.473  30.247  1.00 39.47  ? 201 TYR H CD1 1 
ATOM   8858  C CD2 . TYR E 2 201 ? 10.950  -2.825  30.920  1.00 45.56  ? 201 TYR H CD2 1 
ATOM   8859  C CE1 . TYR E 2 201 ? 12.631  -4.662  29.763  1.00 40.25  ? 201 TYR H CE1 1 
ATOM   8860  C CE2 . TYR E 2 201 ? 10.430  -4.019  30.430  1.00 41.56  ? 201 TYR H CE2 1 
ATOM   8861  C CZ  . TYR E 2 201 ? 11.279  -4.936  29.853  1.00 45.02  ? 201 TYR H CZ  1 
ATOM   8862  O OH  . TYR E 2 201 ? 10.795  -6.130  29.351  1.00 42.30  ? 201 TYR H OH  1 
ATOM   8863  N N   . ILE E 2 202 ? 15.623  -0.390  33.352  1.00 42.03  ? 202 ILE H N   1 
ATOM   8864  C CA  . ILE E 2 202 ? 16.454  0.726   33.783  1.00 43.50  ? 202 ILE H CA  1 
ATOM   8865  C C   . ILE E 2 202 ? 17.539  0.975   32.764  1.00 41.75  ? 202 ILE H C   1 
ATOM   8866  O O   . ILE E 2 202 ? 18.300  0.072   32.432  1.00 42.52  ? 202 ILE H O   1 
ATOM   8867  C CB  . ILE E 2 202 ? 17.170  0.457   35.130  1.00 47.28  ? 202 ILE H CB  1 
ATOM   8868  C CG1 . ILE E 2 202 ? 16.169  0.139   36.243  1.00 50.48  ? 202 ILE H CG1 1 
ATOM   8869  C CG2 . ILE E 2 202 ? 18.060  1.639   35.515  1.00 45.54  ? 202 ILE H CG2 1 
ATOM   8870  C CD1 . ILE E 2 202 ? 16.707  -0.820  37.260  1.00 51.86  ? 202 ILE H CD1 1 
ATOM   8871  N N   . CYS E 2 203 ? 17.628  2.197   32.265  1.00 37.80  ? 203 CYS H N   1 
ATOM   8872  C CA  . CYS E 2 203 ? 18.781  2.514   31.465  1.00 36.17  ? 203 CYS H CA  1 
ATOM   8873  C C   . CYS E 2 203 ? 19.916  3.029   32.357  1.00 42.21  ? 203 CYS H C   1 
ATOM   8874  O O   . CYS E 2 203 ? 19.716  3.799   33.313  1.00 39.53  ? 203 CYS H O   1 
ATOM   8875  C CB  . CYS E 2 203 ? 18.444  3.488   30.348  1.00 33.45  ? 203 CYS H CB  1 
ATOM   8876  S SG  . CYS E 2 203 ? 18.322  5.161   30.863  1.00 56.98  ? 203 CYS H SG  1 
ATOM   8877  N N   . ASN E 2 204 ? 21.113  2.568   32.037  1.00 38.00  ? 204 ASN H N   1 
ATOM   8878  C CA  . ASN E 2 204 ? 22.295  2.907   32.780  1.00 39.90  ? 204 ASN H CA  1 
ATOM   8879  C C   . ASN E 2 204 ? 23.170  3.785   31.905  1.00 45.24  ? 204 ASN H C   1 
ATOM   8880  O O   . ASN E 2 204 ? 23.924  3.299   31.071  1.00 37.25  ? 204 ASN H O   1 
ATOM   8881  C CB  . ASN E 2 204 ? 23.007  1.623   33.198  1.00 42.05  ? 204 ASN H CB  1 
ATOM   8882  C CG  . ASN E 2 204 ? 22.057  0.618   33.809  1.00 43.64  ? 204 ASN H CG  1 
ATOM   8883  O OD1 . ASN E 2 204 ? 21.962  -0.527  33.368  1.00 43.64  ? 204 ASN H OD1 1 
ATOM   8884  N ND2 . ASN E 2 204 ? 21.328  1.051   34.823  1.00 45.26  ? 204 ASN H ND2 1 
ATOM   8885  N N   . VAL E 2 205 ? 23.031  5.093   32.099  1.00 45.02  ? 205 VAL H N   1 
ATOM   8886  C CA  . VAL E 2 205 ? 23.764  6.107   31.348  1.00 43.63  ? 205 VAL H CA  1 
ATOM   8887  C C   . VAL E 2 205 ? 25.016  6.551   32.090  1.00 46.20  ? 205 VAL H C   1 
ATOM   8888  O O   . VAL E 2 205 ? 24.939  7.047   33.216  1.00 48.65  ? 205 VAL H O   1 
ATOM   8889  C CB  . VAL E 2 205 ? 22.908  7.352   31.167  1.00 42.13  ? 205 VAL H CB  1 
ATOM   8890  C CG1 . VAL E 2 205 ? 23.678  8.415   30.436  1.00 34.35  ? 205 VAL H CG1 1 
ATOM   8891  C CG2 . VAL E 2 205 ? 21.623  7.003   30.474  1.00 33.47  ? 205 VAL H CG2 1 
ATOM   8892  N N   . ASN E 2 206 ? 26.166  6.391   31.450  1.00 45.71  ? 206 ASN H N   1 
ATOM   8893  C CA  . ASN E 2 206 ? 27.427  6.846   32.024  1.00 47.64  ? 206 ASN H CA  1 
ATOM   8894  C C   . ASN E 2 206 ? 28.245  7.807   31.131  1.00 46.56  ? 206 ASN H C   1 
ATOM   8895  O O   . ASN E 2 206 ? 28.588  7.473   29.997  1.00 45.04  ? 206 ASN H O   1 
ATOM   8896  C CB  . ASN E 2 206 ? 28.271  5.645   32.414  1.00 49.67  ? 206 ASN H CB  1 
ATOM   8897  C CG  . ASN E 2 206 ? 29.415  6.033   33.282  1.00 53.11  ? 206 ASN H CG  1 
ATOM   8898  O OD1 . ASN E 2 206 ? 29.229  6.302   34.472  1.00 55.92  ? 206 ASN H OD1 1 
ATOM   8899  N ND2 . ASN E 2 206 ? 30.618  6.104   32.702  1.00 53.38  ? 206 ASN H ND2 1 
ATOM   8900  N N   . HIS E 2 207 ? 28.556  8.994   31.652  1.00 47.75  ? 207 HIS H N   1 
ATOM   8901  C CA  . HIS E 2 207 ? 29.327  10.001  30.910  1.00 47.21  ? 207 HIS H CA  1 
ATOM   8902  C C   . HIS E 2 207 ? 30.600  10.430  31.659  1.00 50.43  ? 207 HIS H C   1 
ATOM   8903  O O   . HIS E 2 207 ? 30.591  11.434  32.366  1.00 52.13  ? 207 HIS H O   1 
ATOM   8904  C CB  . HIS E 2 207 ? 28.450  11.232  30.644  1.00 45.89  ? 207 HIS H CB  1 
ATOM   8905  C CG  . HIS E 2 207 ? 29.132  12.306  29.848  1.00 45.60  ? 207 HIS H CG  1 
ATOM   8906  N ND1 . HIS E 2 207 ? 29.317  13.586  30.329  1.00 47.14  ? 207 HIS H ND1 1 
ATOM   8907  C CD2 . HIS E 2 207 ? 29.674  12.287  28.606  1.00 44.04  ? 207 HIS H CD2 1 
ATOM   8908  C CE1 . HIS E 2 207 ? 29.954  14.305  29.421  1.00 46.57  ? 207 HIS H CE1 1 
ATOM   8909  N NE2 . HIS E 2 207 ? 30.181  13.541  28.368  1.00 44.70  ? 207 HIS H NE2 1 
ATOM   8910  N N   . LYS E 2 208 ? 31.688  9.678   31.495  1.00 51.58  ? 208 LYS H N   1 
ATOM   8911  C CA  . LYS E 2 208 ? 32.955  9.939   32.207  1.00 54.90  ? 208 LYS H CA  1 
ATOM   8912  C C   . LYS E 2 208 ? 33.410  11.421  32.332  1.00 49.20  ? 208 LYS H C   1 
ATOM   8913  O O   . LYS E 2 208 ? 33.613  11.898  33.450  1.00 51.85  ? 208 LYS H O   1 
ATOM   8914  C CB  . LYS E 2 208 ? 34.096  9.069   31.656  1.00 55.83  ? 208 LYS H CB  1 
ATOM   8915  C CG  . LYS E 2 208 ? 33.654  7.754   31.052  1.00 54.76  ? 208 LYS H CG  1 
ATOM   8916  C CD  . LYS E 2 208 ? 33.933  6.556   31.954  1.00 58.01  ? 208 LYS H CD  1 
ATOM   8917  C CE  . LYS E 2 208 ? 33.676  5.225   31.218  1.00 57.29  ? 208 LYS H CE  1 
ATOM   8918  N NZ  . LYS E 2 208 ? 34.075  4.018   32.019  1.00 60.44  ? 208 LYS H NZ  1 
ATOM   8919  N N   . PRO E 2 209 ? 33.566  12.150  31.202  1.00 47.51  ? 209 PRO H N   1 
ATOM   8920  C CA  . PRO E 2 209 ? 34.014  13.550  31.322  1.00 48.89  ? 209 PRO H CA  1 
ATOM   8921  C C   . PRO E 2 209 ? 33.389  14.386  32.465  1.00 50.68  ? 209 PRO H C   1 
ATOM   8922  O O   . PRO E 2 209 ? 34.118  15.159  33.094  1.00 53.58  ? 209 PRO H O   1 
ATOM   8923  C CB  . PRO E 2 209 ? 33.657  14.142  29.957  1.00 45.89  ? 209 PRO H CB  1 
ATOM   8924  C CG  . PRO E 2 209 ? 33.832  12.999  29.027  1.00 44.08  ? 209 PRO H CG  1 
ATOM   8925  C CD  . PRO E 2 209 ? 33.421  11.759  29.780  1.00 44.44  ? 209 PRO H CD  1 
ATOM   8926  N N   . SER E 2 210 ? 32.095  14.224  32.744  1.00 49.26  ? 210 SER H N   1 
ATOM   8927  C CA  . SER E 2 210 ? 31.448  15.018  33.792  1.00 50.55  ? 210 SER H CA  1 
ATOM   8928  C C   . SER E 2 210 ? 31.136  14.185  35.023  1.00 53.23  ? 210 SER H C   1 
ATOM   8929  O O   . SER E 2 210 ? 30.395  14.627  35.905  1.00 54.05  ? 210 SER H O   1 
ATOM   8930  C CB  . SER E 2 210 ? 30.170  15.717  33.280  1.00 51.77  ? 210 SER H CB  1 
ATOM   8931  O OG  . SER E 2 210 ? 29.155  14.803  32.896  1.00 45.73  ? 210 SER H OG  1 
ATOM   8932  N N   . ASN E 2 211 ? 31.706  12.981  35.067  1.00 52.84  ? 211 ASN H N   1 
ATOM   8933  C CA  . ASN E 2 211 ? 31.425  12.017  36.124  1.00 54.74  ? 211 ASN H CA  1 
ATOM   8934  C C   . ASN E 2 211 ? 29.916  11.830  36.356  1.00 57.95  ? 211 ASN H C   1 
ATOM   8935  O O   . ASN E 2 211 ? 29.468  11.605  37.474  1.00 55.76  ? 211 ASN H O   1 
ATOM   8936  C CB  . ASN E 2 211 ? 32.171  12.418  37.413  1.00 63.14  ? 211 ASN H CB  1 
ATOM   8937  C CG  . ASN E 2 211 ? 32.227  11.300  38.453  1.00 61.86  ? 211 ASN H CG  1 
ATOM   8938  O OD1 . ASN E 2 211 ? 31.762  11.471  39.578  1.00 64.50  ? 211 ASN H OD1 1 
ATOM   8939  N ND2 . ASN E 2 211 ? 32.796  10.156  38.078  1.00 61.44  ? 211 ASN H ND2 1 
ATOM   8940  N N   . THR E 2 212 ? 29.115  11.941  35.301  1.00 54.38  ? 212 THR H N   1 
ATOM   8941  C CA  . THR E 2 212 ? 27.701  11.642  35.462  1.00 53.19  ? 212 THR H CA  1 
ATOM   8942  C C   . THR E 2 212 ? 27.629  10.140  35.395  1.00 52.59  ? 212 THR H C   1 
ATOM   8943  O O   . THR E 2 212 ? 28.272  9.527   34.545  1.00 51.34  ? 212 THR H O   1 
ATOM   8944  C CB  . THR E 2 212 ? 26.782  12.257  34.377  1.00 50.00  ? 212 THR H CB  1 
ATOM   8945  O OG1 . THR E 2 212 ? 26.588  13.657  34.604  1.00 46.48  ? 212 THR H OG1 1 
ATOM   8946  C CG2 . THR E 2 212 ? 25.414  11.608  34.417  1.00 48.82  ? 212 THR H CG2 1 
ATOM   8947  N N   . LYS E 2 213 ? 26.907  9.556   36.345  1.00 53.85  ? 213 LYS H N   1 
ATOM   8948  C CA  . LYS E 2 213 ? 26.504  8.161   36.291  1.00 52.95  ? 213 LYS H CA  1 
ATOM   8949  C C   . LYS E 2 213 ? 25.029  8.167   36.702  1.00 52.48  ? 213 LYS H C   1 
ATOM   8950  O O   . LYS E 2 213 ? 24.690  8.554   37.813  1.00 55.05  ? 213 LYS H O   1 
ATOM   8951  C CB  . LYS E 2 213 ? 27.401  7.302   37.202  1.00 56.37  ? 213 LYS H CB  1 
ATOM   8952  C CG  . LYS E 2 213 ? 26.945  5.856   37.443  1.00 57.25  ? 213 LYS H CG  1 
ATOM   8953  C CD  . LYS E 2 213 ? 26.732  5.105   36.130  1.00 54.14  ? 213 LYS H CD  1 
ATOM   8954  C CE  . LYS E 2 213 ? 25.696  3.963   36.280  1.00 53.96  ? 213 LYS H CE  1 
ATOM   8955  N NZ  . LYS E 2 213 ? 25.584  3.128   35.052  1.00 51.07  ? 213 LYS H NZ  1 
ATOM   8956  N N   . VAL E 2 214 ? 24.142  7.814   35.779  1.00 49.51  ? 214 VAL H N   1 
ATOM   8957  C CA  . VAL E 2 214 ? 22.716  7.843   36.088  1.00 49.50  ? 214 VAL H CA  1 
ATOM   8958  C C   . VAL E 2 214 ? 22.039  6.532   35.756  1.00 48.67  ? 214 VAL H C   1 
ATOM   8959  O O   . VAL E 2 214 ? 22.254  5.970   34.683  1.00 42.82  ? 214 VAL H O   1 
ATOM   8960  C CB  . VAL E 2 214 ? 21.972  8.991   35.367  1.00 47.27  ? 214 VAL H CB  1 
ATOM   8961  C CG1 . VAL E 2 214 ? 20.467  8.802   35.460  1.00 43.69  ? 214 VAL H CG1 1 
ATOM   8962  C CG2 . VAL E 2 214 ? 22.384  10.337  35.946  1.00 48.97  ? 214 VAL H CG2 1 
ATOM   8963  N N   . ASP E 2 215 ? 21.247  6.038   36.704  1.00 50.99  ? 215 ASP H N   1 
ATOM   8964  C CA  . ASP E 2 215 ? 20.408  4.884   36.477  1.00 50.73  ? 215 ASP H CA  1 
ATOM   8965  C C   . ASP E 2 215 ? 18.977  5.384   36.451  1.00 50.57  ? 215 ASP H C   1 
ATOM   8966  O O   . ASP E 2 215 ? 18.458  5.827   37.466  1.00 53.16  ? 215 ASP H O   1 
ATOM   8967  C CB  . ASP E 2 215 ? 20.597  3.850   37.581  1.00 54.21  ? 215 ASP H CB  1 
ATOM   8968  C CG  . ASP E 2 215 ? 21.980  3.207   37.559  1.00 55.37  ? 215 ASP H CG  1 
ATOM   8969  O OD1 . ASP E 2 215 ? 22.484  2.935   36.440  1.00 52.97  ? 215 ASP H OD1 1 
ATOM   8970  O OD2 . ASP E 2 215 ? 22.557  2.970   38.664  1.00 58.94  ? 215 ASP H OD2 1 
ATOM   8971  N N   . LYS E 2 216 ? 18.344  5.345   35.284  1.00 47.86  ? 216 LYS H N   1 
ATOM   8972  C CA  . LYS E 2 216 ? 16.970  5.816   35.176  1.00 47.56  ? 216 LYS H CA  1 
ATOM   8973  C C   . LYS E 2 216 ? 15.985  4.679   34.994  1.00 48.29  ? 216 LYS H C   1 
ATOM   8974  O O   . LYS E 2 216 ? 16.125  3.872   34.084  1.00 46.38  ? 216 LYS H O   1 
ATOM   8975  C CB  . LYS E 2 216 ? 16.820  6.772   34.000  1.00 43.90  ? 216 LYS H CB  1 
ATOM   8976  C CG  . LYS E 2 216 ? 15.534  7.538   34.048  1.00 43.46  ? 216 LYS H CG  1 
ATOM   8977  C CD  . LYS E 2 216 ? 15.555  8.445   35.251  1.00 46.04  ? 216 LYS H CD  1 
ATOM   8978  C CE  . LYS E 2 216 ? 14.380  9.395   35.269  1.00 46.36  ? 216 LYS H CE  1 
ATOM   8979  N NZ  . LYS E 2 216 ? 14.876  10.810  35.339  1.00 46.67  ? 216 LYS H NZ  1 
ATOM   8980  N N   . LYS E 2 217 ? 14.975  4.623   35.850  1.00 51.51  ? 217 LYS H N   1 
ATOM   8981  C CA  . LYS E 2 217 ? 13.902  3.663   35.649  1.00 52.28  ? 217 LYS H CA  1 
ATOM   8982  C C   . LYS E 2 217 ? 12.907  4.211   34.632  1.00 50.99  ? 217 LYS H C   1 
ATOM   8983  O O   . LYS E 2 217 ? 12.473  5.364   34.723  1.00 51.12  ? 217 LYS H O   1 
ATOM   8984  C CB  . LYS E 2 217 ? 13.199  3.352   36.952  1.00 55.74  ? 217 LYS H CB  1 
ATOM   8985  C CG  . LYS E 2 217 ? 12.327  2.129   36.865  1.00 56.55  ? 217 LYS H CG  1 
ATOM   8986  C CD  . LYS E 2 217 ? 11.428  1.980   38.105  1.00 60.51  ? 217 LYS H CD  1 
ATOM   8987  C CE  . LYS E 2 217 ? 10.534  0.747   37.998  1.00 54.35  ? 217 LYS H CE  1 
ATOM   8988  N NZ  . LYS E 2 217 ? 9.362   0.824   38.912  1.00 59.20  ? 217 LYS H NZ  1 
ATOM   8989  N N   . VAL E 2 218 ? 12.568  3.380   33.648  1.00 50.15  ? 218 VAL H N   1 
ATOM   8990  C CA  . VAL E 2 218 ? 11.589  3.751   32.642  1.00 49.23  ? 218 VAL H CA  1 
ATOM   8991  C C   . VAL E 2 218 ? 10.265  3.043   32.903  1.00 52.15  ? 218 VAL H C   1 
ATOM   8992  O O   . VAL E 2 218 ? 10.092  1.848   32.635  1.00 52.52  ? 218 VAL H O   1 
ATOM   8993  C CB  . VAL E 2 218 ? 12.106  3.509   31.229  1.00 45.51  ? 218 VAL H CB  1 
ATOM   8994  C CG1 . VAL E 2 218 ? 11.246  4.250   30.220  1.00 43.38  ? 218 VAL H CG1 1 
ATOM   8995  C CG2 . VAL E 2 218 ? 13.535  3.986   31.133  1.00 44.35  ? 218 VAL H CG2 1 
ATOM   8996  N N   . GLU E 2 219 ? 9.346   3.833   33.452  1.00 54.11  ? 219 GLU H N   1 
ATOM   8997  C CA  . GLU E 2 219 ? 8.047   3.398   33.943  1.00 56.33  ? 219 GLU H CA  1 
ATOM   8998  C C   . GLU E 2 219 ? 7.016   3.661   32.859  1.00 55.53  ? 219 GLU H C   1 
ATOM   8999  O O   . GLU E 2 219 ? 7.135   4.655   32.132  1.00 53.31  ? 219 GLU H O   1 
ATOM   9000  C CB  . GLU E 2 219 ? 7.701   4.269   35.150  1.00 58.99  ? 219 GLU H CB  1 
ATOM   9001  C CG  . GLU E 2 219 ? 6.539   3.793   35.983  1.00 62.11  ? 219 GLU H CG  1 
ATOM   9002  C CD  . GLU E 2 219 ? 6.935   2.662   36.906  1.00 64.50  ? 219 GLU H CD  1 
ATOM   9003  O OE1 . GLU E 2 219 ? 6.107   2.258   37.761  1.00 67.87  ? 219 GLU H OE1 1 
ATOM   9004  O OE2 . GLU E 2 219 ? 8.087   2.187   36.776  1.00 63.33  ? 219 GLU H OE2 1 
ATOM   9005  N N   . PRO E 2 220 ? 6.001   2.784   32.729  1.00 57.60  ? 220 PRO H N   1 
ATOM   9006  C CA  . PRO E 2 220 ? 4.840   3.103   31.879  1.00 57.99  ? 220 PRO H CA  1 
ATOM   9007  C C   . PRO E 2 220 ? 4.107   4.391   32.288  1.00 60.29  ? 220 PRO H C   1 
ATOM   9008  O O   . PRO E 2 220 ? 4.632   5.177   33.066  1.00 61.06  ? 220 PRO H O   1 
ATOM   9009  C CB  . PRO E 2 220 ? 3.924   1.891   32.057  1.00 59.50  ? 220 PRO H CB  1 
ATOM   9010  C CG  . PRO E 2 220 ? 4.731   0.852   32.772  1.00 60.36  ? 220 PRO H CG  1 
ATOM   9011  C CD  . PRO E 2 220 ? 6.125   1.340   32.971  1.00 58.86  ? 220 PRO H CD  1 
ATOM   9012  N N   . LYS E 2 221 ? 2.912   4.612   31.742  1.00 61.98  ? 221 LYS H N   1 
ATOM   9013  C CA  . LYS E 2 221 ? 2.051   5.755   32.128  1.00 65.03  ? 221 LYS H CA  1 
ATOM   9014  C C   . LYS E 2 221 ? 2.692   7.126   31.825  1.00 64.35  ? 221 LYS H C   1 
ATOM   9015  O O   . LYS E 2 221 ? 3.263   7.794   32.700  1.00 65.74  ? 221 LYS H O   1 
ATOM   9016  C CB  . LYS E 2 221 ? 1.594   5.647   33.606  1.00 68.28  ? 221 LYS H CB  1 
ATOM   9017  C CG  . LYS E 2 221 ? 0.722   6.791   34.110  1.00 70.75  ? 221 LYS H CG  1 
ATOM   9018  C CD  . LYS E 2 221 ? 1.305   7.409   35.374  1.00 73.09  ? 221 LYS H CD  1 
ATOM   9019  C CE  . LYS E 2 221 ? 0.879   6.649   36.635  1.00 77.05  ? 221 LYS H CE  1 
ATOM   9020  N NZ  . LYS E 2 221 ? -0.593  6.743   36.847  1.00 80.12  ? 221 LYS H NZ  1 
ATOM   9021  N N   . ASP F 3 1   ? 45.590  18.522  -9.517  1.00 66.39  ? 1   ASP L N   1 
ATOM   9022  C CA  . ASP F 3 1   ? 45.954  17.287  -8.834  1.00 62.81  ? 1   ASP L CA  1 
ATOM   9023  C C   . ASP F 3 1   ? 45.178  16.113  -9.375  1.00 61.20  ? 1   ASP L C   1 
ATOM   9024  O O   . ASP F 3 1   ? 44.199  16.286  -10.108 1.00 63.29  ? 1   ASP L O   1 
ATOM   9025  C CB  . ASP F 3 1   ? 45.709  17.402  -7.341  1.00 60.88  ? 1   ASP L CB  1 
ATOM   9026  C CG  . ASP F 3 1   ? 46.949  17.847  -6.592  1.00 61.71  ? 1   ASP L CG  1 
ATOM   9027  O OD1 . ASP F 3 1   ? 47.927  18.267  -7.273  1.00 64.57  ? 1   ASP L OD1 1 
ATOM   9028  O OD2 . ASP F 3 1   ? 46.947  17.780  -5.334  1.00 59.57  ? 1   ASP L OD2 1 
ATOM   9029  N N   . ILE F 3 2   ? 45.617  14.914  -9.028  1.00 58.13  ? 2   ILE L N   1 
ATOM   9030  C CA  . ILE F 3 2   ? 44.904  13.744  -9.471  1.00 57.12  ? 2   ILE L CA  1 
ATOM   9031  C C   . ILE F 3 2   ? 43.595  13.570  -8.680  1.00 54.64  ? 2   ILE L C   1 
ATOM   9032  O O   . ILE F 3 2   ? 43.602  13.456  -7.444  1.00 41.55  ? 2   ILE L O   1 
ATOM   9033  C CB  . ILE F 3 2   ? 45.743  12.475  -9.362  1.00 44.85  ? 2   ILE L CB  1 
ATOM   9034  C CG1 . ILE F 3 2   ? 46.913  12.522  -10.328 1.00 47.69  ? 2   ILE L CG1 1 
ATOM   9035  C CG2 . ILE F 3 2   ? 44.883  11.243  -9.657  1.00 47.07  ? 2   ILE L CG2 1 
ATOM   9036  C CD1 . ILE F 3 2   ? 47.387  11.152  -10.773 1.00 47.65  ? 2   ILE L CD1 1 
ATOM   9037  N N   . VAL F 3 3   ? 42.462  13.571  -9.392  1.00 55.23  ? 3   VAL L N   1 
ATOM   9038  C CA  . VAL F 3 3   ? 41.199  13.283  -8.727  1.00 52.62  ? 3   VAL L CA  1 
ATOM   9039  C C   . VAL F 3 3   ? 40.829  11.825  -8.917  1.00 50.32  ? 3   VAL L C   1 
ATOM   9040  O O   . VAL F 3 3   ? 41.014  11.244  -9.981  1.00 51.51  ? 3   VAL L O   1 
ATOM   9041  C CB  . VAL F 3 3   ? 40.041  14.205  -9.132  1.00 54.97  ? 3   VAL L CB  1 
ATOM   9042  C CG1 . VAL F 3 3   ? 38.942  14.128  -8.085  1.00 53.05  ? 3   VAL L CG1 1 
ATOM   9043  C CG2 . VAL F 3 3   ? 40.513  15.623  -9.239  1.00 57.62  ? 3   VAL L CG2 1 
ATOM   9044  N N   . MET F 3 4   ? 40.347  11.233  -7.840  1.00 47.17  ? 4   MET L N   1 
ATOM   9045  C CA  . MET F 3 4   ? 39.948  9.853   -7.865  1.00 45.68  ? 4   MET L CA  1 
ATOM   9046  C C   . MET F 3 4   ? 38.469  9.807   -7.549  1.00 45.29  ? 4   MET L C   1 
ATOM   9047  O O   . MET F 3 4   ? 38.015  10.431  -6.585  1.00 44.66  ? 4   MET L O   1 
ATOM   9048  C CB  . MET F 3 4   ? 40.756  9.086   -6.836  1.00 43.23  ? 4   MET L CB  1 
ATOM   9049  C CG  . MET F 3 4   ? 42.227  9.226   -7.091  1.00 44.07  ? 4   MET L CG  1 
ATOM   9050  S SD  . MET F 3 4   ? 42.704  8.159   -8.438  1.00 39.11  ? 4   MET L SD  1 
ATOM   9051  C CE  . MET F 3 4   ? 42.514  6.591   -7.587  1.00 35.69  ? 4   MET L CE  1 
ATOM   9052  N N   . THR F 3 5   ? 37.718  9.080   -8.366  1.00 46.08  ? 5   THR L N   1 
ATOM   9053  C CA  . THR F 3 5   ? 36.274  9.091   -8.252  1.00 39.12  ? 5   THR L CA  1 
ATOM   9054  C C   . THR F 3 5   ? 35.754  7.668   -8.281  1.00 42.11  ? 5   THR L C   1 
ATOM   9055  O O   . THR F 3 5   ? 35.925  6.971   -9.280  1.00 43.60  ? 5   THR L O   1 
ATOM   9056  C CB  . THR F 3 5   ? 35.642  9.934   -9.369  1.00 42.64  ? 5   THR L CB  1 
ATOM   9057  O OG1 . THR F 3 5   ? 36.660  10.301  -10.304 1.00 48.14  ? 5   THR L OG1 1 
ATOM   9058  C CG2 . THR F 3 5   ? 35.038  11.213  -8.807  1.00 43.51  ? 5   THR L CG2 1 
ATOM   9059  N N   . GLN F 3 6   ? 35.142  7.232   -7.176  1.00 39.90  ? 6   GLN L N   1 
ATOM   9060  C CA  . GLN F 3 6   ? 34.625  5.869   -7.080  1.00 39.14  ? 6   GLN L CA  1 
ATOM   9061  C C   . GLN F 3 6   ? 33.165  5.816   -7.473  1.00 40.99  ? 6   GLN L C   1 
ATOM   9062  O O   . GLN F 3 6   ? 32.469  6.810   -7.340  1.00 42.07  ? 6   GLN L O   1 
ATOM   9063  C CB  . GLN F 3 6   ? 34.806  5.327   -5.665  1.00 36.43  ? 6   GLN L CB  1 
ATOM   9064  C CG  . GLN F 3 6   ? 36.235  5.132   -5.270  1.00 34.94  ? 6   GLN L CG  1 
ATOM   9065  C CD  . GLN F 3 6   ? 36.387  4.598   -3.857  1.00 32.64  ? 6   GLN L CD  1 
ATOM   9066  O OE1 . GLN F 3 6   ? 37.324  4.953   -3.144  1.00 31.67  ? 6   GLN L OE1 1 
ATOM   9067  N NE2 . GLN F 3 6   ? 35.476  3.733   -3.449  1.00 32.16  ? 6   GLN L NE2 1 
ATOM   9068  N N   . SER F 3 7   ? 32.699  4.657   -7.939  1.00 41.95  ? 7   SER L N   1 
ATOM   9069  C CA  . SER F 3 7   ? 31.285  4.476   -8.317  1.00 44.07  ? 7   SER L CA  1 
ATOM   9070  C C   . SER F 3 7   ? 30.697  3.123   -7.899  1.00 43.68  ? 7   SER L C   1 
ATOM   9071  O O   . SER F 3 7   ? 31.322  2.087   -8.090  1.00 43.60  ? 7   SER L O   1 
ATOM   9072  C CB  . SER F 3 7   ? 31.110  4.638   -9.824  1.00 47.37  ? 7   SER L CB  1 
ATOM   9073  O OG  . SER F 3 7   ? 31.337  5.976   -10.217 1.00 48.87  ? 7   SER L OG  1 
ATOM   9074  N N   . PRO F 3 8   ? 29.481  3.124   -7.334  1.00 43.83  ? 8   PRO L N   1 
ATOM   9075  C CA  . PRO F 3 8   ? 28.698  4.303   -6.955  1.00 44.68  ? 8   PRO L CA  1 
ATOM   9076  C C   . PRO F 3 8   ? 29.161  4.774   -5.590  1.00 42.56  ? 8   PRO L C   1 
ATOM   9077  O O   . PRO F 3 8   ? 30.154  4.253   -5.087  1.00 40.55  ? 8   PRO L O   1 
ATOM   9078  C CB  . PRO F 3 8   ? 27.295  3.739   -6.829  1.00 45.61  ? 8   PRO L CB  1 
ATOM   9079  C CG  . PRO F 3 8   ? 27.515  2.347   -6.381  1.00 43.94  ? 8   PRO L CG  1 
ATOM   9080  C CD  . PRO F 3 8   ? 28.739  1.876   -7.083  1.00 43.67  ? 8   PRO L CD  1 
ATOM   9081  N N   . ASP F 3 9   ? 28.448  5.719   -4.989  1.00 43.32  ? 9   ASP L N   1 
ATOM   9082  C CA  . ASP F 3 9   ? 28.795  6.173   -3.642  1.00 41.63  ? 9   ASP L CA  1 
ATOM   9083  C C   . ASP F 3 9   ? 28.437  5.119   -2.585  1.00 39.99  ? 9   ASP L C   1 
ATOM   9084  O O   . ASP F 3 9   ? 29.220  4.859   -1.669  1.00 37.93  ? 9   ASP L O   1 
ATOM   9085  C CB  . ASP F 3 9   ? 28.168  7.544   -3.331  1.00 44.06  ? 9   ASP L CB  1 
ATOM   9086  C CG  . ASP F 3 9   ? 28.955  8.713   -3.961  1.00 46.08  ? 9   ASP L CG  1 
ATOM   9087  O OD1 . ASP F 3 9   ? 29.840  9.297   -3.278  1.00 45.27  ? 9   ASP L OD1 1 
ATOM   9088  O OD2 . ASP F 3 9   ? 28.711  9.050   -5.148  1.00 48.78  ? 9   ASP L OD2 1 
ATOM   9089  N N   . SER F 3 10  ? 27.260  4.508   -2.720  1.00 41.20  ? 10  SER L N   1 
ATOM   9090  C CA  . SER F 3 10  ? 26.866  3.402   -1.844  1.00 39.93  ? 10  SER L CA  1 
ATOM   9091  C C   . SER F 3 10  ? 26.271  2.243   -2.633  1.00 40.34  ? 10  SER L C   1 
ATOM   9092  O O   . SER F 3 10  ? 25.854  2.403   -3.762  1.00 42.14  ? 10  SER L O   1 
ATOM   9093  C CB  . SER F 3 10  ? 25.907  3.862   -0.741  1.00 41.06  ? 10  SER L CB  1 
ATOM   9094  O OG  . SER F 3 10  ? 24.609  4.091   -1.245  1.00 44.20  ? 10  SER L OG  1 
ATOM   9095  N N   . LEU F 3 11  ? 26.223  1.075   -2.023  1.00 39.32  ? 11  LEU L N   1 
ATOM   9096  C CA  . LEU F 3 11  ? 25.938  -0.123  -2.761  1.00 37.46  ? 11  LEU L CA  1 
ATOM   9097  C C   . LEU F 3 11  ? 25.368  -1.211  -1.874  1.00 37.68  ? 11  LEU L C   1 
ATOM   9098  O O   . LEU F 3 11  ? 26.002  -1.633  -0.922  1.00 36.15  ? 11  LEU L O   1 
ATOM   9099  C CB  . LEU F 3 11  ? 27.237  -0.626  -3.364  1.00 43.63  ? 11  LEU L CB  1 
ATOM   9100  C CG  . LEU F 3 11  ? 27.136  -1.853  -4.255  1.00 38.11  ? 11  LEU L CG  1 
ATOM   9101  C CD1 . LEU F 3 11  ? 26.376  -1.457  -5.472  1.00 40.56  ? 11  LEU L CD1 1 
ATOM   9102  C CD2 . LEU F 3 11  ? 28.511  -2.367  -4.612  1.00 37.28  ? 11  LEU L CD2 1 
ATOM   9103  N N   . ALA F 3 12  ? 24.174  -1.686  -2.199  1.00 39.98  ? 12  ALA L N   1 
ATOM   9104  C CA  . ALA F 3 12  ? 23.578  -2.792  -1.458  1.00 40.76  ? 12  ALA L CA  1 
ATOM   9105  C C   . ALA F 3 12  ? 23.601  -3.996  -2.359  1.00 43.53  ? 12  ALA L C   1 
ATOM   9106  O O   . ALA F 3 12  ? 23.223  -3.904  -3.519  1.00 45.40  ? 12  ALA L O   1 
ATOM   9107  C CB  . ALA F 3 12  ? 22.136  -2.468  -1.027  1.00 42.76  ? 12  ALA L CB  1 
ATOM   9108  N N   . VAL F 3 13  ? 24.053  -5.118  -1.824  1.00 41.97  ? 13  VAL L N   1 
ATOM   9109  C CA  . VAL F 3 13  ? 24.234  -6.322  -2.609  1.00 43.63  ? 13  VAL L CA  1 
ATOM   9110  C C   . VAL F 3 13  ? 23.701  -7.491  -1.810  1.00 45.05  ? 13  VAL L C   1 
ATOM   9111  O O   . VAL F 3 13  ? 23.814  -7.514  -0.604  1.00 44.02  ? 13  VAL L O   1 
ATOM   9112  C CB  . VAL F 3 13  ? 25.730  -6.519  -2.973  1.00 44.64  ? 13  VAL L CB  1 
ATOM   9113  C CG1 . VAL F 3 13  ? 25.990  -7.893  -3.557  1.00 44.33  ? 13  VAL L CG1 1 
ATOM   9114  C CG2 . VAL F 3 13  ? 26.197  -5.426  -3.935  1.00 43.23  ? 13  VAL L CG2 1 
ATOM   9115  N N   . SER F 3 14  ? 23.080  -8.447  -2.474  1.00 50.25  ? 14  SER L N   1 
ATOM   9116  C CA  . SER F 3 14  ? 22.517  -9.562  -1.745  1.00 52.33  ? 14  SER L CA  1 
ATOM   9117  C C   . SER F 3 14  ? 23.603  -10.468 -1.193  1.00 52.18  ? 14  SER L C   1 
ATOM   9118  O O   . SER F 3 14  ? 24.649  -10.635 -1.807  1.00 51.63  ? 14  SER L O   1 
ATOM   9119  C CB  . SER F 3 14  ? 21.547  -10.337 -2.620  1.00 55.77  ? 14  SER L CB  1 
ATOM   9120  O OG  . SER F 3 14  ? 20.303  -9.674  -2.630  1.00 54.24  ? 14  SER L OG  1 
ATOM   9121  N N   . LEU F 3 15  ? 23.358  -11.039 -0.018  1.00 52.95  ? 15  LEU L N   1 
ATOM   9122  C CA  . LEU F 3 15  ? 24.305  -11.974 0.569   1.00 53.47  ? 15  LEU L CA  1 
ATOM   9123  C C   . LEU F 3 15  ? 24.430  -13.208 -0.329  1.00 56.36  ? 15  LEU L C   1 
ATOM   9124  O O   . LEU F 3 15  ? 23.455  -13.926 -0.552  1.00 59.11  ? 15  LEU L O   1 
ATOM   9125  C CB  . LEU F 3 15  ? 23.861  -12.350 1.984   1.00 54.66  ? 15  LEU L CB  1 
ATOM   9126  C CG  . LEU F 3 15  ? 24.951  -12.876 2.922   1.00 54.70  ? 15  LEU L CG  1 
ATOM   9127  C CD1 . LEU F 3 15  ? 24.654  -12.477 4.359   1.00 54.13  ? 15  LEU L CD1 1 
ATOM   9128  C CD2 . LEU F 3 15  ? 25.106  -14.403 2.792   1.00 58.33  ? 15  LEU L CD2 1 
ATOM   9129  N N   . GLY F 3 16  ? 25.628  -13.441 -0.857  1.00 56.24  ? 16  GLY L N   1 
ATOM   9130  C CA  . GLY F 3 16  ? 25.837  -14.509 -1.827  1.00 59.60  ? 16  GLY L CA  1 
ATOM   9131  C C   . GLY F 3 16  ? 26.166  -14.003 -3.227  1.00 59.55  ? 16  GLY L C   1 
ATOM   9132  O O   . GLY F 3 16  ? 26.987  -14.581 -3.920  1.00 60.89  ? 16  GLY L O   1 
ATOM   9133  N N   . GLU F 3 17  ? 25.531  -12.908 -3.626  1.00 58.53  ? 17  GLU L N   1 
ATOM   9134  C CA  . GLU F 3 17  ? 25.694  -12.316 -4.951  1.00 59.13  ? 17  GLU L CA  1 
ATOM   9135  C C   . GLU F 3 17  ? 27.019  -11.543 -5.058  1.00 56.81  ? 17  GLU L C   1 
ATOM   9136  O O   . GLU F 3 17  ? 27.844  -11.595 -4.152  1.00 55.26  ? 17  GLU L O   1 
ATOM   9137  C CB  . GLU F 3 17  ? 24.458  -11.437 -5.269  1.00 59.33  ? 17  GLU L CB  1 
ATOM   9138  C CG  . GLU F 3 17  ? 24.295  -10.894 -6.720  1.00 77.63  ? 17  GLU L CG  1 
ATOM   9139  C CD  . GLU F 3 17  ? 24.285  -11.977 -7.816  1.00 81.24  ? 17  GLU L CD  1 
ATOM   9140  O OE1 . GLU F 3 17  ? 23.280  -12.737 -7.897  1.00 84.00  ? 17  GLU L OE1 1 
ATOM   9141  O OE2 . GLU F 3 17  ? 25.281  -12.043 -8.594  1.00 81.38  ? 17  GLU L OE2 1 
ATOM   9142  N N   . ARG F 3 18  ? 27.209  -10.825 -6.161  1.00 57.04  ? 18  ARG L N   1 
ATOM   9143  C CA  . ARG F 3 18  ? 28.490  -10.228 -6.526  1.00 55.59  ? 18  ARG L CA  1 
ATOM   9144  C C   . ARG F 3 18  ? 28.515  -8.699  -6.547  1.00 52.66  ? 18  ARG L C   1 
ATOM   9145  O O   . ARG F 3 18  ? 27.728  -8.050  -7.222  1.00 53.63  ? 18  ARG L O   1 
ATOM   9146  C CB  . ARG F 3 18  ? 28.881  -10.734 -7.904  1.00 59.11  ? 18  ARG L CB  1 
ATOM   9147  C CG  . ARG F 3 18  ? 29.868  -9.861  -8.610  1.00 58.74  ? 18  ARG L CG  1 
ATOM   9148  C CD  . ARG F 3 18  ? 30.596  -10.656 -9.640  1.00 62.36  ? 18  ARG L CD  1 
ATOM   9149  N NE  . ARG F 3 18  ? 29.964  -10.514 -10.932 1.00 65.62  ? 18  ARG L NE  1 
ATOM   9150  C CZ  . ARG F 3 18  ? 30.596  -10.070 -12.012 1.00 67.39  ? 18  ARG L CZ  1 
ATOM   9151  N NH1 . ARG F 3 18  ? 31.889  -9.737  -11.941 1.00 66.03  ? 18  ARG L NH1 1 
ATOM   9152  N NH2 . ARG F 3 18  ? 29.934  -9.977  -13.168 1.00 70.60  ? 18  ARG L NH2 1 
ATOM   9153  N N   . ALA F 3 19  ? 29.454  -8.115  -5.831  1.00 49.66  ? 19  ALA L N   1 
ATOM   9154  C CA  . ALA F 3 19  ? 29.556  -6.668  -5.805  1.00 47.30  ? 19  ALA L CA  1 
ATOM   9155  C C   . ALA F 3 19  ? 30.697  -6.210  -6.698  1.00 42.09  ? 19  ALA L C   1 
ATOM   9156  O O   . ALA F 3 19  ? 31.770  -6.824  -6.727  1.00 42.39  ? 19  ALA L O   1 
ATOM   9157  C CB  . ALA F 3 19  ? 29.753  -6.159  -4.355  1.00 39.41  ? 19  ALA L CB  1 
ATOM   9158  N N   . THR F 3 20  ? 30.461  -5.137  -7.440  1.00 42.17  ? 20  THR L N   1 
ATOM   9159  C CA  . THR F 3 20  ? 31.532  -4.501  -8.178  1.00 42.09  ? 20  THR L CA  1 
ATOM   9160  C C   . THR F 3 20  ? 31.511  -3.002  -7.924  1.00 40.27  ? 20  THR L C   1 
ATOM   9161  O O   . THR F 3 20  ? 30.462  -2.382  -7.872  1.00 40.50  ? 20  THR L O   1 
ATOM   9162  C CB  . THR F 3 20  ? 31.510  -4.817  -9.710  1.00 45.36  ? 20  THR L CB  1 
ATOM   9163  O OG1 . THR F 3 20  ? 30.498  -4.046  -10.350 1.00 47.60  ? 20  THR L OG1 1 
ATOM   9164  C CG2 . THR F 3 20  ? 31.272  -6.306  -9.988  1.00 47.83  ? 20  THR L CG2 1 
ATOM   9165  N N   . ILE F 3 21  ? 32.703  -2.448  -7.753  1.00 39.37  ? 21  ILE L N   1 
ATOM   9166  C CA  . ILE F 3 21  ? 32.917  -1.057  -7.411  1.00 37.23  ? 21  ILE L CA  1 
ATOM   9167  C C   . ILE F 3 21  ? 33.925  -0.471  -8.395  1.00 40.58  ? 21  ILE L C   1 
ATOM   9168  O O   . ILE F 3 21  ? 34.972  -1.055  -8.628  1.00 38.55  ? 21  ILE L O   1 
ATOM   9169  C CB  . ILE F 3 21  ? 33.537  -0.985  -6.019  1.00 38.34  ? 21  ILE L CB  1 
ATOM   9170  C CG1 . ILE F 3 21  ? 32.614  -1.643  -5.007  1.00 34.06  ? 21  ILE L CG1 1 
ATOM   9171  C CG2 . ILE F 3 21  ? 33.880  0.442   -5.632  1.00 33.24  ? 21  ILE L CG2 1 
ATOM   9172  C CD1 . ILE F 3 21  ? 33.372  -2.111  -3.808  1.00 36.25  ? 21  ILE L CD1 1 
ATOM   9173  N N   . ASN F 3 22  ? 33.609  0.685   -8.962  1.00 41.18  ? 22  ASN L N   1 
ATOM   9174  C CA  . ASN F 3 22  ? 34.468  1.312   -9.954  1.00 42.74  ? 22  ASN L CA  1 
ATOM   9175  C C   . ASN F 3 22  ? 35.339  2.399   -9.368  1.00 41.18  ? 22  ASN L C   1 
ATOM   9176  O O   . ASN F 3 22  ? 34.956  3.033   -8.385  1.00 39.85  ? 22  ASN L O   1 
ATOM   9177  C CB  . ASN F 3 22  ? 33.627  1.889   -11.089 1.00 45.84  ? 22  ASN L CB  1 
ATOM   9178  C CG  . ASN F 3 22  ? 32.657  0.877   -11.647 1.00 48.21  ? 22  ASN L CG  1 
ATOM   9179  O OD1 . ASN F 3 22  ? 33.001  -0.293  -11.784 1.00 48.64  ? 22  ASN L OD1 1 
ATOM   9180  N ND2 . ASN F 3 22  ? 31.421  1.311   -11.940 1.00 49.99  ? 22  ASN L ND2 1 
ATOM   9181  N N   . CYS F 3 23  ? 36.516  2.596   -9.961  1.00 41.89  ? 23  CYS L N   1 
ATOM   9182  C CA  . CYS F 3 23  ? 37.374  3.737   -9.659  1.00 38.74  ? 23  CYS L CA  1 
ATOM   9183  C C   . CYS F 3 23  ? 37.819  4.359   -10.959 1.00 50.43  ? 23  CYS L C   1 
ATOM   9184  O O   . CYS F 3 23  ? 38.312  3.667   -11.844 1.00 43.52  ? 23  CYS L O   1 
ATOM   9185  C CB  . CYS F 3 23  ? 38.615  3.301   -8.862  1.00 39.33  ? 23  CYS L CB  1 
ATOM   9186  S SG  . CYS F 3 23  ? 39.483  4.639   -7.971  1.00 63.20  ? 23  CYS L SG  1 
ATOM   9187  N N   . GLU F 3 24  ? 37.658  5.665   -11.082 1.00 50.85  ? 24  GLU L N   1 
ATOM   9188  C CA  . GLU F 3 24  ? 38.174  6.351   -12.257 1.00 54.24  ? 24  GLU L CA  1 
ATOM   9189  C C   . GLU F 3 24  ? 39.287  7.316   -11.894 1.00 52.93  ? 24  GLU L C   1 
ATOM   9190  O O   . GLU F 3 24  ? 39.164  8.100   -10.959 1.00 50.73  ? 24  GLU L O   1 
ATOM   9191  C CB  . GLU F 3 24  ? 37.075  7.104   -12.995 1.00 58.16  ? 24  GLU L CB  1 
ATOM   9192  C CG  . GLU F 3 24  ? 37.541  7.713   -14.328 1.00 62.78  ? 24  GLU L CG  1 
ATOM   9193  C CD  . GLU F 3 24  ? 36.659  8.874   -14.773 1.00 65.77  ? 24  GLU L CD  1 
ATOM   9194  O OE1 . GLU F 3 24  ? 36.748  9.258   -15.962 1.00 69.70  ? 24  GLU L OE1 1 
ATOM   9195  O OE2 . GLU F 3 24  ? 35.888  9.397   -13.922 1.00 64.45  ? 24  GLU L OE2 1 
ATOM   9196  N N   . SER F 3 25  ? 40.372  7.269   -12.654 1.00 54.64  ? 25  SER L N   1 
ATOM   9197  C CA  . SER F 3 25  ? 41.515  8.106   -12.351 1.00 54.18  ? 25  SER L CA  1 
ATOM   9198  C C   . SER F 3 25  ? 41.599  9.322   -13.271 1.00 57.41  ? 25  SER L C   1 
ATOM   9199  O O   . SER F 3 25  ? 41.359  9.226   -14.476 1.00 60.97  ? 25  SER L O   1 
ATOM   9200  C CB  . SER F 3 25  ? 42.791  7.284   -12.426 1.00 54.09  ? 25  SER L CB  1 
ATOM   9201  O OG  . SER F 3 25  ? 43.913  8.091   -12.153 1.00 54.36  ? 25  SER L OG  1 
ATOM   9202  N N   . SER F 3 26  ? 41.945  10.463  -12.683 1.00 56.54  ? 26  SER L N   1 
ATOM   9203  C CA  . SER F 3 26  ? 42.150  11.726  -13.397 1.00 59.44  ? 26  SER L CA  1 
ATOM   9204  C C   . SER F 3 26  ? 43.274  11.647  -14.430 1.00 61.59  ? 26  SER L C   1 
ATOM   9205  O O   . SER F 3 26  ? 43.445  12.549  -15.239 1.00 65.13  ? 26  SER L O   1 
ATOM   9206  C CB  . SER F 3 26  ? 42.549  12.794  -12.370 1.00 58.66  ? 26  SER L CB  1 
ATOM   9207  O OG  . SER F 3 26  ? 41.714  13.936  -12.423 1.00 60.70  ? 26  SER L OG  1 
ATOM   9208  N N   . GLN F 3 27  ? 44.055  10.575  -14.368 1.00 59.80  ? 27  GLN L N   1 
ATOM   9209  C CA  . GLN F 3 27  ? 45.309  10.471  -15.085 1.00 61.80  ? 27  GLN L CA  1 
ATOM   9210  C C   . GLN F 3 27  ? 45.709  9.002   -15.040 1.00 60.19  ? 27  GLN L C   1 
ATOM   9211  O O   . GLN F 3 27  ? 45.248  8.261   -14.188 1.00 56.82  ? 27  GLN L O   1 
ATOM   9212  C CB  . GLN F 3 27  ? 46.363  11.349  -14.402 1.00 61.60  ? 27  GLN L CB  1 
ATOM   9213  C CG  . GLN F 3 27  ? 47.620  11.627  -15.227 1.00 65.68  ? 27  GLN L CG  1 
ATOM   9214  C CD  . GLN F 3 27  ? 48.886  11.821  -14.375 1.00 64.68  ? 27  GLN L CD  1 
ATOM   9215  O OE1 . GLN F 3 27  ? 49.526  12.870  -14.427 1.00 66.59  ? 27  GLN L OE1 1 
ATOM   9216  N NE2 . GLN F 3 27  ? 49.254  10.794  -13.612 1.00 61.99  ? 27  GLN L NE2 1 
ATOM   9217  N N   . SER F 3 28  ? 46.552  8.575   -15.968 1.00 63.15  ? 28  SER L N   1 
ATOM   9218  C CA  . SER F 3 28  ? 46.956  7.176   -16.053 1.00 63.05  ? 28  SER L CA  1 
ATOM   9219  C C   . SER F 3 28  ? 47.877  6.753   -14.896 1.00 60.51  ? 28  SER L C   1 
ATOM   9220  O O   . SER F 3 28  ? 48.856  7.443   -14.567 1.00 60.77  ? 28  SER L O   1 
ATOM   9221  C CB  . SER F 3 28  ? 47.632  6.921   -17.407 1.00 67.76  ? 28  SER L CB  1 
ATOM   9222  O OG  . SER F 3 28  ? 47.930  5.549   -17.600 1.00 68.46  ? 28  SER L OG  1 
ATOM   9223  N N   . LEU F 3 29  ? 47.555  5.611   -14.289 1.00 58.42  ? 29  LEU L N   1 
ATOM   9224  C CA  . LEU F 3 29  ? 48.347  5.044   -13.192 1.00 52.10  ? 29  LEU L CA  1 
ATOM   9225  C C   . LEU F 3 29  ? 49.256  3.918   -13.707 1.00 57.21  ? 29  LEU L C   1 
ATOM   9226  O O   . LEU F 3 29  ? 49.798  3.127   -12.947 1.00 53.84  ? 29  LEU L O   1 
ATOM   9227  C CB  . LEU F 3 29  ? 47.430  4.561   -12.053 1.00 48.32  ? 29  LEU L CB  1 
ATOM   9228  C CG  . LEU F 3 29  ? 46.416  5.634   -11.639 1.00 46.30  ? 29  LEU L CG  1 
ATOM   9229  C CD1 . LEU F 3 29  ? 45.497  5.205   -10.512 1.00 42.96  ? 29  LEU L CD1 1 
ATOM   9230  C CD2 . LEU F 3 29  ? 47.109  6.922   -11.283 1.00 46.25  ? 29  LEU L CD2 1 
ATOM   9231  N N   . LEU F 3 30  ? 49.415  3.859   -15.020 1.00 61.14  ? 30  LEU L N   1 
ATOM   9232  C CA  . LEU F 3 30  ? 50.226  2.829   -15.653 1.00 64.57  ? 30  LEU L CA  1 
ATOM   9233  C C   . LEU F 3 30  ? 51.591  3.424   -15.873 1.00 67.30  ? 30  LEU L C   1 
ATOM   9234  O O   . LEU F 3 30  ? 51.701  4.472   -16.502 1.00 69.09  ? 30  LEU L O   1 
ATOM   9235  C CB  . LEU F 3 30  ? 49.603  2.431   -17.002 1.00 67.74  ? 30  LEU L CB  1 
ATOM   9236  C CG  . LEU F 3 30  ? 50.125  1.304   -17.902 1.00 71.73  ? 30  LEU L CG  1 
ATOM   9237  C CD1 . LEU F 3 30  ? 51.362  1.731   -18.667 1.00 75.90  ? 30  LEU L CD1 1 
ATOM   9238  C CD2 . LEU F 3 30  ? 50.391  0.039   -17.112 1.00 70.61  ? 30  LEU L CD2 1 
ATOM   9239  N N   . ASN F 3 31  ? 52.628  2.780   -15.346 1.00 67.98  ? 31  ASN L N   1 
ATOM   9240  C CA  . ASN F 3 31  ? 53.982  3.161   -15.721 1.00 71.49  ? 31  ASN L CA  1 
ATOM   9241  C C   . ASN F 3 31  ? 54.513  2.249   -16.827 1.00 76.88  ? 31  ASN L C   1 
ATOM   9242  O O   . ASN F 3 31  ? 54.260  1.041   -16.830 1.00 77.54  ? 31  ASN L O   1 
ATOM   9243  C CB  . ASN F 3 31  ? 54.922  3.178   -14.521 1.00 69.75  ? 31  ASN L CB  1 
ATOM   9244  C CG  . ASN F 3 31  ? 56.343  3.563   -14.902 1.00 73.48  ? 31  ASN L CG  1 
ATOM   9245  O OD1 . ASN F 3 31  ? 56.652  4.737   -15.121 1.00 74.09  ? 31  ASN L OD1 1 
ATOM   9246  N ND2 . ASN F 3 31  ? 57.216  2.570   -14.986 1.00 76.36  ? 31  ASN L ND2 1 
ATOM   9247  N N   . SER F 3 32  ? 55.238  2.836   -17.773 1.00 81.12  ? 32  SER L N   1 
ATOM   9248  C CA  . SER F 3 32  ? 55.708  2.102   -18.943 1.00 86.64  ? 32  SER L CA  1 
ATOM   9249  C C   . SER F 3 32  ? 56.859  1.134   -18.653 1.00 89.17  ? 32  SER L C   1 
ATOM   9250  O O   . SER F 3 32  ? 56.971  0.095   -19.292 1.00 92.84  ? 32  SER L O   1 
ATOM   9251  C CB  . SER F 3 32  ? 56.097  3.077   -20.053 1.00 86.74  ? 32  SER L CB  1 
ATOM   9252  O OG  . SER F 3 32  ? 54.983  3.859   -20.438 1.00 85.38  ? 32  SER L OG  1 
ATOM   9253  N N   . GLY F 3 33  ? 57.708  1.464   -17.691 1.00 83.74  ? 33  GLY L N   1 
ATOM   9254  C CA  . GLY F 3 33  ? 58.868  0.643   -17.416 1.00 86.67  ? 33  GLY L CA  1 
ATOM   9255  C C   . GLY F 3 33  ? 58.564  -0.739  -16.876 1.00 86.00  ? 33  GLY L C   1 
ATOM   9256  O O   . GLY F 3 33  ? 59.307  -1.687  -17.112 1.00 90.14  ? 33  GLY L O   1 
ATOM   9257  N N   . ASN F 3 34  ? 57.463  -0.857  -16.151 1.00 81.17  ? 34  ASN L N   1 
ATOM   9258  C CA  . ASN F 3 34  ? 57.155  -2.076  -15.411 1.00 80.08  ? 34  ASN L CA  1 
ATOM   9259  C C   . ASN F 3 34  ? 55.802  -2.617  -15.813 1.00 84.47  ? 34  ASN L C   1 
ATOM   9260  O O   . ASN F 3 34  ? 55.449  -3.744  -15.470 1.00 78.93  ? 34  ASN L O   1 
ATOM   9261  C CB  . ASN F 3 34  ? 57.157  -1.768  -13.919 1.00 75.52  ? 34  ASN L CB  1 
ATOM   9262  C CG  . ASN F 3 34  ? 56.642  -0.375  -13.629 1.00 71.53  ? 34  ASN L CG  1 
ATOM   9263  O OD1 . ASN F 3 34  ? 55.687  0.083   -14.257 1.00 70.42  ? 34  ASN L OD1 1 
ATOM   9264  N ND2 . ASN F 3 34  ? 57.303  0.326   -12.715 1.00 69.91  ? 34  ASN L ND2 1 
ATOM   9265  N N   . GLN F 3 35  ? 55.057  -1.796  -16.548 1.00 83.66  ? 35  GLN L N   1 
ATOM   9266  C CA  . GLN F 3 35  ? 53.705  -2.125  -16.971 1.00 82.75  ? 35  GLN L CA  1 
ATOM   9267  C C   . GLN F 3 35  ? 52.852  -2.497  -15.761 1.00 78.06  ? 35  GLN L C   1 
ATOM   9268  O O   . GLN F 3 35  ? 52.047  -3.428  -15.803 1.00 78.05  ? 35  GLN L O   1 
ATOM   9269  C CB  . GLN F 3 35  ? 53.704  -3.244  -18.016 1.00 87.92  ? 35  GLN L CB  1 
ATOM   9270  C CG  . GLN F 3 35  ? 54.515  -2.926  -19.259 1.00 93.34  ? 35  GLN L CG  1 
ATOM   9271  C CD  . GLN F 3 35  ? 54.056  -1.650  -19.949 1.00 92.83  ? 35  GLN L CD  1 
ATOM   9272  O OE1 . GLN F 3 35  ? 54.874  -0.855  -20.408 1.00 95.17  ? 35  GLN L OE1 1 
ATOM   9273  N NE2 . GLN F 3 35  ? 52.744  -1.456  -20.035 1.00 90.16  ? 35  GLN L NE2 1 
ATOM   9274  N N   . LYS F 3 36  ? 53.050  -1.767  -14.673 1.00 74.39  ? 36  LYS L N   1 
ATOM   9275  C CA  . LYS F 3 36  ? 52.239  -1.956  -13.500 1.00 63.98  ? 36  LYS L CA  1 
ATOM   9276  C C   . LYS F 3 36  ? 51.275  -0.806  -13.407 1.00 63.90  ? 36  LYS L C   1 
ATOM   9277  O O   . LYS F 3 36  ? 51.541  0.278   -13.930 1.00 61.18  ? 36  LYS L O   1 
ATOM   9278  C CB  . LYS F 3 36  ? 53.107  -2.060  -12.255 1.00 62.73  ? 36  LYS L CB  1 
ATOM   9279  C CG  . LYS F 3 36  ? 53.568  -3.469  -11.993 1.00 65.28  ? 36  LYS L CG  1 
ATOM   9280  C CD  . LYS F 3 36  ? 54.616  -3.541  -10.909 1.00 65.25  ? 36  LYS L CD  1 
ATOM   9281  C CE  . LYS F 3 36  ? 54.837  -4.988  -10.495 1.00 68.87  ? 36  LYS L CE  1 
ATOM   9282  N NZ  . LYS F 3 36  ? 56.145  -5.193  -9.821  1.00 71.14  ? 36  LYS L NZ  1 
ATOM   9283  N N   . ASN F 3 37  ? 50.131  -1.071  -12.782 1.00 60.50  ? 37  ASN L N   1 
ATOM   9284  C CA  . ASN F 3 37  ? 49.166  -0.036  -12.460 1.00 57.35  ? 37  ASN L CA  1 
ATOM   9285  C C   . ASN F 3 37  ? 49.297  0.316   -10.980 1.00 53.90  ? 37  ASN L C   1 
ATOM   9286  O O   . ASN F 3 37  ? 49.184  -0.552  -10.106 1.00 52.41  ? 37  ASN L O   1 
ATOM   9287  C CB  . ASN F 3 37  ? 47.749  -0.501  -12.775 1.00 57.18  ? 37  ASN L CB  1 
ATOM   9288  C CG  . ASN F 3 37  ? 47.522  -0.756  -14.266 1.00 61.60  ? 37  ASN L CG  1 
ATOM   9289  O OD1 . ASN F 3 37  ? 47.419  0.186   -15.067 1.00 62.97  ? 37  ASN L OD1 1 
ATOM   9290  N ND2 . ASN F 3 37  ? 47.408  -2.037  -14.639 1.00 63.95  ? 37  ASN L ND2 1 
ATOM   9291  N N   . TYR F 3 38  ? 49.560  1.588   -10.703 1.00 52.79  ? 38  TYR L N   1 
ATOM   9292  C CA  . TYR F 3 38  ? 49.853  2.028   -9.344  1.00 49.94  ? 38  TYR L CA  1 
ATOM   9293  C C   . TYR F 3 38  ? 48.577  2.488   -8.638  1.00 46.49  ? 38  TYR L C   1 
ATOM   9294  O O   . TYR F 3 38  ? 48.354  3.676   -8.414  1.00 45.22  ? 38  TYR L O   1 
ATOM   9295  C CB  . TYR F 3 38  ? 50.936  3.108   -9.351  1.00 47.34  ? 38  TYR L CB  1 
ATOM   9296  C CG  . TYR F 3 38  ? 52.312  2.552   -9.609  1.00 50.45  ? 38  TYR L CG  1 
ATOM   9297  C CD1 . TYR F 3 38  ? 53.332  2.713   -8.688  1.00 50.34  ? 38  TYR L CD1 1 
ATOM   9298  C CD2 . TYR F 3 38  ? 52.599  1.854   -10.781 1.00 60.10  ? 38  TYR L CD2 1 
ATOM   9299  C CE1 . TYR F 3 38  ? 54.613  2.204   -8.931  1.00 54.17  ? 38  TYR L CE1 1 
ATOM   9300  C CE2 . TYR F 3 38  ? 53.876  1.331   -11.031 1.00 57.36  ? 38  TYR L CE2 1 
ATOM   9301  C CZ  . TYR F 3 38  ? 54.872  1.509   -10.099 1.00 57.19  ? 38  TYR L CZ  1 
ATOM   9302  O OH  . TYR F 3 38  ? 56.117  0.996   -10.324 1.00 60.89  ? 38  TYR L OH  1 
ATOM   9303  N N   . LEU F 3 39  ? 47.737  1.519   -8.305  1.00 44.74  ? 39  LEU L N   1 
ATOM   9304  C CA  . LEU F 3 39  ? 46.453  1.780   -7.676  1.00 41.47  ? 39  LEU L CA  1 
ATOM   9305  C C   . LEU F 3 39  ? 46.319  0.801   -6.535  1.00 39.88  ? 39  LEU L C   1 
ATOM   9306  O O   . LEU F 3 39  ? 46.717  -0.357  -6.656  1.00 41.42  ? 39  LEU L O   1 
ATOM   9307  C CB  . LEU F 3 39  ? 45.299  1.557   -8.664  1.00 42.18  ? 39  LEU L CB  1 
ATOM   9308  C CG  . LEU F 3 39  ? 43.961  1.546   -7.936  1.00 39.51  ? 39  LEU L CG  1 
ATOM   9309  C CD1 . LEU F 3 39  ? 43.298  2.897   -8.013  1.00 38.54  ? 39  LEU L CD1 1 
ATOM   9310  C CD2 . LEU F 3 39  ? 43.061  0.446   -8.424  1.00 40.45  ? 39  LEU L CD2 1 
ATOM   9311  N N   . THR F 3 40  ? 45.758  1.256   -5.427  1.00 37.02  ? 40  THR L N   1 
ATOM   9312  C CA  . THR F 3 40  ? 45.699  0.436   -4.244  1.00 35.97  ? 40  THR L CA  1 
ATOM   9313  C C   . THR F 3 40  ? 44.273  0.455   -3.739  1.00 34.16  ? 40  THR L C   1 
ATOM   9314  O O   . THR F 3 40  ? 43.641  1.509   -3.758  1.00 33.26  ? 40  THR L O   1 
ATOM   9315  C CB  . THR F 3 40  ? 46.668  0.994   -3.187  1.00 35.34  ? 40  THR L CB  1 
ATOM   9316  O OG1 . THR F 3 40  ? 48.008  0.804   -3.645  1.00 37.58  ? 40  THR L OG1 1 
ATOM   9317  C CG2 . THR F 3 40  ? 46.487  0.304   -1.840  1.00 34.56  ? 40  THR L CG2 1 
ATOM   9318  N N   . TRP F 3 41  ? 43.760  -0.700  -3.310  1.00 34.10  ? 41  TRP L N   1 
ATOM   9319  C CA  . TRP F 3 41  ? 42.400  -0.795  -2.745  1.00 32.57  ? 41  TRP L CA  1 
ATOM   9320  C C   . TRP F 3 41  ? 42.430  -0.990  -1.223  1.00 29.97  ? 41  TRP L C   1 
ATOM   9321  O O   . TRP F 3 41  ? 43.159  -1.838  -0.716  1.00 31.01  ? 41  TRP L O   1 
ATOM   9322  C CB  . TRP F 3 41  ? 41.624  -1.968  -3.370  1.00 32.45  ? 41  TRP L CB  1 
ATOM   9323  C CG  . TRP F 3 41  ? 41.072  -1.708  -4.730  1.00 40.20  ? 41  TRP L CG  1 
ATOM   9324  C CD1 . TRP F 3 41  ? 41.514  -2.229  -5.917  1.00 42.59  ? 41  TRP L CD1 1 
ATOM   9325  C CD2 . TRP F 3 41  ? 39.952  -0.876  -5.055  1.00 39.34  ? 41  TRP L CD2 1 
ATOM   9326  N NE1 . TRP F 3 41  ? 40.742  -1.763  -6.955  1.00 36.62  ? 41  TRP L NE1 1 
ATOM   9327  C CE2 . TRP F 3 41  ? 39.779  -0.933  -6.452  1.00 34.73  ? 41  TRP L CE2 1 
ATOM   9328  C CE3 . TRP F 3 41  ? 39.088  -0.080  -4.301  1.00 37.45  ? 41  TRP L CE3 1 
ATOM   9329  C CZ2 . TRP F 3 41  ? 38.793  -0.218  -7.105  1.00 35.04  ? 41  TRP L CZ2 1 
ATOM   9330  C CZ3 . TRP F 3 41  ? 38.095  0.623   -4.958  1.00 31.26  ? 41  TRP L CZ3 1 
ATOM   9331  C CH2 . TRP F 3 41  ? 37.958  0.551   -6.342  1.00 33.31  ? 41  TRP L CH2 1 
ATOM   9332  N N   . TYR F 3 42  ? 41.621  -0.229  -0.495  1.00 28.29  ? 42  TYR L N   1 
ATOM   9333  C CA  . TYR F 3 42  ? 41.485  -0.453  0.948   1.00 29.31  ? 42  TYR L CA  1 
ATOM   9334  C C   . TYR F 3 42  ? 40.088  -0.893  1.352   1.00 29.05  ? 42  TYR L C   1 
ATOM   9335  O O   . TYR F 3 42  ? 39.095  -0.533  0.716   1.00 28.88  ? 42  TYR L O   1 
ATOM   9336  C CB  . TYR F 3 42  ? 41.832  0.800   1.730   1.00 26.51  ? 42  TYR L CB  1 
ATOM   9337  C CG  . TYR F 3 42  ? 43.249  1.259   1.545   1.00 27.10  ? 42  TYR L CG  1 
ATOM   9338  C CD1 . TYR F 3 42  ? 44.240  0.824   2.397   1.00 27.89  ? 42  TYR L CD1 1 
ATOM   9339  C CD2 . TYR F 3 42  ? 43.589  2.130   0.522   1.00 27.28  ? 42  TYR L CD2 1 
ATOM   9340  C CE1 . TYR F 3 42  ? 45.524  1.232   2.242   1.00 29.10  ? 42  TYR L CE1 1 
ATOM   9341  C CE2 . TYR F 3 42  ? 44.872  2.544   0.359   1.00 28.11  ? 42  TYR L CE2 1 
ATOM   9342  C CZ  . TYR F 3 42  ? 45.843  2.092   1.220   1.00 29.11  ? 42  TYR L CZ  1 
ATOM   9343  O OH  . TYR F 3 42  ? 47.156  2.483   1.086   1.00 30.53  ? 42  TYR L OH  1 
ATOM   9344  N N   . GLN F 3 43  ? 40.014  -1.657  2.432   1.00 29.42  ? 43  GLN L N   1 
ATOM   9345  C CA  . GLN F 3 43  ? 38.730  -1.987  3.043   1.00 29.20  ? 43  GLN L CA  1 
ATOM   9346  C C   . GLN F 3 43  ? 38.704  -1.369  4.437   1.00 28.74  ? 43  GLN L C   1 
ATOM   9347  O O   . GLN F 3 43  ? 39.633  -1.565  5.214   1.00 29.27  ? 43  GLN L O   1 
ATOM   9348  C CB  . GLN F 3 43  ? 38.576  -3.497  3.126   1.00 30.73  ? 43  GLN L CB  1 
ATOM   9349  C CG  . GLN F 3 43  ? 37.271  -3.952  3.692   1.00 31.23  ? 43  GLN L CG  1 
ATOM   9350  C CD  . GLN F 3 43  ? 37.304  -5.401  4.130   1.00 33.57  ? 43  GLN L CD  1 
ATOM   9351  O OE1 . GLN F 3 43  ? 38.301  -5.879  4.667   1.00 34.66  ? 43  GLN L OE1 1 
ATOM   9352  N NE2 . GLN F 3 43  ? 36.203  -6.106  3.917   1.00 34.68  ? 43  GLN L NE2 1 
ATOM   9353  N N   . GLN F 3 44  ? 37.677  -0.586  4.750   1.00 28.37  ? 44  GLN L N   1 
ATOM   9354  C CA  . GLN F 3 44  ? 37.559  -0.011  6.093   1.00 28.88  ? 44  GLN L CA  1 
ATOM   9355  C C   . GLN F 3 44  ? 36.236  -0.408  6.733   1.00 30.47  ? 44  GLN L C   1 
ATOM   9356  O O   . GLN F 3 44  ? 35.177  0.105   6.354   1.00 30.36  ? 44  GLN L O   1 
ATOM   9357  C CB  . GLN F 3 44  ? 37.696  1.516   6.072   1.00 27.56  ? 44  GLN L CB  1 
ATOM   9358  C CG  . GLN F 3 44  ? 37.810  2.130   7.441   1.00 27.47  ? 44  GLN L CG  1 
ATOM   9359  C CD  . GLN F 3 44  ? 37.952  3.647   7.428   1.00 27.16  ? 44  GLN L CD  1 
ATOM   9360  O OE1 . GLN F 3 44  ? 37.271  4.356   6.686   1.00 26.64  ? 44  GLN L OE1 1 
ATOM   9361  N NE2 . GLN F 3 44  ? 38.824  4.154   8.290   1.00 27.93  ? 44  GLN L NE2 1 
ATOM   9362  N N   . LYS F 3 45  ? 36.309  -1.336  7.689   1.00 32.36  ? 45  LYS L N   1 
ATOM   9363  C CA  . LYS F 3 45  ? 35.134  -1.816  8.410   1.00 34.20  ? 45  LYS L CA  1 
ATOM   9364  C C   . LYS F 3 45  ? 34.779  -0.825  9.531   1.00 35.39  ? 45  LYS L C   1 
ATOM   9365  O O   . LYS F 3 45  ? 35.633  -0.033  9.957   1.00 34.97  ? 45  LYS L O   1 
ATOM   9366  C CB  . LYS F 3 45  ? 35.376  -3.234  8.941   1.00 35.87  ? 45  LYS L CB  1 
ATOM   9367  C CG  . LYS F 3 45  ? 35.692  -4.248  7.836   1.00 36.61  ? 45  LYS L CG  1 
ATOM   9368  C CD  . LYS F 3 45  ? 35.456  -5.719  8.244   1.00 39.13  ? 45  LYS L CD  1 
ATOM   9369  C CE  . LYS F 3 45  ? 34.024  -5.981  8.793   1.00 72.85  ? 45  LYS L CE  1 
ATOM   9370  N NZ  . LYS F 3 45  ? 32.856  -5.879  7.846   1.00 72.20  ? 45  LYS L NZ  1 
ATOM   9371  N N   . PRO F 3 46  ? 33.506  -0.841  9.995   1.00 36.97  ? 46  PRO L N   1 
ATOM   9372  C CA  . PRO F 3 46  ? 33.055  0.165   10.973  1.00 37.62  ? 46  PRO L CA  1 
ATOM   9373  C C   . PRO F 3 46  ? 33.913  0.210   12.244  1.00 38.78  ? 46  PRO L C   1 
ATOM   9374  O O   . PRO F 3 46  ? 34.187  -0.830  12.854  1.00 39.97  ? 46  PRO L O   1 
ATOM   9375  C CB  . PRO F 3 46  ? 31.644  -0.292  11.308  1.00 39.11  ? 46  PRO L CB  1 
ATOM   9376  C CG  . PRO F 3 46  ? 31.204  -1.110  10.103  1.00 38.73  ? 46  PRO L CG  1 
ATOM   9377  C CD  . PRO F 3 46  ? 32.431  -1.795  9.636   1.00 37.92  ? 46  PRO L CD  1 
ATOM   9378  N N   . GLY F 3 47  ? 34.348  1.409   12.616  1.00 38.80  ? 47  GLY L N   1 
ATOM   9379  C CA  . GLY F 3 47  ? 35.165  1.595   13.803  1.00 40.18  ? 47  GLY L CA  1 
ATOM   9380  C C   . GLY F 3 47  ? 36.658  1.316   13.686  1.00 40.00  ? 47  GLY L C   1 
ATOM   9381  O O   . GLY F 3 47  ? 37.364  1.340   14.687  1.00 41.21  ? 47  GLY L O   1 
ATOM   9382  N N   . GLN F 3 48  ? 37.150  1.090   12.469  1.00 38.85  ? 48  GLN L N   1 
ATOM   9383  C CA  . GLN F 3 48  ? 38.532  0.644   12.270  1.00 39.06  ? 48  GLN L CA  1 
ATOM   9384  C C   . GLN F 3 48  ? 39.350  1.399   11.217  1.00 36.88  ? 48  GLN L C   1 
ATOM   9385  O O   . GLN F 3 48  ? 38.816  2.214   10.479  1.00 35.05  ? 48  GLN L O   1 
ATOM   9386  C CB  . GLN F 3 48  ? 38.526  -0.836  11.939  1.00 40.83  ? 48  GLN L CB  1 
ATOM   9387  C CG  . GLN F 3 48  ? 38.293  -1.680  13.129  1.00 44.13  ? 48  GLN L CG  1 
ATOM   9388  C CD  . GLN F 3 48  ? 38.297  -3.119  12.762  1.00 46.44  ? 48  GLN L CD  1 
ATOM   9389  O OE1 . GLN F 3 48  ? 38.259  -3.470  11.579  1.00 45.79  ? 48  GLN L OE1 1 
ATOM   9390  N NE2 . GLN F 3 48  ? 38.353  -3.982  13.767  1.00 49.57  ? 48  GLN L NE2 1 
ATOM   9391  N N   . PRO F 3 49  ? 40.670  1.139   11.170  1.00 37.56  ? 49  PRO L N   1 
ATOM   9392  C CA  . PRO F 3 49  ? 41.479  1.786   10.135  1.00 36.74  ? 49  PRO L CA  1 
ATOM   9393  C C   . PRO F 3 49  ? 41.315  1.067   8.821   1.00 36.16  ? 49  PRO L C   1 
ATOM   9394  O O   . PRO F 3 49  ? 40.966  -0.101  8.813   1.00 36.57  ? 49  PRO L O   1 
ATOM   9395  C CB  . PRO F 3 49  ? 42.919  1.598   10.638  1.00 38.02  ? 49  PRO L CB  1 
ATOM   9396  C CG  . PRO F 3 49  ? 42.795  1.126   12.065  1.00 39.66  ? 49  PRO L CG  1 
ATOM   9397  C CD  . PRO F 3 49  ? 41.509  0.418   12.150  1.00 39.46  ? 49  PRO L CD  1 
ATOM   9398  N N   . PRO F 3 50  ? 41.551  1.759   7.705   1.00 35.92  ? 50  PRO L N   1 
ATOM   9399  C CA  . PRO F 3 50  ? 41.465  0.985   6.467   1.00 36.17  ? 50  PRO L CA  1 
ATOM   9400  C C   . PRO F 3 50  ? 42.585  -0.045  6.477   1.00 38.05  ? 50  PRO L C   1 
ATOM   9401  O O   . PRO F 3 50  ? 43.655  0.192   7.042   1.00 39.08  ? 50  PRO L O   1 
ATOM   9402  C CB  . PRO F 3 50  ? 41.690  2.032   5.369   1.00 35.32  ? 50  PRO L CB  1 
ATOM   9403  C CG  . PRO F 3 50  ? 41.409  3.336   6.017   1.00 34.82  ? 50  PRO L CG  1 
ATOM   9404  C CD  . PRO F 3 50  ? 41.812  3.185   7.456   1.00 35.45  ? 50  PRO L CD  1 
ATOM   9405  N N   . LYS F 3 51  ? 42.309  -1.199  5.887   1.00 38.68  ? 51  LYS L N   1 
ATOM   9406  C CA  . LYS F 3 51  ? 43.277  -2.264  5.780   1.00 40.49  ? 51  LYS L CA  1 
ATOM   9407  C C   . LYS F 3 51  ? 43.545  -2.433  4.299   1.00 40.42  ? 51  LYS L C   1 
ATOM   9408  O O   . LYS F 3 51  ? 42.613  -2.383  3.490   1.00 39.97  ? 51  LYS L O   1 
ATOM   9409  C CB  . LYS F 3 51  ? 42.696  -3.527  6.414   1.00 42.33  ? 51  LYS L CB  1 
ATOM   9410  C CG  . LYS F 3 51  ? 43.161  -4.867  5.826   1.00 45.14  ? 51  LYS L CG  1 
ATOM   9411  C CD  . LYS F 3 51  ? 42.503  -6.019  6.609   1.00 47.15  ? 51  LYS L CD  1 
ATOM   9412  C CE  . LYS F 3 51  ? 42.961  -7.391  6.142   1.00 50.26  ? 51  LYS L CE  1 
ATOM   9413  N NZ  . LYS F 3 51  ? 42.436  -8.436  7.081   1.00 52.60  ? 51  LYS L NZ  1 
ATOM   9414  N N   . PRO F 3 52  ? 44.821  -2.566  3.924   1.00 41.32  ? 52  PRO L N   1 
ATOM   9415  C CA  . PRO F 3 52  ? 45.170  -2.670  2.503   1.00 41.60  ? 52  PRO L CA  1 
ATOM   9416  C C   . PRO F 3 52  ? 44.737  -4.012  1.937   1.00 34.15  ? 52  PRO L C   1 
ATOM   9417  O O   . PRO F 3 52  ? 45.025  -5.041  2.542   1.00 39.89  ? 52  PRO L O   1 
ATOM   9418  C CB  . PRO F 3 52  ? 46.697  -2.555  2.516   1.00 34.11  ? 52  PRO L CB  1 
ATOM   9419  C CG  . PRO F 3 52  ? 47.094  -2.978  3.861   1.00 35.13  ? 52  PRO L CG  1 
ATOM   9420  C CD  . PRO F 3 52  ? 46.016  -2.482  4.771   1.00 33.15  ? 52  PRO L CD  1 
ATOM   9421  N N   . LEU F 3 53  ? 44.057  -3.994  0.796   1.00 33.82  ? 53  LEU L N   1 
ATOM   9422  C CA  . LEU F 3 53  ? 43.512  -5.204  0.196   1.00 35.54  ? 53  LEU L CA  1 
ATOM   9423  C C   . LEU F 3 53  ? 44.149  -5.597  -1.157  1.00 38.86  ? 53  LEU L C   1 
ATOM   9424  O O   . LEU F 3 53  ? 44.526  -6.757  -1.375  1.00 40.43  ? 53  LEU L O   1 
ATOM   9425  C CB  . LEU F 3 53  ? 42.023  -5.008  0.002   1.00 35.73  ? 53  LEU L CB  1 
ATOM   9426  C CG  . LEU F 3 53  ? 41.131  -6.001  0.729   1.00 36.47  ? 53  LEU L CG  1 
ATOM   9427  C CD1 . LEU F 3 53  ? 41.154  -5.734  2.235   1.00 35.59  ? 53  LEU L CD1 1 
ATOM   9428  C CD2 . LEU F 3 53  ? 39.732  -5.928  0.156   1.00 35.72  ? 53  LEU L CD2 1 
ATOM   9429  N N   . ILE F 3 54  ? 44.245  -4.636  -2.074  1.00 37.88  ? 54  ILE L N   1 
ATOM   9430  C CA  . ILE F 3 54  ? 44.867  -4.867  -3.375  1.00 39.99  ? 54  ILE L CA  1 
ATOM   9431  C C   . ILE F 3 54  ? 45.951  -3.820  -3.632  1.00 39.45  ? 54  ILE L C   1 
ATOM   9432  O O   . ILE F 3 54  ? 45.719  -2.622  -3.433  1.00 37.09  ? 54  ILE L O   1 
ATOM   9433  C CB  . ILE F 3 54  ? 43.818  -4.822  -4.524  1.00 40.28  ? 54  ILE L CB  1 
ATOM   9434  C CG1 . ILE F 3 54  ? 42.681  -5.816  -4.278  1.00 39.61  ? 54  ILE L CG1 1 
ATOM   9435  C CG2 . ILE F 3 54  ? 44.462  -5.135  -5.842  1.00 42.19  ? 54  ILE L CG2 1 
ATOM   9436  C CD1 . ILE F 3 54  ? 43.059  -7.249  -4.524  1.00 42.89  ? 54  ILE L CD1 1 
ATOM   9437  N N   . TYR F 3 55  ? 47.134  -4.275  -4.044  1.00 41.90  ? 55  TYR L N   1 
ATOM   9438  C CA  . TYR F 3 55  ? 48.186  -3.383  -4.520  1.00 42.29  ? 55  TYR L CA  1 
ATOM   9439  C C   . TYR F 3 55  ? 48.384  -3.648  -5.995  1.00 45.44  ? 55  TYR L C   1 
ATOM   9440  O O   . TYR F 3 55  ? 48.041  -4.712  -6.479  1.00 47.31  ? 55  TYR L O   1 
ATOM   9441  C CB  . TYR F 3 55  ? 49.517  -3.670  -3.833  1.00 46.01  ? 55  TYR L CB  1 
ATOM   9442  C CG  . TYR F 3 55  ? 49.551  -3.442  -2.357  1.00 42.20  ? 55  TYR L CG  1 
ATOM   9443  C CD1 . TYR F 3 55  ? 49.329  -2.179  -1.826  1.00 44.42  ? 55  TYR L CD1 1 
ATOM   9444  C CD2 . TYR F 3 55  ? 49.837  -4.478  -1.490  1.00 43.75  ? 55  TYR L CD2 1 
ATOM   9445  C CE1 . TYR F 3 55  ? 49.368  -1.956  -0.461  1.00 38.21  ? 55  TYR L CE1 1 
ATOM   9446  C CE2 . TYR F 3 55  ? 49.876  -4.265  -0.122  1.00 45.08  ? 55  TYR L CE2 1 
ATOM   9447  C CZ  . TYR F 3 55  ? 49.644  -3.002  0.381   1.00 39.75  ? 55  TYR L CZ  1 
ATOM   9448  O OH  . TYR F 3 55  ? 49.688  -2.789  1.728   1.00 38.96  ? 55  TYR L OH  1 
ATOM   9449  N N   . TRP F 3 56  ? 48.977  -2.705  -6.708  1.00 46.31  ? 56  TRP L N   1 
ATOM   9450  C CA  . TRP F 3 56  ? 49.225  -2.898  -8.132  1.00 49.87  ? 56  TRP L CA  1 
ATOM   9451  C C   . TRP F 3 56  ? 47.928  -3.242  -8.884  1.00 50.53  ? 56  TRP L C   1 
ATOM   9452  O O   . TRP F 3 56  ? 47.961  -4.047  -9.810  1.00 53.78  ? 56  TRP L O   1 
ATOM   9453  C CB  . TRP F 3 56  ? 50.238  -4.038  -8.392  1.00 53.74  ? 56  TRP L CB  1 
ATOM   9454  C CG  . TRP F 3 56  ? 51.617  -3.975  -7.722  1.00 54.68  ? 56  TRP L CG  1 
ATOM   9455  C CD1 . TRP F 3 56  ? 52.255  -4.989  -7.049  1.00 56.63  ? 56  TRP L CD1 1 
ATOM   9456  C CD2 . TRP F 3 56  ? 52.515  -2.873  -7.710  1.00 54.18  ? 56  TRP L CD2 1 
ATOM   9457  N NE1 . TRP F 3 56  ? 53.486  -4.571  -6.605  1.00 57.46  ? 56  TRP L NE1 1 
ATOM   9458  C CE2 . TRP F 3 56  ? 53.666  -3.275  -6.998  1.00 55.94  ? 56  TRP L CE2 1 
ATOM   9459  C CE3 . TRP F 3 56  ? 52.454  -1.581  -8.215  1.00 52.79  ? 56  TRP L CE3 1 
ATOM   9460  C CZ2 . TRP F 3 56  ? 54.731  -2.437  -6.793  1.00 56.44  ? 56  TRP L CZ2 1 
ATOM   9461  C CZ3 . TRP F 3 56  ? 53.501  -0.756  -8.001  1.00 53.33  ? 56  TRP L CZ3 1 
ATOM   9462  C CH2 . TRP F 3 56  ? 54.635  -1.182  -7.303  1.00 55.16  ? 56  TRP L CH2 1 
ATOM   9463  N N   . ALA F 3 57  ? 46.796  -2.680  -8.454  1.00 47.90  ? 57  ALA L N   1 
ATOM   9464  C CA  . ALA F 3 57  ? 45.492  -2.836  -9.131  1.00 48.03  ? 57  ALA L CA  1 
ATOM   9465  C C   . ALA F 3 57  ? 44.909  -4.239  -9.126  1.00 49.91  ? 57  ALA L C   1 
ATOM   9466  O O   . ALA F 3 57  ? 43.694  -4.400  -9.026  1.00 49.03  ? 57  ALA L O   1 
ATOM   9467  C CB  . ALA F 3 57  ? 45.521  -2.283  -10.551 1.00 49.97  ? 57  ALA L CB  1 
ATOM   9468  N N   . SER F 3 58  ? 45.757  -5.253  -9.219  1.00 53.07  ? 58  SER L N   1 
ATOM   9469  C CA  . SER F 3 58  ? 45.268  -6.626  -9.259  1.00 55.64  ? 58  SER L CA  1 
ATOM   9470  C C   . SER F 3 58  ? 45.957  -7.565  -8.261  1.00 57.41  ? 58  SER L C   1 
ATOM   9471  O O   . SER F 3 58  ? 45.407  -8.612  -7.907  1.00 58.69  ? 58  SER L O   1 
ATOM   9472  C CB  . SER F 3 58  ? 45.358  -7.195  -10.680 1.00 59.57  ? 58  SER L CB  1 
ATOM   9473  O OG  . SER F 3 58  ? 46.672  -7.088  -11.201 1.00 62.21  ? 58  SER L OG  1 
ATOM   9474  N N   . THR F 3 59  ? 47.152  -7.201  -7.805  1.00 57.98  ? 59  THR L N   1 
ATOM   9475  C CA  . THR F 3 59  ? 47.887  -8.046  -6.863  1.00 58.81  ? 59  THR L CA  1 
ATOM   9476  C C   . THR F 3 59  ? 47.240  -8.099  -5.469  1.00 57.83  ? 59  THR L C   1 
ATOM   9477  O O   . THR F 3 59  ? 47.041  -7.076  -4.804  1.00 54.41  ? 59  THR L O   1 
ATOM   9478  C CB  . THR F 3 59  ? 49.364  -7.627  -6.761  1.00 56.59  ? 59  THR L CB  1 
ATOM   9479  O OG1 . THR F 3 59  ? 50.026  -7.922  -8.000  1.00 59.18  ? 59  THR L OG1 1 
ATOM   9480  C CG2 . THR F 3 59  ? 50.041  -8.375  -5.637  1.00 56.70  ? 59  THR L CG2 1 
ATOM   9481  N N   . ARG F 3 60  ? 46.914  -9.307  -5.032  1.00 60.30  ? 60  ARG L N   1 
ATOM   9482  C CA  . ARG F 3 60  ? 46.100  -9.485  -3.834  1.00 58.73  ? 60  ARG L CA  1 
ATOM   9483  C C   . ARG F 3 60  ? 46.944  -9.699  -2.570  1.00 59.68  ? 60  ARG L C   1 
ATOM   9484  O O   . ARG F 3 60  ? 47.627  -10.708 -2.416  1.00 63.26  ? 60  ARG L O   1 
ATOM   9485  C CB  . ARG F 3 60  ? 45.091  -10.617 -4.065  1.00 60.54  ? 60  ARG L CB  1 
ATOM   9486  C CG  . ARG F 3 60  ? 44.193  -10.933 -2.913  1.00 59.25  ? 60  ARG L CG  1 
ATOM   9487  C CD  . ARG F 3 60  ? 42.966  -11.681 -3.399  1.00 60.73  ? 60  ARG L CD  1 
ATOM   9488  N NE  . ARG F 3 60  ? 43.251  -12.587 -4.508  1.00 65.33  ? 60  ARG L NE  1 
ATOM   9489  C CZ  . ARG F 3 60  ? 43.199  -13.916 -4.428  1.00 69.48  ? 60  ARG L CZ  1 
ATOM   9490  N NH1 . ARG F 3 60  ? 42.868  -14.500 -3.280  1.00 69.77  ? 60  ARG L NH1 1 
ATOM   9491  N NH2 . ARG F 3 60  ? 43.479  -14.663 -5.496  1.00 73.50  ? 60  ARG L NH2 1 
ATOM   9492  N N   . GLU F 3 61  ? 46.878  -8.719  -1.676  1.00 56.85  ? 61  GLU L N   1 
ATOM   9493  C CA  . GLU F 3 61  ? 47.614  -8.725  -0.419  1.00 57.54  ? 61  GLU L CA  1 
ATOM   9494  C C   . GLU F 3 61  ? 47.362  -9.994  0.373   1.00 60.06  ? 61  GLU L C   1 
ATOM   9495  O O   . GLU F 3 61  ? 46.229  -10.445 0.481   1.00 59.48  ? 61  GLU L O   1 
ATOM   9496  C CB  . GLU F 3 61  ? 47.262  -7.480  0.399   1.00 53.83  ? 61  GLU L CB  1 
ATOM   9497  C CG  . GLU F 3 61  ? 47.926  -7.379  1.750   1.00 54.67  ? 61  GLU L CG  1 
ATOM   9498  C CD  . GLU F 3 61  ? 49.455  -7.488  1.724   1.00 58.18  ? 61  GLU L CD  1 
ATOM   9499  O OE1 . GLU F 3 61  ? 50.087  -7.256  0.667   1.00 59.45  ? 61  GLU L OE1 1 
ATOM   9500  O OE2 . GLU F 3 61  ? 50.038  -7.815  2.787   1.00 60.07  ? 61  GLU L OE2 1 
ATOM   9501  N N   . SER F 3 62  ? 48.441  -10.561 0.911   1.00 63.25  ? 62  SER L N   1 
ATOM   9502  C CA  . SER F 3 62  ? 48.424  -11.851 1.617   1.00 66.83  ? 62  SER L CA  1 
ATOM   9503  C C   . SER F 3 62  ? 47.402  -11.938 2.756   1.00 64.58  ? 62  SER L C   1 
ATOM   9504  O O   . SER F 3 62  ? 47.415  -11.121 3.684   1.00 61.87  ? 62  SER L O   1 
ATOM   9505  C CB  . SER F 3 62  ? 49.828  -12.179 2.151   1.00 71.16  ? 62  SER L CB  1 
ATOM   9506  O OG  . SER F 3 62  ? 50.396  -11.057 2.822   1.00 69.27  ? 62  SER L OG  1 
ATOM   9507  N N   . GLY F 3 63  ? 46.531  -12.942 2.684   1.00 66.22  ? 63  GLY L N   1 
ATOM   9508  C CA  . GLY F 3 63  ? 45.474  -13.102 3.663   1.00 65.08  ? 63  GLY L CA  1 
ATOM   9509  C C   . GLY F 3 63  ? 44.112  -12.705 3.124   1.00 62.14  ? 63  GLY L C   1 
ATOM   9510  O O   . GLY F 3 63  ? 43.090  -13.089 3.681   1.00 61.69  ? 63  GLY L O   1 
ATOM   9511  N N   . VAL F 3 64  ? 44.089  -11.940 2.036   1.00 60.83  ? 64  VAL L N   1 
ATOM   9512  C CA  . VAL F 3 64  ? 42.829  -11.523 1.421   1.00 59.27  ? 64  VAL L CA  1 
ATOM   9513  C C   . VAL F 3 64  ? 42.234  -12.614 0.528   1.00 61.93  ? 64  VAL L C   1 
ATOM   9514  O O   . VAL F 3 64  ? 42.858  -13.030 -0.452  1.00 64.37  ? 64  VAL L O   1 
ATOM   9515  C CB  . VAL F 3 64  ? 43.007  -10.252 0.595   1.00 57.51  ? 64  VAL L CB  1 
ATOM   9516  C CG1 . VAL F 3 64  ? 41.721  -9.930  -0.162  1.00 56.24  ? 64  VAL L CG1 1 
ATOM   9517  C CG2 . VAL F 3 64  ? 43.431  -9.097  1.482   1.00 55.13  ? 64  VAL L CG2 1 
ATOM   9518  N N   . PRO F 3 65  ? 41.015  -13.070 0.860   1.00 61.66  ? 65  PRO L N   1 
ATOM   9519  C CA  . PRO F 3 65  ? 40.376  -14.263 0.276   1.00 64.77  ? 65  PRO L CA  1 
ATOM   9520  C C   . PRO F 3 65  ? 40.094  -14.244 -1.244  1.00 64.95  ? 65  PRO L C   1 
ATOM   9521  O O   . PRO F 3 65  ? 39.958  -13.189 -1.857  1.00 62.36  ? 65  PRO L O   1 
ATOM   9522  C CB  . PRO F 3 65  ? 39.071  -14.391 1.076   1.00 63.70  ? 65  PRO L CB  1 
ATOM   9523  C CG  . PRO F 3 65  ? 38.843  -13.050 1.655   1.00 59.51  ? 65  PRO L CG  1 
ATOM   9524  C CD  . PRO F 3 65  ? 40.188  -12.467 1.917   1.00 58.85  ? 65  PRO L CD  1 
ATOM   9525  N N   . ASP F 3 66  ? 39.987  -15.438 -1.825  1.00 68.29  ? 66  ASP L N   1 
ATOM   9526  C CA  . ASP F 3 66  ? 39.818  -15.630 -3.270  1.00 69.44  ? 66  ASP L CA  1 
ATOM   9527  C C   . ASP F 3 66  ? 38.724  -14.788 -3.963  1.00 66.48  ? 66  ASP L C   1 
ATOM   9528  O O   . ASP F 3 66  ? 38.832  -14.474 -5.153  1.00 66.93  ? 66  ASP L O   1 
ATOM   9529  C CB  . ASP F 3 66  ? 39.594  -17.121 -3.575  1.00 74.34  ? 66  ASP L CB  1 
ATOM   9530  C CG  . ASP F 3 66  ? 40.847  -17.972 -3.330  1.00 78.29  ? 66  ASP L CG  1 
ATOM   9531  O OD1 . ASP F 3 66  ? 41.909  -17.389 -2.989  1.00 77.11  ? 66  ASP L OD1 1 
ATOM   9532  O OD2 . ASP F 3 66  ? 40.773  -19.220 -3.495  1.00 82.81  ? 66  ASP L OD2 1 
ATOM   9533  N N   . ARG F 3 67  ? 37.681  -14.423 -3.223  1.00 63.80  ? 67  ARG L N   1 
ATOM   9534  C CA  . ARG F 3 67  ? 36.508  -13.790 -3.820  1.00 61.56  ? 67  ARG L CA  1 
ATOM   9535  C C   . ARG F 3 67  ? 36.710  -12.311 -4.111  1.00 57.27  ? 67  ARG L C   1 
ATOM   9536  O O   . ARG F 3 67  ? 35.894  -11.707 -4.806  1.00 56.22  ? 67  ARG L O   1 
ATOM   9537  C CB  . ARG F 3 67  ? 35.291  -13.985 -2.922  1.00 61.29  ? 67  ARG L CB  1 
ATOM   9538  C CG  . ARG F 3 67  ? 35.422  -13.368 -1.528  1.00 58.92  ? 67  ARG L CG  1 
ATOM   9539  C CD  . ARG F 3 67  ? 34.228  -13.766 -0.645  1.00 59.37  ? 67  ARG L CD  1 
ATOM   9540  N NE  . ARG F 3 67  ? 34.185  -13.050 0.629   1.00 56.90  ? 67  ARG L NE  1 
ATOM   9541  C CZ  . ARG F 3 67  ? 34.915  -13.368 1.695   1.00 57.67  ? 67  ARG L CZ  1 
ATOM   9542  N NH1 . ARG F 3 67  ? 35.762  -14.382 1.654   1.00 60.85  ? 67  ARG L NH1 1 
ATOM   9543  N NH2 . ARG F 3 67  ? 34.802  -12.667 2.809   1.00 55.69  ? 67  ARG L NH2 1 
ATOM   9544  N N   . PHE F 3 68  ? 37.786  -11.741 -3.558  1.00 55.23  ? 68  PHE L N   1 
ATOM   9545  C CA  . PHE F 3 68  ? 38.197  -10.354 -3.813  1.00 51.92  ? 68  PHE L CA  1 
ATOM   9546  C C   . PHE F 3 68  ? 39.195  -10.316 -4.979  1.00 53.64  ? 68  PHE L C   1 
ATOM   9547  O O   . PHE F 3 68  ? 40.227  -10.996 -4.947  1.00 56.14  ? 68  PHE L O   1 
ATOM   9548  C CB  . PHE F 3 68  ? 38.901  -9.758  -2.587  1.00 49.50  ? 68  PHE L CB  1 
ATOM   9549  C CG  . PHE F 3 68  ? 37.988  -9.405  -1.436  1.00 47.51  ? 68  PHE L CG  1 
ATOM   9550  C CD1 . PHE F 3 68  ? 37.373  -8.171  -1.371  1.00 44.75  ? 68  PHE L CD1 1 
ATOM   9551  C CD2 . PHE F 3 68  ? 37.797  -10.283 -0.384  1.00 48.84  ? 68  PHE L CD2 1 
ATOM   9552  C CE1 . PHE F 3 68  ? 36.565  -7.839  -0.300  1.00 43.23  ? 68  PHE L CE1 1 
ATOM   9553  C CE2 . PHE F 3 68  ? 36.986  -9.952  0.683   1.00 47.24  ? 68  PHE L CE2 1 
ATOM   9554  C CZ  . PHE F 3 68  ? 36.366  -8.730  0.719   1.00 44.46  ? 68  PHE L CZ  1 
ATOM   9555  N N   . SER F 3 69  ? 38.912  -9.527  -6.009  1.00 52.69  ? 69  SER L N   1 
ATOM   9556  C CA  . SER F 3 69  ? 39.876  -9.371  -7.092  1.00 54.30  ? 69  SER L CA  1 
ATOM   9557  C C   . SER F 3 69  ? 39.795  -7.983  -7.713  1.00 52.56  ? 69  SER L C   1 
ATOM   9558  O O   . SER F 3 69  ? 38.729  -7.360  -7.746  1.00 51.18  ? 69  SER L O   1 
ATOM   9559  C CB  . SER F 3 69  ? 39.692  -10.450 -8.156  1.00 58.23  ? 69  SER L CB  1 
ATOM   9560  O OG  . SER F 3 69  ? 38.812  -10.009 -9.170  1.00 58.56  ? 69  SER L OG  1 
ATOM   9561  N N   . GLY F 3 70  ? 40.930  -7.496  -8.192  1.00 53.14  ? 70  GLY L N   1 
ATOM   9562  C CA  . GLY F 3 70  ? 40.975  -6.190  -8.803  1.00 45.82  ? 70  GLY L CA  1 
ATOM   9563  C C   . GLY F 3 70  ? 41.325  -6.375  -10.250 1.00 52.50  ? 70  GLY L C   1 
ATOM   9564  O O   . GLY F 3 70  ? 41.862  -7.416  -10.634 1.00 55.70  ? 70  GLY L O   1 
ATOM   9565  N N   . SER F 3 71  ? 41.023  -5.367  -11.059 1.00 52.37  ? 71  SER L N   1 
ATOM   9566  C CA  . SER F 3 71  ? 41.290  -5.436  -12.489 1.00 55.92  ? 71  SER L CA  1 
ATOM   9567  C C   . SER F 3 71  ? 41.338  -4.045  -13.084 1.00 52.20  ? 71  SER L C   1 
ATOM   9568  O O   . SER F 3 71  ? 41.178  -3.056  -12.383 1.00 49.17  ? 71  SER L O   1 
ATOM   9569  C CB  . SER F 3 71  ? 40.232  -6.280  -13.211 1.00 55.15  ? 71  SER L CB  1 
ATOM   9570  O OG  . SER F 3 71  ? 38.961  -5.667  -13.157 1.00 53.48  ? 71  SER L OG  1 
ATOM   9571  N N   . GLY F 3 72  ? 41.557  -3.968  -14.388 1.00 59.34  ? 72  GLY L N   1 
ATOM   9572  C CA  . GLY F 3 72  ? 41.596  -2.683  -15.045 1.00 55.97  ? 72  GLY L CA  1 
ATOM   9573  C C   . GLY F 3 72  ? 43.022  -2.266  -15.288 1.00 57.15  ? 72  GLY L C   1 
ATOM   9574  O O   . GLY F 3 72  ? 43.965  -2.960  -14.901 1.00 57.61  ? 72  GLY L O   1 
ATOM   9575  N N   . SER F 3 73  ? 43.171  -1.119  -15.935 1.00 58.03  ? 73  SER L N   1 
ATOM   9576  C CA  . SER F 3 73  ? 44.467  -0.644  -16.355 1.00 59.89  ? 73  SER L CA  1 
ATOM   9577  C C   . SER F 3 73  ? 44.300  0.819   -16.727 1.00 59.84  ? 73  SER L C   1 
ATOM   9578  O O   . SER F 3 73  ? 43.200  1.249   -17.062 1.00 59.89  ? 73  SER L O   1 
ATOM   9579  C CB  . SER F 3 73  ? 44.947  -1.471  -17.548 1.00 68.04  ? 73  SER L CB  1 
ATOM   9580  O OG  . SER F 3 73  ? 46.338  -1.331  -17.759 1.00 70.05  ? 73  SER L OG  1 
ATOM   9581  N N   . GLY F 3 74  ? 45.375  1.591   -16.625 1.00 59.98  ? 74  GLY L N   1 
ATOM   9582  C CA  . GLY F 3 74  ? 45.360  2.962   -17.095 1.00 60.88  ? 74  GLY L CA  1 
ATOM   9583  C C   . GLY F 3 74  ? 44.527  3.957   -16.313 1.00 60.94  ? 74  GLY L C   1 
ATOM   9584  O O   . GLY F 3 74  ? 45.013  4.553   -15.353 1.00 58.56  ? 74  GLY L O   1 
ATOM   9585  N N   . THR F 3 75  ? 43.278  4.150   -16.720 1.00 61.24  ? 75  THR L N   1 
ATOM   9586  C CA  . THR F 3 75  ? 42.441  5.188   -16.122 1.00 59.12  ? 75  THR L CA  1 
ATOM   9587  C C   . THR F 3 75  ? 41.193  4.655   -15.392 1.00 56.61  ? 75  THR L C   1 
ATOM   9588  O O   . THR F 3 75  ? 40.542  5.394   -14.632 1.00 54.61  ? 75  THR L O   1 
ATOM   9589  C CB  . THR F 3 75  ? 42.025  6.250   -17.172 1.00 73.29  ? 75  THR L CB  1 
ATOM   9590  O OG1 . THR F 3 75  ? 41.811  7.512   -16.530 1.00 71.84  ? 75  THR L OG1 1 
ATOM   9591  C CG2 . THR F 3 75  ? 40.759  5.830   -17.925 1.00 75.27  ? 75  THR L CG2 1 
ATOM   9592  N N   . ASP F 3 76  ? 40.874  3.377   -15.617 1.00 56.93  ? 76  ASP L N   1 
ATOM   9593  C CA  . ASP F 3 76  ? 39.707  2.738   -14.998 1.00 54.56  ? 76  ASP L CA  1 
ATOM   9594  C C   . ASP F 3 76  ? 40.006  1.403   -14.329 1.00 52.47  ? 76  ASP L C   1 
ATOM   9595  O O   . ASP F 3 76  ? 40.606  0.505   -14.924 1.00 54.62  ? 76  ASP L O   1 
ATOM   9596  C CB  . ASP F 3 76  ? 38.579  2.556   -16.007 1.00 57.63  ? 76  ASP L CB  1 
ATOM   9597  C CG  . ASP F 3 76  ? 38.127  3.863   -16.600 1.00 59.85  ? 76  ASP L CG  1 
ATOM   9598  O OD1 . ASP F 3 76  ? 37.531  4.677   -15.856 1.00 57.78  ? 76  ASP L OD1 1 
ATOM   9599  O OD2 . ASP F 3 76  ? 38.368  4.068   -17.814 1.00 64.04  ? 76  ASP L OD2 1 
ATOM   9600  N N   . PHE F 3 77  ? 39.548  1.284   -13.087 1.00 48.62  ? 77  PHE L N   1 
ATOM   9601  C CA  . PHE F 3 77  ? 39.850  0.130   -12.265 1.00 46.92  ? 77  PHE L CA  1 
ATOM   9602  C C   . PHE F 3 77  ? 38.603  -0.347  -11.542 1.00 43.94  ? 77  PHE L C   1 
ATOM   9603  O O   . PHE F 3 77  ? 37.710  0.432   -11.246 1.00 42.80  ? 77  PHE L O   1 
ATOM   9604  C CB  . PHE F 3 77  ? 40.973  0.481   -11.272 1.00 43.43  ? 77  PHE L CB  1 
ATOM   9605  C CG  . PHE F 3 77  ? 42.192  1.037   -11.937 1.00 45.22  ? 77  PHE L CG  1 
ATOM   9606  C CD1 . PHE F 3 77  ? 43.236  0.200   -12.311 1.00 48.38  ? 77  PHE L CD1 1 
ATOM   9607  C CD2 . PHE F 3 77  ? 42.277  2.384   -12.236 1.00 45.42  ? 77  PHE L CD2 1 
ATOM   9608  C CE1 . PHE F 3 77  ? 44.345  0.697   -12.944 1.00 49.30  ? 77  PHE L CE1 1 
ATOM   9609  C CE2 . PHE F 3 77  ? 43.382  2.887   -12.882 1.00 47.47  ? 77  PHE L CE2 1 
ATOM   9610  C CZ  . PHE F 3 77  ? 44.420  2.043   -13.232 1.00 49.36  ? 77  PHE L CZ  1 
ATOM   9611  N N   . THR F 3 78  ? 38.569  -1.639  -11.255 1.00 44.20  ? 78  THR L N   1 
ATOM   9612  C CA  . THR F 3 78  ? 37.423  -2.253  -10.631 1.00 43.22  ? 78  THR L CA  1 
ATOM   9613  C C   . THR F 3 78  ? 37.779  -3.192  -9.482  1.00 41.77  ? 78  THR L C   1 
ATOM   9614  O O   . THR F 3 78  ? 38.737  -3.958  -9.553  1.00 42.98  ? 78  THR L O   1 
ATOM   9615  C CB  . THR F 3 78  ? 36.571  -3.007  -11.689 1.00 47.97  ? 78  THR L CB  1 
ATOM   9616  O OG1 . THR F 3 78  ? 35.193  -2.651  -11.518 1.00 47.69  ? 78  THR L OG1 1 
ATOM   9617  C CG2 . THR F 3 78  ? 36.719  -4.530  -11.568 1.00 49.11  ? 78  THR L CG2 1 
ATOM   9618  N N   . LEU F 3 79  ? 36.995  -3.132  -8.419  1.00 39.60  ? 79  LEU L N   1 
ATOM   9619  C CA  . LEU F 3 79  ? 37.117  -4.105  -7.359  1.00 40.33  ? 79  LEU L CA  1 
ATOM   9620  C C   . LEU F 3 79  ? 35.895  -4.968  -7.389  1.00 41.61  ? 79  LEU L C   1 
ATOM   9621  O O   . LEU F 3 79  ? 34.767  -4.474  -7.381  1.00 41.30  ? 79  LEU L O   1 
ATOM   9622  C CB  . LEU F 3 79  ? 37.217  -3.415  -6.006  1.00 37.35  ? 79  LEU L CB  1 
ATOM   9623  C CG  . LEU F 3 79  ? 37.244  -4.333  -4.788  1.00 36.75  ? 79  LEU L CG  1 
ATOM   9624  C CD1 . LEU F 3 79  ? 38.612  -4.935  -4.559  1.00 36.16  ? 79  LEU L CD1 1 
ATOM   9625  C CD2 . LEU F 3 79  ? 36.814  -3.534  -3.607  1.00 34.40  ? 79  LEU L CD2 1 
ATOM   9626  N N   . THR F 3 80  ? 36.105  -6.267  -7.427  1.00 43.56  ? 80  THR L N   1 
ATOM   9627  C CA  . THR F 3 80  ? 34.984  -7.175  -7.615  1.00 45.71  ? 80  THR L CA  1 
ATOM   9628  C C   . THR F 3 80  ? 34.952  -8.116  -6.420  1.00 45.79  ? 80  THR L C   1 
ATOM   9629  O O   . THR F 3 80  ? 35.998  -8.495  -5.920  1.00 46.29  ? 80  THR L O   1 
ATOM   9630  C CB  . THR F 3 80  ? 35.129  -7.936  -8.990  1.00 51.22  ? 80  THR L CB  1 
ATOM   9631  O OG1 . THR F 3 80  ? 34.457  -7.203  -10.022 1.00 48.11  ? 80  THR L OG1 1 
ATOM   9632  C CG2 . THR F 3 80  ? 34.586  -9.357  -8.924  1.00 49.73  ? 80  THR L CG2 1 
ATOM   9633  N N   . ILE F 3 81  ? 33.777  -8.452  -5.913  1.00 45.64  ? 81  ILE L N   1 
ATOM   9634  C CA  . ILE F 3 81  ? 33.697  -9.533  -4.936  1.00 46.43  ? 81  ILE L CA  1 
ATOM   9635  C C   . ILE F 3 81  ? 32.737  -10.552 -5.503  1.00 49.54  ? 81  ILE L C   1 
ATOM   9636  O O   . ILE F 3 81  ? 31.583  -10.216 -5.774  1.00 49.78  ? 81  ILE L O   1 
ATOM   9637  C CB  . ILE F 3 81  ? 33.186  -9.046  -3.582  1.00 44.18  ? 81  ILE L CB  1 
ATOM   9638  C CG1 . ILE F 3 81  ? 34.016  -7.851  -3.092  1.00 41.49  ? 81  ILE L CG1 1 
ATOM   9639  C CG2 . ILE F 3 81  ? 33.202  -10.190 -2.571  1.00 45.49  ? 81  ILE L CG2 1 
ATOM   9640  C CD1 . ILE F 3 81  ? 33.471  -7.196  -1.813  1.00 39.37  ? 81  ILE L CD1 1 
ATOM   9641  N N   . SER F 3 82  ? 33.193  -11.782 -5.725  1.00 52.41  ? 82  SER L N   1 
ATOM   9642  C CA  . SER F 3 82  ? 32.368  -12.737 -6.475  1.00 55.83  ? 82  SER L CA  1 
ATOM   9643  C C   . SER F 3 82  ? 31.130  -13.227 -5.694  1.00 56.92  ? 82  SER L C   1 
ATOM   9644  O O   . SER F 3 82  ? 30.001  -13.210 -6.195  1.00 57.92  ? 82  SER L O   1 
ATOM   9645  C CB  . SER F 3 82  ? 33.210  -13.905 -7.004  1.00 58.96  ? 82  SER L CB  1 
ATOM   9646  O OG  . SER F 3 82  ? 33.933  -14.542 -5.966  1.00 58.99  ? 82  SER L OG  1 
ATOM   9647  N N   . SER F 3 83  ? 31.339  -13.654 -4.460  1.00 57.10  ? 83  SER L N   1 
ATOM   9648  C CA  . SER F 3 83  ? 30.230  -14.074 -3.621  1.00 58.30  ? 83  SER L CA  1 
ATOM   9649  C C   . SER F 3 83  ? 30.327  -13.313 -2.297  1.00 55.86  ? 83  SER L C   1 
ATOM   9650  O O   . SER F 3 83  ? 31.216  -13.587 -1.495  1.00 55.99  ? 83  SER L O   1 
ATOM   9651  C CB  . SER F 3 83  ? 30.255  -15.596 -3.421  1.00 62.12  ? 83  SER L CB  1 
ATOM   9652  O OG  . SER F 3 83  ? 29.640  -15.975 -2.204  1.00 62.35  ? 83  SER L OG  1 
ATOM   9653  N N   . LEU F 3 84  ? 29.436  -12.341 -2.095  1.00 54.18  ? 84  LEU L N   1 
ATOM   9654  C CA  . LEU F 3 84  ? 29.433  -11.523 -0.882  1.00 52.10  ? 84  LEU L CA  1 
ATOM   9655  C C   . LEU F 3 84  ? 29.184  -12.330 0.400   1.00 54.01  ? 84  LEU L C   1 
ATOM   9656  O O   . LEU F 3 84  ? 28.257  -13.153 0.466   1.00 56.71  ? 84  LEU L O   1 
ATOM   9657  C CB  . LEU F 3 84  ? 28.392  -10.407 -0.984  1.00 50.51  ? 84  LEU L CB  1 
ATOM   9658  C CG  . LEU F 3 84  ? 28.435  -9.322  0.088   1.00 41.33  ? 84  LEU L CG  1 
ATOM   9659  C CD1 . LEU F 3 84  ? 29.615  -8.404  -0.153  1.00 41.65  ? 84  LEU L CD1 1 
ATOM   9660  C CD2 . LEU F 3 84  ? 27.185  -8.518  0.089   1.00 41.05  ? 84  LEU L CD2 1 
ATOM   9661  N N   . GLN F 3 85  ? 30.028  -12.097 1.406   1.00 52.94  ? 85  GLN L N   1 
ATOM   9662  C CA  . GLN F 3 85  ? 29.820  -12.638 2.745   1.00 54.28  ? 85  GLN L CA  1 
ATOM   9663  C C   . GLN F 3 85  ? 29.537  -11.481 3.707   1.00 51.18  ? 85  GLN L C   1 
ATOM   9664  O O   . GLN F 3 85  ? 29.721  -10.311 3.369   1.00 48.17  ? 85  GLN L O   1 
ATOM   9665  C CB  . GLN F 3 85  ? 31.036  -13.425 3.247   1.00 56.75  ? 85  GLN L CB  1 
ATOM   9666  C CG  . GLN F 3 85  ? 31.752  -14.273 2.223   1.00 59.95  ? 85  GLN L CG  1 
ATOM   9667  C CD  . GLN F 3 85  ? 30.938  -15.458 1.768   1.00 64.46  ? 85  GLN L CD  1 
ATOM   9668  O OE1 . GLN F 3 85  ? 29.962  -15.832 2.421   1.00 66.07  ? 85  GLN L OE1 1 
ATOM   9669  N NE2 . GLN F 3 85  ? 31.328  -16.060 0.633   1.00 66.78  ? 85  GLN L NE2 1 
ATOM   9670  N N   . ALA F 3 86  ? 29.115  -11.831 4.916   1.00 52.54  ? 86  ALA L N   1 
ATOM   9671  C CA  . ALA F 3 86  ? 28.592  -10.878 5.866   1.00 51.51  ? 86  ALA L CA  1 
ATOM   9672  C C   . ALA F 3 86  ? 29.623  -9.859  6.250   1.00 49.47  ? 86  ALA L C   1 
ATOM   9673  O O   . ALA F 3 86  ? 29.293  -8.689  6.427   1.00 47.72  ? 86  ALA L O   1 
ATOM   9674  C CB  . ALA F 3 86  ? 28.118  -11.595 7.082   1.00 46.11  ? 86  ALA L CB  1 
ATOM   9675  N N   . GLU F 3 87  ? 30.869  -10.305 6.381   1.00 49.90  ? 87  GLU L N   1 
ATOM   9676  C CA  . GLU F 3 87  ? 31.944  -9.463  6.905   1.00 48.21  ? 87  GLU L CA  1 
ATOM   9677  C C   . GLU F 3 87  ? 32.648  -8.642  5.823   1.00 45.94  ? 87  GLU L C   1 
ATOM   9678  O O   . GLU F 3 87  ? 33.656  -7.966  6.073   1.00 44.63  ? 87  GLU L O   1 
ATOM   9679  C CB  . GLU F 3 87  ? 32.954  -10.296 7.696   1.00 50.44  ? 87  GLU L CB  1 
ATOM   9680  C CG  . GLU F 3 87  ? 33.837  -11.189 6.860   1.00 52.00  ? 87  GLU L CG  1 
ATOM   9681  C CD  . GLU F 3 87  ? 33.092  -12.374 6.247   1.00 54.91  ? 87  GLU L CD  1 
ATOM   9682  O OE1 . GLU F 3 87  ? 31.972  -12.734 6.728   1.00 56.13  ? 87  GLU L OE1 1 
ATOM   9683  O OE2 . GLU F 3 87  ? 33.639  -12.953 5.268   1.00 56.27  ? 87  GLU L OE2 1 
ATOM   9684  N N   . ASP F 3 88  ? 32.094  -8.693  4.621   1.00 45.76  ? 88  ASP L N   1 
ATOM   9685  C CA  . ASP F 3 88  ? 32.582  -7.895  3.533   1.00 43.82  ? 88  ASP L CA  1 
ATOM   9686  C C   . ASP F 3 88  ? 32.037  -6.486  3.635   1.00 41.24  ? 88  ASP L C   1 
ATOM   9687  O O   . ASP F 3 88  ? 32.490  -5.607  2.920   1.00 40.30  ? 88  ASP L O   1 
ATOM   9688  C CB  . ASP F 3 88  ? 32.164  -8.523  2.214   1.00 45.72  ? 88  ASP L CB  1 
ATOM   9689  C CG  . ASP F 3 88  ? 32.798  -9.893  1.986   1.00 48.72  ? 88  ASP L CG  1 
ATOM   9690  O OD1 . ASP F 3 88  ? 33.700  -10.254 2.770   1.00 49.32  ? 88  ASP L OD1 1 
ATOM   9691  O OD2 . ASP F 3 88  ? 32.417  -10.604 1.015   1.00 50.71  ? 88  ASP L OD2 1 
ATOM   9692  N N   . VAL F 3 89  ? 31.064  -6.255  4.515   1.00 40.53  ? 89  VAL L N   1 
ATOM   9693  C CA  . VAL F 3 89  ? 30.461  -4.921  4.639   1.00 38.15  ? 89  VAL L CA  1 
ATOM   9694  C C   . VAL F 3 89  ? 31.430  -3.902  5.214   1.00 35.68  ? 89  VAL L C   1 
ATOM   9695  O O   . VAL F 3 89  ? 31.934  -4.034  6.331   1.00 35.99  ? 89  VAL L O   1 
ATOM   9696  C CB  . VAL F 3 89  ? 29.157  -4.921  5.438   1.00 39.03  ? 89  VAL L CB  1 
ATOM   9697  C CG1 . VAL F 3 89  ? 28.193  -5.865  4.805   1.00 40.88  ? 89  VAL L CG1 1 
ATOM   9698  C CG2 . VAL F 3 89  ? 29.398  -5.317  6.869   1.00 39.69  ? 89  VAL L CG2 1 
ATOM   9699  N N   . ALA F 3 90  ? 31.699  -2.877  4.430   1.00 33.53  ? 90  ALA L N   1 
ATOM   9700  C CA  . ALA F 3 90  ? 32.746  -1.945  4.776   1.00 31.63  ? 90  ALA L CA  1 
ATOM   9701  C C   . ALA F 3 90  ? 32.604  -0.760  3.856   1.00 29.92  ? 90  ALA L C   1 
ATOM   9702  O O   . ALA F 3 90  ? 31.750  -0.763  2.970   1.00 28.73  ? 90  ALA L O   1 
ATOM   9703  C CB  . ALA F 3 90  ? 34.105  -2.597  4.588   1.00 28.16  ? 90  ALA L CB  1 
ATOM   9704  N N   . VAL F 3 91  ? 33.419  0.264   4.087   1.00 29.31  ? 91  VAL L N   1 
ATOM   9705  C CA  . VAL F 3 91  ? 33.649  1.280   3.079   1.00 28.87  ? 91  VAL L CA  1 
ATOM   9706  C C   . VAL F 3 91  ? 34.939  0.888   2.378   1.00 28.83  ? 91  VAL L C   1 
ATOM   9707  O O   . VAL F 3 91  ? 35.901  0.453   3.020   1.00 29.02  ? 91  VAL L O   1 
ATOM   9708  C CB  . VAL F 3 91  ? 33.779  2.681   3.675   1.00 28.33  ? 91  VAL L CB  1 
ATOM   9709  C CG1 . VAL F 3 91  ? 34.059  3.699   2.586   1.00 25.62  ? 91  VAL L CG1 1 
ATOM   9710  C CG2 . VAL F 3 91  ? 32.536  3.025   4.429   1.00 26.35  ? 91  VAL L CG2 1 
ATOM   9711  N N   . TYR F 3 92  ? 34.935  0.995   1.056   1.00 29.02  ? 92  TYR L N   1 
ATOM   9712  C CA  . TYR F 3 92  ? 36.094  0.655   0.253   1.00 29.10  ? 92  TYR L CA  1 
ATOM   9713  C C   . TYR F 3 92  ? 36.679  1.920   -0.333  1.00 28.99  ? 92  TYR L C   1 
ATOM   9714  O O   . TYR F 3 92  ? 35.950  2.760   -0.881  1.00 29.84  ? 92  TYR L O   1 
ATOM   9715  C CB  . TYR F 3 92  ? 35.703  -0.339  -0.848  1.00 30.30  ? 92  TYR L CB  1 
ATOM   9716  C CG  . TYR F 3 92  ? 35.370  -1.672  -0.261  1.00 28.32  ? 92  TYR L CG  1 
ATOM   9717  C CD1 . TYR F 3 92  ? 34.103  -1.935  0.227   1.00 28.59  ? 92  TYR L CD1 1 
ATOM   9718  C CD2 . TYR F 3 92  ? 36.344  -2.647  -0.124  1.00 29.00  ? 92  TYR L CD2 1 
ATOM   9719  C CE1 . TYR F 3 92  ? 33.807  -3.143  0.816   1.00 29.48  ? 92  TYR L CE1 1 
ATOM   9720  C CE2 . TYR F 3 92  ? 36.058  -3.859  0.458   1.00 30.02  ? 92  TYR L CE2 1 
ATOM   9721  C CZ  . TYR F 3 92  ? 34.786  -4.096  0.924   1.00 30.21  ? 92  TYR L CZ  1 
ATOM   9722  O OH  . TYR F 3 92  ? 34.493  -5.297  1.496   1.00 31.58  ? 92  TYR L OH  1 
ATOM   9723  N N   . TYR F 3 93  ? 37.987  2.070   -0.202  1.00 28.29  ? 93  TYR L N   1 
ATOM   9724  C CA  . TYR F 3 93  ? 38.670  3.163   -0.857  1.00 28.28  ? 93  TYR L CA  1 
ATOM   9725  C C   . TYR F 3 93  ? 39.646  2.628   -1.899  1.00 29.39  ? 93  TYR L C   1 
ATOM   9726  O O   . TYR F 3 93  ? 40.291  1.584   -1.709  1.00 30.02  ? 93  TYR L O   1 
ATOM   9727  C CB  . TYR F 3 93  ? 39.446  3.992   0.167   1.00 27.58  ? 93  TYR L CB  1 
ATOM   9728  C CG  . TYR F 3 93  ? 38.578  4.673   1.167   1.00 27.13  ? 93  TYR L CG  1 
ATOM   9729  C CD1 . TYR F 3 93  ? 38.062  5.939   0.918   1.00 27.53  ? 93  TYR L CD1 1 
ATOM   9730  C CD2 . TYR F 3 93  ? 38.252  4.051   2.365   1.00 26.60  ? 93  TYR L CD2 1 
ATOM   9731  C CE1 . TYR F 3 93  ? 37.248  6.561   1.836   1.00 27.41  ? 93  TYR L CE1 1 
ATOM   9732  C CE2 . TYR F 3 93  ? 37.428  4.666   3.283   1.00 26.32  ? 93  TYR L CE2 1 
ATOM   9733  C CZ  . TYR F 3 93  ? 36.933  5.914   3.012   1.00 26.78  ? 93  TYR L CZ  1 
ATOM   9734  O OH  . TYR F 3 93  ? 36.122  6.523   3.934   1.00 27.28  ? 93  TYR L OH  1 
ATOM   9735  N N   . CYS F 3 94  ? 39.762  3.351   -3.003  1.00 30.02  ? 94  CYS L N   1 
ATOM   9736  C CA  . CYS F 3 94  ? 40.908  3.185   -3.888  1.00 30.83  ? 94  CYS L CA  1 
ATOM   9737  C C   . CYS F 3 94  ? 41.861  4.348   -3.633  1.00 30.64  ? 94  CYS L C   1 
ATOM   9738  O O   . CYS F 3 94  ? 41.482  5.405   -3.090  1.00 29.91  ? 94  CYS L O   1 
ATOM   9739  C CB  . CYS F 3 94  ? 40.485  3.153   -5.352  1.00 32.26  ? 94  CYS L CB  1 
ATOM   9740  S SG  . CYS F 3 94  ? 39.615  4.638   -5.902  1.00 37.16  ? 94  CYS L SG  1 
ATOM   9741  N N   . GLN F 3 95  ? 43.111  4.162   -4.014  1.00 31.60  ? 95  GLN L N   1 
ATOM   9742  C CA  . GLN F 3 95  ? 44.061  5.226   -3.802  1.00 31.68  ? 95  GLN L CA  1 
ATOM   9743  C C   . GLN F 3 95  ? 45.091  5.276   -4.908  1.00 33.72  ? 95  GLN L C   1 
ATOM   9744  O O   . GLN F 3 95  ? 45.665  4.263   -5.309  1.00 34.94  ? 95  GLN L O   1 
ATOM   9745  C CB  . GLN F 3 95  ? 44.721  5.082   -2.440  1.00 30.67  ? 95  GLN L CB  1 
ATOM   9746  C CG  . GLN F 3 95  ? 45.636  6.210   -2.118  1.00 31.27  ? 95  GLN L CG  1 
ATOM   9747  C CD  . GLN F 3 95  ? 46.872  5.772   -1.345  1.00 31.87  ? 95  GLN L CD  1 
ATOM   9748  O OE1 . GLN F 3 95  ? 47.044  4.598   -1.004  1.00 31.97  ? 95  GLN L OE1 1 
ATOM   9749  N NE2 . GLN F 3 95  ? 47.745  6.721   -1.078  1.00 32.61  ? 95  GLN L NE2 1 
ATOM   9750  N N   . ASN F 3 96  ? 45.284  6.473   -5.428  1.00 34.61  ? 96  ASN L N   1 
ATOM   9751  C CA  . ASN F 3 96  ? 46.355  6.734   -6.361  1.00 37.08  ? 96  ASN L CA  1 
ATOM   9752  C C   . ASN F 3 96  ? 47.723  6.519   -5.699  1.00 36.08  ? 96  ASN L C   1 
ATOM   9753  O O   . ASN F 3 96  ? 48.112  7.255   -4.793  1.00 38.31  ? 96  ASN L O   1 
ATOM   9754  C CB  . ASN F 3 96  ? 46.188  8.161   -6.873  1.00 38.37  ? 96  ASN L CB  1 
ATOM   9755  C CG  . ASN F 3 96  ? 47.473  8.780   -7.356  1.00 39.17  ? 96  ASN L CG  1 
ATOM   9756  O OD1 . ASN F 3 96  ? 48.307  8.133   -7.992  1.00 40.84  ? 96  ASN L OD1 1 
ATOM   9757  N ND2 . ASN F 3 96  ? 47.632  10.064  -7.068  1.00 39.54  ? 96  ASN L ND2 1 
ATOM   9758  N N   . ASP F 3 97  ? 48.436  5.492   -6.140  1.00 37.52  ? 97  ASP L N   1 
ATOM   9759  C CA  . ASP F 3 97  ? 49.776  5.263   -5.654  1.00 38.46  ? 97  ASP L CA  1 
ATOM   9760  C C   . ASP F 3 97  ? 50.800  5.720   -6.666  1.00 41.34  ? 97  ASP L C   1 
ATOM   9761  O O   . ASP F 3 97  ? 51.979  5.418   -6.528  1.00 42.94  ? 97  ASP L O   1 
ATOM   9762  C CB  . ASP F 3 97  ? 50.036  3.803   -5.338  1.00 38.83  ? 97  ASP L CB  1 
ATOM   9763  C CG  . ASP F 3 97  ? 51.265  3.633   -4.481  1.00 43.05  ? 97  ASP L CG  1 
ATOM   9764  O OD1 . ASP F 3 97  ? 52.168  2.845   -4.837  1.00 45.42  ? 97  ASP L OD1 1 
ATOM   9765  O OD2 . ASP F 3 97  ? 51.341  4.344   -3.457  1.00 41.69  ? 97  ASP L OD2 1 
ATOM   9766  N N   . TYR F 3 98  ? 50.372  6.454   -7.683  1.00 42.42  ? 98  TYR L N   1 
ATOM   9767  C CA  . TYR F 3 98  ? 51.304  6.831   -8.734  1.00 47.30  ? 98  TYR L CA  1 
ATOM   9768  C C   . TYR F 3 98  ? 52.029  8.126   -8.394  1.00 47.30  ? 98  TYR L C   1 
ATOM   9769  O O   . TYR F 3 98  ? 53.214  8.283   -8.709  1.00 48.66  ? 98  TYR L O   1 
ATOM   9770  C CB  . TYR F 3 98  ? 50.583  6.941   -10.092 1.00 49.30  ? 98  TYR L CB  1 
ATOM   9771  C CG  . TYR F 3 98  ? 51.508  7.067   -11.292 1.00 51.42  ? 98  TYR L CG  1 
ATOM   9772  C CD1 . TYR F 3 98  ? 51.905  8.312   -11.773 1.00 53.34  ? 98  TYR L CD1 1 
ATOM   9773  C CD2 . TYR F 3 98  ? 51.976  5.938   -11.944 1.00 53.69  ? 98  TYR L CD2 1 
ATOM   9774  C CE1 . TYR F 3 98  ? 52.750  8.424   -12.865 1.00 57.35  ? 98  TYR L CE1 1 
ATOM   9775  C CE2 . TYR F 3 98  ? 52.813  6.037   -13.042 1.00 58.74  ? 98  TYR L CE2 1 
ATOM   9776  C CZ  . TYR F 3 98  ? 53.199  7.277   -13.499 1.00 59.53  ? 98  TYR L CZ  1 
ATOM   9777  O OH  . TYR F 3 98  ? 54.032  7.354   -14.589 1.00 63.92  ? 98  TYR L OH  1 
ATOM   9778  N N   . SER F 3 99  ? 51.313  9.044   -7.747  1.00 44.25  ? 99  SER L N   1 
ATOM   9779  C CA  . SER F 3 99  ? 51.824  10.392  -7.565  1.00 45.24  ? 99  SER L CA  1 
ATOM   9780  C C   . SER F 3 99  ? 51.535  11.025  -6.211  1.00 42.94  ? 99  SER L C   1 
ATOM   9781  O O   . SER F 3 99  ? 50.473  10.838  -5.650  1.00 40.62  ? 99  SER L O   1 
ATOM   9782  C CB  . SER F 3 99  ? 51.275  11.305  -8.661  1.00 47.18  ? 99  SER L CB  1 
ATOM   9783  O OG  . SER F 3 99  ? 51.825  12.610  -8.575  1.00 48.80  ? 99  SER L OG  1 
ATOM   9784  N N   . TYR F 3 100 ? 52.502  11.781  -5.704  1.00 43.97  ? 100 TYR L N   1 
ATOM   9785  C CA  . TYR F 3 100 ? 52.237  12.792  -4.701  1.00 44.69  ? 100 TYR L CA  1 
ATOM   9786  C C   . TYR F 3 100 ? 51.012  13.603  -5.119  1.00 44.60  ? 100 TYR L C   1 
ATOM   9787  O O   . TYR F 3 100 ? 50.887  13.922  -6.295  1.00 46.38  ? 100 TYR L O   1 
ATOM   9788  C CB  . TYR F 3 100 ? 53.445  13.721  -4.610  1.00 47.20  ? 100 TYR L CB  1 
ATOM   9789  C CG  . TYR F 3 100 ? 53.233  14.956  -3.764  1.00 47.90  ? 100 TYR L CG  1 
ATOM   9790  C CD1 . TYR F 3 100 ? 53.833  15.075  -2.513  1.00 48.08  ? 100 TYR L CD1 1 
ATOM   9791  C CD2 . TYR F 3 100 ? 52.459  16.026  -4.225  1.00 49.23  ? 100 TYR L CD2 1 
ATOM   9792  C CE1 . TYR F 3 100 ? 53.646  16.218  -1.737  1.00 48.91  ? 100 TYR L CE1 1 
ATOM   9793  C CE2 . TYR F 3 100 ? 52.250  17.158  -3.463  1.00 50.10  ? 100 TYR L CE2 1 
ATOM   9794  C CZ  . TYR F 3 100 ? 52.849  17.257  -2.223  1.00 50.08  ? 100 TYR L CZ  1 
ATOM   9795  O OH  . TYR F 3 100 ? 52.646  18.394  -1.467  1.00 51.40  ? 100 TYR L OH  1 
ATOM   9796  N N   . PRO F 3 101 ? 50.104  13.952  -4.172  1.00 42.85  ? 101 PRO L N   1 
ATOM   9797  C CA  . PRO F 3 101 ? 49.924  13.440  -2.810  1.00 40.44  ? 101 PRO L CA  1 
ATOM   9798  C C   . PRO F 3 101 ? 48.988  12.288  -3.007  1.00 39.10  ? 101 PRO L C   1 
ATOM   9799  O O   . PRO F 3 101 ? 48.140  12.353  -3.873  1.00 40.25  ? 101 PRO L O   1 
ATOM   9800  C CB  . PRO F 3 101 ? 49.220  14.580  -2.100  1.00 40.11  ? 101 PRO L CB  1 
ATOM   9801  C CG  . PRO F 3 101 ? 48.448  15.257  -3.155  1.00 39.94  ? 101 PRO L CG  1 
ATOM   9802  C CD  . PRO F 3 101 ? 49.203  15.090  -4.444  1.00 41.97  ? 101 PRO L CD  1 
ATOM   9803  N N   . TYR F 3 102 ? 49.123  11.219  -2.268  1.00 37.31  ? 102 TYR L N   1 
ATOM   9804  C CA  . TYR F 3 102 ? 48.678  9.962   -2.833  1.00 36.52  ? 102 TYR L CA  1 
ATOM   9805  C C   . TYR F 3 102 ? 47.160  9.817   -2.661  1.00 34.79  ? 102 TYR L C   1 
ATOM   9806  O O   . TYR F 3 102 ? 46.680  9.115   -1.776  1.00 33.39  ? 102 TYR L O   1 
ATOM   9807  C CB  . TYR F 3 102 ? 49.552  8.840   -2.279  1.00 34.28  ? 102 TYR L CB  1 
ATOM   9808  C CG  . TYR F 3 102 ? 51.032  9.187   -2.458  1.00 39.39  ? 102 TYR L CG  1 
ATOM   9809  C CD1 . TYR F 3 102 ? 51.626  10.208  -1.715  1.00 36.91  ? 102 TYR L CD1 1 
ATOM   9810  C CD2 . TYR F 3 102 ? 51.824  8.509   -3.372  1.00 38.31  ? 102 TYR L CD2 1 
ATOM   9811  C CE1 . TYR F 3 102 ? 52.922  10.547  -1.880  1.00 39.08  ? 102 TYR L CE1 1 
ATOM   9812  C CE2 . TYR F 3 102 ? 53.164  8.842   -3.540  1.00 40.61  ? 102 TYR L CE2 1 
ATOM   9813  C CZ  . TYR F 3 102 ? 53.708  9.869   -2.791  1.00 40.94  ? 102 TYR L CZ  1 
ATOM   9814  O OH  . TYR F 3 102 ? 55.038  10.238  -2.936  1.00 43.49  ? 102 TYR L OH  1 
ATOM   9815  N N   . THR F 3 103 ? 46.429  10.525  -3.533  1.00 35.12  ? 103 THR L N   1 
ATOM   9816  C CA  . THR F 3 103 ? 45.012  10.857  -3.337  1.00 33.88  ? 103 THR L CA  1 
ATOM   9817  C C   . THR F 3 103 ? 44.082  9.652   -3.288  1.00 32.93  ? 103 THR L C   1 
ATOM   9818  O O   . THR F 3 103 ? 44.272  8.670   -4.009  1.00 33.73  ? 103 THR L O   1 
ATOM   9819  C CB  . THR F 3 103 ? 44.500  11.820  -4.413  1.00 35.49  ? 103 THR L CB  1 
ATOM   9820  O OG1 . THR F 3 103 ? 45.210  11.559  -5.616  1.00 37.57  ? 103 THR L OG1 1 
ATOM   9821  C CG2 . THR F 3 103 ? 44.771  13.245  -4.047  1.00 36.27  ? 103 THR L CG2 1 
ATOM   9822  N N   . PHE F 3 104 ? 43.074  9.747   -2.423  1.00 31.57  ? 104 PHE L N   1 
ATOM   9823  C CA  . PHE F 3 104 ? 42.098  8.695   -2.214  1.00 30.18  ? 104 PHE L CA  1 
ATOM   9824  C C   . PHE F 3 104 ? 40.785  9.013   -2.934  1.00 30.78  ? 104 PHE L C   1 
ATOM   9825  O O   . PHE F 3 104 ? 40.414  10.178  -3.127  1.00 31.04  ? 104 PHE L O   1 
ATOM   9826  C CB  . PHE F 3 104 ? 41.805  8.575   -0.714  1.00 28.82  ? 104 PHE L CB  1 
ATOM   9827  C CG  . PHE F 3 104 ? 42.899  7.932   0.093   1.00 28.41  ? 104 PHE L CG  1 
ATOM   9828  C CD1 . PHE F 3 104 ? 42.820  6.591   0.444   1.00 27.79  ? 104 PHE L CD1 1 
ATOM   9829  C CD2 . PHE F 3 104 ? 43.985  8.674   0.547   1.00 29.03  ? 104 PHE L CD2 1 
ATOM   9830  C CE1 . PHE F 3 104 ? 43.826  5.993   1.217   1.00 27.83  ? 104 PHE L CE1 1 
ATOM   9831  C CE2 . PHE F 3 104 ? 44.997  8.078   1.310   1.00 28.89  ? 104 PHE L CE2 1 
ATOM   9832  C CZ  . PHE F 3 104 ? 44.915  6.740   1.646   1.00 28.23  ? 104 PHE L CZ  1 
ATOM   9833  N N   . GLY F 3 105 ? 40.067  7.968   -3.319  1.00 30.43  ? 105 GLY L N   1 
ATOM   9834  C CA  . GLY F 3 105 ? 38.695  8.142   -3.768  1.00 30.97  ? 105 GLY L CA  1 
ATOM   9835  C C   . GLY F 3 105 ? 37.839  8.386   -2.542  1.00 29.33  ? 105 GLY L C   1 
ATOM   9836  O O   . GLY F 3 105 ? 38.240  8.043   -1.441  1.00 28.17  ? 105 GLY L O   1 
ATOM   9837  N N   . GLN F 3 106 ? 36.673  8.983   -2.728  1.00 30.46  ? 106 GLN L N   1 
ATOM   9838  C CA  . GLN F 3 106 ? 35.788  9.357   -1.642  1.00 30.16  ? 106 GLN L CA  1 
ATOM   9839  C C   . GLN F 3 106 ? 35.228  8.145   -0.893  1.00 28.77  ? 106 GLN L C   1 
ATOM   9840  O O   . GLN F 3 106 ? 34.708  8.273   0.212   1.00 28.39  ? 106 GLN L O   1 
ATOM   9841  C CB  . GLN F 3 106 ? 34.636  10.193  -2.194  1.00 32.38  ? 106 GLN L CB  1 
ATOM   9842  C CG  . GLN F 3 106 ? 33.505  9.352   -2.847  1.00 34.88  ? 106 GLN L CG  1 
ATOM   9843  C CD  . GLN F 3 106 ? 33.663  9.075   -4.367  1.00 41.40  ? 106 GLN L CD  1 
ATOM   9844  O OE1 . GLN F 3 106 ? 34.747  9.238   -4.959  1.00 41.42  ? 106 GLN L OE1 1 
ATOM   9845  N NE2 . GLN F 3 106 ? 32.553  8.656   -4.998  1.00 42.82  ? 106 GLN L NE2 1 
ATOM   9846  N N   . GLY F 3 107 ? 35.323  6.966   -1.480  1.00 28.40  ? 107 GLY L N   1 
ATOM   9847  C CA  . GLY F 3 107 ? 34.861  5.776   -0.802  1.00 27.47  ? 107 GLY L CA  1 
ATOM   9848  C C   . GLY F 3 107 ? 33.486  5.293   -1.230  1.00 32.82  ? 107 GLY L C   1 
ATOM   9849  O O   . GLY F 3 107 ? 32.585  6.097   -1.537  1.00 34.16  ? 107 GLY L O   1 
ATOM   9850  N N   . THR F 3 108 ? 33.329  3.968   -1.247  1.00 28.23  ? 108 THR L N   1 
ATOM   9851  C CA  . THR F 3 108 ? 32.058  3.324   -1.562  1.00 29.34  ? 108 THR L CA  1 
ATOM   9852  C C   . THR F 3 108 ? 31.576  2.481   -0.394  1.00 28.75  ? 108 THR L C   1 
ATOM   9853  O O   . THR F 3 108 ? 32.223  1.532   0.014   1.00 28.05  ? 108 THR L O   1 
ATOM   9854  C CB  . THR F 3 108 ? 32.190  2.441   -2.809  1.00 30.39  ? 108 THR L CB  1 
ATOM   9855  O OG1 . THR F 3 108 ? 32.559  3.265   -3.914  1.00 36.32  ? 108 THR L OG1 1 
ATOM   9856  C CG2 . THR F 3 108 ? 30.878  1.732   -3.144  1.00 31.86  ? 108 THR L CG2 1 
ATOM   9857  N N   . LYS F 3 109 ? 30.424  2.826   0.144   1.00 29.47  ? 109 LYS L N   1 
ATOM   9858  C CA  . LYS F 3 109 ? 29.859  2.051   1.233   1.00 31.66  ? 109 LYS L CA  1 
ATOM   9859  C C   . LYS F 3 109 ? 29.070  0.835   0.713   1.00 32.73  ? 109 LYS L C   1 
ATOM   9860  O O   . LYS F 3 109 ? 28.042  0.981   0.069   1.00 34.30  ? 109 LYS L O   1 
ATOM   9861  C CB  . LYS F 3 109 ? 28.971  2.940   2.095   1.00 30.12  ? 109 LYS L CB  1 
ATOM   9862  C CG  . LYS F 3 109 ? 29.122  2.721   3.563   1.00 29.58  ? 109 LYS L CG  1 
ATOM   9863  C CD  . LYS F 3 109 ? 27.762  2.806   4.242   1.00 32.24  ? 109 LYS L CD  1 
ATOM   9864  C CE  . LYS F 3 109 ? 27.855  3.293   5.688   1.00 31.31  ? 109 LYS L CE  1 
ATOM   9865  N NZ  . LYS F 3 109 ? 26.495  3.503   6.271   1.00 33.42  ? 109 LYS L NZ  1 
ATOM   9866  N N   . LEU F 3 110 ? 29.574  -0.359  1.003   1.00 32.26  ? 110 LEU L N   1 
ATOM   9867  C CA  . LEU F 3 110 ? 28.913  -1.609  0.645   1.00 34.02  ? 110 LEU L CA  1 
ATOM   9868  C C   . LEU F 3 110 ? 28.115  -2.199  1.830   1.00 35.44  ? 110 LEU L C   1 
ATOM   9869  O O   . LEU F 3 110 ? 28.692  -2.481  2.902   1.00 35.10  ? 110 LEU L O   1 
ATOM   9870  C CB  . LEU F 3 110 ? 29.978  -2.607  0.179   1.00 33.59  ? 110 LEU L CB  1 
ATOM   9871  C CG  . LEU F 3 110 ? 29.531  -4.011  -0.194  1.00 35.00  ? 110 LEU L CG  1 
ATOM   9872  C CD1 . LEU F 3 110 ? 28.551  -3.949  -1.370  1.00 36.64  ? 110 LEU L CD1 1 
ATOM   9873  C CD2 . LEU F 3 110 ? 30.727  -4.891  -0.498  1.00 34.98  ? 110 LEU L CD2 1 
ATOM   9874  N N   . GLU F 3 111 ? 26.806  -2.379  1.642   1.00 37.26  ? 111 GLU L N   1 
ATOM   9875  C CA  . GLU F 3 111 ? 25.929  -2.909  2.681   1.00 38.70  ? 111 GLU L CA  1 
ATOM   9876  C C   . GLU F 3 111 ? 25.162  -4.108  2.157   1.00 40.00  ? 111 GLU L C   1 
ATOM   9877  O O   . GLU F 3 111 ? 25.161  -4.361  0.969   1.00 40.35  ? 111 GLU L O   1 
ATOM   9878  C CB  . GLU F 3 111 ? 24.939  -1.847  3.146   1.00 40.79  ? 111 GLU L CB  1 
ATOM   9879  C CG  . GLU F 3 111 ? 25.506  -0.826  4.122   1.00 40.83  ? 111 GLU L CG  1 
ATOM   9880  C CD  . GLU F 3 111 ? 24.735  0.500   4.104   1.00 43.04  ? 111 GLU L CD  1 
ATOM   9881  O OE1 . GLU F 3 111 ? 24.649  1.187   5.156   1.00 43.45  ? 111 GLU L OE1 1 
ATOM   9882  O OE2 . GLU F 3 111 ? 24.216  0.861   3.018   1.00 44.64  ? 111 GLU L OE2 1 
ATOM   9883  N N   . ILE F 3 112 ? 24.509  -4.845  3.043   1.00 41.23  ? 112 ILE L N   1 
ATOM   9884  C CA  . ILE F 3 112 ? 23.796  -6.039  2.634   1.00 40.92  ? 112 ILE L CA  1 
ATOM   9885  C C   . ILE F 3 112 ? 22.402  -5.690  2.140   1.00 42.85  ? 112 ILE L C   1 
ATOM   9886  O O   . ILE F 3 112 ? 21.711  -4.880  2.740   1.00 43.18  ? 112 ILE L O   1 
ATOM   9887  C CB  . ILE F 3 112 ? 23.669  -7.024  3.775   1.00 42.14  ? 112 ILE L CB  1 
ATOM   9888  C CG1 . ILE F 3 112 ? 25.041  -7.509  4.208   1.00 40.94  ? 112 ILE L CG1 1 
ATOM   9889  C CG2 . ILE F 3 112 ? 22.884  -8.213  3.341   1.00 44.88  ? 112 ILE L CG2 1 
ATOM   9890  C CD1 . ILE F 3 112 ? 24.970  -8.475  5.363   1.00 42.62  ? 112 ILE L CD1 1 
ATOM   9891  N N   . LYS F 3 113 ? 22.004  -6.287  1.023   1.00 44.51  ? 113 LYS L N   1 
ATOM   9892  C CA  . LYS F 3 113 ? 20.657  -6.114  0.498   1.00 46.97  ? 113 LYS L CA  1 
ATOM   9893  C C   . LYS F 3 113 ? 19.739  -7.205  1.016   1.00 49.59  ? 113 LYS L C   1 
ATOM   9894  O O   . LYS F 3 113 ? 20.096  -8.385  1.060   1.00 50.30  ? 113 LYS L O   1 
ATOM   9895  C CB  . LYS F 3 113 ? 20.649  -6.139  -1.026  1.00 47.97  ? 113 LYS L CB  1 
ATOM   9896  C CG  . LYS F 3 113 ? 19.553  -5.301  -1.634  1.00 49.88  ? 113 LYS L CG  1 
ATOM   9897  C CD  . LYS F 3 113 ? 19.411  -5.557  -3.118  1.00 51.78  ? 113 LYS L CD  1 
ATOM   9898  C CE  . LYS F 3 113 ? 18.490  -6.744  -3.372  1.00 56.26  ? 113 LYS L CE  1 
ATOM   9899  N NZ  . LYS F 3 113 ? 17.825  -6.661  -4.709  1.00 59.28  ? 113 LYS L NZ  1 
ATOM   9900  N N   . ARG F 3 114 ? 18.548  -6.790  1.413   1.00 34.67  ? 114 ARG L N   1 
ATOM   9901  C CA  . ARG F 3 114 ? 17.558  -7.703  1.918   1.00 36.88  ? 114 ARG L CA  1 
ATOM   9902  C C   . ARG F 3 114 ? 16.187  -7.275  1.421   1.00 37.51  ? 114 ARG L C   1 
ATOM   9903  O O   . ARG F 3 114 ? 16.059  -6.345  0.626   1.00 37.22  ? 114 ARG L O   1 
ATOM   9904  C CB  . ARG F 3 114 ? 17.594  -7.725  3.435   1.00 33.67  ? 114 ARG L CB  1 
ATOM   9905  C CG  . ARG F 3 114 ? 17.354  -6.396  4.066   1.00 31.37  ? 114 ARG L CG  1 
ATOM   9906  C CD  . ARG F 3 114 ? 16.720  -6.600  5.415   1.00 34.05  ? 114 ARG L CD  1 
ATOM   9907  N NE  . ARG F 3 114 ? 15.349  -7.094  5.298   1.00 34.34  ? 114 ARG L NE  1 
ATOM   9908  C CZ  . ARG F 3 114 ? 14.709  -7.789  6.238   1.00 32.48  ? 114 ARG L CZ  1 
ATOM   9909  N NH1 . ARG F 3 114 ? 15.313  -8.104  7.379   1.00 32.28  ? 114 ARG L NH1 1 
ATOM   9910  N NH2 . ARG F 3 114 ? 13.461  -8.187  6.022   1.00 35.40  ? 114 ARG L NH2 1 
ATOM   9911  N N   . THR F 3 115 ? 15.155  -7.967  1.875   1.00 39.07  ? 115 THR L N   1 
ATOM   9912  C CA  . THR F 3 115 ? 13.814  -7.681  1.396   1.00 40.79  ? 115 THR L CA  1 
ATOM   9913  C C   . THR F 3 115 ? 13.262  -6.476  2.121   1.00 38.66  ? 115 THR L C   1 
ATOM   9914  O O   . THR F 3 115 ? 13.690  -6.169  3.223   1.00 36.64  ? 115 THR L O   1 
ATOM   9915  C CB  . THR F 3 115 ? 12.895  -8.875  1.592   1.00 43.54  ? 115 THR L CB  1 
ATOM   9916  O OG1 . THR F 3 115 ? 13.217  -9.486  2.844   1.00 43.13  ? 115 THR L OG1 1 
ATOM   9917  C CG2 . THR F 3 115 ? 13.106  -9.889  0.467   1.00 46.52  ? 115 THR L CG2 1 
ATOM   9918  N N   . VAL F 3 116 ? 12.330  -5.780  1.484   1.00 39.63  ? 116 VAL L N   1 
ATOM   9919  C CA  . VAL F 3 116 ? 11.762  -4.585  2.082   1.00 38.16  ? 116 VAL L CA  1 
ATOM   9920  C C   . VAL F 3 116 ? 11.083  -4.970  3.379   1.00 37.72  ? 116 VAL L C   1 
ATOM   9921  O O   . VAL F 3 116 ? 10.477  -6.033  3.483   1.00 39.75  ? 116 VAL L O   1 
ATOM   9922  C CB  . VAL F 3 116 ? 10.790  -3.853  1.131   1.00 35.86  ? 116 VAL L CB  1 
ATOM   9923  C CG1 . VAL F 3 116 ? 10.161  -2.683  1.836   1.00 34.44  ? 116 VAL L CG1 1 
ATOM   9924  C CG2 . VAL F 3 116 ? 11.529  -3.355  -0.098  1.00 36.73  ? 116 VAL L CG2 1 
ATOM   9925  N N   . ALA F 3 117 ? 11.259  -4.132  4.390   1.00 35.47  ? 117 ALA L N   1 
ATOM   9926  C CA  . ALA F 3 117 ? 10.615  -4.323  5.677   1.00 34.99  ? 117 ALA L CA  1 
ATOM   9927  C C   . ALA F 3 117 ? 10.098  -2.968  6.090   1.00 33.52  ? 117 ALA L C   1 
ATOM   9928  O O   . ALA F 3 117 ? 10.847  -2.007  6.120   1.00 28.10  ? 117 ALA L O   1 
ATOM   9929  C CB  . ALA F 3 117 ? 11.587  -4.831  6.676   1.00 30.07  ? 117 ALA L CB  1 
ATOM   9930  N N   . ALA F 3 118 ? 8.796   -2.889  6.340   1.00 34.66  ? 118 ALA L N   1 
ATOM   9931  C CA  . ALA F 3 118 ? 8.172   -1.736  6.986   1.00 33.75  ? 118 ALA L CA  1 
ATOM   9932  C C   . ALA F 3 118 ? 8.782   -1.476  8.363   1.00 28.24  ? 118 ALA L C   1 
ATOM   9933  O O   . ALA F 3 118 ? 9.153   -2.405  9.071   1.00 30.16  ? 118 ALA L O   1 
ATOM   9934  C CB  . ALA F 3 118 ? 6.664   -1.975  7.128   1.00 32.44  ? 118 ALA L CB  1 
ATOM   9935  N N   . PRO F 3 119 ? 8.884   -0.208  8.750   1.00 26.80  ? 119 PRO L N   1 
ATOM   9936  C CA  . PRO F 3 119 ? 9.252   0.092   10.136  1.00 27.62  ? 119 PRO L CA  1 
ATOM   9937  C C   . PRO F 3 119 ? 8.073   -0.059  11.068  1.00 29.22  ? 119 PRO L C   1 
ATOM   9938  O O   . PRO F 3 119 ? 6.954   0.135   10.642  1.00 30.62  ? 119 PRO L O   1 
ATOM   9939  C CB  . PRO F 3 119 ? 9.639   1.571   10.085  1.00 26.00  ? 119 PRO L CB  1 
ATOM   9940  C CG  . PRO F 3 119 ? 8.867   2.108   8.919   1.00 27.23  ? 119 PRO L CG  1 
ATOM   9941  C CD  . PRO F 3 119 ? 8.780   0.999   7.919   1.00 26.60  ? 119 PRO L CD  1 
ATOM   9942  N N   . SER F 3 120 ? 8.321   -0.421  12.318  1.00 29.17  ? 120 SER L N   1 
ATOM   9943  C CA  . SER F 3 120 ? 7.358   -0.197  13.395  1.00 30.89  ? 120 SER L CA  1 
ATOM   9944  C C   . SER F 3 120 ? 7.530   1.214   13.915  1.00 26.41  ? 120 SER L C   1 
ATOM   9945  O O   . SER F 3 120 ? 8.636   1.620   14.249  1.00 24.93  ? 120 SER L O   1 
ATOM   9946  C CB  . SER F 3 120 ? 7.587   -1.181  14.523  1.00 28.95  ? 120 SER L CB  1 
ATOM   9947  O OG  . SER F 3 120 ? 7.473   -2.481  14.011  1.00 30.61  ? 120 SER L OG  1 
ATOM   9948  N N   . VAL F 3 121 ? 6.444   1.969   13.960  1.00 27.22  ? 121 VAL L N   1 
ATOM   9949  C CA  . VAL F 3 121 ? 6.515   3.343   14.420  1.00 26.27  ? 121 VAL L CA  1 
ATOM   9950  C C   . VAL F 3 121 ? 6.001   3.473   15.852  1.00 27.31  ? 121 VAL L C   1 
ATOM   9951  O O   . VAL F 3 121 ? 4.970   2.905   16.195  1.00 29.35  ? 121 VAL L O   1 
ATOM   9952  C CB  . VAL F 3 121 ? 5.722   4.274   13.504  1.00 26.80  ? 121 VAL L CB  1 
ATOM   9953  C CG1 . VAL F 3 121 ? 5.891   5.728   13.950  1.00 26.03  ? 121 VAL L CG1 1 
ATOM   9954  C CG2 . VAL F 3 121 ? 6.148   4.068   12.061  1.00 26.45  ? 121 VAL L CG2 1 
ATOM   9955  N N   . PHE F 3 122 ? 6.747   4.207   16.680  1.00 26.28  ? 122 PHE L N   1 
ATOM   9956  C CA  . PHE F 3 122 ? 6.327   4.555   18.023  1.00 27.43  ? 122 PHE L CA  1 
ATOM   9957  C C   . PHE F 3 122 ? 6.511   6.035   18.222  1.00 26.63  ? 122 PHE L C   1 
ATOM   9958  O O   . PHE F 3 122 ? 7.436   6.599   17.708  1.00 25.08  ? 122 PHE L O   1 
ATOM   9959  C CB  . PHE F 3 122 ? 7.166   3.793   19.024  1.00 27.75  ? 122 PHE L CB  1 
ATOM   9960  C CG  . PHE F 3 122 ? 7.107   2.313   18.838  1.00 28.82  ? 122 PHE L CG  1 
ATOM   9961  C CD1 . PHE F 3 122 ? 6.161   1.556   19.511  1.00 31.41  ? 122 PHE L CD1 1 
ATOM   9962  C CD2 . PHE F 3 122 ? 7.985   1.673   17.975  1.00 27.66  ? 122 PHE L CD2 1 
ATOM   9963  C CE1 . PHE F 3 122 ? 6.108   0.197   19.358  1.00 32.85  ? 122 PHE L CE1 1 
ATOM   9964  C CE2 . PHE F 3 122 ? 7.933   0.314   17.812  1.00 28.95  ? 122 PHE L CE2 1 
ATOM   9965  C CZ  . PHE F 3 122 ? 6.991   -0.428  18.503  1.00 31.58  ? 122 PHE L CZ  1 
ATOM   9966  N N   . ILE F 3 123 ? 5.618   6.685   18.945  1.00 28.02  ? 123 ILE L N   1 
ATOM   9967  C CA  . ILE F 3 123 ? 5.864   8.072   19.341  1.00 30.54  ? 123 ILE L CA  1 
ATOM   9968  C C   . ILE F 3 123 ? 5.995   8.143   20.878  1.00 31.80  ? 123 ILE L C   1 
ATOM   9969  O O   . ILE F 3 123 ? 5.428   7.302   21.592  1.00 33.89  ? 123 ILE L O   1 
ATOM   9970  C CB  . ILE F 3 123 ? 4.757   9.031   18.800  1.00 31.24  ? 123 ILE L CB  1 
ATOM   9971  C CG1 . ILE F 3 123 ? 5.157   10.506  18.983  1.00 28.26  ? 123 ILE L CG1 1 
ATOM   9972  C CG2 . ILE F 3 123 ? 3.405   8.702   19.420  1.00 31.06  ? 123 ILE L CG2 1 
ATOM   9973  C CD1 . ILE F 3 123 ? 4.184   11.492  18.379  1.00 29.47  ? 123 ILE L CD1 1 
ATOM   9974  N N   . PHE F 3 124 ? 6.754   9.126   21.370  1.00 30.73  ? 124 PHE L N   1 
ATOM   9975  C CA  . PHE F 3 124 ? 7.036   9.308   22.799  1.00 31.28  ? 124 PHE L CA  1 
ATOM   9976  C C   . PHE F 3 124 ? 6.873   10.769  23.141  1.00 31.58  ? 124 PHE L C   1 
ATOM   9977  O O   . PHE F 3 124 ? 7.554   11.613  22.576  1.00 30.50  ? 124 PHE L O   1 
ATOM   9978  C CB  . PHE F 3 124 ? 8.483   8.912   23.129  1.00 30.30  ? 124 PHE L CB  1 
ATOM   9979  C CG  . PHE F 3 124 ? 8.780   7.459   22.918  1.00 30.17  ? 124 PHE L CG  1 
ATOM   9980  C CD1 . PHE F 3 124 ? 8.503   6.533   23.904  1.00 31.06  ? 124 PHE L CD1 1 
ATOM   9981  C CD2 . PHE F 3 124 ? 9.345   7.013   21.717  1.00 28.11  ? 124 PHE L CD2 1 
ATOM   9982  C CE1 . PHE F 3 124 ? 8.767   5.189   23.713  1.00 31.34  ? 124 PHE L CE1 1 
ATOM   9983  C CE2 . PHE F 3 124 ? 9.619   5.651   21.527  1.00 28.03  ? 124 PHE L CE2 1 
ATOM   9984  C CZ  . PHE F 3 124 ? 9.326   4.741   22.540  1.00 29.98  ? 124 PHE L CZ  1 
ATOM   9985  N N   . PRO F 3 125 ? 5.969   11.087  24.071  1.00 33.62  ? 125 PRO L N   1 
ATOM   9986  C CA  . PRO F 3 125 ? 5.788   12.482  24.489  1.00 33.48  ? 125 PRO L CA  1 
ATOM   9987  C C   . PRO F 3 125 ? 6.886   12.928  25.438  1.00 35.53  ? 125 PRO L C   1 
ATOM   9988  O O   . PRO F 3 125 ? 7.558   12.075  26.040  1.00 35.99  ? 125 PRO L O   1 
ATOM   9989  C CB  . PRO F 3 125 ? 4.429   12.461  25.180  1.00 36.03  ? 125 PRO L CB  1 
ATOM   9990  C CG  . PRO F 3 125 ? 4.249   11.073  25.604  1.00 36.86  ? 125 PRO L CG  1 
ATOM   9991  C CD  . PRO F 3 125 ? 4.926   10.207  24.613  1.00 35.58  ? 125 PRO L CD  1 
ATOM   9992  N N   . PRO F 3 126 ? 7.084   14.250  25.577  1.00 35.84  ? 126 PRO L N   1 
ATOM   9993  C CA  . PRO F 3 126 ? 8.200   14.673  26.422  1.00 36.57  ? 126 PRO L CA  1 
ATOM   9994  C C   . PRO F 3 126 ? 7.880   14.306  27.837  1.00 39.04  ? 126 PRO L C   1 
ATOM   9995  O O   . PRO F 3 126 ? 6.727   14.387  28.195  1.00 40.74  ? 126 PRO L O   1 
ATOM   9996  C CB  . PRO F 3 126 ? 8.208   16.190  26.250  1.00 37.27  ? 126 PRO L CB  1 
ATOM   9997  C CG  . PRO F 3 126 ? 6.823   16.547  25.923  1.00 37.80  ? 126 PRO L CG  1 
ATOM   9998  C CD  . PRO F 3 126 ? 6.245   15.387  25.165  1.00 36.41  ? 126 PRO L CD  1 
ATOM   9999  N N   . SER F 3 127 ? 8.862   13.874  28.612  1.00 39.99  ? 127 SER L N   1 
ATOM   10000 C CA  . SER F 3 127 ? 8.631   13.466  30.000  1.00 43.08  ? 127 SER L CA  1 
ATOM   10001 C C   . SER F 3 127 ? 8.271   14.642  30.917  1.00 45.71  ? 127 SER L C   1 
ATOM   10002 O O   . SER F 3 127 ? 8.647   15.782  30.664  1.00 45.30  ? 127 SER L O   1 
ATOM   10003 C CB  . SER F 3 127 ? 9.868   12.752  30.541  1.00 42.66  ? 127 SER L CB  1 
ATOM   10004 O OG  . SER F 3 127 ? 10.799  13.676  31.076  1.00 46.55  ? 127 SER L OG  1 
ATOM   10005 N N   . ASP F 3 128 ? 7.543   14.351  31.985  1.00 48.92  ? 128 ASP L N   1 
ATOM   10006 C CA  . ASP F 3 128 ? 7.227   15.349  33.006  1.00 52.27  ? 128 ASP L CA  1 
ATOM   10007 C C   . ASP F 3 128 ? 8.456   16.025  33.617  1.00 52.96  ? 128 ASP L C   1 
ATOM   10008 O O   . ASP F 3 128 ? 8.437   17.226  33.912  1.00 53.73  ? 128 ASP L O   1 
ATOM   10009 C CB  . ASP F 3 128 ? 6.391   14.715  34.115  1.00 56.68  ? 128 ASP L CB  1 
ATOM   10010 C CG  . ASP F 3 128 ? 4.904   14.821  33.854  1.00 58.07  ? 128 ASP L CG  1 
ATOM   10011 O OD1 . ASP F 3 128 ? 4.499   15.749  33.115  1.00 57.02  ? 128 ASP L OD1 1 
ATOM   10012 O OD2 . ASP F 3 128 ? 4.140   13.990  34.394  1.00 60.64  ? 128 ASP L OD2 1 
ATOM   10013 N N   . GLU F 3 129 ? 9.513   15.243  33.814  1.00 53.27  ? 129 GLU L N   1 
ATOM   10014 C CA  . GLU F 3 129 ? 10.779  15.785  34.296  1.00 55.23  ? 129 GLU L CA  1 
ATOM   10015 C C   . GLU F 3 129 ? 11.239  16.871  33.374  1.00 53.73  ? 129 GLU L C   1 
ATOM   10016 O O   . GLU F 3 129 ? 11.429  18.012  33.790  1.00 55.70  ? 129 GLU L O   1 
ATOM   10017 C CB  . GLU F 3 129 ? 11.875  14.725  34.339  1.00 54.97  ? 129 GLU L CB  1 
ATOM   10018 C CG  . GLU F 3 129 ? 11.723  13.726  35.437  1.00 58.16  ? 129 GLU L CG  1 
ATOM   10019 C CD  . GLU F 3 129 ? 11.248  12.376  34.942  1.00 56.60  ? 129 GLU L CD  1 
ATOM   10020 O OE1 . GLU F 3 129 ? 10.087  12.257  34.432  1.00 54.79  ? 129 GLU L OE1 1 
ATOM   10021 O OE2 . GLU F 3 129 ? 12.067  11.436  35.079  1.00 57.41  ? 129 GLU L OE2 1 
ATOM   10022 N N   . GLN F 3 130 ? 11.416  16.499  32.112  1.00 50.66  ? 130 GLN L N   1 
ATOM   10023 C CA  . GLN F 3 130 ? 11.929  17.422  31.116  1.00 49.52  ? 130 GLN L CA  1 
ATOM   10024 C C   . GLN F 3 130 ? 11.091  18.683  30.986  1.00 50.84  ? 130 GLN L C   1 
ATOM   10025 O O   . GLN F 3 130 ? 11.631  19.778  30.857  1.00 51.85  ? 130 GLN L O   1 
ATOM   10026 C CB  . GLN F 3 130 ? 12.034  16.753  29.762  1.00 45.91  ? 130 GLN L CB  1 
ATOM   10027 C CG  . GLN F 3 130 ? 12.602  17.688  28.751  1.00 44.67  ? 130 GLN L CG  1 
ATOM   10028 C CD  . GLN F 3 130 ? 12.651  17.097  27.377  1.00 41.58  ? 130 GLN L CD  1 
ATOM   10029 O OE1 . GLN F 3 130 ? 11.797  16.290  27.003  1.00 40.20  ? 130 GLN L OE1 1 
ATOM   10030 N NE2 . GLN F 3 130 ? 13.660  17.485  26.614  1.00 40.77  ? 130 GLN L NE2 1 
ATOM   10031 N N   . LEU F 3 131 ? 9.774   18.530  31.012  1.00 51.29  ? 131 LEU L N   1 
ATOM   10032 C CA  . LEU F 3 131 ? 8.896   19.676  30.896  1.00 52.81  ? 131 LEU L CA  1 
ATOM   10033 C C   . LEU F 3 131 ? 9.136   20.692  32.013  1.00 56.89  ? 131 LEU L C   1 
ATOM   10034 O O   . LEU F 3 131 ? 9.150   21.898  31.763  1.00 57.82  ? 131 LEU L O   1 
ATOM   10035 C CB  . LEU F 3 131 ? 7.444   19.219  30.847  1.00 53.03  ? 131 LEU L CB  1 
ATOM   10036 C CG  . LEU F 3 131 ? 6.935   18.973  29.424  1.00 50.44  ? 131 LEU L CG  1 
ATOM   10037 C CD1 . LEU F 3 131 ? 5.571   18.288  29.432  1.00 51.06  ? 131 LEU L CD1 1 
ATOM   10038 C CD2 . LEU F 3 131 ? 6.880   20.285  28.643  1.00 50.30  ? 131 LEU L CD2 1 
ATOM   10039 N N   . LYS F 3 132 ? 9.345   20.205  33.239  1.00 59.70  ? 132 LYS L N   1 
ATOM   10040 C CA  . LYS F 3 132 ? 9.645   21.081  34.378  1.00 63.70  ? 132 LYS L CA  1 
ATOM   10041 C C   . LYS F 3 132 ? 10.904  21.922  34.124  1.00 64.11  ? 132 LYS L C   1 
ATOM   10042 O O   . LYS F 3 132 ? 11.029  23.039  34.624  1.00 66.89  ? 132 LYS L O   1 
ATOM   10043 C CB  . LYS F 3 132 ? 9.792   20.271  35.677  1.00 66.63  ? 132 LYS L CB  1 
ATOM   10044 C CG  . LYS F 3 132 ? 8.488   19.672  36.202  1.00 67.99  ? 132 LYS L CG  1 
ATOM   10045 C CD  . LYS F 3 132 ? 8.687   18.851  37.489  1.00 71.55  ? 132 LYS L CD  1 
ATOM   10046 C CE  . LYS F 3 132 ? 9.031   19.736  38.700  1.00 76.24  ? 132 LYS L CE  1 
ATOM   10047 N NZ  . LYS F 3 132 ? 9.177   18.977  39.988  1.00 80.30  ? 132 LYS L NZ  1 
ATOM   10048 N N   . SER F 3 133 ? 11.830  21.385  33.336  1.00 61.64  ? 133 SER L N   1 
ATOM   10049 C CA  . SER F 3 133 ? 13.063  22.100  33.037  1.00 62.32  ? 133 SER L CA  1 
ATOM   10050 C C   . SER F 3 133 ? 12.846  23.197  31.987  1.00 61.42  ? 133 SER L C   1 
ATOM   10051 O O   . SER F 3 133 ? 13.720  24.038  31.783  1.00 62.78  ? 133 SER L O   1 
ATOM   10052 C CB  . SER F 3 133 ? 14.192  21.131  32.633  1.00 60.59  ? 133 SER L CB  1 
ATOM   10053 O OG  . SER F 3 133 ? 14.406  21.076  31.221  1.00 57.22  ? 133 SER L OG  1 
ATOM   10054 N N   . GLY F 3 134 ? 11.686  23.193  31.329  1.00 59.62  ? 134 GLY L N   1 
ATOM   10055 C CA  . GLY F 3 134 ? 11.341  24.242  30.373  1.00 59.15  ? 134 GLY L CA  1 
ATOM   10056 C C   . GLY F 3 134 ? 11.404  23.913  28.886  1.00 55.69  ? 134 GLY L C   1 
ATOM   10057 O O   . GLY F 3 134 ? 11.089  24.756  28.035  1.00 55.72  ? 134 GLY L O   1 
ATOM   10058 N N   . THR F 3 135 ? 11.799  22.688  28.561  1.00 52.92  ? 135 THR L N   1 
ATOM   10059 C CA  . THR F 3 135 ? 11.908  22.298  27.164  1.00 49.55  ? 135 THR L CA  1 
ATOM   10060 C C   . THR F 3 135 ? 11.181  20.971  26.874  1.00 46.49  ? 135 THR L C   1 
ATOM   10061 O O   . THR F 3 135 ? 10.988  20.160  27.767  1.00 46.64  ? 135 THR L O   1 
ATOM   10062 C CB  . THR F 3 135 ? 13.401  22.302  26.708  1.00 61.85  ? 135 THR L CB  1 
ATOM   10063 O OG1 . THR F 3 135 ? 13.690  21.134  25.926  1.00 59.12  ? 135 THR L OG1 1 
ATOM   10064 C CG2 . THR F 3 135 ? 14.334  22.353  27.920  1.00 64.30  ? 135 THR L CG2 1 
ATOM   10065 N N   . ALA F 3 136 ? 10.757  20.772  25.628  1.00 44.25  ? 136 ALA L N   1 
ATOM   10066 C CA  . ALA F 3 136 ? 10.008  19.573  25.251  1.00 36.99  ? 136 ALA L CA  1 
ATOM   10067 C C   . ALA F 3 136 ? 10.711  18.753  24.168  1.00 38.08  ? 136 ALA L C   1 
ATOM   10068 O O   . ALA F 3 136 ? 11.207  19.297  23.196  1.00 37.67  ? 136 ALA L O   1 
ATOM   10069 C CB  . ALA F 3 136 ? 8.607   19.949  24.803  1.00 37.31  ? 136 ALA L CB  1 
ATOM   10070 N N   . SER F 3 137 ? 10.763  17.441  24.333  1.00 36.82  ? 137 SER L N   1 
ATOM   10071 C CA  . SER F 3 137 ? 11.344  16.595  23.294  1.00 31.12  ? 137 SER L CA  1 
ATOM   10072 C C   . SER F 3 137 ? 10.375  15.509  22.941  1.00 29.97  ? 137 SER L C   1 
ATOM   10073 O O   . SER F 3 137 ? 10.104  14.628  23.757  1.00 30.45  ? 137 SER L O   1 
ATOM   10074 C CB  . SER F 3 137 ? 12.642  15.957  23.753  1.00 31.13  ? 137 SER L CB  1 
ATOM   10075 O OG  . SER F 3 137 ? 13.727  16.822  23.512  1.00 37.06  ? 137 SER L OG  1 
ATOM   10076 N N   . VAL F 3 138 ? 9.832   15.590  21.731  1.00 28.96  ? 138 VAL L N   1 
ATOM   10077 C CA  . VAL F 3 138 ? 8.913   14.574  21.239  1.00 28.18  ? 138 VAL L CA  1 
ATOM   10078 C C   . VAL F 3 138 ? 9.724   13.676  20.319  1.00 30.15  ? 138 VAL L C   1 
ATOM   10079 O O   . VAL F 3 138 ? 10.491  14.164  19.482  1.00 29.71  ? 138 VAL L O   1 
ATOM   10080 C CB  . VAL F 3 138 ? 7.755   15.199  20.467  1.00 28.77  ? 138 VAL L CB  1 
ATOM   10081 C CG1 . VAL F 3 138 ? 6.658   14.215  20.307  1.00 30.62  ? 138 VAL L CG1 1 
ATOM   10082 C CG2 . VAL F 3 138 ? 7.247   16.404  21.180  1.00 30.69  ? 138 VAL L CG2 1 
ATOM   10083 N N   . VAL F 3 139 ? 9.586   12.367  20.468  1.00 25.91  ? 139 VAL L N   1 
ATOM   10084 C CA  . VAL F 3 139 ? 10.469  11.459  19.756  1.00 25.74  ? 139 VAL L CA  1 
ATOM   10085 C C   . VAL F 3 139 ? 9.696   10.449  18.916  1.00 25.36  ? 139 VAL L C   1 
ATOM   10086 O O   . VAL F 3 139 ? 8.696   9.856   19.368  1.00 26.34  ? 139 VAL L O   1 
ATOM   10087 C CB  . VAL F 3 139 ? 11.432  10.757  20.726  1.00 24.87  ? 139 VAL L CB  1 
ATOM   10088 C CG1 . VAL F 3 139 ? 12.045  9.483   20.110  1.00 23.88  ? 139 VAL L CG1 1 
ATOM   10089 C CG2 . VAL F 3 139 ? 12.506  11.750  21.207  1.00 25.51  ? 139 VAL L CG2 1 
ATOM   10090 N N   . CYS F 3 140 ? 10.141  10.272  17.675  1.00 24.20  ? 140 CYS L N   1 
ATOM   10091 C CA  . CYS F 3 140 ? 9.505   9.297   16.821  1.00 24.06  ? 140 CYS L CA  1 
ATOM   10092 C C   . CYS F 3 140 ? 10.503  8.207   16.616  1.00 23.49  ? 140 CYS L C   1 
ATOM   10093 O O   . CYS F 3 140 ? 11.637  8.503   16.311  1.00 23.38  ? 140 CYS L O   1 
ATOM   10094 C CB  . CYS F 3 140 ? 9.161   9.933   15.480  1.00 24.06  ? 140 CYS L CB  1 
ATOM   10095 S SG  . CYS F 3 140 ? 7.975   8.987   14.531  1.00 39.35  ? 140 CYS L SG  1 
ATOM   10096 N N   . LEU F 3 141 ? 10.113  6.957   16.782  1.00 22.27  ? 141 LEU L N   1 
ATOM   10097 C CA  . LEU F 3 141 ? 11.053  5.874   16.585  1.00 23.07  ? 141 LEU L CA  1 
ATOM   10098 C C   . LEU F 3 141 ? 10.586  5.004   15.442  1.00 23.44  ? 141 LEU L C   1 
ATOM   10099 O O   . LEU F 3 141 ? 9.429   4.581   15.432  1.00 24.89  ? 141 LEU L O   1 
ATOM   10100 C CB  . LEU F 3 141 ? 11.203  5.032   17.853  1.00 24.01  ? 141 LEU L CB  1 
ATOM   10101 C CG  . LEU F 3 141 ? 11.891  3.661   17.720  1.00 24.30  ? 141 LEU L CG  1 
ATOM   10102 C CD1 . LEU F 3 141 ? 13.357  3.786   17.360  1.00 23.34  ? 141 LEU L CD1 1 
ATOM   10103 C CD2 . LEU F 3 141 ? 11.735  2.855   18.989  1.00 26.11  ? 141 LEU L CD2 1 
ATOM   10104 N N   . LEU F 3 142 ? 11.473  4.749   14.473  1.00 22.52  ? 142 LEU L N   1 
ATOM   10105 C CA  . LEU F 3 142 ? 11.190  3.861   13.339  1.00 22.29  ? 142 LEU L CA  1 
ATOM   10106 C C   . LEU F 3 142 ? 12.039  2.602   13.475  1.00 22.42  ? 142 LEU L C   1 
ATOM   10107 O O   . LEU F 3 142 ? 13.246  2.639   13.300  1.00 21.88  ? 142 LEU L O   1 
ATOM   10108 C CB  . LEU F 3 142 ? 11.524  4.568   12.036  1.00 21.70  ? 142 LEU L CB  1 
ATOM   10109 C CG  . LEU F 3 142 ? 10.461  5.482   11.407  1.00 22.32  ? 142 LEU L CG  1 
ATOM   10110 C CD1 . LEU F 3 142 ? 9.969   6.513   12.386  1.00 22.41  ? 142 LEU L CD1 1 
ATOM   10111 C CD2 . LEU F 3 142 ? 10.967  6.149   10.120  1.00 22.20  ? 142 LEU L CD2 1 
ATOM   10112 N N   . ASN F 3 143 ? 11.424  1.476   13.791  1.00 23.78  ? 143 ASN L N   1 
ATOM   10113 C CA  . ASN F 3 143 ? 12.225  0.334   14.183  1.00 25.04  ? 143 ASN L CA  1 
ATOM   10114 C C   . ASN F 3 143 ? 12.365  -0.760  13.146  1.00 25.85  ? 143 ASN L C   1 
ATOM   10115 O O   . ASN F 3 143 ? 11.373  -1.299  12.675  1.00 26.96  ? 143 ASN L O   1 
ATOM   10116 C CB  . ASN F 3 143 ? 11.711  -0.259  15.501  1.00 27.52  ? 143 ASN L CB  1 
ATOM   10117 C CG  . ASN F 3 143 ? 12.847  -0.733  16.396  1.00 29.34  ? 143 ASN L CG  1 
ATOM   10118 O OD1 . ASN F 3 143 ? 12.716  -1.692  17.163  1.00 31.50  ? 143 ASN L OD1 1 
ATOM   10119 N ND2 . ASN F 3 143 ? 13.992  -0.067  16.280  1.00 28.88  ? 143 ASN L ND2 1 
ATOM   10120 N N   . ASN F 3 144 ? 13.606  -1.080  12.792  1.00 25.76  ? 144 ASN L N   1 
ATOM   10121 C CA  . ASN F 3 144 ? 13.931  -2.310  12.057  1.00 26.69  ? 144 ASN L CA  1 
ATOM   10122 C C   . ASN F 3 144 ? 13.404  -2.432  10.628  1.00 26.62  ? 144 ASN L C   1 
ATOM   10123 O O   . ASN F 3 144 ? 12.782  -3.434  10.262  1.00 28.23  ? 144 ASN L O   1 
ATOM   10124 C CB  . ASN F 3 144 ? 13.562  -3.546  12.888  1.00 28.81  ? 144 ASN L CB  1 
ATOM   10125 C CG  . ASN F 3 144 ? 14.476  -3.727  14.092  1.00 30.04  ? 144 ASN L CG  1 
ATOM   10126 O OD1 . ASN F 3 144 ? 15.643  -4.136  13.955  1.00 31.05  ? 144 ASN L OD1 1 
ATOM   10127 N ND2 . ASN F 3 144 ? 13.968  -3.410  15.273  1.00 30.45  ? 144 ASN L ND2 1 
ATOM   10128 N N   . PHE F 3 145 ? 13.687  -1.420  9.819   1.00 25.34  ? 145 PHE L N   1 
ATOM   10129 C CA  . PHE F 3 145 ? 13.176  -1.356  8.451   1.00 25.71  ? 145 PHE L CA  1 
ATOM   10130 C C   . PHE F 3 145 ? 14.304  -1.488  7.395   1.00 24.66  ? 145 PHE L C   1 
ATOM   10131 O O   . PHE F 3 145 ? 15.496  -1.444  7.703   1.00 24.04  ? 145 PHE L O   1 
ATOM   10132 C CB  . PHE F 3 145 ? 12.396  -0.046  8.249   1.00 24.93  ? 145 PHE L CB  1 
ATOM   10133 C CG  . PHE F 3 145 ? 13.215  1.189   8.515   1.00 23.56  ? 145 PHE L CG  1 
ATOM   10134 C CD1 . PHE F 3 145 ? 13.896  1.830   7.470   1.00 23.72  ? 145 PHE L CD1 1 
ATOM   10135 C CD2 . PHE F 3 145 ? 13.341  1.694   9.811   1.00 22.67  ? 145 PHE L CD2 1 
ATOM   10136 C CE1 . PHE F 3 145 ? 14.682  2.970   7.712   1.00 22.96  ? 145 PHE L CE1 1 
ATOM   10137 C CE2 . PHE F 3 145 ? 14.109  2.829   10.077  1.00 20.95  ? 145 PHE L CE2 1 
ATOM   10138 C CZ  . PHE F 3 145 ? 14.794  3.470   9.035   1.00 22.05  ? 145 PHE L CZ  1 
ATOM   10139 N N   . TYR F 3 146 ? 13.909  -1.656  6.145   1.00 25.70  ? 146 TYR L N   1 
ATOM   10140 C CA  . TYR F 3 146 ? 14.837  -1.678  5.037   1.00 26.33  ? 146 TYR L CA  1 
ATOM   10141 C C   . TYR F 3 146 ? 14.044  -1.387  3.785   1.00 30.31  ? 146 TYR L C   1 
ATOM   10142 O O   . TYR F 3 146 ? 12.913  -1.853  3.646   1.00 28.88  ? 146 TYR L O   1 
ATOM   10143 C CB  . TYR F 3 146 ? 15.513  -3.042  4.912   1.00 27.33  ? 146 TYR L CB  1 
ATOM   10144 C CG  . TYR F 3 146 ? 16.602  -3.042  3.878   1.00 28.15  ? 146 TYR L CG  1 
ATOM   10145 C CD1 . TYR F 3 146 ? 17.916  -2.814  4.232   1.00 27.63  ? 146 TYR L CD1 1 
ATOM   10146 C CD2 . TYR F 3 146 ? 16.303  -3.224  2.528   1.00 29.90  ? 146 TYR L CD2 1 
ATOM   10147 C CE1 . TYR F 3 146 ? 18.904  -2.781  3.270   1.00 34.96  ? 146 TYR L CE1 1 
ATOM   10148 C CE2 . TYR F 3 146 ? 17.275  -3.197  1.571   1.00 31.05  ? 146 TYR L CE2 1 
ATOM   10149 C CZ  . TYR F 3 146 ? 18.570  -2.979  1.934   1.00 36.52  ? 146 TYR L CZ  1 
ATOM   10150 O OH  . TYR F 3 146 ? 19.534  -2.956  0.962   1.00 38.06  ? 146 TYR L OH  1 
ATOM   10151 N N   . PRO F 3 147 ? 14.620  -0.605  2.863   1.00 30.80  ? 147 PRO L N   1 
ATOM   10152 C CA  . PRO F 3 147 ? 15.884  0.145   2.836   1.00 30.26  ? 147 PRO L CA  1 
ATOM   10153 C C   . PRO F 3 147 ? 15.907  1.361   3.770   1.00 28.74  ? 147 PRO L C   1 
ATOM   10154 O O   . PRO F 3 147 ? 14.860  1.770   4.293   1.00 28.15  ? 147 PRO L O   1 
ATOM   10155 C CB  . PRO F 3 147 ? 15.934  0.662   1.399   1.00 32.31  ? 147 PRO L CB  1 
ATOM   10156 C CG  . PRO F 3 147 ? 15.043  -0.185  0.659   1.00 34.02  ? 147 PRO L CG  1 
ATOM   10157 C CD  . PRO F 3 147 ? 13.952  -0.554  1.557   1.00 33.03  ? 147 PRO L CD  1 
ATOM   10158 N N   . ARG F 3 148 ? 17.088  1.960   3.918   1.00 28.33  ? 148 ARG L N   1 
ATOM   10159 C CA  . ARG F 3 148 ? 17.289  3.058   4.855   1.00 27.18  ? 148 ARG L CA  1 
ATOM   10160 C C   . ARG F 3 148 ? 16.457  4.328   4.551   1.00 27.75  ? 148 ARG L C   1 
ATOM   10161 O O   . ARG F 3 148 ? 16.155  5.107   5.482   1.00 26.86  ? 148 ARG L O   1 
ATOM   10162 C CB  . ARG F 3 148 ? 18.790  3.365   4.985   1.00 27.35  ? 148 ARG L CB  1 
ATOM   10163 C CG  . ARG F 3 148 ? 19.220  4.483   5.969   1.00 44.26  ? 148 ARG L CG  1 
ATOM   10164 C CD  . ARG F 3 148 ? 20.705  4.779   5.773   1.00 45.60  ? 148 ARG L CD  1 
ATOM   10165 N NE  . ARG F 3 148 ? 21.031  4.445   4.386   1.00 47.72  ? 148 ARG L NE  1 
ATOM   10166 C CZ  . ARG F 3 148 ? 21.966  3.577   3.979   1.00 49.15  ? 148 ARG L CZ  1 
ATOM   10167 N NH1 . ARG F 3 148 ? 22.761  2.953   4.860   1.00 48.81  ? 148 ARG L NH1 1 
ATOM   10168 N NH2 . ARG F 3 148 ? 22.116  3.354   2.665   1.00 51.03  ? 148 ARG L NH2 1 
ATOM   10169 N N   . GLU F 3 149 ? 16.077  4.536   3.284   1.00 29.32  ? 149 GLU L N   1 
ATOM   10170 C CA  . GLU F 3 149 ? 15.274  5.711   2.905   1.00 30.06  ? 149 GLU L CA  1 
ATOM   10171 C C   . GLU F 3 149 ? 13.900  5.679   3.546   1.00 29.37  ? 149 GLU L C   1 
ATOM   10172 O O   . GLU F 3 149 ? 13.183  4.679   3.474   1.00 29.73  ? 149 GLU L O   1 
ATOM   10173 C CB  . GLU F 3 149 ? 15.095  5.817   1.393   1.00 32.77  ? 149 GLU L CB  1 
ATOM   10174 C CG  . GLU F 3 149 ? 16.387  5.633   0.594   1.00 34.33  ? 149 GLU L CG  1 
ATOM   10175 C CD  . GLU F 3 149 ? 16.503  4.244   -0.084  1.00 65.08  ? 149 GLU L CD  1 
ATOM   10176 O OE1 . GLU F 3 149 ? 15.952  4.058   -1.218  1.00 67.28  ? 149 GLU L OE1 1 
ATOM   10177 O OE2 . GLU F 3 149 ? 17.154  3.340   0.516   1.00 63.70  ? 149 GLU L OE2 1 
ATOM   10178 N N   . ALA F 3 150 ? 13.543  6.790   4.173   1.00 28.83  ? 150 ALA L N   1 
ATOM   10179 C CA  . ALA F 3 150 ? 12.284  6.946   4.892   1.00 28.21  ? 150 ALA L CA  1 
ATOM   10180 C C   . ALA F 3 150 ? 12.060  8.432   5.111   1.00 29.09  ? 150 ALA L C   1 
ATOM   10181 O O   . ALA F 3 150 ? 12.999  9.195   5.345   1.00 29.11  ? 150 ALA L O   1 
ATOM   10182 C CB  . ALA F 3 150 ? 12.322  6.226   6.227   1.00 25.94  ? 150 ALA L CB  1 
ATOM   10183 N N   . LYS F 3 151 ? 10.814  8.854   5.004   1.00 30.24  ? 151 LYS L N   1 
ATOM   10184 C CA  . LYS F 3 151 ? 10.466  10.229  5.292   1.00 30.66  ? 151 LYS L CA  1 
ATOM   10185 C C   . LYS F 3 151 ? 9.690   10.321  6.648   1.00 38.67  ? 151 LYS L C   1 
ATOM   10186 O O   . LYS F 3 151 ? 8.767   9.535   6.913   1.00 27.50  ? 151 LYS L O   1 
ATOM   10187 C CB  . LYS F 3 151 ? 9.700   10.827  4.111   1.00 33.06  ? 151 LYS L CB  1 
ATOM   10188 C CG  . LYS F 3 151 ? 9.484   12.308  4.247   1.00 34.61  ? 151 LYS L CG  1 
ATOM   10189 C CD  . LYS F 3 151 ? 8.996   12.967  2.969   1.00 38.42  ? 151 LYS L CD  1 
ATOM   10190 C CE  . LYS F 3 151 ? 8.754   14.450  3.217   1.00 40.34  ? 151 LYS L CE  1 
ATOM   10191 N NZ  . LYS F 3 151 ? 8.510   15.195  1.959   1.00 44.51  ? 151 LYS L NZ  1 
ATOM   10192 N N   . VAL F 3 152 ? 10.087  11.257  7.507   1.00 26.86  ? 152 VAL L N   1 
ATOM   10193 C CA  . VAL F 3 152 ? 9.355   11.498  8.760   1.00 26.27  ? 152 VAL L CA  1 
ATOM   10194 C C   . VAL F 3 152 ? 8.810   12.933  8.843   1.00 27.88  ? 152 VAL L C   1 
ATOM   10195 O O   . VAL F 3 152 ? 9.562   13.893  8.815   1.00 30.97  ? 152 VAL L O   1 
ATOM   10196 C CB  . VAL F 3 152 ? 10.244  11.199  10.007  1.00 24.31  ? 152 VAL L CB  1 
ATOM   10197 C CG1 . VAL F 3 152 ? 9.538   11.599  11.235  1.00 29.10  ? 152 VAL L CG1 1 
ATOM   10198 C CG2 . VAL F 3 152 ? 10.598  9.732   10.095  1.00 23.12  ? 152 VAL L CG2 1 
ATOM   10199 N N   . GLN F 3 153 ? 7.503   13.098  8.952   1.00 30.04  ? 153 GLN L N   1 
ATOM   10200 C CA  . GLN F 3 153 ? 6.934   14.454  8.933   1.00 32.06  ? 153 GLN L CA  1 
ATOM   10201 C C   . GLN F 3 153 ? 6.312   14.727  10.277  1.00 31.57  ? 153 GLN L C   1 
ATOM   10202 O O   . GLN F 3 153 ? 5.659   13.846  10.828  1.00 31.17  ? 153 GLN L O   1 
ATOM   10203 C CB  . GLN F 3 153 ? 5.883   14.589  7.831   1.00 34.89  ? 153 GLN L CB  1 
ATOM   10204 C CG  . GLN F 3 153 ? 6.028   15.831  6.953   1.00 37.58  ? 153 GLN L CG  1 
ATOM   10205 C CD  . GLN F 3 153 ? 5.365   15.679  5.555   1.00 58.10  ? 153 GLN L CD  1 
ATOM   10206 O OE1 . GLN F 3 153 ? 4.737   14.659  5.237   1.00 58.11  ? 153 GLN L OE1 1 
ATOM   10207 N NE2 . GLN F 3 153 ? 5.511   16.707  4.727   1.00 60.98  ? 153 GLN L NE2 1 
ATOM   10208 N N   . TRP F 3 154 ? 6.536   15.922  10.817  1.00 32.01  ? 154 TRP L N   1 
ATOM   10209 C CA  . TRP F 3 154 ? 5.948   16.289  12.115  1.00 31.94  ? 154 TRP L CA  1 
ATOM   10210 C C   . TRP F 3 154 ? 4.739   17.211  11.973  1.00 34.61  ? 154 TRP L C   1 
ATOM   10211 O O   . TRP F 3 154 ? 4.853   18.309  11.443  1.00 36.49  ? 154 TRP L O   1 
ATOM   10212 C CB  . TRP F 3 154 ? 6.972   16.970  13.026  1.00 30.74  ? 154 TRP L CB  1 
ATOM   10213 C CG  . TRP F 3 154 ? 7.907   16.038  13.665  1.00 28.62  ? 154 TRP L CG  1 
ATOM   10214 C CD1 . TRP F 3 154 ? 9.189   15.776  13.293  1.00 27.41  ? 154 TRP L CD1 1 
ATOM   10215 C CD2 . TRP F 3 154 ? 7.649   15.235  14.812  1.00 27.84  ? 154 TRP L CD2 1 
ATOM   10216 N NE1 . TRP F 3 154 ? 9.749   14.846  14.123  1.00 25.84  ? 154 TRP L NE1 1 
ATOM   10217 C CE2 . TRP F 3 154 ? 8.827   14.500  15.078  1.00 26.21  ? 154 TRP L CE2 1 
ATOM   10218 C CE3 . TRP F 3 154 ? 6.537   15.058  15.644  1.00 28.54  ? 154 TRP L CE3 1 
ATOM   10219 C CZ2 . TRP F 3 154 ? 8.925   13.601  16.151  1.00 25.45  ? 154 TRP L CZ2 1 
ATOM   10220 C CZ3 . TRP F 3 154 ? 6.637   14.166  16.702  1.00 27.85  ? 154 TRP L CZ3 1 
ATOM   10221 C CH2 . TRP F 3 154 ? 7.821   13.439  16.938  1.00 26.38  ? 154 TRP L CH2 1 
ATOM   10222 N N   . LYS F 3 155 ? 3.587   16.775  12.467  1.00 35.30  ? 155 LYS L N   1 
ATOM   10223 C CA  . LYS F 3 155 ? 2.422   17.639  12.478  1.00 38.40  ? 155 LYS L CA  1 
ATOM   10224 C C   . LYS F 3 155 ? 2.156   18.149  13.881  1.00 38.45  ? 155 LYS L C   1 
ATOM   10225 O O   . LYS F 3 155 ? 2.196   17.380  14.820  1.00 36.85  ? 155 LYS L O   1 
ATOM   10226 C CB  . LYS F 3 155 ? 1.192   16.900  11.942  1.00 40.49  ? 155 LYS L CB  1 
ATOM   10227 C CG  . LYS F 3 155 ? 1.227   16.588  10.434  1.00 41.73  ? 155 LYS L CG  1 
ATOM   10228 C CD  . LYS F 3 155 ? -0.181  16.397  9.848   1.00 45.20  ? 155 LYS L CD  1 
ATOM   10229 C CE  . LYS F 3 155 ? -0.105  15.737  8.486   1.00 46.28  ? 155 LYS L CE  1 
ATOM   10230 N NZ  . LYS F 3 155 ? -1.450  15.486  7.908   1.00 50.11  ? 155 LYS L NZ  1 
ATOM   10231 N N   . VAL F 3 156 ? 1.895   19.443  14.026  1.00 40.84  ? 156 VAL L N   1 
ATOM   10232 C CA  . VAL F 3 156 ? 1.483   19.994  15.322  1.00 41.93  ? 156 VAL L CA  1 
ATOM   10233 C C   . VAL F 3 156 ? 0.118   20.694  15.229  1.00 45.67  ? 156 VAL L C   1 
ATOM   10234 O O   . VAL F 3 156 ? 0.013   21.846  14.793  1.00 47.08  ? 156 VAL L O   1 
ATOM   10235 C CB  . VAL F 3 156 ? 2.580   20.902  15.959  1.00 40.55  ? 156 VAL L CB  1 
ATOM   10236 C CG1 . VAL F 3 156 ? 2.030   21.707  17.102  1.00 42.40  ? 156 VAL L CG1 1 
ATOM   10237 C CG2 . VAL F 3 156 ? 3.718   20.066  16.448  1.00 37.50  ? 156 VAL L CG2 1 
ATOM   10238 N N   . ASP F 3 157 ? -0.912  19.977  15.675  1.00 46.49  ? 157 ASP L N   1 
ATOM   10239 C CA  . ASP F 3 157 ? -2.308  20.320  15.409  1.00 50.26  ? 157 ASP L CA  1 
ATOM   10240 C C   . ASP F 3 157 ? -2.511  20.503  13.911  1.00 51.65  ? 157 ASP L C   1 
ATOM   10241 O O   . ASP F 3 157 ? -3.031  21.516  13.449  1.00 54.66  ? 157 ASP L O   1 
ATOM   10242 C CB  . ASP F 3 157 ? -2.764  21.543  16.204  1.00 53.26  ? 157 ASP L CB  1 
ATOM   10243 C CG  . ASP F 3 157 ? -3.004  21.230  17.676  1.00 53.36  ? 157 ASP L CG  1 
ATOM   10244 O OD1 . ASP F 3 157 ? -3.465  20.107  17.984  1.00 53.22  ? 157 ASP L OD1 1 
ATOM   10245 O OD2 . ASP F 3 157 ? -2.739  22.110  18.523  1.00 53.94  ? 157 ASP L OD2 1 
ATOM   10246 N N   . ASN F 3 158 ? -2.054  19.495  13.174  1.00 49.82  ? 158 ASN L N   1 
ATOM   10247 C CA  . ASN F 3 158 ? -2.163  19.410  11.716  1.00 51.45  ? 158 ASN L CA  1 
ATOM   10248 C C   . ASN F 3 158 ? -1.279  20.331  10.875  1.00 52.07  ? 158 ASN L C   1 
ATOM   10249 O O   . ASN F 3 158 ? -1.318  20.256  9.653   1.00 53.57  ? 158 ASN L O   1 
ATOM   10250 C CB  . ASN F 3 158 ? -3.615  19.497  11.254  1.00 55.41  ? 158 ASN L CB  1 
ATOM   10251 C CG  . ASN F 3 158 ? -4.245  18.144  11.114  1.00 55.17  ? 158 ASN L CG  1 
ATOM   10252 O OD1 . ASN F 3 158 ? -3.566  17.142  10.887  1.00 52.12  ? 158 ASN L OD1 1 
ATOM   10253 N ND2 . ASN F 3 158 ? -5.552  18.100  11.249  1.00 58.77  ? 158 ASN L ND2 1 
ATOM   10254 N N   . ALA F 3 159 ? -0.493  21.190  11.519  1.00 51.33  ? 159 ALA L N   1 
ATOM   10255 C CA  . ALA F 3 159 ? 0.457   22.034  10.804  1.00 50.31  ? 159 ALA L CA  1 
ATOM   10256 C C   . ALA F 3 159 ? 1.792   21.299  10.661  1.00 46.66  ? 159 ALA L C   1 
ATOM   10257 O O   . ALA F 3 159 ? 2.219   20.612  11.576  1.00 43.67  ? 159 ALA L O   1 
ATOM   10258 C CB  . ALA F 3 159 ? 0.634   23.364  11.517  1.00 51.74  ? 159 ALA L CB  1 
ATOM   10259 N N   . LEU F 3 160 ? 2.438   21.435  9.508   1.00 47.34  ? 160 LEU L N   1 
ATOM   10260 C CA  . LEU F 3 160 ? 3.707   20.771  9.279   1.00 44.41  ? 160 LEU L CA  1 
ATOM   10261 C C   . LEU F 3 160 ? 4.846   21.555  9.895   1.00 43.53  ? 160 LEU L C   1 
ATOM   10262 O O   . LEU F 3 160 ? 4.878   22.778  9.799   1.00 48.37  ? 160 LEU L O   1 
ATOM   10263 C CB  . LEU F 3 160 ? 3.976   20.611  7.792   1.00 45.94  ? 160 LEU L CB  1 
ATOM   10264 C CG  . LEU F 3 160 ? 3.035   19.657  7.090   1.00 46.80  ? 160 LEU L CG  1 
ATOM   10265 C CD1 . LEU F 3 160 ? 3.137   19.827  5.591   1.00 49.68  ? 160 LEU L CD1 1 
ATOM   10266 C CD2 . LEU F 3 160 ? 3.358   18.254  7.517   1.00 43.19  ? 160 LEU L CD2 1 
ATOM   10267 N N   . GLN F 3 161 ? 5.800   20.831  10.486  1.00 45.16  ? 161 GLN L N   1 
ATOM   10268 C CA  . GLN F 3 161 ? 6.964   21.421  11.137  1.00 39.49  ? 161 GLN L CA  1 
ATOM   10269 C C   . GLN F 3 161 ? 8.220   21.498  10.245  1.00 44.52  ? 161 GLN L C   1 
ATOM   10270 O O   . GLN F 3 161 ? 8.407   20.726  9.287   1.00 39.09  ? 161 GLN L O   1 
ATOM   10271 C CB  . GLN F 3 161 ? 7.256   20.678  12.438  1.00 36.63  ? 161 GLN L CB  1 
ATOM   10272 C CG  . GLN F 3 161 ? 6.092   20.702  13.435  1.00 37.03  ? 161 GLN L CG  1 
ATOM   10273 C CD  . GLN F 3 161 ? 5.721   22.119  13.886  1.00 42.31  ? 161 GLN L CD  1 
ATOM   10274 O OE1 . GLN F 3 161 ? 6.467   22.748  14.642  1.00 39.76  ? 161 GLN L OE1 1 
ATOM   10275 N NE2 . GLN F 3 161 ? 4.561   22.621  13.426  1.00 45.68  ? 161 GLN L NE2 1 
ATOM   10276 N N   . SER F 3 162 ? 9.082   22.449  10.582  1.00 45.10  ? 162 SER L N   1 
ATOM   10277 C CA  . SER F 3 162 ? 10.195  22.812  9.721   1.00 46.21  ? 162 SER L CA  1 
ATOM   10278 C C   . SER F 3 162 ? 11.370  23.353  10.547  1.00 45.47  ? 162 SER L C   1 
ATOM   10279 O O   . SER F 3 162 ? 11.250  24.369  11.249  1.00 46.80  ? 162 SER L O   1 
ATOM   10280 C CB  . SER F 3 162 ? 9.732   23.872  8.706   1.00 50.72  ? 162 SER L CB  1 
ATOM   10281 O OG  . SER F 3 162 ? 10.649  24.027  7.629   1.00 52.44  ? 162 SER L OG  1 
ATOM   10282 N N   . GLY F 3 163 ? 12.503  22.664  10.451  1.00 43.59  ? 163 GLY L N   1 
ATOM   10283 C CA  . GLY F 3 163 ? 13.744  23.127  11.039  1.00 43.79  ? 163 GLY L CA  1 
ATOM   10284 C C   . GLY F 3 163 ? 13.707  23.157  12.544  1.00 42.25  ? 163 GLY L C   1 
ATOM   10285 O O   . GLY F 3 163 ? 14.295  24.020  13.173  1.00 41.18  ? 163 GLY L O   1 
ATOM   10286 N N   . ASN F 3 164 ? 12.996  22.200  13.116  1.00 39.58  ? 164 ASN L N   1 
ATOM   10287 C CA  . ASN F 3 164 ? 12.900  22.068  14.552  1.00 38.43  ? 164 ASN L CA  1 
ATOM   10288 C C   . ASN F 3 164 ? 13.013  20.609  15.012  1.00 35.42  ? 164 ASN L C   1 
ATOM   10289 O O   . ASN F 3 164 ? 12.675  20.291  16.158  1.00 34.65  ? 164 ASN L O   1 
ATOM   10290 C CB  . ASN F 3 164 ? 11.618  22.718  15.064  1.00 39.72  ? 164 ASN L CB  1 
ATOM   10291 C CG  . ASN F 3 164 ? 10.368  22.064  14.513  1.00 39.37  ? 164 ASN L CG  1 
ATOM   10292 O OD1 . ASN F 3 164 ? 10.422  21.302  13.536  1.00 38.82  ? 164 ASN L OD1 1 
ATOM   10293 N ND2 . ASN F 3 164 ? 9.225   22.364  15.129  1.00 40.11  ? 164 ASN L ND2 1 
ATOM   10294 N N   . SER F 3 165 ? 13.516  19.744  14.124  1.00 31.66  ? 165 SER L N   1 
ATOM   10295 C CA  . SER F 3 165 ? 13.670  18.320  14.397  1.00 29.23  ? 165 SER L CA  1 
ATOM   10296 C C   . SER F 3 165 ? 15.037  17.815  13.967  1.00 28.87  ? 165 SER L C   1 
ATOM   10297 O O   . SER F 3 165 ? 15.663  18.419  13.137  1.00 30.36  ? 165 SER L O   1 
ATOM   10298 C CB  . SER F 3 165 ? 12.609  17.559  13.642  1.00 28.30  ? 165 SER L CB  1 
ATOM   10299 O OG  . SER F 3 165 ? 12.770  17.840  12.276  1.00 31.69  ? 165 SER L OG  1 
ATOM   10300 N N   . GLN F 3 166 ? 15.490  16.702  14.527  1.00 27.28  ? 166 GLN L N   1 
ATOM   10301 C CA  . GLN F 3 166 ? 16.767  16.105  14.144  1.00 27.11  ? 166 GLN L CA  1 
ATOM   10302 C C   . GLN F 3 166 ? 16.629  14.603  14.025  1.00 28.13  ? 166 GLN L C   1 
ATOM   10303 O O   . GLN F 3 166 ? 15.857  13.993  14.730  1.00 24.16  ? 166 GLN L O   1 
ATOM   10304 C CB  . GLN F 3 166 ? 17.853  16.408  15.155  1.00 36.18  ? 166 GLN L CB  1 
ATOM   10305 C CG  . GLN F 3 166 ? 18.317  17.830  15.133  1.00 39.07  ? 166 GLN L CG  1 
ATOM   10306 C CD  . GLN F 3 166 ? 19.253  18.150  16.292  1.00 41.26  ? 166 GLN L CD  1 
ATOM   10307 O OE1 . GLN F 3 166 ? 20.337  18.709  16.087  1.00 43.56  ? 166 GLN L OE1 1 
ATOM   10308 N NE2 . GLN F 3 166 ? 18.837  17.795  17.526  1.00 40.90  ? 166 GLN L NE2 1 
ATOM   10309 N N   . GLU F 3 167 ? 17.363  14.004  13.102  1.00 28.06  ? 167 GLU L N   1 
ATOM   10310 C CA  . GLU F 3 167 ? 17.257  12.574  12.893  1.00 26.64  ? 167 GLU L CA  1 
ATOM   10311 C C   . GLU F 3 167 ? 18.566  11.933  13.224  1.00 26.55  ? 167 GLU L C   1 
ATOM   10312 O O   . GLU F 3 167 ? 19.602  12.577  13.149  1.00 28.03  ? 167 GLU L O   1 
ATOM   10313 C CB  . GLU F 3 167 ? 16.926  12.264  11.451  1.00 27.21  ? 167 GLU L CB  1 
ATOM   10314 C CG  . GLU F 3 167 ? 15.475  12.310  11.103  1.00 27.90  ? 167 GLU L CG  1 
ATOM   10315 C CD  . GLU F 3 167 ? 15.229  11.946  9.636   1.00 29.50  ? 167 GLU L CD  1 
ATOM   10316 O OE1 . GLU F 3 167 ? 14.043  11.996  9.197   1.00 30.39  ? 167 GLU L OE1 1 
ATOM   10317 O OE2 . GLU F 3 167 ? 16.219  11.619  8.912   1.00 30.15  ? 167 GLU L OE2 1 
ATOM   10318 N N   . SER F 3 168 ? 18.508  10.664  13.603  1.00 25.28  ? 168 SER L N   1 
ATOM   10319 C CA  . SER F 3 168 ? 19.691  9.845   13.739  1.00 25.38  ? 168 SER L CA  1 
ATOM   10320 C C   . SER F 3 168 ? 19.336  8.440   13.284  1.00 22.14  ? 168 SER L C   1 
ATOM   10321 O O   . SER F 3 168 ? 18.245  7.970   13.574  1.00 25.95  ? 168 SER L O   1 
ATOM   10322 C CB  . SER F 3 168 ? 20.196  9.855   15.177  1.00 23.92  ? 168 SER L CB  1 
ATOM   10323 O OG  . SER F 3 168 ? 21.392  9.101   15.305  1.00 24.85  ? 168 SER L OG  1 
ATOM   10324 N N   . VAL F 3 169 ? 20.248  7.783   12.573  1.00 22.62  ? 169 VAL L N   1 
ATOM   10325 C CA  . VAL F 3 169 ? 19.996  6.462   12.016  1.00 22.04  ? 169 VAL L CA  1 
ATOM   10326 C C   . VAL F 3 169 ? 21.044  5.490   12.454  1.00 22.82  ? 169 VAL L C   1 
ATOM   10327 O O   . VAL F 3 169 ? 22.221  5.785   12.394  1.00 24.08  ? 169 VAL L O   1 
ATOM   10328 C CB  . VAL F 3 169 ? 19.995  6.459   10.434  1.00 25.65  ? 169 VAL L CB  1 
ATOM   10329 C CG1 . VAL F 3 169 ? 19.543  5.121   9.890   1.00 21.92  ? 169 VAL L CG1 1 
ATOM   10330 C CG2 . VAL F 3 169 ? 19.070  7.510   9.902   1.00 25.74  ? 169 VAL L CG2 1 
ATOM   10331 N N   . THR F 3 170 ? 20.639  4.294   12.836  1.00 22.51  ? 170 THR L N   1 
ATOM   10332 C CA  . THR F 3 170 ? 21.635  3.286   13.148  1.00 23.68  ? 170 THR L CA  1 
ATOM   10333 C C   . THR F 3 170 ? 22.376  2.745   11.902  1.00 27.44  ? 170 THR L C   1 
ATOM   10334 O O   . THR F 3 170 ? 21.964  2.929   10.756  1.00 26.96  ? 170 THR L O   1 
ATOM   10335 C CB  . THR F 3 170 ? 21.034  2.122   13.938  1.00 23.77  ? 170 THR L CB  1 
ATOM   10336 O OG1 . THR F 3 170 ? 20.108  1.398   13.113  1.00 24.85  ? 170 THR L OG1 1 
ATOM   10337 C CG2 . THR F 3 170 ? 20.323  2.643   15.169  1.00 23.59  ? 170 THR L CG2 1 
ATOM   10338 N N   . GLU F 3 171 ? 23.492  2.071   12.130  1.00 28.62  ? 171 GLU L N   1 
ATOM   10339 C CA  . GLU F 3 171 ? 24.101  1.340   11.056  1.00 28.94  ? 171 GLU L CA  1 
ATOM   10340 C C   . GLU F 3 171 ? 23.315  0.069   10.830  1.00 28.38  ? 171 GLU L C   1 
ATOM   10341 O O   . GLU F 3 171 ? 22.451  -0.297  11.621  1.00 27.35  ? 171 GLU L O   1 
ATOM   10342 C CB  . GLU F 3 171 ? 25.556  1.054   11.372  1.00 28.92  ? 171 GLU L CB  1 
ATOM   10343 C CG  . GLU F 3 171 ? 26.396  2.289   11.304  1.00 29.93  ? 171 GLU L CG  1 
ATOM   10344 C CD  . GLU F 3 171 ? 26.309  3.010   9.961   1.00 35.03  ? 171 GLU L CD  1 
ATOM   10345 O OE1 . GLU F 3 171 ? 25.463  3.920   9.812   1.00 33.76  ? 171 GLU L OE1 1 
ATOM   10346 O OE2 . GLU F 3 171 ? 27.093  2.675   9.050   1.00 36.52  ? 171 GLU L OE2 1 
ATOM   10347 N N   . GLN F 3 172 ? 23.596  -0.595  9.720   1.00 29.69  ? 172 GLN L N   1 
ATOM   10348 C CA  . GLN F 3 172 ? 22.833  -1.772  9.354   1.00 29.79  ? 172 GLN L CA  1 
ATOM   10349 C C   . GLN F 3 172 ? 23.004  -2.831  10.430  1.00 31.17  ? 172 GLN L C   1 
ATOM   10350 O O   . GLN F 3 172 ? 24.116  -3.114  10.863  1.00 32.44  ? 172 GLN L O   1 
ATOM   10351 C CB  . GLN F 3 172 ? 23.269  -2.268  7.992   1.00 30.57  ? 172 GLN L CB  1 
ATOM   10352 C CG  . GLN F 3 172 ? 22.666  -3.569  7.597   1.00 31.18  ? 172 GLN L CG  1 
ATOM   10353 C CD  . GLN F 3 172 ? 22.738  -3.781  6.108   1.00 32.15  ? 172 GLN L CD  1 
ATOM   10354 O OE1 . GLN F 3 172 ? 23.823  -3.960  5.545   1.00 33.79  ? 172 GLN L OE1 1 
ATOM   10355 N NE2 . GLN F 3 172 ? 21.583  -3.741  5.454   1.00 31.33  ? 172 GLN L NE2 1 
ATOM   10356 N N   . ASP F 3 173 ? 21.887  -3.385  10.877  1.00 31.47  ? 173 ASP L N   1 
ATOM   10357 C CA  . ASP F 3 173 ? 21.905  -4.375  11.933  1.00 34.03  ? 173 ASP L CA  1 
ATOM   10358 C C   . ASP F 3 173 ? 22.567  -5.682  11.524  1.00 36.69  ? 173 ASP L C   1 
ATOM   10359 O O   . ASP F 3 173 ? 22.173  -6.317  10.552  1.00 36.82  ? 173 ASP L O   1 
ATOM   10360 C CB  . ASP F 3 173 ? 20.494  -4.641  12.443  1.00 34.13  ? 173 ASP L CB  1 
ATOM   10361 C CG  . ASP F 3 173 ? 20.469  -5.698  13.531  1.00 36.87  ? 173 ASP L CG  1 
ATOM   10362 O OD1 . ASP F 3 173 ? 20.278  -6.888  13.185  1.00 38.85  ? 173 ASP L OD1 1 
ATOM   10363 O OD2 . ASP F 3 173 ? 20.671  -5.349  14.723  1.00 37.40  ? 173 ASP L OD2 1 
ATOM   10364 N N   . SER F 3 174 ? 23.570  -6.083  12.291  1.00 39.43  ? 174 SER L N   1 
ATOM   10365 C CA  . SER F 3 174 ? 24.356  -7.273  11.977  1.00 42.99  ? 174 SER L CA  1 
ATOM   10366 C C   . SER F 3 174 ? 23.520  -8.546  11.864  1.00 44.73  ? 174 SER L C   1 
ATOM   10367 O O   . SER F 3 174 ? 23.889  -9.457  11.127  1.00 46.62  ? 174 SER L O   1 
ATOM   10368 C CB  . SER F 3 174 ? 25.451  -7.479  13.023  1.00 45.92  ? 174 SER L CB  1 
ATOM   10369 O OG  . SER F 3 174 ? 24.886  -7.691  14.313  1.00 46.96  ? 174 SER L OG  1 
ATOM   10370 N N   . LYS F 3 175 ? 22.401  -8.611  12.586  1.00 44.46  ? 175 LYS L N   1 
ATOM   10371 C CA  . LYS F 3 175 ? 21.607  -9.832  12.641  1.00 46.26  ? 175 LYS L CA  1 
ATOM   10372 C C   . LYS F 3 175 ? 20.554  -9.903  11.561  1.00 44.95  ? 175 LYS L C   1 
ATOM   10373 O O   . LYS F 3 175 ? 20.464  -10.901 10.867  1.00 46.80  ? 175 LYS L O   1 
ATOM   10374 C CB  . LYS F 3 175 ? 20.956  -9.999  14.013  1.00 47.66  ? 175 LYS L CB  1 
ATOM   10375 C CG  . LYS F 3 175 ? 21.945  -10.094 15.172  1.00 50.10  ? 175 LYS L CG  1 
ATOM   10376 C CD  . LYS F 3 175 ? 22.938  -11.260 14.990  1.00 53.38  ? 175 LYS L CD  1 
ATOM   10377 C CE  . LYS F 3 175 ? 24.358  -10.775 14.596  1.00 66.21  ? 175 LYS L CE  1 
ATOM   10378 N NZ  . LYS F 3 175 ? 25.217  -11.844 13.972  1.00 68.74  ? 175 LYS L NZ  1 
ATOM   10379 N N   . ASP F 3 176 ? 19.751  -8.855  11.419  1.00 42.27  ? 176 ASP L N   1 
ATOM   10380 C CA  . ASP F 3 176 ? 18.657  -8.872  10.441  1.00 41.44  ? 176 ASP L CA  1 
ATOM   10381 C C   . ASP F 3 176 ? 18.812  -7.927  9.245   1.00 38.58  ? 176 ASP L C   1 
ATOM   10382 O O   . ASP F 3 176 ? 17.913  -7.839  8.418   1.00 38.18  ? 176 ASP L O   1 
ATOM   10383 C CB  . ASP F 3 176 ? 17.305  -8.645  11.129  1.00 42.25  ? 176 ASP L CB  1 
ATOM   10384 C CG  . ASP F 3 176 ? 17.160  -7.247  11.727  1.00 41.20  ? 176 ASP L CG  1 
ATOM   10385 O OD1 . ASP F 3 176 ? 17.699  -6.280  11.134  1.00 39.99  ? 176 ASP L OD1 1 
ATOM   10386 O OD2 . ASP F 3 176 ? 16.487  -7.112  12.788  1.00 41.78  ? 176 ASP L OD2 1 
ATOM   10387 N N   . SER F 3 177 ? 19.937  -7.214  9.192   1.00 37.01  ? 177 SER L N   1 
ATOM   10388 C CA  . SER F 3 177 ? 20.294  -6.300  8.106   1.00 34.78  ? 177 SER L CA  1 
ATOM   10389 C C   . SER F 3 177 ? 19.306  -5.155  7.921   1.00 32.29  ? 177 SER L C   1 
ATOM   10390 O O   . SER F 3 177 ? 19.180  -4.620  6.829   1.00 32.16  ? 177 SER L O   1 
ATOM   10391 C CB  . SER F 3 177 ? 20.503  -7.045  6.782   1.00 35.77  ? 177 SER L CB  1 
ATOM   10392 O OG  . SER F 3 177 ? 21.318  -8.192  6.938   1.00 37.56  ? 177 SER L OG  1 
ATOM   10393 N N   . THR F 3 178 ? 18.618  -4.770  8.985   1.00 30.57  ? 178 THR L N   1 
ATOM   10394 C CA  . THR F 3 178 ? 17.687  -3.651  8.900   1.00 28.79  ? 178 THR L CA  1 
ATOM   10395 C C   . THR F 3 178 ? 18.275  -2.384  9.527   1.00 27.40  ? 178 THR L C   1 
ATOM   10396 O O   . THR F 3 178 ? 19.345  -2.437  10.137  1.00 28.25  ? 178 THR L O   1 
ATOM   10397 C CB  . THR F 3 178 ? 16.342  -3.973  9.603   1.00 27.99  ? 178 THR L CB  1 
ATOM   10398 O OG1 . THR F 3 178 ? 16.571  -4.337  10.972  1.00 28.30  ? 178 THR L OG1 1 
ATOM   10399 C CG2 . THR F 3 178 ? 15.630  -5.112  8.904   1.00 29.73  ? 178 THR L CG2 1 
ATOM   10400 N N   . TYR F 3 179 ? 17.574  -1.255  9.393   1.00 25.63  ? 179 TYR L N   1 
ATOM   10401 C CA  . TYR F 3 179 ? 17.997  0.006   10.011  1.00 24.40  ? 179 TYR L CA  1 
ATOM   10402 C C   . TYR F 3 179 ? 16.942  0.495   10.994  1.00 24.41  ? 179 TYR L C   1 
ATOM   10403 O O   . TYR F 3 179 ? 15.745  0.150   10.845  1.00 25.14  ? 179 TYR L O   1 
ATOM   10404 C CB  . TYR F 3 179 ? 18.208  1.101   8.956   1.00 23.58  ? 179 TYR L CB  1 
ATOM   10405 C CG  . TYR F 3 179 ? 19.182  0.746   7.844   1.00 24.08  ? 179 TYR L CG  1 
ATOM   10406 C CD1 . TYR F 3 179 ? 20.537  1.036   7.965   1.00 24.26  ? 179 TYR L CD1 1 
ATOM   10407 C CD2 . TYR F 3 179 ? 18.735  0.123   6.671   1.00 24.51  ? 179 TYR L CD2 1 
ATOM   10408 C CE1 . TYR F 3 179 ? 21.410  0.719   6.980   1.00 25.14  ? 179 TYR L CE1 1 
ATOM   10409 C CE2 . TYR F 3 179 ? 19.612  -0.216  5.680   1.00 25.28  ? 179 TYR L CE2 1 
ATOM   10410 C CZ  . TYR F 3 179 ? 20.951  0.094   5.833   1.00 26.52  ? 179 TYR L CZ  1 
ATOM   10411 O OH  . TYR F 3 179 ? 21.846  -0.226  4.830   1.00 28.18  ? 179 TYR L OH  1 
ATOM   10412 N N   . SER F 3 180 ? 17.367  1.291   11.988  1.00 23.89  ? 180 SER L N   1 
ATOM   10413 C CA  . SER F 3 180 ? 16.421  2.025   12.831  1.00 23.51  ? 180 SER L CA  1 
ATOM   10414 C C   . SER F 3 180 ? 16.694  3.516   12.784  1.00 23.25  ? 180 SER L C   1 
ATOM   10415 O O   . SER F 3 180 ? 17.842  3.923   12.619  1.00 23.68  ? 180 SER L O   1 
ATOM   10416 C CB  . SER F 3 180 ? 16.434  1.506   14.259  1.00 21.72  ? 180 SER L CB  1 
ATOM   10417 O OG  . SER F 3 180 ? 16.067  0.140   14.250  1.00 26.73  ? 180 SER L OG  1 
ATOM   10418 N N   . LEU F 3 181 ? 15.646  4.324   12.906  1.00 20.10  ? 181 LEU L N   1 
ATOM   10419 C CA  . LEU F 3 181 ? 15.774  5.772   12.839  1.00 19.96  ? 181 LEU L CA  1 
ATOM   10420 C C   . LEU F 3 181 ? 15.010  6.384   13.977  1.00 23.05  ? 181 LEU L C   1 
ATOM   10421 O O   . LEU F 3 181 ? 14.000  5.833   14.423  1.00 20.12  ? 181 LEU L O   1 
ATOM   10422 C CB  . LEU F 3 181 ? 15.179  6.309   11.540  1.00 24.19  ? 181 LEU L CB  1 
ATOM   10423 C CG  . LEU F 3 181 ? 15.271  7.815   11.236  1.00 24.72  ? 181 LEU L CG  1 
ATOM   10424 C CD1 . LEU F 3 181 ? 15.554  8.047   9.771   1.00 21.22  ? 181 LEU L CD1 1 
ATOM   10425 C CD2 . LEU F 3 181 ? 14.033  8.592   11.642  1.00 20.61  ? 181 LEU L CD2 1 
ATOM   10426 N N   . SER F 3 182 ? 15.476  7.536   14.445  1.00 23.08  ? 182 SER L N   1 
ATOM   10427 C CA  . SER F 3 182 ? 14.717  8.304   15.417  1.00 23.00  ? 182 SER L CA  1 
ATOM   10428 C C   . SER F 3 182 ? 14.607  9.749   14.944  1.00 23.09  ? 182 SER L C   1 
ATOM   10429 O O   . SER F 3 182 ? 15.556  10.298  14.386  1.00 23.27  ? 182 SER L O   1 
ATOM   10430 C CB  . SER F 3 182 ? 15.408  8.266   16.775  1.00 23.58  ? 182 SER L CB  1 
ATOM   10431 O OG  . SER F 3 182 ? 16.316  9.355   16.872  1.00 24.32  ? 182 SER L OG  1 
ATOM   10432 N N   . SER F 3 183 ? 13.453  10.364  15.171  1.00 23.45  ? 183 SER L N   1 
ATOM   10433 C CA  . SER F 3 183 ? 13.289  11.786  14.888  1.00 24.46  ? 183 SER L CA  1 
ATOM   10434 C C   . SER F 3 183 ? 12.943  12.563  16.163  1.00 25.45  ? 183 SER L C   1 
ATOM   10435 O O   . SER F 3 183 ? 11.999  12.215  16.865  1.00 25.61  ? 183 SER L O   1 
ATOM   10436 C CB  . SER F 3 183 ? 12.202  11.993  13.835  1.00 24.93  ? 183 SER L CB  1 
ATOM   10437 O OG  . SER F 3 183 ? 11.922  13.364  13.663  1.00 26.35  ? 183 SER L OG  1 
ATOM   10438 N N   . THR F 3 184 ? 13.702  13.611  16.461  1.00 26.67  ? 184 THR L N   1 
ATOM   10439 C CA  . THR F 3 184 ? 13.414  14.394  17.642  1.00 28.40  ? 184 THR L CA  1 
ATOM   10440 C C   . THR F 3 184 ? 12.957  15.856  17.415  1.00 30.44  ? 184 THR L C   1 
ATOM   10441 O O   . THR F 3 184 ? 13.759  16.751  17.121  1.00 31.81  ? 184 THR L O   1 
ATOM   10442 C CB  . THR F 3 184 ? 14.557  14.334  18.689  1.00 26.91  ? 184 THR L CB  1 
ATOM   10443 O OG1 . THR F 3 184 ? 14.910  12.968  18.963  1.00 26.27  ? 184 THR L OG1 1 
ATOM   10444 C CG2 . THR F 3 184 ? 14.098  15.007  19.988  1.00 28.02  ? 184 THR L CG2 1 
ATOM   10445 N N   . LEU F 3 185 ? 11.653  16.070  17.601  1.00 30.75  ? 185 LEU L N   1 
ATOM   10446 C CA  . LEU F 3 185 ? 11.048  17.391  17.628  1.00 32.32  ? 185 LEU L CA  1 
ATOM   10447 C C   . LEU F 3 185 ? 11.300  18.048  18.972  1.00 34.05  ? 185 LEU L C   1 
ATOM   10448 O O   . LEU F 3 185 ? 11.031  17.445  20.020  1.00 34.18  ? 185 LEU L O   1 
ATOM   10449 C CB  . LEU F 3 185 ? 9.545   17.250  17.462  1.00 32.33  ? 185 LEU L CB  1 
ATOM   10450 C CG  . LEU F 3 185 ? 8.762   18.549  17.335  1.00 34.18  ? 185 LEU L CG  1 
ATOM   10451 C CD1 . LEU F 3 185 ? 9.109   19.260  16.023  1.00 35.00  ? 185 LEU L CD1 1 
ATOM   10452 C CD2 . LEU F 3 185 ? 7.295   18.239  17.409  1.00 34.68  ? 185 LEU L CD2 1 
ATOM   10453 N N   . THR F 3 186 ? 11.782  19.289  18.947  1.00 35.75  ? 186 THR L N   1 
ATOM   10454 C CA  . THR F 3 186 ? 12.122  20.007  20.174  1.00 37.45  ? 186 THR L CA  1 
ATOM   10455 C C   . THR F 3 186 ? 11.431  21.355  20.263  1.00 40.26  ? 186 THR L C   1 
ATOM   10456 O O   . THR F 3 186 ? 11.529  22.168  19.351  1.00 41.47  ? 186 THR L O   1 
ATOM   10457 C CB  . THR F 3 186 ? 13.634  20.235  20.309  1.00 37.87  ? 186 THR L CB  1 
ATOM   10458 O OG1 . THR F 3 186 ? 14.316  18.975  20.256  1.00 36.16  ? 186 THR L OG1 1 
ATOM   10459 C CG2 . THR F 3 186 ? 13.942  20.917  21.636  1.00 39.84  ? 186 THR L CG2 1 
ATOM   10460 N N   . LEU F 3 187 ? 10.742  21.593  21.374  1.00 41.85  ? 187 LEU L N   1 
ATOM   10461 C CA  . LEU F 3 187 ? 9.963   22.809  21.562  1.00 44.55  ? 187 LEU L CA  1 
ATOM   10462 C C   . LEU F 3 187 ? 10.280  23.443  22.897  1.00 47.48  ? 187 LEU L C   1 
ATOM   10463 O O   . LEU F 3 187 ? 10.756  22.775  23.811  1.00 47.17  ? 187 LEU L O   1 
ATOM   10464 C CB  . LEU F 3 187 ? 8.483   22.460  21.508  1.00 44.02  ? 187 LEU L CB  1 
ATOM   10465 C CG  . LEU F 3 187 ? 8.101   21.904  20.148  1.00 42.26  ? 187 LEU L CG  1 
ATOM   10466 C CD1 . LEU F 3 187 ? 6.692   21.381  20.134  1.00 42.10  ? 187 LEU L CD1 1 
ATOM   10467 C CD2 . LEU F 3 187 ? 8.292   23.023  19.137  1.00 43.89  ? 187 LEU L CD2 1 
ATOM   10468 N N   . SER F 3 188 ? 10.026  24.733  23.026  1.00 51.00  ? 188 SER L N   1 
ATOM   10469 C CA  . SER F 3 188 ? 10.061  25.304  24.351  1.00 54.30  ? 188 SER L CA  1 
ATOM   10470 C C   . SER F 3 188 ? 8.845   24.732  25.090  1.00 54.62  ? 188 SER L C   1 
ATOM   10471 O O   . SER F 3 188 ? 7.878   24.307  24.447  1.00 53.42  ? 188 SER L O   1 
ATOM   10472 C CB  . SER F 3 188 ? 10.038  26.837  24.300  1.00 57.80  ? 188 SER L CB  1 
ATOM   10473 O OG  . SER F 3 188 ? 8.772   27.343  23.909  1.00 58.88  ? 188 SER L OG  1 
ATOM   10474 N N   . LYS F 3 189 ? 8.912   24.675  26.425  1.00 56.45  ? 189 LYS L N   1 
ATOM   10475 C CA  . LYS F 3 189 ? 7.749   24.295  27.232  1.00 57.46  ? 189 LYS L CA  1 
ATOM   10476 C C   . LYS F 3 189 ? 6.590   25.210  26.845  1.00 59.20  ? 189 LYS L C   1 
ATOM   10477 O O   . LYS F 3 189 ? 5.485   24.748  26.547  1.00 58.64  ? 189 LYS L O   1 
ATOM   10478 C CB  . LYS F 3 189 ? 8.058   24.441  28.724  1.00 49.82  ? 189 LYS L CB  1 
ATOM   10479 C CG  . LYS F 3 189 ? 6.972   23.944  29.677  1.00 56.22  ? 189 LYS L CG  1 
ATOM   10480 C CD  . LYS F 3 189 ? 6.593   25.013  30.711  1.00 54.98  ? 189 LYS L CD  1 
ATOM   10481 C CE  . LYS F 3 189 ? 6.284   24.411  32.082  1.00 57.02  ? 189 LYS L CE  1 
ATOM   10482 N NZ  . LYS F 3 189 ? 7.505   24.131  32.906  1.00 57.93  ? 189 LYS L NZ  1 
ATOM   10483 N N   . ALA F 3 190 ? 6.878   26.511  26.829  1.00 61.81  ? 190 ALA L N   1 
ATOM   10484 C CA  . ALA F 3 190 ? 5.914   27.548  26.489  1.00 64.43  ? 190 ALA L CA  1 
ATOM   10485 C C   . ALA F 3 190 ? 5.135   27.213  25.222  1.00 63.10  ? 190 ALA L C   1 
ATOM   10486 O O   . ALA F 3 190 ? 3.910   27.226  25.222  1.00 64.29  ? 190 ALA L O   1 
ATOM   10487 C CB  . ALA F 3 190 ? 6.622   28.893  26.344  1.00 66.71  ? 190 ALA L CB  1 
ATOM   10488 N N   . ASP F 3 191 ? 5.853   26.893  24.151  1.00 60.55  ? 191 ASP L N   1 
ATOM   10489 C CA  . ASP F 3 191 ? 5.232   26.660  22.855  1.00 59.36  ? 191 ASP L CA  1 
ATOM   10490 C C   . ASP F 3 191 ? 4.534   25.307  22.855  1.00 57.32  ? 191 ASP L C   1 
ATOM   10491 O O   . ASP F 3 191 ? 3.454   25.150  22.290  1.00 57.96  ? 191 ASP L O   1 
ATOM   10492 C CB  . ASP F 3 191 ? 6.277   26.738  21.728  1.00 58.46  ? 191 ASP L CB  1 
ATOM   10493 C CG  . ASP F 3 191 ? 5.642   26.835  20.330  1.00 59.28  ? 191 ASP L CG  1 
ATOM   10494 O OD1 . ASP F 3 191 ? 4.615   27.548  20.175  1.00 62.02  ? 191 ASP L OD1 1 
ATOM   10495 O OD2 . ASP F 3 191 ? 6.169   26.201  19.377  1.00 57.52  ? 191 ASP L OD2 1 
ATOM   10496 N N   . TYR F 3 192 ? 5.151   24.331  23.507  1.00 55.85  ? 192 TYR L N   1 
ATOM   10497 C CA  . TYR F 3 192 ? 4.605   22.988  23.546  1.00 54.61  ? 192 TYR L CA  1 
ATOM   10498 C C   . TYR F 3 192 ? 3.205   22.983  24.135  1.00 56.57  ? 192 TYR L C   1 
ATOM   10499 O O   . TYR F 3 192 ? 2.341   22.237  23.700  1.00 55.95  ? 192 TYR L O   1 
ATOM   10500 C CB  . TYR F 3 192 ? 5.525   22.070  24.343  1.00 53.55  ? 192 TYR L CB  1 
ATOM   10501 C CG  . TYR F 3 192 ? 4.939   20.708  24.593  1.00 52.98  ? 192 TYR L CG  1 
ATOM   10502 C CD1 . TYR F 3 192 ? 4.850   19.765  23.575  1.00 50.95  ? 192 TYR L CD1 1 
ATOM   10503 C CD2 . TYR F 3 192 ? 4.476   20.357  25.857  1.00 54.66  ? 192 TYR L CD2 1 
ATOM   10504 C CE1 . TYR F 3 192 ? 4.307   18.504  23.815  1.00 50.45  ? 192 TYR L CE1 1 
ATOM   10505 C CE2 . TYR F 3 192 ? 3.938   19.103  26.108  1.00 54.18  ? 192 TYR L CE2 1 
ATOM   10506 C CZ  . TYR F 3 192 ? 3.848   18.181  25.086  1.00 52.13  ? 192 TYR L CZ  1 
ATOM   10507 O OH  . TYR F 3 192 ? 3.313   16.939  25.347  1.00 52.16  ? 192 TYR L OH  1 
ATOM   10508 N N   . GLU F 3 193 ? 2.971   23.840  25.115  1.00 59.39  ? 193 GLU L N   1 
ATOM   10509 C CA  . GLU F 3 193 ? 1.680   23.851  25.796  1.00 62.17  ? 193 GLU L CA  1 
ATOM   10510 C C   . GLU F 3 193 ? 0.602   24.630  25.041  1.00 64.04  ? 193 GLU L C   1 
ATOM   10511 O O   . GLU F 3 193 ? -0.499  24.823  25.549  1.00 66.15  ? 193 GLU L O   1 
ATOM   10512 C CB  . GLU F 3 193 ? 1.827   24.388  27.221  1.00 64.96  ? 193 GLU L CB  1 
ATOM   10513 C CG  . GLU F 3 193 ? 2.474   23.407  28.187  1.00 64.35  ? 193 GLU L CG  1 
ATOM   10514 C CD  . GLU F 3 193 ? 2.816   24.051  29.520  1.00 67.49  ? 193 GLU L CD  1 
ATOM   10515 O OE1 . GLU F 3 193 ? 2.280   25.150  29.803  1.00 70.44  ? 193 GLU L OE1 1 
ATOM   10516 O OE2 . GLU F 3 193 ? 3.627   23.468  30.279  1.00 67.33  ? 193 GLU L OE2 1 
ATOM   10517 N N   . LYS F 3 194 ? 0.915   25.066  23.826  1.00 63.63  ? 194 LYS L N   1 
ATOM   10518 C CA  . LYS F 3 194 ? -0.016  25.889  23.066  1.00 66.43  ? 194 LYS L CA  1 
ATOM   10519 C C   . LYS F 3 194 ? -0.804  25.045  22.081  1.00 66.18  ? 194 LYS L C   1 
ATOM   10520 O O   . LYS F 3 194 ? -1.807  25.500  21.528  1.00 69.33  ? 194 LYS L O   1 
ATOM   10521 C CB  . LYS F 3 194 ? 0.718   27.017  22.335  1.00 67.02  ? 194 LYS L CB  1 
ATOM   10522 C CG  . LYS F 3 194 ? 1.322   28.062  23.253  1.00 68.66  ? 194 LYS L CG  1 
ATOM   10523 C CD  . LYS F 3 194 ? 1.119   29.472  22.708  1.00 71.79  ? 194 LYS L CD  1 
ATOM   10524 C CE  . LYS F 3 194 ? 2.414   30.271  22.740  1.00 71.94  ? 194 LYS L CE  1 
ATOM   10525 N NZ  . LYS F 3 194 ? 3.531   29.513  22.097  1.00 68.43  ? 194 LYS L NZ  1 
ATOM   10526 N N   . HIS F 3 195 ? -0.352  23.815  21.874  1.00 62.88  ? 195 HIS L N   1 
ATOM   10527 C CA  . HIS F 3 195 ? -0.973  22.935  20.905  1.00 62.06  ? 195 HIS L CA  1 
ATOM   10528 C C   . HIS F 3 195 ? -1.380  21.659  21.597  1.00 61.21  ? 195 HIS L C   1 
ATOM   10529 O O   . HIS F 3 195 ? -0.966  21.409  22.718  1.00 60.75  ? 195 HIS L O   1 
ATOM   10530 C CB  . HIS F 3 195 ? -0.004  22.652  19.768  1.00 59.39  ? 195 HIS L CB  1 
ATOM   10531 C CG  . HIS F 3 195 ? 0.717   23.873  19.292  1.00 60.19  ? 195 HIS L CG  1 
ATOM   10532 N ND1 . HIS F 3 195 ? 0.078   24.909  18.646  1.00 63.26  ? 195 HIS L ND1 1 
ATOM   10533 C CD2 . HIS F 3 195 ? 2.017   24.239  19.402  1.00 58.93  ? 195 HIS L CD2 1 
ATOM   10534 C CE1 . HIS F 3 195 ? 0.954   25.859  18.368  1.00 63.87  ? 195 HIS L CE1 1 
ATOM   10535 N NE2 . HIS F 3 195 ? 2.137   25.477  18.816  1.00 61.31  ? 195 HIS L NE2 1 
ATOM   10536 N N   . LYS F 3 196 ? -2.206  20.855  20.946  1.00 61.41  ? 196 LYS L N   1 
ATOM   10537 C CA  . LYS F 3 196 ? -2.719  19.669  21.607  1.00 61.20  ? 196 LYS L CA  1 
ATOM   10538 C C   . LYS F 3 196 ? -2.298  18.373  20.921  1.00 58.57  ? 196 LYS L C   1 
ATOM   10539 O O   . LYS F 3 196 ? -1.876  17.430  21.587  1.00 45.33  ? 196 LYS L O   1 
ATOM   10540 C CB  . LYS F 3 196 ? -4.243  19.750  21.750  1.00 64.92  ? 196 LYS L CB  1 
ATOM   10541 C CG  . LYS F 3 196 ? -4.884  18.464  22.233  1.00 53.78  ? 196 LYS L CG  1 
ATOM   10542 C CD  . LYS F 3 196 ? -6.340  18.397  21.822  1.00 57.45  ? 196 LYS L CD  1 
ATOM   10543 C CE  . LYS F 3 196 ? -6.897  16.980  21.959  1.00 61.53  ? 196 LYS L CE  1 
ATOM   10544 N NZ  . LYS F 3 196 ? -8.397  16.928  21.844  1.00 66.05  ? 196 LYS L NZ  1 
ATOM   10545 N N   . VAL F 3 197 ? -2.425  18.321  19.598  1.00 46.51  ? 197 VAL L N   1 
ATOM   10546 C CA  . VAL F 3 197 ? -2.121  17.095  18.861  1.00 44.51  ? 197 VAL L CA  1 
ATOM   10547 C C   . VAL F 3 197 ? -0.716  17.093  18.270  1.00 41.37  ? 197 VAL L C   1 
ATOM   10548 O O   . VAL F 3 197 ? -0.327  18.023  17.567  1.00 41.49  ? 197 VAL L O   1 
ATOM   10549 C CB  . VAL F 3 197 ? -3.148  16.811  17.758  1.00 46.60  ? 197 VAL L CB  1 
ATOM   10550 C CG1 . VAL F 3 197 ? -2.810  15.514  17.051  1.00 44.77  ? 197 VAL L CG1 1 
ATOM   10551 C CG2 . VAL F 3 197 ? -4.517  16.730  18.360  1.00 50.05  ? 197 VAL L CG2 1 
ATOM   10552 N N   . TYR F 3 198 ? 0.035   16.042  18.594  1.00 39.01  ? 198 TYR L N   1 
ATOM   10553 C CA  . TYR F 3 198 ? 1.396   15.840  18.120  1.00 40.06  ? 198 TYR L CA  1 
ATOM   10554 C C   . TYR F 3 198 ? 1.426   14.503  17.404  1.00 38.98  ? 198 TYR L C   1 
ATOM   10555 O O   . TYR F 3 198 ? 0.942   13.499  17.934  1.00 39.18  ? 198 TYR L O   1 
ATOM   10556 C CB  . TYR F 3 198 ? 2.385   15.857  19.290  1.00 34.90  ? 198 TYR L CB  1 
ATOM   10557 C CG  . TYR F 3 198 ? 2.508   17.213  19.918  1.00 36.15  ? 198 TYR L CG  1 
ATOM   10558 C CD1 . TYR F 3 198 ? 3.539   18.046  19.573  1.00 35.38  ? 198 TYR L CD1 1 
ATOM   10559 C CD2 . TYR F 3 198 ? 1.571   17.665  20.843  1.00 38.53  ? 198 TYR L CD2 1 
ATOM   10560 C CE1 . TYR F 3 198 ? 3.646   19.278  20.114  1.00 36.89  ? 198 TYR L CE1 1 
ATOM   10561 C CE2 . TYR F 3 198 ? 1.664   18.905  21.394  1.00 39.96  ? 198 TYR L CE2 1 
ATOM   10562 C CZ  . TYR F 3 198 ? 2.706   19.712  21.021  1.00 39.13  ? 198 TYR L CZ  1 
ATOM   10563 O OH  . TYR F 3 198 ? 2.835   20.966  21.551  1.00 41.80  ? 198 TYR L OH  1 
ATOM   10564 N N   . ALA F 3 199 ? 1.962   14.507  16.188  1.00 38.38  ? 199 ALA L N   1 
ATOM   10565 C CA  . ALA F 3 199 ? 1.952   13.331  15.318  1.00 37.83  ? 199 ALA L CA  1 
ATOM   10566 C C   . ALA F 3 199 ? 3.204   13.298  14.478  1.00 35.99  ? 199 ALA L C   1 
ATOM   10567 O O   . ALA F 3 199 ? 3.749   14.331  14.118  1.00 36.11  ? 199 ALA L O   1 
ATOM   10568 C CB  . ALA F 3 199 ? 0.736   13.342  14.406  1.00 39.91  ? 199 ALA L CB  1 
ATOM   10569 N N   . CYS F 3 200 ? 3.674   12.108  14.168  1.00 34.66  ? 200 CYS L N   1 
ATOM   10570 C CA  . CYS F 3 200 ? 4.693   12.014  13.146  1.00 33.89  ? 200 CYS L CA  1 
ATOM   10571 C C   . CYS F 3 200 ? 4.161   11.060  12.115  1.00 34.96  ? 200 CYS L C   1 
ATOM   10572 O O   . CYS F 3 200 ? 3.693   9.973   12.451  1.00 35.19  ? 200 CYS L O   1 
ATOM   10573 C CB  . CYS F 3 200 ? 6.061   11.575  13.701  1.00 31.81  ? 200 CYS L CB  1 
ATOM   10574 S SG  . CYS F 3 200 ? 6.165   9.889   14.358  1.00 41.43  ? 200 CYS L SG  1 
ATOM   10575 N N   . GLU F 3 201 ? 4.176   11.509  10.866  1.00 35.97  ? 201 GLU L N   1 
ATOM   10576 C CA  . GLU F 3 201 ? 3.705   10.723  9.741   1.00 37.12  ? 201 GLU L CA  1 
ATOM   10577 C C   . GLU F 3 201 ? 4.934   10.069  9.158   1.00 34.61  ? 201 GLU L C   1 
ATOM   10578 O O   . GLU F 3 201 ? 5.918   10.733  8.939   1.00 33.78  ? 201 GLU L O   1 
ATOM   10579 C CB  . GLU F 3 201 ? 3.065   11.658  8.722   1.00 40.61  ? 201 GLU L CB  1 
ATOM   10580 C CG  . GLU F 3 201 ? 2.693   11.048  7.375   1.00 43.28  ? 201 GLU L CG  1 
ATOM   10581 C CD  . GLU F 3 201 ? 1.654   11.902  6.631   1.00 47.53  ? 201 GLU L CD  1 
ATOM   10582 O OE1 . GLU F 3 201 ? 1.187   12.924  7.193   1.00 48.81  ? 201 GLU L OE1 1 
ATOM   10583 O OE2 . GLU F 3 201 ? 1.282   11.551  5.494   1.00 49.90  ? 201 GLU L OE2 1 
ATOM   10584 N N   . VAL F 3 202 ? 4.894   8.768   8.936   1.00 34.04  ? 202 VAL L N   1 
ATOM   10585 C CA  . VAL F 3 202 ? 6.029   8.069   8.362   1.00 28.56  ? 202 VAL L CA  1 
ATOM   10586 C C   . VAL F 3 202 ? 5.784   7.482   6.947   1.00 33.45  ? 202 VAL L C   1 
ATOM   10587 O O   . VAL F 3 202 ? 4.995   6.537   6.792   1.00 31.56  ? 202 VAL L O   1 
ATOM   10588 C CB  . VAL F 3 202 ? 6.428   6.915   9.287   1.00 28.97  ? 202 VAL L CB  1 
ATOM   10589 C CG1 . VAL F 3 202 ? 7.495   6.053   8.626   1.00 26.10  ? 202 VAL L CG1 1 
ATOM   10590 C CG2 . VAL F 3 202 ? 6.874   7.443   10.634  1.00 25.55  ? 202 VAL L CG2 1 
ATOM   10591 N N   . THR F 3 203 ? 6.451   8.001   5.910   1.00 33.87  ? 203 THR L N   1 
ATOM   10592 C CA  . THR F 3 203 ? 6.369   7.299   4.607   1.00 35.79  ? 203 THR L CA  1 
ATOM   10593 C C   . THR F 3 203 ? 7.590   6.407   4.320   1.00 34.06  ? 203 THR L C   1 
ATOM   10594 O O   . THR F 3 203 ? 8.708   6.753   4.649   1.00 32.04  ? 203 THR L O   1 
ATOM   10595 C CB  . THR F 3 203 ? 5.992   8.215   3.379   1.00 42.14  ? 203 THR L CB  1 
ATOM   10596 O OG1 . THR F 3 203 ? 7.167   8.659   2.688   1.00 41.73  ? 203 THR L OG1 1 
ATOM   10597 C CG2 . THR F 3 203 ? 5.151   9.412   3.823   1.00 43.48  ? 203 THR L CG2 1 
ATOM   10598 N N   . HIS F 3 204 ? 7.350   5.242   3.735   1.00 35.05  ? 204 HIS L N   1 
ATOM   10599 C CA  . HIS F 3 204 ? 8.420   4.301   3.479   1.00 34.30  ? 204 HIS L CA  1 
ATOM   10600 C C   . HIS F 3 204 ? 8.018   3.260   2.442   1.00 37.20  ? 204 HIS L C   1 
ATOM   10601 O O   . HIS F 3 204 ? 6.856   2.825   2.375   1.00 39.03  ? 204 HIS L O   1 
ATOM   10602 C CB  . HIS F 3 204 ? 8.836   3.620   4.771   1.00 31.81  ? 204 HIS L CB  1 
ATOM   10603 C CG  . HIS F 3 204 ? 9.967   2.649   4.615   1.00 31.09  ? 204 HIS L CG  1 
ATOM   10604 N ND1 . HIS F 3 204 ? 9.783   1.354   4.192   1.00 32.26  ? 204 HIS L ND1 1 
ATOM   10605 C CD2 . HIS F 3 204 ? 11.293  2.776   4.868   1.00 29.72  ? 204 HIS L CD2 1 
ATOM   10606 C CE1 . HIS F 3 204 ? 10.949  0.724   4.181   1.00 31.46  ? 204 HIS L CE1 1 
ATOM   10607 N NE2 . HIS F 3 204 ? 11.882  1.566   4.584   1.00 29.87  ? 204 HIS L NE2 1 
ATOM   10608 N N   . GLN F 3 205 ? 9.009   2.862   1.647   1.00 37.64  ? 205 GLN L N   1 
ATOM   10609 C CA  . GLN F 3 205 ? 8.843   1.899   0.571   1.00 40.03  ? 205 GLN L CA  1 
ATOM   10610 C C   . GLN F 3 205 ? 8.046   0.651   0.949   1.00 41.03  ? 205 GLN L C   1 
ATOM   10611 O O   . GLN F 3 205 ? 7.424   0.044   0.083   1.00 43.94  ? 205 GLN L O   1 
ATOM   10612 C CB  . GLN F 3 205 ? 10.218  1.478   0.055   1.00 39.48  ? 205 GLN L CB  1 
ATOM   10613 C CG  . GLN F 3 205 ? 10.182  0.692   -1.249  1.00 42.22  ? 205 GLN L CG  1 
ATOM   10614 C CD  . GLN F 3 205 ? 11.544  0.542   -1.883  1.00 42.06  ? 205 GLN L CD  1 
ATOM   10615 O OE1 . GLN F 3 205 ? 12.522  1.163   -1.451  1.00 40.17  ? 205 GLN L OE1 1 
ATOM   10616 N NE2 . GLN F 3 205 ? 11.619  -0.281  -2.920  1.00 44.43  ? 205 GLN L NE2 1 
ATOM   10617 N N   . GLY F 3 206 ? 8.062   0.271   2.226   1.00 39.21  ? 206 GLY L N   1 
ATOM   10618 C CA  . GLY F 3 206 ? 7.380   -0.926  2.687   1.00 40.47  ? 206 GLY L CA  1 
ATOM   10619 C C   . GLY F 3 206 ? 6.000   -0.701  3.273   1.00 42.17  ? 206 GLY L C   1 
ATOM   10620 O O   . GLY F 3 206 ? 5.348   -1.652  3.730   1.00 43.37  ? 206 GLY L O   1 
ATOM   10621 N N   . LEU F 3 207 ? 5.551   0.552   3.268   1.00 42.72  ? 207 LEU L N   1 
ATOM   10622 C CA  . LEU F 3 207 ? 4.187   0.866   3.683   1.00 45.15  ? 207 LEU L CA  1 
ATOM   10623 C C   . LEU F 3 207 ? 3.331   1.298   2.483   1.00 49.29  ? 207 LEU L C   1 
ATOM   10624 O O   . LEU F 3 207 ? 3.681   2.238   1.771   1.00 49.58  ? 207 LEU L O   1 
ATOM   10625 C CB  . LEU F 3 207 ? 4.183   1.977   4.731   1.00 43.10  ? 207 LEU L CB  1 
ATOM   10626 C CG  . LEU F 3 207 ? 4.969   1.811   6.031   1.00 40.17  ? 207 LEU L CG  1 
ATOM   10627 C CD1 . LEU F 3 207 ? 5.023   3.153   6.758   1.00 38.74  ? 207 LEU L CD1 1 
ATOM   10628 C CD2 . LEU F 3 207 ? 4.392   0.719   6.915   1.00 40.77  ? 207 LEU L CD2 1 
ATOM   10629 N N   . SER F 3 208 ? 2.203   0.623   2.272   1.00 52.88  ? 208 SER L N   1 
ATOM   10630 C CA  . SER F 3 208 ? 1.331   0.939   1.140   1.00 57.11  ? 208 SER L CA  1 
ATOM   10631 C C   . SER F 3 208 ? 0.765   2.356   1.264   1.00 57.50  ? 208 SER L C   1 
ATOM   10632 O O   . SER F 3 208 ? 0.459   3.015   0.264   1.00 60.20  ? 208 SER L O   1 
ATOM   10633 C CB  . SER F 3 208 ? 0.214   -0.112  0.985   1.00 61.24  ? 208 SER L CB  1 
ATOM   10634 O OG  . SER F 3 208 ? -0.172  -0.653  2.245   1.00 60.57  ? 208 SER L OG  1 
ATOM   10635 N N   . SER F 3 209 ? 0.634   2.820   2.500   1.00 55.02  ? 209 SER L N   1 
ATOM   10636 C CA  . SER F 3 209 ? 0.207   4.184   2.761   1.00 55.02  ? 209 SER L CA  1 
ATOM   10637 C C   . SER F 3 209 ? 1.029   4.684   3.926   1.00 51.22  ? 209 SER L C   1 
ATOM   10638 O O   . SER F 3 209 ? 1.431   3.891   4.790   1.00 49.16  ? 209 SER L O   1 
ATOM   10639 C CB  . SER F 3 209 ? -1.275  4.233   3.130   1.00 57.58  ? 209 SER L CB  1 
ATOM   10640 O OG  . SER F 3 209 ? -2.073  3.726   2.077   1.00 61.62  ? 209 SER L OG  1 
ATOM   10641 N N   . PRO F 3 210 ? 1.281   5.999   3.963   1.00 50.61  ? 210 PRO L N   1 
ATOM   10642 C CA  . PRO F 3 210 ? 1.998   6.600   5.096   1.00 47.04  ? 210 PRO L CA  1 
ATOM   10643 C C   . PRO F 3 210 ? 1.375   6.183   6.432   1.00 45.98  ? 210 PRO L C   1 
ATOM   10644 O O   . PRO F 3 210 ? 0.203   5.829   6.501   1.00 48.61  ? 210 PRO L O   1 
ATOM   10645 C CB  . PRO F 3 210 ? 1.816   8.102   4.866   1.00 48.34  ? 210 PRO L CB  1 
ATOM   10646 C CG  . PRO F 3 210 ? 1.589   8.230   3.371   1.00 51.45  ? 210 PRO L CG  1 
ATOM   10647 C CD  . PRO F 3 210 ? 0.863   6.993   2.958   1.00 53.47  ? 210 PRO L CD  1 
ATOM   10648 N N   . VAL F 3 211 ? 2.166   6.203   7.490   1.00 42.54  ? 211 VAL L N   1 
ATOM   10649 C CA  . VAL F 3 211 ? 1.665   5.802   8.790   1.00 41.88  ? 211 VAL L CA  1 
ATOM   10650 C C   . VAL F 3 211 ? 1.784   6.939   9.780   1.00 40.33  ? 211 VAL L C   1 
ATOM   10651 O O   . VAL F 3 211 ? 2.829   7.557   9.888   1.00 32.41  ? 211 VAL L O   1 
ATOM   10652 C CB  . VAL F 3 211 ? 2.391   4.572   9.302   1.00 34.10  ? 211 VAL L CB  1 
ATOM   10653 C CG1 . VAL F 3 211 ? 2.169   4.407   10.777  1.00 33.66  ? 211 VAL L CG1 1 
ATOM   10654 C CG2 . VAL F 3 211 ? 1.875   3.376   8.579   1.00 36.22  ? 211 VAL L CG2 1 
ATOM   10655 N N   . THR F 3 212 ? 0.694   7.241   10.474  1.00 41.89  ? 212 THR L N   1 
ATOM   10656 C CA  . THR F 3 212 ? 0.748   8.266   11.502  1.00 40.99  ? 212 THR L CA  1 
ATOM   10657 C C   . THR F 3 212 ? 0.596   7.643   12.877  1.00 40.30  ? 212 THR L C   1 
ATOM   10658 O O   . THR F 3 212 ? -0.210  6.732   13.091  1.00 41.85  ? 212 THR L O   1 
ATOM   10659 C CB  . THR F 3 212 ? -0.300  9.379   11.300  1.00 43.92  ? 212 THR L CB  1 
ATOM   10660 O OG1 . THR F 3 212 ? -0.156  9.948   9.991   1.00 45.17  ? 212 THR L OG1 1 
ATOM   10661 C CG2 . THR F 3 212 ? -0.094  10.473  12.321  1.00 43.07  ? 212 THR L CG2 1 
ATOM   10662 N N   . LYS F 3 213 ? 1.436   8.119   13.784  1.00 38.24  ? 213 LYS L N   1 
ATOM   10663 C CA  . LYS F 3 213 ? 1.352   7.785   15.178  1.00 33.29  ? 213 LYS L CA  1 
ATOM   10664 C C   . LYS F 3 213 ? 1.198   9.133   15.832  1.00 37.99  ? 213 LYS L C   1 
ATOM   10665 O O   . LYS F 3 213 ? 1.797   10.106  15.382  1.00 36.94  ? 213 LYS L O   1 
ATOM   10666 C CB  . LYS F 3 213 ? 2.636   7.107   15.640  1.00 31.01  ? 213 LYS L CB  1 
ATOM   10667 C CG  . LYS F 3 213 ? 2.417   5.746   16.249  1.00 32.00  ? 213 LYS L CG  1 
ATOM   10668 C CD  . LYS F 3 213 ? 2.081   4.704   15.223  1.00 32.91  ? 213 LYS L CD  1 
ATOM   10669 C CE  . LYS F 3 213 ? 1.395   3.505   15.850  1.00 35.22  ? 213 LYS L CE  1 
ATOM   10670 N NZ  . LYS F 3 213 ? 1.210   2.428   14.828  1.00 37.63  ? 213 LYS L NZ  1 
ATOM   10671 N N   . SER F 3 214 ? 0.375   9.198   16.874  1.00 39.64  ? 214 SER L N   1 
ATOM   10672 C CA  . SER F 3 214 ? 0.074   10.464  17.528  1.00 40.18  ? 214 SER L CA  1 
ATOM   10673 C C   . SER F 3 214 ? -0.371  10.331  18.996  1.00 41.65  ? 214 SER L C   1 
ATOM   10674 O O   . SER F 3 214 ? -0.575  9.231   19.525  1.00 42.12  ? 214 SER L O   1 
ATOM   10675 C CB  . SER F 3 214 ? -1.009  11.206  16.752  1.00 42.35  ? 214 SER L CB  1 
ATOM   10676 O OG  . SER F 3 214 ? -2.257  10.584  16.977  1.00 41.43  ? 214 SER L OG  1 
ATOM   10677 N N   . PHE F 3 215 ? -0.525  11.488  19.631  1.00 42.88  ? 215 PHE L N   1 
ATOM   10678 C CA  . PHE F 3 215 ? -0.992  11.569  20.995  1.00 45.55  ? 215 PHE L CA  1 
ATOM   10679 C C   . PHE F 3 215 ? -1.533  12.971  21.288  1.00 47.95  ? 215 PHE L C   1 
ATOM   10680 O O   . PHE F 3 215 ? -1.009  13.961  20.788  1.00 46.76  ? 215 PHE L O   1 
ATOM   10681 C CB  . PHE F 3 215 ? 0.139   11.196  21.958  1.00 38.84  ? 215 PHE L CB  1 
ATOM   10682 C CG  . PHE F 3 215 ? 1.224   12.228  22.068  1.00 36.99  ? 215 PHE L CG  1 
ATOM   10683 C CD1 . PHE F 3 215 ? 1.052   13.376  22.833  1.00 38.32  ? 215 PHE L CD1 1 
ATOM   10684 C CD2 . PHE F 3 215 ? 2.439   12.030  21.450  1.00 34.31  ? 215 PHE L CD2 1 
ATOM   10685 C CE1 . PHE F 3 215 ? 2.054   14.319  22.946  1.00 37.09  ? 215 PHE L CE1 1 
ATOM   10686 C CE2 . PHE F 3 215 ? 3.459   12.977  21.559  1.00 33.10  ? 215 PHE L CE2 1 
ATOM   10687 C CZ  . PHE F 3 215 ? 3.263   14.119  22.302  1.00 37.31  ? 215 PHE L CZ  1 
ATOM   10688 N N   . ASN F 3 216 ? -2.583  13.054  22.100  1.00 51.79  ? 216 ASN L N   1 
ATOM   10689 C CA  . ASN F 3 216 ? -3.030  14.347  22.618  1.00 54.48  ? 216 ASN L CA  1 
ATOM   10690 C C   . ASN F 3 216 ? -2.197  14.750  23.828  1.00 54.73  ? 216 ASN L C   1 
ATOM   10691 O O   . ASN F 3 216 ? -1.889  13.919  24.681  1.00 54.65  ? 216 ASN L O   1 
ATOM   10692 C CB  . ASN F 3 216 ? -4.504  14.297  23.002  1.00 58.48  ? 216 ASN L CB  1 
ATOM   10693 C CG  . ASN F 3 216 ? -5.357  13.729  21.909  1.00 59.85  ? 216 ASN L CG  1 
ATOM   10694 O OD1 . ASN F 3 216 ? -5.497  14.332  20.847  1.00 59.82  ? 216 ASN L OD1 1 
ATOM   10695 N ND2 . ASN F 3 216 ? -5.933  12.557  22.152  1.00 61.53  ? 216 ASN L ND2 1 
ATOM   10696 N N   . ARG F 3 217 ? -1.831  16.021  23.908  1.00 55.75  ? 217 ARG L N   1 
ATOM   10697 C CA  . ARG F 3 217 ? -0.998  16.468  25.015  1.00 56.64  ? 217 ARG L CA  1 
ATOM   10698 C C   . ARG F 3 217 ? -1.641  16.254  26.398  1.00 60.66  ? 217 ARG L C   1 
ATOM   10699 O O   . ARG F 3 217 ? -2.655  16.887  26.752  1.00 63.70  ? 217 ARG L O   1 
ATOM   10700 C CB  . ARG F 3 217 ? -0.599  17.923  24.837  1.00 45.96  ? 217 ARG L CB  1 
ATOM   10701 C CG  . ARG F 3 217 ? 0.263   18.414  25.947  1.00 46.15  ? 217 ARG L CG  1 
ATOM   10702 C CD  . ARG F 3 217 ? 0.709   19.806  25.665  1.00 46.33  ? 217 ARG L CD  1 
ATOM   10703 N NE  . ARG F 3 217 ? -0.415  20.671  25.379  1.00 48.86  ? 217 ARG L NE  1 
ATOM   10704 C CZ  . ARG F 3 217 ? -0.961  21.491  26.265  1.00 58.24  ? 217 ARG L CZ  1 
ATOM   10705 N NH1 . ARG F 3 217 ? -0.484  21.558  27.504  1.00 52.70  ? 217 ARG L NH1 1 
ATOM   10706 N NH2 . ARG F 3 217 ? -1.987  22.245  25.904  1.00 60.78  ? 217 ARG L NH2 1 
ATOM   10707 N N   . GLY F 3 218 ? -1.042  15.348  27.169  1.00 61.39  ? 218 GLY L N   1 
ATOM   10708 C CA  . GLY F 3 218 ? -1.498  15.070  28.521  1.00 65.98  ? 218 GLY L CA  1 
ATOM   10709 C C   . GLY F 3 218 ? -1.967  13.648  28.782  1.00 68.40  ? 218 GLY L C   1 
ATOM   10710 O O   . GLY F 3 218 ? -2.609  13.406  29.793  1.00 71.89  ? 218 GLY L O   1 
ATOM   10711 N N   . GLU F 3 219 ? -1.629  12.719  27.886  1.00 66.92  ? 219 GLU L N   1 
ATOM   10712 C CA  . GLU F 3 219 ? -2.095  11.323  27.942  1.00 68.99  ? 219 GLU L CA  1 
ATOM   10713 C C   . GLU F 3 219 ? -3.617  11.244  27.767  1.00 72.72  ? 219 GLU L C   1 
ATOM   10714 O O   . GLU F 3 219 ? -4.199  11.958  26.942  1.00 72.78  ? 219 GLU L O   1 
ATOM   10715 C CB  . GLU F 3 219 ? -1.622  10.601  29.228  1.00 70.79  ? 219 GLU L CB  1 
ATOM   10716 C CG  . GLU F 3 219 ? -2.061  9.124   29.365  1.00 72.71  ? 219 GLU L CG  1 
ATOM   10717 C CD  . GLU F 3 219 ? -2.910  8.841   30.630  1.00 77.67  ? 219 GLU L CD  1 
ATOM   10718 O OE1 . GLU F 3 219 ? -2.654  9.436   31.705  1.00 79.23  ? 219 GLU L OE1 1 
ATOM   10719 O OE2 . GLU F 3 219 ? -3.842  8.012   30.545  1.00 80.33  ? 219 GLU L OE2 1 
HETATM 10720 C C1  . NAG G 4 .   ? 64.501  20.096  -2.203  1.00 47.94  ? 1   NAG E C1  1 
HETATM 10721 C C2  . NAG G 4 .   ? 65.055  21.038  -1.193  1.00 48.07  ? 1   NAG E C2  1 
HETATM 10722 C C3  . NAG G 4 .   ? 65.339  20.235  0.071   1.00 48.50  ? 1   NAG E C3  1 
HETATM 10723 C C4  . NAG G 4 .   ? 64.061  19.533  0.551   1.00 48.28  ? 1   NAG E C4  1 
HETATM 10724 C C5  . NAG G 4 .   ? 63.578  18.591  -0.558  1.00 47.76  ? 1   NAG E C5  1 
HETATM 10725 C C6  . NAG G 4 .   ? 62.286  17.771  -0.390  1.00 46.99  ? 1   NAG E C6  1 
HETATM 10726 C C7  . NAG G 4 .   ? 66.346  22.956  -1.982  1.00 47.65  ? 1   NAG E C7  1 
HETATM 10727 C C8  . NAG G 4 .   ? 65.121  23.761  -2.001  1.00 47.79  ? 1   NAG E C8  1 
HETATM 10728 N N2  . NAG G 4 .   ? 66.222  21.671  -1.741  1.00 47.72  ? 1   NAG E N2  1 
HETATM 10729 O O3  . NAG G 4 .   ? 65.809  21.175  1.030   1.00 48.73  ? 1   NAG E O3  1 
HETATM 10730 O O4  . NAG G 4 .   ? 64.114  19.004  1.905   1.00 48.38  ? 1   NAG E O4  1 
HETATM 10731 O O5  . NAG G 4 .   ? 63.367  19.464  -1.632  1.00 47.91  ? 1   NAG E O5  1 
HETATM 10732 O O6  . NAG G 4 .   ? 61.102  18.360  0.174   1.00 46.44  ? 1   NAG E O6  1 
HETATM 10733 O O7  . NAG G 4 .   ? 67.389  23.485  -2.186  1.00 47.54  ? 1   NAG E O7  1 
HETATM 10734 C C1  . NAG G 4 .   ? 63.730  19.000  3.048   1.00 69.80  ? 2   NAG E C1  1 
HETATM 10735 C C2  . NAG G 4 .   ? 63.925  17.879  4.057   1.00 65.76  ? 2   NAG E C2  1 
HETATM 10736 C C3  . NAG G 4 .   ? 63.241  18.177  5.379   1.00 69.11  ? 2   NAG E C3  1 
HETATM 10737 C C4  . NAG G 4 .   ? 63.580  19.557  5.907   1.00 72.92  ? 2   NAG E C4  1 
HETATM 10738 C C5  . NAG G 4 .   ? 63.358  20.556  4.777   1.00 71.17  ? 2   NAG E C5  1 
HETATM 10739 C C6  . NAG G 4 .   ? 63.714  21.995  5.110   1.00 70.97  ? 2   NAG E C6  1 
HETATM 10740 C C7  . NAG G 4 .   ? 64.205  15.704  3.077   1.00 62.29  ? 2   NAG E C7  1 
HETATM 10741 C C8  . NAG G 4 .   ? 63.539  14.477  2.529   1.00 60.82  ? 2   NAG E C8  1 
HETATM 10742 N N2  . NAG G 4 .   ? 63.392  16.654  3.518   1.00 60.22  ? 2   NAG E N2  1 
HETATM 10743 O O3  . NAG G 4 .   ? 63.646  17.231  6.328   1.00 71.51  ? 2   NAG E O3  1 
HETATM 10744 O O4  . NAG G 4 .   ? 62.655  19.787  6.936   1.00 82.21  ? 2   NAG E O4  1 
HETATM 10745 O O5  . NAG G 4 .   ? 64.143  20.185  3.675   1.00 72.24  ? 2   NAG E O5  1 
HETATM 10746 O O6  . NAG G 4 .   ? 62.824  22.822  4.385   1.00 74.68  ? 2   NAG E O6  1 
HETATM 10747 O O7  . NAG G 4 .   ? 65.437  15.801  3.101   1.00 64.73  ? 2   NAG E O7  1 
HETATM 10748 C C1  . BMA G 4 .   ? 63.278  20.222  8.150   1.00 86.72  ? 3   BMA E C1  1 
HETATM 10749 C C2  . BMA G 4 .   ? 62.223  20.962  8.977   1.00 97.31  ? 3   BMA E C2  1 
HETATM 10750 C C3  . BMA G 4 .   ? 62.678  21.244  10.423  1.00 103.74 ? 3   BMA E C3  1 
HETATM 10751 C C4  . BMA G 4 .   ? 63.518  20.123  11.044  1.00 96.66  ? 3   BMA E C4  1 
HETATM 10752 C C5  . BMA G 4 .   ? 64.533  19.599  10.034  1.00 93.84  ? 3   BMA E C5  1 
HETATM 10753 C C6  . BMA G 4 .   ? 65.406  18.478  10.585  1.00 92.52  ? 3   BMA E C6  1 
HETATM 10754 O O2  . BMA G 4 .   ? 60.972  20.261  8.960   1.00 97.27  ? 3   BMA E O2  1 
HETATM 10755 O O3  . BMA G 4 .   ? 61.548  21.606  11.254  1.00 108.53 ? 3   BMA E O3  1 
HETATM 10756 O O4  . BMA G 4 .   ? 64.233  20.697  12.136  1.00 105.26 ? 3   BMA E O4  1 
HETATM 10757 O O5  . BMA G 4 .   ? 63.819  19.143  8.891   1.00 85.62  ? 3   BMA E O5  1 
HETATM 10758 O O6  . BMA G 4 .   ? 65.467  17.419  9.619   1.00 92.55  ? 3   BMA E O6  1 
HETATM 10759 C C1  . MAN G 4 .   ? 61.561  23.014  11.582  1.00 116.59 ? 4   MAN E C1  1 
HETATM 10760 C C2  . MAN G 4 .   ? 60.368  23.361  12.473  1.00 115.78 ? 4   MAN E C2  1 
HETATM 10761 C C3  . MAN G 4 .   ? 60.379  24.850  12.867  1.00 118.51 ? 4   MAN E C3  1 
HETATM 10762 C C4  . MAN G 4 .   ? 60.721  25.792  11.698  1.00 121.38 ? 4   MAN E C4  1 
HETATM 10763 C C5  . MAN G 4 .   ? 61.781  25.259  10.717  1.00 121.40 ? 4   MAN E C5  1 
HETATM 10764 C C6  . MAN G 4 .   ? 63.222  25.534  11.169  1.00 120.62 ? 4   MAN E C6  1 
HETATM 10765 O O2  . MAN G 4 .   ? 60.376  22.536  13.620  1.00 108.51 ? 4   MAN E O2  1 
HETATM 10766 O O3  . MAN G 4 .   ? 61.273  25.099  13.936  1.00 109.36 ? 4   MAN E O3  1 
HETATM 10767 O O4  . MAN G 4 .   ? 59.545  26.081  10.973  1.00 117.67 ? 4   MAN E O4  1 
HETATM 10768 O O5  . MAN G 4 .   ? 61.575  23.875  10.448  1.00 121.44 ? 4   MAN E O5  1 
HETATM 10769 O O6  . MAN G 4 .   ? 64.103  25.322  10.089  1.00 116.58 ? 4   MAN E O6  1 
HETATM 10770 C C1  . MAN G 4 .   ? 66.752  16.796  9.374   1.00 92.38  ? 5   MAN E C1  1 
HETATM 10771 C C2  . MAN G 4 .   ? 68.002  17.439  9.991   1.00 96.23  ? 5   MAN E C2  1 
HETATM 10772 C C3  . MAN G 4 .   ? 69.118  16.389  9.982   1.00 96.15  ? 5   MAN E C3  1 
HETATM 10773 C C4  . MAN G 4 .   ? 69.022  15.452  8.767   1.00 95.89  ? 5   MAN E C4  1 
HETATM 10774 C C5  . MAN G 4 .   ? 68.210  16.030  7.589   1.00 96.07  ? 5   MAN E C5  1 
HETATM 10775 C C6  . MAN G 4 .   ? 67.965  14.966  6.516   1.00 94.54  ? 5   MAN E C6  1 
HETATM 10776 O O2  . MAN G 4 .   ? 67.804  17.907  11.310  1.00 101.60 ? 5   MAN E O2  1 
HETATM 10777 O O3  . MAN G 4 .   ? 69.071  15.607  11.163  1.00 83.57  ? 5   MAN E O3  1 
HETATM 10778 O O4  . MAN G 4 .   ? 70.327  15.095  8.349   1.00 89.07  ? 5   MAN E O4  1 
HETATM 10779 O O5  . MAN G 4 .   ? 66.967  16.615  7.981   1.00 93.00  ? 5   MAN E O5  1 
HETATM 10780 O O6  . MAN G 4 .   ? 67.551  15.546  5.298   1.00 95.91  ? 5   MAN E O6  1 
HETATM 10781 C C1  . FUL G 4 .   ? 66.945  21.199  2.087   1.00 93.36  ? 6   FUL E C1  1 
HETATM 10782 C C2  . FUL G 4 .   ? 67.938  22.265  2.482   1.00 90.64  ? 6   FUL E C2  1 
HETATM 10783 O O2  . FUL G 4 .   ? 67.749  23.451  1.709   1.00 79.85  ? 6   FUL E O2  1 
HETATM 10784 C C3  . FUL G 4 .   ? 67.539  22.401  3.950   1.00 95.95  ? 6   FUL E C3  1 
HETATM 10785 O O3  . FUL G 4 .   ? 68.164  23.534  4.578   1.00 94.71  ? 6   FUL E O3  1 
HETATM 10786 C C4  . FUL G 4 .   ? 67.796  21.051  4.676   1.00 98.44  ? 6   FUL E C4  1 
HETATM 10787 O O4  . FUL G 4 .   ? 69.162  20.981  5.123   1.00 104.99 ? 6   FUL E O4  1 
HETATM 10788 C C5  . FUL G 4 .   ? 67.416  19.777  3.859   1.00 98.75  ? 6   FUL E C5  1 
HETATM 10789 C C6  . FUL G 4 .   ? 68.212  18.528  4.240   1.00 101.94 ? 6   FUL E C6  1 
HETATM 10790 O O5  . FUL G 4 .   ? 67.522  19.936  2.430   1.00 99.89  ? 6   FUL E O5  1 
HETATM 10791 C C1  . FUL G 4 .   ? 60.267  17.518  0.702   1.00 66.09  ? 7   FUL E C1  1 
HETATM 10792 C C2  . FUL G 4 .   ? 59.140  17.660  -0.332  1.00 66.65  ? 7   FUL E C2  1 
HETATM 10793 O O2  . FUL G 4 .   ? 58.972  16.425  -1.051  1.00 62.56  ? 7   FUL E O2  1 
HETATM 10794 C C3  . FUL G 4 .   ? 57.801  17.958  0.320   1.00 70.83  ? 7   FUL E C3  1 
HETATM 10795 O O3  . FUL G 4 .   ? 56.870  18.272  -0.706  1.00 79.30  ? 7   FUL E O3  1 
HETATM 10796 C C4  . FUL G 4 .   ? 57.808  19.072  1.374   1.00 74.78  ? 7   FUL E C4  1 
HETATM 10797 O O4  . FUL G 4 .   ? 56.948  20.169  1.021   1.00 75.14  ? 7   FUL E O4  1 
HETATM 10798 C C5  . FUL G 4 .   ? 59.218  19.517  1.792   1.00 76.59  ? 7   FUL E C5  1 
HETATM 10799 C C6  . FUL G 4 .   ? 59.785  20.740  1.046   1.00 84.57  ? 7   FUL E C6  1 
HETATM 10800 O O5  . FUL G 4 .   ? 60.143  18.416  1.814   1.00 70.28  ? 7   FUL E O5  1 
HETATM 10801 C C1  . NAG H 5 .   ? -7.687  27.726  -52.649 1.00 71.00  ? 1   NAG F C1  1 
HETATM 10802 C C2  . NAG H 5 .   ? -7.097  29.007  -53.201 1.00 71.12  ? 1   NAG F C2  1 
HETATM 10803 C C3  . NAG H 5 .   ? -5.756  28.740  -53.791 1.00 71.07  ? 1   NAG F C3  1 
HETATM 10804 C C4  . NAG H 5 .   ? -5.138  29.188  -52.523 1.00 70.91  ? 1   NAG F C4  1 
HETATM 10805 C C5  . NAG H 5 .   ? -5.319  27.819  -51.889 1.00 70.86  ? 1   NAG F C5  1 
HETATM 10806 C C6  . NAG H 5 .   ? -4.635  27.709  -50.567 1.00 70.83  ? 1   NAG F C6  1 
HETATM 10807 C C7  . NAG H 5 .   ? -7.163  30.981  -54.341 1.00 71.03  ? 1   NAG F C7  1 
HETATM 10808 C C8  . NAG H 5 .   ? -7.575  31.799  -55.503 1.00 71.01  ? 1   NAG F C8  1 
HETATM 10809 N N2  . NAG H 5 .   ? -7.794  29.855  -54.121 1.00 71.12  ? 1   NAG F N2  1 
HETATM 10810 O O3  . NAG H 5 .   ? -5.544  29.498  -54.962 1.00 71.11  ? 1   NAG F O3  1 
HETATM 10811 O O4  . NAG H 5 .   ? -3.788  29.677  -52.471 1.00 70.90  ? 1   NAG F O4  1 
HETATM 10812 O O5  . NAG H 5 .   ? -6.684  27.379  -51.696 1.00 70.90  ? 1   NAG F O5  1 
HETATM 10813 O O6  . NAG H 5 .   ? -5.516  26.905  -49.776 1.00 70.81  ? 1   NAG F O6  1 
HETATM 10814 O O7  . NAG H 5 .   ? -6.229  31.246  -53.635 1.00 70.96  ? 1   NAG F O7  1 
HETATM 10815 C C1  . NAG H 5 .   ? -3.203  29.759  -51.235 1.00 28.85  ? 2   NAG F C1  1 
HETATM 10816 C C2  . NAG H 5 .   ? -1.813  29.239  -51.281 1.00 28.77  ? 2   NAG F C2  1 
HETATM 10817 C C3  . NAG H 5 .   ? -0.992  30.020  -50.361 1.00 29.34  ? 2   NAG F C3  1 
HETATM 10818 C C4  . NAG H 5 .   ? -0.818  31.383  -50.883 1.00 29.63  ? 2   NAG F C4  1 
HETATM 10819 C C5  . NAG H 5 .   ? -2.253  31.896  -50.892 1.00 29.76  ? 2   NAG F C5  1 
HETATM 10820 C C6  . NAG H 5 .   ? -2.391  33.258  -51.524 1.00 30.38  ? 2   NAG F C6  1 
HETATM 10821 C C7  . NAG H 5 .   ? -2.559  27.119  -51.273 1.00 28.15  ? 2   NAG F C7  1 
HETATM 10822 C C8  . NAG H 5 .   ? -2.502  25.756  -50.717 1.00 27.86  ? 2   NAG F C8  1 
HETATM 10823 N N2  . NAG H 5 .   ? -1.757  27.945  -50.743 1.00 28.57  ? 2   NAG F N2  1 
HETATM 10824 O O3  . NAG H 5 .   ? 0.272   29.439  -50.262 1.00 29.98  ? 2   NAG F O3  1 
HETATM 10825 O O4  . NAG H 5 .   ? -0.089  31.729  -49.723 1.00 29.79  ? 2   NAG F O4  1 
HETATM 10826 O O5  . NAG H 5 .   ? -3.132  31.091  -51.639 1.00 29.17  ? 2   NAG F O5  1 
HETATM 10827 O O6  . NAG H 5 .   ? -3.542  33.896  -50.998 1.00 30.87  ? 2   NAG F O6  1 
HETATM 10828 O O7  . NAG H 5 .   ? -3.264  27.517  -52.130 1.00 27.92  ? 2   NAG F O7  1 
HETATM 10829 C C1  . BMA H 5 .   ? 1.068   32.580  -49.661 1.00 103.02 ? 3   BMA F C1  1 
HETATM 10830 C C2  . BMA H 5 .   ? 2.434   31.930  -49.986 1.00 106.47 ? 3   BMA F C2  1 
HETATM 10831 C C3  . BMA H 5 .   ? 3.591   32.952  -49.952 1.00 103.02 ? 3   BMA F C3  1 
HETATM 10832 C C4  . BMA H 5 .   ? 3.216   34.429  -50.203 1.00 106.35 ? 3   BMA F C4  1 
HETATM 10833 C C5  . BMA H 5 .   ? 1.794   34.785  -49.763 1.00 107.75 ? 3   BMA F C5  1 
HETATM 10834 C C6  . BMA H 5 .   ? 1.392   36.219  -50.124 1.00 106.30 ? 3   BMA F C6  1 
HETATM 10835 O O2  . BMA H 5 .   ? 2.430   31.212  -51.236 1.00 102.46 ? 3   BMA F O2  1 
HETATM 10836 O O3  . BMA H 5 .   ? 4.575   32.559  -50.914 1.00 91.67  ? 3   BMA F O3  1 
HETATM 10837 O O4  . BMA H 5 .   ? 4.128   35.284  -49.501 1.00 107.36 ? 3   BMA F O4  1 
HETATM 10838 O O5  . BMA H 5 .   ? 0.898   33.831  -50.343 1.00 109.38 ? 3   BMA F O5  1 
HETATM 10839 O O6  . BMA H 5 .   ? 1.871   37.125  -49.123 1.00 98.04  ? 3   BMA F O6  1 
HETATM 10840 C C1  . FUL H 5 .   ? -4.760  30.672  -55.192 1.00 20.00  ? 4   FUL F C1  1 
HETATM 10841 C C2  . FUL H 5 .   ? -3.328  30.582  -54.661 1.00 20.00  ? 4   FUL F C2  1 
HETATM 10842 O O2  . FUL H 5 .   ? -2.989  29.213  -54.428 1.00 20.00  ? 4   FUL F O2  1 
HETATM 10843 C C3  . FUL H 5 .   ? -2.372  31.179  -55.699 1.00 20.00  ? 4   FUL F C3  1 
HETATM 10844 O O3  . FUL H 5 .   ? -1.050  31.237  -55.157 1.00 20.00  ? 4   FUL F O3  1 
HETATM 10845 C C4  . FUL H 5 .   ? -2.850  32.593  -56.049 1.00 20.00  ? 4   FUL F C4  1 
HETATM 10846 O O4  . FUL H 5 .   ? -2.717  33.439  -54.904 1.00 20.00  ? 4   FUL F O4  1 
HETATM 10847 C C5  . FUL H 5 .   ? -4.318  32.530  -56.476 1.00 20.00  ? 4   FUL F C5  1 
HETATM 10848 C C6  . FUL H 5 .   ? -4.796  33.932  -56.862 1.00 20.00  ? 4   FUL F C6  1 
HETATM 10849 O O5  . FUL H 5 .   ? -5.113  32.037  -55.400 1.00 20.00  ? 4   FUL F O5  1 
HETATM 10850 C C1  . FUL H 5 .   ? -4.547  26.853  -48.641 1.00 58.00  ? 5   FUL F C1  1 
HETATM 10851 C C2  . FUL H 5 .   ? -5.614  26.625  -47.576 1.00 58.28  ? 5   FUL F C2  1 
HETATM 10852 O O2  . FUL H 5 .   ? -5.597  25.252  -47.170 1.00 58.27  ? 5   FUL F O2  1 
HETATM 10853 C C3  . FUL H 5 .   ? -5.374  27.517  -46.364 1.00 58.47  ? 5   FUL F C3  1 
HETATM 10854 O O3  . FUL H 5 .   ? -6.506  27.447  -45.489 1.00 58.67  ? 5   FUL F O3  1 
HETATM 10855 C C4  . FUL H 5 .   ? -5.146  28.963  -46.786 1.00 58.30  ? 5   FUL F C4  1 
HETATM 10856 O O4  . FUL H 5 .   ? -6.381  29.528  -47.240 1.00 58.22  ? 5   FUL F O4  1 
HETATM 10857 C C5  . FUL H 5 .   ? -4.108  29.051  -47.898 1.00 58.14  ? 5   FUL F C5  1 
HETATM 10858 C C6  . FUL H 5 .   ? -3.935  30.489  -48.372 1.00 58.20  ? 5   FUL F C6  1 
HETATM 10859 O O5  . FUL H 5 .   ? -4.515  28.234  -48.993 1.00 57.92  ? 5   FUL F O5  1 
HETATM 10860 C C1  . NAG I 6 .   ? -28.648 39.550  -50.120 1.00 90.61  ? 1   NAG G C1  1 
HETATM 10861 C C2  . NAG I 6 .   ? -29.108 40.927  -50.581 1.00 101.83 ? 1   NAG G C2  1 
HETATM 10862 C C3  . NAG I 6 .   ? -27.903 41.862  -50.783 1.00 103.76 ? 1   NAG G C3  1 
HETATM 10863 C C4  . NAG I 6 .   ? -26.936 41.796  -49.587 1.00 98.44  ? 1   NAG G C4  1 
HETATM 10864 C C5  . NAG I 6 .   ? -26.551 40.314  -49.517 1.00 94.69  ? 1   NAG G C5  1 
HETATM 10865 C C6  . NAG I 6 .   ? -25.290 40.005  -48.722 1.00 92.85  ? 1   NAG G C6  1 
HETATM 10866 C C7  . NAG I 6 .   ? -31.101 41.242  -51.981 1.00 96.52  ? 1   NAG G C7  1 
HETATM 10867 C C8  . NAG I 6 .   ? -31.668 41.101  -53.363 1.00 92.43  ? 1   NAG G C8  1 
HETATM 10868 N N2  . NAG I 6 .   ? -29.838 40.834  -51.837 1.00 98.78  ? 1   NAG G N2  1 
HETATM 10869 O O3  . NAG I 6 .   ? -28.326 43.172  -51.156 1.00 116.73 ? 1   NAG G O3  1 
HETATM 10870 O O4  . NAG I 6 .   ? -25.801 42.623  -49.776 1.00 93.70  ? 1   NAG G O4  1 
HETATM 10871 O O5  . NAG I 6 .   ? -27.691 39.607  -49.070 1.00 89.88  ? 1   NAG G O5  1 
HETATM 10872 O O6  . NAG I 6 .   ? -25.579 39.518  -47.432 1.00 99.00  ? 1   NAG G O6  1 
HETATM 10873 O O7  . NAG I 6 .   ? -31.791 41.705  -51.067 1.00 88.61  ? 1   NAG G O7  1 
HETATM 10874 C C1  . FUC I 6 .   ? -28.373 43.634  -52.422 1.00 125.92 ? 2   FUC G C1  1 
HETATM 10875 C C2  . FUC I 6 .   ? -28.615 45.117  -52.710 1.00 122.17 ? 2   FUC G C2  1 
HETATM 10876 C C3  . FUC I 6 .   ? -27.294 45.873  -52.544 1.00 121.88 ? 2   FUC G C3  1 
HETATM 10877 C C4  . FUC I 6 .   ? -26.110 45.217  -53.296 1.00 125.67 ? 2   FUC G C4  1 
HETATM 10878 C C5  . FUC I 6 .   ? -26.148 43.667  -53.264 1.00 133.46 ? 2   FUC G C5  1 
HETATM 10879 C C6  . FUC I 6 .   ? -25.207 42.985  -54.263 1.00 129.07 ? 2   FUC G C6  1 
HETATM 10880 O O2  . FUC I 6 .   ? -29.609 45.659  -51.866 1.00 112.66 ? 2   FUC G O2  1 
HETATM 10881 O O3  . FUC I 6 .   ? -27.501 47.201  -52.967 1.00 118.45 ? 2   FUC G O3  1 
HETATM 10882 O O4  . FUC I 6 .   ? -26.027 45.702  -54.624 1.00 119.30 ? 2   FUC G O4  1 
HETATM 10883 O O5  . FUC I 6 .   ? -27.474 43.163  -53.425 1.00 131.80 ? 2   FUC G O5  1 
HETATM 10884 C C1  . FUL I 6 .   ? -24.761 38.351  -47.175 1.00 108.95 ? 3   FUL G C1  1 
HETATM 10885 C C2  . FUL I 6 .   ? -23.261 38.696  -47.316 1.00 114.66 ? 3   FUL G C2  1 
HETATM 10886 O O2  . FUL I 6 .   ? -22.714 38.835  -45.993 1.00 111.12 ? 3   FUL G O2  1 
HETATM 10887 C C3  . FUL I 6 .   ? -22.378 37.742  -48.157 1.00 119.21 ? 3   FUL G C3  1 
HETATM 10888 O O3  . FUL I 6 .   ? -21.614 38.506  -49.107 1.00 114.59 ? 3   FUL G O3  1 
HETATM 10889 C C4  . FUL I 6 .   ? -23.124 36.616  -48.891 1.00 116.35 ? 3   FUL G C4  1 
HETATM 10890 O O4  . FUL I 6 .   ? -23.620 37.084  -50.157 1.00 110.78 ? 3   FUL G O4  1 
HETATM 10891 C C5  . FUL I 6 .   ? -24.282 36.130  -48.032 1.00 112.96 ? 3   FUL G C5  1 
HETATM 10892 C C6  . FUL I 6 .   ? -24.978 34.901  -48.608 1.00 104.29 ? 3   FUL G C6  1 
HETATM 10893 O O5  . FUL I 6 .   ? -25.205 37.217  -47.943 1.00 116.72 ? 3   FUL G O5  1 
HETATM 10894 C C1  . NAG J 7 .   ? 67.646  -6.814  -6.290  1.00 114.70 ? 408 NAG C C1  1 
HETATM 10895 C C2  . NAG J 7 .   ? 66.848  -6.871  -4.961  1.00 127.94 ? 408 NAG C C2  1 
HETATM 10896 C C3  . NAG J 7 .   ? 66.147  -8.233  -4.748  1.00 125.92 ? 408 NAG C C3  1 
HETATM 10897 C C4  . NAG J 7 .   ? 65.237  -8.510  -5.945  1.00 121.95 ? 408 NAG C C4  1 
HETATM 10898 C C5  . NAG J 7 .   ? 66.166  -8.522  -7.164  1.00 120.10 ? 408 NAG C C5  1 
HETATM 10899 C C6  . NAG J 7 .   ? 65.499  -8.952  -8.468  1.00 112.47 ? 408 NAG C C6  1 
HETATM 10900 C C7  . NAG J 7 .   ? 67.116  -5.885  -2.736  1.00 135.29 ? 408 NAG C C7  1 
HETATM 10901 C C8  . NAG J 7 .   ? 68.049  -5.585  -1.596  1.00 134.68 ? 408 NAG C C8  1 
HETATM 10902 N N2  . NAG J 7 .   ? 67.645  -6.516  -3.794  1.00 133.49 ? 408 NAG C N2  1 
HETATM 10903 O O3  . NAG J 7 .   ? 65.424  -8.311  -3.531  1.00 115.33 ? 408 NAG C O3  1 
HETATM 10904 O O4  . NAG J 7 .   ? 64.517  -9.716  -5.774  1.00 116.43 ? 408 NAG C O4  1 
HETATM 10905 O O5  . NAG J 7 .   ? 66.731  -7.224  -7.306  1.00 117.98 ? 408 NAG C O5  1 
HETATM 10906 O O6  . NAG J 7 .   ? 66.513  -9.400  -9.341  1.00 105.69 ? 408 NAG C O6  1 
HETATM 10907 O O7  . NAG J 7 .   ? 65.928  -5.556  -2.661  1.00 127.82 ? 408 NAG C O7  1 
HETATM 10908 C C1  . NAG K 7 .   ? -24.861 44.002  -47.848 1.00 81.18  ? 409 NAG D C1  1 
HETATM 10909 C C2  . NAG K 7 .   ? -23.852 44.697  -48.725 1.00 81.34  ? 409 NAG D C2  1 
HETATM 10910 C C3  . NAG K 7 .   ? -23.766 46.110  -48.161 1.00 81.32  ? 40